4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
b'LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
3I6YA 2GBGA 4DIUA 3IUNA 4QNNA 3C6BA 3R3WA 1CUGA 5CT5A 4ARAA 1LPOA 3IUJA 1H22A 3D5EA 5A7GA 4G4GA 5C7YA 5EIAA 5HKBA 3IUQA 2XI4A 1U4NA 4KAJA 4G1FA 1XLWA 5A2GA 5LKRA 1FFDA 5LZ5A 5HF5A 1EX9A 3E1GA 1VXRA 2B20A 1CUHA 4BB0A 1E8NA 1F0PA 1THGA 4X93A 3WYDA 3GUUA 2XUAA 5AM1A 1A8QA 2Y1KA 1Y37A 1DX4A 4W1SA 1XQYA 3W04A 1BU8A 3OG9A 2WQZA 2GZRA 2IITA 4H35A 5CT8A 4BE4A 2VTVA 3ESBA 1BS9A 4LIPD 3Q0TA 5H3HA 3HRHA 3BDVA 3EBLA 1TCAA 3F97A 2B9VA 3WWPA 1U2EA 5AK6A 1B6GA 1E3QA 1F0NA 1GZ7A 4FLFA 2GZSA 2WUEA 3WK6A 4FTWA 1Q0RA 1UK8A 5CXXA 1ZGBA 1YB6A 4KE8A 3W05A 4B82A 3QM1A 4EY4A 1XZBA 4FDMA 1XRRA 4Q3LA 3Q8WA 4AB1A 4DTCA 5AKJA 2WHPB 2RAUA 4G5XA 3F9CA 3FWHA 3WL7A 2WLSA 3KXPA 5LYYA 2QOEA 4DNQA 1SCQA 1VA4A 3I2IA 1KU6A 3WK7A 1J07A 3I2KA 3M81A 2WFMA 3HABA 2G5TA 2VF2A 3BF7A 1TK3A 1NU6A 5C8VA 1CLEA 1JMYA 3H0CA 1JFRA 1QO7A 2HU7A 2XMBA 4QEKA 1C7IA 2DHCA 5HFNA 4ZXFA 4UBKA 4GLBA 3C45A 2C0QA 1R50A 3AZPA 3VJLA 4QE3A 4FBMA 4UFPA 3CN7A 5AICA 2WTNA 1ZIXA 3ILSA 2PU7A 1HBJA 1ZI6A 3ESAA 1HL7A 4MQMA 3R3YA 5JAPA 5K3AA 1GPKA 3LCRA 5I7UA 2O2HA 3CN9A 2QUAA 2PX6A 3D2CA 2JF0A 2XMZA 5DNWA 4F5ZA 2WIKA 1VE7A 5CRIA 4EZIA 2VJAA 4Y2TA 3FLEA 3QYJA 1XZMA 4MWSA 4CCWA 3IA2A 4GW3A 1EXWA 2XUFA 4PSDA 1BN7A 2V96A 2WIDA 3R3ZA 4PF1A 2CBGA 3WL5A 1GQRA 5ALPA 2JIDA 2JGLA 3IBTA 4Y7DA 4J0DA 4BYMA 4OYLA 2ACKA 4AMYA 3ZLTA 2I78A 1M33A 3B3QA 1HLGA 4BTVA 3WMRA 3BWXA 3RARA 2X5XA 3WKBA 3UUFA 1LPAB 5HQ3A 5D6OA 4U2EA 4M0FA 2Y2VA 4HAIA 5ISMA 1HKHA 1XQVA 4UHCA 1TRHA 4PQEA 3K6KA 1FFEA 2HM7A 3CCBA 1EB9A 1G4HA 4P92A 2VAVA 5ALYA 1C4XA 5EFZA 5AP9A 4KE9A 1G66A 4GBGA 4AX4A 1ZIYA 4H7KA 1OCEA 4NS4A 4DNFA 1VZ2A 3FVTA 3STXA 2WHQA 5EHXA 4QWWA 3B5EA 4IHAA 1OILA 1XRMA 4N5HX 4G8DA 5DJ5A 2AJLI 4K6HA 4EY6A 2GBCA 1UFOA 1JJBA 3I2GA 4C87A 2BGNA 2RIPA 4FFVA 4G4JA 1K4YA 1XQWA 3HZOA 2PSFA 4X95A 4GHWA 2PSHA 3F96A 3FOBA 4Y2YA 2X8BA 3C43A 3D4LA 3HACA 5JATA 5FPQA 1DWQA 5EHZA 2OCGA 5T4FA 4UHEA 1MT3A 3RKSA 3KWFA 4EY5A 2HA3A 1QONA 5J3JA 1TQHA 3WL6A 1CUZA 4CG2A 7YASA 4OU5A 1VZ3A 3LIIA 3QPDA 1A88A 3H19A 5D7BA 4I19A 4B9AA 2O7RA 2DSNA 4FMPA 4HXEB 4ZGBA 4FKBA 1QIJA 2HA2A 4A5SA 5A6VA 5ALDA 2J4FA 3G0CA 2ORYA 1YB7A 4Y9SA 3W9UA 3G9ZA 4UHFA 1XZEA 5E4JA 2Z8ZA 2X76A 4BCDA 2RI6A 4GXNA 4W63A 4C6HA 1EA5A 2QUBA 5AO9A 2ACEA 5YASA 1ZJ4A 1EDBA 5HF6A 3C5VA 5HK8A 4FWBA 4XVCA 3TJMA 4P93A 1K6EA 2C58A 4OPMA 1W6RA 1DX6A 2WHRA 5AOCA 1MN6A 3JYHA 2Z3WA 2JGEA 3BIXA 5FV4A 1Q83A 3FYTA 3G9XA 4H7HA 4V2IA 1THTA 2IIVA 1RYYA 5CH8A 2PM8A 2XB6A 2OPHA 4QLAA 4X6XA 1XRLA 4P08A 3OM8A 2WJ6A 5JD6A 2RGUA 1LPPA 1CUIA 4C89A 5JAHA 3H2KA 1ZD3A 3SC2A 1T2NA 5ALNA 3VVLA 2HU8A 4ITVA 5AM3A 1CUSA 4UFNA 3H1BA 4UUQA 4N8SA 3D2AA 1XLUA 2GBIA 3STWA 3O4HA 3UUEA 4CCYA 2QXUA 1KU0A 3IUMA 2QZPA 1MPXA 3EIOA 5CXUA 2GYVA 5CW2A 1UKAA 4ETWA 3F98A 1E66A 2HDWA 4DMCA 4F21A 4B9EA 4OU4A 2E3JA 4BC0A 1KEZA 4BVKA 3WK8A 5A7FA 4IH4A 4AO8A 1QIIA 2HHAA 2RHTA 3ZPXA 2FJPA 4IH9A 4OD0A 1ODCA 4N5IX 4AZ0A 5JANA 5AKGA 1MU0A 2HRQA 1FFCA 3RK4A 1DTEA 2WFLA 5K3CA 5EIEA 4AQDA 4HRXA 1OXMA 1ISPA 3X3HA 3FYUC 2VJDA 3V1MA 3G8YA 4H7JA 1Y7IA 2ZJ6A 1WB6A 1YA4A 1I6WA 3C70A 4TPKA 3ICVA 4JYMA 5E4TA 2VSQA 5JARA 1SFRA 3FSGD 1P0MA 5AM5A 5I8PA 2D0DA 5HF8A 4ZRDA 3LLCA 2WM2A 3ESCA 3G9UA 2PSDA 2WJ4A 2PKYX 1EVQA 4FNGA 2XMCA 1O6GA 2XUGA 3FCYA 4AO7A 2PUJA 1ZOIA 4UBNA 1YA8A 2CJPA 5EI5A 5CH5A 3F67A 2VJCA 2JGMA 4EHBA 2PSJA 2QMQA 1BCSA 1HQDA 2OG1A 1BROA 3R40A 4KYVA 4J7AA 4UBLA 1VKHA 2HA5A 3V1LA 3ESDA 4B0OA 1WOMA 4C01A 4JYPA 1X70A 4FBLA 1EVEA 3HYSA 4UBJA 4J0CA 2VT6A 1USWA 3PE6A 3STUA 2VJBA 4MYSA 2I3DA 5JAUA 2XUIA 2ZSIA 1BEZA 1H23A 2XMSA 3BF8A 2C0PA 1MAHA 5AI8A 1GQSA 4XIIA 4EA6A 3QMMA 2Y6VA 3G0GA 3DOHA 2JEYA 1EB8A 3ANSA 4WJLA 3H04A 5EIHA 4Z49A 4U2FA 1DT3A 1QZ3A 2CKMA 3PICA 5AK4A 2YXPX 1QE3A 4BZWA 4QDUA 1CRLA 4H18A 2C5GA 3PI6A 2QJRA 5AKLA 4J3JA 1VLQA 1PJAA 4C4XA 5C81A 2PUHA 5CTAA 5AI4A 4KAAA 2PL5A 5IVHA 4N8DA 5AKEA 3HJUA 5AOAA 1CUDA 1QIMA 4X7BA 3SWWA 3WK5A 1WM1A 3NGMA 1ORWA 1G42A 5HQ3B 4K6GA 5ALVA 5ESRA 1RWQA 4CFSA 1RP1A 1UT6A 1ZI8A 1MJ5A 4C4YA 3AINA 3WJ1A 4XJVA 3O4IA 5ALJA 5AKKA 5HKAA 2RHWA 5K3DA 2O2IA 2H1IA 5AM0A 1QIHA 4BDSA 4OUKX 4G8CA 5ALXA 4E11A 5LZ2A 1XRNA 1DWOA 4X6UA 2PU5A 2GYUA 4KE6A 3DQZA 5ALSA 1CUAA 2W22A 4HRYA 5HK9A 3I2JA 1BE0A 3KOOA 4ZV7A 2DHEA 1MAAA 2J3DA 4BCCA 4QLOA 4DMFA 4NVRA 1QFSA 3VXKA 1ZI9A 1MTZA 1XROA 5DYYA 4D9JA 2VAXA 2BUBA 5CT9A 4JNCA 1AGYA 3A2LA 3UMJA 2ZYSA 3WK4A 1NU8A 2CMFA 2XUHA 3WZLA 4MEBA 4RE5A 1ODSA 3QZUA 4W9RA 5ALKA 4Q05A 2VT7A 3C8HA 1Q0ZA 3TGLA 1VE6A 3DKKA 2XUOA 4H77A 4LXIA 4B80A 3D59A 2BJHA 3I1IA 2AJ8A 1FSSA 4RE6A 4B83A 3WWEA 1A8UA 4QZVA 4DSZA 4OYYA 4UBMA 2WG0A 1ZJ5A 1T4MA 5ALZA 1JT2A 2C5FA 1MX5A 5KBYA 3CCCA 1XZLA 3NUZA 3OTQA 3HI4A 3FVRA 3BDIA 2HRRA 2OCIA 4JEIA 2OAEA 5JASA 1JU3A 1WCYA 2WJ3A 2WKWA 1IUPA 2HA7A 4AZ3A 1CQWA 1E8MA 1BN6A 3VKFA 1CFJA 5JD5A 5AKHA 4K5QA 2I03A 5JAOA 2HU5A 1K63A 2XQGA 3NWOA 5ALUA 2GYWA 1LBTA 4OB8A 4WFJA 1AC5A 1L7RA 4EY8A 2G63A 3M83A 2XQFA 3WLAA 5IVDA 5FDFA 4BDTA 1YS2X 4DMKA 2XMQA 5IH7A 4AMZA 2Y2UA 2HIHA 3DKRA 3DJYA 1WPRA 2FX5A 5ALLA 3D7RA 5KWIA 3O9VA 1K5PA 4E15A 4P9NA 1ZD5A 2V97A 1BRTA 4DNOA 1WHSA 4X91A 4KRXA 2WU3A 3D2BA 4F0JA 3C6YA 1CUJA 2H7YA 3HLKA 3O4GA 3EF3A 4QA9A 3MUOA 3C5WP 4J0GA 1F6WA 5AH0A 4GDMA 1DQYA 1JKMA 3W06A 1H2WA 3JW8A 3WL8A 1H2YA 2HL6A 1H2ZA 2XUDA 3H2IA 1LLFA 3O95A 2ROQA 4K6KA 3AILA 5CT4A 5E2IA 5T4BA 1XLVA 3E4DA 4GI1A 1PFQA 5ALHA 3U1TA 1IUOA 1UOQA 5C8ZA 2XMRA 2Y6UA 4W1PA 4KR0A 3RM3A 2WIGA 5FOQA 3IIIA 5JD4A 4CIAA 5ALGA 1UOOA 4B84A 3QITA 1MX9A 2NW6A 5LLSA 4W1RA 1CVLA 4JH0A 5HF9A 2OCKA 5LZ7A 2XT0A 2HADA 2QXTA 3E0XA 3YASA 4A16A 4BTLA 3BE8A 1DQZA 1LPMA 4NMWA 3V9AA 2JEZA 5IKXA 3AZOA 1WB5A 3L1JA 2WG1A 5JZBA 3FLBA 2VATA 5DWDA 1YS1X 1LZKA 1IMJA 3WWCA 1LPSA 3O4JA 3I1YA 5K3BA 4LYDA 4RGYA 4Y2VA 3L1HA 3LIPA 4N8EA 5CH3A 4WCVA 4BRZA 1YR2A 2WFLB 3DCNA 4U2GA 1XZCA 1AZWA 1LBSA 3OC0A 1R9MA 4O08A 2FJ0A 1ZD4A 3WA7A 5ALOA 4H7DA 5JYCA 2Z3ZA 3EQ9A 1CIJA 3U0VA 4KAFA 2XQIA 1IUNA 4PSUA 3M3DA 4EUSA 4ZV9A 2BKLA 3IVMA 3IURA 1TKRA 4YASA 4B85A 1GPLA 1AUOA 3FYUB 5CURA 3MGAA 5AIBA 2XUQA 1UXOA 4J0KA 4BE9A 1LPBB 1W76A 5CT6A 4KJXA 2HA6A 4DGQA 5K3EA 3MVEA 1XRQA 1O6FA 4EY7A 1LGYA 2VEOA 1A8SA 2VQ6A 1ACLA 2V9ZA 2XQJA 1AQLA 1TIBA 4DYHA 4GECA 2RONA 1GKKA 1W75A 1Y7HA 4HS9A 4X71A 4JUIA 6YASA 2WUDA 5KREA 3PUIA 4QDTA 4BATA 4KE7A 5AM2A 2OGTA 3QH4A 4MYDA 2IX9A 4DLNA 2HA4A 5A62A 3C87A 1HPLA 5A71A 1F8UA 5CBKA 1U65A 3I2FA 1IZ8A 4WY8A 4G9EA 4C88A 4CI9A 1BCRA 1EH5A 3IB3A 5FXMA 4K2AA 3CXUA 3H2GA 5ALMA 3ICWA 5EGNA 3N0TA 3AJAA 1UK6A 4WFKA 4U2DA 2OGSA 3GZJA 5AHXA 2BGRA 3K9BA 1XFDA 1AURA 2CB9A 3F8SA 4NZZA 3ZI7A 5HFAA 4F60A 2WILA 1DT5A 2JGJA 5AKZA 1AX9A 1W52X 3ED1A 1LZLA 3H1AA 4WDRA 3BJRA 2WIJA 2BCEA 3I2HA 1LPNA 4HXGA 2DCMA 2ECFA 4MEAA 2OQIA 1WB4A 3VVMA 4IQ4A 5ALWA 3RLIA 3O9MA 4S0XA 1XRPA 5AOBA 3I6MA 5K3FA 3JWEA 3GROA 3C8DA 2HFJA 3K2IA 4X97A 1P0PA 2EDCA 3M82A 4HTAA 4Y2UA 2B61A 3TEJA 5BV7A 3PUHA 3WJ2A 5SYNA 1P0IA 4Q34A 3A6ZA 1ODTC 3C6ZA 3SK0A 2J4CA 2QS9A 2WSLA 1K8QA 1CUEA 3SX4A 2C4HA 2CUTA 4EB0A 5ALFA 2QR5A 5DTJA 1JJIA 3G0BA 4LYEA 4RNCA 1YAHA 1CV2A 5HZGA 1EHYA 2PVSA 4J0HA 4Q3KA 2EDAA 3EQ7A 3WI7A 4B6GA 2C7BA 5AI6A 3G02A 4AO6A 4L72A 4B81A 4H0CA 5LZ8A 4TVKA 4Y2RA 5AJHA 1QFMA 1IZ7A 1L7AA 4UHBA 3I28A 2EEPA 5LIPA 1VA5A 1E8DA 4KRYA 4BBZA 5DNUA 3G9TA 4AN1A 3V48A 3HXKA 3KSRA 4KACA 1A7UA 4BAZA 5ALQA 5LZ4A 1QIKA 1QIDA 1L7QA 3L1IA 4XX1A 1XZHA 4M0EA 3HC7A 2AXEA 4GEGA 3QPAA 5A7HA 5I9IA 1AMNA 3H2JA 4Y2JA 1JMKC 3A70A 3FCXA 2G4LA 3H17A 2BUCA 3IULA 4YK7A 1AKNA 3D3NA 1ZD2P 5AM4A 5ALEA 1QTIA 3V1KA 1XQXA 1CUBA 3E3AA 2HA0A 3WA6A 1QOZA 5JIBA 4UHHA 3WKAA 3QBJA 2AJDA 3PFCA 1SOMA 4RPCA 3WKDA 5IVIA 2OLEA 4OB6A 4Q1VA 4FLMA 3QPCA 3GBSA 2B4KA 2HFKA 2ONCA 2OXEA 3DYIA 1SC9A 3A2MA 4HVTA 3DLTA 3GELA 5HCUA 4Y2QA 1Z68A 3KD2A 3FBWA 3IDAA 3OURA 4UBIA 5FRDA 4DMHA 2ZJFA 4MXDA 1UK9A 4BC1A 3P2MA 2UZ0A 3AIMA 1FJ2A 4INZA 2Z5GA 3KDAA 5FPPA 3H18A 1CQZA 1XZIA 5KWJA 2WUFA 4J03A 5BWCA 1XZFA 3N2ZB 1LNSA 1CUVA 1GXSA 1FFAA 4BAUA 1GPNA 2V98A 1NX9A 2DR0A 3DEAA 3I6ZA 2ZJ7A 1Q84A 4HZGA 3AUKA 1EDDA 4MWTA 5JZ9A 5LKAA 2PBLA 2XE4A 1TAHA 5AKXA 3OPMA 2OAGA 2CEKA 1R4ZA 2R8BA 2OQVA 4DNPA 1C7JA 1UK7A 2QTBA 4QDOA 2AJBA 3V1NA 5T4EA 2XUPA 5LP1A 4BVJA 5AKYA 3QVMA 4G9GA 2LIPA 2XDWA 4U2CA 4ZWNA 4WY5A 4OSEA 3EQ8A 2JBWA 3BL8A 1HDEA 4J0JA 1GT6A 3B12A 4BP9A 4PW0A 2XLCA 4IO0A 2Z8XA 3QMVA 4PO3X 5AI5A 1ETHA 4DSAA 2WHPA 3PF8A 1EK2A 1EINA 1P0QA 4LHEA 2QRUA 4PV7A 2JGFA 1X2EA 3DS8A 3KWJA 3PF9A 4PSCA 4PNZA 2H9YA 2O2GA 1N1MA 5FP0A 4LXHA 2XMDA 3AIKA 4CG3A 4G4IA 1J1IA 2DFPA 2ZYIA 4L0CA 5D3ZA 1UZAA 5C8XA 4HXFB 5AIAA 5BWBA 4M0MA 3R3VA 5T4HA 4FNMA 1IVYA 2I3ZA 4Y2PA 2P8SA 4QDZA 1N8SA 1EDEA 2OGZA 1QJ4A 2DQYA 1B41A 1PV1A 3AFIA 3WIOA 2QKYA 1TCCA 1VOTA 2YASA 2OCLA 1XZKA 3FNBA 5DYWA 4I3FA 3VISA 3PFBA 1W4LA 2WG2A 1WPXA 1XKTA 5JALA 1XKLA 5JADA 1E89A 2ZSHA 2PPLA 4ROTA 3ANTA 5SYMA 3WK9A 3OOSA 5F4ZA 1YSCA 2XUJA 4C4ZA 2ES4A 2WIFA 3BJMA 4X92A 5DNVA 3W2TA 4X00A 2R11A 3GFFA 4H7IA 4FLEA 1VXOA 4B0PA 4CCYB 5AKIA 1J2EA 1QLWA 4H7FA 1UWCA 2XUKA 3ZWQA 1MO2A 3VJKA 2W6CX 3D0KA 5ALTA 5AK3A 1UOPA 2WUGA 3G0DA 1XZDA 3DL4A 3DNMA 3HSSA 1S8OA 3AIOA 5EHNA 1DU4A 3DL7A 3R41A 3FLAA 4BP8A 1QGED 2QM0A 3S8YA 4UBOA 2AJCA 3AZQA 4QDXA 2DHDA 1R1DA 2ZYRA 1CUFA 2DQZA 4GWLA 4OCZA 1DINA 2JGKA 1GKLA 5IVKA 3G0IA 3WKCA 3LS2A 1J06A 4Q82A 4BRSA 1ACJA 4Y2SA 3BIWA 1XZAA 5AI9A 1XZGA 1CEXA 2D5LA 1WHTA 1UKCA 3DYVA 4FFWA 5EHQA 1CUYA 4FOLA 3WKEA 4L9AA 2GBFA 1YAJA 4X6YA 3DOIA 1CUWA 2XMGA 3WQHA 3G7NA 5ALIA 4UHDA 4TGLA 2H7CA 3VDXA 4OB7A 1QO9A 3LP5A 4CG1A 1YCDA 5K3FB 5D3KA 2Q0XA 2CZQA 5CMLA 4A23A 4X94A 5AK5A 3VJMA 3QMWA 4W1QA 1DWPA 1MX1A 4MQLA 4Q3OA 4E14A 1QIGA 2WFZA 5FLKA 1GGVA 1BEEA 5DTIA 1R3DA 4UFOA 1ORVA 4Y2XA 4FHZA 4LKOA 2QJWA 4QWMA 5LZ9A 4CIBA 4H7EA 3WWDA 4WFIA 2YYSA 1G5FA 1QTRA 4AXBA 3ZLUA 3STTA 1JU4A 4X85A 4XWGA 4ARBA 3WZMA 3MUNA 5FUMA 1CR6A 1R88A 3T4UA 4UPDA 2PSEA 5JZSA 4BVLA 3R3UA 4IH1A 4L3WA 1XZJA 4WDQA 1D07A 4BAGA 4YX9A 3DD5A 4YPVA 2QT9A 4X90A 1E5TA 2J3QA 3FSGA 1ZGCA 1QIEA 3S2ZA 3PDCA 1EK1A 3R0VA 1SCIA 3WWOA 1CUUA 3DDUA 1UKBA 4EBBA 1SCKA 3BXPA 4X3CA 3H2HA 5E4YA 2H7XA 5AI0A 3GA7A 1EI9A 1ZICA 2XQKA 2XLBA 2BUAA 2VA9A 1CUCA 2G5PA 5K5EA 1TCBA 2WU4A 5FKJA 3HEAA 4E46A 3STVA 4B7ZA 3T52A 1R9NA 4KEAA 1JJFA 4DM7A 4MJ3A 2WTMA 3O0DA 4ZREA 1CPYA 3A2NA 1JI3A 2O7VA 2K2QB 4AN0A 1CUXA 2FUKA 4I4CA 2BAGA 3FAKA 1VJ5A 1N5RA 1QIFA 5ALRA 3ZV7A 3C6XA 3W9BA 3WIBA 3STYA 3R3XA 4J0IA 4ZI5A 2JGIA 5BOVA 3TRDA 4BZZA 1H2XA 1MNAA 2BFNA 4LXGA 3WYNA 2YH2A 3ZLVA 2QVBA 1YASA 2ZYHA 1N5MA 4U2BA 4G8BA 3FYUA 5DYTA 2ZVDA 1X2BA 1W1IA 1FFBA 1U8EA 5DLPA 3NOXA 1MNQA 4BCBA
chains in the Genus database with same CATH superfamily
1K08A 2P0YA 3IIJA 1DL5A 3QLJA 4HJXA 2NYRA 1UJ4A 4YA6A 1PVVA 4CGZA 3MIZA 4QGAA 1ULZA 1JQJC 1Z83A 4TL6A 2V7EA 5AJZA 1RBYA 4OHXA 3NUGA 4BNIA 3KZCA 4D92A 3L7KA 1WW3A 3N59A 5G0WA 3D8RA 5HKBA 3ZW8A 3QXJA 3SR4A 3S2UA 1U4NA 1MZPA 1B8NA 4R41A 4G1FA 1NN3A 2YC4C 4PE5B 2QK4A 4RYDA 4MVJA 1E3MA 3ZJTA 5B1YA 1KZ7B 2H4HA 2O19A 1FFDA 2HV9A 4MA4A 3THOA 1JEEA 2ZJ1A 3SQDA 4MUEA 1FNNA 3UK0A 3GHHA 1Y5LA 4WMLA 1L5NA 2VYCA 3D7KA 1K0FA 1U5AA 1VXRA 2B20A 3IR6A 3I09A 4I7EA 2H4FA 2J48A 2ZR7A 4BB0A 3T5PA 1THGA 1WXEA 2OO5A 4TVBA 4X8LA 2AX4A 5K2MA 3GUUA 2XUAA 2P41A 5AM1A 2HR1A 2VF8A 3GK3A 3ZGZA 2Y1KA 1Y37A 1DX4A 3RTAA 4MVWA 2W48A 3W04A 5IDQA 3KAKA 1MA0A 1OY1A 1T0IA 2HBZA 1BU8A 4V0ME 1CZRA 4JV5B 2AV6A 5DOZA 3EQ6A 3RSHA 2Z9BA 4K81B 4H35A 3AXSA 5K8LA 1ZKDA 1CDEA 3IAS1 1Q0TA 1M76A 3L7YA 4H3SA 2E0IA 2G7ZA 1QQTA 1R6AA 3GPIA 4U7DA 4GYWA 1PJRA 3D6JA 4JGGA 5B2ZA 4YJGA 2VTVA 4EG0A 4ZVVA 3AEUB 1JLKA 1V48A 2H59A 3IJPA 3JSXA 4UDXX 3UHPA 3RODA 1E3TA 2X4LA 4N1AA 3HRHA 1VMDA 1H2AS 4IO1A 4LNHA 4MVYA 1DTWB 4R5HA 1ZAYA 4NXNB 1GFZA 1PWEA 3KSZO 4FBGA 1QPBA 2FLVA 5HGJA 1ILWA 3O6VA 5LP6F 3CUUA 1V0JA 5F5XA 1KYQA 3GLHE 5LCXA 1EZ1A 3GT3A 3ZXIA 4U7WA 3L0CA 3V80A 2XR1A 3NETA 3M6IA 4WT7A 5AK6A 1YRBA 4FLFA 4AJ2A 3ISVA 3JD0A 2C5SA 4Q66C 4B2IA 1JQEA 4ND6A 4M83A 1VJ1A 2RHJA 3O84A 4O5AA 1K5HA 3SM3A 3I01M 1M66A 4FTWA 3TOVA 1Q0RA 2Q4DA 1ZLYA 4LQ4A 2C57A 5CLJA 1H5UA 3MW8A 2IGTA 5BWMA 8ATCA 5JNSA 3QM1A 3EDRA 5DOVA 1GNSA 1HDYA 1R4MB 2QPTA 3A1WA 3ZTWA 4JUBA 4FDMA 1XRRA 1PZGA 1OOEA 1J09A 4Q16A 1HI9A 4CEIB 3T5BA 2EFCB 2CXHA 1C41A 3JAWB 3LT5A 4B3IA 5KWSA 2VJKA 1NFRA 4P33A 4QUEA 3UV3A 1LWOA 4EGFA 1J0EA 2OBBA 2BFPA 3TZKA 1OU0A 1UOEA 1E1RD 5AKJA 2A5YB 3S27A 1CY0A 1OX6A 4B45A 1M1YB 3BFJA 3CZ9A 1NVBA 2IX3A 4Z7OB 3WL7A 3OEHA 5I9BA 4JWTA 1NI3A 5L51A 3FKJA 3HM9A 3GLTA 5D3MB 2ZLBA 5LC1A 3SBEA 1INLA 2ZSDA 2Z1DA 3KV1A 4LNAA 1KU6A 3HTXA 3OZRA 3WK7A 4EMBA 4OYHA 3I2KA 1NC3A 2ZWAA 3M81A 4ZPXA 2AYYA 3MCVA 1LA2A 4ZALA 1J0DA 5B7QA 2R1VA 2WFMA 1HDCA 1EVZA 2KSQA 1PFVA 3HABA 4WXPA 4KPUB 4POAA 2JFNA 2V7UA 4KQGA 4F3RA 1BDBA 5BVHB 4IRXA 3A1TA 2OBXA 3OA0A 4HDQB 2QE6A 4XPIB 3WO1A 4W5TA 4PLGA 5JO0A 3C7AA 1SQ0A 3PVZA 2XA9A 4RUKA 4E30A 2W8ZA 2ZJZA 4MS1A 4HX5A 4IG9A 2WWVD 3H0CA 1IPHA 2HI0A 3U44B 1O7JA 2XMBA 4DJDC 1M7BA 1I0ZA 1P2TA 5KU7A 3LUBA 3JQAA 3NBQA 4KMRA 1UBJS 3AEZA 3RNLA 3SKXA 1HMYA 3LPMA 2IYEA 3L6RA 3PTAA 1C7IA 1YULA 3UMSA 2XCSB 2Y8EA 3QA3E 1IONA 1RXWA 2J3JA 2O9JA 3G49A 3R9WA 1YL5A 4ITRC 3HJRA 3LFHA 1XEWY 4UBKA 4UCXA 4R1OA 5DISB 1CU1A 1MW8X 1MBZA 4HSEA 4M38A 2ZRKA 3T7EA 1R50A 2W6IA 4D9HA 1J1UA 1SVMA 5GWXA 5KYVA 4IIVA 3EUEA 3RQSA 1YQEA 3FWZA 3VJLA 2NGRA 1FQWA 3OTHA 3FPJA 4GX2A 5FQNA 1U02A 2RK3A 3H3FA 4O4HA 4UFPA 2X22A 4FFNA 2P8JA 5AICA 1FDWA 1ZCFA 1SVWA 2AQKA 2COKA 2OZLA 3THXB 2PZEA 2Q5LA 2IYVA 5I51A 2IOHA 3IAM6 4FZVA 3LCJA 3I6BA 1ZI6A 4GT1A 4F2PA 1FFGA 2YWJA 4YBZA 2GN1A 6REQB 4FB5A 1E1MA 3ZHUA 2O1XA 3LOUA 3SGLA 3I04M 3N53A 4MCHA 4Y0AA 4I5EA 3OZBA 4CODB 5JAPA 5TPWA 1GPKA 2FWNA 4MYUA 2ZJOA 4FI3F 4RF3A 3B52X 4AY5A 4YXWD 3TSOA 5I7UA 1Z2PX 3FTQA 2JJ2D 4RSGA 1X0XA 1U3WA 3JZMA 5BYJA 4R8LA 1PWZA 1QVAA 2MR5A 2Q46A 1U28A 4IIBA 2XMZA 2Z2XA 4EPTA 5IDXA 5DK6A 2FWBA 2Z9CA 3R3JA 5JISA 4RKYA 2CF6A 1I4WA 3DTYA 3KWMA 1B8UA 5JSQA 2G08A 1FZTA 3V4OA 1PT6A 1UDBA 1W2HA 3GMTA 2XIJA 2HXGA 2YV4A 5JTUA 1RYMA 5LP6B 3ASUA 4EZIA 3TW4A 5JFTA 1U7ZA 2VUTA 4XB6B 3D8TA 4ILEA 3FLEA 5EWMB 4NJOA 3UXYA 1W0KA 3U4AA 4DDMA 4L22A 3NHRA 3QG1A 2I1QA 4I6EA 4ZU6X 3L93A 1GUZA 2ZJBA 3PTLA 2RHCA 5TARA 3COYA 1SA0A 3L7IA 1JYSA 4BV3A 4DVGA 1N33B 3ADCA 5J2TF 3KR0A 4RVHA 3RV3A 1TJ4A 1BW9A 1BN7A 1U7DA 1J2JA 1XR3A 2BN4A 2I3AA 2V6IA 2PR2A 3LT0A 13PKA 2V96A 5IARA 2GN8A 4KFRA 5IABA 1N2CE 4HDNB 2D8MA 2FW1A 2JCVA 2ZWIA 1R8QA 2PLWA 2H0RA 3T7TA 1PUJA 5JBNA 5JMWA 4AJ9A 4EARA 1NBHA 3TUIC 1FQJA 2YS6A 4U00A 5THKA 2ACKA 2Q6IA 1JHYA 8LDHA 3KQLA 3GO4A 1A9XA 4JDUA 2I55A 4AMYA 4H27A 4K1LA 4LGVA 3O8RA 3A6FA 4EYKA 4P3YA 1GT91 2WTXA 3JD1A 3HNOA 1BRMA 2VPZA 2WSIA 3KZVA 4LJ9A 4B2PA 4LJ8A 4BTVA 4ZDKA 3WMRA 3LM8A 1EWVA 4RA6B 5K0NA 2YXEA 3DVAA 4KNWA 1OIXA 4UVHA 3T95A 4BMNA 4IXNA 5IAAA 4X6LA 3FJYA 1AZSC 3PQ8A 4FFMA 2CMDA 3HK2A 1NY6A 1WKCA 1N9ZA 2OM6A 1M6YA 3HR7A 2IHNA 1R5JA 1RQLA 2LE0A 3AC0A 4RBNA 1W48A 4UAGA 4M0FA 3WGHA 1HO3A 4JJ8A 2CB0A 2NPOA 2NV6A 3CIFA 3EIQA 4RGVA 4CIDA 3P2JA 2QLTA 1HKHA 3FWPA 1UXJA 4MRMA 3UK1A 4BUZA 1XQVA 2JDID 3MT0A 1B1CA 2HQSA 3ZDAA 1IE3A 4MA5A 4CKYA 5D7NA 5IEBA 4C6RA 1JR3D 2WZDA 4LTMA 4YRAA 1RHRA 1P17A 2AEFA 1VYHA 3KZKA 1CIVA 5H9VA 2ZPTX 5IAJA 1XDSA 3AHDA 2CHFA 4OMCA 3F4KA 5KNDA 3AFNA 3F90A 1GAEO 4BVEA 4DEYA 1EB9A 3KKKA 1SCNE 3DEYX 5HKKA 2OAP1 4GKKB 3AVYA 1OAAA 2R6FA 3KFLA 4ZAZA 2QAGA 4G89A 4UPVA 4Z8XA 2R0QC 5EFZA 4LXTA 3T5CA 4KSCA 3JAKA 3MBIA 3QVLA 1T2UA 4CM3A 3QXGA 3CKKA 4Y9RA 1QX4A 1O97D 5AD1A 2GLXA 4QYWA 4KN8A 1ZZGA 1V3VA 3GJYA 4GVPA 3Q11A 2EBUA 1IJKA 3AYZB 3NKFA 1SKUA 3CT4A 4C22A 2ZSAA 4JC4A 4LCEA 3HNRA 3WVNA 5CUQA 3VQTA 1X1DA 4DNFA 3VR3A 2WSSD 2ICAA 4B8ZA 4DIKA 1OU4A 2R86A 4HEA1 4NV3A 1G3IA 5JVDF 4Y1RB 1LWNA 1YQUA 1L1FA 3M70A 1OBFO 3RDPA 3SFZA 3TZQA 1D5CA 3VHQA 4EABA 3VJRA 1YKFA 3ZDRA 2YZKA 3VR5A 3I76A 1T13A 2ZBGA 3E7FA 4WOBA 2ZB8A 3HFGA 5CLGA 3MYYA 4ZN6A 4Q01A 5GADl 1SVKA 4JMLA 4IHAA 4YDQA 1GN8A 5D8DA 5JCJA 4XLTA 4DCPA 1K8ZB 2AD1A 2P7HA 4N5HX 4HP8A 1E62A 2QNBA 4G8DA 5KX5B 4L07A 2ZBQA 1DKQA 2J30A 2A9PA 5TJHA 1TM7E 5LQRA 1FLAA 1ZGHA 4EW3A 3NH6A 1J9EA 2BFDA 4PTLA 5J2UA 3FDFA 1FMFA 2BW0A 3O1LA 4MVXA 1OWPA 2EW8A 1C8KA 2GBCA 3P9KA 3SS9X 3I2GA 5HQJA 5G1OA 3RC8A 3AKEA 4FFVA 3ZE1B 4NJMB 4GMDA 5EJ2A 3G89A 4YUAA 1XQWA 2QUJA 2QQEA 2QSYA 4YMHA 1HWYA 3W1EA 2XXBA 2XNKA 3HZOA 1D4AA 5CM8B 4CQNA 5F2OA 2PSFA 2ZQZA 4X95A 4QOSA 5CCDA 3WLQA 1DJQA 4GHWA 2IA5A 1TF2A 3UBMA 1T1RA 1TA9A 3QY0A 3P9QA 5ECWA 4D4JA 3FOBA 4QOEA 4M6WB 2X8BA 3F6YA 1KI3A 1XHEA 2AJTA 1Z4QA 4FONA 2N0SA 1UPTA 5KYKA 4YCDA 1HNZB 3F7MA 3D4LA 3OMLA 4M36A 1NVVQ 3AXTA 3HEBA 1A9PA 4M8IA 2X3UA 1ONPA 5FPQA 5IJAA 1ZINA 4Q3CA 1WUTA 3E3MA 5EJFA 1BVUA 3WNBA 4ZZ3A 1B14A 1SVUA 5B57C 4KBYA 1M1NB 1SQ6A 3K1AB 5BR8B 4UHEA 4A8JA 1MT3A 1BMTA 4NYJR 5HS4A 3DLPX 1M74A 1Y33E 2IHYA 2IWRA 3FPCA 4Z99A 4QYTA 3TTTA 4WA7A 3N75A 1C3VA 1QFZA 3B1WA 3LL7A 5IM4A 2BH9A 2DKNA 3WSWA 1EEXB 2PMBA 2VHJA 3IIKA 5EQDA 5P8WA 5DT2A 4D3FA 5D00A 4R31A 3CNNA 1VZ3A 3QPDA 3CX4A 4JXKA 3PGXA 4POOA 2UXBB 1A88A 2FR8A 1SG0A 3ANNA 3N3BC 4MMZB 2QWXA 4UASA 2V4MA 2W98A 3DWGA 1X7ZB 2QVGA 2HWYA 1GNRA 3RO7A 3C15C 1MABA 3Q7RA 4HB3A 5KS2A 1Y8QA 5KSZA 3IJ5A 5A6SB 1HDZA 3NVDA 2DSNA 4FMPA 5D85A 5FL7D 3ZK7A 2C3YA 3T7CA 3RSZA 4ZGBA 3PQ2A 2NVUB 1T3ZA 1QIJA 1Z0FA 3TMAA 2I6QA 5KIAA 2RHMA 5A6VA 3VZSA 5F64A 1CD5A 3D0OA 1SMKA 2QYOA 1GU1A 3FNHA 4A5OA 1KZ6A 3EEYA 1ISFA 3EZ7A 3ON5A 4RIGA 3KEMA 3RJTA 3I5MA 1TQ6A 1SZPA 2R2AA 3TPFA 1JVNA 1YI1A 4HX9A 3LX8A 1FTWA 2XA2A 2HMAA 2AR9A 4JLSA 1D6JA 3H5RA 5GJCA 2FP4B 2G5CA 1G6OA 1IN8A 5C7IO 2BGMA 2R1TB 3N9IA 4EQZA 1N3IA 1XZEA 2JIZA 2OAQ1 1PEKE 1J22A 1PDOA 5TPZA 2HLHA 5B7GA 4BP1A 3TMYA 1RRCA 2CXTA 3CB2A 5K3SA 3PXXA 1P2SA 1XTJA 4E51A 4E5DA 4W63A 3K0HA 4C6HA 1EA5A 1UBSB 4AX8A 3VNSA 2VFAA 5AO9A 4HR7A 2WYWA 4WLFA 1ZJJA 3UT0A 2ACEA 5YASA 4IJ5A 1EDBA 1V11A 4YY3B 4OQQA 3WLFA 2UYGA 1KAEA 4N5DA 4S1PA 1Z4KA 4B7UA 4FWBA 3WXMA 4J90A 3BWYA 4PSAA 4OTZA 4N3AA 1OHHD 5CIYA 2ZR9A 1XDBA 2BI8A 1W6RA 4I36A 4LN1A 1RIFA 1DX6A 3SYRA 4BRUA 2PV0A 1U63A 4XCQA 5EZYA 1WCWA 2FKNA 4QO7A 1SHKA 3DOOA 3K6SB 1HT2E 4FR2A 4Y98A 4JP8A 1R5NA 2QENA 2XZDA 2ZITA 3NVMB 5HE8A 4P3OA 2VXOA 5A3VA 4EBFA 1CP3A 1QAOA 1DIRA 2L19A 4PYOA 4EA9A 4RJTA 4YRTA 1PTKA 1IN4A 4LXQA 3E84A 5TMEA 4PZLA 3TQRA 4MGEA 3K0AA 2GPAA 3W7VA 4MDFA 1PDWA 5J5AA 3ESQA 2R7NA 1J8MF 3GLIE 2FUG1 2OC9A 4ZI3A 4DCUA 4CQMD 2J5KA 4DRZA 1EGAA 1DLIA 4AZSA 3DLHA 4AMGA 3QW4B 4BZQA 3BXEA 2NU6A 1POWA 4QSMA 1DKRA 1RAAA 2B83A 1C7FA 1NVWQ 1OMOA 2BE9A 2JCGA 2W2TA 2XB6A 4QLAA 4ZOLF 1Z5GA 5JCOA 4F46A 5BVHA 1LRJA 3TCXB 3IAHA 2XD9A 3HU3A 2W8BB 2PJUA 4TLAA 3KQUA 2XDYA 2DBZA 4YRDA 5IAKA 2NZWA 2C7RA 1YZVA 1CTQA 1OFIA 1T26A 2GXUA 5JLAA 4EITA 1REQB 1ZVJA 1LC0A 2DBRA 1JQDA 2ERYA 5CVTA 1RLMA 2EJCA 2PMFA 1SUCA 4HAXA 4WK0B 5ALNA 1EPUA 4ITVA 3HUTA 4RXTA 1S7CA 3FETA 1YVUA 3H1BA 1PCXA 4GLOA 3H2BA 2ZDGA 4RK0A 5BSKA 3JS5A 1TEZA 3RASA 1U0RA 3STWA 2FW7A 3V8VA 4ABTA 1SO8A 4PPFA 4DS3A 5I4KA 4AKGA 1ZRMA 1KU0A 4C05A 4ZARA 4ZCQA 621PA 3IUMA 2QZPA 1MPXA 3KFXA 3SZGA 4L76A 2PO7A 4WECA 2C5EA 2W2XA 2XZPA 3I0MA 1E5DA 3I0ZA 5CW2A 4HMQA 1L7OA 2CV0A 3WV5A 4DMCA 2ODTX 2HU2A 2DWUA 3TAUA 2BI7A 3ZKAA 4QELA 1ZVMA 3ESRA 3N0WA 4EYEA 1JAYA 3RR2A 3HDGA 5A2QA 2VP9A 2ZE6A 5K7SA 3JZIA 1CSEE 1P5ZB 4O4HF 5L7TA 4ZO7A 2DZDA 2VPXA 3LK6A 4GMHA 5G2OA 4Z7NB 2E37A 4FFOA 1SCDA 1HGXA 2Z5FA 4BC0A 4DKXA 3IT2A 4YAFA 2MDTA 3M4ZA 2FMKA 4JCOA 4M1TA 4NATA 2GEKA 4YECA 1QIIA 1V41E 2HHAA 4EG8A 1FF9A 1OAOA 1CG6A 1Z2DA 2DX7A 5JQGA 3DFKA 3OX1A 2DF8A 4AFNA 3IX7A 5KQGA 3AL2A 2YRWA 4UTXA 3R75A 4TN5A 1CULC 4AZ0A 4YRZA 1V7QA 5HHTA 3ISJA 2F8TA 4O5OA 4EG1A 5AVXA 4D96A 3AR7A 2V3CC 3GLGA 3IP1A 1XMSA 5FA5A 1FJGB 7GPBA 2J8ZA 5I7AA 2GSDA 3AERA 1P1CA 3VNBA 1D3AA 3QYFA 4YJGB 1A4XA 4DKJA 1Z8NA 3G6KA 2NV2B 1PK8A 2DXIA 4DLSA 1E3JA 1J8YF 1IULA 1OLUA 3T99A 3T61A 3ZE8A 5E7IA 5KYXA 4GLJA 2J41A 1FPQA 3O92A 3KB2A 4HRXA 1OXMA 2FWPA 1ZCAA 3LWNA 4BFTA 2GJSA 1QFYA 3EXG2 4M0DA 4ZVUA 4BFWA 4YLYA 2PX3A 4CZ2A 3D0QA 4UJ5A 2GZ1A 1M6HA 3X3HA 2NNLD 1K7YA 1QKIA 1GWNA 1XTSA 3ABSB 3NB0A 4U3JB 2GD0A 2W6OA 3QFCA 1KQFA 1H85A 3LRPA 3AF3A 1USKA 3AVQA 1ENZA 2FOLA 1UBTS 1RU3A 3JZAA 2LZ0A 1KEWA 3TKYA 3ZR4B 3C70A 3HJAA 1ECGA 5CLFA 3GCDA 1O3YA 1TM1E 2JIQA 3TIFA 1FUIA 3BXHA 2X2PA 1D4OA 1MGOA 3FSGD 1G20E 4DC0A 5AM5A 3SYTA 2TMKA 4W9MC 5LLDA 2QN1A 1BXRA 3Q41A 4EB6A 1SRRA 2WM2A 1JFTA 4KH0A 1VG9B 2A8YA 4F6CA 4EW1A 3ESCA 4DQXA 2G9VA 3VPBA 2IXFA 4OH1A 5JXIA 2AMJA 3AG6A 3CMMA 4P2BA 1GCUA 3KWLA 3UCXA 4Q4JA 5IK2A 3IXMA 4OQZA 1BKSB 2XUGA 4JB0A 5HOQA 5I6DA 2HYIC 2IZ6A 3B60A 3GP8A 1U2PA 3MAJA 2Y1EA 4AO7A 4F4JA 4FP9A 1DBVO 1ZOIA 3AL0C 1WKBA 4UBNA 4MDEA 1P5JA 1OXSC 2HEGA 3D3QA 3HJHA 4HFMA 5D2CA 5LUBA 1W36D 1LB1B 2DPXA 3H9BA 4R1NA 1GGMA 2R1VB 1JRLA 3LVQE 3WQSB 3UCEA 4QEZA 4FFLA 2X13A 2IJGX 2IHJA 4ZQGA 3GXOA 1T6NA 2QYTA 1KE1A 1UADA 4GICA 4IHQA 2VKTA 3W6NA 1RWXA 3Q3IA 4GPTA 3H5VA 4KYVA 3BK1A 4F8EA 1U9IA 4MS1B 1WA5A 3IPRA 3RS0A 3USCS 4U1RA 2HA5A 2X1HA 2IBTA 3QLVC 4B0OA 4JC0A 2V1XA 3JQAB 3QFTA 4C01A 2C8KA 4K03A 1NW7A 5AVKA 1JJAA 3PVSA 1FS5A 4FFPA 1X70A 1Z36A 3HYSA 1ABBA 1R8YA 2Z8YM 4J0CA 5J1SB 4WV3A 2IW1A 3EXG1 3FNGA 3GMIA 3GMDA 2C9YA 4YCLA 1TO6A 4NDAA 3CRRA 1QSGA 4RSMA 5ABPA 2VJBA 3A9RA 3U6KA 3A6KA 3JQ9A 4E5UA 5ULLA 1UC4B 2RHOA 2XUIA 1PEAA 1QVWA 2NAFA 1KYZA 3Q2KA 4WXEA 2XOXA 5DHSA 6NULA 4O4HB 4AULA 4PG7A 2NZJA 3NDRA 5EJ9A 5GIPE 2OZLB 5C7OO 1MAHA 1G6HA 4BKPA 1WY5A 2WZQA 4XIYA 5CNMA 1GQSA 2CLFB 4EA6A 3OOHA 3L1VA 2C8JA 4W9NC 1MIHA 5HYVA 2Y1DA 1E4VA 4TLEA 3FCAA 2Q1SA 3RG2A 1IN6A 3SQLA 1I6LA 3DOHA 3N70A 1ZS9A 2VT3A 1AGXA 5TPWB 4NYIR 4C20A 1IM2A 1G1MA 4XDYA 2JRLA 2WA2A 1JQ3A 2BWJA 1SEPA 2HCRA 2ISQA 2QVXX 2Z9DA 2YZMA 3OZDA 4HD8A 4RY2A 1F1BA 5DEIA 3CF0A 2IIQA 4Z49A 1E99A 4PFKA 3JQDA 3L8YA 1L1RA 3GJRA 4G1VA 3UZUA 5J2UF 4BKUA 2FR1A 2EZ8A 3LRXA 2R87A 1XK7A 1L4NA 1IHXA 2GF0A 1X1QA 2GYYA 3K0FB 4L1KA 3T5DA 1GR0A 3VUEA 5BQ3A 1B26A 4AS3A 2ZUFA 4E0BA 5BQXA 1P4SA 3NATA 2C5GA 3OIDA 3P71T 4LGMA 2R8PA 4YRRA 3ZK9A 3PI6A 2WD9A 2QJRA 1NQVA 3EZYA 1DJNA 2M1XA 4WBXC 1CRQA 4V0NA 4R6WA 4C4XA 3FAZA 4MUAA 4C76A 5GZ3A 5HS6A 3AKCA 5AKXA 5BUZA 1IIRA 2BPOA 1NTRA 4NP6A 1VP9A 5KI6A 1T0JB 1MC8A 1UZMA 3F7NA 3PD7A 2CLLB 4G0YA 3V9PA 1F2UA 1YV9A 4EYQA 1SA0B 5FWDA 2R6ZA 2EQ5A 3GJ3A 2W58A 3QU7A 4NDNE 1MRZA 1BW9B 2HH9A 2A5FA 2W93A 4KIJA 4TT3A 3R1IA 4UAUA 4G07A 3BH6A 3U5ZB 4P5PA 3LAWA 2OL4A 2Y9MB 1I7LA 4N8DA 1VE5A 4CM6A 1JWAB 3JQFA 1KEEA 5LOVA 1R6DA 2QX8A 2XE8A 1HFJA 5GOTA 2VK4A 1A9XB 4DLVA 5C31A 4DQVA 1PT8A 1E4OA 3EVAA 3NIDB 4NU8X 4D3ZA 2DQKA 3ETJA 2PXHA 3VU0A 4R8KA 1IHDA 5F5LA 1YS7A 2J4DA 5TVKA 5LYJF 5IM4F 2WT8A 2WM9B 3DFUA 3DVAB 3M6UA 1Y3IA 3PZRA 4KO8A 2ZDQA 3ZIUA 2GEDA 2GHIA 4RHTA 2G3YA 3GH3A 4PYQA 3IQIX 3TZ6A 2RGAA 1SNYA 5ESRA 2Q5FA 4JYBA 5L6MB 4YT4A 3BMNA 2O5RA 4C4YA 4OOFA 1W73A 4YP1A 2P1DA 4K9OA 1J2TA 3C98A 4H4EA 1B74A 4MRMB 5HMMA 2QVZX 4EFMA 3O4IA 3WGLA 5ALJA 1JDSA 3N05A 5AKKA 4DLXA 4LHWA 2RHWA 4XGQA 3E35A 4ZGGA 4TZTA 1XEAA 3BTUA 5BN4A 2VJMB 1A96A 1A4UA 1DEKA 3P2IA 4H0NA 4EHNA 5AM0A 2PZGA 2QL9A 4LWOA 5F78A 3FR8A 1NMSA 2H17A 2JFBA 2WLTA 3CY6A 4PVCA 4RGQA 2IYXA 2YRFA 2BR5A 1CJCA 2HF8A 1ECLA 5EMLA 3IQEA 3DT8A 3FZGA 4OUKX 4QTUB 3WC4A 4G8CA 1UBMS 4M1KA 3T7SA 2NXNA 2QAGB 2RHDA 3L77A 2BZGA 3PKIA 1Y8ZA 2OFXA 3JAKB 1NDQA 4F9TA 4KITB 3SG0A 5CFRA 2VZLA 4H1VA 1DAPA 2Q49A 5IP5A 1KYYA 3FYDA 5IC5A 2PU5A 2BSXA 5CFMA 5CFLA 1UAAA 3B7WA 2G83A 3TUZC 1O9HA 3C4JA 3BRCA 3GNLA 4UD6A 3LQFA 1B23P 1N7JA 1CUAA 1UWVA 2W22A 3DW3X 4HRYA 3RIYA 4HNTA 5HK9A 1WUHS 4KLNA 1YJCA 4CL2A 1BE0A 3KOOA 2YS7A 3RRBA 2IXTA 4AM8A 1IB0A 2VAMA 2OKCA 4KL8S 2A9RA 1ZK0A 4UNIA 3L2OB 1QFSA 2ZUBA 1ZI9A 4HX2A 1MEJA 3LJKA 3EZ9A 4R1LA 4RJ2A 5I9TA 2VQSA 3ND6A 4FOSA 1JIIA 1RJGA 5CGQB 3HYNA 4TYWA 1P18A 1KGDA 3DO5A 3GP5A 3I5UA 2FPIA 4E4RA 2IBMA 2BP7A 2QTWB 3HY6A 4JNCA 4F4HA 3B1XA 4FE4A 1UF9A 1LTHR 1G7TA 2J9GA 4QBHA 1TF7A 2Z08A 5J2UB 3EVDA 2BFDB 1KDYA 1MQ9A 3ZXYA 4ZAFA 1NU8A 2J67A 2VG8A 2XUHA 3NOQA 2P9HA 3T7KA 1OH8A 1AGNA 1EUCA 1HETA 4MEBA 5A5EA 1NJ1A 2P11A 4RE5A 3C1UA 1ODSA 3QZUA 1N5LA 3W5AA 2CE7A 3K9HA 1JV2B 2B4YA 4JT4A 2EYUA 2XVZA 2ZTVA 4FMCF 3AFOA 4AQYB 2YV5A 3EXFA 1Q0ZA 3KKPA 4DUZB 3HO6A 3DM9B 1VLHA 1MZVA 1FRNA 2ZYAA 4CLHA 3BM5A 3CLKA 3GN1A 4ZOAA 3D5QA 4F71A 4FZRA 4FSXA 4W82A 4EGAA 3EXHC 4RIHA 3UM9A 2CF5A 3E53A 3SSOA 4ZT6A 3Q88A 5DP2A 4C5CA 5HPYB 2JFWA 5K01A 1HQYE 3NHLA 1MMFB 4QU9A 5BQFA 4O4IA 3H4IA 5K51A 2ZIZA 4D6PA 2BMWA 3FTPA 5ITSA 1VCOA 2K87A 2Q4EA 4M86A 2GJAA 5DW0A 1F2TA 3TOXA 2P62A 3KT6A 2P68A 4A8JB 3I1JA 5KVSA 2DLNA 3HQ4O 4YFVA 3DZJA 5HWSA 3QOXA 2WG0A 2CCJA 4LI3X 1U8AA 3EA4A 5KMGA 5KBYA 1GYQA 4RJKA 2QG6A 2G0AA 1WULS 5FL3A 1GGHA 3NHUA 5B4TA 1GAQA 1D7AA 1QZUA 1USIA 4OVKA 3JRWA 4JVNA 4J1QA 2PR7A 2MMCA 1KJ9A 2OCIA 2IY7A 4LKRA 4Z51A 5BNZA 5IEJA 4OQEA 1BJTA 2DBQA 3E9RA 1JU3A 4AYWA 5AW2A 3D3JA 3PT5A 5FUBA 3IH5A 5C37A 3I34X 3ZS9A 1DI0A 5ILGA 2WIAA 2HA7A 4Y0VA 3WLTA 1UIRA 1V1RB 1MABB 3CUEF 4LYGA 2W2PA 1Y8QB 4TQAA 4YAOA 1U0FA 4XM2A 4JI1B 5ADWA 3HS3A 3TLZA 5FX2A 3L07A 4XDZA 2PGXA 4MQUA 1EWRA 2G17A 4H4CA 4LHVA 3DV2A 2XSZA 5A0VA 4PCAA 2IF2A 5ALUA 1F06A 2W37A 2PUWA 4N0QA 1YFJA 1NQOA 4D8YA 4EY8A 2YWDA 2X0EA 1SC6A 1UFKA 3T5TA 1IU9A 4XPZA 2CNLA 4I4TA 3OX4A 4BFZA 1E2GA 4E5YA 3T38A 1IATA 2J0EA 3AL3A 1YS2X 3ZWBA 1NFFA 5IH7A 4C3UA 3CVWA 4QQFA 4B6JA 3F47A 1O54A 3BGVA 4YRSA 4II7A 1BTOA 1L8AA 1XAGA 5A4JA 4TT8A 1G19A 4Q93A 1NKVA 3VBEA 1R4NA 2ZVJA 1QJCA 2FX5A 4I08A 1U9CA 1W96A 2EZUA 3M4XA 3IMCA 3D7RA 3NBXX 1RD4A 3CRMA 1H1LA 1Z6PA 2NIPA 4A8HA 4E15A 3ZE9A 4CIXA 4UD2A 3F1LA 4CFYA 1Z4PX 4MJ7A 1T2VA 5KSPA 4CKEA 2WTBA 3ROFA 2X19A 3IUBA 5KC8A 3RCBA 1BRTA 4HB0A 2V45A 2RGBA 3AJ9A 4J2TA 4ZTUB 1U99A 1DEAA 5FUWA 2DPYA 1SIBE 3C39A 3C6MA 3D2BA 4K1XA 4MGYR 1Q50A 1WBJB 5DCUA 1SBNE 3G2LA 4CDMA 4DRXB 2PUTA 4BKOA 5TF4A 5EZYB 3HLKA 2OWDA 4DE5A 1XVTA 4E03A 5I7RA 1NBMA 1CNEA 1JT9A 2CL7X 2OHJA 4HH0A 1NZJA 1UDXA 3NJ4A 5DBOA 5IUJC 2GOYA 4ETMA 1UBCA 3AU8A 3TIXB 2PRJA 1PAUA 3K0AB 3UWSA 1S2NA 1SD2A 3SVZA 4J0GA 4L5CA 5FTMA 2HTFA 1F6WA 2FMFA 3UANA 1TFRA 1IHPA 1H69A 3CBGA 5BPHA 3O8LA 4HVLA 5FB3A 1DQYA 1YCFA 4BX3A 5ICGA 2FR8C 4GC9A 2NU6B 3QIVA 1Z2OX 3WL8A 3ZWNA 1DB3A 3JWHA 1BGVA 1SELA 2P2CA 1H2ZA 3H2IA 4R5MA 2HRZA 1LLFA 5DXFA 1YZQA 3O95A 4F9EA 2FFAA 2ZT7A 4WXRA 3ZGYA 3AILA 4W5NA 4EG7A 3IUPA 5I47A 2JFGA 1PD0A 1YE5A 2YINC 3LWBA 4M9UA 4NU5A 2BTEA 3LFUA 3UMBA 1U5BA 3NNSA 1H0HA 4GPD1 4QVKA 1HLFA 5HVNA 2ZXFA 1NT2A 1YZHA 5ITZA 3ETDA 4P53A 1PFQA 4XDHA 1CHNA 4LZJA 3N6XA 5DM4A 2QR2A 1UOQA 3O4FA 1SHLA 2ZE5A 3DB1A 4IIJF 4IMPA 3ZHRA 5C8ZA 3WLKX 3RUAA 2NZXA 5KNLA 1NRWA 5LWHA 2GK4A 3TAXA 5DN6A 2IU4A 3LXUX 4BU1A 1H1TA 3LX6A 3QVVA 3PRJA 3TW0A 2PBFA 3G2JA 4Q7JB 5JD4A 1W88A 3GJQA 1VKJA 2X4DA 1SB9A 2G9UA 1A27A 4BBJA 4BNUA 4DILA 4YAKA 2IV7A 3QITA 3ZLBA 2XHEA 2NUTA 2YCBA 3EBPA 1O94D 4Q9JA 4Z8YA 3DDNA 4MIKA 1NUPA 4V3CA 3FFTA 1V3TA 4I46A 3SQWA 2EHJA 3QG5A 3JATA 3LQQA 1AN0A 4B6EA 5TGDA 5HF9A 2XT0A 1VRVA 1CQIB 4RK7A 4FOPA 4I1OA 1EM6A 1TTTA 1QRDA 1C3LA 1MHTA 3V9AA 4DV6B 1VDZA 3RC7A 2I2CA 2JIPA 3VKUA 2RJOA 2Q6TA 4MO9A 4MNTA 1PD1A 1SZCA 4KAXA 2I4NA 5E0OA 2OC4A 2VATA 1ECJA 4AZ0B 1N6OA 1YS1X 3AHEA 4IXTA 1GDDA 1LZKA 3UFBA 2Z4SA 3WWCA 4CHTA 1LPSA 1ZMXA 3I1YA 3U7EB 3QBVA 2CV2A 5K3BA 5GQSA 3BX1A 1JEDA 1CR0A 2EYQA 3AERB 3CPSA 4L9RA 4RGYA 2MJLA 3PVCA 2EL9A 4BRZA 4DANA 5BOSA 1Z8FA 4MUHA 1C3EA 2A1TR 1Q3KA 4Q18A 5CDFA 2R7AA 1OLUB 4U2GA 2GEUA 3AM1A 3CB4A 2YICA 1AZWA 1IVNA 1NW5A 1UJ5A 2QX4A 1YKSA 1E2KA 1KERA 1TZKA 3HADA 1W4ZA 3QJYA 3WYEA 4BWGA 3OC0A 1YF3A 2O8DA 4EX6A 1ZD4A 3RS9A 4TMKA 3IXLA 2ISCA 5LD2C 2NYUA 2J5XA 2R4TA 2C29D 2Z30A 4HQNA 4Q9LA 5ALOA 5LJIA 1QNLA 1VCIA 2YHAA 4HNAA 4LJSA 1B3BA 1BVRA 2D74A 3SEAA 2SECE 1BH2A 4X62B 5DHTA 5DBHX 3SHTA 5CR9A 2PEZA 2PZMA 4REOA 3K2BA 2JAUA 3N2LA 1CIJA 3RU9A 3H11A 3OC6A 3REQB 3E18A 3QWFA 1WU8A 5H4GA 5LOVF 1IUNA 3M3DA 3B2EA 2X6QA 1LUAA 2YDYA 2Y0EA 5ARCA 1BXRB 2A88A 4WVFA 4EB6B 2NP6A 2FETA 1QH8A 1Z82A 1TEHA 1ZH2A 2XUZA 4G0OA 3V8RA 2OXRA 1NKSA 2W2LD 3K4HA 5J63A 3PT9A 4HVCA 5A0FA 4YB8A 4Q4JB 1WDLA 2C82A 4XWOA 4K9LA 1VE3A 4YP7A 2CFIA 4Q7QA 2X0NA 1F5NA 4B85A 1E5VA 2Q0SA 3QHPA 4IGAA 1KRWA 3IP9A 2NO0A 1DADA 1YRQA 2QP3A 4UUBA 4LF8B 2H2AA 1UUFA 4FWIB 5F77A 4QOGA 2WF7A 2G9QA 3E9EA 2V3VA 3SNKA 5JRJA 2EBWA 4B3RB 3LHSA 1JTEA 2VDNB 1UXOA 1BIFA 3SOZA 1LPBB 1Y5IA 2TMGA 1W76A 3T1TA 1RFGE 4DV7B 3EZ2A 3TVDA 4AL4A 5KYYA 2RI1A 5CT6A 2A0WA 4CMGA 1QRUA 2XECA 3VR4H 1HDXA 3ZIAA 1O77A 1ZONA 2H65A 1OAOC 3EZFA 3KPVA 4IIJB 3GLQA 4TMXA 4Y0NA 2CLOB 4G2NA 1LRKA 5FYDA 3GJTA 3U9TA 5KC9A 3HP4A 1YL7A 4DPLA 1O6FA 1GPMA 3K73O 3MTDA 4OKSA 3V4LA 5HTOA 1HFEL 1ZH0A 4QQKA 1I7NA 2Y67A 1A2BA 3AP1A 5EKDA 3HPQA 5L3SA 2OENG 1A8SA 5EIOA 4J0FA 1KO8A 2V9ZA 4BB5A 4HI0E 2YC2C 1GPWB 1VMKA 3L8GA 4XVQA 3MPUA 4DYHA 5SZKB 1Y1TA 2I66A 2RONA 4CDGA 3LBIA 1GKKA 3QVUA 1W75A 5DDIP 2QT0A 1PBTA 1MOSA 3FPLA 4E6PA 6YASA 4DZZA 4RELA 1NRIA 3JYOA 4V38A 4QDTA 4BATA 3C3MA 4KE7A 5K99A 3HGMA 2QN3A 3CTPA 5CYOA 3BA6A 2IPOA 3T0GA 2IX9A 4G5GA 1UQTA 3H9JA 3HJBA 4QQNA 3QA9A 2HA4A 4WERA 5EZ5A 1RXUA 5A71A 2QN6A 1EVKA 3FMFA 3MT9A 5CBKA 5F3RA 3I2FA 5DGCA 3AB8A 3G8BA 1JWLA 1IZ8A 5EKTA 4C88A 3G5MA 2E49A 4ND5A 4JY7A 2C9ZA 1QNFA 1ZKMA 4D0NA 3LQ1A 4HPJB 3ETHA 3UB3A 4G81A 4HF7A 2KPOA 4LFBB 1HDGO 1L3IA 4Q4AA 3Q85A 1JTFA 1ONSA 1RJ9A 5LPNA 2H2WA 4N03A 4TM7A 5KOHA 1E6KA 3GJ8A 4JBYA 4MCAA 3CPEA 4R1PA 4BO1A 1XNQB 1UEIA 1XMVA 4RZXA 2OGSA 4OKIA 2R5WA 3WS7A 3DQQA 2VI5A 4AD8A 1AQJA 2VCEA 4EHLA 1KAQA 2F43B 4YJ3F 2NU9A 1AURA 4ZAGA 3IEMA 1KWGA 4NZZA 2FW6A 3IILA 3QLUC 4G1MB 1QGOA 3OWHA 3PX2A 1LY1A 2R25B 2JGJA 4LYFA 4P58A 2VO1A 4MCIA 4Q9AA 5AKZA 4E7PA 1AX9A 3R6LA 2OUKA 4JN6B 1F2UB 1FFYA 1IZZA 2GH1A 1W52X 3QUSA 1DC8A 2Z3VA 1KZYC 4UE6A 1U3CA 1DRKA 2PFSA 1UBOS 5JNLA 4ZEVA 2C2ZA 1K7XB 1XV5A 4WDRA 3IIEA 4QTXA 2PIAA 1LPNA 1KEEB 3I2HA 2PMCA 1E64A 2Q1YA 3DMFA 4I66A 4HXGA 5LOVB 2UUAB 4PZDA 2FI1A 3L8MA 5HRAA 4W5WA 3BZBA 1ZCJA 2IV3A 1A9TA 2D13A 3PNSA 3HXTA 4IGFA 4M1YA 2JBAA 5E2BA 2PH7A 3UJ8A 3BEDA 4KDFA 1I5EA 2W4MA 3GROA 3OF5A 4PRKA 3JQ6A 1DG1G 3BFPA 3RT7A 4K2HA 3EVCA 1MV5A 1NF3A 2G7MC 3MXTA 3P2YA 5LB2A 4KVZA 2IXAA 3QKUA 1SBIA 2Q3LA 4LMRA 4BJHB 4U8HA 1D03A 3ZBUA 3P9YA 5KO2A 3JZFA 3OAAD 4GPEA 2OUIA 5JXJA 2ZAYA 4RK4A 2JASA 2X86A 2B61A 4OF4A 5BV7A 2ID9A 1HUQA 4DQ0A 1PJ8A 2IPXA 1QCCA 1X19A 2JHCA 1N5JA 2O7SA 1P0IA 2ZYVX 3OQ1A 1YZ3A 3L6UA 1KVSA 2YJGA 3R24A 3C6ZA 2NSYA 4O33A 4I1YA 4PAQA 4PAMA 3EG9A 5BN4B 2FWAA 4EKDA 2IP4A 3D6HA 1S3GA 5BSFA 5DFAA 1IN7A 4UM8B 5IYZA 4RQUA 3A1UA 3CVUA 2G70A 2VOEA 5JQGB 4MV3A 2Y77A 2I9PA 4MB0A 4P5DA 1WXHA 5BSGA 1R0CA 4C43A 1G6KA 4KYTA 2H2HA 2QR5A 5EXEA 1IQ0A 2CL6X 1JJIA 3G88A 4JLJA 3G0BA 3PL5A 3AP2A 4X1KA 3CO5A 4MRAA 2EVWX 4PO9A 3LPCA 4RNCA 5JCPA 3GJ5A 3WLHA 1RQNA 2MYTA 1P4GA 3E23A 2PK3A 4DTIA 5CEFA 2PO5A 2GDZA 3OCYA 4CFZA 4D8WA 4J0HA 1VSQA 4LF5B 3K32A 1A0OA 1M2JA 3FNEA 1U8ZA 1RM0A 2PVPA 3CTMA 4II2A 2O8CB 1JKJA 1JLLA 3W3AH 3R5HA 4DNXA 3CPJB 2FRDC 2D8AA 4EI8A 2GTPA 4OX9B 4GFDA 2NG1A 2B1IA 1XCMA 2VHXA 4J6FA 2ZM6B 4YMGA 3EIHA 2ZZKA 4NH0A 4DVJA 3AR8A 3F9IA 2ZR8A 4RLFA 2IYAA 3MD9A 3LQ4A 4IF4A 4B81A 3AHGA 4H0CA 1OQAA 1XB2A 3GNQA 3X2SA 1YWGO 1R6UA 4TVKA 1QFMA 2YW9A 4RFVA 1JXAA 2FPIB 2O2DA 3ETLA 1U7XA 3H7AA 3QX9A 3JQFC 4JJAA 4MO2A 4XYBA 3FSJX 3KEQA 1QRSA 3IOMA 4L75A 3HCPA 1BSVA 1D2NA 4NZMA 3M6VA 3TG2A 4CLDA 5KWVA 4UHBA 3H0EA 2QN2A 4HLUA 5LIPA 1ECFA 1DKLA 1VA5A 3JPYA 4NCKA 4OXNA 3F2VA 2REOA 4LTDA 5CYPA 5DNUA 4FQ8A 1EUCB 3G9TA 1SG6A 1E1RA 4AN1A 4B3TB 3KSRA 4ZHSA 4ME6A 2VPTA 5ERGB 3D7NA 2A0FA 1QIKA 3LVFO 1QIDA 3T15A 3L1IA 3TIVA 4XX1A 3SVTA 3EXFB 4M0EA 2H1CA 1EEHA 2AXNA 2ZW9A 2G6BA 2VN8A 4XM1A 5K45A 4LZAA 1CQPA 2AXEA 2F59A 1TO1E 2VF5X 2ZU0C 3MWGA 2XWQA 2G06A 3Q4GA 4MRSA 4RV4A 2RK6A 1NULA 4GSKA 5I9IA 3PNLA 1B43A 4U7HA 3FF4A 4O4IB 5AOVA 4JBWA 5AW5A 3ZHTA 1VBFA 1JMKC 4Q47A 4S2UA 1IZ0A 2IELA 3FCXA 4M1QA 5C3MA 1F2TB 4R01A 1L4MA 3FMGA 3L8DA 1Z7WA 1KE2A 2DEUA 3H17A 3BL5A 1TAGA 2E1RA 4PLHA 5F9FA 1ZJYA 2GRAA 3E2MA 4LHYA 3H1GA 5JSYA 1L3CA 5KMGB 1QTIA 1IJBA 1NP3A 1GNVA 2WF5A 3BHMA 3QVXA 2O6HA 2FE1A 1BFKA 5CD9A 1TT7A 4TS4A 3DL0A 1UC9A 3E3AA 4Q7KA 5C5IA 3VTZA 4NJEB 4RMNA 3WA6A 2Q1XA 3NTQA 4OQXA 1ADJA 1MORA 4BJ3A 3H2ZA 1XF9A 1QOZA 1PZEA 4JB3A 2AHOA 4ZAXA 1OLOA 1SUFA 1U6JA 4JP2A 2Q4OA 4FS3A 4KI7A 4KXUA 4E12A 2ZBFA 2WZCA 3W1WA 3FHTA 3JY6A 1YI0A 3DTVD 4CTKA 1XAJA 2HY7A 4GGOA 5H1YA 3U3OA 1VYUA 2ECKA 4W5OA 3T5MA 1Z0IA 2AB0A 3HFJA 3QUQA 4PBSA 2F3TA 1ATZA 1LI4A 2DJIA 3K0BA 5GPBA 2QMEA 4OQ4A 1L5KA 3IQHX 5IVIA 5MDHA 1RHKA 2QNIA 1NOIA 1I3LA 2PWPA 3D4PA 3FSRA 1QU3A 1AKWA 4OB6A 4ZYWA 1IZ9A 4YXWA 1VKOA 1X8LA 4I4TB 4TSFD 3SHQA 2JJ2A 3IAXA 4LDQA 1SVIA 3M1YA 4NRDA 3E9YA 3SXJA 1FTGA 4FFBA 4L5AA 3QVOA 5L4NA 3O9ZA 5BXYA 4LPSA 4RABA 5HUQA 4BO5A 3HCBA 4HVTA 3A2MA 4K7JA 4Z0PA 4YAJA 2ZB2A 1LVUA 2WVJA 3PPYA 4M7RA 2P6NA 1D8AA 3IVGA 2FQ1A 3LPLA 1R4NB 4Y2QA 4C6SA 1IY8A 2PGDA 1EFUA 3BXOA 3MTGA 4DMHA 3GOQA 2FQXA 5G3ZA 4AF8A 1N2ZA 1I0IA 1OT5A 3N87A 4P2GA 1N34B 1CKEA 4H1WA 1UK9A 2KBFA 4BC1A 5HIKA 1H1LB 1F4VA 3NT2A 3B2QA 3OZIA 1E0SA 1FJ2A 3T1OA 1HEUA 1VYVA 3WFIA 5I3CA 821PA 4INZA 3PC8A 4YRBA 2WJVA 5JS7A 4CKEB 3AOEA 2OCBA 1P75A 5EA2A 1F9AA 1KXZA 2Q5OA 5FPPA 1Y5RA 1DAOA 1RWBA 1SURA 2PWYA 2XY4A 3AHCA 3NEPX 4IWNA 3CCFA 3WL4A 4J8PA 3KETA 4FGLA 4DQLA 2C61A 4L74A 4N3BA 1XO1A 1CQZA 1FFHA 1TF5A 2GAAA 1J20A 3C7KA 2BI4A 3Q5GA 4A10A 1XZIA 1N78A 4L6CA 2WUFA 3PGVA 4NZ9A 4D7AA 3VPSA 1DRUA 4EECA 1VLZA 1XZFA 2GSWA 5PGMA 1LNSA 1J5PA 5HIIA 4HL6A 3Q7QA 2EL7A 4QARA 4BNTA 4OGFA 1RI2A 4CCAA 1M1YE 1JHZA 3ENNA 4FHGA 4PYIA 4BAUA 3CNOA 1PJ4A 1FUYB 1KEUA 2JCBA 3FHJA 4J9VA 4UATA 4DR6B 3EEIA 1P3JA 2G40A 5EJGA 2IYRA 3MJEA 2V98A 1G9TA 1B7GO 1SKBA 1NX9A 2DR0A 1CJSA 1WCXA 2VWGA 3ETEA 4ZO6A 1CY2A 4HZGA 1Q84A 4G63A 5SZHB 1L7XA 3AUKA 3BC1A 2ONZA 2C96A 4Q3DA 4HN4B 3TNLA 2QTTA 1TAHA 2REBA 1NASA 1E7QA 1SUAA 1UC5B 2XE4A 3GDFA 1UBUS 3GLRA 2JDIA 1OE0A 1SUIA 2X9GA 3ENWA 3M89A 2BFFA 3OPMA 5GTDA 2B36A 3ZTTA 3K7EA 4CM5A 4Y2GA 5SY6A 1BE6A 1JR3A 5GZ6A 2LCIA 3VYTB 1KIMA 5E9QA 5FFMA 4C4SA 2PDAA 4KGXA 2RB4A 1XKQA 4IFTA 1R4ZA 1U5BB 4W5HA 5ENDA 4BP3A 4S3MA 2ZI4A 4JODA 1U2ZA 5KYUA 1RNLA 5ITZB 4DA7A 1V8PA 4IMRA 4TVOA 2A58A 4ZYLA 3NAQA 2C8VA 2GCOB 2XUPA 2ECQA 4BXOB 3UATA 4HNHA 4BLSA 4DUGD 1ZO8A 3IE0A 4BVJA 5G0UA 5T57A 2PJDA 5B55A 4DYDA 4O59O 3IT0A 3M6WA 3ZOKA 2XGJA 5NULA 2GFQA 4XASA 4G9GA 4BXOA 1KDVA 1T6ZA 4ZWNA 3GRRA 1W88B 1DMRA 1JDZA 3A7EA 4NU6A 2PMWB 2CXOA 3L9XA 1D9ZA 1U98A 1Z0JA 4REQA 2NUTB 3STHA 1KI6B 4TKLA 2YBEA 5DCWA 1PQ4A 1Z73A 3B12A 3TBHA 5B6JA 5IMSA 1IZYA 1X14A 3QMPA 1BFDA 1XCGB 5KOJA 3NP9A 3EYAA 3JATB 2XLCA 4Q7MB 1RXSA 1WOYA 2AF3C 4W8GA 5AI5A 1SC1A 1RBZA 3HCCA 3LYHA 3SIPA 5L4LA 3LBFA 4V0QA 1NBOA 1VBMA 2W6PA 3QX3A 2H1VA 4OXRA 1YNSA 4C0QC 4DSAA 1XCOA 2GPNA 3INYA 5ILQA 2OOKA 2FSSA 3NG1A 3GDHA 3TXAA 2IS2A 3AIIA 3PU6A 2BKEA 3PF8A 4MW6A 4YAGA 1UZLA 2LBPA 3T35A 4CLOA 1F0YA 1NJFA 2QRUA 4DV4B 4DMGA 1W5TA 8ABPA 3DS8A 3NXKA 3PF9A 4PSCA 3OFVA 3BD6A 1H8ED 1V96A 4RFLA 4ZVKA 1I2DA 2FSVC 4TV9F 1LF0A 4ICIA 1N1MA 5EWLA 1OXVA 2YIDA 4FKMA 1ZUNA 4DA6A 1YR7A 2DB3A 3QWIA 5FA8A 2RGYA 4F3TA 5BOSB 1OXBB 3TJRA 1Q95A 1TE2A 2Q21A 4ZAWA 2YY5A 2WDZA 4M7PA 4RPGA 2QDKA 4GD3Q 5D3ZA 1AE1A 1QGYA 4ZV4A 1VJ0A 4LNUA 3ZY4A 4HXFB 4F6RA 5BP7A 4DOMA 2YYZA 1XDGA 5ICFA 3KS9A 1PYDA 3BBLA 2O8DB 1FDTA 3R3VA 3NHAA 2LIVA 3L7CA 4PYKA 4C2AA 5C8DA 3G2PA 1ZIPA 2VYVD 3FD8A 2I6TA 3DBVO 3J7TA 4BZPA 4ZIRA 3K1JA 4G1UC 3NBFA 4RKEA 3ZZMA 4HNAB 5CLIA 2P9GA 2Z83A 1BMFD 1L9KA 2ZRDA 3HBFA 5HUHA 1ZM3A 2IGBA 3CLSD 4Y2PA 5FTJA 4OHZA 4N5NA 3TSYA 4XEHA 2IEAA 2Q3MA 4BPRA 1OUMA 1WD7A 3ZJ5A 1AIPA 4KWTA 3H11B 5AYVA 4X41A 4AS2A 1PSWA 1EDEA 1B42A 3ZE0B 4KN9S 3QU5A 1XNGA 1J42A 5CM2Z 2ZREA 2C20A 2R6R1 4JZKA 2I1LA 4PGHA 5F23A 3TNFA 5L40A 5KYNA 1B41A 3DZBA 1J8DA 5DMHA 3MCUA 4OHRA 4L02A 2P6OA 1G0NA 5L6LB 1ODKA 1QH8B 1VOTA 1GQ2A 4QXQA 3VOBA 3FNBA 2IUTA 5DYWA 3FSEA 3NC0C 2RK4A 3PA8A 5MF6A 3A3PA 2O06A 1RDFA 1P9NA 1HTBA 3GDOA 3RSFA 2IZOA 1SOAA 4YJ2F 5HIJA 4RVCA 5DIZA 3WDSA 3CR7A 1GCIA 4PFQA 1UP6A 1OR8A 4NAVA 5JALA 5JH7F 1XKLA 4QJIA 4TRRA 1E89A 1U8YA 2ZSHA 2PPLA 3MBOA 1XN4A 2A9QA 2WMYA 1JKIA 4XIFA 3DBRA 3IS3A 5FD8A 2X0DA 1MJFA 4MRPA 4FEAA 5LQSA 2XE6A 5SYMA 2PZ8A 2ZIGA 3ZWMA 3U09A 5DZSA 4H7PA 4MWCA 2Q3EA 3CX8A 3ZCXA 5KYYB 1NVEA 4KGDA 4EVIA 3MGBA 1HT0A 1V2HE 3PNQA 4WCFA 2HQ1A 3CRNA 1EVJA 3KYCA 4A1OA 1PR9A 1NNSA 3RIEA 3VH4A 1DIHA 2XXAA 1DBQA 1URPA 3Q6IA 5B4UA 3BJMA 2RHRA 4P7JA 1EAMA 5ADHA 3ZV5A 4X92A 2DP4E 2PZBA 2QPAA 2XNCA 5DNVA 1DBSA 5IYZF 3P5SA 3W2TA 5DE3A 1SR8A 4F3NA 4ZI7A 3GFFA 2V6FA 2DG2A 3E7PA 4PS0A 5A5GA 4TV8A 4F93B 3RS8A 5L3SB 4Z4CA 3E9MA 3EEQA 2FK8A 3U7HB 2V55B 4UM9B 3H2YA 3GNSA 3GUYA 2XZLA 1J2EA 1NIJA 1T9GR 2AR0A 4QPZA 1RWPA 2XUKA 3R7NA 1RTTA 1OTXA 3BH7A 4RVNA 2Q62A 2BD0A 3D0KA 2AZXA 1SZJG 4H1TA 1KMCA 2ZJYA 4EHJA 3L0ZA 1TA4A 3B6ZA 3GRAA 3KVYA 2VDOB 1UMCA 1OZGA 3L7MA 1VC2A 3U81A 4YFYA 4UTPA 1GZ5A 4B33A 3FUXA 1ML4A 2QV7A 3VV3A 1H93A 1TJNA 2D0IA 4QXRA 4WGFA 3V8PA 3EW9A 3VR0A 3EE6A 1RJEA 3L7AA 3P7MA 4BP8A 3HN2A 1HE2A 4N01A 2WC1A 3U5TA 4UBOA 3DQPA 4K46A 1NF8A 2AYXA 1RP7A 1YDMA 3ZX5A 4FJ1A 1KK1A 5CFZA 2IUSA 3AZQA 1EGHA 4G97A 4GMGA 2WBLC 3UJ7A 4Q4AB 2GVDC 1RJ9B 2RG1A 1WZEA 2G67A 1KYWA 3AUAA 4JHXA 4NPAA 3T1YB 5C1DA 1PR4A 1UT5A 2VJQA 5KOHB 3HM2A 5KQRA 3W5JA 5F4BA 2DY1A 2GK3A 5KNCD 5B58C 1JEYA 4CQMA 2FWMX 3REOA 2V7GA 2FPUA 3OEWA 2DOKA 3AY7A 3UAXA 2ZBRA 2OXTA 2NU9B 5JQWA 1DCKA 2YR0A 4V1CA 1LBHA 3RHSA 1MQAA 4CV2A 4JXXA 4YBRA 4MR7A 2PRZA 3RE1A 1UXIA 2JGDA 4IJUA 3VFDA 1N2EA 3FUCA 5KKAA 3IMEA 4FGZA 1E98A 3KOWA 1W5SA 4F9GA 4LOAA 3FTFA 2QU7A 3W1VA 4L7QA 3TVYA 4HH4A 5FPKA 4PGGA 5AI9A 1OW3B 2QSJA 121PA 2D5LA 1RMYA 4MRVA 1DZIA 3A32A 1RMTA 2P30A 3T9CA 1OZ0A 1O4VA 1CYEA 5EHQA 5IG2A 1ADCA 2GCPA 2Y27A 2VNIA 1GG5A 1SWVA 2HJVA 4P3KA 5K9ZA 3H0KA 1T8TA 2J1LA 1ZNZA 2VJOA 1XA3A 1SU4A 2GBFA 3GX1A 2LGJA 3Q87B 4GX0A 4L9SA 3HKBB 3WJAA 3TQQA 3KHSA 4A6XA 4BBAA 4BVGA 1CUWA 5J59A 3V6MA 4YP5A 3WQHA 4WX2B 3ZJYA 1NIPA 1QE0A 4Y9DA 3WQRA 1KP9A 3SFTA 1E61A 1LDNA 1R18A 1RWKA 1RWNA 2G28A 3PHLA 1ZNWA 4IEIA 4N54A 4PS1A 3WRYC 3E3NA 5LQUA 2P7IA 4EQ6A 5L4SA 1AM4D 3QOWA 2JBAB 2JD0A 4HN9A 1OX4A 2Q0XA 2X2EA 4OQMA 4XOIA 1NOJA 1R2QA 5EUMA 1FW8A 4X94A 4A23A 4AG3A 5BUSA 1UDWA 5AK5A 3K5WA 2Q0HA 4NZPA 2DUJA 3K9GA 3DV9A 4P32A 2HSJA 2V7VA 1NTOA 1PR0A 1Q21A 4PQFA 3PJRA 1CJKC 2G88A 5C2JB 2Z1NA 2PV7A 2WNSA 3P9IA 3PDUA 3IVCA 4AQ7A 5JU6A 4DJTA 1T5SA 3GY0A 3OU6A 4AUKA 2I34A 3C14C 1IVSA 3CVXA 4E14A 1U0SY 4I2VA 1U7WA 2A9OA 2PX2A 2WFZA 3MZ0A 3I83A 3TO5A 3JVVA 4TTSA 4B44A 5FLKA 2F1HA 2R47A 1GGVA 3FUTA 4BKMA 1KJZA 1LDGA 3F3MA 4XSHA 4DWOA 2W6QA 4Z1MD 3EG9B 2HLNA 4QO8A 5ECGC 4IDPA 1J90A 1F6BA 4D82A 1TYAE 4QGGA 4CMEC 4FCTA 4JVLA 5IYZB 1VE1A 3E7DA 4OQFA 4J0QA 4QXAA 2QJWA 4QWMA 1XUOA 4YIKA 3DE1X 4XQGA 4RPHA 3TZHA 2BGIA 2ZIUB 2EKDA 3AUFA 3DBLA 4FYHA 1YZKA 3GFRA 4UUOA 1EG2A 1Z28A 2YYSA 3FMIA 4O29A 4I9UA 3ETGA 3TKAA 1TUIA 4KPEC 4V0RA 4X1KB 3MM4A 2ZUEA 5FUYA 2F3SA 1XU4A 4ARBA 3QTBA 1KFEB 4JX9A 5FUMA 1P2DA 1HEYA 3HU2A 1HORA 1R88A 4EL0A 4MW2A 1H5QA 4KJZA 2PGJA 3UAYA 3ROKA 5KVAA 4ZK6A 4LVCA 1JKJB 1N2HA 1JLLB 1NATA 1P3DA 3KPYA 4NOMA 3TZLA 2C54A 1N9GB 4QFMA 3LQRA 4TRNA 3H6GA 3TFWA 3PHBE 4Y9UA 4WXHA 2FEAA 4OQPA 1C2TA 4DV3B 2NZUG 4L3WA 4NNOA 2NADA 1A9SA 2NM0A 4LOHA 3RV4A 1QP7A 4CU2A 4EPYA 3SZ3A 1QV6A 2GR9A 3UWMA 1A76A 2F8LA 2M1ZA 3S5JA 1E5TA 3LG2A 4ALMA 3PE4A 1G64A 1A82A 3FSGA 4YLGA 4FWTA 3QKWA 2VXBA 1H3NA 3EHDA 3PDCA 1EK1A 3R0VA 5CJ2A 1OVMA 1IQUA 1ZL0A 3PQ4A 3ILVA 3EY4A 3ZHQA 2YFKA 1MAVA 1Q1EA 2B2XA 3DDUA 4EJ0A 2VXYA 1G5IA 1QVRA 5DM1A 2WF8A 4FYJA 1TQ2A 4LY6A 1ZESA 2FOXA 1P2FA 1LJLA 2BLNA 1A4IA 1ND6A 3ITKA 2FMIA 2WKQA 5AI0A 4DREA 1TGVA 4JB2A 5E38A 1Z22A 4W8HA 3RKRA 4ZQHA 5C3UA 3RU3A 2XLBA 2B7BA 2LVBA 5CB6A 2C7GA 1P7YA 1IHUA 1OBCA 1GQOA 1CUCA 1ND5A 2AI2A 2VA9A 3D3KA 3HBMA 2QG9A 3NHBA 4MAAA 4WIAA 4UTNA 2WU4A 5J4VA 5IT0A 3GLIA 1TKBA 3GAFA 4GZ6A 3ABOB 3Q1LA 2NZ8A 5KDDA 1QC5A 4EI2A 1DBRA 1CZKA 4QGSA 5DN9A 1M5RA 2P9YA 1R0WA 4Q9IA 5ERYA 1NR7A 1TZMA 4HB2A 2CLMB 5JUWA 4B34A 2UUCB 2QW1A 2V4ZA 2Y0BA 4D1YA 5K2OA 3FUUA 2VT2A 1E60A 4GZLA 3T52A 4GI2A 2MOKA 3MCTA 4RL6A 4WZBB 2HF7A 3PGMA 4GKVA 1GKIA 2JHAA 3UYLA 2NQTA 2GD2A 5BUCA 4MJ3A 4B8WA 4F5EA 5HTKA 4HZUA 1DQNA 3R7WA 4ER3A 3PRKE 2VNJA 2ZK7A 3EGDA 2RGRA 1NVUQ 3A2NA 4CETA 3C5HA 3NANA 1YIOA 2K2QB 3NTOA 4AN0A 4NBNA 4FYVA 3AKDA 5DW3A 4YRGA 1I9CA 3MUFA 2ZWVA 7ABPA 1M73E 3W0LB 1I3OA 4GRDA 1C2YA 1IJFA 3R4CA 1OFVA 2QTMA 3BB3A 4QICA 3ZCRA 1GV1A 5FLEX 3Q3CA 2YWFA 5K03A 4RTLA 1O5IA 2ZZMA<