2WD7B

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7B00
4FFPA 2XAAA 4Z9XA 2EKQA 4CM7A 5G0VA 4CM8A 3TZQA 1DC6A 2PGJA 4J1TA 3W4IA 2Y1DA 3TFOA 1PL8A 1DAOA 1UDAA 2GZ1A 1Z74A 4N5NA 2BFAA 2NU6A 1QSGA 4NK5A 3ZWMA 3AI2A 3UXYA 4A2CA 4YJGB 1I10A 1KEUA 2PV7A 3OQBA 3LLVA 1CWUA 2O2YA 3QVWA 2GN6A 3WLEA 2VWQA 5JMPA 3ZHYA 2YHUA 3ZNPA 4KZPA 1KETA 1GU7A 1PGQA 1HE4A 5IXSA 2HU2A 4CV2A 5K0ZA 3AY3A 1BW9B 4ID9A 3QJ5A 3DWFA 2RCYA 1DC5A 4D0SA 2Q1WA 4QEDA 1U2DA 5CDYA 1QG6A 5JAZA 4BB5A 3H3JA 3ITDA 3RQSA 2BRUA 2D2IA 2VNSA 1MP0A 4B7XA 4R9SA 2ZCVA 1GPDG 3E1KA 3WGQA 4LMPA 4XB1A 2YFHA 5JPIA 2H6EA 3UF0A 1WAMA 4KTVE 4ONEA 4BQPA 2VUTA 4RV9A 3DOJA 1AHIA 4DPMA 5CP8A 3JD0A 2X8LA 3NRCA 1ZXBA 1Y6JA 3DL2A 2Z1MA 5CDTA 3D64A 3SBOA 1XDWA 3V2UA 4RF3A 4WOKA 4BV8A 2EIHA 3NTOA 2AMFA 4RPLA 3G3EA 3CZMA 5DCYA 1H9AA 4IJWA 4IQ0A 4ZQGA 3HDQA 3JTMA 1LSJA 1T1RA 1GCOA 2HMWA 3K6JA 4RF2A 1Y5RA 3SX2A 3MJEA 1M75A 3RBVA 5DP2A 3KEOA 3PHGA 4Y98A 4PG7A 3NTQA 4ALIA 1AE1A 2H1SA 5JLAA 4YYZA 5L7TA 5F5LA 3B1KA 5THQA 2IDZA 4TQGA 5I7EA 1CQIA 1P1IA 2CDCA 3NJ8A 2FPIA 2GZ2A 2X9VA 1JU9A 2B83A 4NFSA 3AM4A 2CVQA 4WLUA 1F12A 1BW9A 5EIOA 4HP8A 3PI7A 1DEHA 2C59A 2O23A 3MJTA 2Q4BA 1ZK2A 3E8XA 3P7MA 4IS2A 1V9LA 3MJ4A 1P0FA 3L6EA 4DWVA 4N54A 1GV1A 3EW7A 1H6DA 4KQXA 1YOVB 3RD5A 3WYCA 1EMDA 4LVUA 4PLVA 1A27A 4YPOA 5TF4A 1GDHA 4EJ6A 1OFGA 2AQKA 1KVUA 1LJ8A 3BHIA 4IDDA 2AQIA 4X54A 5K6AC 3D3WB 2Q3EA 3GF4A 3I52A 3DC2A 1IPEA 2CF5A 3W6UA 1E5LA 4TSKA 4HNGA 1AGNA 3WGOA 2IXAA 4GMGA 2OFPA 2YV3A 2DBRA 3FTNA 3HB4X 5JSFA 3I23A 1FJHA 4LGVA 4XYLA 1HT0A 2Y0DA 3ZZNA 5BSEA 3INRA 3ZV4A 3ONFA 4WUVA 3GVIA 3WGIA 2ET6A 2DT5A 3WGZA 4R4JA 2P4QA 2P9CA 4LW8A 3TF5A 3CKYA 4B7CA 1UJMA 1GY8A 4FGWA 1U3WA 3FNFA 3ETDA 2EGGA 1VL8A 3JQFA 3I9MA 3TN7A 4Q3AA 2DAPA 2GDZA 2VHVA 1R37A 1N2SA 4MO2A 3JQGB 4TVBA 5AXAA 3S2GA 4RJTA 3FR8A 5GZ1A 3GG9A 4IDEA 4M49A 3A9WA 2PZLA 3ZWVA 1JW9B 1SMKA 3OIFA 3Q2KA 2GSDA 2ZCUA 4CM4B 1T4BA 3BA1A 4II2A 4QTZA 5LC1A 4WASA 4XWYA 4AJ4A 1SNYA 4BGVA 1PL7A 4DL9A 1YS4A 1YL6A 4OXYA 4YXFA 1Y8QB 3PK0A 3LT0A 4PLCA 1W4ZA 2YDXA 3WFIA 2V6GA 4CV0A 4D3DA 3WNQA 4ND3A 3M2TA 3MJCA 1E1LA 4IDFA 4RVSA 4XR4A 1YKFA 3VKUA 3NTRA 3UFXA 2VRBA 3NJ4A 3LDHA 3AJRA 4CQLA 4BKQA 3WFJA 4OH1A 1GPJA 4OSPA 2Q2WA 5IDXA 2UYYA 2E37A 2PZJA 5KJFA 3HUDA 1NM5A 2YV1A 3OP4A 5ITWA 2PLAA 1HETA 2JFFA 3GEMA 4ILKA 1VJ0A 1DIHA 1X15A 4QUKA 3OBBA 3WSWA 4A27A 4CLEA 4Z3KA 1K6IA 2AA3A 4DIOA 1T2CA 1Z73A 3D1LA 3VZSA 4GH5A 6ADHA 3RC1A 2YUTA 3WMXA 5JMWA 3GEDA 2CDBA 4DBZA 2BGLA 1DFHA 4IXWA 3H9EO 2C5EA 4R1TA 4MDHA 3I4CA 2ZKLA 2X7HA 3Q9NA 4CLHA 2BI7A 2PNFA 1HZZA 3WDSA 1MV8A 5IF3A 1DRVA 3KVOA 3WOHA 4CR8A 1CQJA 1VSVA 1KVSA 1EQ2A 2Y67A 3MZ0A 4BNUA 4OXKA 3FTPA 1XA0A 2P2SA 3JQ9A 4AJ2A 5JDCA 2E4AA 5EPOA 3I9OA 3Q3CA 1AUPA 2D5CA 2ZTLA 3WXBA 3M6IA 1U9JA 4EZBA 1WWKA 1VSUA 4BNLA 1UXKA 1A4IA 1P9LA 4HBGA 3GN1A 3GPDG 2QYSA 4I9UA 5C37A 1GQQA 1KVRA 2GASA 4TRNA 2HMSA 1VE9A 3F47A 3I5MA 3H5RA 3LC7O 4D46A 1NXQA 3BMQA 1TT5A 4E5PA 3EUWA 2YW9A 4ZICA 1O89A 3H9QA 5A5FA 4CMEC 1FDTA 3GVHA 3ZU2A 4ALJA 3KETA 1G0OA 4OQZA 5JO9A 3H3FA 5DZSA 5CAEA 5JS6A 1ZSYA 1KIFA 2NU9A 4AJNA 2QRKA 1ZFNA 5C7IO 4JP3A 1GADO 4E5NA 2CDAA 3I6QA 4D3SA 3BTUA 3SLKA 3X2EA 4TROA 1FMCA 4GLLA 1P74A 3EHEA 3ZH2A 3UGKA 2DFVA 4IDBA 7ADHA 3WNVA 4AJHA 4B3HA 2VN8A 5A1TA 3GHYA 1NPDA 3JV7A 3BAZA 4J7UA 2J5QA 1I3MA 3QWFA 4E21A 2FRDA 4DXHA 4ND4A 4UREA 1E6UA 1BVUA 1X0VA 4M87A 3VTFA 2NM0A 2OP1A 5I7SA 4QO8A 1SC6A 2C82A 3AOGA 2PR2A 2QIOA 2VUUA 4CLDA 5IXYA 3G1UA 1JTVA 3DBLA 1CETA 1UZNA 3VPGA 4EUEA 3W4JA 5G2OA 4F3YA 3GOHA 2B5VA 2VNAA 3OICA 4J0FA 1EE9A 1TT7A 1DHTA 2E82A 3BZUA 3F4LA 5H83A 1HSZA 5U4QA 3RASA 4LSMA 4HX5A 4IDCA 5EQFA 2NTJA 1KEVA 2DBVO 2A92A 4DLBA 4U0JA 3UH1A 1HDYA 1LC3A 3VH3A 1ORRA 2HUNA 4J43A 3GAZA 4HV4A 4BOYA 2HAEA 1LLDA 4EJMA 1DFGA 1DHRA 3Q1LA 2P91A 3QY9A 2YV2A 4N7RA 1T24A 2H63A 4L74A 1HYEA 4WLFA 1FDWA 4S3MA 2AW5A 3H4VA 2I66A 4GQAA 9LDBA 3QWBA 4QT0A 3UCXA 1V0JA 1IZ9A 1C1XA 3VKVA 3O38A 2BI8A 3HFSA 4RPGA 5THKA 1XU7A 5G4LA 1PTJA 3E6AA 1OC4A 2Z5LA 3QWIA 1A9ZA 2QRLA 4JNKA 1HF3A 4Q9NA 3ROPA 5JW6A 5LCXA 4BQRA 1Y81A 1I01A 4DQUA 2QZ9A 3H65A 4H15A 4AJKA 1LSOA 4M1QA 3F5SA 4ROSA 1QLJA 2BMAA 1KYQA 3TQHA 4ZRNA 3PQFA 1DJNA 4YBZA 2X58A 3ZHXA 4Q3EA 3ZWXA 1EVYA 1YGYA 2EXXA 3AU9A 4D44A 3FRJA 2QX7A 4N5LA 5ICSA 2ZYAA 1LDMA 2F00A 3K5PA 2WD7B 4YJFA 4L75A 4U0KA 5L9AA 5CEJA 1DIBA 3GHHA 4F46A 2VWPA 2DTXA 4FSHA 1MXHA 1E1KA 1BXKA 1XQ1A 4R41A 2IE0A 4WEOA 4A7PA 2IRWA 3JQ7B 1M2WA 5EERA 1EDOA 3GQVA 1DIRA 5DBFA 4NFHA 4O63O 4EEZA 3OJOA 3RUHA 4DGSA 3RVDA 3S1LA 3OJLA 3MEQA 3FNHA 3G17A 3DZKA 4RVDA 5TX7A 3WIDA 5H81A 4LRTB 1ZO8A 1NAHA 3DMYA 2CVOA 1ZMOA 3RC9A 3TWOA 1T2EA 3PJDA 3BMNA 3GT0A 4FJ0A 4TVOA 4U5QA 3ULKA 1H93A 4RL6A 1TEHA 1ZK1A 3FHLA 3JD4A 3ST7A 1MC4A 2X6TA 4BGIA 4XJSA 4E32A 4DA9A 3PZRA 5K6AA 4E5YA 4DUPA 1UH5A 1PZHA 1ZW1A 1RM5A 3H9JA 3RBXA 4KDEA 5TJ9A 1ENYA 4GX2A 4YACA 1X7HA 1JKIA 4YEDA 1W6UA 4WGGA 1CRWG 4ZQFA 1OI7A 3VH1A 1B8UA 1Z45A 3O9ZA 5IDQA 5FF9A 3LT1A 3RUFA 3HJAA 3IMFA 3WYEA 3M1AA 3N58A 3KUXA 3JQAB 1R0SA 1Q7GA 1GUFA 2VOEA 5DBGA 3ZWBA 1LDBA 2UAGA 2H9IA 3HN7A 1HDOA 1T4DA 4I5EA 1KVTA 4IJUA 2PGDA 3KRTA 3CH6A 3ZDFA 3ZWCA 3QLJA 4XYMA 3HDJA 4UUNA 2BH9A 5EINA 3HNPA 1PJ4A 2BGKA 3PWZA 1EUDA 1YB4A 1U5AA 5ER9A 4FFMA 4DVJA 5AQ1A 1G0NA 3KYCB 1Q0QA 3DZBA 2WSBA 3CSDA 4GSLA 4ZQBA 1HYHA 3ZN2A 3IP3A 1KY4A 3TSCA 5T8KC 2LDBA 4RLHA 1FXSA 1NHGA 5G4KB 3TPCA 4AJOA 2NACA 3UOGA 2G1UA 1F8GA 3PGXA 4W9NC 3PJFA 2GF2A 1X7DA 1GZ4A 4JLWA 2NLOA 1Y5MA 1DIGA 3Q0EA 1C0PA 2D4AA 1HE2A 4YQZA 2NUAA 3L4BA 4HFJA 4YAJA 1ISMA 2O2SA 4KUGA 2HK8A 3ONEA 3H2SA 2YHIB 3PYLA 2YDYA 3ZI0A 1ZK4A 1YDWA 3T4XA 1ZH8A 3DHYA 5C5IA 4PZEA 3TZKA 3PRJA 4R69A 3OA0A 1E3EA 4M8SA 1WMAA 3ASVA 3RU9A 4YB8A 1B8VA 2ZIZA 1Y9AA 3FF4A 1XGKA 3FNGA 4YVFA 4CMJA 2XPCA 3DAPA 5IZCA 4P4GA 1BXZA 1BTOA 3LYLA 1F17A 3HDHA 2GZ3A 1A7KA 1ZUD1 2FR0A 5B4VA 1ZEJA 4L4RA 4JIGA 1IOLA 4BNTA 4PCVA 3VOSA 1LUAA 1LDYA 2C54A 4PFJA 4UVGA 3BTVA 1BDBA 1UZMA 3KHUA 3WMWA 3BIOA 1QR6A 1ULUA 3F5QA 4NBRA 1DC3A 1PX0A 3NKLA 4XDZA 2FOIA 3KYCA 1PGOA 2JJYA 2OZPA 2ZB8A 4PZCA 4YR9A 1O8CA 5BNFA 2V65A 4JBGA 5MDHA 4BGUA 4PLZA 1T2DA 1RWBA 4INAA 4TWRA 5B37A 1SEVA 2HQ1A 2HJSA 1IB6A 2FR1A 5TJHA 4D41A 2BELA 3OIGA 3RFVA 3KO8A 1C0IA 1IZ0A 3KYBA 4R5MA 3WTCA 4P4NA 5TC4A 5U9CA 3RUDA 2YZ7A 2C5AA 1FF9A 4O59O 3GVCA 4XYBA 1CEQA 2EW8A 3RAJA 1LDEA 1QXSA 1KOLA 2XOXA 2YHIA 3B6ZA 2GRAA 2NV6A 1PL6A 4RCVA 1ZZEA 3AWDA 4R1NA 4CUZA 4ZA2A 2VOJA 4D79A 3WBFA 4UAGA 3LZ6A 4OHUA 2G17A 5BNTA 3KSDO 3ZWAA 1PGNA 1N8KA 2O3TA 2PZMA 3DBHA 2PZKA 2YYYA 4FFOA 1HRDA 1K2WA 1V3UA 2J3KA 2YQ5A 4HNHA 2ZTUA 3NDIA 3C7AA 3ABIA 1LXCA 3DMTC 1QKIA 4IMRA 1PS9A 4BO3A 2Y99A 4WCFB 1EFLA 4GL4A 4XJTA 3RC2A 1E5QA 3AOEA 4RGBA 5JYDA 2PFGA 4QFCA 4U7WA 5AXCA 8LDHA 3IKVA 1LTHR 1KBZA 2OMEA 2PY6A 4RPKA 2V6FA 2IZ0A 2NU7A 4UUMA 1MC5A 3KYDB 3ONDA 4OAQA 3NGLA 3I83A 2ZQYA 3CXRA 4RVHA 5ER6A 2EV9A 4G5HA 4IZHA 3ZCXA 2HLPA 1I3NA 2Z95A 4DREA 3JYLA 4WNCA 4NU5A 2YY7A 2PKRA 5DN9A 3GY0A 4D0RA 5DT9A 2WD8A 4AICA 4B4UA 2FY8A 1U3UA 2ZJ0A 4RO0A 1LEHA 1QV7A 5KJCA 1ZNQO 4EGFA 3EZYA 4CMBA 4ZJUA 1VLLA 2O7QA 2A4KA 4BNWA 4A5OA 2HMTA 4ALKA 3ETEA 1HEUA 1L7DA 1N1EA 3UVEA 1E6WA 3KOUA 4P38A 4FFLA 4EW6A 1SEPA 3ZV6A 1HDZA 3ANNA 1F8FA 4NBVA 3OSUA 2ZJ1A 2A9FA 3GLQA 2VUSA 4NDNE 4K28A 4XB2A 3QWHA 3G79A 5A9SB 3OETA 3OH8A 4LMRA 4BKRA 2X5OA 4QXMA 3QHAA 4IXTA 5GY7A 5ENDA 1MUUA 3PLNA 4WCFA 2JD0A 1I24A 5A4DA 1B7GO 1KC3A 4HWKA 4GGPA 4BNIA 4R1UA 1TA4A 4P22A 3L9XA 4TRRA 2UUOA 1A72A 3AM5A 5MGBA 1UAYA 3ZNQA 2ZTVA 4H3VA 3S8MA 1I3LA 1NP3A 3KYDA 3FBTA 1EZ4A 3RFXA 4YJDA 4YAIA 5AXDA 1QMGA 3F3SA 3GH3A 3SJUA 5IFLA 2G0TA 4WLVA 2GGSA 4UVDA 1N9GB 1WLYA 4WCDA 1N1GA 3IKTA 2DPGA 2FMUA 5KIAA 2B37A 1PWXA 1T1SA 3E82A 4HKTA 3ZHBA 1A9YA 1ML3A 5HBRA 2FPPA 2B36A 4RVUA 3ENKA 3D4PA 3DB2A 3CUKA 4K1LA 4MPDA 4IDAA 1LDGA 3PWKA 2FN7A 3GFBA 2Z1NA 3LK7A 3OMLA 8ADHA 5AVOA 2QHXA 2EWMA 4BO8A 2I67A 3AUUA 3QQPA 1EVIA 2AG5A 4XGKA 4R16A 4FDAA 3DZIA 3TL3A 3E9MA 1HDXA 2J5KA 1KEPA 3VZQA 1MXFA 1NQ5A 2B4TO 1PEDA 2NADA 2ZATA 3IQDB 3TJRA 3A14A 4FOSA 3UUWA 2P5UA 3JSAA 3C1TA 2D0IA 2QRJA 5A9SA 4RZIA 3VTZA 2O7SA 4LK3A 5HS4A 1XSEA 4GI2A 4UULA 2EJVA 1P45A 4GWKA 1DLIA 3K92A 4XQGA 1NFRA 1YJ8A 1SOVA 1DBVO 5ENVA 2Y1CA 3MJSA 4JBIA 3DBVO 1HDCA 4CQLB 1QYVA 2X5JO 3IP1A 2VYVD 2WMDA 2FPGA 2VYVA 5CPFA 3PHIA 1H9BA 4EDFA 4L73A 1JA9A 1UUFA 3OJEA 2A35A 4WLEA 2D8AA 1E7SA 2AE2A 3ZW9A 1QRRA 3V5NA 3U5TA 3MWEB 5F21A 3GZNA 4DPKA 1GD1O 3GA0A 4NZ9A 4DC1A 2DVMA 1N9GA 1TLTA 4LSWA 2BFPA 3C1OA 2HRZA 3FPCA 1NASA 4NBUA 2BGMA 5A3JA 2BD0A 1VRWA 4WJZA 2NQTA 4LRSB 2EHDA 3WQRA 3INTA 4PG5A 4FW8A 4CM1A 1LLUA 1SAYA 5TLSA 1B15A 2YJZA 5JE8A 4D7AA 4B8ZA 2CD9A 3PXXA 1NPTO 3DO5A 1I2BA 1BHSA 1HLPA 1P1HA 5A9RA 5JO0A 3FSRA 4OGWA 4XIYA 4M55A 4CL8A 5TIIA 1Y7TA 5T5QA 4IJKA 3ZWOA 5LDHA 1OMOA 3L4SO 4BNVA 2OO5A 4DLAA 4EJ0A 3NV9A 3WTBA 3ZNOA 1K6JA 3GPIA 3BMQB 5CEEA 3DBRB 1TT5B 4XQ9A 1AXEA 3DAFA 3P2YA 3BMOA 1W8DA 2DUUA 3QSGA 2RBEA 4GX5A 4NK4A 1XELA 1PSDA 1OBFO 2WE8A 3HADA 2G82A 4IS3A 2AEMA 3PDUA 4GSKA 5KTKA 1JAYA 1LBEA 2LDXA 5ADHA 1PQPA 3MWDB 1BXGA 5IG2A 1HDRA 1E7WA 2VTDA 3JYQA 3DZGA 2J3HA 3LSYA 3OECA 3ORFA 1Z6ZA 3WICA 1RYEA 3A1NA 2Y93A 4DLLA 2PKQO 1VKOA 4CLOB 4IZIA 1P1RA 3JQDA 3I6IA 3E9QA 3GDFA 4NBWA 4BKUA 4J4HA 4J49A 3DHNA 3IC5A 1U3TA 2VT2A 4NQZA 1R4MA 1VKNA 4BNZA 1CF2O 1Z75A 1NWHA 2VWGA 4YA6A 5I9NA 3L9WA 4E6PA 4Q3DA 4R1SA 3DBLB 4GVXA 4WK6A 3E18A 4PLYA 3INGA 4IUYA 5A02A 1JLLA 2JCYA 2Y05A 3JQEA 5DNAA 3B70A 4FBGA 3RUEA 2OP0A 1I32A 2P68A 2BLLA 4FJ2A 4DQVA 1HE3A 5ES3A 3F9IA 3SLGA 2HO5A 4W99A 3OEYA 4CV1A 3WLFA 4JJGA 1YBMA 4BNGA 1GEGA 3PHJA 3DBRA 3RROA 2I6TA 1F14A 1AXGA 1NYTA 4B8WA 2C29D 2O3UA 5KJ6A 1HDGO 1Y9EA 1RKXA 3F1KA 1ZJYA 2R00C 4BNKA 1IULA 2W2KB 3F46A 4QSMA 1YB1A 1JVBA 3WGGA 3DMTA 3IUSA 1C1XB 5BNIA 3UAGA 1Q2XA 3FN4A 3K9QO 2IYPA 4BO6A 3IJPA 1PJ3A 3PLRA 2X0RA 1LX6A 1PJ2A 3MOGA 1TI7A 5CFZA 1EUZA 4BNJA 4Q3BA 2VYND 2VYNA 4R51A 3B1JA 1P1KA 2ZYGA 4AL4A 1MFPA 4RPHA 1U1IA 4CLOA 1KY5A 1EUCA 2WYVA 3Q11A 2XXJA 3I9JA 3JQBA 3T4EA 4ALLA 1E7YA 1P1FA 2O50A 1UP7A 2B4RO 4J6FA 4Y9DA 4FQ8A 5KKCA 2X0JA 3CMMA 1DFIA 1UR5A 1VJ1A 2RAFA 2WYWA 3LC2O 1ONPA 3TZCA 3H8VA 4YJFB 2I76A 5L7YA 3ROQA 4YT5A 2C0CA 2IEBA 5CG2A 4ZRMA 3W1VA 5I9LA 1GAEO 1YBVA 2X5KO 1DB3A 4MJLA 5CEFA 5JYEA 3O8QB 4MKRA 1VM6A 4IJVA 5A3VA 4F6LA 2Y0CA 4YT4A 3EK2A 4CLXA 4JCOA 1R66A 3U09A 1CYDA 1GYRA 1N5DA 2C7VA 3LC1O 3HSKA 1QLHA 5F1OA 2PD6A 2VWHA 3S2EA 4GKVA 3K30A 4AJPA 5KJ1A 3T7EA 4L76A 3RSHA 1R16A 4HXYA 5T6BA 1ZKMA 3KV3O 4CQMD 4HFRA 1R12A 2OOSA 5G0WA 1CERA 3NDJA 4CQMA 5CDSA 4LCEA 5ILOA 3DDNA 2DTDA 1Y1PA 4JK3A 1NNUA 1B3RA 1MFZA 2Y1GA 5L51A 3D5TA 3DZFA 2GNAA 3GMSA 5DCWA 4XZ3A 2GD1O 3A4VA 3BMNB 3GEGA 2SCUA 2W2KA 1AN9A 1OC2A 1GQ2A 2PD4A 2Y0EA 2AE1A 3OA2A 4JROA 2I65A 3CZRA 2E49A 3TNLA 2PD3A 3RIHA 4A26A 1NPYA 4MVJH 4BO7A 3BMCA 4GX0A 3DFZA 3FNEA 2GPTA 3SEFA 5G0SA 4J90A 4BNFA 1WVGA 1U4SA 2JHGA 3ANMA 1PGPA 2W4QA 5T67A 2O4CA 2BFMA 2NU8A 1P0CA 4PRKA 2I5PO 3IL2A 3MJVA 4L4SA 1GTMA 4PG6A 4NU6A 2O3SA 3PJGA 4GLOA 2AXQA 2YQ4A 2Q2VA 1XCBA 4ALNA 4A03A 2W98A 5G0TA 3ZW8A 1NR1A 3PQEA 3K31A 1R4NB 4R5HA 5JCJD 1LU9A 5JCJA 3U4IA 4JBHA 2GERA 2R2GA 1NQTA 3PIDA 5K9ZA 3AY6A 1S7CA 1C1DA 3O8QA 3G1TA 3P2OA 4RF5A 1EBFA 3AFMA 1C0KA 1C0LA 3ON5A 1MX3A 2NVUB 4E2XA 1ZK0A 1OOEA 4A10A 4F6CA 4CMGA 1XIVA 5HWSA 1GYQA 5JFOA 2P9EA 1R0KA 2X1HA 1WDKA 2GYYA 4NG5A 4UEJA 3WGTA 3GUYA 2BHLA 2QW8A 4TZKA 2Q1UA 4Q3NA 3IIEA 3I1JA 1M67A 5KWEA 1J0XO 1H6CA 3ICCA 3JYOA 3R3SA 3WIEA 4KUHA 1KVQA 1W73A 4DBVO 4PLWA 5EL0A 3BTOA 2CZCA 2X9GA 4CL3A 3C1AA 4AFNA 4CJXA 4BO4A 1QYDA 5TQVA 5L4NA 4OO3A 2DC1A 5COBA 4OXNA 4JN6B 4Z0PA 2VZ0A 3SJ7A 2X86A 5IAAA 4ZU3A 2D5AA 4UUOA 2CMDA 3GNQA 3JQ6A 5ICMA 2C2XA 3W8EA 5BT9A 3U62A 1E7RA 3VPXA 4BS9A 4HFMA 4B3IA 3BXXA 3EMKA 3E48A 4BNHA 5JDIC 1E6EA 3OJFA 4OOFA 1SB8A 2DU8A 3KBOA 4KWHA 3OFSA 1YL5A 5BSGA 4QFDA 3A28A 3WGHA 1QYCA 3GAFA 1R4NA 2AEJA 2UDPA 3CMCO 4FPXA 2JCVA 1PJSA 3JD2A 5L40A 2VT3A 4J1SA 2Q50A 1NBOA 4YTEA 3ZU4A 4KUEA 1MG0A 3QIVA 2X0NA 4GBJA 1NWCA 2DTEA 1SPXA 3RJ9A 1E7MA 1LRKA 5C3MA 5L7WA 2NVUA 5F3RA 3KM0A 1JKFA 1K6XA 1M6HA 3VHRA 2C2YA 3PDJA 3D7LA 3VPSA 4FCCA 3LT4A 3NYWA 4MP3A 2HSDA 1ADCA 4O1MA 1MGOA 2WWRA 4NJMA 5IDWA 4IBOA 4YAEA 4ZVVA 4DMMA 4WLOA 1LDNA 1DJQA 1AHHA 4KTTE 1YXMA 1JWAB 5KVSA 1CJCA 3S2FA 3GGGA 1BMDA 2PTGA 4JJIA 1XEAA 1PJCA 2EP5A 4GWGA 1CIVA 2X4GA 3N74A 3MTGA 1PZGA 1HTBA 1KS9A 1LSSA 2DQ4A 1DO8A 2B0JA 2HMUA 4YRAA 3RU7A 3S55A 3OM9A 3U3XA 3VZRA 4EI2A 5JC1A 5EJ2A 3W8FA 1D4FA 3DBHB 2Q2QA 3E5RA 1LLQA 3RKRA 3GVXA 4P4LA 4KOAA 1QYXA 5G0UA 4AG3A 2HMVA 2OBYA 4PN3A 1WDLA 3H7AA 4PLTA 5EESA 4FC6A 3SXPA 3LU1A 1ADFA 4IY1A 4NFYA 2JCXA 1Y8RA 1GZ3A 2VRCD 2VRCA 4I5GA 4DYVA 4E2WA 4NBTA 5HS6A 5COAA 2VZ9A 4XRRA 3ZWNA 3C3XA 2DUWA 3CINA 1G6KA 2EEZA 4YT8A 1XQ6A 4NH4A 2Q45A 4OOEA 4YQYA 3S2IA 2Y1OA 1N7HA 3HWRA 1YBAA 4XEHA 3VH4A 1P44A 2O3QA 3IOYA 1JN0A 1KEWA 1GFSA 1IPFA 2I3GA 3KLPX 5FI5A 3QA9A 4M86A 4MIOA 1XHLA 4R01A 3I9KA 3ZWPA 4YDRA 4GMFA 1PIWA 2D1YA 1DRWA 4O5OA 2FHSA 2RIRA 5IN5A 3R6DA 3ROMA 3TOZA 2FP4A 2VCYA 1H5QA 4FR5A 4KP7A 3VPHA 4IDGA 3AM3A 5IZ4A 1BVRA 2NWQA 2JAPA 2O4UX 4XQEA 3OEWA 4H16A 2C07A 4MVJE 3O4RA 1ISHA 1PWZA 4YRBA 1J4AA 1NQOA 2ZQZA 5TGDA 4O0LA 1FK8A 1ULSA 1JQBA 4CMEA 4Z0HO 1RYDA 2WYUA 1EFKA 2R00A 1PU2A 3VVCA 2POQX 4J0EA 4OKIA 3EY4A 5I8ZA 5C7LO 4AVYA 4ITUA 1IL0A 1B16A 3PZBA 3UICA 5A04A 1E1MA 1I30A 3U9LA 3WX0A 1I33A 3I9NA 3EVNA 4EUHA 2GR9A 1ZXLA 2IYOA 4O6VA 4I5DA 1XKQA 3QVSA 3K2BA 1RM0A 3PTZA 4RORA 4BV9A 5HA5A 4MVJP 4J3FA 4ZQEA 3P5SA 4URFA 2J3IA 3D0OA 2Q1TA 4XYEA 3ROKA 4PG8A 1ISJA 1CDOA 5B1YA 1EK6A 4IPTA 5LDGA 5JAIA 5A9TA 2PWZA 4FGSA 4RQTA 4XYGA 2NSDA 2DBQA 2CNBA 2I99A 1YQXA 3UHAA 1ONOA 4WOJA 1GUZA 2VHWA 3V1YA 3MCVA 4NMHA 4FIZA 5ILGA 4EEXA 3RJ5A 5TRTA 3N7UA 1PJTA 3EDMA 3QVTA 3U4HA 3WSVA 1ISFA 2TMDA 4W6ZA 2EW2A 1O0SA 3VZPA 4JJFA 3EAGA 3FPLA 4R3WA 4G65A 2EKPA 4BVAA 1X0XA 5CDGA 3SC4A 1M6WA 1NAIA 3F4BA 3CE6A 5CPBA 2GN4A 3DOCA 2ILTA 2IODA 3AW9A 4XX0A 4IM7A 3TOXA 3UCFA 2WEKA 2UV8A 4E2ZA 2AQ8A 4R9RA 4Y6RA 4PLHA 5DP1A 5JDIA 4ND2A 5B12A 1LQUA 3CTMA 4I08A 4DC0A 4Q3CA 4HADA 2OHXA 4J1NA 4B4VA 1PR3A 1U3VA 5L3ZA 3B1FA 1U4OA 1LA2A 4D45A 1L7EA 5JBIA 4E5KA 4R68A 3K2EA 4CMIA 2IZ1A 4J1QA 5JAQA 1E7QA 4J9VA 2E6UX 1H94A 3HDYA 3ANLA 2VTEA 5GMOA 1WXDA 1HWYA 3DOOA 2EJWA 2Y1FA 4Z9FA 4ZD6A 1B2LA 3ZU3A 1MLDA 4EYEA 1BSVA 3KXDA 2W90A 3RI3A 4RF4A 3WWYA 3OF2A 1LRLA 3FWZA 3X2FA 1V35A 1ZCJA 3PGJA 2TMGA 4FD3A 5KJEA 4UEOA 1GYPA 3ZV3A 4IQ8A 1K5HA 3BYZA 3L0DA 3PJEA 3AUAA 2NNLD 1IYZA 3ENNA 3JYPA 3GDGA 4WECA 2J6IA 1A71A 3BTSA 5HRUA 4XD2A 4A0SA 3GZNB 4GX1A 3QVXA 4BKOA 2HCTA 2XXBA 4FC7A 2H5LA 4HUJA 3F1LA 3JD3A 2GUGA 4Y6PA 1F06A 4RZHA 4KMSA 1PQWA 5I9MA 4GPD1 3H9UA 4GVLA 2PH5A 3RKUA 1X1TA 5AXBA 4BHTA 1DC4A 4R3NA 2Q4EA 3ZGYA 3FCOA 1WPQA 4MVJM 5B4UA 4RLSA 3WYBA 4AJIA 1NR7A 4FB5A 1WZIA 3WJ7A 3RUCA 3C7CB 4KDFA 5F1PA 3L6OO 4DIBA 4XDYA 2GCGA 5T57A 2R6JA 2DPHA 2RHRA 3KZVA 1YQGA 3OJ0A 4FOOA 1S6YA 4J91A 1L1FA 1V8BA 2AEFA 3KB6A 3VDQA 4BKPA 1RPNA 4BMSA 1FDUA 4DPLA 1HKUA 1P77A 4BNYA 3KTDA 1E77A 2X22A 2BF7A 1XWFA 2DBZA 3GRKA 1ZBQA 1IY8A 4F45A 3V1UA 5I8WA 2NTVA 4H7PA 4Z0TA 3ZWYA 4YJGA 4B4OA 1GR0A 3BMOB 3AK4A 3TL2A 4YAKA 1ENPA 3UN1A 1U7HA 4B7UA 4NNJA 2Q99A 1NVTA 1BDMA 2DLDA 3FWNA 1ZIDA 1P31A 3ZV5A 3H9GA 3I3OA 1WZEA 3IAHA 1GUYA 1I2ZA 3FR7A 3Q6IA 1YDEA 1YO6A 1PZEA 1ZEMA 4MIEA 3W6ZA 4BNMA 2JL1A 2DKNA 1BXGB 1ZSVA 1ID1A 3NX4A 3AI3A 2B4QA 1GV0A 2VZ8A 3C8MA 3UKOA 4M54A 1KERA 5H82A 3PHHA 1IUKA 4PRLA 4W7HA 5T8KA 4CMCA 4CV3A 4EITA 4NI5A 1SO8A 1BG6A 3IDSA 3BHMA 4W9NA 1R4MB 4BO2A 3WWZA 1C14A 2V6BA 4PIVA 2NTNA 3TFQA 4C7KA 3DZHA 3WGYA 3PYXA 1H0KA 4YWJA 2XF8A 9LDTA 4ZQHA 2VQ3A 1ZVMA 4WPGA 4E13A 2QZZA 4II3A 3EYWA 1UDCA 3U4DA 2B69A 4AJEA 4BO0A 3AI1A 4WE3A 4DRYA 1JKJA 2OL4A 3PWSA 1J6UA 3AFNA 4PLGA 3DAGA 2FZWA 1FDVA 1E3WB 3L07A 1LRJA 3WQSB 1GCUA 4DQXA 3COSA 4RDIA 1D1SA 4IGFA 4N5MA 5DDIP 2F1KA 3NUGA 2PGLA 3GGOA 1PQUA 3HFGA 2I3AA 5JNLA 4D3FA 1XYGA 3HB5X 4U6SA 3BHJA 5KKAA 5FEUA 5IN4A 5KNLA 1XU9A 6LDHA 3LQFA 4PGFA 4L0QA 2I9PA 3EGOA 3NT2A 2V7PA 1DXYA 1V3VA 2EGHA 1Q7CA 1EK5A 2G5CA 3L4BC 5JC8A 4WEQA 2ZYDA 1YOVA 1NX6A 3HE3A 4MIYA 3PPIA 3V2GA 4W7IA 4XIJA 5HM8A 2OORA 1OAAA 3ZNNA 5J23A 1QV6A 5JCXA 1ZJZA 3D3WA 4GKBA 5L45A 1Z7EA 4WKGA 1YH3A 4RVFA 4TRJA 4BMNA 4MP6A 5DOZA 1DOHA 2JD1A 3GGPA 4MVJI 4TMFA 2AHRA 4OQYA 2YFQA 3AUTA 4UEKA 3DHEA 3K73O 5A05A 3PP8A 5IZCC 1A5ZA 2FWMX 1NVGA 5BSFA 5F5NA 2Y68A 1WDMA 2GO1A 2EP7A 5CG1A 3RUAA 4J2OA 2Y66A 1UDBA 4YJHB 1VI2A 3HQ4O 4BO9A 4I9HA 2RH8A 3KEQA 4FFNA 1MB4A 3GRPA 4PVDA 3VDRA 1E3WA 2EG9A 3F6YA 1HZJA 5JAMA 4I8XA 4ND1A 3JQCA 5TT0A 4TRMA 4CQMB 1RM3A 3KLMX 3PQDA 3U49A 1WP4A 2P4HX 4CR6A 1H2HA 3JQGA 4C4OA 4J16A 4NR0A 3C24A 1H6AA 5A5EA 1VPDA 1QP8A 3NDRA 4TZTA 2JFGA 4CM4A 2ZTMA 3NT4A 2W8ZA 3BMCB 3GFGA 1B8PA 1D8AA 5C7OO 1U8XX 4XGNA 1VL0A 1Y8QA 4BNNA 1EDZA 1HL3A 5BR7A 1C3VA 3DTYA 2G76A 1E3SA 4OL9A 3UW3A 4E4YA 3GK3A 3E5MA 3M2PA 1XLTA 1D7OA 4NHEA 2DM6A 3ADOA 4PZDA 1I5RA 2PKQP 3GDOA 4B4WA 1YVEI 3LVFO 4OIMA 3QWAA 1X14A 3WBBA 4XGIA 1NQAO 1YONA 1DIAA 3CPSA 3H6KA 1UXIA 1P3DA 2GLXA 4W4TA 1GZ6A 4IINA 5JY6A 3Q9UA 1YJQA 1E3IA 1F0YA 1GL3A 3C85A 4IIUA 5BSHA 4YCAA 2HRBA 3IS3A 1PJLA 4K6CA 4CM9D 1ADGA 1ZK3A 1C1DB 1DPGA 1TVEA 2X23A 5TT1A 4CM9A 1HLDA 3PVZA 4JXKA 3LF2A 3MOIA 1FDSA 3L77A 2NQ8A 4QECA 3HN2A 4YJHA 3QV1A 2X0IA 4M89A 3JD1A 3OQ6A 1E3JA 2GN8A 4FS3A 4FJ1A 1X1EA 1EBUA 1UZLA 2CVZA 1T26A 1UAGA 3AOEC 2OGUA 1JDJA 3G0OA 3NAQA 3TZHA 4K6FA 4BUCA 5F1KA 3GMDA 3GNSA 4ALMA 3ASUA 4EUFA 1H6BA 1YWGO 3GR6A 2D59A 2E48A 2O3JA 4TKLA 4XKJA 5HTOA 1UXGA 3EC7A 1E3LA 4GGOA 4IQGA 1K89A 3RFTA 5FI3A 1PJQA 4ESOA 1K3TA 3DZJA 2IZZA 2IXBA 1IHYA 3QP9A 4E12A 4J7XA 1DAPA 1HYGA 3NEPX 4B79A 2JFHA 3GN2A 4UVEA 1PS0A 1T25A 4XQCA 1T2AA 4ZN6A 3K8ZA 4B3JA 7MDHA 2CSUA 4S1VA 2OXIA 4LVCA 2BFOA 1ISGA 2J3JA 1YQDA 2CUKA 3FBGA 4EBFA 5COQA 3V8BA 1R6DA 1NHWA 1N92A 1UXHA 4LCJA 5DOVA 4LN1A 1IE3A 1M66A 5EQDA 4JQCA 1QORA 4OM8A 1PJBA 1WW8A 1BRMA 4J2HA 3WJAA 2B5WA 4CLRB 4JGBA 4OKNA 2X9NA 3JCZA 1HXHA 3RWBA 2RHCA 4DYDA 1O9BA 1J49A 3GC6A 3DEYX 4NIMA 2J5RA 1M76A 2WJPA 4J7CA 3AU8A 5EMHA 2WDZA 1EQUA 1ZSNA 4A73A 4WCFC 2PH3A 3B20A 1Z7BA 3LLSA 3OQ1A 4NJMB 3FI9A 4P8RA 4E31A 1SOWA 4IMPA 5GZ6A 5KCZA 1GEEA 1I2CA 2CFCA 4K26A 4PG4A 1O94A 3ZHZA 4BO1A 1Z82A 1NTOA 3K96A 3UCEA 3VPFA 3WB9A 1JVSA 3T7CA 2VHYA 2FSSA 2P5YA 3U0BA 5TNXA 2JD2A 3MTJA 4Y67A 4FN4A 1VJTA 4CMKA 4PVCA 5FYDA 4R54A 1P1JA 3GVPA 1Q0LA 2EKLA 1QYWA 3NGXA 4FFRA 3I4FA 3ZWWA 2WE7A 1ISIA 1DDOA 3I9LA 5IDYA 5I7VA 4XCVA 1E0DA 2D3TA 4ZGWA 5L95A 2O3RA 5L4LA 2HK7A 1E1NA 2W2LD 2W2LA 4CPDA 1KC1A 4OMUA 3ICPA 1O95A 4N18A 2Q49A 3TZ6A 3PYMA 4XRGA 3D4OA 4RPJA 4HFNA 1Y8RB 3U4CA 3RCBA 2Y1EA 1Q1NA 2PK3A 1D1TA 1PR9A 1A4UA 1W0CA 4JX8A 3CEAA 1XG5A 4BB6A 2JAHA 4CLRA 1UP4A 4ND5A 2WM3A 5L4SA 4DTIA 1IHXA 1YRLA 1V3TA 2HJRA 1HE5A 2ZB7A 1WNTA 4RQUA 1DRUA 4YAGA 1A7AA 3AUSA 3LF1A 2BKAA 3DXFA 3VAZA 3PFFA 4WNIA 5CHEA 3DFUA 5JY1A 4CUJA 1U28A 2FR8A 1SBYA 5L53A 4CM6A 4BGEA 1I8TA 1VL6A 4Y8VA 2WD7A 5BQFA 4MOWA 3D3EA 3O26A 2CY0A 3ZU5A 4MVJF 1SZJG 1LI4A 1T2FA 3HHPA 4UUPA 3VC7A 4OYRA 4CMAA 5FWNA 3CIFA 4BIIA 4L4XA 5KVQA 3JQ8B 4G2NA 4Z3DA 4E0BA 3JQ7A 1ARZA 1DLJA 4CR7A 3D4NA 2P9GA 4I9NA 1LQTA 1N7GA 1RJWA 2HKIA 2UUPA 3LT2A 5TSDA 1I3KA 1JWBB 3G49A 4KWIA 1ENZA 4Z9YA 3PEFA 4J9UE 5DCUA 3OHSX 1EE2A 1XR3A 4QX6A 3V2HA 3GNTA 4MINA 4CUKA 4Y6SA 5ITVA 1WMBA 1E92A 1ONNA 5I7FA 1X13A 3RBZA 3JQFC 3R1IA 3P19A 3HZZA 4IIVA 3DR3A 2A94A 5FFFA 3WQQA 1B3BA 1NFQA 1PS8A 4RDHA 4MVJD 1HSOA 1I0ZA 4MVJA 5A06A 4Z6KA 3DQPA 3ITKA 4E3ZA 4E2YA 2EF1A 4UVIA 2VHZA 4XA8A 3SVTA 2AQHA 4U8GA 4CM5A 2ZB4A 3FD8A 1Q7BA 1TXGA 3D5QA 1VC2A 5KVCA 4J4TA 3WG9A 3QVOA 4MVJG 3PIIA 5GZ3A 3OIDA 4ZHSA 2Q1SA 1ENOA 5JXWA 1U2GA 1D3AA 5CDUA 3E9NA 4UVHA 3JQAD 3JQAA 2QYTA 4WLNA 1G1AA 4TKMA 1MA0A 2NVWA 2NVBA 3VH2A 2ZK7A 1B0AA 1PZFA 3Q2IA 4AJJA 2AG8A 2OBNA 1UXJA 4QO7A 2QQ5A 2FSVA 3EZLA 4D42A 5T64A 5A03A 4E30A 2VHXA 4KQWA 2HDHA 4G81A 3JQ8A 4C7JA 3NT5A 3ADPA 1NFFA 3A06A 4RVGA 1K0UA 3EVTA 1R0LA 3AY7A 4GAEA 1H2BA 4IGEA 2GN9A 4PLFA 2Q46A 3TRIA 1BWSA 4K9DA 2JHFA 1J5PA 5G4KA 4L8VA 3GUCA 4PLPA 4YRDA 3M1LA 3ETGA 3GG2A 2DFDA 5DBIA 4CM3A 1X7GA 4DMLA 3R3JA 3DTTA 4CM8B 4L9RA 5JDCC 3JQ9C 5B4TA 1LNQA 3HG7A 4YT2A 4CMIB 2C7GA 5DF1A 3SC6A 1B26A 1SB9A 3WR5A 4CODB 4XR9A 4LISA 1ZMTA 4NPCA 2CF6A 1NVMB 1YB5A 3IJRA 4MKXA 4QQRA 3L6DA 1TB4A 2QG4A 1EVZA 3STHA 1JAXA 1O5IA 1PGJA 1YE3A 5TS3A 4MP8A 2JKVA 4D43A 1R15A 3RC7A 3QRWA 4JP2A 5IJZA 4OSOA 3PHLA 3R0IA 4NJOA 3RUIA 3VVBA 5DULA 2EERA 1UP6A 2PA3A 4MKZA 4W82A 4J4BA 1GQYA 1DSSG 1Q0HA 2IEDA 1ADBA 3O03A 4I5FA 5AYVA 4AJLA 5KVVA 4BNXA 1O6ZA 3W8DA 3PFWO 4E33A 2V6MA 1SCUA 3DONA 5EN4A 4E5MA 1RM4A 3H5AA 4HY3A 1B14A 1I36A 2C20A 2RH4A 3KSZO 3TDKA 4CMHA 3IUPA 4AJ1A 1MG5A 3W4KA 4U6QA 4BMVA 4BO5A 4I1IA 1U8FO 2ZB3A 1U7TA 3GZ4A 5KOIA 1P33A 2B35A 1U5CA 3JYNA 3V1TC 4DIFA 1LSUA 3QE3A 5AOVA 1LLCA 2OUIA 4Q39A 1LC0A 5U1PA 3KSUA 2WTBA 1BGVA 3JQBC 3H2ZA 4BL5A 2HK9A 3E03A 1EEHA 1V6AA 2FZEA 3H5NA 1YL7A 1EVJA 3QW2A 2UVDA 2O48X 2J8ZA 3WS7A 3C7DB 1OZAA 4OJNA
chains in the Genus database with same CATH superfamily
5T7BA 4HN4B 4GI1A 3EOZA 4Z9XA 2EKQA 3KJXA 4CM7A 5G0VA 4BEBA 2PUVA 4EP1A 2QUBA 4J1TA 4MUKA 2R25B 2FWAA 1N2IA 3PNLA 3WYFA 2QRVA 4YECA 2BGTA 2IUEA 4UCWA 4IHQA 1DAOA 2EJBA 4BP9A 1P5JA 4N5NA 2X1MA 2JIDA 1G8YA 3A6PC 4R0VA 2VSYA 1MNAA 3KPUA 3LP5A 1I10A 4BECA 1PV4A 3OQBA 5LN1A 1FU4A 4KLZA 2GN6A 3UAYA 5JMPA 2JZCA 1CQIB 1KETA 4KZPA 4NYMQ 5ELMA 5IP5A 3IOEA 1IM5A 2C31A 5GPBA 2R7LA 4ID9A 2WHRA 1NLZA 1K8YB 1GPUA 5LOVF 1SKQA 3J7TA 5DHUA 2YWFA 5LYYA 3CRMA 1AUVA 1OIXA 1X87A 2ZSAA 1XT6A 1ECBA 3HXKA 3IPLA 5TQ2A 2J85A 2QRGA 3RQSA 1BVYF 2VNSA 3TUIC 3LA8A 4C0AC 4P35A 1Y1TA 4R9SA 4D9EA 1GPDG 1NUTA 2ZJ3A 4LMPA 2V7QA 3WSTA 1M5UA 2VFAA 2D8MA 2GBCA 3T1OA 1UZAA 4FYWA 1RXUA 1FNDA 1G18A 1QF9A 1KY3A 2JJQA 3LWBA 2WG0A 4RK6A 5JPIA 1TYBE 1H69A 3EA0A 2FV8A 3OIWA 1RAFA 1P5FA 2H4XA 2YWBA 2FSGA 3OE7D 4FMDB 3IOCA 4RV9A 4YJ3F 2GRUA 5AKHA 4AUNA 2UYCA 3DMNA 2P11A 3OZGA 3DEJA 3WHIA 1GLNA 1XVUA 1Y6JA 2BMWA 2WR8A 4CKWA 2WFAA 2JDID 1Z0DA 3DL2A 3P5BA 4D4MA 2FVXA 3D64A 3FNRA 3SBOA 4WFQA 2WBLC 4GP6A 4Q34A 4RF3A 3NTOA 2AMFA 4AYXA 1U3FA 2PYDA 4WFIA 2FN4A 3CZMA 2E89A 2WWYA 4I1SA 4IJWA 2GHIA 3HDQA 1PZXA 4ZQGA 1FMTA 2JS7A 2QS9A 1E63A 4M99A 5AKEA 2ZUWA 1T1RA 3JWGA 3NHPA 3OCXA 4DCMA 2I55A 1UPUA 4LTNA 2A1UB 3K6JA 3SX2A 3QZUA 1M75A 1H8ED 2PV0A 3AHFA 3DUFB 3AEKB 3SDZA 3OCYA 1E4EB 1TPYA 2PKWA 1N0WA 4UDNA 5IH7A 3CN7A 2W6CX 1Q3TA 3PI6A 2YOHA 1AE1A 2H1SA 2I2DA 4FYJA 4RHFA 2JH9A 3VR0A 3RVPA 1L4KA 1CVIA 1HQYE 2IDZA 2YZGA 2R8PA 3MUNA 3RSSA 1WMDA 1CQIA 2AN3A 2CDCA 1E3QA 2FUCA 3GELA 2NYAA 2ATEA 1JU9A 2Q5EA 2O2CA 2CVQA 1XZPA 4XWAA 3CVUA 1F12A 3DXZA 2WC1A 2ZTSA 2BOVA 1UM8A 1H4TA 3D2BA 2AD1A 4JKYA 5AM2A 3CVJA 3QNWA 1NC3A 1P3JA 4FWTA 1PG0A 2OGZA 1WPGA 1EQAA 1V9LA 1NBMD 1D2CA 1F8YA 1RRPA 1GV1A 1XO1A 2WU8A 1Z0FA 3OFNA 3TVTA 4CCWA 2P8SA 5KI6A 4UFOA 1U0SY 5EAIA 1R5OA 4LVUA 4QTXA 4YPOA 1E6LA 1W9MA 4EJ6A 2HY7A 5K6AC 2ZT7A 4GICA 1LJ8A 3BHIA 1K7EB 3B2EA 1Q12A 2ZSHA 2HJHA 4TT8A 3SQLA 3FCYA 3GF4A 4ZVNA 5KVAA 4RTSA 1OXXK 2CF5A 3W6UA 3C3PA 1E5LA 1GGNA 2RBGA 2VJKA 5KSYA 3O8RA 4LFBB 3MIIA 3OIUA 4IR7A 4MGIR 3U3DA 1U98A 2R97A 2EKDA 3FPGA 3Q9LA 4GMGA 4FGJA 2W4MA 2YV3A 2WJZB 3URMA 1YZHA 2P9BA 5JSFA 4B87A 1OHHA 3L18A 2XVXA 3I23A 1FJHA 1V9CA 4LGVA 5DLDA 5EXEA 3ZBQA 5MN6A 2QDKA 1YGPA 1SUEA 3INRA 1JLMA 2PJUA 1XTUA 4C6SA 3GVIA 2BFNA 4J07A 4CKEA 3A6HA 4JP8A 1KTVA 4TKZA 2EARA 5JXGA 1SN7A 4YLEA 5IM4F 1EVLA 1FTSA 5LL6P 4LW8A 4ABYA 3AP3A 2H5EA 4QHSA 1RWMA 1E9AA 2ZDQA 3KT6A 1XD2B 1U3WA 3DUFA 1L7QA 4JAVC 4B6OA 1RZRD 2IZOA 1GL7A 3JQFA 2YNMA 3CF6R 4RHXA 3U4MA 3UC5A 3EXHB 2VIIA 1CRQA 2VHVA 1OT5A 1ZIOA 1OU4A 2A1IA 3DF9A 3OWXA 4MO2A 4URUR 3TRHA 2H57A 4A1OA 4D4JA 1Q77A 4EHBA 2F1HA 2Z58A 3SJBA 4R7GA 4BVEA 5CD1A 1F38A 3ZWVA 1SMKA 4DLNA 3K5HA 1KZ9A 1T4BA 5LC1A 1DVRA 4O2BB 3HJBA 3DCYA 4AJ4A 3B6KA 3SR3A 5JFTA 3RYHB 1CRPA 1SU7A 2J3QA 4DL9A 3TNYA 4H6XA 1BXRA 3SC2A 1G3QA 1Y8QB 1E2EA 1TMOA 3AUYA 3G68A 3P97A 1MTZA 1W4ZA 1YRHA 2A88A 5J4KA 2ZULA 2YJ5A 4DIMA 4ND3A 2XYRA 1E1LA 1UJ5A 4BP3A 3LY9A 1T1EA 3MUEA 4HDSA 4RVSA 5AKZA 1YKFA 3AESB 4ZAZA 4UNIA 3D3JA 3GFQA 3A4IA 3KALA 1L4EA 1PR5A 1SUCA 1NN3A 4BKQA 4WCVA 4A9AA 3EZ9A 1SKUA 2B61A 3I9V1 3E7XA 5TS2A 3NZEA 2ACWA 4AY3A 2PJRA 3TM5A 1E1YA 2JFPA 2YJNA 3HUDA 4RHEA 1V95A 4RWZA 5CH8A 5DTMA 4EMTA 1JH9A 4ZCIA 3GEMA 3OPYA 5JROA 4QUKA 2P9JA 2QZPA 3OBBA 2JC3A 1K6IA 1YZUA 2AA3A 3KQTA 6ADHA 4WVLA 3WMXA 1Y4AE 1Y3IA 1EPUA 3DV0B 1JDTA 3E4DA 1OTXA 3FFAA 1NIJA 2M1XA 2XZPA 1DFHA 3B85A 1EP2B 1O87A 4MDHA 1WSWA 5IF3A 1HZZA 5FORA 3AERA 1DRVA 3BL6A 1SXJE 1XD2A 1E79A 1WOYA 5JXIA 2FWNA 3KVYA 4IWYA 1EQ2A 3D7MA 3MZ0A 4V0RA 1YR8A 4AJ2A 2P2SA 3JQ9A 1H1DA 4TXMA 5EPOA 1VA4A 2YIJA 1S7GA 1USKA 3VAYA 3WXBA 2OAQ1 4H18A 4OHRA 3ZCPA 2OMKA 3LYUA 4TTSA 3A1DA 4BNLA 1UXKA 3FDIA 3KEFA 4HBGA 5IT0A 1VTKA 1CJTC 1O03A 2QSUA 3GPDG 4KPGA 5J1TB 1YC2A 2QYSA 2RGYA 3CEHA 1HR0B 1GQQA 3TGLA 1KVRA 4HXGA 4U7HA 3U4AA 1RJEA 3AV3A 2BTQA 2WZDA 2CNLA 4NVRA 4DJEC 3BRWD 3RYHA 2BGWA 3H5RA 3VO1A 3PQCA 1TKCA 2ZT5A 1Z29A 4OQQA 2XNDA 1SPBS 4IG9A 4EQ6B 3EGXA 3S28A 1J8QA 4I6GA 2I80A 3HA5A 2DH6A 2DJ5A 1T8PA 1P4RA 5IAEA 4NKRA 1J70A 4MR7A 4ALJA 4I99A 2HI0A 3VPCA 3DZCA 3LQKA 4A5SA 4AMZA 5JU6A 5DZSA 3MILA 1ZSYA 2DFLA 2QLLA 1BHJA 1NW6A 3OCJA 5H70A 4AJNA 2UXBB 2P2DA 1IEQA 3LBYA 4JHLA 1K9VF 3Q8WA 4CIBA 1CJUC 1IZ8A 1MV5A 2DP4E 3F0TA 3WGNA 4WRRA 4EL5A 3FZGA 1KH3A 3EZXA 4LPKA 4TROA 4GLLA 4DYHA 3STUA 3IOBA 1R6TA 4E2FA 3QEKA 3WNVA 1TEZA 4Z4FA 3THWB 3UKDA 4ZJYA 1TIBA 2VN8A 4IIJB 3A0RB 2YS6A 4JEUA 5DMHA 5DX8A 3VR5H 3JV7A 4C0KA 4C1NA 3DV0A 1BS9A 4J7UA 2J5QA 1I3MA 1K98A 3CUEF 1QG4A 3KDPA 4FX2A 2QE7D 2PMDA 3TO5A 3WNCA 4AKGA 2FRDA 3PD7A 1KZGB 4ARIA 1E6UA 2QM0A 3WO1A 4OJTA 2R8ZA 2FMKA 1JDSA 4MUBA 2ISSD 1MOSA 3HJUA 5BP7A 5I7SA 1CB0A 3AOGA 5JWOA 1DAEA 3AG5A 4CKCA 2GVZC 3DVAA 1SD1A 4JT4A 3DBLA 1FLNA 3QF4B 1PDVA 2EG5A 2JI9A 4ZZ2A 4I81A 5G2OA 4RTNA 5AOAA 4F3YA 3T9AA 4PEVA 4YXWD 2AZDA 4J0FA 1W5EA 2E82A 1DHTA 4TMTA 5UKDA 5IJ9B 3F4LA 5H83A 2HU5A 2I34A 3KOXA 4C3UA 1KMIY 1WXQA 5K3CA 4LSMA 3ZYZA 4WESA 4OK3A 5FBHA 4BJHB 4RKEA 2Z6UA 1PZMA 1Y34E 2DBVO 1UKVY 2ZBEA 2A92A 4BFTA 4G6ZA 1LC3A 2YUIA 3O93A 1T3ZA 1ZISA 3GAZA 1T3TA 3GGJA 3GRYA 4RPIA 4U2FA 1OGYA 4URWR 4X6UA 5EPEA 4BOYA 2HRCA 4D4LA 2YV2A 3FJOA 4F5EA 3WLIA 3OUZA 2AXPA 4UBLA 1ZN9A 1K92A 1FDWA 2JGJA 4LGCA 2B82A 1COWA 4QT0A 5HZKA 1W48A 4ZIRB 4WKPA 5J5AA 2H2GA 1NW3A 3L1KA 1OYYA 3N6RA 1VG0B 1XZGA 4ZXFA 2A0UA 4WA8A 3E6AA 1B93A 2Z5LA 2PO5A 3W0LB 5JW6A 2R6R1 4WDRA 1YRBA 5E1DA 4MQBA 5LCXA 2QGNA 3EWAA 4QDJA 4IIJA 3ZDAA 1Y4SA 1EA7A 3R3VA 4DQUA 4M60A 3H5VA 2A1TR 1LSOA 4NBSA 4DQDA 3EARA 1SBNE 3GLTA 4QGHA 1XZNA 1SUSA 2BMAA 3C3MA 3OE5A 2BMJA 2V7BA 2OCIA 3JALA 3C3YA 4YBZA 3M34A 4Q3EA 5DWVA 1JR2A 3M6MD 4NONA 3TMYA 3A3YA 4EVQA 5EHXA 4JP5A 3K0CC 1LK0A 2VPTA 2JJMA 2WD7B 3UZUA 3ZGOA 2EQAA 4RFLA 2XSZA 1E4VA 1MZPA 2Y8EA 2NW6A 1DS6A 3UEOA 2ZRMA 4WBNB 4OGLA 4P0TA 4F46A 5FPHA 1UMBA 3GJ0A 3QF4A 1W94A 2O8BB 3FPHA 5FUVA 1FLVA 1E1KA 2C2MA 3K9LA 2GK3A 3TRFA 2ZIGA 1P1CA 3TSYA 4RE6A 2UYQA 4MUEA 3TQIA 2A8YA 3X1MA 3N2NA 4XB6B 2IRWA 3PA8A 1ZGHA 3GL9A 5GVSA 2I8AA 1N6PA 2JPDA 3L79A 4OHBA 4E4RA 1F7UA 4S1PA 1ZUIA 4OI4A 4RCYA 4E1BA 1XXHE 3LYAA 2FZ5A 2CHUA 2OK8A 3T61A 2EQBA 1F0NA 3RUHA 1DAMA 1UMCB 3QX3A 1MQSA 4XSVA 5IANA 4HLUC 1JQKA 2GN0A 2XDQA 4OB6A 4AO6A 1P2DA 3RREA 3DXXA 4L4YA 2ZANA 4DARA 2IBTA 1T8YA 2YYZA 4EB3A 1PI3A 2FRXA 2IK8A 5HF5A 4MQFB 4DDWA 4RVDA 2A5LA 3G5LA 1LS6A 4LQCA 4RLFA 2BONA 2QAGC 2I7XA 3TGPA 1CUXA 1USIA 3M3PA 1ZMOA 3EGDA 4IP0A 1ZHFA 4X3CA 5SZJA 4TVOA 4ZT3A 3BK7A 3KDAA 4NNOA 4V0LA 3O94A 1H93A 4I1VA 4ZIRA 4FDUA 2C03A 2XYPA 1JBQA 3PTLA 2ZITA 2I4MA 2X6TA 3HCRA 4KV7A 4MMZB 4E32A 3FRHA 4GZ5A 4DA9A 3JWIA 4JLDA 1JR6A 2GSWA 5JD6A 1UOEA 5C1IA 1TQ6A 5CFRA 3IR6A 1X1CA 4BMDA 2NP6A 1ENYA 2J1LA 2QTAA 4GX2A 4KGVA 1THGA 3VNVA 1Z12A 3VH1A 1JA1A 1OI7A 2VBFA 4DA8A 1U8YA 3GDHA 2WVAA 1B8UA 3FOCA 3H2YA 3EGIA 4MK4A 3RUFA 1U90A 3NORA 2NO9A 2DOKA 2HU8A 4YMIA 1DT5A 2VF2A 3KVVA 3JQAB 5CH5A 2BE9A 1NI4B 3OZFA 1UPFA 5DBGA 3OX4A 4JR1A 3C0KA 3FRIA 2C5SA 3H87A 4YUYA 3SHVA 1T4DA 4P3XA 4DLRA 4I5EA 1HLFA 2PS9A 5KYXB 1TLFA 4LF7B 3AXTA 4WBNA 1Z07A 1RHJA 1FXWA 1LBTA 3NVKI 4BWYA 3GMIA 3SI7A 3QLJA 3LG2A 2P78A 1QOPB 3CNLA 3ZWCA 4BYMA 4QC2A 5EINA 5HZGA 4E08A 3HNPA 5C3UA 4EKGA 1VYTA 1YB4A 1U5AA 2ZWVA 4X7MA 4D8UA 1X6VA 1G0NA 3D6MA 1Q0QA 4K9SA 2PCJA 3DZBA 5LA6A 3UTDA 3FPBA 5CA0B 3BZBA 1JMVA 4PHGA 3CH7A 2YXDA 3TSCA 3Q41A 1QHGA 1Y4ZA 3GNLA 1UMCA 1SCJA 2LDBA 4RLHA 1E1RD 5FTKA 3PC6A 1NHGA 2C3MA 4GOMD 3JWJA 4NAVA 2IUSA 3SBDA 1JEOA 3TPCA 4MVYA 3UOGA 2G1UA 1JNYA 3KPWA 4RTLA 5AHKA 4DLUA 3IIJA 4Q7QA 1DGQA 1GZ4A 4WXPA 2HTEA 1PFWA 4YYEA 3Q0EA 3KC2A 1X92A 3MPUA 1B6GA 4YQZA 4BATA 2NUAA 1GPMA 3L4BA 4E22A 2Z6VA 1ISMA 1CR2A 3BIWA 1XTZA 2O2SA 2VNKA 2HK8A 4EJFA 2KW5A 2C9DA 2BUCA 3EXEB 3I0ZA 1NZDA 4Q18A 1W88B 4G0UA 3FYSA 2F4VB 2W71A 4I19A 2VP2A 3LKDA 3CE9A 3R40A 1Y1SA 5C5IA 4PZEA 4KN5A 2ZJ4A 1MPTA 4OQNA 5K09A 1NMEA 2OECA 3O7WA 2ZP1A 3HUUA 1QANA 4NECA 1Y9AA 3FNGA 1BHQ1 1XQ9A 4LV5B 4YO7A 4PPQA 3ZD7A 5EVCA 2W8BB 2XPCA 3TQQA 3KP1A 1B6TA 1AY0A 5LJLA 4YCBA 1TEVA 3CLSD 4Q1EA 3SHOA 3H7IA 1F17A 4ZOEA 1A7KA 3O8NA 3A6DA 3AT1A 5HQJA 1NI4A 2XF2A 2F2TA 2O0MA 4M8KA 4KNVA 5J2UA 4L4RA 2GM9A 2IBSA 1NQUA 1J24A 1U8UA 2QTHA 5ABPA 5KYXA 6GPBA 1IBCA 2HNAA 2ASEA 3TLJA 1BDBA 1UZMA 4MR9A 5LUAA 1FNSA 2FG7C 1ZUNB 4XH9B 1ULUA 3F5QA 4JBWA 4NBRA 2Y92A 1PX0A 3F98A 1ZGGA 2PQMA 3EPLA 2ZE5A 2YVKA 2FOIA 4FONA 4XDZA 1C9DB 1PGOA 2HDWA 3ZD9A 1NJGA 2ZB8A 4PZCA 1O8CA 1SIBE 5BNFA 1ULHA 5B3LA 4JBGA 1DKLA 1UWCA 2JARA 2Z2YA 5EKDA 3WIBA 4BGUA 4ESHA 2C4KA 5D5HA 1YZ3A 3OPYI 5D1HA 4YRGA 2ECOA 2GJKA 2JA1A 4IJMA 1L4MA 4TWRA 2H9YA 3UGQA 1SEVA 2HQ1A 5ICCA 3H2KA 3X2SA 4XVCA 4QWMA 1HT2E 1Z08A 3IVCA 4CKYA 1KJYA 1SQGA 3KKQA 4D41A 3RFVA 5LWHA 2BR4A 2IEIA 3IJ5A 1IZ0A 3KYBA 2Z4RA 2J9FB 4X5OA 3WTCA 2Q1XA 1VMIA 4D26A 2J7KA 4XYBA 5KTMA 2Q0SA 4Z3OA 1LDEA 5BQ3A 2R11A 1NLMA 1W88A 3AJ9A 1RYHA 1BX1A 1L1RA 2VJQA 1AQYA 1NJ6A 3UKJA 1ZZEA 2D06A 2QMHA 3EDRA 4ZT4A 4CUZA 3PD1A 1JJ7A 1NF8A 2C04A 4DNFA 2A67A 2BSQA 1A5AB 4OHUA 1UPCA 1WE2A 3G59A 4LZPA 1BU8A 2J45A 3BF8A 4WA7A 2B21A 4A0HA 4BE9A 4C05A 4OFXA 5KOIA 4OHYA 2PZMA 3DC7A 3DBHA 2PZKA 4FFOA 4JASB 1MU0A 2V9CA 3P9NA 3RU3A 2VK4A 4KFTA 2B1RA 4OSEA 2GA8A 1M6VB 1V3UA 5DM1A 5JIBA 3EGEA 4QBGB 2QWXA 1QDEA 1ESNA 2FTKE 4Q7MB 3BSYA 5DM60 3L8FA 2V5UA 3MJDA 4N1AA 1ZGBA 3D4LA 4BTEA 2AMLA 4IMRA 3ZK8A 1PS9A 3BRCA 4BO3A 3IPAA 2Y99A 3PC7A 3UK1A 4UNSA 5JFGA 1EFLA 4GL4A 1KMNA 2O1WA 3RC2A 3VYUB 4TZ0A 4RGBA 4QXPA 2PFGA 1J25A 2DQYA 4Y6GB 1OI4A 3TW4A 3M5WA 5ECGC 2XVZA 4K46A 4P7BA 1NRWA 4B3CA 2HWUA 4RPKA 1Q7RA 1MH9A 1S2MA 4FHCA 4NY1A 5K0EA 2IZ0A 3EVBA 4DV1B 1BS1A 1SZPA 2WICA 3ONDA 1IBKB 2Z83A 4XUEA 4P08A 621PA 1XVVA 3K6RA 3I83A 5HTKA 2ZQYA 2QG9A 3KUDA 4PBTA 1BD4A 4UM7A 2HLPA 1D04A 2XCOA 4K7JA 3RYIA 4NU5A 2YY7A 1R0CA 4BZPA 4CCYA 3EPHA 1IY1A 3LPLA 2P30A 3BBLA 3GY0A 1L5HA 2ETXA 3QKUA 2WD8A 3SXJA 2FY8A 4RE5A 4R8SA 3U44B 2PVPA 1KYVA 2ZJ0A 4HCJA 4HGPA 5LZ8A 4M53A 3TBKA 5KJCA 3DDUA 4BLSA 4YROA 5E0KB 3ZY3A 4CMBA 5FUXA 1ZLXA 2EX4A 1GOTA 3LXUX 1KSGA 1Z26A 2O2DA 3AB7A 2WHYA 3I5YA 4FGUA 4A5OA 3PNBA 1RPZA 3K2IA 4X45A 2QN2A 3LCMA 3C97A 3I04M 1HEUA 3OM1A 3AKYA 2ZYIA 1J33A 1AOXA 3UVEA 3KOUA 4EW6A 5MN5A 4WZAE 3GXOA 3R3YA 4TL6A 4XOUA 4BGDA 2RI1A 1ZRMA 2ECKA 5C4IA 3DS8A 4I46A 3G8CA 4DZRA 4TWJA 1GTVA 1DI0A 1KMHA 3DYVA 3G6KA 4NBVA 2YHSA 3SG0A 4IF4A 3RJTA 5A0TA 3UK7A 3NHUA 1QHIA 1DWPA 2HH9A 2VUSA 3QWHA 4K28A 1Z2OX 4BJ1A 5CBPA 1NVKA 3OETA 2AOWA 5IWAB 5GP1A 2X5OA 3S1AB 4KQ2A 1OASA 3ZOKA 1U7OA 4LRWA 3O0DA 1AIPA 5GY7A 5ENDA 3AKEA 1MUUA 4P6VF 4BEVA 2IU6A 1AZSC 2GA9A 2O14A 3K1AB 5CVJA 1UQRA 3I2KA 2F3UA 3AIIA 1L5YA 2CXXA 1AB5A 3LBIA 4LYYA 4D96A 2LTAA 1CF9A 2NN3C 1JECA 5FULA 4R1UA 4PPGA 2MYUA 2WFMA 1TA4A 2QTNA 4X6XA 1XAGA 3DHVA 3L1HA 3AM5A 2XOKA 3TLKA 4KLAA 4A6PA 4BN0A 3S8MA 1KQOA 3RFXA 1P6UA 1NVWQ 2CB9A 2CL6X 4YJDA 1VMAA 3PUWA 3F3SA 4G8BA 1SZDA 1B0ZA 3GH3A 3SJUA 3ZDXB 3D1VA 3MM4A 3OCUA 4U9IS 4WLVA 1DQRA 2COKA 1N9GB 2I6UA 2JCGA 2ZAGA 4E46A 5AW1A 2QMOA 1Y37A 4WCDA 1GTRA 1QH1B 2DPGA 3TW0A 5KIAA 2B37A 2IYAA 3UMYA 1AT1A 4YMGA 2EJCA 2NZVG 1F20A 3UMVA 1CE8B 1OTYA 5REQB 2FPPA 4G1BA 2R62A 4RVUA 3ENKA 1Q1GA 5JQWA 3WMRA 1RZ3A 2P5TB 3CNHA 4K1LA 1OAKA 3ZDDA 1TU0A 1RLUA 5IUJC 1XNRB 1LDGA 2FN7A 4Q1DA 3H8SA 2M9MA 5JAUA 4X92A 5K05A 2ZVJA 4NENB 4Q19A 3O95A 1GDTA 4D8TA 2J7PA 5H5JA 4BPRA 1Q1QA 8ADHA 2BVNA 3ODPA 5CM2Z 3F2VA 5AVOA 1OAOA 3PQ3A 4B4DA 2ERCA 4DKJA 4IO0A 2DQZA 4EPTA 2AG5A 1KR2A 3CR7A 3ORSA 4R16A 1GSIA 1N6HA 3RTCA 3R4CA 4H3SA 4NCHA 4Q6WA 3VZQA 4P7JA 4PPYA 2I4OA 1MXFA 2VSXA 5EPUA 1O6BA 5F12A 4NEGA 2B4TO 1PEDA 1PDOA 1R5BA 1X7WA 2OC9A 1YR2A 2ZATA 3HEMA 3LOPA 4WMLA 4H1WA 3UUWA 2P5UA 5C4MA 2OFWA 2INGX 1EH5A 1QH9A 2XX3A 3A3KA 1T1JA 3EEBA 3H4TA 3LNCA 4HWSA 5DJ5A 1HE8B 1EFPA 2O7SA 2UZ0A 4LK3A 4C6RA 5ICEA 2ZRGA 1VIVA 2IHBA 3GJ4A 4LZAA 5JCOA 1P45A 5K6RA 3M33A 1DLIA 3LXRA 3LQ4A 3K92A 4R6XA 3HYTA 1SOVA 1DBVO 3KK0A 2Y0BA 2Y1CA 3FCAA 3MJSA 4RKWA 2P4UA 1HDCA 1Y0BA 2ZIEA 4I55F 2FI1A 3DDWA 5JWRA 2YVLA 3GLUA 4CF4A 3TFWA 3PL5A 1DARA 3U56A 1LGYA 3L43A 1H9BA 2OQVA 1UUFA 5A4IS 1Y63A 3RRMA 1N8TA 1Q1BA 2D8AA 3ZW9A 2V3CC 5J2TB 3R9XA 1JAIA 1VECA 1QRRA 2FQYA 2MSKA 1GAXA 1KORA 2G8LA 1VXRA 2O07A 5F21A 3T4PA 3PNSA 1CR4A 3M6AA 4DPKA 1GD1O 1HC7A 3GA0A 4P4SA 4AMGA 5JISA 2AYZA 2FGKA 4XTCS 1L4YA 1N9GA 1SRRA 4ETWA 3HCEA 2HRZA 3V8RA 1QH1A 4HEJA 2MIIA 4LE0A 1Z5PA 1X8JA 3ONVA 1CU1A 2FK8A 2BD0A 2GEUA 1FTQA 4WJZA 3X1KA 2QDXA 3VISA 4YQFA 2OT3B 3BWMA 3FFXA 5HKAA 2NQTA 3WE7A 4HMPA 1CFJA 3AI7A 3QSYA 3TOCA 1CE8A 2PH7A 3INTA 4PG5A 5I4BA 1G21A 1KFCB 4Y7DA 4CM1A 1A5BB 3DAHA 5IDVA 1T8WA 1KZ4A 2YJZA 4G25A 5JE8A 3UPDA 4PO3X 1X80B 4NENA 5TLSA 4OX9B 5JJ5A 1YJCA 3G2LA 3WB0A 3WIVA 1R5NA 1U28C 2ZI4A 4S2UA 1P1HA 1OWMA 2E9SA 3AINA 3LHDA 2IH2A 1P7CA 2AH5A 1XX6A 4XIYA 1W93A 4R8MA 3CZCA 4F92B 1YR9A 3OE1A 1IZ7A 3ZXSA 2EFHB 1OMOA 3P9QA 2QXYA 3L4SO 1AU9A 2V96A 2R751 3EASA 2QXUA 2E21A 1JPNA 3CWQA 2FUG6 5B36A 1K6JA 3GPIA 4UEQA 4YDSA 1S89A 2XH8A 1B0UA 5DN6A 5CEEA 4EMBA 3E35A 5ITZB 1P80A 2X9QA 4MRPA 4XI9A 1ZR4A 3WZ2A 2O19A 2QROA 5K8TA 3DAFA 3O6VA 3P2YA 3FG9A 1A5TA 4M0PA 2RBEA 3Q8XB 4WJKB 3GFRA 1HG0A 1ZAKA 4LI0A 2GEKA 3ZR4B 3R0JA 3L4KA 1OBFO 4XD7D 1E5TA 2QXTA 4TTIA 4U2BA 1X1DA 4P31A 3AVXA 3BWVA 2QQFA 1R88A 3PDUA 1UKEA 1JAYA 2LDXA 2IOFK 2VTVA 1BXGA 1MVLA 1UBEA 4RMGA 4M6WB 1E7WA 4UMDA 2VTKA 3PJRA 4EHJA 3VGPA 3CBGA 3W3ZB 5FUMA 1PN3A 2JVKA 2X8WA 3A1NA 1RAGA 2Y93A 3QVUA 1TU4A 2NPOA 3CBQA 5DB4A 3L84A 4IZIA 1P1RA 3OC6A 2Y1XA 3O2JA 2QAIA 4KXLA 1NVUQ 2BISA 3G2QA 4NBWA 3VXKA 2GHRA 3VYRB 4F71A 1C3OA 3MWLA 3TL6A 2VT2A 3K70D 1DKQA 4NQZA 4UCQA 3RNOA 3FUTA 1NG9A 5FA8A 4JB8A 1VSTA 4CDNA 4CYMA 5B57C 3UFBA 5HQTA 1Z75A 2AJTA 4YA6A 2D5LA 3AHJA 3L9WA 4MB2A 1OXUA 3HR8A 4MV6A 5IK2A 3VNAA 4E6PA 4EX6A 1EVKA 3B12A 3ND8A 4ZCSA 4FNGA 5E6SA 3EEQA 4PLYA 5IBQA 5C1PA 2H1RA 3IMKA 3I12A 1TL7C 3EFBA 3K4PA 4ZC8A 2OBBA 4OTZA 5A02A 2IS6A 5KU7A 2Y05A 3JQEA 5DNAA 1IY0A 1E9DA 2OP0A 4XVUA 1PD0A 1AV7A 4DQVA 3HKCA 4ZOLF 1YTLA 2JKZA 1H9CA 1ND6A 1J0CA 1KU0A 3H8JA 3OPVA 2HO5A 1UK9A 4R1QA 4FEAA 3HWSA 4HQNA 1GEGA 3PHJA 3ABOB 3D3KA 1JQAA 2QTVA 3L7AA 4TLAA 5DHSA 3RROA 2NZXA 4CE6A 3WB1A 5C5DA 2C29D 3WDLA 3TLCA 4EIWA 1VHDA 2GTPA 3N2ZB 1RKXA 4TMXA 3DH0A 1U2EA 3PWTA 3EUEA 1RLIA 1HV8A 1UFQA 3UHJA 4KW7A 3C3BA 1F6DA 1QU2A 5BNIA 3BH0A 1IM8A 2C7OA 3FN4A 4UE6A 1F1JA 3U26A 5E6RB 1R8JA 3HA7A 2P77A 3WC4A 1Y4DE 3BRQA 1P61B 3PLRA 1PWHA 4D3YA 1LX6A 1R64A 4MEAA 2L0XA 1T3SA 2G5GX 2XJ9A 5JASA 2Q9CA 5DYGA 1EUZA 2C8VA 4GOOD 4LBYA 4Q3BA 5CLLA 4BNJA 5CFZA 2VYNA 5CA1F 4EY3A 3DXYA 3TLEA 2FWIA 3B1JA 2ZYGA 5EZ6B 2NU8B 5EGSA 1U1IA 2WVJA 1AF4A 3CPHA 3D5EA 2R60A 3JQBA 3MHPA 1W5AA 2VTBA 2O50A 1H2FA 2Q5HA 1AXRA 4J6FA 3SY8A 2HWWA 3ZY2A 4UHBA 1UBHS 4FQ8A 3VKGA 4YH1A 5KKCA 3E15A 5F98A 1UR5A 4R2HA 4B3RB 2E18A 2Q0HA 3TZCA 4KU4A 3JSXA 5LP1A 4RGYA 3Q85A 4LV8B 3VR4A 2I76A 1M7BA 3IUQA 2CK3D 5L7YA 1RRFA 1ZR2A 1W581 3FNBA 4E94A 4ZC1A 2VP6A 5CG2A 2V4MA 1U2SA 4B2LA 5I9LA 1GAEO 1YBVA 1HRKA 4I50B 4KPUB 5JYEA 1GAJA 4Q9AA 3ZZ0A 3V97A 1B6SA 5LUBA 4D02A 4INOA 3EK2A 1QPGA 1OKKD 1WO8A 1DTEA 1KPHA 4JCOA 1LV8A 4NATA 4WK4B 5BSUA 3QPDA 1DQYA 2BMDA 2C7VA 3LPCA 4JC4A 3HSKA 3ZHVA 1EFRA 5EE0A 2ZI5A 4UJ3A 5F1OA 1TK2A 2PD6A 2VWHA 1ML4A 3S2EA 3RE1A 3ZHTA 4KLCA 1D1PA 3QQ5A 4F5YA 4L76A 2ZRIA 4HXYA 5AWFC 5T6BA 1SBIA 1R12A 2OOSA 1CD5A 3PA6A 5G0WA 5CDSA 4CF5A 4LCEA 4ENUA 1LPSA 4BCCA 1K6MA 2V3WA 1NNUA 1B3RA 4HNSA 2Y1GA 3BWBA 5AJXA 4H6VA 5HMLA 1UBJS 1T0PA 4UD2A 2Y0EA 1B8NA 1OC2A 4Y2PA 1ORIA 1TTHA 1NF9A 1XLUA 2I65A 3TNLA 2PD3A 2XB4A 1NPYA 4A26A 4PIPA 5E6RA 3BMCA 4CDRA 1L8AA 3D3NA 3HDGA 1J8DA 2QLTA 4F38A 2OHFA 1B1CA 5D85A 1N25A 4IIBA 2EFJA 3L1JA 4RM3A 1R6UA 5E2BA 1A4XA 4N3CA 3ANMA 3FSGD 4Y2JA 4AO8A 5IT4A 1Q1ZA 2O4CA 2RBKA 3HKEA 1I7LA 3OLXA 1G5FA 2FMFA 5IH3A 4Z0NA 2VO1A 3IMGA 4IRXA 2NU8A 1JHQA 2ZIAA 1RYMA 4ENQA 5LQCA 3IL2A 1CCWA 3NYIA 4L4SA 5CFLA 1AM4D 5AHWA 1Z34A 4ZP1A 4B46A 5HQ3A 3PJGA 3HBFA 2Q2VA 3VR3D 4ANFA 1QX4A 5LP6C 3ZQJA 3PQ5A 1E4YA 1FFAA 2V03A 4K0KB 2GF0A 1NR1A 1R4NB 1IM2A 4ZTBA 4X9XA 5I7HA 2EW1A 3U4IA 4D92A 5JH7A 5KWSA 2AX4A 2GERA 2R2GA 5CLQA 4GE3A 4JUIA 4MV5A 1S7CA 4QXRA 4ZO4A 2PPLA 4CFZA 2ERXA 4ER3A 3G1TA 4BIMA 4BBJA 1RC0A 3ESYA 4F4HA 4TV9B 3K9HA 1GRCA 4W8GA 2R1TB 4G9BA 4D9FA 3TTYA 5HGXA 1N3BA 4CMGA 1XIVA 4Q47A 3K0KA 1GYQA 5HWSA 1OT3A 2FH5B 4LI3X 1V5IA 2X1HA 3WGTA 3IR5A 2QUJA 2R4QA 1RLMA 2AMJA 1XFAA 1Z9BA 2IOHA 2IW1A 2Q1UA 3E8MA 4KN9S 5BR4A 3I1JA 1JZQA 1M67A 1JQLB 3TCNA 5KWEA 5DX1A 4Y1RB 4CN9A 4Y9UA 5TVGA 3JYOA 3R3SA 1TECE 1B1AA 2OVBA 5EL0A 2K7FA 2P5SA 1G6OA 1ZUWA 2YW2A 3C1AA 3CLHA 4ALNA 1JJAA 2FUEA 1Z35A 1KYTA 2YVUA 3ZE8A 3RFUA 4F97A 4FD2A 5AUOB 2FN9A 1FQJA 1QAOA 4Q1CA 1Q95A 4JN6B 1M2VB 4X60A 2VZ0A 2C9BA 2P6OA 4LYAA 2B1GA 3UOAB 4ZVMA 6AT1A 1HE1C 2D5AA 3LH5A 4UUOA 1MQ8B 1XMJA 3GNQA 1Z2CA 2FOLA 3CGGA 4XWOA 3U62A 3UJDA 4JLUA 1G7RA 1XRMA 2I2CA 5JSYA 3T0FA 4HFMA 5I6DA 3BXXA 4G36A 4K6MA 3ZDBA 4LG1A 3RAEC 5ECWA 1N5IA 3EUFA 3KBOA 3M4ZA 4RETA 3PV0A 1YL5A 5C80A 2P3SA 3RHFA 1Q15A 3P0IA 4ARAA 4EECA 3PDHA 3SS8A 5FPYA 3TSOA 4BEWA 4KITB 2EZTA 3IKLA 1CQWA 1QM5A 3V4VB 1N8SA 4ZVQA 1R4NA 3CMCO 3Q7PA 1E3DA 5A5DA 2JCVA 1P2TA 5L40A 3GQBA 3QYJA 2VT3A 3I04A 4J1SA 4JLVA 4KYUA 1F2TA 4G5XA 5DGCA 3S2ZA 3VR5A 5B2EA 4M1OA 4TVKA 3F8TA 2YR0A 1OFVA 4KUEA 1MG0A 2DHDA 2X0NA 2QQGA 2WHPB 1LRKA 1TKBA 1E2QA 1HDEA 1LWOA 3CXUA 4OJMX 1CUSA 1K6XA 4QELA 5F3RA 1UCFA 2G80A 1D6SA 2BHRA 2C2YA 4I2NA 4QGBA 4D80A 3X1ZA 1E58A 3WLHA 3ILHA 3BE8A 3BS4A 1ECJA 1T8UA 2G08A 3NHJA 1GZ7A 2TSYB 5EMNA 5FX2A 3NYWA 2NNWB 4AY2A 2F17A 3BCSA 2C88A 1KAMA 1ADCA 2Q9UA 3SIWA 1MGOA 2WWRA 3ER6A 3IESA 2WIAA 3G9QA 4UAJA 2LW7A 5K20A 5FBQB 1RWOA 3NTLA 1VI5A 1LDNA 1DJQA 2YASA 1Z2NX 2DR3A 4N0DA 4NPHA 1CUFA 4R0NA 4IIXA 5BSTA 2QGZA 4GZ3A 1CJCA 3QKSA 3GEIA 1WXWA 1J21A 1TIPA 2QD3A 4X6LA 5GVRA 3AVTA 1JFFB 2WHQA 1X8LA 1HM5A 1I9CA 2AI1A 2IYSA 2LGJA 4L5BA 5AMXA 5LQJA 4GG1A 2EBUA 3NYQA 4HLDA 3O84A 2BEWB 1PZGA 1J7KA 1HTBA 3C7KA 1TA9A 1NLUA 1Q0UA 2RFLA 4ISCA 3W2EA 2DQ4A 5AW8A 2C00A 3RVLA 2HF7A 1YIOA 4R8LA 1ULTA 4LRUA 3MD0A 121PA 2PRSA 2JI4A 1P6QA 2EJTA 4OU4A 1D4FA 2X77A 5FNVF 5I9IA 1YJ5A 2QD2A 2GX6A 4U39A 4DDVA 2QVXX 1QYXA 2CNNA 1U2PA 5TPZD 2F43B 2ZJOA 5FQNA 4GR9A 2QVZX 2O6HA 2MWMA 3EIOA 2HC9A 3LU1A 2NP7A 3DP9A 1ULBA 2JCXA 5BW4A 3N76A 3SHFA 2HREA 2VRCD 4K88A 4I5GA 4E2WA 4L07A 3OHPA 4NBTA 4AQDA 4P34A 4QVIA 5EZYB 3C3XA 5JTTA 1G6KA 1XK6A 4DLKA 1XQ6A 2Q45A 3LUGA 3NOVA 4RABA 4QE3A 2W6OA 4YQYA 4Z99A 3EXG1 4EYQA 4NYJR 1FNCA 2FP3A 3A1WA 3QXJA 3J7AC 3NDBB 1P44A 1BGXT 3IOYA 1JN0A 4M1TA 1UBSB 1KEWA 2P0YA 1GFSA 1AKMA 2WA2A 2WHPA 3LCCA 4E07A 4CKBB 3K3PA 4FYYA 4PX5A 4EO9A 1GNLA 3ZWPA 4OXQA 4RAOA 4OQLA 2W83A 4J3NA 1FBNA 1V11B 2OXRA 1AHNA 1FRQA 2P1ZA 1PIWA 4YDRA 3SFVA 4BFLA 3FUCA 4DSNA 1DRWA 3PHBE 1L6RA 1UQUA 2GEBA 4O5OA 1PHPA 2NXWA 3UO8B 5JXJA 3PGA1 1VDMA 3TOZA 1H5QA 4MUMA 3UWOA 3CPJB 1LK7A 3VUFA 5IZ4A 2JLQA 1NM5C 1THTA 1X2BA 1Y7PA 2JAPA 2QY6A 3KYIB 1H3EA 2I1QA 5C52B 1L5WA 2C07A 2HJWA 2IVFA 2LE0A 1NOKA 5JQGA 2GCNA 1N0UA 1ECLA 2ZQZA 3UAVA 4O0LA 1FK8A 1RKUA 1S4QA 2QJRA 2ZRLA 2HIGA 1ULSA 1JQBA 1NRJB 2GBPA 2YINC 4UDOA 3EUAA 3VYTB 3EA5A 2I03A 4Z0HO 1KO5A 2BEWA 3W1WA 6ABPA 2POQX 5TMEA 4J0EA 3H1GA 2H1IA 4OKIA 1EESA 3EY4A 4MARA 4BASA 1IVYA 3PX3A 1U9IC 3AEQB 1B16A 3G7UA 4HXFB 4XQ0A 5EE5B 1M1UA 2H1CA 1OGJA 2ADMA 5CNJA 1A9QA 3ROTA 1FUIA 4EH1A 3OESA 3WX0A 2JCBA