4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
1ODTC 3U0VA 1DT3A 5EIAA 3AILA 2XUOA 3FYTA 1ZIXA 2PSDA 5AM0A 5DYWA 4G5XA 3FOBA 5ALHA 4UBJA 4X85A 3LP5A 1LLFA 3STYA 5AI0A 2ORYA 1XZCA 2XB6A 5BWBA 5IVKA 5ALEA 4DSZA 2J3QA 4AB1A 2WIJA 3CCBA 3PF8A 4E46A 1LPMA 3H2IA 2EDAA 4X93A 4OYLA 1XRLA 2OAEA 4C88A 3H2KA 1FFBA 2GBIA 3FYUA 1IMJA 4J0CA 4YX9A 3VVLA 4AO7A 4H7FA 2PUJA 2RHWA 2WKWA 6YASA 5ALIA 3R3VA 4INZA 5ALXA 1YA8A 4DNOA 4UBMA 3FLEA 3I2KA 3N2ZB 5A71A 4QWWA 5ALRA 3PICA 3O9VA 3OOSA 4TVKA 5LKRA 5T4EA 2VJDA 4IQ4A 3WK5A 2B4KA 4JEIA 5K3EA 3RK4A 4AN0A 4X97A 1EDDA 5FRDA 5CTAA 4IO0A 2GBCA 3QPCA 3G0DA 2GBFA 2JGMA 1CLEA 5K3DA 1QZ3A 2C5GA 3HLKA 3IB3A 2PUHA 2FJPA 3I2IA 1YS1X 5CRIA 4C4ZA 5ALSA 5EIEA 5ALUA 2ZYHA 3W05A 5D3ZA 5AI6A 4KR0A 3STTA 1KU6A 3R3UA 1UXOA 4U2EA 1W1IA 1VLQA 1A8SA 3B12A 1CUBA 1E89A 2XLBA 3H04A 4J3JA 2H7XA 1MPXA 2AJBA 2CJPA 4UBKA 4BRZA 4IH9A 3WKBA 4W1QA 4H7JA 2QXUA 1CRLA 1G66A 1DWOA 4ETWA 2WHRA 3EF3A 4H7KA 5ALTA 1U2EA 1W6RA 2HM7A 4MYSA 3P2MA 1YCDA 2D5LA 2WUDA 1XZJA 3VJKA 3BF8A 1FFEA 3V48A 4B9EA 4PNZA 4A23A 4FFVA 4HRYA 4W1PA 5JASA 2BFNA 2QRUA 2HADA 1YAJA 5T4HA 2CZQA 2WUFA 4XX1A 1GPLA 4Q82A 1TCAA 4QWMA 3HI4A 3WK9A 3QPDA 1B41A 3KWJA 4UHFA 3HC7A 3L1JA 5JIBA 4S0XA 3UUFA 2OGZA 4X71A 1VZ2A 5KBYA 3GELA 4GDMA 3ZWQA 1EK1A 4FFWA 4JNCA 1XZMA 3MUNA 3W9UA 4AO8A 3FYUC 4Q3KA 5AH0A 1JT2A 2W6CX 1F0PA 5JZBA 2BAGA 1KEZA 1WPRA 2XE4A 4BCCA 4RGYA 3GA7A 3WL7A 1FFAA 5AKLA 4K6KA 4KACA 1AGYA 4QEKA 1E3QA 4OD0A 2Y2VA 2Z3ZA 1IUNA 1ORWA 4XVCA 2XQKA 2ECFA 4G9GA 4L0CA 4GBGA 3HZOA 4W9RA 1H2YA 4DNPA 4CFSA 4XIIA 4PSDA 2RGUA 2VJBA 5HKAA 2FJ0A 1T2NA 1OXMA 3D3NA 1EX9A 4MWSA 2HU5A 2CBGA 1WHTA 4Y2QA 5HF8A 4WDRA 5HKBA 2ZSHA 2XI4A 3H1BA 2X5XA 4I4CA 5DTJA 4H0CA 1EXWA 5IVDA 4ZRDA 3AZQA 3ESAA 1Q0ZA 4KAFA 2WIGA 3ZLUA 4DNFA 1DU4A 4FKBA 4EUSA 1QIGA 1A7UA 4FLMA 4XWGA 4Y9SA 4DM7A 1TKRA 1A8UA 3I2GA 2OQIA 2ROQA 5AKHA 5EIHA 3DCNA 5I9IA 4G4GA 1LPBB 3FCXA 4QDZA 2ONCA 3MVEA 4I3FA 2BGRA 3H0CA 3I6MA 5ALQA 1MNAA 3V1KA 2WSLA 4B82A 5CH5A 3C43A 5T4FA 3OTQA 2QUAA 3NWOA 4OU5A 1MO2A 1WCYA 1YS2X 4EZIA 1H2WA 4QZVA 1R88A 2GYWA 2PSHA 1CUHA 4FNMA 1EVQA 2HFKA 4EY5A 2C0PA 1GT6A 5CT8A 1CR6A 3DKRA 2Z8ZA 2DQZA 3FBWA 1VXOA 3OC0A 2OG1A 4EY7A 4IHAA 3G8YA 2FUKA 4EY6A 2JGFA 5I7UA 1W75A 1K8QA 2R11A 4X7BA 3FYUB 4H7DA 4LXHA 2JEYA 4NVRA 1LPOA 1DX6A 1PV1A 4HAIA 4AN1A 5BV7A 2O7RA 1AURA 3LLCA 3IUJA 1XZIA 4B83A 4H77A 4BAGA 4DIUA 1QIJA 1AKNA 4QA9A 5FLKA 3GFFA 4HTAA 1D07A 3WI7A 2ZSIA 5HFNA 1R1DA 5ESRA 4MWTA 3FNBA 3H2HA 5HF5A 2QR5A 1Q83A 5ALJA 1MU0A 2V9ZA 1BE0A 4TPKA 2XMRA 1WB4A 4GW3A 2I3ZA 1LPSA 3QH4A 2OGTA 3TRDA 1AUOA 2WG1A 3YASA 2WFLA 4QDXA 3C70A 1ISPA 1W52X 3WKEA 4CG3A 2J4CA 4BVKA 2C5FA 3Q8WA 2JGLA 1FSSA 1W76A 1IZ8A 4HXEB 3PDCA 3BJRA 5CT5A 5AK4A 2BUAA 3R41A 4UHBA 5LKAA 3PFBA 1GQSA 3STXA 5AIAA 3DYVA 4EY8A 1XZLA 4BATA 3FWHA 1E66A 4ARAA 4LXIA 1FFDA 1QONA 5AKJA 5F4ZA 4Q1VA 1EDEA 1LBTA 5E4TA 2GBGA 4UFOA 1MX5A 1PJAA 5AKIA 2WM2A 1K6EA 4N5HX 3WA6A 3ESCA 1QIIA 1SCIA 1TCBA 4LYEA 2QS9A 5ISMA 1DT5A 1OCEA 5BOVA 5IKXA 2JIDA 3WL5A 3M83A 4ZWNA 3G02A 1L7RA 5BWCA 3KXPA 3CN9A 1K4YA 3R3YA 1ZD5A 1J2EA 4FNGA 4JUIA 4X94A 1OILA 3IA2A 4ZV9A 5AK5A 5E2IA 1TCCA 4KAJA 1R50A 3D2AA 2JGIA 4BCBA 1HLGA 4NZZA 2C58A 1MNQA 5FP0A 3O0DA 4G4JA 2HA4A 2X8BA 5DNVA 1WHSA 3C5WP 4C01A 2WIKA 3PI6A 1TAHA 1VA5A 2GYVA 4UBOA 1H2XA 5AI5A 2WG2A 1CV2A 1CUWA 4KE9A 2ZVDA 4GLBA 2XUPA 4BP9A 1P0PA 5FPPA 1ZI9A 1K63A 2V98A 4BAUA 3A2NA 1UK6A 4H7EA 3TJMA 5FDFA 3QMWA 3BWXA 5EHNA 2VJCA 5AO9A 2HU8A 2H9YA 1BEEA 3G7NA 4BRSA 1RP1A 1GZ7A 2JBWA 5HFAA 4MQMA 1UK7A 2XUHA 4UHEA 2C0QA 3BDIA 3DYIA 2HIHA 1ZD3A 1CIJA 2JEZA 3DEAA 2IITA 4X3CA 2B61A 1EB8A 1T4MA 2VSQA 3MUOA 1O6FA 5K3FB 1BS9A 2WJ3A 5AI4A 1EHYA 1P0IA 3I1IA 5LP1A 2QTBA 3EQ7A 3QZUA 1UOPA 1R4ZA 4FDMA 5EI5A 1XQYA 4HS9A 1EA5A 4BP8A 1QE3A 4N8DA 5KWIA 3NUZA 1Z68A 4QLOA 4YASA 4H35A 3LIPA 3I1YA 4J0GA 3V1MA 1CUYA 3DDUA 3VVMA 2XMDA 5JZSA 4J0HA 3IVMA 4W1SA 1A8QA 3ZPXA 3O9MA 5HF6A 1Q84A 3ICVA 1E8MA 4DTCA 1UT6A 1QTIA 2HA3A 4JYPA 1QJ4A 4Y2TA 4M0FA 1CFJA 3W2TA 1YSCA 2C7BA 4C89A 4F60A 2WQZA 4AO6A 4WJLA 3I2FA 1JJIA 5C7YA 4NS4A 1HPLA 3CCCA 2PKYX 2VAXA 5J3JA 1VJ5A 3KOOA 1LBSA 4Y2SA 1JI3A 4UUQA 2UZ0A 1CQZA 3E4DA 5FUMA 3A2LA 3HEAA 1DWPA 5AKGA 2JGKA 5ALDA 3F96A 3KSRA 4WY8A 3IURA 5A7HA 5KREA 1N5MA 1EINA 5LYYA 3H2JA 2G5PA 4G4IA 1ODSA 2VA9A 1G5FA 2WU4A 3HSSA 4Y2XA 1HL7A 1Y7HA 2HFJA 3X3HA 3RM3A 4J0IA 2EEPA 2WHPA 4AMZA 1SC9A 2WTMA 1XZBA 3G9ZA 4DMCA 2FX5A 3ESDA 1GKKA 2OCGA 3RKSA 1YB7A 3HACA 5FPQA 1UOOA 5CH3A 3OM8A 2BUBA 2DHEA 4P92A 1JFRA 4DMHA 1UKCA 4J7AA 1TQHA 1QTRA 4FLFA 2QOEA 1BROA 5FKJA 3AUKA 3G9UA 3B5EA 5C8XA 5AOAA 2AJDA 5IVIA 1E8DA 4PW0A 4HZGA 4P93A 4P9NA 5ALLA 3CXUA 5DYYA 1NU8A 4DMFA 1G4HA 1GXSA 3M3DA 3STVA 3GROA 3Q0TA 3OURA 5YASA 1WM1A 4BVJA 2CUTA 2BKLA 2XUFA 1R9NA 5HK8A 3K2IA 3IULA 4QDTA 3EIOA 3GUUA 1S8OA 1YR2A 2Y1KA 5AK6A 5K3BA 3DJYA 3PUIA 1M33A 4PF1A 1Q0RA 1XRNA 4ARBA 4BC0A 3KD2A 2WHPB 3WK8A 3G0IA 5IVHA 2XQFA 2BGNA 4QDOA 4PSUA 3D7RA 4MXDA 4UFPA 3G0CA 3QPAA 2PU7A 2W22A 4CG2A 2NW6A 5DWDA 2WG0A 1UZAA 2OCLA 1MX9A 2WJ4A 3A2MA 5K3FA 4B84A 3AIKA 5K3CA 2PBLA 4FMPA 2XUKA 2DR0A 1CUVA 3DLTA 3WWDA 5LZ5A 2XMGA 3EQ8A 2DQYA 2GZRA 4MJ3A 5E4YA 5DLPA 2ZJFA 2CKMA 1DQYA 2WJ6A 2XUAA 4ITVA 2PSFA 4JYMA 2HA6A 2HA2A 1CUUA 1BRTA 5HK9A 3B3QA 5A6VA 1LZKA 1MX1A 5AM3A 1DWQA 1BN6A 1QFMA 3C8DA 1UK8A 1CUJA 1HBJA 3C5VA 2PU5A 1XZKA 1UWCA 1GPKA 4Y2PA 1JKMA 2O7VA 2QKYA 1XFDA 4C4YA 2WU3A 3PUHA 4G8DA 3WZLA 5EHZA 3RLIA 3N0TA 1NU6A 2R8BA 3I2JA 3W06A 2XUDA 4H18A 3D5EA 4GI1A 3ANSA 5C81A 1LPAB 2IX9A 4BC1A 3FSGA 3O4IA 1IZ7A 4ROTA 3T4UA 2WUEA 1XKTA 4X90A 1VA4A 4KE7A 1CUZA 2RI6A 4MEBA 2B9VA 4MEAA 3JYHA 2HA5A 4Y2VA 3UMJA 3STWA 4ZGBA 4Y2UA 1FJ2A 2XLCA 1NX9A 1XQWA 1N1MA 3KWFA 3E3AA 4WCVA 4W63A 4CG1A 1QIHA 4Q05A 3TEJA 5JANA 1F6WA 4C6HA 1MJ5A 2VT6A 2X76A 3SC2A 5CH8A 1I6WA 4E14A 3R3XA 4PQEA 1GKLA 1QOZA 1J07A 1VZ3A 5CT9A 4BE9A 1ZI6A 5DNUA 4BCDA 3WL6A 5DJ5A 5AHXA 1H2ZA 1ZJ4A 1DX4A 5ALNA 3O4JA 2VT7A 1XZFA 2E3JA 2PSEA 4BTVA 2V96A 5D6OA 3WWEA 1AZWA 3EQ9A 3CN7A 2YASA 4L3WA 2VJAA 4N8SA 4OCZA 2J3DA 5JAUA 5LZ2A 1XQVA 1J06A 5AKEA 5A7GA 1L7QA 4FWBA 5K3AA 2Z5GA 5CURA 1AQLA 5JD5A 1X2BA 1XLVA 2JGEA 1HKHA 1WPXA 3WIBA 4GXNA 2AJCA 4OB6A 2PVSA 4AX4A 1PFQA 3WKDA 4U2DA 5IH7A 1QLWA 5FV4A 1CQWA 4Q3OA 4UBNA 4DYHA 2WIFA 3W04A 4Y2YA 3HYSA 5CXUA 1ZOIA 2VEOA 3STUA 1VKHA 4U2FA 1BCSA 1KU0A 5AM4A 5CT4A 2QM0A 5EGNA 1USWA 2O2GA 2BUCA 4RNCA 4X6YA 4UHDA 3SK0A 1R3DA 5EFZA 5JD6A 3WK4A 3JWEA 1QIMA 3MGAA 5AM2A 2G5TA 1F0NA 4EA6A 3F97A 1XZGA 3HXKA 1SFRA 2I3DA 1LPNA 1TK3A 3I2HA 4Z49A 3SWWA 2I78A 5T4BA 2G4LA 4PO3X 4KE6A 4AQDA 4MYDA 1ACJA 2Z3WA 4HXGA 3QMMA 4DSAA 4E15A 4HVTA 4WFIA 3BXPA 4MQLA 3EBLA 3AZOA 3WKCA 3FAKA 5DTIA 4BYMA 3LCRA 4UPDA 4DLNA 3WWPA 1UOQA 4QE3A 4CCYB 4FBMA 4CCYA 1CVLA 4N8EA 5ALKA 1H23A 4WY5A 2QJWA 4A5SA 2WFLB 3QITA 3E0XA 3VKFA 2H7YA 1IUOA 3F98A 3KDAA 2BCEA 2O2HA 2G63A 1CUDA 1B6GA 2AJ8A 2RIPA 1CUXA 3U1TA 4BZZA 3L1IA 4KAAA 3BL8A 3WIOA 2WFZA 3DOIA 4OU4A 4U2CA 1HQDA 1AX9A 4X00A 4UBLA 1XRQA 2JGJA 4OYYA 4WFJA 5AM5A 1XZHA 3QM1A 2OQVA 2DHCA 4CI9A 5AKXA 2D0DA 2XMZA 3WJ2A 4JH0A 3LS2A 1LNSA 3WLAA 4B81A 1TIBA 5LZ7A 2XDWA 2PPLA 2XMCA 2PM8A 1CUSA 4KRYA 2H1IA 1QIEA 1RYYA 4EHBA 1YAHA 4AMYA 1VE7A 4B9AA 4B6GA 1GQRA 2OXEA 4N5IX 4AXBA 3I28A 2QUBA 4OSEA 4OPMA 2AJLI 1BCRA 3WYDA 5AK3A 3QMVA 3O95A 1C4XA 4EBBA 4ZREA 1SCKA 5SYNA 4BE4A 4C87A 2CEKA 3ED1A 2Z8XA 3AINA 1HDEA 4AZ0A 1CUEA 1XROA 2HU7A 2YYSA 4K6HA 1JU3A 4RPCA 4YK7A 4PSCA 2XQIA 1L7AA 4J0KA 3RARA 1XQXA 5AIBA 3GBSA 3W9BA 5ALWA 1THGA 3ZLVA 3BE8A 3IBTA 3PF9A 2VAVA 3FLBA 3K6KA 5JZ9A 3OPMA 5JAHA 3K9BA 2DCMA 3ZV7A 4FHZA 2BJHA 4KJXA 3M82A 1CPYA 4AZ3A 1XLWA 4GEGA 3H17A 4V2IA 5CXXA 5AOBA 5LZ8A 4BTLA 4WDQA 1WB6A 5ALOA 3D2CA 3D4LA 3D59A 4J0DA 1W4LA 1EDBA 3R40A 4IH4A 4QNNA 1EVEA 3OG9A 4OUKX 5JARA 2WLSA 2ES4A 5ALPA 3QYJA 4UFNA 2HRRA 3V1NA 1JMKC 5FXMA 5JATA 4E11A 2PX6A 2ZYRA 4F5ZA 1U4NA 1CUIA 4B0OA 2WUGA 1QIDA 3T52A 2CB9A 3FLAA 4U2GA 3R3ZA 1SCQA 3I6ZA 3FCYA 4FBLA 4G9EA 5C8ZA 4H7IA 5HQ3B 4FOLA 1YB6A 1R9MA 2QXTA 1A88A 1XRRA 3O4GA 4Y2RA 1VOTA 3C6XA 1MTZA 1XZDA 2XUJA 3GZJA 5LZ4A 3DL4A 2VATA 1X70A 7YASA 1ZD4A 5HQ3A 1SOMA 5E4JA 2OPHA 2P8SA 4CCWA 3I6YA 2ACEA 2RONA 3ZI7A 4K2AA 4X95A 3SX4A 5ALMA 1MN6A 4KYVA 3WKAA 1MAHA 3WWOA 3ICWA 3VISA 3G9XA 2CMFA 2RAUA 5CT6A 1CEXA 2OLEA 3IUQA 4X6UA 3VJMA 5H3HA 3BIWA 4LKOA 1EK2A 1JMYA 2XUGA 3QVMA 1MT3A 2QJRA 2XMQA 3NOXA 2HRQA 2ZYIA 1ORVA 1U8EA 3VDXA 3VJLA 5AJHA 1Y7IA 2JF0A 5FOQA 1MAAA 1ACLA 1LGYA 5KWJA 1CUCA 5HZGA 3DQZA 3DD5A 1JU4A 1UKAA 5JADA 2AXEA 5ALZA 1XRPA 4D9JA 4L72A 1VE6A 1ZGBA 4YPVA 2HDWA 5AI8A 1DTEA 4G8BA 4W1RA 2EDCA 3BDVA 3C6ZA 1ZJ5A 2WFMA 3ILSA 3AJAA 2ACKA 1ZIYA 5JALA 3D2BA 3WMRA 4F21A 2XMBA 5EHQA 4X91A 1WOMA 3QBJA 1QO7A 2J4FA 1C7JA 4KE8A 3WA7A 1E8NA 1DQZA 3WQHA 4F0JA 3V1LA 1JJBA 1XRMA 5AOCA 4KRXA 4FLEA 4O08A 3S8YA 1EB9A 2DSNA 3FSGD 2XUQA 3LIIA 5ALFA 1XKLA 3C6BA 2WIDA 1F8UA 4PV7A 3BF7A 3IDAA 3C8HA 4BAZA 4UBIA 1RWQA 4TGLA 1GGVA 1YA4A 3IUMA 4H7HA 2WHQA 4GWLA 1JJFA 3AIOA 1WB5A 1CUFA 5CBKA 1TRHA 1QGED 4BZWA 2PL5A 3DOHA 2Y2UA 1J1IA 4RE5A 5I8PA 5A62A 3DL7A 4OB7A 2HA7A 2XMSA 4M0EA 3PE6A 3FVRA 3F8SA 3S2ZA 1H22A 2VTVA 2WILA 4Q3LA 4J0JA 1YASA 4BVLA 4Y2JA 3H18A 4EB0A 5LLSA 3FVTA 2YXPX 2QVBA 1ODCA 2OCIA 5JD4A 1CUGA 3H1AA 5AICA 1O6GA 4B0PA 5D7BA 3PFCA 1P0MA 5LZ9A 4DGQA 3UUEA 5JAPA 2QZPA 3DKKA 4GHWA 4M0MA 5ALGA 4B7ZA 2HHAA 3C6YA 5C8VA 1AC5A 5AM1A 2I03A 3DNMA 2RHTA 5HCUA 3AFIA 2OAGA 1N5RA 3VXKA 1ZICA 1CUAA 2ZJ7A 3H19A 1QO9A 3BJMA 1QFSA 4J03A 3A6ZA 3C45A 4HRXA 3TGLA 4G8CA 5HF9A 3H2GA 1G42A 4K5QA 5EHXA 2V97A 3V9AA 2GZSA 3WZMA 3WK6A 1UFOA 3WJ1A 3G0GA 3A70A 1P0QA 2XQJA 3IIIA 5K5EA 2LIPA 1EH5A 4B85A 1X2EA 2XQGA 1GPNA 5JYCA 5AI9A 4QDUA 2ZYSA 5AKKA 1QIKA 2K2QB 4WFKA 4BDTA 3D0KA 3HJUA 4QLAA 1BU8A 1K5PA 1U65A 4UHHA 4L9AA 1IUPA 5JAOA 4A16A 3AIMA 3ESBA 1LZLA 2OGSA 4K6GA 4X92A 2DFPA 4NMWA 2H7CA 1N8SA 4LHEA 2QT9A 2VQ6A 3HRHA 3M81A 1ETHA 4BDSA 4X6XA 5ALYA 1ZI8A 1XZEA 2DHDA 3L1HA 1C7IA 2HL6A 4IH1A 4DNQA 1BEZA 3F9CA 5CW2A 4ZV7A 3HABA 4LYDA 3E1GA 1XZAA 4G1FA 1EI9A 5ALVA 4XJVA 3DS8A 2PSJA 5CMLA 3ZLTA 2OCKA 5SYMA 1DINA 1FFCA 4B80A 3WL8A 2Q0XA 2O2IA 4P08A 1BN7A 2WTNA 5DNWA 3C87A 3G0BA 1VXRA 5AKYA 3F67A 4LIPD 4CIBA 5D3KA 2VF2A 4OB8A 5DYTA 2IIVA 3WK7A 3G9TA 3WWCA 4Q34A 3JW8A 4ZXFA 1IVYA 4BBZA 1AMNA 3WYNA 3IUNA 1ZGCA 4I19A 4CIAA 2XUIA 4BB0A 4EY4A 1UKBA 1LPPA 3BIXA 4LXGA 1QIFA 1XLUA 5LIPA 1Y37A 2GYUA 3R0VA 4C4XA 4HXFB 2QMQA 5AP9A 5A2GA 5AKZA 1E5TA 1THTA 2Y6UA 5A7FA 4DMKA 3ANTA 2YH2A 2B20A 2Y6VA 3O4HA 2XT0A 4KEAA 1UK9A 4ZI5A 2HA0A 4Y7DA 3NGMA 2ZJ6A 4FTWA 4U2BA 2C4HA 4UHCA 1ZD2P 4RE6A 3AZPA 4GECA 3R3WA
chains in the Genus database with same CATH superfamily
3TTWA 4A4DA 3U0VA 3BULA 3DQPA 1DT3A 2WU1A 2HMTA 2PWZA 3N3BC 1D2HA 3JALB 3O3NB 1K6XA 3MIIA 1NULA 3QTTA 1S2LA 2XUOA 3T1VA 1PEAA 2HBZA 2ADOA 1OR8A 1ZIXA 4EL5A 3ORFA 4L5AA 4QBIA 5J2TB 3AFMA 4LKRA 5HGXA 4DKJA 2FEMA 4KN6A 5F78A 5AM0A 1ZGJA 4R8LA 3X2SA 2O8CB 1KEVA 3LPAA 2GPYA 2GSWA 2IUYA 2JA1A 3FOBA 2QL6A 4U0KA 5ALHA 3ICEA 1TW3A 4X85A 5MDHA 2QRVA 1LLFA 2NO1A 3LP5A 4G0WA 3B78A 2GBLC 4ICIA 2CVFA 1VMKA 1JQEA 4L4XA 4GZ3A 3ZE0B 3GNLA 4IKPA 4RLHA 3T1YB 2B21A 4EX7A 1MABA 4TZTA 1W0JA 3IVCA 4HLDA 5LJLA 3ROXA 1R2QA 4RJKA 1YB2A 5ENZA 3F3YA 4JBGA 5KYVA 3RTGA 1S96A 2HQOA 3KDPA 4EGAA 3U7QB 5DIZA 4Z1MA 1ELOA 3VPBA 1OV6A 2FPLA 3GUZA 1DCTA 4DG8A 4L5IA 4CF3A 4B3SB 1EEHA 2JGRA 3LYHA 4DFDA 3MHTA 4RVNA 3KE8A 1EFVB 2IBMA 3GPDG 3PGKA 2J3QA 3U9SA 3TDKA 1ZN7A 3K94A 3DMFA 1E1CA 3EIUA 2GK7A 2C2YA 2GRUA 3ITKA 1ZJZA 4PVDA 4QD3A 2OA0A 4E21A 1GV1A 3TZHA 4Z5XA 5JV5A 3UOGA 3CCBA 3NM5A 3HKDB 3PF8A 4GICA 4QQNA 1LPMA 2EFJA 4I5FA 4NZ9A 3L4BA 1KDZA 4M0PA 4P0TA 1ULSA 1FLDA 1DDGA 5JXGA 4OYLA 4WACA 1O9GA 1K66A 1Q11A 3K4HA 3AB7A 4C88A 2AX3A 3PE4A 3IVXA 3H2BA 3OZUA 5IKMA 3FYUA 5G0WA 1J70A 4YX9A 1L8AA 2VT3A 3ETNA 5KAPA 1SQ6A 3UJCA 1VL6A 3VVLA 4Z7NB 5T7BA 1Q7EA 2WB4A 3SFTA 3CUVA 2D2XA 4Q48A 4N7RA 3CTMA 5MF6A 1Z0JA 2BMVA 4HI0E 4EI7A 3V4PB 3W5JA 3LDAA 2QTGA 3AVPA 4UBMA 2ZQYA 3QA9A 5ER6A 3N2ZB 3MMNA 2VDOB 3E23A 2WWGA 3LCMA 3MFQA 3OZDA 2V7QA 3PK0A 3PKJA 1FDRA 1IHPA 5LKRA 3IP1A 4R05A 1FJHA 1XF1A 2QTLA 2VJLA 4Y6OA 5T4EA 1GL9B 4JYCA 3IE1A 1D7OA 1ECLA 2C59A 1PKEA 5ESWA 1JFFA 4HNRA 4I2VA 4J49A 5DPMA 4BGDA 4CQNA 4WXEA 3RV4A 3MXTA 3JRXA 1MBZA 3EXFB 1TADA 4URFA 4HS4A 3OKFA 1YTLA 5U9CA 3ZD8A 3UHOA 4EHJA 5LWHA 1L7VC 2FPUA 2QMHA 2IZOA 3GLIA 3F7OA 5FNVB 1GU0A 3TG2A 1H9CA 4ZQCB 3JARA 3ZW9A 4Z8XA 2F3SA 1TYDE 2Q1SA 2E1RA 2EOAA 2IS4A 5KSPA 4FC7A 3F46A 4JJEA 3Q8LA 1OAKA 3D7NA 3G0DA 3WMFA 2GBFA 1CLEA 4Q1EA 4MGZR 4Q9AA 3HM2A 1E2HA 2R4TA 3LCUA 1AUQA 3HLKA 1V4VA 1VI2A 4FW9A 4WK0B 4PO8A 5HG0A 5IABA 4OHUA 2VT2A 2Q50A 3SC2B 1A8HA 4G5FA 3GEGA 4WERA 2NZUG 4M8KA 1Z5WA 4KIJA 3U4CA 1A98A 4IILA 4C4ZA 5EIEA 1KO4A 2ONKA 3A6HA 1I9CA 1KAHA 2RSLA 2WPNA 1RQGA 3GOQA 5E9QA 3WGGA 5ITSA 4OTZA 3OKPA 4U2EA 2B36A 2R8EA 3CLHA 4IZHA 3D6HA 4CGZA 4G37A 1A8SA 3BL6A 1JBEA 3IP5A 4CV2A 3P9PA 2G6TA 2XLBA 1T5LA 1ISHA 3H04A 2H7XA 4DL9A 3EG9B 3MBIA 4KREA 3I53A 1T1IA 4C4AA 2H6EA 2ZRGA 2CJPA 4HCJA 1D8TA 4UBKA 3WKBA 2DFLA 1VLMA 3DBIA 4IM7A 1F9AA 1ORRA 1VE3A 1XHLA 4JVSB 1XA0A 1V9LA 3HDQA 3KIPA 5EWMA 2NU9B 4L9SA 3V7UA 4JWTA 1N7GA 1P17A 4LYGA 4B79A 5KX5A 3I6IA 1O3YA 1ZP6A 3DT6A 4HYTA 1SKUA 1C9JA 2D7JA 3FW1A 2NYAA 4WXRA 2HLDD 4CV0A 1NXXA 2JFPA 1FRFS 1NIPA 3E81A 1JSLA 5EEHA 3URMA 1FDWA 2VPWA 1NOIA 1PZGA 1NV8A 1P6QA 3Q88A 3COSA 2P4SA 5ADWA 1Q5PA 3L1UA 3EF3A 1PR9A 2AOTB 2ZJOA 4H7KA 4FEGA 3VU0A 2H3HA 4FU0A 1G4UR 3ID6C 1U2EA 4KFUA 4U63A 1SVSA 5FTWA 3SXPA 1MGOA 1RT9A 4BO1A 1UUFA 5KTRA 4CUZA 1YCDA 2D5LA 2IVFA 2WUDA 3LUKA 4R01A 1XZJA 2Q1YA 2YINC 2CNKA 1IHXA 4TWZA 3VJKA 3KEFA 2Q27A 5BRAA 1I3OA 3HU2A 3O8QB 2BOVA 3MSXA 3P20A 1U8TA 2Z4SA 3TLZA 2UZ3A 4R8MA 1FTYA 2G25A 3NGLA 4ZHQB 2ZETA 4LC0A 1FFEA 3V48A 4E2FA 4RM3A 3IV7A 4A0GA 4HRYA 4HUJA 5KINB 1Q2XA 3R6DA 3UMBA 4W1PA 5A5EA 5C46F 3RFUA 1JUDA 4JUCA 1M10A 2X9GA 2B0CA 4L02A 1YHYA 4LMBA 4URVR 1NQ5A 2HADA 2W6JA 3MJSA 2WZQA 4JQCA 5T4HA 1JQLB 4YHBA 4Q3EA 3UK7A 5T5QA 2CZQA 1XT6A 1A1VA 4XX1A 1GPLA 4Q82A 1DMSA 1TCAA 1IDN1 2LKDA 2RKWA 3E8SA 3FCSB 3PFIA 4AWBA 3QPDA 3UANA 1VSUA 3AF4A 4I99A 4BP3A 3F5SA 3UAZA 4TTPA 2RGWA 1D7AA 3OF3A 4LRYA 3UUFA 2OGZA 3DE1X 4NENA 1VZ2A 1MG0A 4E3ZA 5KBYA 1RJWA 1HI9A 2Q9UA 4GM1A 2VKTA 4JQOA 4A73A 4JNCA 4MOWA 3QG1A 5DNCA 4X1OA 3FYUC 2UAGA 5DBIA 2W6CX 5B6JA 1BH6A 3E5RA 5KYGA 3AU9A 5CIYA 1RYFA 4O4JA 2XE4A 4BCCA 3TNYA 4MZXA 4RGYA 1JYFA 5HKOA 1EHCA 3IEXA 3WBJA 4GGOA 1OXBB 4MVJH 4O4JF 5LP6F 2I91A 1IVNA 4K6KA 3DP9A 2X4LA 4UKDA 3RVKA 1U9YA 3VU9B 1BRMA 1SQSA 1ZY2A 1IXSB 5LQNA 3I9KA 3MW8A 1E3QA 4OATA 1IY8A 2R79A 5A2QA 3R44A 2CLLB 1IUNA 1ONPA 4YAEA 2H29A 4OI4A 2AYYA 1C8LA 5CITA 3PG5A 1J5PA 1JAIA 3H5OA 4MS1B 1W2HA 2WKSA 3USCS 4ZQGA 4F2HA 2CNDA 4D80A 5TV2A 4X44A 4LOIA 3OEYA 1H2YA 1EHIA 1B26A 2CJWA 2BI8A 1KVSA 4PLPA 3RT9A 4CFSA 1FXUA 4E7OA 5CX4A 5BNZA 1M54A 5E6RA 5IYZB 4PSDA 1QU3A 3HCFA 4HMOA 4I6GA 5C80A 3GMIA 4FFPA 4ZRNA 3NTRA 3OMXA 1H94A 1RAEA 4S1TA 4RV4A 2JZNA 2VJBA 4DY6A 2G77B 3CT4A 2C2WA 1RE0A 2JD0A 3HA7A 3FUVA 4IDPA 3F78A 3DO6A 5H7XA 2I7CA 3ROTA 1HMPA 2HBYA 4RGBA 3V97A 2NTNA 4LE2A 3ZTYA 1IL0A 2C8VA 2IHVA 4JP5A 4MWSA 5H59A 4A2WA 5FLEX 1Z5OA 1MOQA 4EF5A 4DRXA 4R16A 2Z6VA 3Q15C 1FP4B 3SIPA 2WV9A 1WHTA 4P58A 3SF8B 4PXAA 2GKSA 2PZJA 5C8DA 5HF8A 1KYYA 1GAXA 3GJYA 3UV6A 4AD8A 4GS5A 2IXGA 3VR1A 2EL7A 2V7VA 3AGQA 5EC8A 2A5GA 4A10A 2VJMA 4HEJA 4R2XA 3LUPA 4UMDA 5TS2A 3KPYA 4WZ6A 1UFVA 4H0CA 3WP1B 5EKXA 2FW8A 1CEYA 3KSMA 4ZVKA 3NM4A 1J0BA 4ZRDA 3TVTA 3AZQA 3BIOA 4IDFA 4ESHA 3C5HA 1WSBA 1PNOA 1QLHA 1YVPA 1WXXA 3RTEA 1X1QA 4XGRA 1KI6B 1TF7A 4KAFA 4QXPA 4FNOA 1CERA 1EE1A 1CQIA 1DU4A 4RAQA 3LUAA 4FKBA 3S7TA 3HEMA 1CY0A 1QIGA 1TU4A 2B6HA 2C77A 2R6DA 4NDAA 5FO0A 3VR4D 1HYGA 4Y9SA 4A8PA 4L74A 4CKZA 1N2IA 2HJWA 2CLSA 2JH8A 3M70A 2OQIA 2OHFA 4YHHB 2ZPAA 3PEYA 2YXEA 1Q92A 3N7UA 3X1JA 2FEKA 4BJ5A 4QM7A 5I9IA 5IP5A 3DTNA 4W9NC 4EA9A 1G1MA 2C83A 3KJEA 3A0RB 1M0SA 3FCXA 4L4RA 3MC1A 4N3AA 4TKLA 2AFHA 1OYOA 4RMHA 2ONCA 3FCAA 1JDBC 3MVEA 2SKDA 1X1TA 4D3ZA 3EC7A 4I3HA 3GRAA 5K45A 3NC0C 4UATA 1MNAA 1OJLA 3I5AA 4RFLA 1M9NA 4XRRA 3V1KA 5CVUA 2XZPA 3TUZC 4ZQHA 2QD3A 1G18A 4HAWA 3FNGA 1E6LA 1AN9A 2MMGA 3QSGA 2ORIA 1C0EA 3DTVD 2OE2A 3H16A 1UJ4A 3LT1A 1HUQA 1YU6A 4GLLA 4RD0A 1JIQA 1DC3A 3G5MA 4I55F 1QR2A 1N4AA 3T9DA 1YS2X 2EF1A 3GVHA 4ZK2A 2A5FA 3TZCA 2QTMA 4QZVA 3L4KA 1SXJE 3I9V6 5I5EA 2OUKA 4TVBA 4ZDWA 5JH7F 5C18A 2X0DA 1RXYA 2HFKA 4BNUA 4JR0A 2PA0A 4ZZ3A 1IQUA 1VL0A 1BJTA 3DULA 1N5DA 4HNAB 1C4KA 3KR9A 2VDJA 2PBZA 4E12A 5JCJD 4J16A 1QYDA 2Z8ZA 4AKSA 3QKRB 5DBGA 1VXOA 2FWJA 1Z83A 4N47A 3OC0A 3UNXA 1T36B 4FINA 1F2TA 1C30A 3NANA 1T0JB 4PN7A 2QNRA 2WNHA 2C7PA 3RSLA 1K4KA 4V0OA 4FYKA 1KOLA 4IIBA 2AOUA 4WKNA 1O0BA 5A9SA 1J4AA 2R3SA 1KFBB 2FWAA 5L4NA 3WRVA 4LHYA 2ETXA 1G55A 4JL5A 4MQEB 3GF4A 5CK5A 2C98A 3BWDD 3DNPA 2WTXA 1RJGA 4V02A 4DV5B 2OHXA 4FGKA 2JD1A 1S7GA 2DWOA 5D51S 4MKZA 4S1PA 4M8IA 3OQPA 4HAIA 1F7VA 4MDFA 3PWSA 4IG4A 4O2RA 2JPDA 3OZWA 4MWZA 4DRXB 4TVSA 3GFQA 3LH5A 4AN1A 4QTXA 3DEKA 3PA8A 4ODIA 1LV7A 2IYUA 4RPLA 2NUPA 1N0UA 2IZ6A 4JJ7A 3PFGA 4KMRA 4TLDA 3T7EA 1MO4A 1BWPA 2E1PA 3IUJA 4BNNA 4B83A 2IHUA 2KHZA 5C0OE 4H77A 1U1GA 2WWHA 4DIUA 4ZYYA 3ZV4A 2GJ4A 2NU8B 3A7EA 3L8ZA 3M6MD 1L4GA 3CA8A 4LMRA 4AP9A 5DSXA 2VXOA 1WXQA 1CZLA 4R3UC 5KSOA 1VG0B 3IAS1 3GAAA 1T8UA 2EJTA 3MOSA 3WI7A 4CUKA 2EHDA 5ADVA 1ZC3A 5T8KA 2VJNA 3D7KA 1YS9A 1KI6A 4YMGA 2P9FA 3BMCA 2CLMB 3A9TA 1JR3D 3FTPA 4V0SA 3R7LA 4R0MA 1RZRA 1OMOA 1HEUA 3H87A 3X44A 5JG7A 3ORYA 4MO2A 2L18A 4BRWA 5ALJA 3P1JA 5DHUA 1JLHA 4NG5A 4B34A 3PV0A 4R9UC 1VPVA 4RH3A 1VKRA 1YE5A 4TPKA 3K0FA 1M8KA 4CT4B 4J75A 1O94D 1SEPA 1E7MA 3HU5A 1NBHA 1XB2A 4GW3A 3C16C 4HO1X 3GZTB 4B74A 1DTWB 3NGXA 2GZDA 3GRUA 4FZ3A 1FNBA 1ZXLA 2OGTA 2WJGA 1THZA 3TRDA 3YASA 4EP1A 2D59A 2WFLA 3MK31 4M46A 3C70A 1ISPA 1BGXT 1H2RS 1U3GA 1PT5A 4PGFA 3WKEA 4LZJA 1SC4A 1Y8RB 1UJ2A 1H0RA 2IXTA 1TM3E 2QGFA 4KTVE 4MCHA 4CG3A 1G7SA 1EMDA 4LI3X 1M5RA 5JZOA 5DBFA 1UXKA 2H4YA 4M6WA 3MWJA 3GFSA 3KG2A 1CIPA 2JGLA 3O6VA 1WPGA 5GINE 1EFRA 1EBBA 3FNIA 3IVAA 3PDCA 5KNCH 1XYVA 3BJRA 4P32A 5CT5A 4AZ3B 4H1VA 2CLKB 1V3TA 1B6SA 3MN1A 1QXSA 2P3OA 3N2IA 2OV6A 2EYQA 4FSHA 2O52A 5LKAA 1O96B 2CJWB 5FEUA 1IBLB 3O4RA 3TLXA 4CQMD 1L9XA 3HYRA 1NMYA 1AMUA 1GQSA 1X86B 1VJ1A 4RACA 4HLUC 1DTSA 2WSSA 3RSGA 3A1DA 3DYVA 2JCSA 3RSQA 4LOKA 1LV8A 4LWZA 4J0EA 1KARA 4XVQA 2F4NA 1QX3A 2KE5A 3PIIA 1C3LA 5J2TF 3T35A 3TDMA 4BATA 3L0PA 1NXOA 1IN8A 2F7SA 2Y1EA 3HCDA 2BP7B 1K68A 1FE8A 3FWHA 3L8FA 5A0TA 2PUAA 1GFSA 1MMFB 4QJIA 3ETCA 5FUYA 3CBGA 3FX2A 1NP7A 3WGLA 3VR6D 3TW0A 3M9WA 1T5HX 1VCOA 1FP7A 2QSYA 4JJ8A 5EUBA 4JXZA 4TRNA 1HRKA 1QOQB 2Y3IA 2QORA 4NBVA 3ME5A 1T24A 5F4ZA 3IODA 3JYOA 4RKYA 4KMSA 1G6Q1 4MQUA 4L7VA 4KWTA 2V3WA 4GI5A 2H92A 4KQEA 4Q1VA 2BMWA 3THYB 1C30B 2H1OA 3AVXA 5BMVF 1LBTA 4AX8A 4Z1OA 3QE2A 2PJDA 1PGOA 2I2AA 4B6OA 2VBFA 3DDOA 4A3SA 2IV7A 4DMUB 1NXWA 1DEHA 1PJAA 1YE3A 4DC1A 4QU8A 4DT1A 4F5WA 2C2GA 3TVYA 3NALA 4MJLA 4MW1A 3VSDA 2ILVA 1YF3A 4HNAA 2XMPA 4JVOA 3JQBC 3JVVA 4UVGA 4F6CA 2VUSA 2LIVA 3C7DB 3HXMA 4E33A 2J5XA 5JRDS 3OT1B 1ZK2A 1KKLA 4A26A 5E9WA 2VCHA 3ABSB 2WE7A 2Y4NA 4LV6A 1CJSA 1YZNA 3LO5A 2PDAA 1GUFA 1ZHHA 5BOVA 3ROFA 4JEMA 2B1JA 3LLUA 1JECA 1DDIA 1YNSA 4KQKA 5EQJB 3HYNA 3UTDA 3DHEA 3VC1A 4ZWNA 3G02A 4ZJUA 1X1RA 1J8QA 2M98A 2NSHA 1QWOA 2X6RA 3GLUA 2PGJA 3CN9A 3KXPA 1EBUA 1PLKA 3OEHA 2AR0A 3GJZA 4YS6A 1OT3A 3GEMA 3CYFA 4FNGA 1N6HA 1ZD1A 2WEKA 1IJBA 4KXFB 4B48A 1T3LA 3GN1A 1HV8A 1HG0A 1S2GA 4IEIA 5LBUA 2GN2A 2CLOB 4I0WB 4BNWA 5ABPA 2K7ZA 3MLAA 4I50B 5EXDA 4CM9A 3D6FA 1T5BA 2BF4A 3K4PA 4J9UE 4IDQA 1V1RB 1R6AA 3H5LA 1L2TA 2FOIA 4I8XA 4BCBA 1DKLA 4QOHA 1T1SA 1NF2A 1J97A 2FP3A 5B7QA 1BJRE 3JZFA 5FEMA 1D4OA 1RADA 4NZZA 1ZM7A 2XNDD 4QX6A 4UU8A 5FR2A 4BWGA 3SQWA 5FP0A 2BGGA 3O0DA 2AHOA 4HNGA 1VPEA 1BS2A 2X8BA 3G2JA 3T3NA 1AKEA 1WZCA 3ZY5A 1MPTA 4LRTB 3FZNA 1PEDA 3PEEA 3UAYA 2ENWA 1AKWA 3I1JA 3CUTA 1RLOA 4Z6KA 2OO3A 2VBGA 1A8IA 3KWLA 5BSGA 5KWVA 2W4IA 1TAHA 4P53A 4UBOA 1GZVA 1UPUA 4EPXA 3KQNA 1H2XA 1QYVA 1WLYA 1XHEA 3JPWA 5AI5A 2ZUVA 1MQ9A 2XUPA 4IXTA 2FSVA 4GX5A 3Q6NA 3IELA 1KBZA 3DLAA 4AJ1A 5FPPA 4QOGA 4RY2A 2O05A 5KYWB 1U0LA 4BNYA 2GEUA 1FUEA 1GSOA 2QLBA 3A2NA 1Z5VA 3QHQA 1UAYA 2WE8A 1Y7PA 5CVCA 1SCAA 4AL4A 3TQTA 4H7EA 4PGAA 1QB7A 1DO0A 2Y99A 3TJMA 2QX8A 3L0OA 3PR3A 7REQA 2OMEA 1PV2A 2ADFA 3OOEA 1K6JA 4BFLA 4QUBA 1YOBA 1QDUA 4LXXA 1DRUA 4PZPA 5HA5A 2GDJA 2OL4A 1I30A 5T64A 3CVOA 3LLSA 5EHNA 2PGDA 4UJ5A 5AO9A 1KEUA 2HU8A 3AETA 3CPSA 5JSKA 1MT0A 2C94A 3DOEA 1NRXA 2I54A 2PS0A 2DFTA 4GKVA 2P9CA 5HIJA 3VYUB 4INPA 2EJVA 4QFMA 3FTFA 3EIFA 5LUAA 4G23A 5J47A 1VMAA 1XU4A 2ANBA 2FXVA 2V6JA 2FTKE 2VTBA 3MWYW 2B34A 4I1OA 2XXJA 3HCCA 1HZJA 2C0QA 2G67A 1XALA 4EFMA 2Q2OA 4RUKA 2HIHA 2PWPA 4RD3A 5EUQB 1ZD3A 3FWNA 4CEIB 1Z36A 1Z0AA 3IEIA 4YRQA 4A8JC 5E7QA 1OFHA 3FMVA 3V42A 1J22A 4TM7A 2WAMA 1TCVA 5BOSB 4DKXA 3RK0A 4EQ6B 2REQB 5JT1A 2YWRA 1R64A 2Z2ZA 1T4MA 3E9CA 1ZOLA 2XDQA 5KQRA 1QZZA 1O6FA 3MUOA 4YWHA 3HCBA 1WZ2A 2A33A 5E6SA 1P0IA 3I1IA 1EP9A 2H5JA 4IVNA 2KM1A 3EQ7A 4AJOA 4H0NA 2GEJA 5C35A 3UB4A 1R4ZA 2GA8A 5B3JC 1FVOA 2EF0A 4OQYA 3CEAA 4N9QA 3TAUA 1EA5A 1CQJA 1ONSA 5JO9A 2PX8A 1E3WA 2QZZA 1X7ZA 3FM9A 3NUZA 4NZYA 1HORA 5KWIA 3N8IA 3SSAA 2C4KA 3RJMA 2J1LA 2A14A 4QLOA 3ROZA 3COYA 1VHJA 3U80A 1P4HA 1LDYA 2C9MA 2H1CA 3EOBI 1ZL0A 4J0GA 5A0FA 1XZQA 3SZGA 1A2OA 4CNBA 4F9TA 5IU6A 5BR7A 3FGZA 5DMHA 2B8JA 5NLLA 4ITUA 4O2BB 3VVMA 5K8JB 4Y9DA 1XG5A 2V65A 3IVMA 2Y05A 2PH7A 1H65A 2W5UA 4KP7A 4BV3A 4C3VA 3G2MA 3NOVA 5K6RA 1LU9A 2VQDA 3OD1A 4URWR 1CE8B 2C5LA 1L1EA 3FGOA 2X0RA 5D2CA 1TGVA 4BNDB 3CC8A 2V7QD 2GDZA 4QPPA 3A9CA 4P80A 1O57A 1P8JA 1VHWA 4MRSA 2QU8A 3I83A 1E8MA 3N74A 1EWRA 1QTIA 1ZXBA 2FQQA 4M1ZA 5DTMA 2YFHA 1L7OA 1ZLYA 3R9KA 2PZLA 1I5RA 2WMOB 3IP3A 2HA3A 4JYPA 3SLRA 3X2EA 4KCGA 3S27A 1OGIA 1OFUX 3L0BA 3W5SA 3MTBA 1MAWA 5JHGB 1CKEA 1G1AA 2ZKIA 1YSCA 2L2QA 1B3BA 4QYXA 3EXG1 4RZXA 3UO8B 2CCKA 3U7QA 2ZSKA 3AWDA 4C89A 4XGNA 3AY7A 3AHHA 4P22A 1R3UA 4WJLA 1Y0BA 4OREX 5CGZA 1VHQA 3WGVA 4HBGA 4AY4A 2Q45A 1H93A 4QUDA 3ISVA 3RT1A 1FSGA 1L8LA 5FQOA 1M7BA 1Y6QA 4R81A 4EYGA 2PKYX 3L0CA 1SEVA 1JNYA 1VJ5A 1X80B 1Z17A 4JBIA 4M1YA 5JVDB 2OCYC 3IIJA 4CT0A 1ND5A 3EFBA 3BWMA 4GYYA 4Y2SA 3TJZA 2O8CA 4DWOA 1APBA 4IQ0A 1DQRA 4AY5A 4UUQA 1RWMA 1FJXA 2QW0X 4ZOBA 2QT0A 5M5BA 2ZIXA 1XN1A 1GCUA 4QRDA 5H70A 4LYJA 2EKQA 3I9V1 4OFZA 4KIWA 2OBFA 2ESRA 4FFNA 1DWPA 3QBTA 1CC1S 1I7NA 4IWXA 4UTZA 3RANA 1L4EA 1RXWA 2WVHA 4Z4FA 1RPAA 1JRLA 3LYUA 5D3MA 3C1TA 2YUTA 3AEQB 4RNDB 3WSTA 1XQ1A 3ZWYA 1JWLA 4IYJA 4JJFA 4K26A 3TNFA 3OPVA 2P0YA 2G9UA 5HTOA 1N5MA 4O8CA 4NE9A 4EAQA 1D03A 2NAFA 1RS0A 4LNAA 1TVCA 3OOYA 1ODSA 4ZEWA 3RYCB 5EFOA 3ZWBA 4JC8A 5J9FA 3VPDA 4TKMA 3CR8A 1G5FA 3HSSA 4A15A 2C99A 2XOKD 4ZCLA 4TXNA 1P18A 4YCMA 1Y6GA 1DXYA 4HTFB 3M5PA 2JAXA 1U3CA 4J0IA 4P4UA 2EEPA 3P9SA 5G3YA 3RIEA 4J3NA 3RROA 3P97A 4KFCA 2C92A 3ZUPA 1D1PA 2HWWA 2AMJA 1D0VA 2CBZA 4AMZA 1OX5A 2VUIB 4CU2A 2J08A 2VTBB 1XZBA 2X4DA 3OEEA 4HDKA 2NXJA 1ZUNA 1JJAA 3NHMA 2J3MA 4MV6A 3CR3C 1GKKA 5JZMA 3EXHC 2HJVA 4OA8A 3EXHB 3RKSA 2RB5A 3N28A 1JVSA 2HSZA 2KYRA 3GVCA 4C7BA 3NHBA 2FR0A 1U5BA 4WWHA 3MF4A 2BEUB 2PUWA 5PNTA 3THXB 5I7WA 4MDHA 4UTVA 4RJIA 1LH0A 3TPCA 1OLUA 4FONA 1KQ3A 4MKXA 4P7GA 3QQ5A 4C3UA 1LKZA 4XFKA 2W98A 3F3SA 5J4HA 3E9ZA 4QAJA 1KKMA 1PD1A 3PIDA 1E0AA 4J7AA 1I9GA 3P19A 3E48A 1PSDA 4H3SA 2FR8A 1S2DA 3COWA 4WY2A 1S2OA 4C2AA 4GMXA 4N01A 5DW3A 5FKJA 3AUKA 1A2QA 3B5EA 3CEMA 3IXMA 5FOVA 5UKDA 4MUHA 4I4TA 4XSHA 1E3DA 2WWRA 2AJDA 3IOMA 5EESA 5IVIA 2YW2A 2H0RA 3ZU6A 1WCWA 4MYTA 3SVZA 3ANYB 3OJWA 5LQUA 3DCIA 1I2AA 5JISA 1XMPA 4HZGA 1N5LA 3ZNNA 1RRCA 4N6GA 1U7DA 3Q8MA 3QEKA 3T5CA 4F4FA 4D74A 4P9NA 1ZOSA 1YH3A 4GBMA 1RJFA 1OH7A 1XR3A 4CDRA 5DYYA 2PWBA 3PX7A 3CW2A 1E32A 1G4HA 2O8FB 4LSWA 4Y0VA 2Z1DA 3PNQA 3V55A 4WBSA 1U31A 4AN4A 5YASA 1WM1A 2LR0A 4BVJA 3GJ5A 2AH5A 1W44A 4UNSA 5BVHA 3HWX1 4QVKA 4OHOA 2J0VA 4N40A 3UWKA 5CB8A 1Y63A 3DSRA 3ICOA 1OTYA 1N7JA 1M8FA 3KQQA 1LK0A 4GDFA 2BEUA 1E5VA 3BCHA 5FWAA 3C4QA 5FFFA 4ENUA 1GVHA 1HDGO 3SYLA 2R8ZA 2AK2A 3EIOA 4Y6PA 1XUOA 4KPGA 1V35A 1Z2OX 1UADA 3NAGA 3W2GA 2NT3A 4MKFA 2E4WA 5K3BA 2UVDA 4RF4A 2DWCA 2HNBA 4HLUA 5KQSA 4MRMA 1UJ6A 3RJ9A 5IT0A 4N76A 4ARBA 3JQRA 4OQFA 2H9AA 3IHWA 3R0ZA 2XCSB 5F52A 2I2FA 3BS4A 2G1UA 2AMVA 4NBRA 3KQOA 4NEGA 3UN1A 3WGKA 3N05A 4JU8A 1S9HA 4C0AC 1RRMA 4KI7A 4X5OA 3W78A 5IVHA 5AVKA 1AN0A 1L4KA 1N5KA 1R6DA 2XQFA 4MS4A 3KLOA 2YV1A 3L3BA 4QFBA 5ELXA 1YMQA 3NHPA 4S2UA 3FZEA 4LVNA 3INTA 3R9IA 1VRVA 1WD5A 2EARA 2X2OA 4RZIA 3DDZX 3DEIA 3K3PA 2XYGA 4FHDA 3ACCA 4XB1A 2PUDA 3G0CA 1EKXA 3QPAA 1N3YA 2W22A 4IGKA 4KUHA 3PWKA 4OBBA 2NW6A 2WV7A 4XIGS 3TKAA 5JWHA 3UGQA 3PDIA 4KQ6A 2ZRAA 3MIZA 3ZEIA 3ZDAA 2BN4A 5CVJA 1L5OA 1NQAO 1J23A 1D4AA 1Q57A 1G20A 3LQ4A 4OXKA 2V6BA 2Q6OA 3DF7A 5K3FA 4EG1A 1QOPB 1IEQA 5KC9A 5EP1A 2P35A 4HSEA 1F38A 1ODKA 2IPXA 3N0WA 3CH4B 1UZUA 2PBLA 4ND4A 4J2OA 4AVYA 2XUKA 3DKIA 2GPTA 2DR0A 2I7XA 4M1MA 5JRZA 1E2NA 1KH2A 1E69A 4TTRA 3H1FA 5B3KA 5E9AA 1AJEA 2DQYA 4JLUA 1BW9B 2GZRA 2OCXA 1Y1SA 3IT1A 9LDBA 4B3FX 5E4YA 2XKKA 2CKMA 4MVWA 1E1RA 3T06B 3ENKA 4BTEA 2XUAA 2JIMA 2EP7A 2NO9A 1GILA 1O5OA 1YV9A 2FFHA 2Z2YA 2GBPA 1UMBA 3AR5A 3VC2A 4E6EA 5C4IA 3QKSA 5T41A 3CSSA 2V6MA 3AERB 4Q3NA 5T6MA 4RCZA 4NCXA 3VX4A 1T1GA 2Q0SA 3L01A 3PRJA 4A8JB 1K8YB 2X0FA 3LFTA 5HRUA 3SYMA 4M7RA 4DADA 5I48A 2D06A 4NCKA 3RIHA 4BX0A 1PNQA 5F64A 3LECA 2JJ1A 4B6FA 3CKYA 2ZYAA 2XTMA 1UK8A 5JPCA 5AJXA 1T0IA 1GA6A 2OHOA 4TSFD 4D9MA 5CR9A 3PDUA 1BFUA 1JKMA 3NONA 1EAYA 2CVOA 2EP8A 3OE5A 1E64A 3O3MB 1E79A 4RELA 3ANXA 2IUUA 1CHNA 2DM6A 1PQWA 1Y4UA 3RLIA 3KQHA 2A1UB 2NZYA 1DXHA 3D64A 3IPAA 4GWGA 3A1TA 2O1WA 3I2JA 2HNKA 1BQEA 4P98A 3D5EA 1T6ZA 4M1WA 3GT0A 3PJDA 1D5WA 1T9AA 1RZ3A 3VR4H 2IX9A 3BTVA 1N0IA 2AG5A 4PRYA 2FCRA 1N3IA 3C8MA 3JQ9C 4HNTA 4TKVB 3CRZA 4P84A 2GXSA 3BWVA 4BUJA 2HCRA 1J2UA 4YFVA 3RUIA 3NBAA 4PR3A 1T9DA 2HAEA 4KE7A 1CUZA 1GU1A 2R4QA 4C29A 1H5QA 1YDFA 1WZIA 2CYBA 3A6DA 4LF8B 4YT2A 4AS2A 2CXQA 1AUVA 1FBNA 2B9VA 3M6UA 4IRMA 1NW5A 4MVJI 2G8LA 4X61A 2UYGA 4DQKA 2DFDA 2ZUUA 2RC6A 3Q1KA 4GC5A 4Y2VA 4AZTA 5C4MA 3U9LA 2PT6A 4YRNA 4A36A 4CIDA 4R0VA 4YAUA 4Y2UA 4YR7A 2IZZA 5KAMA 2AR9A 3H1PA 3NS7A 4U2KA 2GR9A 2XLCA 1NX9A 2Q3JA 5BYAA 1XQWA 2G06A 4QGSA 2A92A 2YDYA 4MK4A 4ZI3A 1KDTA 4C21A 2RGNA 4F71A 4EX6A 5EIBD 3BK1A 3L0ZA 2XZOA 4NK4A 3TIIA 1ENYA 4ARIA 1I7QB 4AY2A 2DZDA 1N92A 3BMNA 5CFOA 2XGMA 2VLBA 4N54A 3O8LA 2RE8A 3T8YA 2VT6A 5F5LA 4DSTA 3LRXA 4RIEA 4H9GA 3MGKA 3UG6A 3SC2A 1V71A 1UJ5A 2WABA 3UJDA 4QOJA 3B6IA 1I6WA 2JL1A 3TEMA 2Y92A 2PAAA 5BSFA 1UMCB 4O4LB 5BN5A 4PQEA 1AU9A 1J07A 1VZ3A 3Q3VA 4M1OA 1DL5A 4OAOA 4PBTA 5DNUA 1THMA 3WL6A 1LDGA 3TFOA 4LWPA 4W7SA 1V6SA 2AZDA 3GLFB 4Q4DA 2FA9A 1NSTA 1YQ9A 2P6NA 3L4EA 1J1ZA 3ZJTA 3TRJA 1ZJ4A 4DLVA 3A6LA 1DX4A 1VGRA 4RM2A 5ALNA 1C14A 4B3DA 3WTBA 4FYMA 1VLVA 2PYZA 1KJ8A 5AJZA 1G2PA 1R4MB 4E5SA 4KBYA 1FSPA 2JH3A 4EG4A 3N2KA 7GPBA 2RK3A 3TD2A 3LCJA 2VP0A 3NEYA 4RD4A 1JDJA 3C5EA 2MINA 3RHZA 4M0KA 5C5DA 4J3FA 2V96A 5LOVF 5FUWA 1EFPB 5I9MA 4K9PA 3K09C 3MMXA 4O5OA 3GWGA 3GRFA 5JLAA 2BKVA 1TJNA 2E4VA 2GARA 3EQ9A 1MP0A 3H8SA 1X42A 4L3WA 4CLRA 3NEAA 2WU8A 2ZCVA 3SI7A 1L1RA 4OCZA 5CFNA 2XWQA 3PT9A 3RS8A 1TKAA 1XQVA 1T2DA 5ARBA 2A4KA 2WOJA 2YV3A 4HUTA 2YFQA 3D0QA 4F06A 3H7AA 1ZUNB 5A7GA 3SC4A 3N39C 4FFOA 5E7JA 3C3MA 1GG8A 2EBHX 1B74A 4GR9A 3VSEA 1XA4A 4NBTA 3DXFA 4DLTA 5BW5A 5KKCA 4TV8A 2PZBA 3T3PB 5A4IS 2Z5GA 3JASA 1EFLA 4MKRA 4F4JA 1E5QA 3SAJA 1X2BA 5H9VA 1SZDA 1J39A 3TEFA 2C4TA 1E2PA 5K8CA 3WIBA 1E1DA 4MCJA 4TRJA 4WLVA 4GXNA 4BX9A 4CMJA 3BXFA 3ENZA 4UU1A 5EJEA 1ZISA 2PVSA 1ESDA 4ZYUA 5TS3A 2QRJA 1QGUA 1MGPA 3OPQA 3QLVA 3RG8A 4AX4A 4E2XA 1PFQA 4NC9A 1L7MA 3WKDA 2I3GA 1TX4B 1X7DA 5IH7A 5C7IO 4RQUA 4CLOB 4Z7JA 4N0PA 4F91B 3F6YA 2YZKA 1YS7A 4X63A 4UBNA 2I66A 4DYHA 4ND8A 1BHO1 3A04A 3LP8A 2X9QA 3JQAD 2YJ5A 3N86A 4HNQA 4XVRA 3WGZA 3KQUA 3ZDDA 2OCPA 5IMSA 5FT9A 4CMEC 3SYTA 4JBLA 3T0IA 4BNFA 3I09A 2DBQA 4BJ3A 3L7DA 2VEOA 5F1YA 4B71A 1JJ7A 2VRCA 5EKSA 2R5NA 1TTPB 3FMIA 1KU0A 3D4OA 3VBCA 4YRAA 5AM4A 3RC2A 2NO4A 1VMEA 1GZDA 1I1NA 4G5QA 4F3TA 10MHA 2QM0A 5TGZA 1D1QA 3HK2A 4JCCA 5CA0F 1JR3E 2FPPA 1GSHA 2WU0A 3GK3A 3QUAA 3N6VA 1FP4A 4KKXB 2O2GA 3W6NA 1NVVQ 1XYYA 1R5BA 3RIYA 3MINB 3QUBA 3UB3A 3SK0A 4ZKDA 3OX2A 3OY7A 1XTIA 1R3DA 3K15A 4RBNA 1NFQA 3WK4A 1IBKB 4D2IA 3CGWA 2BCGY 5DLYA 5F77A 2RKBA 2V7TA 121PA 4MKIA 4KBFA 5L3VA 1E4OA 4MZDA 2G5TA 3QRWA 4H60A 4J7CA 4N03A 4JQSA 3IMEA 1ZNZA 3QY0A 4U7FA 3THYA 3AX6A 1TT5A 4DAOA 3AHGA 1XZGA 4NBKA 1SFRA 2NO0A 4WESB 5KNBD 4B3HA 1LPNA 1TK3A 4HP8A 5IC6A 3H83A 4HLNA 2NG1A 4Z49A 5BOSA 4V0KA 3R75A 2IS1A 5CPFA 1SCUA 3VPXA 3FNFA 3LX8A 1L5LA 3RLFA 3IP8A 3HVUA 2JVJA 1XNHA 3TIVA 3E1KA 4QHSA 1ISSA 1XK7A 2I80A 1ACJA 5ED0A 4JOCA 4G84A 2EW2A 1OSNA 4GP9A 5A3RA 2A1IA 4H6PA 1JB9A 1LBHA 3H5RA 1PR0A 3MD9A 4ZZ0A 1NFFA 3WKCA 4MR8B 4IYRA 2QAIA 3DE4X 4LJ6A 3I4FA 3FAKA 5CNMA 3A9SA 4MHTA 1M76A 1FK8A 4IL5A 1PJSA 1HSZA 1W0KD 3AR9A 3ELWA 3DUWA 1IBCA 1SCJA 3KVVA 4RGVA 4JJGA 1MFPA 3QUTA 9MHTA 1TVEA 5I51A 4LISA 3GLSA 3B3FA 3L93A 3K05A 4MV9A 3BGVA 3GP8A 3LPMA 3DZ8A 3VPFA 2CT8A 3LWZA 4L5JA 4XJXA 5BSHA 2J3JA 3KFXA 3B9QA 3JVIA 4OQMA 4PLWA 1QCYA 5BN4A 4ARVA 3OICA 5EP2A 2FPKA 2NXWA 1JI0A 1II9A 1WTAA 1N1DA 1X15A 2XDQB 2LDXA 4N0MA 3VKFA 4Q9NA 2PWAA 1YQDA 1IUOA 3KDAA 3OJCA 4OMUA 1JVBA 5DGXA 2O2HA 3H42B 2G63A 1CUDA 5CGQB 2AJ8A 3A4VA 5AHKA 3SD7A 4XOIA 3U1TA 4G1CA 4MVJG 2Z8YM 4TX1A 3L1IA 3MAGA 3NIGB 1FQJA 5FULA 5FI0B 1JJVA 1JG3A 3ZCRA 3EZXA 4QYIA 2BTQA 2LZ0A 1XP8A 3F2VA 1SBQA 1MC4A 2WFZA 4BQEA 1ZMXA 3GYBA 1W88A 1TMOA 4JLDA 2G09A 4U2CA 1CP3A 3LRTA 3CLVA 2BHLA 2HLHA 4G5RA 4MAFA 5JJ5A 1FMFA 4ND7A 2YNMD 2IODA 3KQKA 2NGRA 2Y1CA 1DUIA 2R7AA 3V7YA 2PXCA 2OZEA 2ZIWB 3ELYA 1T2EA 5CXSA 4AIIA 1X6VA 3E2IA 1E6KA 1IM2A 2HJ9A 2XYRA 4N12A 2OV8A 2R65A 1E3LA 2CHFA 4Q7JB 1EUQA 3K9FC 1BMFD 1NVTA 3WJ2A 1V8PA 4JH0A 4K8OA 5EP3A 1NQVA 3ZNQA 2HHJA 3VA7A 3UK6A 1Q1QA 3QWFA 2VQEB 2QGZA 1VE1A 3DPIA 5KS2A 2GXQA 2G1PA 3K70D 2CUKA 5EE9A 1EYZA 5HBRA 1AKUA 1QAMA 1RAFA 5EPOA 5TDHA 1ZVQA 1F06A 1WX1A 2H1IA 2B5OA 2O0LA 4TL7A 5HPYB 1ZC4A 2IP2A 3W3ZB 4TVOA 4EHBA 1YAHA 4CDNA 3T54A 4RXMA 2BEVA 4B6GA 4RVSA 4OH1A 4Q9JA 1JDUA 1X9IA 2PNFA 1TM7E 4YRZA 1XF9A 2BGLA 1KRHA 4AXBA 3FF1A 3I28A 3OZEA 2J7PD 1FOEB 4X7MA 4OSEA 1J21A 3OTWA 4FJ0A 2D8MA 5AUOB 3R6LA 5BSEA 5JNVA 1E6WA 2OZPA 2GVDC 3KLNA 2J5KA 3K0AB 1GL7A 3IP7A 5AK3A 2JK1A 4JBNA 5E0OA 1NQUA 1OU0A 3WY9A 3QWHA 3R23A 4INOA 5SYNA 2E82A 5JDIC 4B44A 1IULA 1XQ9A 2ATCA 2VF8A 4QJ5A 4C87A 5AW7A 4GYJA 4DR4B 1X13A 2GUGA 3G82C 3AHFA 4IRUB 3V34A 1YT5A 2KI5A 2IIBA 1CNMA 3EK2A 1Y4AE 1DZ3A 4K6HA 4PC7A 4B3GA 4Y1GA 4KIUA 1WY7A 2BEJA 3D8BA 4WJZA 2O19A 2H7VA 3NBFA 4LF9B 1WP9A 2YYAA 4J0KA 4TV8B 5FPYA 1VL1A 3RARA 2P5YA 3PNSA 3ZY4A 3ZJ5A 1R5NA 1QV6A 4G0PA 4MWBA 4EHHA 1X9GA 1F8FA 3HE3A 3ZHOA 2WMDA 4YRSA 3J80A 4FJ1A 1W4BA 2V0CA 3W9BA 5ALWA 1THGA 1E9VA 4HDNB 5KOJA 3D8HA 1L4UA 3TSOA 4M1SA 5JQGF 3AO0B 1GN9A 3DLBA 4NZPA 2Q21A 2GXUA 3BE8A 3RADC 4PZEA 4YTEA 4NBSA 3HVJA 3GVXA 2WJPA 3X1MA 1D2CA 3V8MA 3GJSA 3HO1A 3K9BA 4NONA 2DCMA 3THWA 3OFKA 4LJ4A 2KLBA 1YVUA 2VH2A 2XYPA 3HWSA 2DFNA 3FFAA 3KSDO 3REFA 1JHMA 5B2EA 1TC2A 2JLQA 3DR3A 1ZAKA 1QGOA 4CMGA 4D9KA 2HLDA 4IUDS 1XCMA 1K97A 1XLWA 4RXTA 5I7AA 1VMIA 3M1IA 4FDAA 4B4VA 1X9HA 4KJZA 5AOBA 1PJQA 3CNNA 1AO3A 1UPXA 1WNTA 4NE2A 4BTLA 1Q1GA 4ILEA 1ANKA 3NETA 3KKQA 4RVCA 1NDQA 3D4LA 3WGUA 3LXUX 1OXXK 2RGEA 3K6SA 4KNVA 5JSYA 3HUTA 3Q2KA 4MR8A 3JQDA 1DTWA 2B82A 4OG2A 1JH9A 1MVOA 1XOIA 4R7ZA 4C0JA 4QNNA 1IM8A 1V45E 5B2ZA 4UQPA 2EWVA 5KTKA 1B0PA 3BEDA 1RNLA 5B4TA 2EC5A 3SEQA 1ZDMA 3PQ5A 5GY7A 1B3RA 2TMKA 1MO3A 2L69A 3DVQX 5BVGA 1U11A 2X19A 3DZJA 3OFVA 4NEQA 1R12A 2VCEA 3D31A 2VWHA 3NHUA 4R68A 4WLNA 4B1FA 4ZCRA 4L3VA 4MUXA 5B64A 1OKKA 4NJEA 5GIOE 2D1RA 2SHKA 3Q11A 3OAAD 4MMYB 5EG5A 1L4NA 3DJFA 3D3WA 5FBQB 3FJOA 1DJMA 1UZLA 1E0DA 2ZR8A 5FYDA 5DOZA 2QB5A 3KSAC 2NAPA 1XAHA 5CVTA 2AMYA 2XSZD 4PLFA 1EZZA 1ULBA 2IYXA 1NI5A 2DMRA 5TIIA 3GRVA 1OPRA 5EJFA 4AI6A 2O2CA 4PQRA 4ZXPA 2A0FA 2AQHA 4Y30A 1HEIA 1FU7A 3NNNA 4TT8A 3RKUA 2OT3B 1H4QA 1II8A 3A6JA 3DMPA 1YI0A 3DD1A 4ZQIA 2G83A 5C8ZA 5LDDC 4FBLA 2QN3A 5SV2A 1DC7A 4LSGA 4DTIA 4MVJP 1XPUA 2NVUB 4FOLA 4F4CA 3DHYA 4JC5A 4JJAA 2HSWA 2YV2A 2DPMA 5G4KB 1NURA 3ZHVA 4H0FA 5LQDA 1UJNA 2GM3A 2QXTA 3GHHA 1VOTA 4Y2RA 1ZR2A 2RG1A 3KBOA 2P5UA 4FDVA 4JUAA 1YJBA 4O3MA 2HF7A 2IU6A 5EZYB 2JLUA 2QPLA 1N7IA 1R5OA 1WUJS 3C6XA 3HYLA 5EJ2A 5CYGA 2WM3A 5ESDA 3S5UA 2QVYX 1U98A 3GZJA 4HSGA 3DL4A 2DLDA 3PQ2A 1X1AA 4MJXA 3AK4A 5I45A 4L95C 2YJ4A 3SZ3A 4RULA 4PQFA 1X70A 2GX6A 3HJFA 3GQBB 1ZD4A 5HQ3A 1SOMA 2AN4A 3TMAA 1P1HA 1OJ7A 1FFXA 1G2QA 2OB1A 4CCWA 4ENPA 2RONA 2P0EA 1OIVA 3JU3A 4CRWB 3DE7X 1P7PA 1TM2A 3GNTA 2J30A 4IBOA 5ALMA 3HYCA 3QQPA 3ABZA 1KSJA 1A0OA 1GP2A 3GFRA 3EMKA 4OO3A 2F67A 4WFQA 3V80A 2VHEA 3K9GA 3TQOA 3G2OA 2R7KA 4R84A 5FA8A 1BFKA 9ATCA 4KLAA 2IHNA 2ZQZA 3G9XA 2Q1WA 2Y9PB 3LY5A 5KQGA 2NIPA 1WNFA 4K40A 2PRSA 2NXNA 3P5BA 3NV7A 2IYSA 3PIRA 3Q3EA 2RAUA 5CT6A 1CEXA 2ZE7A 3IUQA 4PTZA 3V2HA 2AVDA 2G1AA 1QYWA 5C8YF 3OCXA 4TZ6A 3BIWA 3U4AA 1AGRA 5J4VA 4WN9A 3NP7A 2Q99A 1EK2A 1ISRA 3JQBA 4Z51A 4HOYA 4B46A 3EH1A 4PXSA 3HZHA 4CLRB 4JQZA 5B58T 3QVMA 4KTTE 1Z2NX 4L8GA 2CL0X 2QJRA 2OO5A 4NCHA 4IJMA 1XKQA 4US0R 3WLKX 3NOXA 5BNTA 1SA0A 2BEWB 3QUQA 4M9XA 1NSYA 2ZYIA 4EO7A 2PH1A 2DC1A 3VC7A 5CDYA 2Y1LA 3K9QO 5I9BA 4AWXA 2XVXA 1RLUA 1SOVA 2R60A 1RQ7A 4UVEA 4X41A 5AJHA 3EGDB 2AQKA 2XTAA 2ZBUA 4GI2A 3GFBA 4TOIA 5HS4A 2EFDB 4JN6B 3CKLA 4LYYA 4GI3A 4WPGA 4GOOD 5HKKD 1CLUA 4MINA 1ACLA 2NQ8A 2Z95A 1A50B 5JAQA 2B3TA 3H3JA 5HIKA 4DY4A 4MITA 1Y1RA 5LQAA 1XQ6A 1SUFA 4NFHA 4TYMA 2H31A 1PNTA 2VTKA 3W8DA 4LN1A 5AHWA 4EA8A 1CUCA 1SG0A 4KXQA 1JV2B 1AIPA 3GJ7A 4NV1A 1BCSB 3IPYA 5ELLA 5HZGA 3K70C 3VNUA 4PHCA 4IIGA 1PBNA 2IGTA 4OIFA 4LY3A 1GPMA 1KZYC 1N6LA 5L6MB 1UKAA 3WWYA 2ENUA 4O0LA 1N9GA 2E6UX 4O4LF 1ISFA 2HPZA 3HDTA 4IQ8A 1L5QA 4ATNA 4AURA 5G41A 5KHLB 5K20A 5JADA 2V0NA 3QXJA 2BBTA 3I23A 2AXEA 5ALZA 4BFSA 4ETIA 1ILWA 1JKJA 1NUSA 4IIDA 4BVFA 3FZQA 2YYZA 1UBJS 2UUBB 3LI2A 3B6JA 4MGYR 2A30A 2SBTA 3PPWA 3QLTA 5EE0A 3V4FA 4JUDX 1II8B 1AUXA 1ZGBA 4B3CA 4K9KA 4PHGA 1XSEA 2HDWA 1KO5A 4BFWA 4BVEA 1K08A 4DXDA 1DADA 5AI8A 2DGDA 4M0LA 3M5WA 5EQFA 4QJ4A 2VQFB 1KQPA 5CU7A 4NHOA 2YRXA 3C3XA 2ZBPA 3I32A 3IR5A 3VO2A 1DP4A 5P8WA 3RRNA 3JAWA 4G8BA 1LSOA 1NT2A 2HLPA 1GA1A 1VIVA 3EGXB 3Q5EA 5IDVA 3MHPA 5AQ1A 4C7OA 2HPVA 2WYVA 2Z98A 4JYBA 5I4CA 2BISA 5LC1A 5IKEA 1C41A 3C6ZA 4J4BA 3I64A 1X94A 2ZAYA 4WGFA 4QBGB 3UJ9A 5J2UB 3PQFA 3NTUA 1J6UA 4M21A 1E1RD 2DYKA 3T34A 3F7TA 1AM4D 5DXFA 5HGJA 1PUIA 3SIWA 2WWFA 3KOMA 3JR3A 1KEPA 1M1XB 1ODFA 1WUTA 2I6QA 3L7CA 3O94A 4RKRA 5FNVA 4AXXA 2ZWOA 1NN1A 3PGMA 4G97A 1DOHA 3CJQA 5EHQA 4X91A 2CNWD 2P2DA 3UAGA 1WOMA 5TQ2B 5H9WA 4B4DA 3LSYA 2ACWA 2C7QA 1QRAA 2M2IA 1O8CA 5E6UB 1JFTA 4Z4HA 1B14A 2BLLA 2EFCB 2EXXA 2I76A 4EI2A 2N0SA 4V1CB 2PCJA 3VTKA 4NZOA 1XXHA 1GQ2A 4H2DA 1OLUB 1DAHA 4D9FA 1AQJA 4P4GA 4UPDA 4LZNA 5DM0A 4ZVVA 4HT3B 4DCTA 5I7HA 4G24A 3EPHA 1K8XB 3WQHA 1J8YF 3ZXIA 4A8JA 1NW3A 5E8JA 1W36C 3OPXA 4HUQB 1W47A 2GFHA 1P9OA 1XRMA 1MORA 4ECEA 2D5AA 4EGQA 2YZ7A 4BFUA 1PG2A 1NW4A 2XKAA 2UKDA 1EB9A 2VOJA 3DO5A 1GAWA 3EGEA 4BKOA 5AVTA 3VVBA 2XUQA 3FKQA 1HE2A 3LIIA 5DBEX 5K8IA 4KKVA 2HWXA 2O7QA 3L6EA 4DHWA 2D2FA 1WPQA 1GV0A 2WIDA 4EPRA 4D5EA 3QI2A 1F8UA 1L7NA 2IZ5A 1Y8QA 3H1EA 4PV7A 4YQZA 4BO6A 1KI9A 3M4NA 4JOBA 4PYIA 1MDBA 3OY2A 1KBQA 4RABA 4TLAA 1Z4OA 1ZUD1 4MMZB 2ODWA 4WZAA 5HRAA 1PJRA 2NWQA 3BZBA 1JR3A 4BAZA 2P79A 5BWOA 1WKVA 2G76A 2RCYA 2B3DA 2NYRA 4UBIA 5EPEA 5K0ZA 3VPHA 2CSXA 4YROA 3T5BA 2PS3A 3S5JA 1YZGA 4TGLA 4C4TA 1MO5A 3KXLA 4H7HA 3ORSA 4CKBA 5BMOA 2RI0A 2FGKA 4GWLA 5AXDA 5G1OA 4YV7A 3AI3A 4JFRA 3VO9A 4JJZA 3LU1A 4BLRA 2IYTA 2XEXA 3ER9A 4TRMA 1P7CA 1IEWA 1XWWA 2JBHA 4DWJA 4F9FA 4PM4A 3RAPR 4F2GA 1CUFA 3DFZA 2RH4A 4GOMD 3F71A 4HQ6A 4BLTA 2HJRA 1ZH2A 1MABB 2PTHA 5AJVB 1QGED 5TT0A 3Q2OA 4CTMA 1NBIA 4YRKA 4ZN6A 4ZO8A 2R6CA 3DOHA 2Y2UA 2FPPB 4OUDA 1J1IA 4RAOA 1OWNA 4HF7A 4ME6A 5CYOA 1PKXA 1YZTA 2X13A 4YJFA 3R9XB 5KHOC 1OI4A 2IDMA 3RTBA 4FUTA 4B5KA 3OTOB 1PFYA 1ZUHA 4EJSB 1GGMA 2C2OA 1WTCA 1KEWA 2IYOA 3LZCA 4FZJA 4Z9AA 3ROEA 3WMGA 5LMZA 3IO5A 1E99A 4C22A 2J3HA 2BFOA 4G81A 4V0QA 1A5TA 5I4BA 1ZW6A 2BGIA 3S2ZA 1XDZA 3I5UA 5EJGA 4FSDA 4Z4CA 2PRIA 2EGGA 3GY0A 1TKCA 3JQPA 1TK9A 2WILA 2FVXA 3B36A 1Z7GA 3FSRA 1YASA 1H6DA 2ZQ5A 4TV9B 5B12A 2OP1A 1L5HA 2IH4A 2P9HA 3IT3A 1I01A 4D41A 1HR0B 3B52X 3AM1A 3KEMA 4G8JA 1KI3A 3OLVA 2QV0A 1WKCA 2C95A 4LGCA 5E2BA 5FH9A 4DB2A 4DDHA 1G9XA 4ZI7A 3D1JA 3KAPA 2GN0A 5F9MA 1V5IA 1JQKA 5BSMA 5AICA 1RJ9A 3OIGA 4GMFA 1XNJA 4KN5A 3A3KA 4LE0A 1B15A 5EY5B 3SZUA 2WJJA 1R0KA 2W6NA 1WOYA 3ZVLA 5FAKA 2REOA 3LBAA 2H17A 1C4WA 1I3NA 2XW6A 3NDPA 1Z7YA 3OO1A 1QH8B 3MUEA 4RD2A 4RKQA 4DCMA 1Q17A 1RRFA 3DPSA 3K2QA 2IOYA 1KIMA 4LFBB 1NKVA 3CGGA 3BCSA 3RIGA 2ETVA 4FR2A 1RSZA 1YOVA 1QRDA 3S2UA 1QG2A 3RAFC 4B87A 1KR5A 1MC8A 2H52A 5LQMA 4JD5A 4DGQA 4W4TA 1FW6A 4YP0A 2R00A 1JF8A 1Z7BA 4R1OA 1PWEA 3EPLA 1SURA 2HTFA 4P3KA 4ZKEA 1XVLA 1LW7A 4IXNA 4GHWA 3UUEA 3VR3A 1SHKA 2V03A 2HMSA 5D87A 1XVAA 3TSZA 4B7ZA 1U0HC 3AP1A 3OQMA 2QTVB 4H6VA 1V43A 3D8UA 4MWCA 5CJPA 2B9EA 3QFRA 4KR7A 2WD7B 3C6YA 3PHGA 2B8TA 1AC5A 2IEBA 3OF5A 4EEKA 4AY3A 2XTZA 2I03A 3M33A 2XCUA 3DNMA 1FDVA 2RHTA 2PLWA 3T38A 3UENA 2ZGVA 3MOIA 3B2EA 2P5TB 1N5RA 4ZVRA 4QYMA 2PJZA 3WAJA 1WU7A 2VF7A 1ZEMA 3KQYA 4B8WA 2C5AA 3HB5X 5DB4A 3UT6A 3VXKA 3RFVA 3ZJUA 3H19A 3UPDA 2BWJA 2P9JA 2JVKA 4K9NA 3BJMA 1NMXA 2GD0A 1D1SA 4HJXA 5F35A 1PSWA 3KFVA 3ZV5A 2JJQA 4WI1A 4CM6A 4MB6A 5U4QA 5TE9A 1KWGA 4MS3A 2D2IA 1COZA 2EP5A 1DO2A 3F6SA 3PVZA 4PBSA 4GRAA 5IAAA 4TS4A 5GJBA 1RZVA 5C5CA 1GKIA 2VZ0A 1R74A 3H2GA 4YCCA 5JSUA 5K0FA 4PYLA 5E1OA 5EHXA 2VYCA 4QPJC 3UXYA 2XADA 2L19A 3O26A 2JFUA 3D6TB 4B6JA 4EELA 4WLOA 4JL6A 4YMLA 2VDNB 3ZKAA 1XTSA 5JNUA 3VR6H 4OBXA 2ZANA 1UQRA 1US8A 3IDSA 3NH9A 4NBLA 5SZJA 4DXHA 5DMXA 1C9YA 5FL7A 1EH5A 2Q0QA 3ES9A 3FOFC 1P7VA 3S68A 5LQKA 1N9ZA 2JI9A 1U9CA 3P9YA 3Q87B 4WA8A 4D0RA 3F8TA 3LUHA 5EWLB 3R5KA 1TL7C 4OGLA 2ZYSA 3IMGA 1RBYA 1H2EA 3MRXA 5CIQA 2W83A 5IDXA 1TM4E 4HNUA 1GTMA 3HKCA 2C1EA 1H3FA 4GUDA 4Q3CA 1Y6RA 5KMGB 3K1YA 3HY3A 1SOAA 4WFKA 1XZNA 1UBFA 4QLAA 5CEEA 2X7XA 3VJRA 5K0LA 5L40A 4TWAA 4M38A 4P36A 2ZBRA 2ZI3A 3M6FA 1P73A 3KUCA 1NVVR 1U1DA 4LECA 4DA0A 2J7KA 5C1OA 3BH6A 5JAOA 1TEVA 1W4AA 2Q07A 3B70A 2O59A 4ED9A 1YZHA 1NN0A 4IJVA 4FGUA 4R7TA 1Y8CA 5LCXA 3H13A 2QN7A 3RABA 3SM9A 3WG9A 5IJ9A 3B5IA 3VC3A 2DFPA 3I92A 4NMWA 3LVBA 3I39X 2H7CA 2J9YB 4DW8A 1NONA 2AFHE 3MWLA 2JI7A 3PYMA 5DM60 3I58A 3REQA 1M7HA 3ERCA 4KO4S 3BILA 4NYIQ 2A1UA 1Y82A 2ERYA 3R7DA 1XDGA 2I71A 2I87A 2I6UA 3HRHA 3U44A 1V16A 3M81A 4GOLD 4NH0A 2QENA 4JEHA 3UQYS 1K5HA 1ETHA 2HHCA 3IYLW 4BDSA 1VLJA 2AN3A 1S02A 4CFZA 1TT7A 4NU0A 4X6XA 4HV4A 1K06A 2A7XA 2EJUA 3FUXA 5AJTA 5ALYA 3VDNB 4CLOA 2DUUA 3WR5A 1EVYA 4Z3DA 5BW4A 5ADHA 1DIGA 1L5HB 1XZEA 4RTLA 1DBWA 2CDBA 2HL6A 3GEHA 1OA1A 2PUVA 3QI7A 4LY6A 5CHYA 3F9CA 4NKRA 4KR3A 4IZOA 2R5FA 4MTLA 5DK4A 2JATA 2E4AA 4MRRA 2D2VA 4YO7A 1V47A 2OUIA 2ZU0C 3DZCA 3E1GA 3NBUA 1OI7A 2IYQA 4LK2A 4RSRA 1L8QA 1XBTA 1QGYA 4MPPA 1BX3A 4XJVA 3DS8A 1SCNE 1YRYE 2CLCX 4M1QA 4MYHA 1LC0A 4K2HA 4MW0A 4REOA 3OX1A 5CMLA 1NHGA 3QPWA 2I1LA 4COOA 2WVAA 2R68A 1IIRA 4Q01A 3ZLTA 1T0BA 3D6JA 1JHOA 3R5FA 5AK0A 1J5XA 1SCBA 1UIMA 2C29D 1GZ4A 3ZXSA 3GFTA 3U7GA 2H3EA 3WL8A 5EJ6A 1G3RA 3EZGA 4YBZA 3NBMA 3ZJYA 1R4AA 2OHIA 4XQ0A 4F8YA 4UOEA 2Q0XA 5AHRA 4PZCA 1C2YA 2V7GA 5B1IA 3I5XA 2WTNA 2VHVA 4PHHA 5LB2A 4ON9A 2H4XA 4CT5A 3PPIA 4DCJA 5A4KA 3GAZA 5JMTA 2EAUA 4LC1A 3RRJA 3TXXA 2HQBA 4A7PA 3IJ5A 4MUIA 4WXYB 3NHWA 4QQFA 1DEAA 4DJDC 1TZCA 3PC7A 1BMFA 2VF2A 1WZEA 3OTIA 4GOKA 4MIEA 3T94A 3HMKA 3WK7A 5D00A 4X64B 4ZVOA 1P1BA 3WNVA 1G291 1PD0A 1ZD9A 1DKPA 2ZB4A 4Q34A 1KAQA 4FZRA 3UG7A 1ZFNA 2B4RO 3MB5A 4B6EA 4I19A 4CIAA 5DI9A 4RCVA 4DJEC 2XCIA 3AYZB 3I4LA 5IBCA 3BH7A 3AR3A 3OZVA 1XE3A 2BP7A 2CUNA 3GLFA 3BIXA 5HX7A 1ZOPA 1K7FB 4OGFA 3OX4A 2RHHA 1TUBA 3IJRA 4NAVA 2BV3A 3ECCA 3H8VA 1PYDA 1Y37A 4M0UA 3K8QA 4ZP1A 4C7MA 1I7DA 3LKBA 1Q12A 4LI0A 1CRZA 2OM6A 4K6MA 3E15A 3IPLA 2GO1A 3KTAA 3E9MA 2QTAA 3N6XA 4LCEA 3KKLA 4FGWA 1U9IC 3ANTA 2FR1A 3I12A 1WW2A 1CULC 2B20A 4GD3Q 3WDMA 4QOFA 2JDID 1GO2A 4HDRA