4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
2J4FA 3HRHA 1KU6A 4FFVA 4FKBA 1VE6A 5AKHA 2ACEA 5IVKA 1XZGA 3IUNA 4BP9A 2VQ6A 3VVLA 4UUQA 1K63A 1HL7A 5FXMA 4L9AA 4FLMA 3IUQA 1BU8A 1XZDA 4H77A 3O9VA 3RLIA 2JGEA 2XMZA 4PSUA 3KXPA 1VZ3A 5JIBA 3A2LA 1XLWA 1R50A 2Q0XA 2R11A 3HI4A 3G0IA 5FOQA 1P0IA 1BEZA 4MYDA 4L0CA 1LGYA 1JMKC 2DCMA 4C01A 5HK9A 1GPLA 3G0BA 5AIAA 2R8BA 5AI4A 1CUSA 4NMWA 5AM0A 2H1IA 1HPLA 4OB6A 4BYMA 2J3DA 4DLNA 4DNQA 2JGMA 4X93A 4AX4A 1QO7A 4HZGA 5JARA 3F98A 2Y2UA 2ZJ7A 3UUEA 3EQ8A 4LXIA 4HXEB 2ZYIA 4N5IX 5JAHA 5E4JA 1DTEA 2Z3WA 3QITA 4ITVA 1CUZA 3V1KA 1OILA 5LLSA 4DMFA 4B80A 4X85A 3BIWA 4Y2SA 1PV1A 4UFPA 1GQRA 3BXPA 2OCKA 4FFWA 3HXKA 1W76A 5ALQA 1BRTA 4CCYB 2D5LA 3DL4A 1CUWA 3S8YA 2C58A 3EBLA 2BUBA 4H7KA 5I7UA 2WJ4A 1ZD5A 4N8SA 3S2ZA 1TAHA 2QRUA 2HFKA 4YASA 4DNFA 4OU5A 4QNNA 4BZWA 3W05A 4EY5A 1MX5A 3JWEA 3PICA 3DLTA 1X70A 3R3WA 2V96A 1MX1A 4PF1A 3K9BA 1WB6A 2O7VA 1HQDA 1MN6A 2EDCA 1H2WA 3ZPXA 2WU4A 1PFQA 2XUKA 5C8ZA 5AICA 1LPPA 2WUEA 4UBMA 4G4JA 4EY4A 5JASA 1XZEA 4E46A 1E5TA 3DDUA 4WFJA 2OCLA 3P2MA 1QIIA 2UZ0A 2XQFA 1ZIXA 5CBKA 1A88A 1J06A 2VF2A 1F8UA 3BDVA 1W52X 2JF0A 1SFRA 5LKRA 1CUDA 1R88A 1DWQA 1MU0A 3OG9A 5K3DA 3PI6A 5FLKA 5T4FA 3UMJA 2J3QA 4MQMA 4O08A 4QDXA 4X91A 1VXRA 4X95A 4N8DA 3WK7A 4BC1A 3BWXA 3IDAA 2XUIA 4J0GA 1JMYA 2FJPA 4G5XA 4KAJA 1K8QA 2Y6VA 4Y2XA 3TJMA 5ALHA 1P0QA 1DU4A 1VOTA 1SCKA 3LIPA 2QXTA 4OB8A 4QDTA 1IMJA 4MYSA 1TKRA 4J0IA 1TK3A 5AIBA 2PSJA 3B12A 4ARBA 1JU3A 2HIHA 5JAPA 5BWCA 4GXNA 4G4GA 1QIMA 1EDEA 3H0CA 4NVRA 1R4ZA 3WL6A 2WUGA 3NOXA 1QTRA 5EFZA 2XUDA 4CI9A 2PU5A 1CUJA 1FFAA 1XFDA 4BCBA 4B83A 3IA2A 4ARAA 1XZJA 4WCVA 2G5TA 3WL7A 4EY8A 5EIHA 4K6KA 4BTVA 3WZLA 4JYPA 4Q82A 5K3EA 4KR0A 1NU8A 3H1AA 5C8XA 3T4UA 3FYUA 4PNZA 2C5FA 1QE3A 1DX4A 1AUOA 3M3DA 4YX9A 1JJFA 4X7BA 5CW2A 5AKIA 3R40A 4ZXFA 2VEOA 4RE5A 4GI1A 2O2GA 2JGJA 5AKZA 2WHQA 2HA2A 5AK5A 1K4YA 4FWBA 3M83A 1GZ7A 5AI8A 1ZICA 4RNCA 2WG2A 1QOZA 3E3AA 2HRQA 4B7ZA 3O4IA 2RHTA 3VKFA 4AO6A 3R3XA 5AI6A 5D3KA 4OUKX 2W22A 4J0JA 2ROQA 3MUNA 1EB9A 2HADA 5JATA 1D07A 2OGTA 1ZGBA 3G9UA 4BAZA 2JGLA 3ZLUA 5K5EA 1C4XA 1G66A 2HA3A 3SK0A 5K3FA 5D7BA 4MQLA 1JT2A 1LPBB 1T4MA 2GBIA 5I9IA 4BE9A 1R1DA 4WDQA 3GUUA 2WUDA 3DEAA 1EB8A 3GROA 1K6EA 3WK9A 3C45A 3QMVA 4K2AA 2XQJA 4OB7A 3R3YA 1F6WA 2CBGA 1DINA 1Q0RA 1WPRA 3DKKA 2XLBA 5LZ7A 3K2IA 2GBGA 3NGMA 1XRQA 1UXOA 2B20A 5AKJA 4HRXA 1ZD4A 2QTBA 4U2FA 1W4LA 2WIKA 3ILSA 4B85A 3QM1A 3FWHA 4W63A 3T52A 3DOHA 1MPXA 2Z5GA 4BRSA 1CVLA 3W9BA 4ZWNA 1CUHA 2NW6A 2OCIA 4GW3A 5DYWA 3WL5A 1VLQA 2VTVA 5HF6A 2DHCA 4W9RA 5EHZA 2ACKA 3H2HA 4ZI5A 2QUAA 2B4KA 2W6CX 4DMCA 5DNVA 3C8DA 6YASA 2PSEA 2XMSA 5ALEA 2WILA 3C6BA 1XQVA 2QJWA 3JYHA 4JYMA 3L1HA 5ALTA 1IUOA 5ALPA 3BJMA 4AZ3A 4LXHA 3I1YA 5YASA 4C88A 4F0JA 3RK4A 1G5FA 3WKEA 1THTA 2ZJ6A 1H2XA 3BDIA 3ESDA 3I2IA 4B9EA 3BF7A 3AIOA 4XIIA 3EF3A 3IULA 3G9XA 1H2YA 3JW8A 1YSCA 3VJMA 4JEIA 3ZV7A 2PU7A 1CUVA 3R41A 4GDMA 1ORWA 4PSDA 5HZGA 1XKLA 5ISMA 3SX4A 1RWQA 1LZKA 1A8QA 2V97A 2VSQA 2OPHA 3LLCA 4K5QA 3C6YA 4OYYA 2XUAA 3D7RA 4AO7A 4CG1A 4IO0A 5ALSA 1BCSA 1FSSA 1RYYA 2WFLB 1QO9A 4A16A 4RE6A 1BN6A 4RPCA 3RARA 3HACA 5ALYA 4ZV7A 4Q1VA 5ALDA 5AKLA 2I3ZA 4U2DA 1YS1X 1UKBA 1FFEA 1E8MA 2VT7A 4EBBA 4KE7A 2BJHA 1XZCA 2LIPA 3QPAA 3Q8WA 5A71A 1B6GA 5LZ8A 1WB5A 1H2ZA 1MO2A 2AJBA 4H18A 2WM2A 4J7AA 1WOMA 4UHCA 3TGLA 2PVSA 1K5PA 3G9TA 4X94A 2XMQA 2IITA 2C4HA 1H23A 3G7NA 1U8EA 3AIMA 1YA8A 4UFOA 4H7HA 2WIFA 1XZBA 1Q83A 1UZAA 1UK7A 2HFJA 4W1SA 4HAIA 3FAKA 4EY7A 4MWTA 2H7XA 4UBIA 5AKEA 2ZYRA 4FDMA 1EDDA 5JADA 2PKYX 2VJAA 5K3AA 4N8EA 4OCZA 4H7EA 5AM5A 1YASA 5JD5A 3G9ZA 1VJ5A 2X76A 4DNPA 1QIGA 1YS2X 1ZOIA 4XX1A 2XMCA 3C70A 3WWDA 3N2ZB 5AI0A 1XRRA 4FLEA 2CEKA 1MNAA 3CCCA 1I6WA 4I19A 1XLUA 3VJLA 1HDEA 1P0PA 4IH1A 5ALVA 5DNUA 1FFBA 4D9JA 5JYCA 2CUTA 4Y2UA 3ICVA 3STWA 1BS9A 5IVHA 1UKCA 3DCNA 5LZ2A 5AKGA 2O7RA 4B9AA 2XUFA 5LZ5A 3I6ZA 2WIJA 4HRYA 2JEZA 4F21A 4WY5A 3WWEA 3G0CA 5JZBA 3WKBA 3R3ZA 3FYTA 2QXUA 5C7YA 5CT9A 4JUIA 2G63A 2WIDA 3H2GA 2O2IA 2ONCA 5AI9A 3WJ1A 5DNWA 5F4ZA 2I03A 4M0MA 4Y9SA 3AUKA 1XZLA 3FVTA 3ESAA 1XROA 4N5HX 5HF8A 3MGAA 1EK1A 1TCCA 4AN1A 2PSFA 4INZA 5LKAA 2WTMA 4AB1A 1XZFA 5AM2A 5ALUA 4KJXA 3WK5A 3FCXA 5AH0A 1THGA 1O6GA 1XRNA 1KEZA 2OG1A 4K6HA 2YASA 1QIEA 3D0KA 2RHWA 2XMBA 4BAGA 2XDWA 1IUNA 4HTAA 5EGNA 2Y2VA 1TIBA 4W1QA 4Y2PA 1QFMA 3ANTA 5EHQA 2P8SA 1ZI8A 2PUJA 4AXBA 1B41A 4BVLA 1J2EA 2ORYA 5HCUA 1CUUA 3LIIA 4Y7DA 3ED1A 4BB0A 4I4CA 1JJBA 5CH8A 1J07A 3WIBA 1CRLA 1Q0ZA 5SYNA 1ACJA 3MUOA 5FRDA 2GZSA 3PE6A 1L7AA 4CFSA 3W04A 2BFNA 4B6GA 4LKOA 5LZ9A 4AMYA 2I3DA 2WHPB 1R9NA 5AJHA 4E11A 4C4YA 1SCIA 1LPMA 2WHRA 1XQXA 3IUJA 2GYWA 5A7HA 1BEEA 2AJDA 2JIDA 3V1NA 4B82A 5I8PA 2WUFA 5AK6A 1SOMA 2XMGA 5CMLA 4H7IA 5BV7A 1UKAA 1N5MA 1P0MA 1FFCA 2XUQA 3IBTA 3STUA 4WFIA 5CXUA 2OXEA 2BUAA 1UT6A 5EHXA 4WY8A 3QZUA 3HSSA 1U2EA 2BUCA 1QIHA 1Y37A 3CXUA 4LYEA 3I6YA 5CT5A 2OAEA 3H2KA 3D3NA 4KE6A 2XLCA 1UK6A 2I78A 1O6FA 4QDUA 4KAFA 1JKMA 5EI5A 1L7QA 3GELA 3L1IA 5DYYA 2JGFA 3FBWA 1QIJA 1W75A 2GYVA 4BTLA 3CN9A 4FNGA 3STYA 1QJ4A 1Y7IA 5ALXA 1GGVA 2OGZA 1ZIYA 1HLGA 3QPDA 2EDAA 5ALZA 5JZSA 1WCYA 4QDZA 2AJLI 3WYNA 4BCCA 4Q3LA 2D0DA 1XQWA 5ALRA 2HDWA 1JU4A 2QJRA 3NUZA 2ZSHA 3DL7A 3N0TA 1LBTA 5DLPA 2XUHA 4B81A 3HLKA 3O9MA 3C6XA 1CUBA 4U2BA 4H7JA 2JGKA 2XUPA 2XI4A 3NWOA 4F60A 1WHSA 4P93A 3KOOA 1W1IA 1XKTA 1YB7A 3VISA 4EHBA 3GA7A 1IZ7A 5T4BA 4DYHA 5AM3A 3UUFA 2YYSA 1UFOA 1CUXA 3F96A 1AC5A 4TVKA 2AJCA 1L7RA 5SYMA 3WWPA 3DJYA 5CURA 5HFAA 3G0DA 1LPAB 4QZVA 5ALKA 2FUKA 2DQYA 1AZWA 2QZPA 3C5WP 4GBGA 2CKMA 2C7BA 1ZGCA 3W9UA 3C8HA 3SC2A 3WQHA 3F9CA 4BDTA 4C4ZA 5CT6A 1S8OA 4QLAA 3QH4A 5JANA 3VJKA 2QM0A 3DD5A 2JBWA 2H7CA 1GKKA 5K3FB 1VXOA 4FMPA 5KWJA 4KRXA 1XZKA 3PUHA 2HA7A 4DSZA 5ESRA 5AK3A 3WKDA 2HA5A 3ZWQA 5DWDA 2CJPA 1UOQA 3DYVA 5E4YA 4UBKA 4GECA 3W2TA 1VA5A 2OLEA 4FBMA 1MAAA 3FYUC 2FJ0A 3EQ7A 1C7JA 2ECFA 1A7UA 2HU5A 2IIVA 3I2FA 1SCQA 1A8UA 1XQYA 2YH2A 4KE9A 1QZ3A 3OC0A 1U65A 4TGLA 2PL5A 3V48A 3QYJA 2BKLA 3FOBA 3DQZA 2QVBA 3WK6A 3Q0TA 2EEPA 3M82A 3ZLVA 4BVJA 1ZJ4A 3M81A 4KYVA 4UHFA 4UBJA 2HM7A 1LPOA 4MWSA 4C6HA 5AI5A 4E15A 4DTCA 4V2IA 2PUHA 4WJLA 5ALFA 3KDAA 2C0PA 1BCRA 2Z3ZA 2ZVDA 5ALIA 1T2NA 4EY6A 1EVQA 4OPMA 2ZJFA 1R9MA 3V9AA 3LCRA 1YCDA 5A2GA 4G8BA 1Q84A 4X71A 3FVRA 5DJ5A 1ODCA 4Q34A 4G4IA 4MXDA 3A6ZA 1N1MA 4KRYA 1E89A 1HKHA 3H2IA 3YASA 3HJUA 1IVYA 3BE8A 3OPMA 5BOVA 1DT3A 3I1IA 1LPNA 5CH5A 1DWOA 3O4JA 3IURA 2HA6A 2O2HA 2HRRA 1E8NA 3WI7A 4X6XA 2GYUA 1ETHA 4UBLA 3FSGD 2OQVA 2Z8XA 5J3JA 3D5EA 4EZIA 1U4NA 2WFLA 1GKLA 4S0XA 1AX9A 1VA4A 2RGUA 3DKRA 1IUPA 5A7FA 1YB6A 4J0HA 1XZIA 3STTA 4QEKA 1YAHA 2C5GA 4QDOA 3I2HA 2HA4A 3VVMA 3F97A 5FUMA 4P08A 4H35A 1DQYA 5HQ3A 4I3FA 3BJRA 5AM4A 2PSDA 2XT0A 5KBYA 3LS2A 2DSNA 3U1TA 4BBZA 4M0FA 5T4HA 2VAVA 1Y7HA 7YASA 4X97A 4Y2TA 1E3QA 2PX6A 1VKHA 1CQZA 1E8DA 4Q3KA 2WQZA 4PO3X 4M0EA 4X90A 1AGYA 3AINA 3PUIA 1WHTA 3D2CA 3F8SA 4ROTA 5FDFA 2Y1KA 2JEYA 3WA7A 5IVIA 1NX9A 2C0QA 1QFSA 3AIKA 4ZRDA 3RKSA 3ESCA 5ALLA 1ISPA 4DMKA 2RAUA 1EXWA 4MEBA 5C81A 4OYLA 1TCAA 4UPDA 3FNBA 4PSCA 4G1FA 3I6MA 3HZOA 5JALA 4XVCA 3ZI7A 1LLFA 2GBCA 3H04A 4JH0A 2XQGA 5HF9A 4HXGA 4CG2A 2WIGA 1EHYA 4H7DA 1CFJA 5JAUA 2X5XA 1EDBA 4G9GA 1XRPA 4GWLA 1MNQA 4XWGA 4WFKA 2OQIA 4HS9A 3QMMA 4J3JA 2OCGA 4X92A 4AZ0A 4KAAA 2PM8A 4IHAA 2B9VA 1XZMA 1KU0A 4KE8A 4IH4A 4HXFB 4LHEA 2J4CA 3LP5A 2ES4A 4J0CA 5EHNA 1JJIA 1JI3A 1YAJA 1Z68A 3TEJA 3WK4A 3CCBA 2Z8ZA 1RP1A 3GBSA 3KWFA 1MJ5A 2VAXA 3D4LA 2QOEA 4JNCA 2VJBA 3FYUB 4CG3A 4UFNA 3WKAA 4ZV9A 1OXMA 1USWA 1LBSA 2ZYSA 3IB3A 4FLFA 3SWWA 3B3QA 1BE0A 1ODTC 1XRMA 2XMRA 3AFIA 4X00A 1EI9A 3EQ9A 2QS9A 5JD6A 2XUOA 5KREA 2H7YA 3BIXA 3AZOA 2AXEA 1QONA 1DWPA 3GZJA 4F5ZA 2XQIA 5IKXA 4TPKA 1BN7A 1LNSA 1ORVA 1EK2A 4MJ3A 4EA6A 4Y2JA 4CCWA 4BATA 2B61A 4C4XA 4DIUA 2Y6UA 5DTJA 4K6GA 5AOAA 1N5RA 3G8YA 3QVMA 2WHPA 1MAHA 2ZSIA 3E4DA 2XE4A 4BE4A 4DMHA 1EVEA 4BAUA 3R3VA 2PSHA 4Y2VA 1AURA 5A6VA 2RIPA 1EINA 4FBLA 4B84A 4GHWA 2GBFA 2WSLA 2XMDA 5AKKA 4GEGA 4FOLA 5ALMA 4J0DA 4Q05A 1DX6A 5CTAA 5K3CA 3DYIA 4KACA 3TRDA 1CUGA 2QT9A 3O0DA 3C5VA 1TCBA 5CT8A 4PW0A 1CR6A 1DQZA 2CB9A 1YA4A 1G4HA 3FLAA 3E1GA 3BL8A 1CIJA 4G9EA 5D6OA 1QIKA 5LIPA 1ACLA 3OURA 2XUGA 2HU8A 4OD0A 4X6YA 1E66A 4BC0A 5ALNA 1VE7A 3A70A 3DS8A 1C7IA 5DTIA 2VJDA 3F67A 3H17A 4LYDA 1EA5A 2VT6A 5AOBA 1CUCA 2HHAA 2CZQA 1CUYA 2ZYHA 1UK9A 1F0PA 3EIOA 3ESBA 4BVKA 3PDCA 4J0KA 4A23A 2DFPA 5A7GA 1FFDA 2WG1A 1TQHA 3O4GA 2QUBA 4UBOA 3U0VA 4BP8A 3KD2A 2WKWA 4NZZA 3PFBA 3H2JA 2OGSA 3CN7A 5ALJA 4Z49A 4QWWA 1R3DA 2XQKA 4RGYA 5FPQA 3BF8A 1DT5A 3ZLTA 5AK4A 4DNOA 4A5SA 3WK8A 5EIAA 3AZQA 4Y2RA 1UWCA 4AMZA 1HBJA 5HKAA 5JD4A 3O95A 4QLOA 4E14A 3K6KA 5AM1A 2AJ8A 3VXKA 4BZZA 2WFMA 4XJVA 4BCDA 3DOIA 2RI6A 4J03A 5HQ3B 1A8SA 3I28A 1CEXA 1CQWA 4AN0A 1X2EA 3W06A 2G4LA 4CIAA 1M33A 3D2AA 2K2QB 1EH5A 1XZHA 4LXGA 5LZ4A 2XUJA 3R3UA 2YXPX 4UHDA 4CIBA 1ZI6A 3A2MA 1VZ2A 3KSRA 2WFZA 4H7FA 1GPKA 2FX5A 4Q3OA 4U2EA 2V98A 3IUMA 3I2JA 1PJAA 3HYSA 2BAGA 2XB6A 3MVEA 2PBLA 5E2IA 3GFFA 3WL8A 5DYTA 5C8VA 4FTWA 5HFNA 4UHBA 1QIDA 1CUEA 4NS4A 2DHEA 2DQZA 3ANSA 4LIPD 1ZD3A 1UOOA 1N8SA 5AO9A 2HA0A 3ICWA 4G8DA 4EB0A 4CCYA 4C89A 3STXA 1ZJ5A 1QIFA 5AP9A 3FLEA 3C6ZA 4L72A 2WTNA 1ZI9A 2HU7A 3QPCA 3D59A 4PQEA 5E4TA 2E3JA 4QE3A 2WU3A 3FLBA 2V9ZA 1J1IA 4DSAA 5CRIA 5LP1A 1UK8A 1NU6A 2QMQA 3WJ2A 5K3BA 3AILA 2H9YA 4MEAA 4WDRA 5JAOA 5HKBA 4FNMA 5CT4A 1WB4A 1CUAA 2WLSA 3H19A 1WM1A 1CUFA 1TRHA 1CPYA 3QMWA 4BDSA 1ZD2P 4UHEA 2QKYA 3C87A 5JZ9A 5ALGA 4FHZA 1AQLA 1F0NA 3V1MA 4W1RA 2CMFA 3WYDA 4ZREA 1QLWA 3DNMA 5HK8A 5AHXA 4X6UA 5FV4A 1MTZA 1JFRA 3QBJA 3STVA 4Y2YA 5HF5A 3G02A 1CUIA 3L1JA 4PV7A 3KWJA 1OCEA 1H22A 4BRZA 4L3WA 4W1PA 3HEAA 4B0PA 5FPPA 2VA9A 4HVTA 5FP0A 3OM8A 5D3ZA 4DM7A 5CXXA 4UHHA 1GT6A 3B5EA 3AJAA 4H0CA 4G8CA 4C87A 4OU4A 3C43A 1MT3A 2WJ3A 1GQSA 1CLEA 3OTQA 1W6RA 4KEAA 5EIEA 3E0XA 3D2BA 4X3CA 4OSEA 3WWOA 4YK7A 1YR2A 5AOCA 2PPLA 5ALOA 3O4HA 1EX9A 4AQDA 1QTIA 2HL6A 4B0OA 1MX9A 3G0GA 3X3HA 5IVDA 3I2KA 1LPSA 5CH3A 3WZMA 2G5PA 3H1BA 5LYYA 2BCEA 3HC7A 5AKYA 3H18A 4IQ4A 1SC9A 3WA6A 3PF9A 1XZAA 1BROA 2OAGA 3FCYA 4P92A 2VATA 4YPVA 1G42A 5FKJA 1FJ2A 2GZRA 3I2GA 4P9NA 3VDXA 4U2GA 2VJCA 3R0VA 1UOPA 1CV2A 3OOSA 2BGNA 3WWCA 2IX9A 3HABA 3IVMA 4U2CA 2QR5A 1XLVA 3WLAA 2DHDA 1GPNA 4Y2QA 4IH9A 4EUSA 1IZ8A 1AMNA 3WMRA 3IIIA 4QWMA 4UBNA 1WPXA 2WJ6A 2WG0A 4QA9A 4ZGBA 3AZPA 5T4EA 3V1LA 4DGQA 1X2BA 2JGIA 5IH7A 3WKCA 3FSGA 3PFCA 3RM3A 2DR0A 1GXSA 5A62A 1AKNA 5ALWA 2RONA 3PF8A 2BGRA 3A2NA 2X8BA 5AKXA 1QGED 3WIOA 4AO8A 4ETWA 1LZLA 5H3HA 4GLBA 1XRLA 5KWIA 1ODSA 5BWBA
chains in the Genus database with same CATH superfamily
1HK7A 3FE2A 1DZIA 1QF9A 1TUBA 2J4FA 4QBFA 3RH0A 3M6FA 2ONYA 5LSAA 2XV1A 1PQWA 4FFVA 4JJ7A 5AKHA 5A9SB 1Z74A 3KJGA 3NPAA 3WNCA 3AB8A 1VHJA 2QB5A 4Z0TA 3ZZMA 3LX8A 4Q4HB 3I01M 4CV3A 1LSOA 3IUNA 5FTMA 2VQ6A 4ZZ1A 5J63A 2IXBA 3WMGA 4UUQA 3UMYA 1K63A 2HGZA 4FLMA 2DTXA 1R0ZA 3ASZA 2IC5A 3CX8A 4OI2A 4HKTA 1U4SA 4WXPA 5D1NA 4E1BA 4H77A 2C2KA 1A76A 3HJNA 5EJ5A 1W5BA 5LQAA 3L4SO 4BNLA 2X0FA 2JGEA 3RUDA 5CK4A 3BCSA 1AKWA 4EEXA 1HX7A 1SBTA 3EVNA 2R8YA 3L2OB 3RVPA 4TTIA 1GNQA 1VZ3A 3CGWA 1D4OA 4JBNA 1XTPA 4E4TA 4E5YA 2CFOA 1DFHA 4A8HA 1P18A 3C3XA 2QLFA 3DV0A 4IFIA 4ZOLF 2NNLD 4CKZA 1L3CA 1IWPB 3R4VA 3A2LA 1UZLA 4MV6A 1ZAKA 3EGIA 4LHZA 1XP8A 2ATVA 2XE7A 3JQCA 4Q9AA 5FBZA 3SSMA 1X8XA 2VAWA 2OQRA 3RUCA 1JMVA 1U3FA 1YS4A 4FYJA 2ZR7A 4JC4A 1YDGA 1Z4LA 2CHQA 2VDVE 4RD6A 4TWIA 1ONSA 1GTG1 2HLDA 4Y1FA 1E7YA 3U6KA 4Z4GA 1FJGB 2J3EA 3GRPA 3OTOB 3K70C 2Z3VA 1NUQA 3BX1A 1JMKC 4V3BA 5JFOA 1DAGA 4I4LA 8MHTA 3HKBA 3G0BA 4DLRA 4Z4HA 1GRNA 3CVOA 3IBFA 4XD7D 4OMUA 1FNCA 5CFZA 3L0BA 1S8AA 3SBEA 1IOZA 2WF7A 1CUSA 1OV6A 5CAEA 3FCEA 3GN2A 1M73E 2A0KA 4RLHA 2HF8A 3AXTA 2H1IA 5FUWA 5BSTA 2XHZA 1SUDA 1ZH2A 3B3GA 3U31A 5BURA 3A3YA 4BMZA 2SBTA 1ZN8A 4YMSA 4D5EA 4O5OA 4BYMA 3PGA1 5LVAA 3COYA 1OLXB 4B6PA 2ZE6A 3OE1A 5BSVA 1KAGA 3JQFC 5GTDA 1U3GA 1PFWA 3F98A 2ZJ7A 4O4JB 3EQ8A 2X3FA 1SVNA 3IESA 3GGOA 3QLVA 4LHXA 3T9CA 5E4JA 4EI8A 3GJ0A 3QITA 4FGZA 4ITVA 5JXIA 2QUHA 3U5ZB 1CUZA 2LIVA 1P4HA 5H8WA 1T1GA 5LLSA 3F46A 3MWYW 2AFIE 4ITUA 4B87A 5IJ0A 1F6DA 2C92A 4NZ9A 3VX3A 3AEKA 3AUJB 1T3HA 3PWSA 3P9SA 1RQ2A 2NVUA 2A67A 2WDZA 3JQRA 1G9XA 5ALJA 2OCKA 1B23P 2HHCA 4RCVA 3RVJA 5ARBA 4AUKA 3AX6A 1L5MA 5FJJA 4DR3B 1OGYA 3G0HA 1YMVA 3EHEA 5KSYA 1CXZA 2QTNA 1XCGB 1QRDA 2AK3A 2JFVA 1OW3B 2C5AA 4I46A 3UXHA 4ABTA 2JD1A 5D2CA 4CBVA 2C58A 4FYKA 1NJ1A 4D6XA 1YA6A 1X0XA 3OU2A 5J5CA 4FJ2A 2ZG6A 2Z5LA 1AJEA 1Y1QA 4HQOA 1YRLA 1KWGA 3K53A 1MR3F 5KOHA 3PFWO 2VA8A 3GH1A 4WZAA 2IODA 3BWBA 2GXSA 2JDIA 1VYTA 3C5EA 5EYPB 3ISVA 1R64A 3B9BA 1NXOA 3W5AA 2HUNA 1JR3E 4NJEB 3NATA 5BT8A 7ABPA 2WR8A 3BBPA 4ZAXA 3VO9A 1RHRA 5BSHA 5K0ZA 4R9VA 3M4ZA 1KNXA 4KDRA 2OBXA 1PJ2A 2QRUA 3CG4A 2K87A 5JQGA 4FB5A 1B0AA 4YASA 4PN7A 4OU5A 2QX6A 3W05A 2H63A 5KNBD 4DV1B 4HF7A 2HCFA 4PLYA 2V9CA 3CRQA 3PICA 5DLYA 4B4DA 2Q5OA 3B70A 3JV7A 5F52A 3PKIA 1DJNA 1LTKA 1RZRA 2V96A 2FSVC 4KXWA 1DJOA 1JHYA 2CFIA 3HKCA 2H16A 1W85B 2PFKA 2FB9A 2PGLA 1EHCA 2E55A 3A4TA 3EG9B 3JZMA 1HQDA 2QVGA 4TLCA 4BQSA 2OE2A 3V8EA 1XOIA 3KJZA 1Y3FE 3T3PB 1H2WA 4ARZB 2XUKA 3KBBA 3O94A 4HRAA 3R7AA 1ZJJA 4HDKB 3SAJA 3T3HA 2EP5A 4XCXA 2WUEA 4D46A 1CSEE 1DLJA 3C74A 3KWMA 4JBGA 1U0FA 3TNFA 4F38A 3Q7IA 4G4JA 2CLEB 1XZEA 3EE6A 1HF3A 4H3HB 5F1KA 3WBBA 4A03A 4E46A 1E5TA 2E37A 3CURA 1QVWA 1U3WA 2NQTA 4Q1DA 4MX8A 4YT8A 1JJVA 4ZYXA 1S0UA 2IY7A 4D9IA 5HVNA 1OKKA 2ZS9A 3J7AC 1A88A 1ENOA 1L5YA 3KPJA 2JKZA 1ECBA 1J06A 1OH6A 5G0SA 3B1VA 5LQKA 3I1FA 2BGLA 3N2GA 4JVNA 1JILA 5DP2A 2YYYA 4WKPA 3C6KA 4FQ5A 4D4GA 1ZW1A 2EKDA 3AIIA 3MJRA 2I4MA 5K3DA 2G7MC 3TK1A 1W47A 4F6LA 2ZB2A 1E9CA 3PI6A 3NJRA 5EXPA 4DJ5X 1SQGA 1DARA 3RAGA 5JEDA 2IYSA 4HP8A 4O08A 2HIAA 3AY3A 5BSGA 2OMKA 3GK3A 4O0LA 4R0VA 4Q24A 4BO0A 3ZZNA 5AUOB 1Z17A 1OY1A 3AOGA 3L7CA 5IJZA 2CDCA 2FSPA 3SX2A 2LCIA 2CJXA 5IM4A 1NSFA 3UJHA 4A8PA 4L4UA 1Z6XA 1JMYA 2WU0A 3VR3A 2R5FA 4ZEMA 4PR3A 1RLUA 2FQ1A 2UKDA 4HLCA 4DLXA 2K7FA 2DLDA 3PKZA 2Y6VA 3M3PA 4B5KA 3TR6A 1B42A 3RVOA 4AP6A 5LPNA 2JLWA 3UPTA 3H2BA 1NRWA 1H69A 2JJ1D 3BJEA 5ALHA 5EPOA 4F71A 3SHOA 2A94A 5IEJA 1SCKA 1C7RA 4EZEA 4F72A 1UBSB 1EJ2A 2I6FA 4TWJA 1PFYA 2QXTA 2AX4A 5JJKA 2VBFA 1B8PA 1XNQB 5F2EA 1EUDB 3COSA 4GM4A 1IMJA 3CX4A 3HWWA 5C8YA 2ZKIA 5D85A 4ESHA 2B35A 2A59A 2OR3A 4YMHA 2PJDA 3M4YA 1KK1A 1JEAA 1GARA 4H1TA 5IFLA 3JSXA 2J9ZB 3ECSA 4U7HA 4Y9UA 3PXGA 2VJMB 1NE7A 2Z0MA 3SXUA 3V2UA 2WKPA 5KHLB 2JK1A 2UYCA 3UGJA 5DBFA 3TB6A 5DNCA 1QC5A 1JU3A 2HIHA 3ODGA 5JAPA 1O9BA 5LIRA 1CKEA 4XUGB 4D41A 1EIWA 2EHJA 1U7UA 1F0KA 3QKWA 4B6FA 5JZOA 5MHTA 4LUCA 1QIMA 1TEXA 3T7RA 4AW9A 5JSFA 3PB3A 1ZPDA 2I1WA 1VSTA 4GT1A 2EIXA 3IPXA 2GZDA 4MUXA 4DV2B 2ZETA 4BS9A 1G0OA 2UUBB 1D6MA 1XNJA 4QATA 1JZTA 2ESRA 1E4EA 2O2ZA 1R4ZA 2JZNA 2Q5FA 2HMWA 5LXTA 1K88A 3VR5D 4OHOA 1ZH4A 2G36A 1QO0D 2IZZA 3WQRA 3OI7A 3ZE8A 3L8FA 4IS2A 1QTRA 1SPBS 2MWMA 4ZVOA 2A4MA 2HMSA 1PP4A 3KLMX 4C6TB 4DXAA 3RWBA 1GU7A 3U7RA 1A96A 3Q5EA 4UHKA 2NXEA 4HNRA 1FFAA 1XFDA 4WZ6A 4YI5A 4QJ5A 1ZESA 3PXEA 4D74A 2VHJA 3A37A 4QBIA 4DLYA 4LGMA 2JVJA 1NDUA 1Q16A 1OFUA 2YRFA 4NARA 2PGDA 5DNEA 1X6VA 5JSUA 1T36A 5P8WA 1BMFD 2G5TA 2F6RA 1O97C 3KV1A 1IPHA 3WZLA 5L53A 3PUZA 4PSKA 3UHJA 3JVUA 1XXLA 1BX0A 3UJ7A 2I80A 2W4MA 2FEOA 4PS0A 3T3OA 2ZJAA 1Q6ZA 1XTIA 4C4RA 1D8TA 4PNZA 1KJQA 2H4JA 4KXXA 5KIAA 1QE3A 4ZA2A 2R5NA 5DOVA 1NKTA 4WCFB 3DMYA 3NFYA 1JJFA 1OH8A 3VNRA 2P3QA 5JS8A 3LO5A 5TC4A 2EZ9A 5CW2A 3TIGA 4YH1A 3U7EB 5IJWA 1KA9H 1P3DA 3JPYA 2VEOA 3RFCA 2OUKA 5BQXA 2W2QA 1Y63A 2UZAA 1W94A 2ZIXB 3RIXA 5IANA 1WLSA 4OAPA 2JGJA 3MPOA 1QGOA 2I54A 4KTVE 4HAUA 5AKZA 3GDWA 4AAYA 5A0TA 3LYAA 3E3NA 5TNXA 3I9V1 5ERYA 1FYFA 4MKGA 1R0SA 1RP7A 2GASA 3F6SA 4ZYUA 4WNCA 4BN4A 1TLTA 1GVHA 1NF3A 2IY9A 5KMGB 3M83A 4D4HA 4ER0A 5IVPA 1P60A 5B7QA 1ZICA 1ZAYA 3ZVLA 1L4LA 1LLQA 2W4IA 2WG2A 2XJ9A 4UEJA 4D25A 1QOZA 1RXCA 3KAKA 5IDVA 3E3AA 4AJKA 1W4CA 4AZ3B 4XTRA 4P0QB 3MWDB 5IPFA 4WBNB 3OKPA 1HDIA 1Q2UA 2Q0HA 4OA5A 5AI6A 2V6MA 1XMJA 5D3KA 2JVKA 4YLYA 4BXOA 2P6OA 2W22A 4J0JA 1XRSB 4YMLA 5I4CA 1XPOA 3S8EA 3A1FA 5LP6F 2ZM6B 1WXHA 2HF9A 2ID8A 3N0XA 4P5PA 2Q21A 2WZQA 2X5NA 2I8LA 1SC1A 3URKA 1ND6A 3H3FA 2WABA 1WBDA 1H65A 1D07A 3M6AA 3SM3A 1EUCA 1ODLA 3I6QA 4XIJA 1Q3TA 5FULA 2E4ZA 3BK1A 1W4AA 3R77A 5ECGC 2QVXX 1LV8A 3HB5X 3DDZX 3SSNA 3SVTA 2I29A 4UCXA 4C3ZA 2A0XA 5K5EA 2HA3A 4P3OA 5C8YB 1FUYB 2PZKA 5K3FA 5BYKA 1NVWQ 3N7UA 4MQLA 4UFPA 1VPEA 4LAFA 1JT2A 3JASB 3FBGA 2GN9A 4FMCF 4JEMA 2E4WA 1HTWA 1IHUA 1JHMA 2AEJA 1QH8A 2GBIA 3EPKA 1U2QA 1Z3IX 2CBZA 4BE9A 1GG9A 5I9IA 1R8JA 1SVSA 5JNRA 3NHSA 4WDQA 3GUUA 2GERA 3DEAA 3R5TA 3SS8A 5GOTA 3QUCA 4Y2HA 4Q37A 4QSHA 3UMFA 1J22A 1Y5RA 1ZFNA 3H13A 4RJLA 3DT6A 3GEEA 4W9NA 3SG0A 421PA 4EA8A 2PBFA 1TO1E 4LRSB 2H85A 1DDIA 3R3YA 2CBGA 1DSSG 4F85A 5KJCA 1ECPA 3E23A 1IN5A 4TTRA 4Y6PA 1KEEA 4RENA 2DX7A 3K2BA 5BORA 2ODNA 3FUWA 3Q9LA 4IJVA 3NHKA 4JI7B 3H8VA 2VP5A 2MINB 3Q9NA 3JQGA 1JDVA 1O95D 4JMPA 1MENA 1DQRA 2A0FA 2FG5A 1LLUA 4JGGA 4DLTA 2GKGA 2G1KA 2WLTA 1VC2A 3GR6A 5AW8A 1UXOA 1PIWA 4RACA 1P4GA 1ZMTA 4ZU1X 4X61A 4ENRA 1T4CA 2W2LD 4HRXA 2CLDX 3G2IA 3JWIA 4LOLA 3SIPA 2P6UA 5EKSA 3GRZA 2ZT6A 4EIWA 5KAMA 2XA2A 4DARA 1N34B 1SBHA 4AJJA 3LUKA 1K5GA 2NXWA 2HNKA 3ILSA 4IGIA 2LCQA 4B85A 2OHHA 4HNUA 3IV6A 3LWBA 4NFYA 3DMTA 3V7NA 5JDCA 1TZCA 2VP4A 4GPZA 1JQAA 1DUVG 2X9LA 1ULSA 4N03A 2W6IA 5SZHB 4CQMA 3S1SA 1HH4A 1NX6A 3UFBA 3K94A 3RVNA 4MVJH 1CVLA 1XWIA 3PQ4A 3W9BA 1NFQA 5CM9C 2J46A 4E88A 1L1FA 3BS4A 1DRVA 1KBZA 4LZOA 2OCIA 1N7GA 4O2AA 5I7OA 4IDGA 3E2PA 3U4IA 2UVPA 2VTVA 3CLKA 4GVLA 3C97A 5DYWA 5HF6A 3WRXA 2JI4A 4PXAA 1EXMA 4AMUA 4BMYA 5HX7A 2DJIA 3PP8A 4KO4S 4QVKA 4XB6B 1T4BA 1M1NA 1KRHA 4Y18A 2C4VA 2DUUA 1TADA 2H5JA 2ACKA 4FEEA 3TZLA 2I55A 4YXFA 3A6DA 1U9ZA 1RXUA 1OIVA 1P2FA 4OSOA 3IUPA 3HFRA 2B4KA 5AVKA 1JG2A 3MJVA 3WGJA 4DMCA 2NZJA 5DNVA 1PDVA 3C8DA 4CKBB 4LFBB 1UPBA 4LFAB 2XXAB 4B8ZA 5EJEA 1U0SY 2I9KA 1OIWA 2QJWA 4E33A 4V0RA 4PGHA 4DSOA 3TRIA 2FFRA 4MW6A 3L1HA 1GFWA 3VKGA 2I4NA 1GUFA 2QR3A 2TS1A 3H5RA 2ILVA 4DQ0A 2EZ4A 4EUHA 2FUCA 3GDHA 3LC7O 3RK4A 2REBA 1PZGA 1EUZA 1Y89A 3ZI4A 2ZBVA 2OFWA 1WDKA 3WKEA 4NYJQ 2ZJ6A 4P32A 4N9QA 1II8A 3ZGVA 5HGXA 2QL9A 5IWAB 2R00A 4O59O 1E0SA 4TMWA 1LFAA 2TMGA 3I2IA 1Z25A 3WIUA 3GEPA 5KO2A 2P0AA 3E05A 4UXJA 3ROEA 3NC0C 1XMXA 3H8JA 4JC0A 2C57A 4FMCB 3T0FA 3IULA 4B2LA 4RYDA 4MKHA 1W35A 3G9XA 4BKOA 3JW8A 3KJEA 2B4TO 2JB9A 1C7EA 1YS9A 3DVRX 1U7ZA 4PZDA 3VJMA 4YRZA 4RWEA 3X2FA 1V37A 5GPBA 1PR9A 1SKYB 1XFAA 1IQPA 3A6HA 1QNLA 1O94A 4ALLA 2VCEA 3JQAB 4RV5A 5JLAA 5DNYB 1HE5A 4MV5A 5G1OA 3AP1A 1YKSA 2JIPA 2A92A 4PSDA 1SQ6A 4E2ZA 4I5IA 4R51A 1RRKA 2SCUB 3GNSA 5CVUA 4KSYA 4CQNA 2GPSA 2VPXA 3QKSB 1RWQA 1KZYC 4MKRA 4RY2A 3N2KA 1LDMA 2AJTA 1IEQA 4V39A 5EJ4A 1JBQA 1SHZA 2FG6C 3KQPA 4OGLA 2EEZA 2V97A 5BOSA 4PC3A 1GTL1 1NT2A 2MYNA 1UDRA 4S2UA 1NXQA 2OPHA 1KDPA 3RFXA 4AN4A 4FCWA 5AVTA 1J25A 4OYYA 1JKXA 4Z9BA 3GNLA 5ADUS 1DQPA 1UJ5A 3AF5A 4XAQA 1GQOA 1GL3A 1HA3A 2HJHA 2XVYA 4J0FA 3IELA 4LQDA 3MTJA 1VHTA 1Y5NA 2ZSDA 1L0BA 1WR8A 3IJRA 3S29A 1I7QB 3VU8A 2GHRA 1I4LD 4D96A 1A9YA 2ZRDA 2ZKLA 4OVKA 4JKYA 2HWWA 3HDHA 4CM4B 3O4RA 3SDSA 2V45A 3WJ7A 2RGRA 4RPCA 3RARA 3B3FA 3AH8A 2OWDA 4IRMA 5GV7A 3THYA 3QBTA 1ZJYA 2IDMA 3MPUA 1WMSA 5ALYA 4ZXPA 2DFTA 1FDVA 4RZ2A 1AKRA 1QFJA 1RIIA 1RKBA 2GGSA 4TKUA 4JVMA 3UQZA 4YB8A 2O7NA 4CKWA 1CJMA 3DF9A 4CMGA 3I1JA 1V4VA 4Y0AA 2V7XA 2GN2A 2XYQA 1JXQA 3QBDA 3BBLA 4KH1A 3GPLA 1QYVA 3DE6X 2FFBA 1FFEA 1UPTA 2H9AA 4MVJA 1E8MA 2EP8A 2VT7A 1Z18A 2CF5A 2QZ9A 3W1WA 4ZOLB 5BOSB 3GFVA 1LS6A 3KCNA 2YR0A 3MFYA 3FDFA 2BW0A 4LRTB 1OLOA 3Q6MA 3W4IA 1I0IA 2AKAB 3TNDA 4ND2A 2G3YA 4XH9B 4A27A 3JD2A 4N3AA 4MS3B 1W5AA 4NL4H 1MO2A 2AJBA 3H1GA 1JXAA 2WM2A 4H18A 4KFTA 1X87A 4QU8A 3SF8A 1WOMA 3ZTTA 2ZWMA 3DOFA 1XN4A 4XTCS 1O96B 1SQSA 5E7QA 1RI3A 1U0TA 2C96A 3O3NB 3OX4A 4YP1A 1GKUB 2H18A 5A1JA 4DQDA 1P33A 1XTBA 4FYWA 5B1EA 3M1LA 4BQPA 2BN4A 5BMOA 1AIPA 1NVUQ 4KHZA 1DC8A 2G8LA 3FZGA 3UMBA 3G9TA 4X94A 3VDQA 4EMSA 2CXTA 1OX4B 3FPAA 4WK6A 1G9SA 3Q11A 1V43A 4TKVB 4GS5A 5CVDA 2UZ3A 3C3DA 5AJZA 3HB9A 4QYTA 1P5HA 3ZBPA 4C9BA 4YRKA 4P7GA 1NXVA 3L3BA 2I71A 3U9LA 1Q0QA 2JJMA 4U6SA 1YA8A 2AWNA 3W5UA 1Z0ZA 4BFTA 1UPXA 5G0VA 1XZBA 4M1YA 1JL3A 4UNQA 1CP2A 1Q83A 1FBNA 4JX8A 1Q3HA 1CJBA 2GJ9A 3FSEA 3RUAA 3SFVA 3FAKA 5GOZA 4QTUB 2WWVD 1I80A 4MWTA 4UBIA 4ZU6X 4CDGA 1TYBE 2IYLD 2OGUA 4FDMA 4NY1A 4WOKA 1QTNA 2PMBA 1EDDA 1EM8A 4II3A 4KV7A 2VJAA 1DC6A 1L5OA 2PVCA 3FYDA 4H7EA 4NYIR 4EM6A 3K70B 3MINB 3V1YA 5GINE 3PG5A 5L4LA 1X80B 3BWVA 2FMFA 2BHRA 1KIMA 2FNAA 2FX2A 1FXWF 3Q8LA 3LVBA 4XX1A 5WRFA 2GA9A 2P8JA 5A9SA 3EZ9A 1KTIA 3ICEA 2O5EA 3Q3HA 2FPPB 4L85A 3UAVA 2QSZA 4L2IA 1O6CA 3GU3A 4HK4A 3CCCA 1I6WA 4IEIA 4B43A 4Z4CA 2VOJA 5DPMA 1X1DA 4I19A 1XYYA 2ABWA 1I9CA 3KZKA 3KUCA 4BKPA 1JGTA 1K8XB 1O5IA 1IDN1 1P0PA 2YFHA 1CW2B 1R8SA 1P2VA 1UPAA 2VSOA 5FWNA 3IKJA 2Q8NA 2ZZNA 1T24A 1FNMA 3A28A 4D9JA 4EUKA 2BE9A 3RU2A 2SHKA 3D8TA 1ZD1A 3OZVA 4ZEXA 4M7WA 1XMIA 1K9VF 4AIIA 3GAFA 4MO2A 3IEKA 4QQKA 3STWA 2DC1A 3WLTA 4UQLA 1XI2A 3IEPA 1ETUA 4IGKA 2IUYA 1BEUB 3IERA 1BS9A 4TLLB 2W2MA 2YKGA 1UKCA 1VYVA 4ZQEA 3M6XA 2AR9A 1A8HA 1P77A 1YL7A 2WY2D 5LZ2A 1LBHA 3BB3A 1HQYE 5AKGA 2GETA 1AKQA 1Y33E 2PTGA 2UZ1A 2XUFA 4QQ8A 4ENUA 1ZN7A 3LVQE 4LYFA 1GUYA 4CI0B 3HM2A 3AFMA 1WIWA 2JAHA 2WZBA 3VTAA 4CYMA 2H4WA 3KQTA 5CFNA 1KRXA 3UXEA 1XU4A 3LBAA 5J43A 5K0TA 3LW8A 1OD6A 2Z4RA 1C3VA 1I32A 3C8ZA 3DEIA 4NE9A 3WWEA 1JJAA 3I92A 4GKKB 1UKZA 4D3ZA 5BT9A 4QU9A 1NONA 3K5IA 4I66A 4YDQA 4HOYA 1U2DC 1YZKA 3FYTA 3NWJA 1SN7A 3OKFA 3NHBA 1AS3A 2JIMA 1I3CA 5CT9A 3ZCRA 3DBRA 3NGXA 3CUYA 5FR1A 1ZGAA 1UBFA 3EJWA 1D4AA 3VC1A 3L43A 3WJ1A 5B7NA 3WNBA 5JCPA 5F4ZA 4P2GA 1GSAA 4M3NA 3ZV5A 2C4KA 1GUDA 3AUKA 3TZ6A 4EJFA 5KHOC 1MC5A 1BGVA 2OP0A 1IM2A 2ZUWA 3G82C 5BN4A 4UDOA 3J7TA 1I30A 3VPXA 3BHJA 3IAFA 3L8CA 1IRIA 4N5HX 5HF8A 5TT0A 1R7RA 5LMCA 3WYGA 1M1YB 4GOMD 1ZHOA 4V03A 5DLEA 3LT4A 4L5YA 1QB8A 3QMPA 4MW1A 2J3HA 1O95A 1KDOA 2P4EA 1KJ9A 2PKRA 2H4YA 3PHHA 4YDRA 1VI6A 5HQJA 2UVDA 4IUCS 5A02A 4JI0B 4EHAA 3VHXB 3KZCA 2WTMA 2XQVA 4TS4A 1APBA 3RFUA 3THRA 1RHJA 3AUAA 3GMIA 3VKUA 2WQ7A 3HHPA 4OQXA 3W8FA 5ALUA 1YC5A 4KJXA 5C1BA 2P11A 2QL7A 3C3KA 4L5CA 2BR4A 4I50F 3H1PA 5AH0A 3SJAA 4TS9A 3WE7A 4Q3DA 4I4IA 4I08A 1FXSA 3M70A 4P4LA 3SBOA 1XRNA 1MG0A 1QE0A 3O1IC 2NT4A 4CF3A 1HZZA 3C14C 2PWZA 5H9WA 1VLJA 2RHWA 1GO2A 3RS3A 4BAGA 1USGA 1TZKA 5DHAA 5DM4A 4MRSA 5FBQB 5AXBA 3VR5H 2PZEA 2B1RA 1DXYA 1MZVA 2X1VA 1OVMA 1JEQB 1L4NA 3RVKA 4CIDA 2B4RO 4HTAA 1G8AA 2C7PA 2YZMA 1L1EA 1W73A 3G8CA 3EGWA 1BVYF 5JCXA 4UOEA 2WDPA 2O23A 1E79D 1T13A 2POQX 3Q2KA 2HJ9A 3KQSA 1BS2A 3FTEA 3DAOA 2BWJA 3EF0A 2IEGA 3SHWA 2Q2OA 4BNGA 2HRCA 3DFIA 5H02A 1UBGA 2ZGVA 4GH5A 1ABFA 1FU4A 4BJ5A 3IP6A 1T9GS 3KLPX 3EASA 4GM0A 4LJ4A 3UFXB 1WP9A 3ANTA 2FN8A 4MR9B 2R97A 2BDEA 3EGDB 2X8AA 4QULA 4AXBA 1A9TA 4LGYA 1B41A 2P2GA 1N8KA 2Q46A 4URUR 1X1AA 3NXKA 3BMOA 3E9CA 1T0UA 3JQBC 1P2SA 1J2EA 1S1MA 5I7WA 1Z36A 3LIIA 1YBMA 3OD5A 3CNBA 4JUAA 4ZDWA 4DPKA 3P52A 3V34A 1O8CA 3VPAA 1NVAA 4RFLA 4Y7DA 3WLQA 1KI1A 2CW5A 2AQ8A 3BCRA 4TWAA 1YI8A 2BEWA 4BB0A 1QPGA 1YCGA 3JCZA 1E3TA 2I6XA 3DLCA 4EFKA 4EGAA 4CEIB 3M5CA 4I4CA 2VH2A 3RAEC 5A0FA 5K0BA 3N07A 3KZXA 3FVVA 5EE0A 5BVGA 1Y1RA 5L95A 4FYPA 4PPFA 1QDEA 1M0WA 1EBBA 1CRLA 4QGBA 1BDBA 1ZXBA 2C5SA 1QX3A 3BRWD 1Q0ZA 4DVGA 5KJEA 1GZUA 1ACJA 1C3JA 1TE2A 1ZLXA 2GX6A 2YV5A 3INTA 3PE6A 2JFBA 1PL0A 5FRDA 3U62A 4E5DA 4F2PA 1L7AA 6ABPA 3GGDA 4X6LA 2JNWA 4M1ZA 2BHTA 5C37A 1KEKA 5LU9A 1N1DA 3HWX1 4OA8A 5H9VA 4B82A 3G9QA 1LY1A 1NM5A 1GQ2A 3M6LA 2W2XA 4LKOA 2QVLA 4BB9A 5F9FA 3H1TA 3T9AA 1E3WB 4EG1A 2NU8B 3L0PA 5KWVA 1FZQA 4U7FA 4X5OA 3UK7A 1E9RA 4ILEA 1CIVA 4DLKA 1DIGA 3OMXA 3PX3A 3ETGA 4E11A 3AR7A 2OEPA 2WYHA 8OHMA 1I4EB 4OQFA 2WVHA 4Q1EA 4LVCA 4ZCIA 2GJ8A 1LPMA 4G0OA 2XH8A 2GNOA 3E9MA 4I99A 2VRNA 1JHRA 2HNAA 4GF5A 2R2GA 4OXIA 4HZUA 4URHA 2EJWA 1NRJB 2GYWA 5CDFA 5JOQA 1FTNA 1NGSA 1PG2A 2BHNA 3K5PA 1RLMA 3VMFA 3L6CA 1VJ1A 2I65A 4CXMA 4ZI7B 2AJDA 2JIDA 3WG9A 3NJ8A 2GVDC 3V1NA 2YJ6A 4UASA 3ZCXA 1FRQA 1E4EB 2BGMA 4TSFD 1NXWA 4DLUA 3ROGA 3OPYA 4X65B 4EHFA 1ZNQO 3JATA 4V0KA 2WUFA 4V0ME 1W48A 1SOMA 3WGYA 3QHAA 5BW4A 2P75A 3PIRA 4PFKA 1GGNA 1OR8A 1Z8DA 3WDSA 3WLFA 3OT1B 1FNNA 4QUGA 2PKCA 4HSGA 4TRNA 5CCXA 2CVHA 4EMTA 5AW7A 4RAOA 3COPA 2HCTA 4ATNA 1N5MA 1G7RA 2X2EA 5CBPB 1FOEB 1SD1A 3ACBA 3IBTA 1Q1EA 3STUA 3LAWA 3K9FC 5DU2A 4IDPA 5CXUA 2DLCX 4CM8B 2BUAA 3DMTC 2A0YA 5TY0A 5L4NA 1GV1A 2I7DA 1K8ZB 3MQFA 4QHSA 5T3UA 1X1RA 5SZKB 2WWXA 1MRZA 1YQ9A 1KY3A 1TYCA 4J2TA 3CXUA 4GE3A 3DE2X 3MS2A 1U2GC 1B3RA 1R5NA 2C2BA 2XCQA 2OAEA 3H97A 3I6YA 3PQ2A 2VTBB 4UTPA 3UJ3X 1UFRA 5EIFA 1WPGA 1PNQA 1SIOA 3SSOA 1GITA 1UK6A 5J40A 4AK9A 2C61A 2RJNA 5FH9A 1KR5A 2QVCA 2CHGA 2JZOA 3HR7A 4KAFA 2OORC 2GXAA 1YVPA 4LZJA 1XAHA 3AL3A 2EQ5A 1K8YB 3HNRA 4OQQA 3FUCA 3P71T 1FF9A 2GN8A 2OT3B 3BTOA 4LF5B 5E3IA 2P4UA 1WE2A 1MPTA 3HFJA 3VNBA 5BSEA 2IS2A 5KDOA 1IJBA 2BI8A 2E87A 1QCDA 5DNAA 3UUGA 3L1IA 4MHSA 1YRBA 5KNCD 4GPTA 4OHXA 3PQEA 3RRNA 4JFAA 4MUFA 2EX0A 2E1PA 5THKA 3N70A 3BGVA 4O2BA 1W75A 2GCEA 3TLZA 4CF7A 3SXPA 3PEVA 4W9MC 3FPEA 2YJGA 4JQZA 5DX0A 1FLVA 3STYA 3Q5DA 1FW8A 2Q50A 2PUFA 1Y7IA 5GONA 4NH4A 2BP7B 3R0QA 5ALXA 4ARVA 5CLIA 4NULA 1YVUA 1RWKA 1RI1A 3GLIB 1GRRA 5TQVA 1WD5A 2IYYA 3LTEA 4CLOA 1OA1A 4MCJA 3K0CA 3MT7A 4PG8A 3GXOA 3CJRA 4QDZA 5EPEA 3IP7A 4FW9A 3NEJA 1DP4A 1SVOA 3PHLA 1JSLA 2UUOA 1DXQA 2FHPA 1XTZA 1Z15A 3MXTA 4BCCA 4Q3LA 1UWKA 1FP2A 4JP5A 3PDHA 2D0DA 1DKQA 1KPIA 1W8IA 2X0JA 1JFVA 3IV9A 3ZCSA 2XYRA 3HO8A 3EDOA 5BR7A 4J1QA 1N92A 1RC0A 2GSDA 4KU4A 3TYXA 3NUZA 4DPLA 3DL7A 1JAYA 3KPWA 2HQSA 5DLPA 2JFYA 10MHA 6REQA 1DJQA 2DWUA 4MITA 3ZX4A 2HSZA 1XK7A 3HLKA 1SQFA 3UXYA 3RSFA 4LZZA 3ZHVA 1XMSA 1EK6A 3LL4A 2YY5A 3IFSA 1C8VB 1VGVA 1UMDA 3TEFA 3VPBA 3H5NA 2XI4A 1Q1GA 3NWOA 4F60A 1S7CA 3SOZA 4PQGA 2AMVA 2GN6A 2CJWA 3PNKA 1N4AA 3ZI0A 3DE7X 4HAZA 4M0LA 5DGXA 2XWBF 5K0SA 3H3JA 4N7MA 1M54A 4WNIA 5L3ZA 4FFRA 1X7GA 5IF9A 4ZAWA 1RZRD 3UUFA 1UPCA 5TPWA 4YPOA 2NZWA 4XIYA 3KOYA 1V95A 3IAXA 4BUCA 1AC5A 4E3WA 1VBNA 1B00A 5J4YA 1AK2A 1SC4A 1NQOA 1DC4A 2DKNA 4KNVA 1L7RA 2AG5A 1P6QA 5SYMA 3WWPA 4GE0A 4A82A 4WERA 1EVLA 4D3YA 1KOGA 1DBRA 4HDKA 1X9GA 1P61B 3G0DA 1NUPA 4QZVA 3D6UA 5GZ1A 5LB4A 2GCOB 6Q21A 4I7EA 1E3MA 3I37X 3OJWA 2X9VA 3R6GA 2QZPA 4GKJB 4QD3A 4YRBA 4X20A 5TGZA 2CVZA 4GBGA 1Z6GA 4UEQA 1Y6JA 3K6JA 4EX7A 2JFXA 3E1SA 1TM4E 1X14A 4PLCA 2C7BA 1NSTA 3W9UA 5DDIP 1OPRA 3NHRA 3AWIA 3SC2A 2D6FA 5ITVA 1O9HA 1EFKA 2ZRMA 1AQUA 3F9CA 3QXJA 4KFUA 5KNDH 1B15A 4ZTBA 2IZ0A 4AZ0B 3HO6A 1TVKB 4FYXA 4URYR 4HDMB 4YY3B 2JKVA 5KOHB 3I9LA 1FNBA 1IHYA 1U02A 2AF3C 3DWGA 4EFLA 2PMKA 2IHTA 3UCXA 5IXYA 1JB9A 5B6IA 1K66A 1PHPA 3FRHA 3GLGE 1KJIA 1TYEB 3ABZA 2IPXA 2JGDA 4RGVA 4WBSA 4YWHA 3FNEA 1U3DA 3KJIA 4UTVA 3A6PC 3PKJA 2Q0QA 3IPYA 1K3TA 5K3FB 2BI4A 2PRKA 2QG6A 4YRFA 1P62B 3EQ2A 4MPDA 1F3LA 5J5AA 5KWJA 3FTDA 1G2PA 4XDGA 4LE2A 3Q4GA 1JKJA 4GMDA 2NVUB 2HPAA 5L40A 2UUAB 3FMGA 3AETA 4X24A 4ZQCB 5I01A 3PC7A 4UKDA 4BKQA 821PA 1KQFA 4MMXB 1URPA 2MMGA 4UAVA 4H6WA 3E5NA 4LECA 1SO8A 2QWXA 2ZYUX 2X2PA 3I32A 3F0TA 2HEGA 3WKDA 5DP1A 3OZGA 5J2TF 1RAGA 2Q3HA 5HZMA 5IDXA 4BQEA 2ZITA 4G65A 4ZT6A 2E5WA 2A88A 3KJNA 1HLPA 3KO8A 5KAPA 5L45A 1B43A 1OX6A 2HJVA 2ZT5A 3KNZA 4G56A 1V35A 2GAIA 3F78A 3HVIA 3KQYA 4TV8A 2F4VB 3R7WB 1TZ2A 4DV4B 1JFTA 1X0VA 3RVBA 3G6WA 1ZW6A 1YDWA 4BNYA 3EQ7A 3R3SA 5B7PA 2ECFA 1DUSA 3WJAA 1G8JA 1A95A 3K4QA 3RSCA 3HN2A 4L4RA 3CE6A 1WWKA 2GLUA 4JQSA 5IT0A 1SCQA 1A8UA 3K5WA 1JIXA 1GPWB 5U4XA 3ZCTA 5HKKD 2IV2X 4P7FA 1E64A 1QZ3A 3AYXB 2YHAA 4JN6B 3LLMA 1X1QA 2PL5A 2VRBA 4WOBA 1PX2A 2HO4A 3UB2A 3RC8A 2RHHA 3OQVA 1E6CA 2IIPA 1T1RA 2OY0A 4OF4A 1UP7A 3ZOKA 2CXSA 5CK5A 3BMQA 5IULC 2L2QA 1MB0A 3D3JA 1I7NA 3KFVA 3KYDA 2C97A 3QVOA 1Y6ZA 3EC2A 4R54A 1KYVA 3P0HA 3AFGA 1SXJE 4MMZB 1DKPA 1XZPA 4HH0A 5LDDC 1XYVA 3ZD7A 1VLLA 4YAWA 4GMHA 3T7AA 3M82A 3LUAA 4R1QA 4CF6A 2PEZA 3JQ6A 4Y67A 4BPRA 2I2XB 3SYMA 3B6IA 2DH6A 2IVZA 4NBVA 2RC5A 3FPBA 3IDQA 4MWSA 3ZTWA 4HAYA 5AJUA 4DXHA 4E15A 2XOXA 2IT1A 4AJEA 1NRIA 2NPOA 4JLBA 5HWSA 3CW8X 3O8DA 1WW3A 2ZT7A 3ELWA 3FUUA 3LPNA 3PNPA 2P2LA 4NMMA 4TVOA 1P5JA 2JS7A 1V8OA 3K16A 4RMGA 5ALIA 5JECA 4BLVA 1THZA 1T0PA 4M9UA 3IMFA 1EVQA 2FK8A 4XLZA 1TQ4A 2IOFK 1H4TA 8ADHA 2OBNA 1I7PA 2FW9A 1RCUA 4JY7A 1R15A 4NAUA 5FBLB 2VHTA 3KT8A 3WB2A 3T1OA 1F9AA 3VZPA 4TROA 3HVRA 5EE1A 1Q84A 1U1FA 2VZEA 4OUDB 2JI7A 1JI0A 2O8VA 4IFEA 1IZYA 1V16A 4O4IB 4RMNA 4BNHA 4A6PA 4CMHA 3D0RA 3M2TA 1X1BA 3PSHA 4WCFA 2EJUA 5DJ5A 1GA6A 1ODCA 2MSKA 4G4IA 5HE8A 4KREA 2DPXA 2F00A 2AUMA 3NDBB 2QQ5A 2AOWA 1IONA 2FGKA 4ZFNA 2B78A 6REQB 2NZUG 1WY5A 4M1EA 3GZNB 4XA8A 5GJCA 1DIAA 2F3TA 3DZKA 2F1JA 4EKDA 1T26A 2Q3FA 4K2HA 5FWXB 1MIOB 1TF2A 2C3MA 1Y1PA 2G9QA 1QHYA 1PE0A 3H5TA 4JASB 1PJBA 1D3AA 1DDOA 1UBLS 4FYYA 1CS0B 4P33A 4I1RA 2D7DA 4J6EA 4OFZA 4X1IA 2PUAA 3EVDA 3BMQB 3LLUA 3O4JA 2HA6A 4YJ2F 4R98A 3SBXA 1BYUA 2HSGA 3FDXA 4IXDA 4OUDA 3COJA 2O54A 3X44A 1G20B 4YRQA 1MUUA 4Q39A 3TLBA 4WFQA 2ZPTX 4QVIA 5ESWA 1NBME 2WWGA 3H9EO 4YACA 3VHQA 3LOUA 4UBLA 3UWMA 2HXSA 2DR3A 3HPRA 1C3LA 1HEUA 1QDLB 3ML1A 4EJSA 1EVJA 1SAYA 1TU3A 3O21A 1M2NA 3QFCA 1H1TA 1L7XA 5AQ1A 4X7RA 3HI6A 3OU7A 4RETA 1PS8A 4AG6A 4N0PA 3NBFA 4MJLA 2RGUA 4WA8A 3TTXA 1UBUS 3UAGA 2QMOA 1NVDA 4A0QA 1OWMA 1IUPA 3K1TA 4Q6BA 1RBMA 3W78A 5A7FA 4AL4A 2QPAA 3STTA 1GD1O 4AICA 5IXJA 1C2TA 3TAHA 4QEKA 5KNBH 3TUZC 4AQ7A 2IXTA 2XT9A 1I33A 2C5GA 1ZIPA 4JLOA 4IOJA 2QMHA 1SCAA 1XBTA 4QDOA 1NV8A 5DGHA 3NM4A 3EB9A 3I2HA 3RUHA 3DZBA 2HDOA 3V4RA 2HA4A 1S6YA 1P2UA 2V54A 1G9TA 3NHWA 4ZO8A 1GAXA 5FUMA 3FDZB 1OB5A 1ORDA 5IDWA 2VWPA 4H35A 4IZIA 5AW5A 3JQBA 2O05A 5LA6F 4R9UC 3U0BA 5A4AA 4TQGA 2JZCA 1VKOA 1W2GA 3NH9A 1C14A 1VCMA 2X4DA 5A5EA 5ADWA 5DHTA 5BUZA 4KQGA 3FJ1A 4PZPA 1YIDA 2DTDA 2QN1A 4W7IA 2J5RA 4GI2A 2O3SA 3M5WA 4R8VA 5CYGA 1FMCA 2F1HA 1JFSA 4KDEA 1WSBA 3G2HA 4X8MA 1ATIA 3DBHB 2Q8QA 4BBZA 4FDTA 4M0FA 3IOEA 5KTRA 2PJUA 5IMBA 3JARA 2VAVA 5JH7F 4MIOA 1OXBB 1Y7HA 1OFIA 2GUGA 5BSUA 4BV3A 4HDSB 2W6MA 4C0WA 4EATA 2Y05A 1J49A 1ZRSA 3ESQA 3FFXA 1HFJA 2I22A 3HADA 3UT0A 3F6CA 4PAMA 4QPZA 3EA0A 1Q0SA 3AUYA 4Q3KA 1ZS9A 4M1KA 3PCTA 1FS6A 2WQZA 4D80A 1S5PA 3RSLA 4DLPA 2AUNA 4ZK2A 1HZZC 3G5TA 2HREA 4X90A 4BUZA 4DLAA 1VG1A 2JFFA 3IAM1 2AC4A 4IDAA 721PA 3L46A 2WJZB 4B31A 4RKYA 3RVSA 3BFXA 2DPMA 4N0MA 3AINA 1XIVA 3ABSB 1Q1AA 1WVGA 1O2DA 3U16A 3MCWA 4LK3A 3LD9A 4KVFA 1GPBA 3DOJA 1C9DB 1SUPA 1OAAA 2I8AA 2WPDA 3F8SA 4GXTA 4MGKR 4ROTA 2V1UA 2FUG1 3GOQA 2HK9A 3P9RA 4XCVA 3GDGA 3WA7A 4X3OA 2FFAA 1NOIA 5BYBA 4CM3A 3RC9A 2JBHA 3NTOA 4PTLA 3ACDA 4R84A 3ESCA 5K8CA 2XWJI 2YOGA 4FC6A 5ALLA 3WHLA 4BQFA 1A7JA 3B2NA 3WQBA 4GYKA 1XDBA 3LY7A 2CNDA 1KMHB 4L73A 2G9RA 4ETNA 4BGUA 1E2KA 1KO7A 3I12A 2P9HA 1R9JA 3G0OA 4OYLA 3T99A 4WXRA 4EHDA 1A2BA 1T91A 3CVJA 3ER9A 3E53A 1NBOA 5EHIA 1ZL2A 1FTWA 3FNBA 2ZSBA 1YR9A 4PSCA 5LR6A 5TARA 2O5CA 2FF5A 5JALA 2PXAA 3UKJA 3MJHA 1NUAA 3KXKA 3RU7A 1MA0A 1L8OA 2O2XA 4MUGA 3BVPA 1GZDA 4YAFA 2XYGA 4PIMA 2H1CA 3OPXA 1H3NA 1F14A 3OM0A 2CE7A 4ECAA 2R85A 1G63A 1Y8QA 4O4JA 1M1NB 3U9SA 1VL0A 2C42A 4ZVNA 5ITZB 1NYLA 2RB5A 2QAGC 4TT3A 3TNJA 1XD2B 3GXBA 3SYNA 2C03A 4CG2A 4OL9A 3OOWA 3H5OA 2A1TR 4EVIA 2FN9A 5HRUA 2WEKA 4EOGA 1W25A 4GL4A 4UU0A 3U7QB 2WIAA 1KC3A 2QE7A 3BXZA 3GUCA 4RH0A 2BPOA 3VPGA 2H4HA 5KJFA 4QBGB 1CFJA 1BOOA 2QX8A 1TJ5A 3N8IA 4IIFA 4URZR 2X5XA 1PAUA 1GQFA 4GLLA 1OYVA 4LZNA 4B4VA 4GWLA 5JT1A 2UXCB 4OLJA 2ISCA 2D0PB 5HIJA 5BUCA 1ZH0A 5INTA 4J3JA 1SUCA 2OCGA 4HDCA 1L6IA 1A98A 4KYTA 5E1DA 5JMPA 3F5MA 1WZNA 2ODQA 1KYTA 4IHAA 2HJWA 2YHBA 3KJQA 3R7BA 2H07A 1MFZA 2VP6A 3PXAA 3HUDA 1TJ4A 4JOSA 4ZKDA 1E4VA 3NB0A 4BJ6A 1KZ7B 5DLDA 1L4KA 4PLPA 1DC5A 1PW5A 1CJSA 4AWBA 1PDWA 3IR6A 4J91A 5HR5A 4PYQA 3K0FA 3KL4A 3EVFA 1N2GA 2DUNA 2VZ9A 4R0NA 2IUTA 3RTDA 3IDFA 3PX2A 2HEIA 2WSMA 4XUEA 2R8OA 3TLGA 2ES4A 2V0CA 1M1ZA 3MTAA 5EHNA 4EUEA 1ADYA 4XQ9A 1WL8A 3C41J 1ZM3A 4MR7A 2OLJA 2EOAA 1ST2A 5BR4A 1L1QA 2O3UA 3WADA 4BNZA 3GCDA 3LCJA 2Q6VA 3KWFA 1E6UA 4WBNF 2QX7A 3S4YA 4YI3A 4RY9A 1IN4A 3O5AA 4JNCA 3ND7A 4D9MA 4JNKA 3FKJA 1NJ2A 4TYQA 1GNVA 2ZRPA 1IEVA 3ROFA 2QL5A 2EQBA 4RDIA 4JDPA 4BHTA 4CG3A 3WKAA 1IBMB 4HX2A 2J31A 4CIVA 5AW0A 1OXMA 2VYNA 2ZYSA 5TRTA 5LUBA 2VNSA 3U49A 4YR9A 1XGKA 2RHJA 3NWEA 1Z8FA 2WF6A 4LBYA 4ASUA 3OX1A 4AWXA 3U44B 3F90A 1T25A 2BEVA 2XIJA 1ODTC 4YC7A 3MRVA 5FIUA 2FSGA 1W30A 2AFHE 3AFIA 4J43A 4XSVA 5JRJA 5JD6A 2XUOA 3CLRC 3INNA 1RPTA 4JJAA 3QEAZ 1JEYB 1L5FA 3TW8A 1SU4A 2GD6A 1DWPA 1Y80A 1VPDA 4KX5A 4IJQA 2H08A 4Z99A 4PFSA 3TQIA 4QTZA 1TF5A 1C9JA 3PXBA 3H6HA 2B4YA 2PGIA 2ADFA 2IHKA 4IMIB 4BATA 4CCWA 4FMDF 1U2TA 4JIGA 2JVIA 2G9NA 4C4XA 4DIUA 4JXZA 3WGGA 3RADC 2IY8A 1JYSA 3EWAA 2XCUA 3GFRA 3ZQ6A 2W0MA 3H5WA 2HBQA 3A3KA 5JISA 1SBIA 4QUHA 4J0QA 2O52A 2V4ZA 1MAHA 2C4NA 4NOLA 3PQCA 4AWAA 1RJWA 2ZB7A 4JWKA 3E4DA 5EMNA 5JNVA 5KYWB 3ZBTA 3N75A 1GU0A 4REQA 5I7RA 2XE4A 4EITA 3OSZA 1NQTA 1FP6A 3ZH2A 1J0BA 3PL5A 1ZA2A 3UJ9A 2ZULA 3R3VA 5IARA 2JJ8A 4K88A 4QTYA 4MUYA 4AU1A 3IQWA 5HOEA 2PR7A 3Q72A 5A6VA 3NEPX 5EP3A 1DADA 4Q4HA 2BOVA 4FBLA 4F86A 3QEBZ 2I9PA 1FU8A 2ZUCA 3JXEA 1PVDA 1RHUA 3LUCA 3PJEA 3ONEA 2XMDA 2FPWA 2J3LA 4GEGA 1BNCA 3JAWB 4MS4B 1ADFA 2NUPB 2Q4RA 1FQKA 1G3RA 1ADCA 1NVFA 1UT5A 4I8IA 4JUBA 4OK6A 4BL5A 4CV0A 1P4JA 4AS3A 4G0MA 4LOHA 5K0FA 2DUJA 5IUKC 5J9FA 4XASA 2OA0A 4J07A 3A9SA 4ABYA 4ZIRB 1NQXA 3DYIA 4KACA 3MB5A 2I62A 3AR9A 3K05A 4KX3A 2FEWB 3TRDA 4XW2A 5JWRA 3GJQA 3HKCB 3IAAA 3A3PA 1N3IA 4BEWA 2QIPA 5CT8A 1DQZA 2XOEA 3KKZA 2IQ5A 4FHDA 4YRNA 3QFFA 2CB9A 2R6CA 4RL4A 3RVQA 5KX5F 3EISA 4D9FA 4YV7A 3ZWPA 1RJ9A 1NHGA 3MJFA 1C8LA 2Q1XA 5IKOA 1CBUA 1NKVA 3GBVA 2HOQA 1NNEA 4ZZ3A 1A9RA 1OI2A 4EI9A 2GDZA 5BNWA 1LQUA 3OURA 2XUGA 4MW2A 5BXQC 1FZTA 3SD7A 1EM6A 4J9UE 4DCNA 1KDTA 2Z9DA 5AHRA 3P1JA 5KEIA 2Y1GA 3GW8A 3UMCA 4RK5A 3QVUA 4RY8A 4E31A 3U60B 2KE5A 3ZS9A 1MP0A 3KM0A 3GP8A 3OE5A 2ZU0C 4HLUC 2ARKA 3K72B 5G41A 4W9NC 3D1VA 5BUSA 3N2GB 2VJDA 1B6RA 3HVUA 3KKNA 4RM3A 1KI6A 3BXHA 4G1UC 4QC2A 1WVIA 3TIVA 5CEEA 1X92A 2VT6A 3AFHA 4EO4A 5ITZA 1KEVA 1RMYA 3LQFA 5IDQA 1Y3IA 3HXTA 3ZWKA 3FMOB 1A2QA 4ON9A 4DLLA 1X7YB 1RYMA 2GEBA 3DV2A 3PUXA 2C1ZA 3NS7A 1J6UA 1ZITA 3D54D 3F5QA 4GPEA 4GGPA 4DN6A 5C1DA 3NTXA 4GXQA 2XDQA 2JFZA 4MO9A 3EIOA 3QI2A 4F84A 2QM8A 4R4JA 5K4AA 4Y6GB 2VNAA 1LF5A 4BVKA 2A86A 4BNKA 1F2TA 4N5DA 5FOWA 5JSKA 2CXUA 3HMKA 4QVGA 3ILVA 1Z4IA 2GHTA 1YZUA 2VT3A 1YJ5A 3EXFB 5DRYA 1GTJ1 3D4BA 1FFDA 3ZK8A 4E5MA 2IGBA 4ZC8A 1MH9A 4NNPA 3WX0A 4EVSA 3AQIA 4IVRA 3ABOB 3U3JA 1TO6A 2CWDA 4NBSA 1J5XA 4N6OA 3AG6A 4YREA 1E7WA 1Y4SA 4YV0A 2WB2A 2QUBA 3HR8A 4ALKA 1WXIA 1BO6A 1PD1A 4K9PA 1IN8A 1NW4A 4QT0A 4D4MA 2Q3DA 4BGIA 1U5BA 4XQCA 3FPSA 3RR2A 2Q5EA 3LYHA 5ARCA 1KOFA 1E5XA 3C3AA 4RA6A 3X1ZA 2WYVA 3OJCA 3H2YA 4LRYA 4W5WA 1SZPA 1GOTA 1I0LA 4JLJA 1R0KA 5LQSA 4NQRA 4HNAA 3F6EX 4IV0A 2RG7A 3T9DA 3FUTA 4O3FA 2AW3A 3SM9A 4W8OA 1TCUA 2HY7A 1DB3A 4MYUA 1QG0A 3HWRA 3GGSA 2F90A 4DDUA 4ASUD 5E8RA 1CDDA 4G5YA 3ENQA 5F2KA 4ZOEA 2LNDA 1EA7A 5E6UB 2GZAA 1Z28A 4FDUA 2YXDA 4AMZA 1H94A 1IZ0A 2QPLA 3UTDA 2O14A 3N05A 3FM9A 4ZTUB 1HBJA 2MR5A 1YS7A 5HKAA 2XADA 4B6OA 1G5RA 3TLEA 4K26A 4CM9A 1R6VA 3V4FA 3ZW9A 5JD4A 3O95A 2XVXA 3C1UA 3LDGA 1QFYA 3E9EA 4YRRA 4E14A 4HFMA 4P3XA 2YUIA 4MUBA 4O4LB 3ROZA 2R7MA 3VXKA 3AR8A 3TFQA 4I2VA 1VBKA 3T4EA 3TLAA 4BZZA 1YB5A 3DOIA 4GX2A 4NHEA 4YIHA 2H8GA 4KH0A 4B4WA 1PFUA 3FCUB 1MKYA 1TEVA 4M54A 1VQ1A 2G4LA 4HB3A 3IMEA 1M33A 1T9AA 2AG1A 3ZXSA 1T2EA 1P7WA 2A9VA 2K2QB 2YRWA 3GJTA 4QNMA 5EAIA 1K89A 4H1VA 1O5OA 1XZHA 3OPYI 5BRAA 5LZ4A 3R3UA 2OZEA 1DMSA 3ONDA 4RLFA 2GEKA 2JJ1A 3LC2O 3CLHA 1T2VA 1QQAA 1NUSA 4N3NA 4R7GA 5CXSA 2WFZA 3I42A 1SIBE 3HFSA 4FD3A 4U2EA 3RVMA 3UGTA 4M0KA 2RHLA 2YWEA 1N2ZA 2GZHA 1XQ9A 4R01A 4UULA 2Q3LA 4DMRA 3HYSA 4F92B 2BAGA 3UK0A 2C2MA 2XB6A 4DHWA 2WKQA 4XLLA 3R7LA 1FMLA 5F64A 2Y68A 4F5YA 1EZ4A 2Q2WA 1SVLA 1CEYA 2YOFA 3LW7A 3O83A 2A0UA 4ENTA 3CR3C 3PE4A 3WL8A 3D8NA 4YQZA 2WYWA 4CKYA 5GQSA 3K6SB 1DEXA 3GQBB 2GZ3A 1PNRA 1GU1A 3B9RA 2LPMA 2CJWB 1YKGA 5FUBA 3WLRA 5DCLA 1BA3A 2W4QA 3LRTA 2B8NA 1V5IA 4TLMB 2WJVA 4UHBA 4TSRA 1XMOB 2VDWB 3S1LA 4NS4A 4XD2A 3P4YA 3DAPA 3MGCA 4QFDA 5HKOA 3R7FA 1E58A 2OKCA 1IN7A 1FNDA 1PJZA 3NCHA 2W6ID 4LIPD 3G5AA 1N8SA 1DPFA 4NEHB 1ZU5A 3CF4A 3ICWA 3S1AB 1AXEA 4MVWA 1H3FA 2QTAA 5HFJA 3STXA 2W6ZA 3HJGA 1UMCA 4B76A 1ADGA 4PZYA 2DM6A 3PIIA 2V9PA 3WS7A 1NQAO 2ZWVA 4Q02A 3LGXA 1WJGA 2AV6A 4INAA 2AIRA 3EEQA 5CU7A 1E69A 3RWOA 3TL3A 1MJGM 3OPYB 2MMCA 3W7AA 2E3JA 3BKXA 3N8DA 5FLYA 4RXMA 2PIAA 2WU3A 5EQTA 2OZVA 3RTAA 2VDUE 3KTAB 2V9ZA 5BW8A 4C4AA 1Y8RA 1A7KA 1Z38A 2Y9MB 3OZSA 1ZOPA 1PSZA 1BJRE 2RGDA 1S8NA 5EIOA 1NW7A 5A6SB 1L9XA 4EQ6A 2AG8A 3SS9X 3AUUA 1O03A 2VJOA 3ZHXA 2I34A 3CMMA 3DBOB 3EBPA 3A8TA 4MEAA 5I9NA 3X1YA 4RV9A 2WTEA 5HKBA 1GCIA 1I3KA 1KBQA 3CVUA 3TMKA 4DCJA 4NS1A 4ZQHA 5KPDA 4PZUA 1JA1A 2FETA 3CWCA 3D31A 3OTIA 4F3RA 2OFPA 1WM1A 3L40A 3Q7SA 1T6XA 4E30A 3UAOA 2JAQA 2ZBRA 2Y99A 4UDXX 3ODPA 5G0WA 5LMUB 4NH0A 4ZCLA 3M6UA 4HBZA 3GLHB 2HSDA 4NZYA 3L9WA 1BHO1 4J4TA 3TQCA 1X7DA 1L7PA 2XYVA 1MW9X 3GEMA 3N7TA 4C4OA 4ZN6A 5K2MA 1BQEA 4L3VA 3RLFA 1Q57A 3WNDA 1E1RA 4IPTA 2X4IA 3X2SA 1Q0HA 2V0GA 4MB0A 1UXKA 4IJ6A 1ZD2P 3UBMA 4CTNA 4QOEA 1CS4C 9LDBA 1E9DA 3RPEA 1CQJA 5JAMA 5JZ9A 4FX2A 2ZYDA 3KKOA 4BVFA 1XU7A 4CLHA 2C8JA 3HDQA 4YDHB 5K6TA 2P9JA 1XTKA 1ZCZA 3F6PA 2NU7A 4Q6WA 1VHQA 5DBEX 2VTDA 1VSBA 2QN3A 2QF7A 2Y8EA 5G3ZA 5CA0B 4LA4A 2W6QA 5DEIA 3WYDA 1QSGA 1IN6A 1SEVA 2BEUA 4FQ8A 4ZARA 3JAMA 4RQAA 3R5XA 3EVCA 1A9QA 3ZBQA 3HBJA 1YOVB 2OXRA 1FY2A 1H9AA 2GVNA 3TXXA 4CTOA 2G6TA 3P7MA 1TM5E 3QJ5A 1HE3A 4HWOA 3ZHBA 5C1OA 1ZK2A 4NBLA 3P96A 5FTWA 1OXVA 4X6UA 1MC4A 4KXLA 4AMVA 2I8CA 1RHMA 3Q41A 2IYUA 4B3XA 4GL2A 4MJ7A 5ERXA 3G02A 2FWNA 5AW1A 1CUIA 1V96A 4MA0A 3OIVA 7GPBA 1ZVVA 5C46F 3E8SA 4UAGA 5FBRB 1O4WA 1U5CA 2FZEA 1IPFA 3H3XA 3KWJA 1HC7A 1OCEA 3QIAA 2O1EA 4A26A 3K73O 1V48A 1NG1A 3PV0A 2D3TA 3OE4A 4M4SA 4Q00A 4XVQA 1Z75A 4LHVA 4S1NA 5EXDA 2XRFA 4RDCA 1SG6A 2BH2A 5K3OA 1BKYA 4KBFA 3NOOA 4EF6A 4HVTA 1A9XA 3EAGA 2EJVA 2FW7A 5HUQA 1E0AA 2ZBUA 2Q8PA 5L3QA 5JBQA 2PKQP 3FXAA 4EJMA 4AY2A 1JR2A 1QAOA 1PBTA 5KYXB 4ILKA 1TMOA 3HJCA 4ZVQA 5LOVA 3GLGA 2PS0A 4EYKA 3TF5A 4C07A 2N1BA 4E1AA 2DF8A 5LYJF 3B1JA 3TM5A 3RNLA 2Z6VA 3QOWA 2P2DA 3L1VA 1Q7EA 4G8CA 4H0CA 1C4OA 4JL8A 5JAQA 3C4QA 2EV9A 2QAIA 4KOEC 2ZXFA 2VFAA 3VOSA 2WJ3A 3IMCA 4CF5A 3FCSB 2Z8YM 4HX9A 5KTKA 1LWOA 1A5AB 4TYWA 3B6ZA 3DBHA 1GQSA 1W87A 2AR0A 1CLEA 3M1AA 4CQLB 4O4HF 3VNUA 4OHYA 3H7AA 2O8DA 8GPBA 3ESZA 2BEJA 2D5CA 3BAFA 1R0WA 3HA5A 2DZDA 4JK3A 2J5XA 3T0IA 1U0LA 2GCOA 3IHTA 4YAEA 5JSHA 3E0XA 4DSNA 2IA5A 3D2BA 4R1TA 4ZOAA 3CRVA 2DY0A 4G9GA 4PAQA 2ZRIA 3KBOA 1A27A 3KP1A 5A4JA 1ACMA 3VPCA 4LRXA 4MZDA 3K9NA 1EQAA 4L74A 1RCFA 4KPEC 1JWBB 2UVPB 3SLGA 1QTQA 4YP9A 1L4FA 2Z09A 3ENWA 4UU1A 5EUMA 2NUAB 3TSYA 3OPNA 2FW6A 3GD7A 5DKFA 4AQDA 3K9HA 3IBGA 5BWOA 1OYOA 3EN0A 2IX3A 3L1UA 4AJ2A 1O94D 2PWAA 2VPTA 3VAYA 2R4UA 3LDFA 121PA 1RACA 3PRYA 2OFOA 4TYYA 1CT9A 1YZTA 5CH3A 3NVKI 4DOMA 3K4PA 5F78A 5TPZA 2WD9A 3H1BA 2WKSA 2BCEA 3DT9A 5JJCA 1E1YA 1NBIA 3A1VA 2YTZA 1Y1SA 3TSWA 2ZE5A 5AKYA 3E58A 2HYIC 3S5JA 3BQNB 2JASA 3RQIA 4DR7B 4HPXB 1H93A 4FZVA 3EPLA 3PF9A 1STOA 3TE7A 3UV7A 1QHSA 4EW6A 1BROA 1ICEA 2OAGA 3NHFA 3D4OA 3ZDQA 2I6SA 3FCYA 4NR0A 4UQPA 2QK4A 4C22A 3TFOA 1FVFA 2FKNA 4M1QA 1F7VA 3KL2A 2GZRA 5B55A 3I2GA 4MW9A 1UKYA 1Z2CA 3CZAA 1SXJA 3DQQA 3IR7A 2X19A 4JMLA 5FL3A 3HUUA 2C3PA 3WWYA 1P2BA 1Y4ZA 4DJAA 1T3TA 1A1SA 1WCIB 3BE4A 1J8VA 1CV2A 1FDSA 1Z82A 2I2AA 2W83A 3I9KA 3OOSA 4P0TA 1V1RA 4PNHA 4Y9RA 2GD2A 3UJBA 3UYLA 4QBTA 1QAQA 1CJVC 3DO6A 3R0JA 4H4EA 2QRZA 4S0ZA 4PRYA 4WT7A 4ARUA 5GVRA 4CHGA 3CVXA 2GFIA 2MJLA 2VQDA 1QR2A 2JDID 3F6YA 3IAM6 3KVVA 4E3ZA 2GK6A 4PZ9A 4C4SA 1MOSA 1II9A 3C3CA 3UKDA 1BC5A 4CL8A 1ZCFA 3BRQA 2L69A 2DHDA 2QZZA 3HH8A 3IUEA 4RX1A 4GD3Q 5DBIA 2PD4A 5EERA 3HYCA 2ID7A 2I6GA 1YL6A 2NZ2A 4R2KA 4P58A 1IZ8A 4D6YA 4QPNA 1AMNA 2RD2A 3LHKA 4GKBA 2LCFA 2Y1EA 4OG2A 1MZPA 3IIIA 4YXWA 4BLSA 2XZOA 1JKJB 4XKJA 3H99A 4D3DA 4EK9A 2O7QA 4UBNA 1EFPA 1L7NA 4MQFB 3UMMA 2AEFA 3T3IA 4XLTA 2N3ZA 1SXIA 3T41A 2AH5A 2OV6A 3R6WA 2JLBA 2Q2NA 2GPAA 1JSRA 3TINA 3AZPA 1C3XA 2CMDA 4HYYA 5J4KA 3JZDA 4YWJA 1N2IA 4R7ZA 2JGIA 3WC4A 1EKXA 5H80A