2WD7B

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7B00
2EW2A 4IJVA 4H15A 4CQLB 4EGFA 1SOVA 2P68A 1H6DA 4YJDA 2YFQA 4O1MA 4UVIA 1M66A 2DM6A 2VOJA 2NU7A 2O4UX 4RDIA 3ZWAA 1Y8RB 1J5PA 4KMSA 1VKNA 3QWIA 4DLLA 1GPJA 3U49A 3HDJA 1HXHA 3ZI0A 4G5HA 1FF9A 4WLNA 2EJVA 3RJ9A 4LMPA 4D44A 4TWRA 1RM4A 4D43A 1LQTA 2D2IA 1KY5A 3DBHB 1A72A 1Z45A 1KY4A 1UDAA 3B20A 4OH1A 2FOIA 3H9JA 3D3EA 1D8AA 3UCFA 3I9LA 5IF3A 1JA9A 3O8QA 3I4FA 4TMFA 5B12A 4DVJA 3NAQA 3U9LA 1GD1O 2BH9A 2FZEA 1ZBQA 4IIUA 4XYEA 1Q1NA 3V8BA 1VL6A 1ISHA 3O26A 2WWRA 1Q0HA 4FSHA 2GSDA 4OMUA 3CKYA 4NU5A 5COAA 3E8XA 2ZJ0A 4DYVA 4BNJA 4AJNA 1JAXA 4O6VA 3HE3A 5DOVA 3D0OA 3OEWA 1MUUA 4DPLA 3IKVA 2Q99A 1JKFA 4NBWA 1LC3A 5T67A 3W1VA 3KSUA 3TZKA 4YXFA 1R0KA 1R15A 1X7DA 4KQXA 4WNCA 4W6ZA 1YQDA 1EQUA 3U62A 4D46A 2B5VA 2NTVA 3PZBA 4LISA 1FDUA 1YO6A 1WAMA 1HZJA 2D0IA 2NADA 3DTYA 5AXAA 1K2WA 1NASA 2BHLA 4J1SA 1O0SA 3IL2A 1E7MA 3PYXA 4LVCA 1A27A 4H3VA 3V2HA 3RKRA 1AGNA 2NVWA 1M67A 2VCYA 1B8VA 1S6YA 4Z6KA 4CMGA 2XAAA 4R5HA 2HK9A 4YRDA 4IJKA 3H5AA 1BHSA 2NWQA 3EUWA 2GN4A 5L4LA 1UDBA 2DFVA 3CUKA 3BMCB 3PHJA 2X9GA 3O38A 4TRNA 2YUTA 4WUVA 2IZ1A 4RVDA 1UUFA 3WLFA 1ZXLA 3S2GA 4L75A 4UVHA 2NACA 5JC1A 5GZ1A 1IHXA 4BO6A 1MXFA 3MJCA 3B1JA 4E2YA 5TLSA 1TXGA 4MPDA 4IXWA 5U4QA 5JAQA 3FR8A 3KYCB 1T26A 3GEMA 1TLTA 1I0ZA 3I9MA 2FY8A 1P9LA 4BGIA 4ZQFA 3F46A 1YOVB 4RJTA 3VZRA 4KUEA 4QECA 2HRBA 1IUKA 5TT1A 2EP7A 3PIDA 1LI4A 4ILKA 4YWJA 1EBUA 2Y05A 5A3VA 3E9NA 3DFUA 3VC7A 2EW8A 4ND1A 3H5NA 3UCXA 4IQGA 1U28A 3FWZA 4J9UE 5COQA 4BO2A 1ZXBA 4B8WA 4GLOA 1YGYA 5IN5A 5L3ZA 4IDGA 4CQMA 4MDHA 4FW8A 3SVTA 1C1DA 3PDUA 1FMCA 2ILTA 4NK4A 3WGTA 1P44A 2NLOA 4EBFA 4OGWA 3VZPA 4II2A 2V7PA 4D0RA 1ZNQO 1MXHA 4YJFB 1D1TA 3WYCA 3NGXA 5J23A 3UF0A 3INTA 3L4BA 5EPOA 4PLZA 1P33A 2X0RA 2D8AA 2LDBA 4KDFA 3RC2A 4IDCA 4CM7A 5L9AA 1SZJG 4XGNA 3V5NA 1R4MA 2V6BA 3JQ9A 4Q3CA 1BXGA 3QA9A 5DBIA 2P9EA 5AOVA 1PL7A 5CDYA 2JD1A 4A03A 1RWBA 3S2EA 1DC6A 2C2YA 4J1QA 3PHLA 1LNQA 3ITKA 1HDRA 3B6ZA 3GNSA 2AEJA 4NNJA 2G1UA 2OMEA 1E6EA 4WLFA 1CF2O 3UW3A 1VKOA 3PFWO 2RH8A 1PL8A 1UAGA 1Z7EA 3AOEC 1JDJA 2Y1GA 4C7KA 2ET6A 5DDIP 1NFFA 1GUZA 1CQIA 5B1YA 1GUFA 3INRA 4CM8A 3GZNA 2OXIA 3U4IA 4Y98A 1WVGA 1Z6ZA 1ZSVA 2A35A 2G82A 2GF2A 3AFNA 1HETA 4YA6A 4KWHA 3GQVA 3PVZA 5F21A 4BO0A 3ZDFA 4NDNE 5KJFA 4RLSA 4RQUA 3JTMA 5IDQA 2AEFA 5GMOA 3JQBC 3OM9A 1L7EA 2DVMA 1KC1A 1DIBA 3ZWNA 4PGFA 3P19A 1GCUA 2Z1NA 1BSVA 3ICCA 1K3TA 5A9SA 1E3IA 3EGOA 1UXKA 1HDXA 4NJOA 4Q39A 4MVJM 4ZJUA 2VNSA 3QSGA 1DRUA 2CUKA 2VRBA 2VYVD 3KEQA 1UP4A 4ALMA 3K2EA 1E5QA 1JN0A 2B35A 4O63O 2GERA 1DXYA 1UZLA 4AJ1A 4A7PA 3OQ6A 2OFPA 4KWIA 3Q9NA 2I5PO 1VSUA 4YPOA 4E2XA 1YRLA 2EJWA 4E2WA 3E5MA 3JYOA 4CMHA 4R9SA 1OOEA 4XDYA 2C0CA 4JIGA 2QRJA 2X22A 3BTUA 4NJMA 1BWSA 4UVEA 5L45A 3PWSA 1L1FA 3V2GA 4RV9A 3DOJA 5JO9A 4FC6A 3GN2A 2DTDA 4AJHA 4PRKA 2QZZA 1UAYA 4M1QA 2VYND 1H2HA 4N54A 2WDZA 3F5QA 1ADGA 3NJ8A 2Y93A 1XQ6A 4B4WA 1D1SA 5JC8A 5B4VA 5COBA 1SEPA 3ZU2A 3GVHA 4WOJA 4AFNA 2AA3A 4TKMA 2ZQYA 1P1HA 5HBRA 3W8FA 5KVVA 1CRWG 1MLDA 1KVTA 1VLLA 2GZ1A 2X9VA 3TJRA 3WYBA 4IPTA 3NJ4A 3WGOA 3PJGA 4ZQBA 4CM3A 2FWMX 1J4AA 2O3SA 4A5OA 1FDVA 3GEGA 5JSFA 1PGQA 2O3QA 1KOLA 1ZSNA 4YAGA 3VPHA 1IZ0A 4EW6A 3DOCA 3GVXA 1GL3A 3GH3A 1GYRA 2QHXA 2D4AA 5TT0A 4XEHA 4BGUA 3V1YA 3WFJA 3RUFA 1B8PA 4OXKA 2HMSA 5FI3A 5TJ9A 1RJWA 1EVJA 3E9MA 3UKOA 1HYEA 4UUPA 1I33A 2G5CA 3A06A 1XQ1A 5JPIA 3AUSA 1LRLA 3DTTA 1R4MB 1WDLA 3L4SO 3O9ZA 3AUAA 1DC4A 5CDTA 1N7HA 4BO5A 5TIIA 2H9IA 4E30A 1H94A 1I3KA 4FFLA 1DFGA 4BNIA 3KLMX 3PZRA 2B69A 2EP5A 8LDHA 2RBEA 2JJYA 1JTVA 2J8ZA 2UAGA 2YV2A 4WJZA 4GPD1 2Q49A 3AUTA 3U4CA 2X0IA 1E3JA 1SEVA 4ZGWA 1DDOA 1GQ2A 1ZH8A 3M6IA 4CV2A 3R3SA 1VPDA 4OKNA 4XCVA 5T64A 3OIGA 1P1FA 2VUTA 4IQ8A 1P74A 3MJEA 5ENDA 3MJSA 4BKPA 4CM8B 1AE1A 2OUIA 2EIHA 1C3VA 5JFOA 2P5YA 2V6GA 1A5ZA 1KEVA 1UZMA 3H2SA 2BF7A 5DP1A 3DZFA 3NDRA 4E3ZA 4LK3A 2RIRA 4NFHA 1NP3A 4F3YA 2D59A 4CM4A 3BMQA 4TRRA 1E3WA 2PGLA 2X23A 4PLPA 4GVXA 4N5MA 2Y1EA 1DC3A 4OM8A 4Q9NA 3Q2KA 1PJ2A 4FPXA 1E6UA 4M89A 4YBZA 4DBVO 1X7GA 2AQHA 4DIBA 2BFMA 1H2BA 5I9LA 2O3JA 2FSSA 5A5FA 3PJEA 4R16A 4XGIA 2IDZA 4RPLA 4BKOA 1SBYA 5JY6A 1P1RA 3DC2A 1QYWA 4RGBA 4ZQGA 2PD3A 4NH4A 1D4FA 4MIYA 4L4XA 5I9NA 4BV8A 3DQPA 4J49A 1DO8A 1V3VA 1ZJZA 3KSDO 4I5FA 4DQUA 1YBMA 1VM6A 3AU9A 1TA4A 5TGDA 2BMAA 4E31A 4WPGA 2CY0A 1BVRA 3F6YA 2IZ0A 4GWKA 4YJGA 5T6BA 3JQ7A 2X6TA 2VHWA 3RFVA 1JAYA 2GASA 3HJAA 4ZQEA 4E32A 2E49A 3FD8A 3HDQA 5ER6A 3RWBA 4AL4A 3JQGB 1T2DA 5BSEA 1IPFA 1KC3A 5KKCA 4A0SA 3FPLA 5TJHA 5ADHA 3PGJA 1MC5A 4MOWA 4ONEA 2C29D 3CH6A 2JCYA 4PLVA 4WKGA 4YT4A 1X1EA 3STHA 5DP2A 2AG8A 4BGVA 2B36A 1N5DA 3ROPA 2GZ3A 3OH8A 4YACA 1I32A 2AQIA 3QVWA 5DCWA 3V1TC 4FOOA 4I9UA 1NHWA 4XWYA 4A27A 4R3WA 5I8ZA 3NTQA 4R1TA 1PS9A 3ASVA 1T2AA 2QZ9A 5G4KB 1OMOA 4YVFA 2BI7A 3NEPX 3T4XA 3WX0A 2YZ7A 3L77A 1EFKA 4II3A 3JD4A 1JQBA 3KUXA 4BS9A 4BO3A 4GAEA 4GLLA 4D0SA 1LU9A 3TZ6A 2HK8A 3AK4A 3GHHA 4U8GA 2DU8A 4W9NA 2DUUA 4R54A 3GR6A 4ZU3A 3K31A 5CHEA 3S1LA 5ER9A 1CWUA 1NM5A 3F4LA 2X8LA 2EEZA 2GGSA 4FJ0A 4PZEA 3TL2A 3WGQA 3ZWCA 3OQBA 3WGGA 2EKQA 3ETGA 4BB6A 8ADHA 1DFIA 4FOSA 1R0LA 4MVJG 3GVIA 4CMAA 5LDGA 5A9TA 3N58A 4RL6A 5THKA 4RF3A 4J4BA 1M76A 1QV7A 4M54A 4UEJA 1A71A 1GCOA 1Y8RA 3SJUA 1V8BA 3HHPA 3D5TA 2Q1WA 1I2ZA 4RF5A 5ILGA 3HDHA 5A03A 3EVTA 1ZMOA 4XD2A 2WMDA 3GPDG 4H7PA 5JAMA 1E7QA 2DUWA 1ZMTA 3UOGA 3RQSA 4XIYA 3WR5A 2GDZA 3L0DA 3NKLA 1LUAA 1WPQA 5TNXA 2FHSA 3D1LA 4ZA2A 1WXDA 3DWFA 2J3IA 3MOGA 5DULA 5F1PA 3S55A 3DBHA 3WWYA 2AE2A 4NU6A 4DIFA 4L4SA 3T4EA 2PA3A 3PP8A 3SLKA 1I2CA 2HJSA 5L53A 1YDWA 4YAKA 1HLDA 1H6CA 3X2EA 3U0BA 1PJ3A 1G0NA 4CM1A 1FXSA 4DLBA 3JD1A 2IODA 1H9BA 2P4QA 3DFZA 4INAA 5DNAA 3ZH2A 5ICMA 4HP8A 1GV1A 3NTRA 4HFJA 4TZTA 5LC1A 3VPSA 5MGBA 1A9ZA 2PGJA 2DBVO 2YHIB 2EERA 3GMSA 5JMPA 3ZWWA 5TSDA 2J5KA 1CIVA 4BL5A 4DWVA 4IJWA 5A5EA 2A94A 5A9RA 5TF4A 2HSDA 2YDXA 3JQ9C 4WOKA 1ENYA 4F6LA 4DTIA 4UUMA 4FD3A 1VSVA 1X13A 2ZB7A 4CUJA 4J0FA 1ZK3A 4BKUA 4NFSA 4CV3A 1MP0A 1J49A 1DAOA 3CE6A 3ENKA 1EMDA 3OJOA 4TRJA 3R0IA 4YJGB 1B2LA 4BMNA 1VC2A 4RZIA 3N7UA 2B4RO 1ZK2A 3JSAA 5BNFA 3ULKA 2Y1FA 4CM6A 3JQDA 5ENVA 3IP1A 3JQCA 3GNQA 3NYWA 4OKIA 3FBGA 4BHTA 3UHAA 1BXZA 1RKXA 2O23A 2ZIZA 2VWGA 4D41A 2QYTA 1V3TA 1E77A 3QRWA 1EDOA 3WQRA 3RCBA 2AW5A 1LTHR 3WIEA 5JY1A 3HFGA 1EE2A 3E6AA 2ZCVA 3RROA 4DLAA 4KP7A 3BMCA 1Y1PA 5C7OO 3AUUA 1QG6A 3RC9A 1E1MA 1MV8A 4D3SA 1AXEA 1JWAB 2QRKA 3AI2A 3QW2A 3FNGA 3QE3A 4CMIB 2X7HA 4R4JA 4IZHA 1K6IA 5H83A 1H6BA 2VYNA 6LDHA 5JMWA 1YH3A 3GGGA 5HRUA 2W90A 3CINA 4L73A 1GEGA 4Z0TA 3TOZA 1EQ2A 3PHGA 1Y5RA 2NQ8A 3KYCA 4NBRA 2J6IA 3ETDA 3SC4A 3EDMA 1OFGA 4PG5A 1GDHA 3NGLA 1GQYA 3RIHA 1KYQA 4WNIA 3ZWMA 1YOVA 4CLOA 3DONA 2HMUA 1VL0A 7ADHA 3ONEA 1KVRA 5I7FA 4JBIA 1RYDA 2C54A 2VRCD 3GZ4A 3COSA 4E12A 2JCVA 3QIVA 1XLTA 1UXGA 4EJ0A 5CG1A 2Q1UA 3ONDA 1LDBA 3PJFA 1LDMA 1QYCA 3GHYA 4XRGA 1BDMA 1PTJA 1DIHA 3ADPA 1NAIA 4YQYA 3MZ0A 2CVQA 5JAZA 1BTOA 4J3FA 1IHYA 3CEAA 1DIRA 1X15A 4YCAA 3DZGA 4GX0A 1O8CA 3JQAD 2WYVA 3F1KA 3G1TA 2PK3A 4W7IA 4BO4A 5G0TA 2PKRA 1EVIA 3Q11A 5ICSA 3WGZA 4YJFA 3IS3A 1NAHA 4ND2A 4BNKA 1T2EA 3L9XA 4NG5A 2ZK7A 3VPXA 4E6PA 3GRPA 4NBVA 1PJBA 1EUZA 4BV9A 4R68A 1E5LA 1QYDA 2B37A 2UV8A 3DMYA 4XR4A 3OQ1A 2Y0DA 5GY7A 2QYSA 4J1TA 3FI9A 1PGOA 4R5MA 2FR0A 1QRRA 3FRJA 1NHGA 4CMKA 4XR9A 1UJMA 4FB5A 2ZYGA 3QQPA 3CZMA 4OO3A 4AJ2A 4D7AA 3GVPA 3FBTA 1N1EA 1FDSA 3TOXA 5FYDA 3LVFO 1I30A 3PPIA 3FNEA 2EKLA 3DO5A 1FDTA 5IDYA 4EUFA 4LVUA 2PTGA 4BNHA 4I5GA 1I3LA 4NMHA 1DSSG 2QRLA 3K2BA 1U8FO 3OJ0A 3K73O 4A26A 2Y68A 3LQFA 4GMGA 2FRDA 1TT5B 1MG0A 4GX5A 4BKRA 4Q3EA 2VN8A 3ETEA 4YJHB 1OZAA 4MKXA 4RVUA 3RC1A 5IXYA 4N7RA 2WD8A 3BZUA 4OQYA 1JLLA 1EK5A 3JYLA 1GUYA 1XSEA 2GR9A 1GPDG 5L4NA 5DCUA 5EQDA 4AJIA 4Q3AA 4M8SA 1NVTA 3C7CB 3PYLA 3ZWVA 1ZUD1 4WE3A 1AHIA 3PQDA 1UP6A 4BNYA 1PJLA 2ZB8A 4CL8A 2PLAA 3ZU3A 2BD0A 4W4TA 4CV0A 1LSSA 1H93A 1ZFNA 1Q7BA 3C7DB 3DMTA 3OJLA 1AXGA 4IUYA 5IG2A 3TWOA 4E5YA 2OOSA 4AJKA 3B1KA 1ZW1A 3LZ6A 5DBGA 1M2WA 1U1IA 4DPKA 4C7JA 4ID9A 5A04A 4B3IA 4R69A 1W6UA 2PFGA 3DBRB 4PLHA 3I9OA 2C07A 2WM3A 3H2ZA 4IMRA 4XIJA 2VOEA 3EC7A 4E33A 2GPTA 4HADA 4Y8VA 3PGXA 1IYZA 1P1IA 1U5CA 2YDYA 2YY7A 1XIVA 4XKJA 1DLJA 1N92A 4DQXA 2C5EA 5JLAA 1NYTA 4QFDA 3DHEA 3V2UA 3E5RA 2IYPA 4OIMA 4KUGA 4CLOB 1MG5A 4FDAA 1ZO8A 4S1VA 5JYDA 1CEQA 2OHXA 2CDAA 3ZN2A 4E2ZA 3EK2A 5I7VA 2OBNA 4JNKA 3W8DA 4DL9A 1DBVO 4YTEA 1KETA 4RVHA 2O4CA 2B4QA 1DAPA 1PJ4A 4A10A 4GVLA 4LSWA 2X0JA 1U2GA 3RU9A 3WQSB 2OGUA 4G81A 4XQ9A 3JD3A 4MP3A 1PZEA 3ICPA 5JBIA 2DT5A 3WJ7A 2NTNA 2VT2A 3MJVA 4IDBA 4H16A 4BKQA 2G76A 4M87A 2C20A 4QO7A 4R41A 2RHCA 2Y0EA 5CDUA 4WCFA 3MTJA 3DBVO 3C24A 2DKNA 4GGPA 3RBZA 1LSUA 1ZK0A 1PZFA 4I08A 1ISIA 1TVEA 4IMPA 4B4UA 3IJRA 3C1OA 1MA0A 5I7SA 5AXCA 4HXYA 1ZZEA 3TZQA 1NNUA 3NDJA 1NPYA 2EV9A 3BTSA 3RUHA 4I5DA 2UYYA 4RLHA 3K8ZA 3H9EO 1HDYA 4QT0A 3QVTA 1QYXA 2CVZA 4BQRA 4I5EA 4MJLA 2EGGA 4JQCA 2V65A 1MX3A 1WDMA 4BNNA 4F6CA 4YT2A 2Q4BA 2Y67A 4HBGA 5KOIA 1P0FA 1PX0A 1JU9A 3WIDA 2YJZA 1K0UA 4BIIA 5GZ6A 3RD5A 3OECA 5HTOA 3ZHBA 3GT0A 4W9NC 4B4OA 2PD6A 4JX8A 1KVUA 5FF9A 2RHRA 2OORA 4L0QA 3ZNOA 1MFZA 4UREA 1Y5MA 2DLDA 1FJHA 4EUHA 4BNFA 5JO0A 4X54A 4B3HA 5I8WA 5IFLA 3HZZA 3PWKA 1BG6A 4K1LA 4R1NA 2DPGA 3L6DA 3X2FA 1HE3A 2W2LD 2EGHA 2B5WA 3DZIA 5K6AA 4CODB 4FBGA 4R1UA 2E82A 2XXBA 4TRMA 1GU7A 3BA1A 5IAAA 4LCEA 5IN4A 4XYLA 2GD1O 4ZN6A 1LDYA 5K0ZA 1YKFA 2I65A 3ENNA 4GBJA 4XB1A 4IDDA 3ZCXA 2NVBA 4OXYA 1PGJA 5EL0A 3HADA 2NSDA 4ALLA 4Y9DA 3M2TA 3L07A 4HY3A 1RM5A 1QMGA 2PD4A 3WGHA 3FSRA 3RUIA 1CYDA 1U3VA 5LCXA 3GEDA 3GK3A 5CPFA 1PS8A 4BNTA 4BMSA 3WNVA 2YHUA 1LC0A 3CSDA 3GPIA 3WMXA 4QFCA 4IJUA 3GFBA 5TRTA 3WGYA 1PQWA 3BAZA 5EJ2A 1Z82A 1I01A 1ZCJA 4EJ6A 3IAHA 3ZNPA 4ZHSA 2J3KA 2DTXA 4FFMA 5F5NA 3RFXA 3VZQA 3C85A 1DLIA 1M75A 2RCYA 4K6FA 3QP9A 4HUJA 2BFPA 2E48A 2CDBA 3G0OA 3WDSA 2P9CA 3JQGA 3OIFA 3UVEA 4UUNA 1HSOA 1P1KA 2AE1A 1BDBA 4DC0A 5KNLA 2JAPA 1A7AA 3DEYX 2BFOA 3QV1A 5IDWA 1RM0A 4BNZA 2VHXA 4E5NA 1HKUA 1YQXA 3F3SA 1O94A 2X0NA 4BGEA 4LSMA 3D4OA 1FDWA 3BXXA 1JWBB 1EDZA 1EVYA 3JYPA 2J5RA 3S2FA 3K5PA 1SAYA 2P9GA 4CM9D 3E1KA 1DFHA 1IB6A 1E1LA 1U9JA 3WS7A 3AY6A 3BHIA 2PY6A 3RASA 4JP3A 5C5IA 3OJFA 3JQ8B 2VRCA 2H6EA 1PSDA 2UUPA 3NTOA 5G4KA 3PYMA 2WE7A 4WCFB 3H9QA 4PZDA 1GV0A 4Q3DA 4J1NA 4RVGA 1P0CA 1M6WA 1B3BA 5DBFA 5MDHA 1QR6A 4MIEA 3P5SA 5F1KA 3H7AA 3KYDA 1E7YA 3S8MA 1YXMA 3WBBA 4C4OA 1P77A 1E1KA 2GN8A 5JDIA 1C0PA 1HE2A 4RORA 1K5HA 2WTBA 1I8TA 5F5LA 2Q45A 3HB4X 2GO1A 4LW8A 4DQVA 4WEQA 3GAFA 1G6KA 4ZVVA 5CEJA 2X5KO 4XJTA 3ZW9A 5AQ1A 2D5AA 2GUGA 3RBXA 2Q1TA 3DZHA 4PFJA 2TMGA 4FCCA 1BXKA 1LDEA 4FS3A 1S7CA 4OSOA 4RQTA 2JFFA 3QVXA 4K9DA 1DJNA 3ZU4A 4BNXA 3DOOA 3AM4A 3GF4A 3BTOA 1C14A 4AJLA 4BO8A 1G0OA 1U3UA 1L7DA 2I3AA 2J3HA 3ZHYA 4EUEA 4MKRA 4MVJH 3D64A 4ZRNA 2A9FA 2BELA 2JKVA 4J7XA 4JLWA 3H8VA 3ZWOA 2IEBA 4D79A 4WK6A 3I9NA 3ZHXA 1IY8A 2B0JA 1XG5A 1EEHA 2Y1OA 4GKBA 5DN9A 1GZ3A 5G0UA 2IRWA 4Y6RA 3KM0A 4HNHA 1V3UA 3HSKA 3LLVA 5ITVA 1UR5A 4J91A 1P31A 3MJTA 2D5CA 4CPDA 5KVSA 5JS6A 2GYYA 3GGPA 4UVDA 2P4HX 3PFFA 4UEOA 4RPJA 3F4BA 4ALJA 1YONA 4B7CA 3VDRA 4TROA 3TZHA 2GCGA 2CF5A 3ZGYA 5JAIA 5A3JA 2YYYA 5KKAA 1P3DA 1XCBA 2YHIA 4FFRA 4CUZA 3JV7A 3K92A 5IJZA 1W8DA 5U9CA 2C5AA 4NQZA 3UXYA 1LLQA 4KDEA 3OF2A 4ZRMA 5EIOA 3C8MA 2HK7A 3AOGA 4GKVA 3VH2A 3NUGA 1V35A 3OA2A 3ZWBA 3JQFA 2JHGA 4MVJI 4Z9FA 5G0SA 1PS0A 1SMKA 4AJ4A 3GUYA 1AHHA 3IDSA 1EZ4A 1XGKA 1NR7A 1XDWA 4YQZA 1NVMB 2FP4A 1H6AA 4HFMA 1LLCA 1NTOA 1YQGA 3WMWA 3AW9A 3IUPA 4RVFA 1LQUA 3R6DA 3NRCA 4N5LA 3RU7A 1CETA 3EZYA 1I36A 1IL0A 2PH5A 2ZTMA 3T7CA 3OSUA 3DAGA 1ZKMA 2Y66A 4YAJA 3PIIA 4XGKA 1U4SA 2WYUA 3RUAA 2EXXA 4RZHA 1V6AA 1GZ6A 4I9NA 1B8UA 3PWZA 3GA0A 1KVQA 4NR0A 5JCXA 4D45A 4F45A 1R4NA 2J5QA 1F06A 3H5RA 4GSKA 4EEZA 3PI7A 3SBOA 4CLEA 4CMIA 3WLEA 2Q1SA 3NT4A 9LDTA 1T1SA 2GNAA 4XQCA 1ONPA 1W4ZA 3W4IA 4WLVA 3HN2A 2PZLA 4YYZA 2VQ3A 3RUCA 1I3NA 2CSUA 1N9GB 2VT3A 2W8ZA 1QYVA 1WZIA 2BGMA 2JHFA 4PLWA 3KO8A 2Y99A 1LJ8A 1T25A 1C0LA 3QVOA 4E5KA 1EVZA 1XA0A 3KYDB 2VUSA 5C7LO 4AVYA 5JYEA 2HU2A 2OZPA 5KWEA 2QG4A 4ZQHA 4ESOA 4QEDA 3I9JA 3HQ4O 4L8VA 3A1NA 3ANNA 3JQAB 4DMMA 3VZSA 3IUSA 5BT9A 1YL5A 4OOEA 1WWKA 2CD9A 4AJJA 3PHIA 5TX7A 4D3DA 3IIEA 4AICA 3VVBA 4U6QA 3TPCA 1B14A 5ILOA 4HNGA 5A02A 1X0XA 4TSKA 4OQZA 3W8EA 3AOEA 3ORFA 4IDEA 4EJMA 4YAIA 4DXHA 3LDHA 3O4RA 1DPGA 3WSWA 1PWXA 3OEYA 1KERA 4GMFA 4BB5A 3HN7A 2JFGA 4LMRA 2B83A 2EWMA 1YE3A 1EFLA 2E4AA 3ZWYA 4J90A 1KIFA 2H5LA 4YRAA 3Q1LA 3D3WB 2ZATA 1ZEMA 1WW8A 1PZGA 5T8KA 3ST7A 3TN7A 1B26A 1NQTA 2ZJ1A 2NUAA 1Z74A 1F14A 1YVEI 2D3TA 3QVSA 4FFOA 3AM5A 3JQBA 1B7GO 2IZZA 4CLRB 3TQHA 3ZWXA 1K89A 3U3XA 4TVBA 3BHJA 2W2LA 2V6FA 4Q3BA 1YL7A 1N7GA 5L95A 4DC1A 1IZ9A 2VNAA 3JQEA 5T5QA 1PQUA 1UXJA 1LBEA 1K6XA 5G0VA 5C3MA 1RYEA 4Z0PA 3L4BC 3FWNA 2PWZA 3AFMA 2OP0A 3BMNA 1W73A 3H65A 2FR1A 3L6EA 1SO8A 4QXMA 4IBOA 3JD0A 1YJQA 2Q3EA 2I3GA 3E9QA 2GN9A 4IS2A 1SB9A 4FQ8A 3LT2A 4I9HA 3I1JA 3I83A 1TT5A 1DIAA 1E7SA 3O03A 4WASA 4YJHA 1PJQA 2VYVA 1PWZA 1F12A 1JVSA 2CZCA 4OAQA 1CDOA 4TZKA 1KBZA 2OL4A 3DB2A 3SXPA 1BW9B 1Z75A 2E37A 3F5SA 4CLHA 3GN1A 7MDHA 2HRZA 1PJTA 4K26A 5U1PA 5EMHA 5AVOA 5FEUA 3UICA 4KTVE 5CAEA 2PH3A 3FNHA 2BKAA 3PDJA 1PL6A 5EERA 3GVCA 3DXFA 1J6UA 4P38A 3UH1A 4NZ9A 2HLPA 3S2IA 5KVCA 2UDPA 4CUKA 3MEQA 3G17A 1Y8QB 3RJ5A 1R4NB 1FK8A 2XPCA 4XX0A 3DBRA 2ZCUA 3K9QO 3LC7O 1C0IA 3ZHZA 3IMFA 4CLDA 1I24A 1C1XB 1U7HA 2FPIA 3RI3A 4BVAA 3FNFA 4NI5A 3FPCA 4XRRA 2F00A 1Z73A 1AUPA 1DRWA 3D4NA 4PG4A 1QP8A 1I5RA 1GEEA 3KEOA 3PJDA 3INGA 3NT2A 4PVCA 4CM9A 4L4RA 3ONFA 1QXSA 2X9NA 2VWQA 3LC2O 2FSVA 4XYBA 3GLQA 3OMLA 3GDGA 4BO7A 3I3OA 4WLEA 3WTBA 4AJOA 3KOUA 1PR9A 5BQFA 3QWHA 4BNWA 3R1IA 4JGBA 2GRAA 4GL4A 1SPXA 3Q3CA 4B4VA 3UN1A 1T4DA 4CMJA 2C59A 2DBQA 1OC2A 2NU6A 5CEEA 2XF8A 1TEHA 3D5QA 4JXKA 3OIDA 2DBZA 3I5MA 4OJNA 2HJRA 3OP4A 1KEPA 3QWFA 1UXHA 3LK7A 4LCJA 4BNUA 2Q2WA 4XQEA 3ZV4A 1E1NA 3DBLB 4R01A 2O2YA 2PV7A 3NV9A 3MJ4A 3SEFA 4E13A 3N74A 2VTDA 3Q2IA 5LDHA 5A4DA 5T57A 1U3WA 3KVOA 3WOHA 1ULSA 1EK6A 2HKIA 2BLLA 3JQ6A 1HE5A 2X5JO 3PHHA 4J2HA 4TQGA 2FR8A 1UH5A 1VL8A 1E7RA 3IQDB 5HS6A 3BMOA 1ORRA 5I9MA 2X86A 2Q2VA 2VZ0A 1NQAO 1E7WA 2QQ5A 2WD7B 3H4VA 4IQ0A 2PKQO 1LRKA 2I76A 3HFSA 5A1TA 3RUDA 4CJXA 1LRJA 3ROMA 3EYWA 1SOWA 3ZNQA 1EUCA 5L40A 1M6HA 1T24A 5BR7A 2YW9A 4R51A 3L9WA 5JDIC 3CIFA 3FTPA 3BMNB 3JYQA 4PIVA 2YV3A 1WDKA 1ADBA 5DZSA 1GZ4A 2W2KB 1O95A 5AXDA 4CMEA 1QORA 3I6QA 3GY0A 4R1SA 2HDHA 2R00A 1Y9AA 4UUOA 5DCYA 4Y6PA 4CLXA 4ROSA 2ZB4A 4ALNA 1MFPA 4J7CA 1HDOA 1OBFO 4QO8A 4J4TA 1LDGA 1YDEA 3Q9UA 1PZHA 2YV1A 2ZTUA 1KS9A 4N18A 4GH5A 4PG6A 4WLUA 5KVQA 1Z7BA 2PZKA 3WB9A 5C37A 5HWSA 1JKIA 3B70A 3Q0EA 4DREA 5BSFA 3WSVA 2DAPA 1HDCA 3MWDB 2AG5A 1PQPA 3LT1A 3M1AA 3KRTA 4EYEA 5B4TA 5C7IO 1D7OA 1HTBA 1A4IA 4ND3A 5DF1A 1HWYA 3JD2A 4RF4A 4R3NA 5K9ZA 1BRMA 2I6TA 4B79A 2ZTLA 3KLPX 1E92A 4OYRA 4M49A 2TMDA 1XR3A 3H6KA 4ND4A 9LDBA 4EEXA 1T2FA 1ZK1A 5IZ4A 2R2GA 2NVUB 1R66A 2UVDA 4WECA 1B16A 3AJRA 2V6MA 5TQVA 4BNVA 4EDFA 2PR2A 3FCOA 2Q46A 4S3MA 2F1KA 2X4GA 1DIGA 1PR3A 4QX6A 4EI2A 3AI3A 3AI1A 2Z5LA 1C0KA 2EKPA 5DOZA 3OICA 2Q50A 1ENZA 1PGNA 4PCVA 4XYGA 2HMWA 4QQRA 4P4NA 1ADCA 3A14A 3KSZO 4J9VA 3WXBA 4MP6A 1SB8A 5FWNA 1I3MA 2R6JA 3ROQA 2IE0A 4W82A 1DJQA 2G0TA 3H3FA 2VHVA 2WYWA 3ABIA 4DIOA 3DZKA 3Q6IA 3JQFC 4JJGA 4A73A 3U09A 4RCVA 4Z9XA 1AN9A 1NPTO 1SNYA 3HDYA 3SLGA 1BMDA 3EMKA 4JJIA 3W6UA 1UXIA 3DHYA 4GX1A 4KZPA 1QLHA 2ZB3A 3JQ8A 4EZBA 3K96A 1DEHA 5KIAA 4MVJF 5F1OA 2CFCA 4DMLA 1CQJA 1VE9A 4IDFA 3W6ZA 4PG7A 1TI7A 4JCOA 4GQAA 4MVJE 2UUOA 1E6WA 1PGPA 2PZMA 1VI2A 4MINA 1GYQA 1ISFA 1ADFA 1B0AA 1G1AA 1MB4A 3WG9A 1HE4A 4O59O 2CNBA 1WLYA 2EG9A 1PJCA 3BMOB 4RDHA 4A2CA 5G4LA 3NT5A 4MIOA 2WEKA 2Y1CA 3ASUA 3C1AA 2ZQZA 4GX2A 2HAEA 1XKQA 1R37A 4WEOA 3DAFA 4XZ3A 1NX6A 3W4KA 1R0SA 2D1YA 4J7UA 4GWGA 3I52A 4RF2A 4WGGA 1Y6JA 3AY7A 4XB2A 5HM8A 1GAEO 3E18A 4URFA 3ZWPA 3LF2A 3VPGA 4NIMA 3ZU5A 4YR9A 3FTNA 4QUKA 2C7VA 3U4DA 3MWEB 4O5OA 2NM0A 1HDGO 3HUDA 4M55A 1ZJYA 1ZVMA 1LEHA 1XELA 1U8XX 4IGEA 4BNMA 2Q4EA 3MTGA 3O8QB 4JJFA 1JKJA 1YL6A 3F47A 5JNLA 4W7HA 2O7SA 1E3SA 3DZJA 3ADOA 5TS3A 3PXXA 4NBTA 5HS4A 3CTMA 3RBVA 1ENOA 1NR1A 4ND5A 1Q0LA 4JBGA 5IZCA 3PK0A 3BYZA 3PTZA 3RKUA 2DQ4A 4OL9A 2VWPA 3RAJA 1ONOA 1U4OA 4AG3A 3TFQA 1QSGA 4ALKA 1X14A 5CDGA 5L4SA 3OETA 4NHEA 1VJTA 4PN3A 3GC6A 3TZCA 5T8KC 3ZZNA 2AQKA 1BVUA 2OO5A 4P8RA 3SJ7A 2NQTA 2ZYDA 5EQFA 2VHYA 4HKTA 3G1UA 5JCJD 4U5QA 1XEAA 2ZTVA 4Y67A 2POQX 4BMVA 4NBUA 4HFRA 3WGIA 1PJSA 1PIWA 1ZK4A 5JDCA 3TFOA 4NPCA 4FC7A 5KJEA 1WP4A 1UP7A 1NWCA 1HYHA 2VZ9A 4FJ1A 4MVJD 4CR8A 3GG2A 2BRUA 4DA9A 4G65A 3VTFA 3CPSA 4P22A 4JBHA 4BOYA 3KETA 4JN6B 4CMCA 3KBOA 5JW6A 1HDZA 2A92A 4B8ZA 3DL2A 2CDCA 2XXJA 1P1JA 4OHUA 4YDRA 2DPHA 3R3JA 1BGVA 4YT5A 2C82A 3VKVA 2HO5A 1XYGA 2QIOA 4LRTB 4LN1A 4KOAA 4Q3NA 5GZ3A 1KEWA 4IINA 1B15A 3HB5X 4QTZA 4M86A 4PLCA 2IYOA 3LT0A 3BTVA 3DDNA 4Z0HO 4D3FA 3EW7A 4I8XA 1EUDA 2LDXA 3DAPA 4ITUA 4IGFA 3VVCA 2GN6A 2ZKLA 3QWBA 5EESA 1LDNA 3QJ5A 4GI2A 1N9GA 4NK5A 1Y9EA 3VTZA 2WSBA 1HZZA 3B1FA 1U3TA 4O0LA 5G2OA 1ZIDA 1Y7TA 5L7YA 1T2CA 3VKUA 4CV1A 2P91A 1F17A 3KZVA 1U5AA 3PRJA 4HWKA 1HLPA 2VWHA 3KV3O 1JVBA 1NWHA 3BHMA 3JQAA 4IS3A 4K28A 4IIVA 1R16A 4HFNA 4CQMB 2HCTA 4J43A 3UCEA 3E03A 2Z95A 4D42A 1C1DB 1LA2A 3H9UA 1JW9B 1DOHA 4ZICA 5L51A 4HV4A 3LYLA 5KCZA 2Q2QA 3QY9A 3I4CA 3L6OO 4JP2A 6ADHA 5CG2A 2O2SA 3ZV6A 1E3EA 2QW8A 5BSGA 4BNGA 1ONNA 1DHTA 4FJ2A 3E82A 5EINA 2Z1MA 1GY8A 4IM7A 4XYMA 3DR3A 5KJ6A 3UFXA 1E3LA 1NQOA 1Q0QA 5I7EA 4AJEA 1BXGB 4GGOA 3D3WA 1A9YA 4K6CA 1NPDA 5CP8A 3RUEA 4Z3KA 4XJSA 5L7WA 3GDFA 1H9AA 4P4LA 5CDSA 3GUCA 1XU7A 4RPKA 2O3RA 4CLRA 3RSHA 2E6UX 3GFGA 3EY4A 1N8KA 3G3EA 2IXAA 4PLTA 1ISJA 5H81A 2GZ2A 4U0KA 1GR0A 4FFPA 5F3RA 1VJ0A 3IC5A 3ZNNA 1TT7A 1NVGA 3M1LA 3HWRA 3GZNB 4U0JA 4JROA 1WMAA 3HG7A 1VJ1A 3JYNA 4LGVA 3TDKA 2GLXA 3FN4A 2NTJA 3GOHA 1U7TA 4BNLA 3I23A 2I99A 4L74A 4RVSA 4BO1A 2CMDA 5JE8A 2FZWA 5A06A 1R12A 5L7TA 1YWGO 1DC5A 5KJ1A 3E48A 1R6DA 3C1TA 4L9RA 3ON5A 3ROKA 3D4PA 1XWFA 2DC1A 3P2OA 3EHEA 3BIOA 3F9IA 1CERA 3VPFA 4PZCA 1O9BA 4Z9YA 5A9SB 4CM5A 4PRLA 3WFIA 1H5QA 2DFDA 4BUCA 4AJPA 2RH4A 2ZYAA 4FGSA 1EE9A 3KXDA 1BW9A 3PEFA 4NFYA 5JXWA 2OP1A 2NNLD 1IULA 1TB4A 3PLNA 4DYDA 3A9WA 4FIZA 3PQFA 1HEUA 1KVSA 1VRWA 3TSCA 1T1RA 4CMBA 2PGDA 3EVNA 4CMEC 1UZNA 2BGKA 3UAGA 1ENPA 1U2DA 2R00C 1QV6A 4RO0A 4TKLA 2YFHA 1NQ5A 1YB5A 4I1IA 3VH3A 4MO2A 1IE3A 2RAFA 3GAZA 4ZD6A 3DHNA 1XU9A 3FF4A 3TNLA 2FN7A 3K30A 4MKZA 3UUWA 3I9KA 5AXBA 3A4VA 3C3XA 1Y8QA 2BI8A 4IXTA 4NJMB 4Z3DA 4E0BA 3K6JA 4HX5A 3G79A 2VZ8A 1YBAA 1GYPA 5CEFA 1N2SA 1V9LA 2Y0CA 2CF6A 1ARZA 3GMDA 2IXBA 3LF1A 3ITDA 1C1XA 1O89A 3VAZA 4TVOA 4PG8A 2DTEA 1Q7CA 1Q7GA 1LXCA 2G17A 2PZJA 3FHLA 2H1SA 2HMTA 1LSJA 3NX4A 1O6ZA 3CMCO 3WWZA 4U7WA 3TF5A 3G49A 2B4TO 2AQ8A 3DMTC 3LC1O 5KTKA 1V0JA 1GADO 2PKQP 2QX7A 4KQWA 3TRIA 2BFAA 1LX6A 4RPHA 1GTMA 3ZV3A 1ULUA 4P4GA 4J16A 1EBFA 3ZW8A 4MVJP 2VTEA 3V1UA 2XOXA 1YBVA 3RVDA 5HA5A 2FPGA 2P5UA 3DZBA 3QLJA 1E0DA 3AY3A 4R9RA 3WJAA 1T4BA 1QKIA 2O50A 1ISMA 1ISGA 1YB1A 5KJCA 4EITA 3RFTA 4CL3A 3OJEA 2HQ1A 2JAHA 2PNFA 2FMUA 1GFSA 3WBFA 5IDXA 1ZSYA 4KUHA 2AHRA 3EZLA 1X7HA 1HRDA 2Y1DA 3GNTA 5DT9A 3CXRA 4Y6SA 3DBLA 4E5MA 4UVGA 1IOLA 3IJPA 4CQMD 3C7AA 3LU1A 4YAEA 3FR7A 1OAAA 1OC4A 3A28A 5B4UA 4YRBA 5IXSA 4IZIA 3ZV5A 3M2PA 1RM3A 2JCXA 4FN4A 1RPNA 1Y81A 3P7MA 3VOSA 2VUUA 3QWAA 4CQLA 2AEMA 3AWDA 4F46A 1ZEJA 1WMBA 3OHSX 3GRKA 2SCUA 5CFZA 3IP3A 2WD7A 4BO9A 4KTTE 4WCFC 4B3JA 3TL3A 1PEDA 3VDQA 4OSPA 1NFRA 4XA8A 2P2SA 4ALIA 3H9GA 4QSMA 5H82A 1YS4A 4UULA 2A4KA 3LT4A 3P2YA 4E4YA 4OXNA 2HMVA 4L76A 3AU8A 4RPGA 3GDOA 2FPPA 2HUNA 4CR6A 3CZRA 1F8GA 3U4HA 4N5NA 4U6SA 2CVOA 4DGSA 4UEKA 2W2KA 1HT0A 3LLSA 5G0WA 4J0EA 3AM3A 1B3RA 4CM4B 3BMQB 3LSYA 3VH4A 1E3WB 1MC4A 2AMFA 2X1HA 3H3JA 2I66A 3VHRA 1HSZA 3EAGA 4IDAA 3JCZA 5BNIA 2VHZA 4YEDA 4JK3A 3WNQA 4OOFA 3WYEA 3HNPA 5B37A 5EN4A 4FFNA 3WQQA 5FI5A 4J2OA 4J4HA 1YB4A 2AXQA 3OFSA 1LLDA 1K6JA 3QHAA 4B7UA 4E21A 5JCJA 1LSOA 1SC6A 4BQPA 1IPEA 2X58A 2C7GA 5BSHA 1X1TA 3KB6A 1P45A 3D7LA 4IY1A 2O3UA 2IEDA 3IOYA 1HL3A 4UAGA 4DBZA 3W4JA 2NU8A 4J6FA 3ANMA 4FGWA 4YB8A 2O3TA 2I9PA 4PVDA 1HYGA 4MVJA 5K6AC 3ANLA 3SX2A 5THQA 2YQ5A 5CPBA 2OBYA 3U5TA 1KEUA 2NV6A 2JFHA 1ML3A 4DPMA 2X5OA 4MP8A 3UGKA 4YT8A 3JQ7B 2NVUA 4B7XA 5TC4A 3PLRA 2O48X 1DHRA 2JD2A 3WTCA 1I10A 3PQEA 5AYVA 1N1GA 2WE8A 3T7EA 5IZCC 1A7KA 2H63A 5FFFA 4CR7A 1CJCA 4PLGA 4DUPA 1DB3A 3I6IA 4G2NA 3CMMA 1H0KA 1NFQA 2NU9A 3MCVA 3F1LA 1I2BA 2O7QA 4XQGA 1NBOA 1GQQA 1W0CA 3NDIA 2EHDA 2WJPA 5A05A 2EF1A 2JL1A 2I67A 4WCDA 1X0VA 2DBRA 1PU2A 3MOIA 4DRYA 3SC6A 2YQ4A 1XHLA 1QLJA 2C2XA 4W99A 1SCUA 5BNTA 3KTDA 3GG9A 5ES3A 1YJ8A 2W98A 1J0XO 1D3AA 5JDCC 4XDZA 3GGOA 4FR5A 5ITWA 1O5IA 1LLUA 1WNTA 4GSLA 2JD0A 1HF3A 2BGLA 4WLOA 3KYBA 1ID1A 4LRSB 3RC7A 1OI7A 3WICA 3VH1A 2J3JA 1NXQA 1F8FA 1WZEA 3KHUA 4E5PA 1UDCA 1MGOA 2W4QA 3OBBA 4PLYA 1DRVA 1Q2XA 3OA0A 3IKTA 1F0YA 4PLFA 1A4UA
chains in the Genus database with same CATH superfamily
5F5XA 4EG1A 3LNCA 3RVJA 3ZHQA 5SZKB 3UJ8A 1RI5A 2P68A 3T4UA 3BFXA 3FMFA 1RBZA 1YTLA 1DXQA 3H11B 3F71A 4UHDA 4YJDA 3IBSA 5F35A 2DM6A 3BC1A 2I91A 4KLNA 2ZR7A 2LCIA 1SQGA 3EDRA 1SA0B 1CB7A 3ZWAA 3F97A 3AG6A 4FGZA 2IF2A 5A6SA 4OBBA 1J5PA 1G5HA 2SKCA 1CTQA 1DUIA 5CH8A 2XEXA 4DLLA 1S8FA 3N39C 4RH3A 1C3OA 3HDJA 5JAOA 3PGLA 3FMVA 4LK2A 1QKKA 4TWRA 1RM4A 4D43A 2W2MA 3TOSA 3ACCA 3OMXA 3FGOA 2Z9BA 4F9EA 2EF0A 4QBTA 1G7TA 1XRSB 3B20A 3OZVA 4NDAA 4RNCA 3NBQA 5JADA 5AM0A 3I9LA 5IF3A 4QYIB 1QOPB 4YYEA 3I4FA 5IARA 1BWPA 4DVJA 2JLRA 2FJ0A 5J2UA 1PVOA 4KQHA 4FGLA 1NBMD 1GD1O 5KKNB 2CLCX 1ZBQA 2HBYA 1Z16A 3ZQJA 1SVUA 1VL6A 4ZZ2A 3J7TA 2WWRA 3P45A 4REQA 2GSDA 1PL0A 1W581 3BWYA 3C3JA 3RTCA 2QDXA 3WDMA 3WK6A 4RCZA 4ARCA 1YDFA 2HFKA 3D0OA 3DUFB 5A4FS 3LXXA 4M99A 3T3EA 2Q99A 2FSIA 1NW6A 3FGPA 4C1BA 4D3ZA 3OFVA 4NBWA 4FR2A 4S05A 2GPJA 3CQ9A 4RMGA 3TZKA 4M9RA 3JZFA 1P5JA 1R0KA 3CJQA 3EGCA 5LLSA 1VLQA 3ELUA 1SBHA 2P6NA 3GELA 5BWBA 2VQDA 1GPYA 1IEVA 1TOAA 3SR3A 1THMA 3X0DA 4DIMA 1YQDA 3GLRA 2YWRA 4UU0A 1OXMA 2J9FB 3EDOA 1FQOA 4G4GA 1DWOA 4LISA 5FNVA 4ZVLA 3VR5A 2AK2A 2I6SA 2E6KA 1RWQA 2JH3A 1BZYA 2NADA 3G13A 3LA8A 4GI1A 5SZIA 1YR8A 3Q9LA 3SKXA 3VOAA 4HYQA 5A5GA 1G6Q1 1JP7A 2A1TS 4Y6GB 2G9RA 2EZ8A 2QD1A 3ND7A 3PYXA 4HB0A 4KRGA 3RKRA 1GGFA 1MOSA 5D7BA 1MH9A 3U48A 1Z0AA 1FL9A 5CUQA 3EX7C 3OCJA 4CMGA 2AN9A 5BRAA 2HK9A 1RI3A 2W58A 1O57A 2XIJA 4DDMA 2NWQA 4M46A 3AETA 3H4MA 5L4LA 1QPZA 2DFVA 5KQSA 1UJBA 2G70A 3BMCB 3CUKA 1ZKDA 5HF9A 4BRSA 1C50A 4MUMA 4IV5A 1ECBA 2V8BA 3PQ4A 1YAJA 3DO6A 4OHFA 1FJGB 2IZ1A 4PZYA 3AM1A 2I7DA 3WLFA 2EDAA 2I6QA 2PS9A 3NKFA 4UVHA 3SHWA 5GZ1A 4W63A 3MILA 1OB2A 2NTYC 1MXFA 3K09C 4Z4HA 4HQLA 1G1MA 1EX9A 4YO8A 2B8WA 2INGX 5U4QA 3ZBPA 4EJSC 3GEMA 1HT3A 1NJ5A 4I2VA 2J3MA 2FY8A 1P9LA 1PRYA 3AEQA 2UYOA 4CIYA 4ZQFA 2DH6A 1YOVB 3HJNA 3I0MA 4G36A 4J0CA 1CFJA 5JCPA 3E8SA 5AVWA 4QECA 2HRBA 1BWQA 3B6EA 3IFSA 4XFKA 1TD9A 2VJLA 2EP7A 1F6BA 2XZTA 4LHYA 1JVNA 3TD6A 3ZXUB 2YZKA 4BATA 1EBUA 1H4QA 1XRPA 4S1PA 3E9NA 3MLEA 4ER5A 3DFUA 3JAKA 2D2VA 3QHQA 1N2EA 4ND1A 5AMXA 3UCXA 3BMXA 3EQ2A 2IYSA 1YGPA 4C0HA 3O3NB 3OWOA 1J42A 2AK3A 3GRCA 3MOSA 5I4IA 3LL7A 3UJ6A 4B8WA 4GLOA 2OBXA 1CQPA 2GETA 2N47A 1J8YF 4M9QA 5CCDA 4AKSA 1VE7A 3AX6A 5BPFA 2FOXA 1RE1A 2BR4A 2C9CA 3JRNA 4IDGA 2R4UA 4CQMA 5KWIA 2D1FA 5F51A 1VMDA 4UM9B 1E6LA 5F9HA 2ILTA 1RBMA 4DCUA 4KCGA 1KI9A 4EKEA 4IGIA 4JR0A 3L8CA 4QUDA 5E8JA 4EBFA 4XUGB 5FB3A 1L6RA 2XMCA 1U8CB 2V7PA 1JG1A 4II2A 1MXHA 4YJFB 1D1TA 3M9WA 3WYCA 3SF8A 4E5UA 4JLPA 1T1GA 3UF0A 1XMQB 2GCOB 1T4MA 2ZZMA 2Z2IA 1L4FA 4KNYA 4KDFA 4PPYA 3RC2A 2FX3A 1SUFA 4QE3A 4EGSA 3UAYA 2ZU0C 5DW0A 4BYGA 1RZVA 3CONA 2FA9A 4DCSA 5L9AA 2FG5A 1CNMA 1UBKS 4GRIA 5ADUS 2OGWA 4WGFA 1R4MA 2V6BA 2VEDA 3M4ZA 1KAEA 1XZLA 4O3FA 3QA9A 5EHIA 4CF6A 3CEPB 5AOVA 5CDYA 4LZWA 2JD1A 1KP3A 1Z6QA 4KYUA 3S2EA 3KTAA 4A1OA 1TK2A 4FHGA 4J1QA 3N2KA 3D7SA 3U60B 3PHLA 2BTOA 4G4JA 1MO2A 1B8NA 4HDMB 4RIHA 4EYOA 1G7SA 5DLYA 4C88A 1DVRA 2G1UA 4JODA 4O4LA 3W79A 4Y9UA 3WKBA 3PFWO 3IULA 4ES6A 1EXWA 4DDUA 3C98A 1UAGA 5ECDA 4CQNA 1QIFA 4G1VA 1L8AA 3DBIA 3IQGX 4KNWA 1XPOA 1RR6A 1TW3A 1NVWQ 4G23A 3I5AA 4EI9A 1GUFA 1PYOA 3INRA 3PFNA 4E09A 3GZNA 5JSHA 1CJBA 2F1HA 2G0NA 1KU0A 3E7XA 3CH7A 4GLFA 4HS9A 4NCIA 3IDFA 3KR9A 1L5SA 1ZSVA 4MI9A 3UT6A 4ZDKA 3OIYA 5A3RA 3LYHA 3UJNA 2GFIA 5JJLA 2K2QB 4KWHA 1N8TA 4YA6A 2OE2A 4CF5A 1QLWA 4I1SA 4NZOA 2C5GA 3RC3A 3H9BA 5C1OA 4JIMA 4DXAA 1L5ZA 5A5DA 5KJFA 1W88B 1FTNA 1LV7A 5J4YA 2O6LA 2V7XA 2J6CA 3B2EA 1L7EA 2DVMA 2PM8A 2ORVA 4YRCA 2V9ZA 3VNAA 3ZWNA 4Z8XA 5JV5A 3AZOA 1W9HA 1BSVA 3T1NA 3TK1A 2FDRA 1BX0A 3ICCA 5EGSA 5A9SA 1E3IA 2WJIA 3EGOA 1GOTA 3CGGA 3C6YA 1UDRA 1DX9A 3CRNA 4NYIR 1MQ9A 2JVKA 4EYSA 4F4UA 1L4UA 2F1OA 2VNSA 4LYGA 4ZJUA 3C3YA 4O5AA 1QVWA 3U81A 2VYVD 5DRTA 4ALMA 3FFXA 1UP4A 3FKQA 3RODA 3K2EA 2ATXA 4FT4A 4LF4B 3AR9A 3KJIA 3N8IA 4O63O 3ZOZA 3BBLA 1DXYA 1UZLA 2OV4A 1WUTA 2ZG6A 1FDIA 3P2JA 3A9VA 4A7PA 4ETWA 4K0KB 1E32A 1LQ2A 5FP0A 5KOHB 2QOEA 3GRRA 3GT7A 3GLIE 1FPMA 1VSUA 1JX6A 5FPPA 5D5PA 5J59A 4G8DA 2FSFA 4CMHA 3BRWD 1FBNA 1G21E 4QLAA 4R9SA 4XDYA 4PQFA 1XI2A 1XTUA 2C0CA 4JIGA 5DYTA 1YR7A 5H02A 1ZZGA 1DAKA 1JJIA 1L1FA 2BGRA 2FNAA 2YZMA 4FC6A 5EVJA 1QB7A 1CUIA 1HEIA 3SOPA 1HA3A 1US8A 2QL5A 3QYJA 3EGWA 4QSHA 1EGQA 1WSDA 1GNSA 1NVVR 3H97A 2PU5A 3HJCA 4WRRA 4JI4B 4KPUA 2DWUA 2VF5X 3BK7A 4YWHA 4R8VA 3U4AA 4EKGA 5HRAA 4HQ0A 3BSFA 4LXXA 4RMHA 2YYZA 1QZXA 2WDZA 3NJ8A 1P2TA 2XUAA 2Y93A 1AIPA 1PG2A 3AR2A 3CX3A 3H2JA 3IT2A 4CKCB 5B4VA 1N2CE 4DG8A 3ZU2A 3A7EA 1MJGA 3BIXA 2ZR8A 4C3VA 1W5SA 3W8FA 3SQWA 1MLDA 4MI1A 4BLQA 3S1AB 4IPTA 2QNBA 2I2WA 2IYQA 2XWJI 3NJ4A 4I4CA 3SEZA 2PX6A 1LPNA 2X8AA 3KKKA 3MMPA 4ZQBA 4CM3A 3TIVA 2ON6A 4OGLA 4PAWA 4A5OA 2DKOA 1FDVA 2PS0A 4QDOA 4S1NA 3ZWQA 1ECLA 4I14A 5CVTA 1X8JA 4PYQA 2O3QA 4W1SA 1ZSNA 3ZCQA 4RFSA 4I3HA 1IZ0A 1T2VA 3VPHA 3DOCA 1GL3A 4R05A 3DB1A 3GH3A 3HA5A 4PQGA 3SK0A 2JGAA 3I92A 1VRCA 3Q6NA 3WIVA 3NPAA 3PDIA 1WULS 3V1YA 5C8YB 3S99A 2JK1A 2CJYA 2HMSA 1U1EA 1RJWA 2B98A 3VR4H 3E9MA 2HF8A 2B20A 3SC2B 5TDHA 2ZWAA 3HKDB 1F7UA 1I33A 2G5CA 3A06A 3HCOA 3G9UA 1B43A 4MLCA 4L5CA 4QEKA 3T9DA 2KMLA 1UKEA 2R4TA 2VPYA 4CG2A 1WDLA 1PDOA 2E18A 2FW9A 3AUAA 2HCJB 2X5XA 4TZ6A 2HJWA 2H9IA 1YZUA 3FCEA 3TNJA 1T6NA 1I3KA 1T43A 3BXZA 2ZBRA 3MYRA 4KZKA 3ICQB 2IPOA 2GWRA 2EP5A 1Z2OX 3D8RA 4W5HA 3RVKA 1FBTA 3ASYA 4P08A 4EO7A 2OWDA 2IDJA 5DGTA 3W2TA 5C0OE 3U4CA 1RXCA 4GPTA 1A98A 3T4PA 2JLZA 4P7JA 1XZPA 3OZSA 1PFGA 1P5FA 3M6IA 2W6CX 3L8EA 2HSGA 3TDNA 1VPDA 4CV2A 2P8SA 4MB6A 3CUTA 4XCVA 3OU7A 2G1AA 3V46A 5BYBA 4IQ8A 3DH0A 3D7NA 1P74A 1OI4A 2I29A 2VL7A 3LQYA 1WCIB 3NV7A 4L1KA 5IJ0B 4ZK6A 1RCTE 1O96B 2V6GA 2I1WA 2A14A 4YCJA 1KRHA 1VA5A 4F7WA 3NFYA 4AZ3A 5ICEA 2FWJA 2V9CA 4E3ZA 3T9BA 2RD2A 1UBCA 3UXHA 1NP3A 2DFLA 2NYRA 2ATEA 3E2PA 2PWBA 1XEXA 4CM4A 4QJ3A 2AWNA 4TRRA 3LQ4A 2BYTA 1YE8A 2X23A 3ZVNA 3TNDA 2FEMA 3PFBA 3RJTA 3CLRD 1K68A 1NMSA 1F9AA 3KKQA 5C8YF 1K2VN 1GTJ1 2VQ6A 2Z83A 1Q1AA 3CW9A 3E3LA 3LOUA 4LE1A 4W8OA 4DLRA 1E6UA 4M89A 5GVSA 4JUFA 2WMNB 2HR1A 1KDPA 2HSEA 1E3TA 1T10A 4B3CA 1BJKA 3ZKAA 1H2BA 3C14C 4L5JA 4EZIA 4X8HA 1OWMA 3NANA 3SQOA 3VR6D 3MN1A 4H1WA 3W7VA 1ZLYA 3IAEA 5CVDA 4MS3A 1F8UA 4E07A 1BMFA 2PD3A 1HLFA 4QOSA 4JBXA 3VO8A 5A4JA 4MIYA 5TPWA 1E8NA 4RTMA 3DQPA 3ONVA 2B94A 2I8AA 4TLMB 3S68A 3JZAA 5LWHA 4DQUA 4EL0A 1E9VA 1ZD4A 1E1CA 1UWVA 1QIJA 1VM6A 3OLXA 4DADA 3AHDA 4RIEA 4D8WA 1WD5A 2B9EA 4GOKA 4L2IB 5BUCA 1OFUA 5JTTA 2IZ0A 1Y3FE 3AONB 3GLVA 1CY0A 4TLAA 2FLVA 2B2XA 4H7JA 4HDCA 1TLFA 3E22B 3HJAA 4ZQEA 1FNSA 1UBGA 3LW7A 4E32A 5LOVA 3HDQA 4P7GA 2VYCA 3HJUA 1QQBA 5JSUA 1N25A 5FV4A 1KC3A 2YWCA 5JNSA 5TB5A 5TJHA 3C3BA 5ADHA 4HGQA 2XNDD 4DM3A 5BXQC 3CM0A 1CKEA 2EZ9A 4PBSA 3KQYA 5CU7A 2I62A 2JIZD 4GP9A 5AHRA 1O0BA 3TTVA 4BZQA 1IUOA 1CRLA 1FFXA 3E3AA 2MR6A 3UPUA 4Q9AA 2H1CA 3AHEA 2ZIFA 2B36A 1R8JA 2FUG1 1OHHA 2FP3A 4PSDA 5HCUA 3OZGA 3T61A 4DCJA 4F3NA 3MB5A 3H8WA 1Z08A 2PSEA 3O7WA 1L4KA 4I4TA 4YCNA 1GPNA 3AINA 2GZMA 3OCZA 3HB7A 1REQA 4R3WA 2H3EA 2J9XB 4RZSA 4TLEA 3MS4A 4QWWA 4R1TA 3ASVA 2JHPA 2AMVA 4S04A 4YXWD 4RA9B 4B71A 3Q8XB 3K0SA 3T4XA 3WX0A 1BFUA 1EFKA 2ZUEA 2FG6C 5TMPA 2Q41A 1JQBA 3LLCA 3THXB 4BS9A 1U6KA 1C8LA 2P9TA 4BV3A 2HK8A 4XPIA 5BUZA 3AK4A 4XUDA 3AP1A 4HZGA 3X1KA 2Q6IA 1WVIA 4NNPA 4R54A 2MSEB 2V4MA 2EP8A 3S1LA 1TADA 3RBAA 2PWYA 1XNGA 1NM5A 2YH2A 3EXHA 3IKMB 1ITZA 2A5LA 2GGSA 4FJ0A 4NYJQ 4RA6A 3OM0A 1UCFA 4HG2A 2Q6TA 2WNIA 3U80A 2BN4A 3EH1A 4F2PA 1K66A 4RULA 2I3ZA 4M1OA 1U02A 3C48A 4MVJG 2XCQA 5LDGA 3N58A 1G8KA 3UMGA 4RD4A 2MSDB 3R5JA 5CNMA 4RF3A 3IP7A 2AOUA 4B44A 4D9CA 2TECE 1CQWA 4O2LA 4LWQA 4XD7A 5GJVC 3WK5A 4R0VA 2IL1A 3LUBA 4MIKA 4ZPJA 2JGIA 1NVBA 2PTHA 3W3AH 4X71A 4EX7A 4EFMA 4KACA 2JAQA 3BIJA 1DKUA 4I6GA 4ENPA 4H7PA 5JAMA 4YUZA 3OX3A 1PBTA 4A16A 1ZMTA 3HPQA 3RVPA 5KYXB 2CV1A 2HO4A 3L0DA 2JCGA 1M1YA 4CCSA 1AQUA 3MTQA 1WOMA 3D81A 4F8JA 4X1YB 2A9VA 4C04A 4CEHB 3LECA 1T8PA 3ZUGA 4YRLA 4KR0A 1U3FA 3ABRB 3O0TA 4JJ8A 3T4EA 2PA3A 3L40A 3PP8A 4MYUA 3ZS9A 1E5DA 5ARBA 2YKGA 4LHXA 4FI3C 1Y8CA 2XD9A 3I3SR 4QU0A 4V38A 4HGYA 4RX1A 3U0BA 4DG5A 5EJ8A 4I1YA 5LMUB 1Q77A 1XZBA 2YR0A 3U4GA 3T15A 3HBMA 3N76A 3K1AB 4JS0A 2QY6A 1CZNA 4NY1A 4Y0NA 3L5OA 1J0AA 3QUQA 2C7OA 2Z3WA 6REQB 5LP6B 5MGBA 2V0GA 1E2IA 2DBVO 2YHIB 4D9BA 3A27A 1USVA 3KQMA 2YUIA 2J5KA 4BDSA 1AURA 2C9MA 3EFOA 1T9AA 4DWVA 3ZDZB 2HWWA 3DYVA 3LUJA 1XRLA 1JI0A 4H9GA 2HSDA 3G23A 1QG2A 1JGTA 1H2XA 2A3NA 2QR2A 4WOKA 4C06A 4F6LA 2OOKA 4QOFA 2NP7A 4UUMA 4NEQA 3AERA 2DQKA 1OAOA 2EC5A 2N46A 3B5EA 1FRVA 4KKVA 4KHZA 1XZ8A 2X8JB 3E70C 1S2MA 1UWCA 2GA9A 4NFSA 1MNQA 4TLLB 4BKUA 5JRDS 3CE6A 4TRJA 4XLTA 1Y7HA 3R0IA 4MWTA 4YJGB 4ZO8A 1DTEA 4ZV9A 2OXCA 3G2OA 1GHTA 3K0EA 3N7UA 3PD0A 1PP4A 1IK6A 3MXTA 4GHWA 3QMVA 4HQNA 4AO6A 5DNUA 1HFKA 3S29A 2JJQA 4PZPA 5LDDC 4LJYA 1N78A 3IP1A 3NYWA 3FBGA 1T2UA 2E85A 1BXZA 1JECA 4KFSA 5FI0B 4BHTA 1L8LA 2YXPX 2OSVA 1FU8A 2R2AA 2WWTA 4ENSA 3NMUF 1SK8A 3WQRA 2HEGA 4QDZA 2AW5A 2R62A 1RLOA 2WHYA 4QGAA 2FW6A 2CJWA 2HGSA 3WIEA 1KWGA 1EE2A 2PH7A 4X63A 5E3JA 3KQLA 4FHZA 2ZCVA 2FZLA 4KP7A 4MGIR 3RC9A 3GPCA 1RS0A 4D3SA 1SN7A 2O59A 4X1IA 2COKA 3FNGA 3QE3A 5IT9A 4KFCA 3T1VA 1P5RA 2WQZA 1PNOA 4ZOLA 3GH1A 5LP6F 4BP8A 1UPXA 1XUOA 2KHZA 1GNQA 2CUNA 1UKYA 3EDCA 3KZOA 5FLYA 1V1JA 1UWKA 4HDRB 5JFGA 4Q4AA 3TOZA 3CVXA 4HWTA 1EQ2A 1PQYA 2E4ZA 2GJ9A 2GNPA 3KYCA 4W5TA 4NBRA 4UZFA 1EK1A 3V00A 1YR6A 1FZQA 2QTWB 1MJGM 5TQ0A 3IQZA 2IUSA 5I4BA 2QR5A 3CSUA 4H0CA 1CUUA 2SKDA 1OFVA 4HWSA 4A6PA 4ZV7A 2HMUA 1VL0A 2O54A 1LD3A 1TO6A 3LW8A 5I7FA 1FZTA 1RYDA 3RK1A 2CYAA 2WAAA 4R2WA 2C77A 2QPTA 2YWDA 4QODA 3HCEA 2HSZA 3PSAA 1XMSA 2X8BA 3QJYA 4GQBA 3NETA 3ONDA 2YQZA 4EJ0A 3PJFA 2PGOA 1LDMA 1QYCA 1A2OA 1H5UA 3ROXA 4LBZA 3WBKA 1BDMA 3ADPA 1DIHA 3K2QA 1P1BA 1EAYA 4MLZA 3FB4A 4YQYA 2QB5A 4KMMA 3QVUA 1IHYA 3CEAA 4K3VA 2PUGA 3ICVA 1DIRA 1KE1A 1DG3A 2W6OA 1OUMA 4ZEVA 1OZ0A 1MB3A 1X1SA 3F1KA 2G9VA 2PK3A 4W7IA 2PUDA 2JFVA 3V3TA 1N75A 3WGZA 4RLFA 4QVIA 4B76A 4MITA 5DM1A 4H17A 3TM5A 4BNKA 1ADJA 1GZDA 1T2EA 1XJWA 4RFLA 2DLNA 3L9XA 2EQAA 4V2UA 1L3IA 4IEFB 4NBVA 3C3CA 1QYDA 5CVCA 2B37A 3QMMA 4UUQA 1CSEE 1VJGA 2IOHA 4O4JA 5GY7A 4S12A 4R5MA 2FR0A 3SKYA 1MHPA 1UJMA 3QFFA 5EIBD 2R1TB 3RR2A 4FB5A 5L3QA 3QQPA 4J07A 4M9XA 3I28A 4RUKA 3CZMA 1KDYA 4OO3A 1SPBS 1XTRA 2QE7D 1CUJA 3DLTA 3IDAA 4FK8A 4FFVA 5LSAA 1INLA 2ID8A 1P8JA 3JALB 3GVPA 3JX9A 1FSGA 4MMZB 5AJVB 3LVFO 5KMGB 1IN6A 1I30A 1RQ2A 3MWFA 3MT7A 3R5FA 4ESHA 3B3FA 3IQFA 4JJAA 1F51E 4ZCLA 3HVRA 1JJAA 4X92A 4CU2A 5CA1A 1R0WA 2Q5QA 2QZSA 4N03A 3TGLA 3HCRA 1LS1A 1Z47A 2RKOA 3V55A 4UCFA 4JI1B 2F9MA 4I5GA 5KQLA 1PG5A 2ZIXB 3BB4A 4L95C 4KXYA 5E4YA 1UPFA 2GEJA 2QRLA 4H4EA 5A5VA 5KDOA 4FVTA 4UBLA 1EG7A 3OJ0A 3LC0A 4BNDB 4TT8A 2OHOA 4BQOA 4QULA 2WWFA 3LQFA 3RYIB 3WVNA 4DBLC 4GMGA 3JWHA 1NZJA 1VHLA 2FRDA 4IFBA 3S2ZA 3WRXC 4GX5A 4BASA 2XDAA 3P4XA 5JVDB 4Q3EA 1UBEA 4RV4A 1NR5A 1N2CA 2P6MA 1XF9A 4L08A 4RVUA 2Y77A 1KFCB 3RC1A 5IC4A 2RK6A 1JLLA 3JYLA 1ZGGA 2WIGA 3AGQA 3DOEA 3QOXA 1EK2A 4EUSA 3SSMA 3ESXA 3KDPA 4AJIA 4MGHA 2OM6A 1QUEA 1SZPA 3PYLA 4WE3A 1CZRA 3PQDA 5J63A 4B75A 2JGNA 3OHPA 4BNYA 2ZB8A 4EB6B 3UJPA 7REQA 1E0KA 1KL7A 3F49S 3OPMA 4DZRA 5M7EA 5IKMA 3TQCA 2EBFX 5DNYB 4W4TA 1L5KA 4X66B 3DMTA 3HSYA 3QBTA 3TTUA 1YZKA 4IUYA 1NMYA 2LIPA 4IHQA 2XOKA 3VYSB 4KR2A 3R0XA 5DBGA 2ZBPA 4C7JA 5SZHB 1LBTA 3EBLA 4R69A 5HZGA 2DR0A 3WK8A 1DNPA 4PLHA 2FPOA 2C07A 3LUHA 1Z22A 4GKJB 1ZM7A 2FXIA 4E33A 4AZ0B 4Q9LA 2ZS7A 4LRXA 1V11A 3LRTA 3CFYA 4R1MA 4Y8VA 2NV2B 4O4IB 1G66A 1OXBB 1P1IA 1U5CA 3L0OA 3QE0A 4JX9A 3C5VA 4P35A 1IN8A 4MXDA 1XIVA 3NTVA 5TPZA 5CDHA 4LQDA 2XDYA 4A6DA 1DLJA 1N92A 2ZUUA 2C5EA 3BDIA 3BGDA 1NYTA 4U9HS 5EJIA 1E9DA 4N47A 3DHEA 1U9IC 1MO4A 2ZUDA 3C5HA 1EZ1A 1E3DA 2DFTA 1T2NA 2QJFA 5DYIA 2QD4A 4KUGA 4AYTA 3ZQKA 2HXGA 3QNUA 4FDAA 1ZO8A 5DNVA 2JG3A 1CEQA 3CHYA 5JVDF 1OT5A 3PE6A 4QPJC 1GT6A 4NBKA 5EIFA 1RADA 4F86A 2VK4A 4G0XA 2O0JA 1DG1G 4UM7A 2Q5OA 2VH2A 1MB2A 2O4CA 1V25A 1DAPA 1PJ4A 2RHGB 4UXHA 1RE0A 3K16A 4A10A 4XWOA 2C7PA 3NAZA 1QGZA 2BC9A 1GLGA 1K86A 3PKZA 1CBUA 1PT7A 4G63A 2Q9BA 2OGUA 4XQ9A 3RHZA 1AZLA 1FXUA 3UK2A 2C98A 3JD3A 3N6XA 1PZEA 3ICPA 1WHSA 5AW7A 1VIMA 2DT5A 2H2IA 2P9ZA 3D8TA 3FYSA 4GZ5A 3ZX4A 3I73A 3EPLA 5MN4A 4XGRA 1P7PA 4QTUB 1NRXA 2HK6A 2ZJYA 2Y0EA 1NI5A 4WCFA 4UPEA 1DCMA 3MTJA 5CDUA 4HQKA 1LSUA 4RJLA 3RRNA 1Y3AA 3SM9A 1KJWA 4TLBA 5LBUA 3OT4A 1TVEA 4Y1RB 4B3BA 3K70B 3JASA 3IJRA 4G9GA 1MA0A 3DVLA 3PGVA 4BE4A 1GNVA 3C4VA 3IDZA 1NNUA 3ZD9A 3BTSA 4PNPA 2UYYA 1NURA 1CVRA 4RLHA 4XWTA 3RAGA 3FAZA 4QT0A 4E46A 5DASA 1JHMA 1APBA 4R1QA 1XTBA 4RZ3A 1EP9A 2WU0A 4O4IF 2A84A 1RP7A 1VI5A 1PUJA 3EMDA 3NRJA 3UG6A 1JIKA 3RSOA 4MJLA 4PSCA 4V0LA 1FX1A 2B6HA 2BEVA 2P1DA 2XYPA 1WSAA 1ZUHA 2V65A 4E4TA 1TCCA 3U16A 5LQAA 1ZQ9A 3DW3X 2WMYA 3O3OB 3T0GA 1Y82A 1EA7A 4X20B 2OG2A 2Q9AA 3ZD8A 5JXGA 1A7JA 1RPTA 3EN0A 1LVUA 2PLWA 5DGDA 4MR8B 4DM4A 1K0UA 1AZSC 1AOXA 1COZA 1OILA 1W1UA 1VZ2A 2GDJA 4Q7MB 4XIGS 4ENTA 1XPUA 3P0RA 2ZUVA 4JVLA 1C41A 4FTWA 4NP6A 1RC1A 1KBOA 3UPDA 3NC4A 3LUKA 4CF3A 1AUXA 2RHRA 3DLCA 3AKCA 2Y8EA 4MYHA 4UREA 4EUHA 1ZY2A 1NM5C 3EXHC 3R5XA 3PRKE 4X54A 5D7NA 3T9FA 4B3HA 5LJLA 1B73A 3OPYA 3VZCA 1BG6A 3X2FA 3LBIA 5JU6A 1HE3A 1JH8A 5D2CA 5EZSA 1PK8A 4FM9A 1YDMA 4L6AA 4CODB 1BJTA 4FBGA 5IAAA 2XXBA 5KYUB 3DDSA 2OQVA 1U8UA 1NBHA 1E79D 1ABFA 5AJWA 5EA2A 3HU1A 1CCWA 2W2NA 4H27A 4TL9A 3IGFA 1G5PA 2B8NA 2H4HA 4OAPA 2FF7A 3FUWA 3GJRA 3ZCXA 5LQUA 4OXYA 4YHBA 2CNWA 7YASA 1DAEA 5BW6B 4BCDA 1USUA 2GAAA 5HOQA 1U5BA 2NSDA 1P4RA 2YRXA 1TVKB 4QATA 3VJMA 3ADBA 1WUJS 3MMXA 2NPIA 3QPBA 3SEAA 2J5BA 3DOHA 2VTBB 1JMVA 2V7GA 1FP4A 2Z2XA 4PPGA 4C7VA 2KE5A 2C1EA 5LCXA 3SDSA 2WPDA 3GK3A 3JWGA 5CPFA 2IVZA 2ZBQA 4M1KA 4PE5B 4BNTA 3WNVA 1RNLA 2NYVA 2R7MA 2GXUA 4NZZA 2IX3A 4AUKA 3MYYA 2M32A 1XN4A 3WGYA 3IIIA 2QYOA 3E7WA 2ZAOA 5JZOA 3STXA 3L7MA 5FEMA 4P4UA 1EWYA 2HLDD 4WZ6A 3UJBA 3MTIA 1W5FA 1ZOOA 2AFIB 1MQAA 2DHQA 4HTFB 4TMKA 5F5NA 4ZZ0A 3U44A 2BMEA 1GLNA 3C85A 3FDZA 2IKSA 1Y6ZA 2ZRFA 3I6YA 4ZOBA 3VZQA 4DRXA 4F92B 1M6VB 3QP9A 4M98A 2PQMA 1FRZA 2E48A 4C4SA 4KAJA 3A58B 4Q9JA 3PNOA 3QZUA 3DT9A 3F3MA 4L7QA 2R86A 2QWXA 1LFAA 3G0OA 3GJ7A 4QAJA 1EFRA 3DEFA 3PC8A 2ZGVA 1DTWB 5LLDA 2QTLA 1Y1RA 2XMPA 4AIIA 1A7AA 2IVFA 2YWGA 2BFOA 4YP6A 5B2FA 5K45A 2YC2C 4XTCS 1U31A 4A6XA 4BNZA 1HKHA 4TYWA 3G0GA 3OUUA 3F3SA 3PPVA 4NZYA 1EB9A 1OAOC 3D4OA 1YNOA 3BRCA 3MFQA 1FDWA 4LSMA 3Q12A 5AKXA 1EVYA 3IQWA 2NZ2A 1QNFA 3IAS1 2CWDA 5FHQA 3RFFA 2H8KA 4OB6A 1TQ8A 4ZTBA 3HLYA 3EQZA 3Q4GA 3WS7A 1U9JA 3IUYA 2JLSA 4PNZA 3AY6A 2I55A 1YK1A 2PY6A 2Q6OA 2P3SA 3RASA 3GLGE 5HIMA 1ESNA 3NWOA 5DYGA 5C5IA 1VSBA 3KOOA 1J22A 4MO9A 3SF0A 1L8XA 1WQ1R 2OB2A 2MCFA 5HZKA 1GV0A 4NCKA 5DLPA 1XMIA 4RVGA 1P0CA 1PZXA 5DBFA 1QR6A 4YQFA 1EVKA 3KUDA 2FFAA 3P5SA 2GVNA 3U31A 4YRGA 4XWAA 2CVPA 5IDXA 5JWHA 2BGJA 5I51A 1W4RA 2E9SA 3KT6A 5E7MA 3S8MA 1YXMA 4YK7A 5BY2A 4Q02A 1M72A 1UINA 3CX6A 4RORA 2H2DA 4X8OA 1IOZA 1V8DA 3W8RA 4LW8A 1BXRA 5ALDA 3WB1A 3T1TA 1XKLA 2C5FA 4Y2YA 1FS4A 3AEZA 3GAFA 1G6OA 4NMLA 4ZVVA 1U7ZA 4Y2PA 2CLMB 5E9JA 5AQ1A 4JB8A 4AP6A 2D5AA 2B78A 4YRMA 2Q0SA 4HAOA 1LX7A 1YJCA 2D6FA 4ARSA 1A69A 1GCGA 1P7ZA 2JASA 4EFLA 2J07A 5BUSA 1YDHA 2P5SA 1S7CA 4RD0A 2OCBA 5TV2A 2JFFA 3U4QB 4PCLA 4YMVA 1RZRA 3FUVA 4EF4A 3ZU4A 2REBA 1WXFA 3B7GA 4UZEA 3FPBA 2JIMA 2RJNA 1JB9A 1QYIA 3GQBA 2HA3A 3RHTA 2H7XA 2PZ8A 4AJLA 2A0KA 1LZKA 1L7DA 3STUA 4TV9B 4BWYA 1G5FA 4MKRA 4EUEA 1IB0A 4Y1GA 1Z4MA 2GN2A 2R5FA 2W7TA 4HDSA 1UANA 4J7XA 3T7IA 1EXDA 2DWOA 1IY8A 3ZJ4A 2E7ZA 3CW8X 1DWUA 3KHSA 5AW5A 4GKBA 3R75A 4ZO7A 1YCHA 2RGNA 2JIPA 3KM0A 2AFVA 4JBNA 1MVOA 3IT3A 4R84A 4DY6A 4MQUA 3VHXA 2I2DA 2QDKA 4QDKA 1EUYA 3OWHA 4D26A 3E27A 4JGGA 5DRYA 3HU3A 5BSWA 5J5AA 4ENWA 4UEOA 3KQNA 3IP8A 2HWYA 1TKAA 3EDQA 4OQEA 1QP4A 6GPBA 4TUYB 3F4BA 1UT6A 1TF2A 4B7CA 4G5QA 5CK4A 3LUDA 3USZA 2GCGA 2CF5A 1BE8A 3G5AA 5A3JA 4OI0A 4G0QA 5IJZA 1P3DA 1XCBA 3WDKA 1H2RS 5C8XA 3JV7A 3K92A 4K1XA 4GOMD 2EBUA 1OYVA 5AUPB 5TMEA 1QS0B 2C5AA 5LJIA 5U9CA 1UMDB 1Z07A 3NO4A 4FI3F 4UAUA 1XKTA 3IAM6 4KDEA 3OF2A 2QRGA 4J76A 1IM5A 4EFKA 5IRCD 4M1WA 2ENWA 3MERA 4KQEA 4YUWA 1QVRA 1T34A 3UTDA 4M1EA 4MYSA 3HB1A 3FGNA 2VPQA 1V35A 3ANSA 3IYLW 3OA2A 3JQFA 4Z9FA 3LBHA 3L1JA 3OCCA 1NZDA 1Z4KA 5DIZA 1E5TA 2VJYA 3ETHA 7ABPA 2YBEA 3IDSA 1YR3A 3QKSA 1EWVA 1MEEA 3GJ6A 3KJGA 1XGKA 4NXNB 4NCAA 3IOEA 4TV9F 2FP4A 1ZGAA 2PRSA 4PRYA 2GEFA 1LLCA 1YQGA 2HJVA 1JLSA 3L1UA 4GEKA 1XVIA 3VQTA 5C7YA 2BP7B 2JGMA 3QA3E 3LX4A 3WNDA 3ADCA 4DB2A 3C6XA 2C8JA 2W8BA 1R9MA 3QU9A 3T0IA 5CD1A 1RI1A 2I87A 1EXMA 3KB2A 3P2MA 4GRAA 5D84A 3QVGB 1ZMBA 3MTAA 4LMAA 5EMKA 3DD5A 4ZDIA 1F0PA 3OSUA 3T7CA 2C2GA 3ORYA 4YAJA 1S4QA 4LPKA 4TXMA 3AIKA 3PIIA 4XGKA 3HVIA 2FRDC 3LT5A 3RUAA 3U37A 4TMZA 5KC8A 4RZHA 2F3RA 2XITA 3QITA 5ADVA 5F9MA 2HL6A 3KZKA 2IV3A 4LF8B 3PWZA 3MAAC 2XUIA 3SZGA 4TUYF 5E3IA 2G8NA 1R4NA 5EWLB 2J5QA 1X42A 4JU8A 1NN0A 1CP3A 3CV3A 3W8NA 1EFPA 2BM8A 3SYLA 2Q1SA 3MBKA 3NT4A 1T1SA 1VCOA 1L5QA 2WIJA 3MSCA 1V2GA 4WLVA 3HN2A 5IHPA 3TAUA 2VQ3A 2VT3A 4BVJA 1QYVA 1Q1ZA 3H7IA 4Q19A 2PUHA 2Y99A 3KO8A 4NENB 4B82A 5KYNA 3QVOA 2R7LA 4HUQB 3GXOA 1AF7A 1A7UA 4RXMA 1KO4A 3M4XA 3WLTA 5JYEA 4MHTA 1QU3A 5B3LA 2NO1A 3KPVA 3KWLA 2H1OA 3NEAA 6PFKA 2VAXA 4G4IA 3RVRA 4ARVA 1U0LA 3HQ4O 5CMLA 1MTZA 5B5SA 4ESEA 1NI3A 1YL5A 2QR3A 1KZ1A 4MEAA 4OOEA 2YNMD 2IEGA 1WWKA 1KKUA 5CVUA 1AG9A 1MT0A 2QT1A 5B2ZA 4AJJA 5TX7A 3SXUA 1PE0A 3IIEA 4AICA 3ANYB 1TO2E 4MEBA 3VVBA 3U19A 5CK5A 3ROEA 2NYUA 4B84A 3N07A 3VJRA 1GNRA 2QX4A 3GLHB 1D2AA 4J2TA 5ILOA 5H59A 4DNQA 3GIWA 4TSKA 4EL5A 3M81A 4OQZA 5T4EA 2FJUA 4ZT7A 4YAIA 3TJMA 3WSWA 1EDDA 4UMVA 2GBLA 2P2YA 4GMFA 3SSAA 1T5LA 2H9YA 1OLSB 4YRKA 3P9ZA 2EWMA 1JNYA 4WKCA 2J0SA 2G4CA 2JNWA 5THXA 1Q50A 2F1IA 1AGYA 3D3WB 3O92A 3PDHA 4ZC1A 3AL2A 4L5BA 5DBHX 3H0EA 5LU9A 2HN9A 1PKEA 2I4MA 3CYFA 3WLAA 3C87A 3PRYA 1B26A 3KOZA 3VR5H 1I4WA 5SV2A 1YVEI 2D3TA 4QYSA 2WICA 1KE2A 1LW6E 4CLRB 4BE7B 1P6UA 3TQHA 1VPWA 1MKYA 3D6VA 1OZGA 1T0BA 4OLFA 1N6NA 1SD1A 3PUYA 4X9XA 2WU3A 3CKKA 4N39A 5EVCA 1K89A 5HEKA 2ZJ7A 2I9KA 3SU8A 3P5BA 4UASA 4ESVA 5LKAA 2SNIE 3TMKA 2W2LA 4PO8A 2JKYA 3FTEA 1T6YA 3SFZA 4KGDA 2VNAA 1PQUA 1Z0DA 1PEKE 2UVPA 5C3MA 3HA3A 1G8MA 1BC5A 4QHSA 4Z0PA 2WTUA 3O8OA 2PWZA 2XKKA 1Z0JA 1I7SB 1E1RD 1M2OA 2X3YA 2FYTA 3F5FA 5FWXB 3W5AA 2NMVA 2WTNA 1SO8A 4HWGA 2Y4OA 2VP2A 1N5JA 4CDGA 3AVPA 4MKGA 5JARA 3VNRA 3E61A 2NSJA 5EUCA 2BFEB 3AESB 5K03A 1DIAA 3N2NA 4GRDA 4QDXA 4YJHA 3R5SA 1PJQA 1RCFA 3ZJYA 1XWIA 2VYVA 4PYOA 1V4VA 4KR9A 4JHXA 1F12A 2ZBDA 3FOCA 4M1ZA 4TZKA 2EKBA 2JA2A 3QOWA 2WIAA 4RJKA 1Z75A 2XDQB 5ARDA 2VRNA 1N2HA 4HH3C 3SY8A 1A4UA 2HRZA 1XJCA 1QVVA 4K26A 3B1ZA 5EMHA 121PA 1YK0A 1Z5WA 3UICA 4KTVE 3PCTA 3ZHRA 4JUCA 1VXRA 1GSAA 5KQMA 2PH3A 3AVXA 2FFRA 2BKAA 2XBMA 3PDJA 1T5IA 2AS0A 1PL6A 2KJQA 5LZ8A 1GFZA 1L7QA 1KORA 3GVCA 4Q03A 1IHDA 4UZSA 2VDRB 5F3DA 4C22A 1JTFA 4EKNB 4EY8A 4CUKA 2PSFA 5IAKA 4WZZA 1SCIA 4NE7A 2FXVA 2P7HA 1N32B 3QE2A 3V8VA 3DBRA 1N9KA 5BOSB 1YB2A 4X6UA 4GP7A 3HZRA 1FYEA 1I24A 1NLFA 1KY2A 2IXDA 2XQFA 5CH3A 3ICWA 4WA7A 4JXJA 3RV4A 3FPCA 2X2OA 4MYDA 2X9QA 4WXYB 3BM5A 4R98A 2P1ZA 3OPNA 5DNWA 1DRWA 1VE1A 5P21A 3D4NA 1U0FA 3G9TA 5E4FA 5IKPA 3GCXA 4DQKA 4EHHA 1I5RA 5MFPA 1JZSA 5IYZB 1A9XB 4PVCA 3TD9A 2AVDA 3ONFA 3VM6A 1MMFB 2QU7A 1MC8A 2QD5A 3LC2O 4X24A 2YY5A