2WD7B

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title One Scaffold, Three Binding Modes: Novel and Selective Pteridine Reductase 1 Inhibitors Derived from Fragment Hits Discovered by Virtual Screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wd7B00
2O7SA 4JNKA 3JQEA 4M54A 3NRCA 3C8MA 2GO1A 4IDAA 1PGNA 3F1KA 4W99A 3GAFA 4BGIA 3GVPA 3RJ5A 4OYRA 4K28A 1GV0A 2EEZA 4WUVA 1SB9A 1Q7BA 4B7XA 2VHXA 4ZQEA 1EK6A 5IZCA 1PIWA 2O50A 3HADA 3U3XA 3N74A 4IPTA 3ZU3A 3RQSA 1RJWA 3KB6A 1BTOA 1MG5A 3NDJA 4CM1A 4KMSA 1KC3A 4L4XA 4GWKA 5I7EA 2IZ0A 4J1TA 1UUFA 4WCFA 2IDZA 3CXRA 3WS7A 5JYEA 5K0ZA 1XKQA 4LMPA 1O6ZA 3WXBA 5GY7A 2ZB3A 3OJLA 4E30A 2X0NA 1P0FA 2PZMA 1PTJA 2D8AA 2WTBA 4MP6A 1DHRA 2ZJ1A 4YJGA 2CSUA 2R00A 5C7OO 3ANLA 1N7GA 3GEGA 2Y99A 4URFA 2VRCA 5F1PA 4G81A 1EK5A 1PR3A 3AY6A 3NT4A 2NM0A 4QT0A 4UUPA 1QLJA 1RM5A 3BMOB 4W7IA 3IDSA 1FK8A 3LC1O 3MEQA 2PH3A 1NFFA 1HE5A 2O7QA 2IRWA 5IAAA 4NNJA 1KOLA 4FC7A 4CM7A 3F6YA 4BKRA 1I8TA 2E82A 2ET6A 1GEEA 4EJ0A 4Z3DA 3U49A 4P38A 4I9NA 2IYPA 4E31A 2HK7A 4PLHA 3TL2A 3ZU4A 3PHLA 3DMYA 3OJFA 4GI2A 5IJZA 3UF0A 4Q3AA 2JD1A 2I66A 4CL8A 1DRWA 1OC4A 4IZIA 4W9NA 3AFMA 1B3BA 1B7GO 3TZQA 4CM3A 2GDZA 3DEYX 1KY5A 4P4GA 4B7UA 4F6CA 1TT5A 5KTKA 3HWRA 2BELA 1QXSA 3IOYA 1I33A 4RJTA 3DOOA 4PLVA 4QX6A 4AJOA 1W6UA 4L0QA 5ICMA 2OL4A 4YTEA 2VWHA 3HDJA 2DPGA 2WSBA 1P9LA 2VYVD 2YJZA 4XB2A 3PFWO 2UDPA 3TZHA 1FDUA 3LDHA 1J49A 5B12A 2BKAA 4K26A 1I2BA 1NQAO 1TB4A 1PS0A 1LDYA 3ROKA 2Q1WA 1MFZA 4O0LA 5KWEA 4XYEA 3FPCA 3KSDO 1M75A 1QYVA 3PQDA 3FD8A 4D3SA 1E1NA 3I4CA 2YDYA 4PRLA 3VVBA 4AJPA 5FWNA 4ILKA 3PQFA 3QWIA 3R0IA 1UDAA 1Z82A 4RPGA 4QFCA 3EK2A 5JDIC 4C7JA 5CAEA 1H6DA 3DBLA 2I3AA 3CMMA 2P4QA 1OMOA 3AY7A 3DBVO 3TQHA 2Y1FA 1ZK0A 3MOIA 3BTVA 5AQ1A 5JC8A 1UDCA 2NUAA 4U6QA 3ZWOA 5F21A 1FMCA 3ENKA 3ZV3A 1Q0LA 3HN7A 2H5LA 3WNVA 2PH5A 3K8ZA 2GN4A 5G4KA 2CUKA 3K92A 4PLGA 4XZ3A 1ZK1A 5C3MA 3RC2A 1QKIA 3KUXA 3A06A 3UUWA 4Z0PA 2VTDA 1BRMA 4MVJI 2C59A 1UZMA 4CQMB 5HS4A 1Y8RB 3Q2IA 2W2KA 3VVCA 3VHRA 1NBOA 2B4TO 1UXHA 4IDEA 3F47A 4R1UA 1GQ2A 3VH2A 1CQJA 2E37A 4NFHA 1P1RA 1WZEA 5JBIA 1BVRA 5COQA 4N5LA 2VTEA 1CJCA 2AXQA 2C7VA 2GERA 3LC2O 1LXCA 4BO1A 4BNGA 4YB8A 3WGTA 3E03A 4BIIA 1IE3A 1HDGO 3E9MA 2HQ1A 1HEUA 4FFNA 4ALLA 2X7HA 1DAOA 1E7YA 3NX4A 1EEHA 1QRRA 2V7PA 1IPFA 3H2ZA 4BNXA 2FPGA 4II2A 1C1DB 5A05A 3AW9A 2NU6A 5CDSA 3E8XA 2OO5A 2CF5A 1WMAA 1EE2A 1O95A 4DC0A 3C7AA 1ISFA 1EFKA 1GQQA 2HKIA 2NVBA 4BNNA 4EZBA 3HB4X 4IINA 1ISHA 3WNQA 3NYWA 2DLDA 1ENYA 3QV1A 3BZUA 2RHCA 2QX7A 4CMEC 2P2SA 1U7HA 2ZTLA 2FY8A 1KIFA 4OOEA 4Z9XA 4MOWA 4OO3A 1O5IA 4L75A 1PQWA 5LDHA 2VZ0A 1H6CA 1Y9EA 1K6IA 1LRKA 2GGSA 3H6KA 3UVEA 1N1EA 4YJDA 3DBRB 1HF3A 3S1LA 2P9CA 5JDIA 1P1JA 2RHRA 4FGWA 3WQQA 4CM4A 1Y9AA 3SC6A 3UOGA 1WVGA 2YV2A 3LF1A 4L73A 4QTZA 3ZWMA 4NPCA 3JQAB 2ZATA 2YY7A 1PZGA 3VZRA 4BNKA 4XQ9A 1HE2A 1Y5RA 4BNZA 1T2AA 3WGIA 4Q9NA 3RD5A 4CMBA 1NVTA 1ZK3A 3QVSA 4D41A 5BSGA 2D3TA 1XQ1A 1BSVA 3GPDG 2I65A 4KQXA 4A73A 1U4OA 2EGGA 3WJ7A 4IS3A 1YQGA 4BQPA 1GZ4A 2J3HA 5BNIA 1SEVA 3WDSA 2IXAA 3ZZNA 3ZWVA 4EUHA 4IMPA 4NJMA 4R68A 3Q9NA 2Y1OA 1JLLA 4AJIA 3LVFO 1E7WA 1SBYA 2XAAA 3CH6A 4CMIB 3EVTA 4EUFA 1LX6A 4YAJA 3AUSA 2J8ZA 3K2EA 4WEOA 5I7SA 1PZEA 3PXXA 4I5DA 3GHHA 5IDQA 4ZQBA 1ZJZA 4I08A 5J23A 2HMWA 5JO0A 2BMAA 3MJVA 1P1HA 3GGPA 5BSEA 3HQ4O 3TZ6A 1DJQA 5ENDA 2JFGA 3JD4A 1E6EA 1YB4A 5EJ2A 3DFUA 1ISIA 3HJAA 5T6BA 1U7TA 2PD6A 1ZXBA 3H4VA 5TNXA 2PKRA 4J16A 1BXGA 1KVRA 2X23A 1ONPA 3KYDA 3LC7O 4YR9A 3GK3A 4S3MA 4RF5A 1ZW1A 1B8VA 5IF3A 3INTA 2CD9A 4BNUA 4N18A 2AEMA 1MX3A 3PWZA 3KTDA 4CMEA 4W4TA 1UZNA 3DAGA 3U4CA 2Y0CA 1BWSA 1WNTA 4LSWA 3PEFA 3I9JA 3D1LA 3NEPX 3OA2A 4F45A 5JPIA 1X0VA 1QYCA 2X22A 3OETA 5EESA 1R37A 1MLDA 2YQ5A 3SEFA 1WW8A 4HV4A 3E6AA 4J9UE 2Y0EA 3HFGA 1XU9A 1MB4A 4LCJA 1NQTA 3QRWA 4DQXA 3PLNA 3DHYA 1JA9A 4JP2A 3TWOA 4KQWA 4XGIA 3VDRA 3EC7A 4DIFA 5F1OA 1Y6JA 1X7GA 2YV3A 3JD2A 3QSGA 3UHAA 4PZEA 4AL4A 5F5NA 3ZW8A 3QVTA 5FI3A 3KETA 1XEAA 3OH8A 4RDHA 2VHZA 1WPQA 5A9TA 2XXJA 5IXYA 2ZB4A 2UUOA 1ZEMA 2X5JO 2AA3A 1K6XA 5T8KC 1RYEA 1BDBA 1BVUA 2DUUA 3BTSA 3RUAA 2BI8A 4AJNA 6ADHA 3WQRA 1J0XO 1EUCA 3JQDA 2POQX 3FHLA 1NHWA 2Q3EA 4JQCA 4YRBA 1NFRA 2NWQA 1P1KA 5KKCA 4BKUA 1ZJYA 1RKXA 1ZFNA 3B1FA 3O9ZA 2VCYA 5HA5A 4RVGA 4XQCA 2C5AA 2TMDA 3GGOA 5GMOA 2R6JA 3F5SA 3L4BC 3BMOA 3T4EA 4DPMA 5L53A 1YL6A 3CUKA 4YJGB 3NUGA 4NFYA 1HYHA 2C2YA 1LQUA 2VYNA 3GRPA 5JDCC 2DC1A 2ZYDA 5IDXA 3I6QA 1DIGA 4UVGA 7ADHA 4UEOA 5U9CA 1UH5A 4PLYA 5L7TA 3VOSA 2ZTVA 4ALJA 1B2LA 2GASA 3LT2A 3RU9A 1DFIA 1Z45A 2VRCD 3LT4A 2JHFA 4OSOA 1H5QA 3DO5A 3NJ8A 4JBIA 2VT3A 4CM9A 2O3TA 1T24A 2UV8A 4XGNA 3SXPA 3KM0A 4BO0A 3PWSA 2YHIB 1TEHA 1I01A 2NADA 2WDZA 3FNHA 2PGJA 4DREA 4ID9A 3UXYA 1EDZA 5EERA 1XELA 1NP3A 1VM6A 5TS3A 1Z73A 3TZKA 2G5CA 4E2XA 5AYVA 1H9AA 3A9WA 2DFDA 4E3ZA 1GQYA 1LSSA 2WD7A 4EJMA 3TFOA 4IY1A 4ALIA 2CNBA 1YOVA 4OQZA 1HDOA 1TT5B 2Y1CA 4YBZA 1H93A 1JTVA 3VAZA 4EW6A 4DUPA 5JYDA 4ND4A 3IJRA 1LC3A 3D5QA 1FDWA 1T4BA 4TRRA 4DQVA 5AXAA 3KLMX 2NU9A 4NDNE 3FF4A 3RKUA 4NIMA 3H7AA 1CDOA 4BO4A 4J49A 4ZQGA 4I5EA 4L8VA 3UCXA 2GPTA 1JQBA 4YPOA 3RBXA 3FSRA 3GVHA 2CVZA 3GMSA 4PCVA 1E3IA 5JAZA 4JIGA 1PGPA 4EBFA 5A02A 5CPBA 3V2UA 5G4LA 3H9QA 1BHSA 5DCYA 1PWZA 5T8KA 3VPHA 1E7QA 2BFMA 1EMDA 3C3XA 4IXTA 3C1AA 2H9IA 1AE1A 3FNEA 1HRDA 4RL6A 1IZ9A 3HUDA 3JD0A 4RV9A 4DIOA 3D4PA 1XSEA 1VC2A 4GGOA 5B37A 1C0IA 5KVQA 4LVUA 3L4BA 3U9LA 1VL6A 1R4MA 2NACA 1CYDA 3U4IA 5MGBA 4L4RA 2NTNA 4XKJA 4RVFA 5TC4A 2FSVA 2DUWA 5JDCA 3W4KA 1GYRA 1Y8RA 4CV2A 4FOSA 4DWVA 4OOFA 4N54A 1BDMA 1NWHA 4O1MA 3RI3A 3NAQA 3PYMA 3PZRA 1H2BA 3E5MA 4ZA2A 2FP4A 3QA9A 4JCOA 2HUNA 1QV7A 5T5QA 3NJ4A 5I7FA 3HG7A 4AJ2A 2ZB7A 4MVJD 3EZLA 1XU7A 2D5CA 4LK3A 3OA0A 4FSHA 4PG5A 3HFSA 1YXMA 1T2EA 4CLEA 4Z3KA 4OJNA 5ICSA 3QP9A 5KVCA 1WZIA 1YE3A 2I99A 3IAHA 1LUAA 2VHYA 1DC3A 4ITUA 2IEDA 3ZWYA 3GH3A 1JN0A 3PGJA 4F6LA 2X58A 2IXBA 3OJOA 3GUCA 5KJFA 3I4FA 4B4OA 2DBRA 3V5NA 3NT2A 1LC0A 3ADPA 3GN1A 3G49A 1LEHA 1T2FA 3VH3A 2GUGA 2NVUA 1OOEA 3AOEC 1GZ6A 3ANNA 3FR7A 5DBFA 5CP8A 5FFFA 5DP1A 3LU1A 1GZ3A 1LNQA 4IM7A 5U4QA 3RCBA 4EDFA 1P45A 2IYOA 3GLQA 3LSYA 5DBGA 2CFCA 4CM6A 1QORA 1KS9A 5KJCA 4J2OA 4WJZA 2H1SA 3IMFA 4R1SA 3U5TA 1ZZEA 1YKFA 3RIHA 3ZV6A 3JYOA 2GF2A 4BNTA 2FWMX 4OQYA 1CRWG 4AJ4A 2J5KA 2ZQYA 2FR1A 1X7DA 4P4NA 5IN4A 2NU7A 4GMGA 4WLEA 1ISJA 5TX7A 1SEPA 1NFQA 3H3JA 3MJCA 2QW8A 3G3EA 3VKVA 1A4UA 3FCOA 2VUTA 3BMCB 3JQAA 4TQGA 4CLXA 1B14A 1DAPA 1DC6A 3C7CB 2PZLA 2OBNA 3E1KA 1T25A 1D3AA 5BT9A 1DC5A 4OH1A 2GN9A 3CZRA 2GYYA 2HMTA 2AQ8A 3BMNB 3K2BA 4NHEA 5IG2A 2YFHA 1HDXA 3AI3A 3KLPX 1GD1O 1G6KA 3L9XA 5L7WA 3WGZA 2A94A 3HE3A 1NYTA 1RM3A 3JQFC 4YA6A 3K30A 4A2CA 4RPHA 1KETA 1F14A 1G0NA 1KC1A 4CMIA 1NHGA 2YW9A 4B8WA 2EP7A 1HWYA 2VRBA 3WFJA 1RM4A 3QVWA 1DOHA 3M2TA 4FJ1A 3AWDA 3GHYA 4B3HA 4NH4A 3JQGB 2BLLA 1ISGA 3DOCA 3PHIA 4TKLA 1R0LA 3IS3A 4JROA 3WYEA 4B79A 1EVIA 4PRKA 5B4UA 3V1TC 5KVVA 4CV0A 3ZHZA 3ICCA 3INGA 2AMFA 4PG4A 3UCEA 3R3JA 1X14A 1GCUA 1R16A 1JAXA 2JCVA 3ZWAA 1IOLA 4ZN6A 3AOEA 4IJVA 1HDYA 3TOZA 2B37A 1BXGB 2PV7A 3B1JA 1YDWA 4J1SA 3RC1A 3JQ8B 2WYVA 5C7IO 2BH9A 4IDGA 1QLHA 4NG5A 4IXWA 1M2WA 2Y05A 4XEHA 4FFLA 5KJ6A 2HK9A 2VOJA 3STHA 1F06A 2W4QA 2ZK7A 1U9JA 3TNLA 2CVOA 1EUZA 1CEQA 3GMDA 2B69A 1D7OA 3ZWWA 3RUIA 2O48X 3FNFA 5L45A 4J0FA 3BHMA 4PLPA 3RBZA 3RUHA 1SPXA 2D4AA 3IP3A 1MC4A 1YO6A 1HYGA 4JJFA 3EW7A 2CDCA 2NLOA 4OSPA 4R3NA 1B0AA 2VWGA 4AFNA 4HBGA 3WBBA 4ZRNA 3BA1A 3CPSA 3B20A 4YDRA 4FGSA 4YJHA 4BNFA 3QWHA 1E7MA 1GYQA 1NQ5A 4NBVA 1OC2A 5TJHA 1PGOA 3JQFA 4CUJA 1NM5A 3I1JA 3QIVA 1PJCA 2EV9A 1I3NA 3P7MA 3GNTA 4R41A 4LMRA 3UAGA 2PWZA 1A71A 1LQTA 4BOYA 3W8FA 3ITDA 1V6AA 1C1XA 2C54A 4B8ZA 3AI2A 3ICPA 1HDCA 4WECA 5LCXA 4KWIA 3VPSA 4YAKA 3GNSA 4CUZA 4QO8A 3F5QA 1O94A 5I9MA 3HN2A 2EGHA 3QVOA 2NTVA 4OM8A 2FMUA 1SZJG 4XD2A 4WKGA 5ITWA 3GR6A 2VUUA 2FSSA 2HMSA 2Z95A 2Q46A 4I9UA 1ONOA 5IN5A 2WJPA 2TMGA 2QRKA 2C2XA 5GZ6A 2V65A 2EJVA 1AXEA 1GPJA 4CM5A 4ZGWA 1PL6A 2YHIA 5CDUA 3WWZA 2VYND 2W90A 3KEOA 1I36A 1PJBA 1VPDA 4R16A 1LDNA 1ZIDA 5L95A 3MJ4A 4J7XA 4WE3A 3AUAA 3RKRA 1R6DA 5JCJD 2J3IA 1VJ0A 4IIVA 2Q4EA 1A7AA 3K96A 1NAIA 3DZBA 3U62A 4DC1A 4J90A 2ZYAA 3H9JA 4CM9D 3IIEA 4FIZA 1HT0A 1UR5A 1QYXA 3ROPA 4D0SA 3V1UA 2D59A 1YGYA 3WB9A 3JYPA 3G79A 4RDIA 4DPLA 3GY0A 2WD7B 1PQUA 2JCXA 3COSA 3JYQA 4FDAA 4G2NA 4BGEA 1YOVB 3UW3A 1J6UA 1FDVA 2PGDA 2ZKLA 1HTBA 4CLRA 4D7AA 3D64A 3WIEA 3KZVA 4GX1A 4YJFB 5HM8A 1NQOA 1IB6A 3C1OA 2JFHA 3FTNA 1VL8A 1KEVA 3EDMA 1EDOA 1ZCJA 5AXBA 4FD3A 1GTMA 2AEJA 2RAFA 1E77A 1ENZA 1DBVO 1F8FA 2X0JA 2NV6A 3WYCA 1DIBA 5EQFA 5JSFA 3ONDA 4U5QA 2YFQA 4JN6B 2C82A 3T7EA 4CPDA 2PK3A 2GZ1A 4BKOA 2QQ5A 4WLNA 1R0KA 3PTZA 4WEQA 1E3LA 2WEKA 1K89A 4IUYA 3A4VA 3GQVA 3M1LA 4PGFA 2BGKA 5HS6A 3ZHYA 4HADA 4E21A 2WMDA 4M1QA 1V9LA 4E2WA 4YAGA 2NVWA 3M1AA 1V3UA 2PY6A 4IJWA 2J3JA 1HDZA 4J0EA 3IKTA 3W6ZA 3PIIA 1CF2O 2J3KA 4BVAA 1ENPA 1H2HA 3U09A 1UJMA 2RIRA 2XPCA 1R4MB 4IDBA 1OZAA 3ZU2A 3MWEB 2PNFA 1ADCA 1HSOA 4MVJP 1E1MA 4X54A 4IJUA 4WASA 4I1IA 3PZBA 3N58A 2G76A 5G0TA 1PJSA 3UFXA 4AVYA 1ZH8A 1P1IA 4M86A 3KXDA 1UDBA 4XB1A 1Q1NA 2PLAA 4KUEA 5BNTA 4CQMD 2EW8A 4UULA 2C29D 2DKNA 4EI2A 1GV1A 1YVEI 3D4OA 1K0UA 3INRA 4DVJA 3DTTA 2ZYGA 1PSDA 3PJEA 4LISA 3ZNNA 1K5HA 1C3VA 5JS6A 4XYLA 5F1KA 4J7UA 4U0KA 3IUPA 3RBVA 4CQLA 1KEWA 1U5AA 1LLDA 3PI7A 3VPXA 2E4AA 4IIUA 3TFQA 4OKIA 4BV8A 3DDNA 2HK8A 3GT0A 3PGXA 1M66A 3ZV4A 2D0IA 4UVEA 4DLLA 3WMXA 5L4SA 4MIYA 1XGKA 5JMWA 4JLWA 3TSCA 4J4BA 4BV9A 1X7HA 1WMBA 4J43A 1F8GA 1JU9A 4UVIA 4WLUA 5I9LA 3RFTA 5KNLA 1GCOA 3O26A 1V3TA 2FPPA 1B3RA 1W4ZA 2NVUB 5TLSA 3OBBA 1LDGA 1Y8QB 3JTMA 3L6DA 1RPNA 4MJLA 2UYYA 1T2DA 2Q49A 4WCDA 5EQDA 2W8ZA 3FR8A 1V8BA 3GDOA 1WAMA 1HDRA 3ZH2A 5A5FA 2X9VA 3BMCA 1IPEA 2Y1GA 1QR6A 3FRJA 1LU9A 3QQPA 4M8SA 5ER9A 3S2GA 1VI2A 4XIJA 4CMAA 4DMMA 1SOVA 4GSKA 1ZSVA 4TMFA 3MZ0A 1AXGA 4LVCA 1PQPA 3HDQA 1ULSA 3WGGA 3BMNA 1KVQA 1OAAA 3DZJA 2OZPA 5HWSA 1UP6A 3CMCO 5JAMA 1IYZA 3O8QB 1M6HA 2W2LD 4GL4A 4A27A 4R1TA 2YQ4A 3DHEA 5I7VA 4XWYA 2QYSA 3F4BA 2IZZA 3WGHA 2HMUA 3ZNQA 1GR0A 3JQAD 3RSHA 1H0KA 1Q2XA 1N9GB 4E5MA 3U4HA 5I8WA 3RUCA 1Q7GA 1GPDG 1N5DA 2EG9A 3E9NA 3DZIA 2EKLA 4TROA 3X2EA 1PZHA 3JQGA 4FJ0A 3GZNB 2ZTMA 2D1YA 3CZMA 4Z0HO 2Y68A 3RWBA 2I3GA 3I5MA 4LRSB 4I5FA 3WGQA 4MINA 4XYBA 1T1SA 1GL3A 3A14A 3GVCA 4UEKA 2VWQA 4KUGA 2E49A 4BUCA 1DJNA 4DLBA 1E7RA 3UH1A 1DIHA 2EWMA 1NAHA 1R4NB 2IODA 2GNAA 3CIFA 3RU7A 2UUPA 4UEJA 1Z74A 5DF1A 3JQ8A 2EHDA 1A9ZA 1NXQA 1GU7A 1DXYA 1VL0A 4NBUA 1B8UA 2O4UX 1AN9A 4GSLA 3W4JA 1JKJA 3DXFA 1H6AA 3AK4A 1UXKA 1KVTA 3TOXA 4QUKA 2PGLA 3NTOA 3M6IA 1E7SA 2V6MA 3RROA 3GG2A 3BHIA 4GX5A 4GAEA 1SCUA 5FF9A 4HP8A 1PGJA 3A1NA 5TIIA 2GN6A 2ZB8A 1W0CA 4J6FA 4JXKA 2VOEA 1YBMA 4CLOB 3F3SA 1M6WA 3E82A 4B7CA 4UUOA 1E6WA 4MO2A 3RUEA 3ZHXA 2V6BA 5DN9A 1T4DA 1UXGA 2A9FA 4MKZA 3O03A 3W6UA 1EUDA 4FR5A 5COBA 3I9NA 4KDEA 4LSMA 4YXFA 5T64A 2GLXA 3TDKA 1Z7BA 1NVMB 3LF2A 2QZ9A 1HZJA 3U4DA 2Q50A 4XIYA 1IHYA 1UP4A 1XQ6A 4PLTA 4Y6PA 3CEAA 4QSMA 1L7EA 3WWYA 1PL8A 4IMRA 3ZDFA 4B4VA 3CINA 1L1FA 2QRLA 4AJKA 3TZCA 1ZMOA 1U2DA 3GG9A 4G65A 2AQHA 2EERA 3JYLA 4IZHA 5ADHA 4B3IA 1SC6A 1VRWA 1E5LA 4MKRA 4YJHB 2I6TA 2NQ8A 3GEDA 3LLVA 4EUEA 2B5VA 1I3KA 4BNMA 2PA3A 3F1LA 4BNLA 4TVBA 2GR9A 4FFMA 4N5MA 4QO7A 4BB6A 5CDTA 1C1XB 4O63O 4FB5A 1K3TA 4IQ0A 5TGDA 3ON5A 3ZWNA 1RWBA 3GF4A 4M89A 4CMJA 1P44A 3L9WA 5JXWA 3ZW9A 8LDHA 3K5PA 1I30A 1LDBA 3FNGA 4OL9A 2Y67A 3FPLA 3L77A 2CY0A 4RPKA 1TVEA 4IQ8A 4XRRA 1YRLA 1J5PA 3OMLA 1U8FO 3W1VA 3KSUA 4NI5A 4PLFA 2X0IA 2P4HX 2FZWA 1NTOA 3GAZA 1E3WB 2OBYA 3DFZA 5L7YA 5CEEA 1SOWA 3WTBA 3OJ0A 1F17A 2UAGA 4ALMA 4KUHA 1P3DA 3HSKA 4LW8A 4YACA 4CMCA 4PG7A 4XJTA 1HETA 3WMWA 4GMFA 1X13A 3V2GA 2FN7A 3DL2A 3IC5A 4RPLA 3BAZA 4ROSA 1X1TA 1SNYA 2VUSA 1EQ2A 3L6OO 4PZDA 5C5IA 3ABIA 4XRGA 2G0TA 2XF8A 1OI7A 1O89A 1H94A 1YDEA 3SLGA 5A03A 4I9HA 1AHIA 2DBZA 3OHSX 2B5WA 2O3RA 3OICA 4MVJH 1DC4A 3WFIA 5EN4A 3ST7A 4LCEA 3MJTA 2NNLD 1WP4A 3Q1LA 4NU5A 4LRTB 4YJFA 1Y1PA 2QZZA 3NV9A 3ONEA 1D8AA 4DQUA 1E3JA 2QIOA 3BTOA 5A5EA 1YH3A 3SBOA 3E18A 5ITVA 4FFRA 4D43A 4BMSA 1YJ8A 2PR2A 5I8ZA 4OGWA 4CLRB 2EW2A 1DPGA 1IL0A 3OQBA 3WICA 2VHWA 1I32A 2HAEA 1LA2A 3UICA 1WXDA 4R5MA 3IQDB 1CIVA 5AOVA 4Q3EA 1P31A 2AE1A 1HSZA 3S2EA 4BNIA 3S2IA 4E5PA 3DAPA 1NR7A 2A4KA 3P19A 3VZSA 3H9UA 2CVQA 4CUKA 5F5LA 4AJEA 1D4FA 1NX6A 2VWPA 1B26A 3DAFA 2DQ4A 4YT4A 4RF3A 1KY4A 1AHHA 3WSWA 1ZVMA 4J2HA 1EBFA 2DFVA 4R1NA 5A1TA 1N92A 4IJKA 3RAJA 3PHGA 3RC7A 2WE7A 4R51A 1YS4A 1NPTO 5LC1A 3PVZA 4NK5A 4L4SA 1EBUA 3T7CA 4P4LA 1ZEJA 3VC7A 2VZ9A 5TSDA 3LK7A 3H5NA 3CKYA 3WGYA 1HL3A 1LJ8A 4YRAA 1PWXA 3QJ5A 4CMKA 4E2ZA 1LSOA 1EE9A 2Z5LA 4D79A 4TZTA 3VH4A 1D1SA 5CEJA 4MVJF 2O3JA 4RVSA 4INAA 1AUPA 1XDWA 5KCZA 4WLOA 4MIOA 1UP7A 2PTGA 3I52A 3NKLA 3SC4A 1MP0A 4GH5A 4R69A 2DTDA 3ETEA 4ZJUA 2GSDA 3A28A 3JQBC 3QE3A 3I83A 2YUTA 5JAIA 4FPXA 5BR7A 3IKVA 4CQLB 3ZWPA 5DOVA 1I10A 3OIDA 4IGEA 2FHSA 3MTJA 4RORA 1DDOA 4HY3A 5COAA 1IUKA 1Y8QA 3L4SO 2B36A 4JK3A 3KSZO 1ZK2A 1W73A 5DCUA 4BNHA 2EKPA 1FF9A 3L0DA 2ZCUA 3LLSA 4E33A 4BO9A 4FQ8A 5A06A 1VJ1A 3VTZA 5K9ZA 1HYEA 3OIFA 3P2OA 1XLTA 3H3FA 1NVGA 1T26A 3H5AA 2VHVA 2DAPA 4AICA 4E6PA 2C5EA 1HE3A 5DDIP 3FWZA 3RUDA 2XXBA 4D46A 1T1RA 1V0JA 5A04A 3MJEA 1DB3A 5GZ3A 1LLQA 2QYTA 3C7DB 3DONA 1GADO 2ZCVA 4XR4A 1PJ3A 5IFLA 1FJHA 2H6EA 4OAQA 3O8QA 4ESOA 3AM5A 4MKXA 1ONNA 4EYEA 1BW9B 4UVDA 3DB2A 2RH4A 1G0OA 3I9KA 4FFPA 4P22A 3PLRA 3E5RA 2OOSA 3PRJA 1XCBA 5CFZA 4RLSA 1N9GA 1YL7A 1PS8A 2B4RO 4Q3CA 1U1IA 4ZQFA 1QG6A 3PK0A 2PZKA 4GQAA 4N5NA 4WGGA 3VZQA 3LT1A 5L9AA 2JD2A 3GZNA 3WQSB 1HLPA 4MP8A 1E1LA 2PFGA 3TJRA 4GKVA 1J4AA 3DC2A 3TL3A 3PIDA 4AJHA 1YL5A 1YBVA 4FS3A 4FC6A 4H16A 5BQFA 4XX0A 1PR9A 1ADFA 2X4GA 3PJFA 4KTVE 4DPKA 4W6ZA 4GPD1 2WYWA 1WDKA 1Z6ZA 4J3FA 1ULUA 4OKNA 1R4NA 4QQRA 3JQBA 2GZ2A 4XDZA 4A03A 4TVOA 1C0PA 1WDMA 2CDAA 3AY3A 2C7GA 4XYMA 2O2YA 1F0YA 3SJUA 4Z9FA 5G0VA 2NTJA 3D7LA 4K1LA 4XCVA 4AJ1A 1U2GA 4NBTA 2QG4A 4IDCA 4PZCA 4E5KA 4GVXA 2F1KA 2EXXA 1JWBB 1NPDA 3JQ6A 4N7RA 4TRJA 4U7WA 4CLOA 2Z1MA 3K31A 3PJGA 4E2YA 3QWFA 3MWDB 2DT5A 4YAEA 3AFNA 4DRYA 3O4RA 1U3TA 3B6ZA 4ZHSA 2X8LA 3HNPA 1IHXA 2B0JA 4OHUA 3D3WB 5JLAA 1GFSA 1GAEO 1ZSNA 4JBHA 4R9SA 1XG5A 4K9DA 1ADGA 4HWKA 3S2FA 4M49A 4H3VA 4GGPA 1YB1A 4QFDA 4KZPA 3SX2A 4J1NA 3DTYA 3BMQB 3P5SA 3D0OA 2BFOA 3GC6A 2P5YA 1E6UA 2X86A 3EYWA 4UUMA 3C1TA 1EVYA 2W98A 4MVJE 2WYUA 4K6CA 3E9QA 3DHNA 3FTPA 5IZ4A 4D3DA 4O5OA 2OXIA 4WPGA 5A9SB 3K9QO 2LDBA 3VPGA 3KOUA 1A4IA 1ADBA 4RO0A 4GWGA 3ZN2A 3S55A 4JX8A 2DBVO 3GOHA 3WSVA 5TF4A 1Y81A 3GFBA 2G17A 1I5RA 1R12A 2I5PO 2I9PA 3SVTA 2YZ7A 1Z75A 3JCZA 2OHXA 3NGLA 1JDJA 3GRKA 3PHJA 4Y9DA 5TRTA 1GDHA 3LZ6A 4ZQHA 4EGFA 2BRUA 4RVHA 4A26A 4ND3A 1LSUA 3D3EA 3HZZA 3RVDA 1NASA 1NWCA 2ZJ0A 2VN8A 3UKOA 2OORA 4FJ2A 2B35A 3TPCA 2ILTA 3KRTA 4UUNA 1RYDA 1EVZA 3PJDA 3M2PA 4CL3A 5GZ1A 3NTQA 1ZUD1 2V6FA 1TXGA 4CV1A 3W8EA 1WDLA 3W4IA 5BSFA 4DXHA 1XIVA 1YQXA 2P5UA 7MDHA 1E3WA 3F9IA 1MUUA 5JY6A 1N8KA 5EIOA 2Q2WA 3KYBA 3GN2A 4HNHA 5BSHA 1JWAB 3JQ7B 3N7UA 4L74A 4UVHA 5CEFA 2O3UA 5K6AC 2P9EA 4GX2A 4KTTE 1DRUA 3BXXA 1EVJA 1FDTA 2Q45A 3NGXA 1NNUA 1VSVA 2JAPA 2YYYA 6LDHA 4FW8A 3ANMA 2JCYA 1JAYA 3R1IA 5B4TA 1Y7TA 4GX0A 3WJAA 3K6JA 3OSUA 5ES3A 3C24A 5C37A 4DMLA 3DQPA 1ID1A 3VZPA 3AOGA 5G2OA 4TSKA 5H81A 3NDIA 5THKA 1YBAA 4DGSA 4BB5A 3JD1A 2BHLA 2JL1A 1U8XX 5JNLA 1QP8A 2XOXA 1G1AA 3H2SA 1KEUA 3KV3O 4BNJA 4YQYA 4YT8A 3JD3A 1LDMA 1LDEA 2IZ1A 1QYDA 4JJGA 1KVUA 1VKOA 2BGLA 3Q11A 4FCCA 3R3SA 4RGBA 4E4YA 4NMHA 3U0BA 5TQVA 1DFGA 2HLPA 3AM3A 4F46A 2PD3A 4Y6SA 1ZXLA 1DSSG 4CJXA 5L4LA 3B1KA 1E3EA 2EJWA 3PYLA 4KDFA 2NQTA 3OF2A 3DMTC 5U1PA 4ZRMA 1EFLA 4R54A 4ALNA 3ZWXA 1OFGA 3OQ1A 4MVJM 3WGOA 3DBHA 1IZ0A 1VLLA 3H9GA 3DZHA 1TI7A 5L3ZA 3OQ6A 1S7CA 4GLOA 2V6GA 1T2CA 1B16A 3E48A 5CHEA 2X1HA 1KVSA 4RLHA 2D2IA 3ROQA 4BO3A 1QSGA 1DIRA 1MXFA 2VNAA 3I9OA 2GN8A 4BNYA 3IJPA 5CDGA 4C7KA 2EF1A 2RBEA 4E0BA 1PJQA 2Y66A 4BMVA 4C4OA 4Z9YA 1SO8A 3LYLA 2DVMA 3I3OA 3MCVA 3G0OA 5K6AA 4IGFA 2PD4A 3G1UA 1HE4A 1ZMTA 4I5GA 4MVJA 4TRMA 3QLJA 4WOKA 3SJ7A 4BGUA 3QWBA 4HFNA 8ADHA 2AE2A 1PX0A 4CMGA 3AI1A 4HXYA 3EGOA 4HX5A 4U8GA 2HMVA 1U3VA 3SLKA 2O3SA 4W7HA 2JD0A 3VPFA 1A7KA 2DTXA 4PG6A 2GCGA 1R15A 2VT2A 3BYZA 2QHXA 4RF2A 3VDQA 1O8CA 5CPFA 5DULA 2Z1NA 1KYQA 1LRLA 1SAYA 4A0SA 4ND5A 4D45A 2X9GA 4MPDA 3DOJA 5JE8A 1R0SA 4NJOA 2FPIA 4O59O 5EL0A 5THQA 1DIAA 4E5NA 4FN4A 1MV8A 2O4CA 3ADOA 2HJRA 2C20A 4R3WA 4PVCA 3UN1A 2JKVA 3TF5A 1ZK4A 4HKTA 1C0KA 2J5QA 2BI7A 3P2YA 2PKQP 1M76A 3GPIA 2AEFA 3KVOA 4JP3A 1XA0A 4CR7A 2DBQA 2AG5A 4R5HA 3EHEA 4R9RA 3WLEA 4HUJA 3ZGYA 3OFSA 1BW9A 5KKAA 1K6JA 1XR3A 5ILGA 1ISMA 3PDUA 1BMDA 4OIMA 5ENVA 3ENNA 1GY8A 4WNCA 4IQGA 2ZIZA 2Q2VA 3DMTA 5MDHA 4D0RA 3JYNA 4Q3NA 1I3MA 1YQDA 1HZZA 5B4VA 1VSUA 4TWRA 4I8XA 1UZLA 2Q4BA 3FWNA 5A3JA 4J4TA 3C85A 4ZU3A 5T67A 3V8BA 3WOHA 5ILOA 1PS9A 1LI4A 3DZFA 2Y1EA 5EINA 4OMUA 2JAHA 1ENOA 1D1TA 4RF4A 4FBGA 3KYCB 3K73O 1WLYA 4J7CA 4YRDA 5G0WA 3IP1A 2C07A 5IDYA 3FBTA 3L6EA 3MTGA 1E0DA 2R2GA 2C0CA 4XJSA 3BHJA 4Z0TA 3OM9A 4BGVA 1U4SA 3MOGA 1JVBA 1YONA 4BO7A 4H15A 5FYDA 2WWRA 3DZKA 2VQ3A 4BMNA 2I76A 4WLVA 3OEWA 4CODB 3OEYA 4L9RA 2BFAA 4RQTA 1TT7A 2I67A 1N7HA 2Y93A 2E6UX 1M67A 1V3VA 1ZNQO 3GVXA 5TT1A 4F3YA 1I3LA 1I0ZA 4BNWA 4CM8B 1U3WA 4YCAA 3D3WA 4HFRA 1U28A 4GVLA 4B3JA 1BG6A 1A27A 3AM4A 4UREA 4XGKA 4YWJA 2FR8A 4R4JA 5BNFA 4NK4A 3BMQA 3O38A 4XDYA 3QWAA 4MIEA 3ZNPA 4YVFA 3JQCA 3IL2A 2G82A 1LRJA 4CR8A 4IBOA 1C14A 1X1EA 5JFOA 2RCYA 4Y67A 3LT0A 1V35A 2B83A 4XR9A 4BKPA 3HHPA 5A9RA 5A9SA 2NSDA 2BD0A 4XQEA 1PU2A 4FOOA 2J5RA 1YWGO 4NZ9A 3D4NA 4BHTA 4AG3A 5KOIA 3W8DA 1SMKA 4BS9A 1PEDA 1O0SA 4JJIA 4Q3DA 3NT5A 2QRJA 3NTRA 2FZEA 1PZFA 2E48A 3JV7A 4W82A 4DYVA 3GEMA 4TKMA 1SB8A 4IS2A 4BL5A 1MC5A 4HNGA 4MDHA 3AJRA 2Q1SA 4UAGA 4K6FA 1FDSA 4EJ6A 4RZHA 1P74A 2ZTUA 3ASVA 1A5ZA 5DP2A 3UCFA 2Y1DA 1UXJA 2CF6A 1DHTA 2RH8A 3HDYA 4OXKA 4ND1A 5DOZA 4J1QA 4QECA 2BF7A 1U5CA 1W8DA 5TT0A 1ZSYA 4EEZA 3ORFA 4YEDA 3ZU5A 1DO8A 3ZWBA 3EVNA 5H82A 3CTMA 1KERA 2EIHA 1DEHA 4IDFA 4FFOA 1LLCA 3AUUA 1H6BA 3QHAA 4II3A 4Y98A 4E13A 1P1FA 4HFMA 3ETDA 4Z6KA 3ONFA 5CG2A 3H5RA 3CSDA 1I24A 1ZKMA 4WCFB 1ORRA 3JQ7A 3T4XA 1LBEA 4LN1A 2OFPA 3EZYA 4EEXA 4YT2A 2IEBA 3R6DA 3AU9A 5AXDA 1PL7A 1E92A 4D44A 4O6VA 4KP7A 4MVJG 3RC9A 3VKUA 4G5HA 1ZO8A 1CETA 3WLFA 3OJEA 3ITKA 4PVDA 4GLLA 5H83A 4XA8A 5CG1A 3EMKA 3Q3CA 3MJSA 2X9NA 3B70A 2LDXA 4J4HA 5AVOA 1PGQA 5KJ1A 5JCJA 3WR5A 2J6IA 3I6IA 3OIGA 3Q6IA 2F00A 1QV6A 4BNVA 4NU6A 5JY1A 4A7PA 3H9EO 3KHUA 4BKQA 1Y5MA 4E5YA 1DLIA 1DRVA 4RCVA 2Y0DA 4BQRA 3FBGA 4ND2A 3Q0EA 1YB5A 2Q99A 3G1TA 4Y8VA 4ALKA 1N1GA 1BGVA 2JHGA 2VYVA 3WBFA 3HDHA 3ZV5A 3QW2A 3ULKA 3GZ4A 3TN7A 4D3FA 4HFJA 1DLJA 3GDFA 4NBRA 4OXNA 4BO8A 3RUFA 1IY8A 2HJSA 4TZKA 2VZ8A 4NBWA 3H8VA 4E12A 1I2ZA 1JVSA 4R01A 3FI9A 3WG9A 2A35A 3KBOA 5C7LO 5IXSA 4KWHA 3ETGA 2AQKA 1Q7CA 1ARZA 4WLFA 2X5OA 3L07A 3F46A 3X2FA 2HCTA 1VE9A 2FRDA 1B8PA 2YV1A 5L51A 3TRIA 1PJLA 4RZIA 1QMGA 3Q9UA 1B15A 4WK6A 4YQZA 4YT5A 4OXYA 4S1VA 4U6SA 3PQEA 4P8RA 4BO6A 1ML3A 5KJEA 5ER6A 4DYDA 3RJ9A 4ZVVA 3GUYA 3DBHB 5A3VA 2FOIA 4MP3A 3ZNOA 3PWKA 2GRAA 4PG8A 1Z7EA 1LTHR 2OUIA 1P0CA 1A72A 1CWUA 4PN3A 1AGNA 5IDWA 5DZSA 1MFPA 2HRBA 4DBZA 3AU8A 3UGKA 1TA4A 3DBLB 2A92A 3JSAA 3PFFA 2YDXA 4PIVA 2PKQO 2VNSA 3KEQA 4RVDA 4WOJA 2GD1O 2CDBA 4CQMA 1RM0A 1PJ2A 2GZ3A 5HTOA 1F12A 3ZCXA 2AG8A 3AUTA 3GNQA 4E32A 1TLTA 2HSDA 1DFHA 2OP1A 2P9GA 5I9NA 5G4KB 5KVSA 2OMEA 1BXKA 1HXHA 1K2WA 1GUZA 1U3UA 4RPJA 5JAQA 1E1KA 9LDTA 5L40A 5G0SA 1EQUA 4ONEA 1JW9B 3ZHBA 2AQIA 3JQ9C 3WIDA 1UXIA 2W2KB 1R66A 1UAGA 2IE0A 5CDYA 2DPHA 2JFFA 3DR3A 2CZCA 3WYBA 4LGVA 3F4LA 3GGGA 4JBGA 4RVUA 1E3SA 4WNIA 3EUWA 1GUFA 1NPYA 4GBJA 1MGOA 5DT9A 1CERA 1C1DA 3Q2KA 2WM3A 2X5KO 4Y6RA 3I23A 4BO5A 1H9BA 4DA9A 2HDHA 2O23A 2SCUA 5TJ9A 1Q0HA 2EKQA 4CV3A 4AJJA 3KO8A 3PHHA 2AW5A 5DNAA 2BGMA 1XHLA 4M55A 3CE6A 2B4QA 1GEGA 4PLCA 1MG0A 4EITA 1CQIA 2WE8A 4H7PA 5FEUA 4KOAA 2HU2A 5EMHA 1PJ4A 4RQUA 2P91A 1P33A 2HO5A 4B4UA 1HLDA 1GYPA 5HRUA 2DM6A 4PFJA 4XQGA 3DZGA 3WTCA 4D42A 5G0UA 5AXCA 1I2CA 1UAYA 2G1UA 2OP0A 2W2LA 3I9LA 4NR0A 1E5QA 2NU8A 3DBRA 3S8MA 4Q3BA 4YYZA 4A5OA 2D5AA 3NDRA 4BO2A 3EY4A 5DCWA 2P68A 1MXHA 3KYCA 2DTEA 3V2HA 1S6YA 1YJQA 3GDGA 4GKBA 5JC1A 4U0JA 4DIBA 3LQFA 4CLHA 3ZWCA 3EAGA 4J9VA 1JKIA 2ZQZA 4B4WA 2CMDA 9LDBA 1X0XA 1LSJA 5IZCC 2Q1TA 4CM4B 2WD8A 3IUSA 4NFSA 1XWFA 1P77A 4JGBA 4PLWA 1O9BA 1IULA 1FXSA 1LLUA 4XYGA 3RASA 3VH1A 3PPIA 2Q2QA 3HB5X 3GA0A 4WCFC 1Q0QA 4NQZA 3DWFA 2X6TA 2BFPA 4QEDA 2OGUA 2H63A 5EPOA 3VTFA 3JQ9A 4L76A 5L4NA 1HKUA 4DTIA 1A9YA 1PJTA 4CM8A 2R00C 3OECA 4NJMB 3H65A 3FN4A 3BTUA 3QVXA 1GUYA 2UVDA 2YHUA 4DLAA 5FI5A 3I9MA 1N2SA 1NR1A 5DBIA 5T57A 1WWKA 3GVIA 2FR0A 5HBRA 1BXZA 1L7DA 3ASUA 3QY9A 5B1YA 5KIAA 1XYGA 3ZI0A 1EZ4A 5JO9A 2O2SA 4PLZA 1OBFO 1QYWA 2X0RA 4CMHA 3V1YA 4YAIA 1KBZA 3PDJA 1ZBQA 3PYXA 4M87A 5LDGA 3GFGA 4AJLA 2HRZA 3G17A 3ROMA 4CLDA 5F3RA 2JJYA 3D5TA 4ZICA 2AHRA 2EP5A 3KYDB 3WX0A 1KEPA 1VKNA 1C0LA 4TRNA 2O3QA 1VJTA 3RFXA 1MA0A 4DL9A 4QXMA 2Q1UA 5A4DA 4W9NC 2DU8A 4IDDA 4CR6A 3BIOA 5JMPA 5JW6A 4J91A 5JCXA 1X15A 3PP8A 3RFVA 4A10A 1JKFA 2PZJA 4ZD6A 4Q39A 3OP4A 4DBVO
chains in the Genus database with same CATH superfamily
2Z2KA 4XWTA 3JQEA 3JAKB 4OYLA 5KKNB 1XTUA 4RV5A 2VA9A 3CRQA 1CIJA 3FWHA 1UXOA 4J8PA 5L3SA 2YVQA 4HYYA 1M2OA 4DA8A 2VHJA 4EEKA 1DX9A 1GV0A 3REFA 2GNOA 3DEZA 1G291 3KZ1E 3ZLVA 3LGAA 3TS1A 2EEZA 4BFSA 4BLPA 3D6MA 2VQFB 2OGTA 3F9CA 5JWRA 3AVWA 4TMWA 1Z0ZA 2WFZA 1E61A 3A1TA 4QQKA 1CC1S 1HFWA 2Z04A 1Q57A 3G0CA 2FETA 2JI8A 3AIKA 3ZU3A 4PX5A 1IEWA 3OM8A 4FWIB 4ZXFA 5JQGF 3A9TA 4V0KA 1R5BA 3L1KA 2FZ5A 3QBEA 3IAM1 1QAMA 2W48A 3PXDA 1UUFA 3KNZA 1XDUA 3CXRA 3HM9A 1QQBA 4IG4A 1GR1A 1Z4KA 3DLHA 4TLAA 1EWQA 1XKQA 3EXHB 1NKVA 2HDOA 4UHHA 5B1EA 1PWEA 1SJ9A 4PZYA 3N2IA 5E95A 4KLZA 1P0FA 1JR4A 2PZMA 4AZ3B 3ELUA 2NW6A 3EIHA 3EC1A 3FGNA 4MP6A 1TO1E 4NZOA 5GIOE 3ANLA 3I01M 2O5CA 3A58B 2CWWA 4PXSA 1G64A 1RYHA 5J63A 3PQ7A 5E8RA 1EK5A 1VZ2A 2GEVA 3LUKA 5F64A 3NT4A 3N5KA 3TVTA 1ZOOA 4JLDA 4OFWA 1KBOA 4AF7A 3BMOB 3LC1O 1F9EA 2XQIA 1HE5A 1UADA 2QLMA 3L0YA 4UHDA 4YAFA 1AKNA 2IRWA 4GG1A 5IAAA 1CHDA 4DSNA 3EPHA 4DNXA 1Z07A 2XGSA 4YO7A 3O2JA 1KOLA 5IVHA 4FC7A 4CM7A 5BVHB 3WHIA 1Z8DA 5CT9A 3HBJA 4YCDA 1MNAA 1QMPA 1WBDA 3OFVA 2FQWA 4EJ0A 5MN6A 3U49A 3BWMA 4P38A 4Z7JA 2NYVA 5E0KB 4U7FA 3TL2A 1RE0A 3PHLA 3DMYA 3JR7A 3IP6A 2AD1A 3ZDYB 4N8SA 1XZ8A 4FHGA 4GI2A 1W5EA 1XTZA 1M5RA 4XLLA 2G4LA 2QQEA 2UUAB 2I66A 3BA6A 1OC4A 3I12A 1P73A 1JDPA 3GWZA 3IHWA 2FFRA 3TZQA 3PPWA 1U9ZA 1DQZA 1MQ9A 2DSNA 2GS9A 3BQMB 2V7GA 4R05A 4F6CA 1TT5A 1VGRA 4MV8A 2C2MA 3NGMA 1ICIA 4BP1A 2HSEA 5F33A 2BELA 1C4KA 4RJTA 3R44A 5DHQA 5BR8B 4DV6B 4QX6A 3FETA 2VC2B 4E03A 5ICMA 2OK7A 2O2XA 4IVPA 4YTEA 3ZDEA 4LVNA 4AX4A 2DPGA 2WSBA 1P9LA 2VYVD 3GWGA 2YJZA 1OZHA 4FLEA 3TZHA 1UMCA 2UDPA 1FBNA 3DZ8A 3NU1A 4F4HA 2I91A 5BUZA 3NCTA 1E32A 4D9GA 2NP7A 5D3ZA 3SDBA 1M8GA 3ROKA 1YRYE 4A0FA 4D9HA 3OE7A 2Q1WA 4O0LA 4DZZA 5JS7A 3QEBZ 3ZDDA 4XYEA 5JRZA 1A50B 4DYHA 1PBTA 3SFZA 2XYHA 3AHFA 3FTQA 3MJDA 5BPFA 5LXTA 2B3DA 3IEMA 3FD8A 5BQ3A 1E6MA 1RT9A 3THRA 1GCAA 3D9QX 3HGTA 3VVBA 5AVVA 1JU3A 4EG6A 4U63A 4ILKA 2WY2D 2DPYA 3ZBUA 2BZGA 5FTNA 4B3DA 2Z5VA 1JDBB 5JDIC 4BCBA 4NYMR 1H6DA 2IOHA 2VCEA 3QUTA 2I3AA 3DBVO 3TQHA 2JHCA 4OHRA 2PYZA 3A6LA 4DTCA 1E58A 5DGTA 3MOIA 3UJDA 3BTVA 5AM4A 3MGCA 1UDCA 5AOAA 2PT5A 1NUSA 3WXMA 3ZWOA 1JUDA 3ZV3A 3D0KA 1Q0LA 3WGVA 2H5LA 3UW1A 2DP4E 3KAPA 1PQ4A 2YZKA 2GN4A 1XZQA 3QEMA 4KDRA 4Q1CA 5G4KA 5KZMB 2QL7A 4HAIA 4KX5A 2Q07A 2BGRA 4Z0PA 3JZMA 2LPMA 4NYIR 2C59A 5BPHA 4MRVA 2WUVA 4JT4A 4D8YA 1BH2A 4TN5A 2I4TA 4YP5A 3OAAA 3VVCA 4NBLA 3RJTA 1W0JD 2YWJA 1JDSA 4C88A 2A7XA 4IDEA 3OZVA 3QUAA 2OZLB 4PFSA 4MQBA 2WU3A 2R68A 5THXA 2EJTA 3B53X 5COQA 1NXPA 3MUFA 2VTEA 4GOKA 4TSFA 4YV1A 2AXQA 2XD9A 2V3CC 4R2LA 4BNGA 1U0TA 1FRFS 4BO1A 3MTAA 2PV0A 4H7EA 1VCHA 1NW6A 3AB3A 3KQNA 4JD5A 3T3DA 1W5SA 2HQ1A 2QVXX 4FFNA 5ERXA 1NG1A 2XVZA 1I9CA 2GESA 5DGDA 4NP6A 1E2JA 2C84A 3HP1A 3OM0A 3GJZA 2JLAA 1C1DB 2JAOA 3E8SA 1IUNA 1OUMA 3AW9A 3V1NA 3E8XA 4R0VA 1IM5A 1U0EA 5CLJA 4DC0A 3VKHA 1CJVC 1H2ZA 2QX6A 1XDBA 1ISFA 4JNCA 1XN1A 2YMMA 3WAJA 3ELDA 3K9CA 3NWOA 4FUQA 3F2VA 2DQZA 5D85A 1FFAA 2NVBA 3KL4A 3VNRA 4EKIA 4C6SA 2IELA 2XODA 2JAUA 5IAKA 1VJCA 2DLDA 1CVRA 1YCHA 2Z58A 2IYEA 3DTVA 2JCBA 2I7CA 3C7KA 3H2IA 3JPYA 2KMLA 4U2EA 3SJAA 1E9RA 3LXUX 1HURA 3VSAA 1W35A 3N59A 2XV1A 2P2SA 1U7HA 2ZTLA 4NE7A 5A4IS 2FY8A 2ZYWX 4MOWA 4UMVA 3IPXA 5IEBA 4L5YA 4PSUA 1T43A 4ESVA 2J4FA 5C8ZA 3AVXA 3NO4A 1Y9EA 2JEYA 2PGXA 4IVNA 4JI5B 2VDJA 3UA4A 2PYIA 5BT8A 3H6KA 3ZYZA 4JC0A 4C9BA 3UVEA 1N1EA 3NC1C 3V3TA 4OB6A 2Q5FA 4ZVOA 3DBRB 5JDIA 1TCAA 2P9CA 3FMVA 3S1LA 3PBKA 1P1JA 1ID8A 3WQQA 1PLKA 4EY6A 2W7TA 5E6SA 1YBFA 2OAP1 3Q6MA 3SC6A 2EL7A 4CM4A 4L73A 3ZWMA 4QLBA 5AVQA 2AZTA 1MDFA 2H2DA 1B42A 2V4MA 2ZATA 3FIJA 1PZGA 3JVIA 3JX9A 3LUGA 4HR7A 4KHPB 4XQ9A 4UHJA 3RD5A 4HF7A 4CMBA 3ESDA 3K9NA 4AY6A 3KPJA 1PVDA 2OWEA 3FOAA 4QHTA 5D86A 3LAWA 2D3WA 4GS5A 2D3TA 1I4WA 4KAJA 3GPDG 4A73A 1OXBB 4FKZA 4WXRA 1YQGA 3JW8A 1UPFA 1H2AS 2WJ4A 2ZJZA 1GZ4A 3AEUB 4ND6A 4BQPA 4H08A 3VO1A 4F6RA 2AOWA 3KTFA 4EUHA 1T0BA 3AVVA 1VG8A 2H4YA 3PGA1 3Q9NA 4R68A 5AK6A 2FSGA 1EG7A 3DJFA 3T1NA 5AIBA 4ND7A 2Q9UA 1SBYA 4OQLA 1G98A 3CEHA 2IYZA 2F4VB 2NZ8A 4YAJA 1J97A 4JJ6A 2C4HA 3K2EA 4WEOA 3VR6H 4AMUA 3PWTA 4MV3A 3FZGA 4G37A 3ICQB 5IT4A 4DV2B 3ESRA 5HKOA 2PXCA 1O1YA 4H7JA 4ZZIA 1ATIA 2D2XA 4JVMA 5GJCA 3MJVA 2P9BA 3GGPA 5BSEA 3FROA 1NBIA 3KT3A 3JD4A 4XCQA 5T6BA 3UK2A 1BXGA 4A0RA 3PDWA 4OLBA 5C1PA 1LK0A 5AD1A 2ZI9A 1KJ9A 2QLLA 4W8HA 1TJPB 5FBKA 2B1JA 3AXTA 3QBVA 4S3MA 3W2FA 2XCUA 3CSUA 1ZW1A 3DWGA 1CRLA 5FTWA 1EVEA 1RWNA 2OCBA 3IVMA 4L8WB 4BNUA 1RQXA 1ZOIA 2BY4A 3QFTA 5FXMA 5ARBA 2YKGA 4KXVA 5K99A 1CIPA 2XYGA 3R6TA 1JAIA 4KK3A 4N5HX 1T5IA 4O1HA 4O2LA 4C7MA 4X1KB 4P3KA 2CFRA 3DAGA 3LLUA 2W22A 3MYRA 2GZSA 3D1LA 3Q85A 1BFDA 2ZSIA 4HH0A 5CVDA 5DX0A 2PRJA 1U0FA 2JFZA 2X22A 1Z83A 3HKCB 1MLDA 1OFUX 1XV5A 1WW8A 2SKEA 3SEFA 3BE4A 1RVDA 2YMQA 3SKYA 4AS3A 2ZWVA 2Y0EA 4J9UE 2BKXA 1DRKA 3P5BA 4HDCA 1NQTA 3MMSA 3EPKA 2EWVA 1NMZA 2P69A 4CF3A 4QJ3A 1WCIA 1A77A 3MCWA 3I37X 2C04A 2XKBA 1FTGA 1GQSA 4IOMA 4KQWA 5F1OA 1M2OB 1TZCA 1X7GA 5AUOB 1EP1B 1XDDA 2XIQA 1HMYA 2R6DA 3TI7A 2RK4A 2WHEA 2WYHA 4M1EA 5AW5A 4CG2A 3R5SA 2VHZA 1QZXA 2ZBPA 3QXGA 4P5PA 2C4WA 1IMOA 2NZUG 2ZB4A 4PCLA 4QYSA 4W63A 4DB2A 4LYDA 2BM8A 2X5JO 5LSAA 4Q34A 4XWKA 3FTDA 1WVIA 4Q48A 4S24A 5JWHA 4E11A 1YZNA 1BVUA 2DUUA 4G5SA 3RUAA 5KC9A 5EUCA 6ADHA 3TUJC 5K3EA 4BN0A 2D5BA 1QG4A 5IJAA 4ZC8A 4RQAA 2C2ZA 2AI2A 1L7VC 1LBIA 2NWQA 3E4DA 3E7XA 4YRBA 2TYSB 1RKXA 1PJAA 1ZFNA 2HREA 1T8PA 1MRZA 4B71A 3OHMA 1UZAA 2BFBB 2FWAA 3FMGA 2R6JA 3ZE2B 3L4BC 3AZPA 1NVAA 2WM9B 4DPMA 1HG1A 2C2WA 4AM8A 1YL6A 2VDUE 3LV8A 3ZV7A 3F71A 3TQQA 1ADYA 3BICA 4EI9A 4NFYA 3VOTA 3R5FA 2Z3WA 5A6VA 2QX8A 2C2YA 2C77A 3OOEA 1LQUA 2VYNA 2XA2A 2DQYA 2ZYDA 3BIWA 1DIGA 5LQSA 5U9CA 4UEOA 1XMSA 3DWIA 4P0QB 3PC2A 4AZWA 2R86A 1TNDA 3RW9A 3ZHUA 4DHWA 4HRYA 4ALJA 2GASA 2NUTB 1T9DA 3MBIA 2FEOA 4U2KA 3RU9A 1U90A 3T3GA 1R3UA 2VRCD 4PY2A 4U2FA 1H5QA 3DO5A 3MIZA 2WMOB 3FTCA 1R50A 1J7JA 4BDTA 3L82B 4YONB 2GB4A 3TIIA 2XWBF 1EESA 3NTUA 1D0SA 3K9GA 3GLSA 1RLOA 3DKKA 1UOEA 4YALA 1M2KA 1OIXA 1AM4D 5HFNA 4FLFA 4ID9A 2C8JA 1VM6A 3C8DA 4U3JA 1Z73A 5HKAA 1V2GA 1X77A 5AYVA 1FNNA 1H9AA 3GX1A 5BW6B 3SYLA 3AY0A 1OSNA 1UODA 4YDQA 4UZEA 3MWJA 1JEQA 1LSSA 4N0PA 4UJ3A 2J09A 1FP1D 4QPZA 2WD7A 1Y3DE 1FA9A 1E6CA 1FL9A 1O58A 3A1DA 3IE2A 4RSHA 5ALVA 3ONNA 1ST3A 1J1ZA 3MJRA 1TT5B 3RU2A 2Y1CA 5PGMA 1H93A 1M5UA 4WXPA 3AR9A 1J70A 3INYA 3ROZA 4TKZA 5K8TA 2XGJA 5AT1A 2C98A 2I3ZA 3CVUA 1T4BA 2B7BA 1H8HD 4DQVA 4E3WA 4X0EA 3MT8A 5ECYA 5LP6B 2NU9A 1FLAA 2F9FA 4NDNE 3RKUA 1HEIA 4NIMA 3H7AA 1CDOA 4GI5A 3UT5B 1UMCB 4ZQGA 3I09A 1ZHOA 2EX1A 4MWDA 1AUVA 5CB4F 2H48A 3GVHA 2CVZA 3EMVA 4JIGA 4U9IS 4EBFA 5G4LA 3H9QA 2W93A 5DCYA 4PONA 1PWZA 3BG5A 3G8BA 3V9PA 5LXTB 5IAJA 3W2TA 1EMDA 5LUAA 3NKFA 4OXQA 1SD1A 1C9MA 1BJRE 3C1AA 2H9IA 3P2KA 1AE1A 2OLKA 4HAYA 1CD5A 2ZGVA 3CKKA 4QU8A 3ZQ4A 1IZ9A 4AP6A 4GBGA 5ICGA 4DUGA 5HG0A 1VDZA 4L27A 4URVR 3AETB 3FCCA 5B37A 1C0IA 5HJ2A 5LLTA 2X8JB 5KVQA 4LVUA 3EUFA 3K94A 3L4BA 2LW7A 2ORYA 1IFXA 2Q4OA 4E4TA 4PQRA 2NACA 1A3CA 4H7FA 3NIDB 2C5HA 3IKJA 3PITA 4L4RA 5HQ3B 1RDFA 1D2AA 1N32B 2QT1A 3SPXA 1C7IA 2DUWA 2IYVA 1NUQA 4ND8B 3N7AA 3W4KA 1Y8RA 2FH5B 4BX2A 1Q0TA 2HWKA 3N2EA 2HV9A 4N54A 5K3OA 3M6UA 3NAQA 1X1BA 3WISA 2JZCA 1MHPA 1II8B 1VKHA 4PHGA 5JWOA 2FP4A 1CLEA 3PA8A 1TU0A 3PNOA 3QA9A 4TQAA 3RO7A 3H5IA 3WWCA 5HRAA 3OPVA 3HG7A 3E9EA 3JASA 4MVJD 3EZLA 3TM4A 1DJOA 2D5CA 2DY1A 2C2KA 1YQQA 3QZUA 2PTHA 1I4TD 4PG5A 4WA7A 3UFXB 1NMSA 3BRSA 4C7OA 3L5OA 1G3RA 1T2EA 3LJKA 4CLEA 4Z3KA 3M6FA 1COWA 4M0EA 2I9KA 5ICSA 2HD4A 1YE3A 2ZZNA 3ZEAA 1CG6A 4KQIA 3DE7X 4ZREA 4ZT3A 1M0WA 3L41A 2NO7A 2C78A 2UXDB 3SR0A 2ASEA 3GH3A 4IL5A 3OZTA 5AI5A 1JN0A 2FJPA 3O1IC 3VYWA 4C0KA 2PMKA 4GR5A 1RI2A 4H6XA 1TZ2A 1FP6A 2DBRA 3V5NA 1XTPA 2FEMA 1LC0A 2OM6A 4QOSA 2ZRMA 3L4KA 4RXMA 3VPCA 1GT6A 1ZD5A 3G49A 3IESA 1J0CA 1LEHA 3NOOA 2GUGA 3DFKA 1OOEA 3ANNA 5C1OA 4UNSA 1HLFA 5FFFA 4KOEC 5DP1A 3AEZA 1PFVA 2NT3A 1LNQA 5AI8A 3DP7A 2PVSA 3RC8A 1G41A 5BN3A 1K8RA 3GLQA 4MK4A 4XOIA 4M46A 3RAFC 3CNBA 1TZKA 4J2OA 4KMOA 4QGHA 2XVXA 3MQFA 1JXQA 3KEGA 1H0SA 2Z5FA 4LC9A 1PQYA 2FPPB 4NCIA 1BEEA 3QVMA 5FOXA 2EFDB 2IYLD 3U5TA 2IOFA 2WPDD 1TADA 1O95D 3ZV6A 3LPDA 3AERB 1GQRA 2R6FA 3EC2A 2GF2A 3JYOA 4MW0A 5CK5A 2FWMX 4BNTA 5AUNB 1N8SA 2G7MC 1MAHA 2J5KA 2ZQYA 1VJRA 1X7DA 2FR1A 4P4NA 1Z12A 1LTKA 3LVRE 2BFEA 3N05A 4DUZB 3N70A 2F1JA 1NFQA 3H3JA 3MJCA 3LZCA 3UHFA 1PR5A 3VKVA 2W6PA 1OE0A 2WWFA 2J0QA 3B38A 1A4UA 3DT8A 1OIVA 1T6BY 2Q3JA 3JQAA 5IJ9B 2J67A 1NW8A 5GQSA 4Z7OB 4KPEC 1SU7A 1DAPA 3O3MB 4C78A 3L84A 1U80A 1S0UA 5KNCH 1U7PA 3E1KA 5BT9A 4KVGA 3IV6A 4OH1A 2OQVA 3WE7A 4EHIA 4PSDA 2XT0A 3BFJA 3OLYA 1HO3A 3V55A 3TE6A 3IDQA 1TD1A 2QLJA 4KN5A 5H70A 1IEQA 4IO0A 1G6KA 1XZMA 4BMDA 3ZZ1A 1ZGCA 2IP1A 3L05A 4OF4A 1JHUA 3U17A 4U2CA 4DB4A 3TXYA 5FTLA 4JI4B 1O6CA 4KPFC 1CQZA 2VJDA 1UFOA 1I7NA 3IP7A 4GZ6A 3QTTA 1QRSA 5GJBA 4I66A 4Y30A 4C76A 1B6GA 4M0KA 3TSOA 4CMIA 2AHOA 2GUWA 1U6KA 4B8WA 3N8KA 2BZ0A 4DJTA 1HWYA 2QQFA 4D1YA 4UATA 5ANRB 1GNRA 1RM4A 2I62A 4C4ZA 1DOHA 4KQGA 1L5KA 1FMFA 3M2TA 4FJ1A 4NCKA 3C4JA 4FYJA 1XN4A 1TFUA 1LS6A 3JWGA 1M1YE 1FEZA 3JQGB 2BLLA 1O94C 3HBFA 3IQZA 4IO1A 4X1OA 4TKLA 2V7BA 1LZLA 4JROA 8AT1A 1L5LA 4JXZA 2A0WA 3V1TC 1JPUA 5AK3A 1RQ2A 4F1JA 4MGKR 4ZHQF 1Z6GA 2CDNA 3EGCA 2WMNB 2ISQA 3ICCA 4A8HA 3U19A 5IJ0A 4IZOA 4KV9A 4Y2GA 4TS9A 2PNJA 3EH2A 2VPXA 4OFXA 4OHZA 1X14A 3TYXA 1JAXA 2HRRA 3A3KA 4QU0A 2XVMA 2GVDC 3GRAA 4Q9KA 4P0TA 2IX3A 6REQA 1VP9A 1BXGB 2B37A 2OCIA 2PV7A 4QUIA 4RGQA 4D6PA 1YDWA 2NOAA 4ZK6A 2PLNA 4G4GA 1B6TA 1G59A 1EP3B 2QAIA 3DE5X 2BH9A 3I1FA 4IDGA 2V58A 5SY4A 2HK9A 2VOJA 1TMYA 4GQIA 3JZDA 4BBJA 1M1XB 3HR4A 1P4JA 3IPLA 4INJA 3NXSA 5HF8A 5F2OA 1H2RS 1EUZA 3BMXA 5H59A 4CF5A 3C3KA 3KD3A 1D7OA 2WU8A 5I4IA 2QVLA 2X40A 4F3CA 5CFPA 3RUHA 3IBCA 2ZE7A 1D04A 2C94A 4MV7A 4ZYTA 5LOVF 4DR5B 3IP3A 4O2BB 3OQPA 1MTOA 4HPWA 1IY1A 3QY0A 3EW7A 4EX6A 5ESDA 1J2JA 3R8XA 5NLLA 3AHEA 4C14A 1FJ2A 1RXYA 2VWGA 4FZJA 3KJXA 3BXPA 4ENSA 2WJVA 1WSBA 3LBYA 2V97A 3DCNA 4HBGA 4L0MA 3MYYA 4ZRNA 3RRXA 3CPSA 3MUEA 5HILA 2RGYA 4AJ9A 4MO9A 1R0XA 2W6ID 5JI3E 2XOEA 4NBVA 1NQ5A 3KXIA 1YC5A 1NRXA 2QVCA 3VR6A 3WQBA 2E87A 4EY8A 1IHOA 1QHNA 5KMGA 1PJCA 2EV9A 4OLHA 1I3NA 3U4GA 1TO2E 1W36D 1T10A 3P7MA 1A71A 3UTCA 3COJA 4PM4A 4P84A 3E9RA 3WLTA 2SHKA 4ABTA 2O8CB 2C92A 3JQRA 2AJDA 1C4OA 5T4BA 3T7RA 2ZSAA 3S29A 3WKAA 4CUZA 1UOQA 1O94A 3KB8A 3O2NA 2GBLC 3SXUB 4EVIA 5EZYF 3HN2A 4RTPA 2EGHA 6PFKA 2O5EA 3OOYA 1SZJG 3CYFA 5EIHA 4ZI2A 3NOVA 2ZUWA 1QIEA 1KQNA 5KTTA 2FSSA 2F1HA 5EKDA 3RVBA 3M9LA 5GONA 1U1GA 1H23A 4TT8A 2UZAA 3ZHOA 4FSDA 2DPLA 3QPCA 3L1HA 3R9XA 1NA5A 3LSTA 4HB3A 2V65A 3FZYA 5GJVC 2ZT5A 3K0FA 5GZ6A 1ZITA 5B57C 1BKDR 1QOZA 2W6JD 1CUHA 2J59A 4ZO7A 4K1XA 4AX8A 1UEXC 4F97A 1IY0A 1MAUA 3I01A 3WWZA 3CF0A 1FFGA 1ZHFA 5B6JA 1BOOA 1LB1B 4PC7A 3WYDA 1T0JB 4QTYA 1CZKA 3ZHVA 3LH5A 2QXYA 5FLYA 1LDNA 4FVTA 4X65B 1KZGB 1KOJA 4F84A 3HY4A 1GRNA 1I4OA 3UC5A 4BVHA 4IIVA 1LZKA 2RHDA 2YZNA 1O97C 2JZNA 4J90A 4X8OA 3BFPA 2ZYAA 3H9JA 4CM9D 4XVCA 1GDDA 1GNPA 2D59A 1YGYA 2YVKA 2AEEA 1PZNA 1IHPA 3MHPA 4K6OA 1OCEA 5TQ2B 3WB9A 3G79A 1PO7A 3ANTA 1PHPA 1ZVKA 1X7YA 3C6ZA 1D0IA 3QPUA 1O5TA 2WD7B 1RFLA 3PQ5A 3O4GA 3OD1A 3ZE6A 2QSUA 1UOOA 2MYTA 4F9FA 4BGEA 1GL9B 4KR3A 1HTBA 2X13A 4CDGA 2BEUA 4D7AA 4W1PA 4JYZA 2NAPA 2DUNA 5TE9A 4CKYA 3KAKA 1X8LA 1A2KC 3CNOA 4X7RA 4YJFB 3TRJA 1IB6A 1WXEA 1JIIA 3C1OA 4J29A 5FNVF 1VL8A 2BFFA 1GPMA 1LPMA 3VAYA 1EDOA 3TLKA 2XDWA 4QELA 4YCSA 4ZJYA 3KWJA 1LF0A 4FD3A 4ZVQA 1JHAA 5AKJA 4A2WA 3FPAA 3GARA 3WYCA 1DIBA 4K2AA 5EQFA 3RGWS 2HU8A 4UC0A 3B5JA 3T5MA 4YAUA 2C82A 2VDLB 4MQFA 2M1ZA 2PK3A 4QFBA 4BKOA 2P9TA 3IIIA 4QPDA 1FLDA 2HO4A 2C3MA 4WLNA 3M6AA 4BVFA 3MGKA 3OLQA 4L51A 5FCDA 1K89A 3TNFA 3KLBA 1CJTC 3GQVA 4NAHA 2R60A 5F2NA 4PGFA 4TUYB 4DADA 3KQQA 3NOXA 1F7VA 4WOBA 3B5EA 2GCOB 4NZPA 3QMMA 2R751 3OHPA 5LZ2A 4E21A 2G1PA 4M1QA 1YCDA 5TPZA 1JH9A 1V3UA 1X38A 1PDWA 4IKEA 4OQDA 2P6UA 1L4UA 2YN4A 3PIIA 3IAAA 3DKVA 4LHVA 4CKZA 2A9PA 3NHPA 4E94A 3U09A 1G16A 3HJGA 4EFNA 5IH7A 1BNCA 2C88A 2Z8ZA 1JQKA 2WWIA 3JATB 3VU0A 1E9BA 4JVLA 1OZAA 4L50A 3AVPA 2V74B 3ZDQA 1W4RA 2GBPA 2I1LA 2XSZA 2YFYA 4I1IA 5JQWA 2BEJA 2G76A 4OB8A 1LI7A 3TNYA 1PJSA 1EX9A 1YJXA 3D8TA 2AK3A 3HGQA 4AVYA 2EJBA 1P1IA 4O4IF 2XKJE 3KXDA 4GT1A 1UDBA 5FNZA 1Q1NA 3HL0A 1FNMA 3CLUC 4KUEA 2FP4B 8ATCA 1J5XA 2F1IA 1Y33E 2ZS8A 2DKNA 3IUJA 4RMIA 3EZNA 4KWTA 4IJQA 1GV1A 2L42A 1YVEI 3ZCRA 4B73A 4QJBA 4DVJA 5I3CA 2X3YA 1VL1A 4PTZA 4LISA 2CHGA 1PSDA 3PJEA 1VDMA 4QASA 3ZNNA 3PQ4A 4MI3A 5JS6A 1KQGA 4J7UA 1TCCA 2ZYRA 5J2UA 3IUPA 4CQLA 5KYYB 1OPXA 2J3EA 3BDAA 4AY3A 4IHAA 4BV8A 3JALB 1MVNA 5HUQA 1UWCA 2J46A 5C4GB 3W7VA 5HJ7A 5KYGA 2QM0A 2D0IA 4UVEA 3IQEA 2H1VA 4TTRA 4XJXA 1XO1A 2VP4A 3WMXA 1Q95A 2FW1A 4H4DA 4HJXA 1ZOLA 1OIWA 3JY6A 4JLWA 4MZXA 3F67A 3R7DA 1NXVA 4OATA 3PFBA 4IQFA 3KU4A 2AN9A 4J43A 2MSWA 1BQ4A 1JU9A 5FHRA 1Q7EA 1JMVA 4Z9AA 1SM4A 2NP6A 2WABA 4P7BA 1E4EA 2QMOA 4BFYA 4PZPA 2WAXA 1SZDA 1WUTA 4MPTA 4QD3A 1LDGA 3N28A 1Y8QB 5GADl 3L6DA 3SEQA 3IH5A 1U8ZA 2ISSD 3IUBA 4WBNF 5BN3B 4ETIA 1GZDA 5IWCA 1RWQA 2B98A 2PKWA 2LR0A 2R1TA 1PRYA 3DMDA 3HA2A 3JVEA 4WCDA 1M2HA 3V6MA 2YZ2A 4PX2A 1KR5A 1V8BA 2M6RA 4FN5A 1J0EA 1GGFA 1OZ0A 1IPEA 1QR6A 1OHHA 3LCVB 2ATXA 3KX2A 5DFAA 5K4HA 3MT9A 1Q3KA 1VI2A 3AILA 4XIJA 5K0LA 1SOVA 4RNDB 3SJBA 2DHDA 4AO7A 4AKSA 13PKA 2BFEB 2FPUA 3D6AA 2X42A 3ZZ0A 4TMFA 3MZ0A 5BN1A 5TB5A 4GMHA 4QM6A 3A9VA 4QSHA 2WKWA 3BMNA 2AD5A 3DZJA 3OUUA 1BCSB 2OZPA 1UP6A 4HMQA 1U7OA 4UE3S 2WTMA 4AURA 1P4GA 3PEUA 4GL4A 3CCFA 4JSRA 2RJOA 4C6TA 2JRLA 3U60B 4LFAB 1YE5A 2JVIA 4QJ5A 1CY8A 4RH1A 3WMRA 2ZR0A 1WSWA 2O7RA 3QYJA 2TS1A 2SKCA 3RSHA 1U2DC 1H0KA 1E1RD 2BDEA 3BRCA 3NUQA 1Q2XA 5C5CA 1GGKA 5J59A 3JS5A 3OFJA 3GGCA 1ZNYA 2P90A 4ZPJA 4E5MA 2AKEA 4KQ1A 1JA1A 4WFKA 1YHZA 3OCYA 1S9DA 1GPDG 4EF5A 1IEXA 3MGGA 1NDQA 3HA5A 2ZSFA 2EKLA 4OBBA 5EC8A 4YQFA 2QD5A 2RI0A 3X2EA 3OFND 3SC2A 3QKRA 2XCTB 5KUTA 3O31A 3W5HA 5KTNA 3BM5A 3R7NA 3IQHX 2NXNA 3GZTB 5LP1A 2PGNA 1QK4A 3AWIA 1W4LA 4ARIA 1TAHA 4X41A 3FLMA 2PUDA 1VL2A 2H5IA 3GVCA 4UEKA 4W1QA 2HL6A 2VWQA 3NAMA 3ZCTA 1UJ4A 2QL9A 4N9QA 4YRLA 4B43A 1DJNA 3Q9SA 3I04A 4N3AA 2BYTA 1D9ZA 1Q6ZA 1RMTA 1M6VA 3C0KA 3QXCA 4C3VA 4TTTS 2HLDD 2EWMA 5EZQA 3HYRA 4MYTA 1FRZA 2IODA 1S8OA 2FX3A 1WQ3A 2QN3A 2V6JA 2VYFA 3DAOA 5DRYA 5DU2A 1AMUA 3V42A 3T99A 4MROA 4OU4A 3JQ8A 1Q1ZA 1NXQA 2RGDA 1GU7A 1Z8FA 1M2JA 2FUG6 2P6PA 3W4JA 1JKJA 1JFFA 3AK4A 2XEDA 2ZJ5A 3EEYA 5TQ0A 4PICA 3TOXA 4QUKA 3M6IA 2YZMA 1E7SA 1RC1A 2V6MA 2WM8A 3Q5EA 6REQB 5CBPB 4R0NA 3BHIA 3GLHE 4GX5A 4GAEA 4PYQA 1BFKA 3KHTA 1I7PA 1JDVA 1SXJD 1W0CA 2QSJA 3QI7A 2GYUA 1YBMA 4J6FA 4P54A 5KNCA 4RL4A 3F3SA 4MO2A 3RUEA 2H11A 5DN9A 5A5VA 4MKZA 3WLNA 2G71A 1VFNA 3G8YA 4FR5A 4LSZA 1RZRD 3CX3A 2J32A 5C31A 2C0PA 1HT3A 1N5MA 2G9UA 3PUJA 4YMLA 3GLIE 4G0VA 3TDKA 2R8BA 3WWEA 4DCSA 3UWOA 1D2EA 1NJ8A 4KXLA 2C9BA 4RA6A 1BD4A 1YZHA 4MW9A 2Q50A 4UMDA 1B23P 5KU1A 4O5AA 3TL6A 1BH6A 1KIMA 1WPXA 1ZA2A 2VVTA 4ZCSA 2V7WA 2CNWD 2XMRA 3NALA 3WWYA 5LIRA 2I7XA 5IAOA 4GM0A 5GM1A 1Z36A 1L1FA 4PAOA 4AJKA 3HCNA 4F5DA 1HMPA 1W5FA 1FZQA 2DF8A 4AU1A 2CNNA 1U2DA 4G65A 2JBAB 1TLLA 2D1RA 4IZHA 3WNCA 1FSGA 3S5JA 3FCAA 5A4MS 2Y1WA 3DE2X 4MKRA 1OLXB 2NQ8A 2TECE 4G8BA 2QE6A 2JGAA 2FHPA 1WZ2A 4YJ3F 5KVAA 2Q3CA 2QLTA 1I9GA 1HFKA 1SCAA 2Q28A 4KXWA 4QXOA 4BNLA 3F1LA 2AFHE 3KVNA 1BHQ1 2XHEA 4EOGA 3HKEB 1WMDA 1ABEA 2VUHB 5EIBC 2ONCA 1HQKA 2QQGA 5IBCA 1P9WA 3QITA 3W9SA 1ZGJA 4KN6A 3PEYA 4FB5A 3KQLA 5TGDA 1QAQA 3LM8A 2IV3A 3S81A 1UC9A 1UWLA 4RWEA 1RW4A 1V2HE 2DQKA 4FONA 5K05A 3K8OE 3CW8X 3B6JA 4OHBA 1I30A 1LDBA 1XJQA 3DBOB 1KQFA 1IN1A 1XUOA 3L77A 4LF6B 3RG2A 4U00A 4Q1EA 1J8DA 4WBXC 1TVEA 4IQ8A 4YYEA 3IQWA 4N3CA 3QU9A 3H1FA 1J5PA 2C97A 3TKYA 3L7NA 5LQNA 1ZM9A 3DG9A 4NI5A 1R2QA 2EQAA 3LBFA 3ESCA 2QLNA 3I72A 4FHFA 3R9XB 2J0SA 1T9GR 3Q8WA 4LJ6A 5HOQA 3K0FB 3RT1A 1GA6A 5CITA 2JGFA 2VP6A 5JMOA 3NATA 1SUPA 2KS6A 3TAUA 1ZRSA 2ERCA 3ZD6A 3FPGA 3PT9A 1DTWA 4KREA 4CMCA 1R8SA 1KK0A 3AP1A 3LHDA 4MDEA 1OXTA 5F98A 3EXEA 1ECLA 2FN7A 2KBEA 4QBFA 3BS4A 4PBRA 4GYWA 2PL1A 1X1TA 4HPJB 1EQ2A 2JGJA 3QX9A 1K8YB 2ZJ4A 1H94A 2QR3A 3ASYA 4I9HA 1AHIA 2AJLI 2DBZA 5ALQA 5BR1A 5J40A 1GTVA 2I6SA 4EENA 2B5WA 4L5IA 3DPIA 5JHGB 2CXUA 4IHJF 4QTUB 4ZMSA 2C31A 1ZESA 1DOZA 4D57A 2DLCX 3IGFA 2WVHA 3U31A 1WOMA 2NNLD 1W47A 2FX5A 2GJSA 3BH6A 3FNQA 3NDPA 4NENA 1Z2PX 2AK2A 4QUHA 5FOTA 2GHTA 3KZNA 3GLUA 3UAWA 2ANBA 2F1OA 1JSLA 1K75A 3USES 3BTOA 4DEVA 1YH3A 3SBOA 5ITVA 4R8VA 3KZCA 3SR4A 2JDID 1CU1A 3VSBA 4YS6A 4QU9A 1XRLA 1KYIA 4ZAXA 1DC7A 3I5XA 1GT91 1RWMA 4FDVA 5IANA 5C8XA 3TLJA 3ADKA 1M1YB 2VHWA 3HCPA 1H8ED 1V96A 2HAEA 4X6YA 4DMUB 3FOBA 3DHVA 2JJMA 1CRQA 3FNRA 4PN7A 2BFFB 1UK7A 3IQDB 1Y34E 3O8RA 4N1AA 1CIVA 1JYFA 2J07A 2BH2A 5IC4A 4LPSA 4CYMA 3LQ1A 1YZVA 4KIWA 3EOZA 5JJCA 2X4IA 2XB9A 3ZJUA 1Q0UA 2G07A 3VZSA 3MTDA 2W5UA 4GKAA 3PFKA 3BSSA 5F7ZA 4YIKA 4RIIA 5IHXA 1L9KA 3WWPA 1J07A 2NUPB 2YOFA 1DKLA 4YT4A 4G86A 4R31A 1AHHA 2ZJ8A 5HQJA 3WSWA 1ZVMA 4J2HA 4KFTA 1BMFD 1E2HA 1JEAA 2C4TA 5KX5A 1Z2AA 3RAJA 3PHGA 3RC7A 2QORA 5JRDS 1PFGA 3QE4A 1EFRD 2IHBA 3KOZA 3PDIA 1NI4A 1RCFA 4RVOA 3Q88A 3RABA 1CY4A 2IS4A 3H05A 2JPDA 3ONWA 4FDLA 1WTCA 4P4LA 4AUNA 1ZNXA 1KTIA 2WU1A 5G02A 4ER6A 2P6OA 2XNJA 4B47A 2WB2A 2HCBA 5TSDA 3LK7A 1KI8A 3EFEA 1SG6A 3GJ8A 4O4JA 4ETNA 2OBLA 2WPNA 3UMGA 1PWXA 3GZJA 3EPLA 2E5FA 3AR5A 1ZUHA 1E3DA 3ID6C 3KT8A 3T94A 4TZTA 4RANA 3TNDA 4OXIA 1RXWA 4RVSA 1RRGA 4INAA 5CGQB 1XDWA 4POOA 3VNSA 2QNRA 4MIOA 4AQYB 2GYWA 4HN2A 2IOYA 1IZZA 1MP0A 2FQQA 2VJAA 2WTNA 3GH1A 4GH5A 2GSDA 5ALKA 5G53C 3RYHB 1YJAA 5C7YA 2I2AA 5FUBA 3SFTA 1DEXA 3QXHA 3T7DA 5KTRA 4FM9A 2VBGA 1Q22A 4BAUA 4CQLB 1U6IA 5DOVA 4IDQA 4NMXB 1L1EA 1C4WA 2EX0A 3OIDA 3MN1A 3LDGA 1P2FA 3KB2A 3I61A 4XH9B 1RHJA 1OWMA 4RE6A 4CEIB 2YJ5A 4HY3A 2FEWB 5COAA 2HA3A 2E1PA 3QNMA 2UZ4A 1C7EA 2Q0QA 3KSZO 2RGRA 1F3LA 1J0AA 3S99A 4ZQCB 2AFHA 1C9JA 1FF9A 2ZRBA 1OLOA 4C87A 2ZCUA 1N0VC 1GG2A 2FPIB 2JRCA 2X0KA 5DNEA 5A06A 5K9ZA 3OIFA 3P2OA 2B4AA 4KL8S 1X70A 4ICIA 4QPJC 2X6RA 5BWMA 3ESZA 3OIVA 4J0GA 5AKYA 4BVLA 2VHVA 2JI7A 1BKSB 4AICA 4E6PA 2OXCA 2F17A 1VB5A 3ROMA 2X15A 3LA6A 4A0QA 2RGUA 3CFYA 1JIXA 2CCKA 3G6WA 1Y4UA 3MF4A 4WRRA 5EIFA 4OKSA 3RUDA 3HFJA 4JSTA 2XUZA 4AZTA 4BQSA 1DB3A 5EMNA 4E1VA 4DUYB 3EWAA 5F3DA 1GADO 3RBAA 1JALA 2GZRA 2WIFA 3UJAA 4BX0A 2JIOA 5SV2A 4EYEA 1SHKA 1K63A 1TYCA 4EF6A 3BFVA 1RJGA 1AGPA 3BSYA 3V4OA 5LWHA 1EGVB 3PLRA 3TW4A 2OOSA 2R5WA 1FNBA 1GWNA 1O3YA 3HDGA 4LBZA 4MYRA 4QPPA 2P9QA 1RLJA 1T35A 2IYRA 3QEOA 4DAOA 4RKYA 4DLWA 1XNQB 3ZY3A 1PS8A 2XH8A 2PE5A 4C6TB 1YUNA 4OH7A 4DLUA 1JHQA 5EE9A 4ZQFA 2W6MA 3PK0A 2JF0A 5IK2A 3E3AA 3SE7A 3DPUA 3KKNA 1U0HC 4CCAA 4NCJA 3E3LA 5E2BA 1AUXA 3SHVA 3LT1A 5L9AA 1KPGA 2J30A 5FA5A 2RARA 3I5YA 2RGGA 5AJWA 4P35A 3TJRA 3F0TA 5HZHA 1AK9A 1IAVA 1Y98A 3PIDA 2H92A 2RG7A 3ZVLA 4AJHA 1TIKA 3TQFA 3OZAA 3OEEA 1MD9A 2IU6A 2FN3A 1C3EA 3N07A 1NYRA 2ZYHA 2ATIA 5AKGA 4I6JA 4JR2A 3TAHA 4AAYA 2X4GA 3PJFA 2BP7A 4P82A 1WDKA 2FFBA 4OKNA 4DR2B 3IPRA 1R4NA 1YVRA 4FBMA 4LRYA 4QQRA 4RTMA 1Q15A 1D1PA 4NDAA 1C0PA 4OX9Y 2O2CA 2NZWA 3EIEA 4M38A 1EJBA 5DM70 1U2QA 4JOBA 2IYWA 1M6VB 3VGJA 2QXUA 3IX7A 4QOFA 2Y71A 2ZFUA 3SZGA 1A9QA 1EFAA 2ILVA 1QZTA 3EQ6A 4AJ1A 4NBTA 4AMYA 3VR3A 5JS1A 5B3KA 2DJIA 4PZCA