4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
2QRUA 1AGYA 2RHTA 2HA6A 3B5EA 4HRYA 4ROTA 1L7QA 1MAAA 3C70A 1ACLA 4PSCA 4K6HA 2JGFA 3I28A 3G0DA 4FLFA 3WIOA 3KOOA 2WG0A 1NU8A 4CG3A 2WHQA 3V1NA 4J0KA 4QE3A 4IH4A 1WOMA 3D0KA 3HRHA 3O0DA 4AN1A 2XMBA 4W1PA 1MNAA 4EY5A 4E11A 5T4BA 1QGED 5ALSA 4Y2UA 3FBWA 3BJMA 2DQYA 4BTLA 1AC5A 2BUCA 4LYEA 5A71A 4D9JA 1MO2A 3BWXA 1E66A 3STWA 4H18A 5FKJA 1CUGA 5JARA 5EIAA 3LS2A 4UBOA 2OG1A 3WWEA 2CMFA 5A2GA 3IULA 3NOXA 4BE4A 4BC0A 4K6GA 2ZSIA 4I4CA 1UOQA 1QJ4A 1YB6A 1LZKA 5SYNA 3O4GA 5AM5A 4CIBA 4E46A 2WFMA 3LLCA 4WCVA 2XLBA 4U2DA 5ALYA 2QKYA 4EA6A 1UKAA 4UHCA 4FNMA 1XRLA 2XUPA 1A8SA 3N0TA 1JU4A 2BKLA 1P0QA 1UKBA 4GW3A 5LZ9A 3Q0TA 1U65A 2XMDA 5JAHA 1M33A 5ALTA 2DCMA 2Y6VA 5AKEA 5E4YA 2X8BA 4GLBA 5AM2A 2D0DA 1ODCA 2XUJA 4QEKA 2HIHA 4B9AA 1E3QA 4CG2A 3RM3A 4GHWA 4QDXA 4Z49A 5AM3A 2B61A 4BZZA 4KJXA 2Y1KA 1LZLA 1Z68A 2AXEA 2V9ZA 1G42A 5EFZA 1BN6A 3QMVA 3WMRA 2Q0XA 5KBYA 4QWMA 5CT6A 5DTJA 3WKCA 5E4TA 4B83A 1ZD5A 2QZPA 2GYUA 5ALVA 3E3AA 3O4HA 4IH9A 3TEJA 4C4XA 4S0XA 1BCSA 1VA5A 1UOPA 4FBMA 3GFFA 4UBJA 4UFPA 4ZRDA 1L7AA 5J3JA 4FFVA 2ORYA 3DCNA 5DWDA 4A23A 1ODTC 3I1YA 2ECFA 2WTMA 3G0GA 4I19A 1J06A 2VA9A 1SCKA 1Y7IA 3F97A 3EQ9A 4AO7A 4YASA 4BE9A 3SK0A 3MVEA 2J3DA 2RI6A 4HXGA 4QZVA 5YASA 5FLKA 4BDTA 1VXRA 4UUQA 4PQEA 3C6YA 4Q3OA 1UT6A 5A7FA 4H77A 4UFOA 2WSLA 3H18A 4X94A 2AJBA 2CBGA 3QVMA 5AHXA 3E4DA 4BYMA 4G9EA 1QO9A 4DNPA 2XQFA 3STUA 4ZGBA 3PUIA 2J4CA 1ZICA 4H7HA 3WWCA 1IUOA 2P8SA 2VJBA 1F0PA 1CQZA 2ONCA 4H7FA 3KSRA 1B41A 3D59A 3R3XA 2GYVA 5AKIA 3FYUB 1ORWA 2OXEA 3WQHA 5ALFA 2HFKA 1IVYA 4J0JA 2XUQA 4DSAA 4KE9A 3RARA 4P9NA 5F4ZA 4PNZA 3SX4A 3R0VA 4OUKX 4Y7DA 3G0IA 5BOVA 3KD2A 5ALIA 2DSNA 2OPHA 1DU4A 2G5TA 3L1IA 4HS9A 4U2GA 3FYUA 5JAOA 3ANTA 3WKDA 4WDQA 1XRNA 2OAEA 3ZLUA 4W1RA 1QFMA 3WLAA 3EIOA 3FSGA 4K6KA 1IUPA 5FV4A 5I8PA 4JNCA 2H7YA 4H0CA 2VJDA 2WM2A 5LZ5A 4FLMA 1USWA 3H0CA 5E4JA 1P0PA 3IA2A 3STVA 2PX6A 4B0OA 3I6YA 1QIMA 1J2EA 1CEXA 1JFRA 3BIXA 2DHCA 3QPCA 3DLTA 4G4IA 3IUNA 3H2JA 5ALMA 3X3HA 1QIHA 4J0IA 5K3CA 4H7KA 1QZ3A 1C7IA 3WWOA 5ALXA 1ZJ5A 2RHWA 3FCXA 1TCBA 2PSEA 4AO6A 3V1LA 5IVKA 2HHAA 4EZIA 1CUJA 4GDMA 4YK7A 1R4ZA 2GBCA 2OCKA 4HXFB 4DNFA 2XUKA 3NGMA 3HABA 2WFLA 2VT7A 2G5PA 4OB8A 3AILA 4RPCA 3WL7A 5EIHA 3M82A 3QM1A 2WG2A 5AM0A 1CUIA 2WIKA 1YASA 2DHDA 3CXUA 4LYDA 4V2IA 4DNOA 2HA5A 2K2QB 5AKKA 4OYLA 2C5GA 5C7YA 3G9UA 2J4FA 1UK8A 1JKMA 4BAUA 2Y2VA 5LZ2A 1JI3A 4FMPA 2JGLA 2BFNA 5EHZA 2CUTA 4W9RA 5LZ4A 2J3QA 5LKAA 5BWCA 1CVLA 1QIEA 3AZQA 3QYJA 4MQMA 3GZJA 3AIMA 2WHPB 2ZSHA 5ALOA 3MUNA 3C6XA 2ZYHA 1U2EA 5DJ5A 2ZVDA 3H1BA 3I2GA 3DL4A 4G8BA 1CUEA 3I2FA 3DJYA 5HK8A 4B80A 2Z5GA 1EDDA 1VLQA 2RIPA 4JH0A 2WUEA 1A7UA 2ZYIA 4PV7A 1BRTA 2HADA 3WK8A 2BGRA 4HRXA 3FLAA 3FYUC 2WFZA 3B12A 2ZJFA 1J07A 5K3FA 3H2HA 1VZ2A 4X6XA 4X97A 5A7GA 3FAKA 2WU3A 1YA4A 5HFAA 1E8NA 4Y2XA 3WL6A 1GKKA 1MT3A 5A62A 5BV7A 2CZQA 3QZUA 1EDEA 3OURA 5DTIA 3G02A 3QH4A 4BVKA 3M81A 1MX1A 4X3CA 4A16A 3EF3A 1A8UA 1XKLA 4PO3X 1FFAA 2AJDA 5DNWA 1ODSA 2V96A 4Q3KA 5CXXA 2I3ZA 4PSDA 1YB7A 2WHPA 4B7ZA 4NS4A 4Y2VA 3S2ZA 4X71A 5JYCA 4XX1A 3IIIA 4AMZA 1I6WA 3UUFA 1P0MA 2GBGA 2OGSA 2Z3ZA 3F8SA 3AZOA 5ALEA 1LPOA 1CUWA 3STYA 5DYWA 4MWSA 4BAGA 4N8EA 4OB7A 1E5TA 1QOZA 1AQLA 4P08A 2C7BA 2W22A 1XRMA 2XUHA 1TK3A 1WB5A 2WIDA 5CT5A 1TKRA 4Y2TA 2XMRA 1L7RA 2OGZA 1CR6A 4DMFA 1QIJA 5FXMA 1XFDA 2JGKA 2B4KA 2LIPA 1XLUA 5DYYA 3PICA 1CFJA 1HQDA 2VAVA 3D4LA 5AOCA 5AOAA 5KWJA 2O7RA 1XLVA 1GKLA 4Y9SA 1LGYA 2OLEA 3JYHA 1N1MA 3FLEA 2YYSA 2JGMA 2WIJA 2OGTA 2XUDA 1HBJA 5EHQA 1AKNA 4IH1A 2ZYRA 4X91A 4TPKA 5HF9A 4OD0A 4EY8A 3D2BA 3VJKA 2WIFA 5ALHA 4Y2RA 4FKBA 4UBMA 2B20A 3BF7A 4KE8A 4J0GA 4O08A 1NX9A 3PUHA 2XUFA 1TAHA 4LXGA 5LYYA 1TIBA 5CH3A 4ZREA 1QIGA 3AJAA 4OSEA 2WTNA 5ALPA 4X6UA 1W76A 1UK9A 4GI1A 1EB9A 4G8CA 3WKAA 1CUZA 3ZI7A 2BGNA 1GPLA 3WJ2A 3ESBA 2VEOA 2CKMA 2FJ0A 5FDFA 4F5ZA 4J7AA 4P93A 1DT3A 4EB0A 2CEKA 2PPLA 4KAFA 1ZD2P 4ETWA 2PUHA 4MEBA 2QUBA 3R3UA 4KE7A 4HXEB 5D3KA 3CN9A 4DTCA 1ZD4A 4XIIA 5AK4A 1RWQA 4UBLA 4JEIA 2HA2A 2JGIA 5AKXA 3TGLA 1MPXA 4BZWA 3FOBA 5T4FA 1ZGCA 4EY6A 2AJLI 1W52X 3C43A 1CPYA 3GELA 5AI8A 1ORVA 3M3DA 1MTZA 1JU3A 3PF9A 2BUAA 2VJAA 3H19A 5ALGA 1W1IA 3C6BA 4U2EA 3K9BA 4WY8A 1XZBA 5AKZA 4CG1A 4G8DA 5K3DA 3ZPXA 1WPRA 2AJ8A 2Y2UA 5AO9A 4EBBA 5ALRA 3L1HA 4X6YA 1EK2A 4C4YA 1HKHA 1QLWA 4CCYB 2H7CA 1EB8A 4TGLA 5C81A 1XQWA 1E89A 1PJAA 3AZPA 4IQ4A 4BCBA 5K3EA 2WJ3A 2H7XA 5CRIA 1K4YA 2V98A 4M0EA 3EQ7A 3FLBA 4P92A 1X70A 1FFCA 2WU4A 4CFSA 4IHAA 3DQZA 2R11A 1LBSA 3IVMA 2GBFA 4NVRA 2OCLA 3QMWA 3VKFA 3C8DA 4BRSA 2Y6UA 3HLKA 4DGQA 4ZV7A 2PBLA 3QPAA 2PVSA 1QO7A 4X93A 5AI9A 2EDCA 3WA6A 3JWEA 4L9AA 3GBSA 3IUQA 3BJRA 1MJ5A 1EINA 1HLGA 2DFPA 1BROA 2OCGA 4E14A 3L1JA 2PSDA 1LPNA 3KWJA 5SYMA 1H2ZA 3QBJA 3W06A 2OCIA 2XT0A 1T2NA 2XI4A 3BDIA 3BXPA 5AKGA 4BRZA 5AI4A 1ISPA 2XQJA 1BS9A 4QLOA 1MU0A 5CH5A 5ALDA 3FVTA 3D7RA 4XWGA 5EGNA 2E3JA 4OCZA 5HF5A 1MN6A 3ESAA 5IVDA 4W1QA 4BB0A 1XZJA 4TVKA 3A6ZA 4KRXA 3ICVA 1DQYA 5T4HA 3RKSA 1WB6A 1EHYA 3G7NA 4RNCA 5JZBA 4DMHA 3FNBA 2PSHA 3HEAA 3V9AA 4G9GA 1EH5A 1VA4A 2BUBA 5AH0A 1YA8A 4UHEA 1VKHA 2XB6A 5IKXA 4B9EA 1VE6A 4Q34A 5AM1A 4CI9A 4E15A 2QT9A 3HZOA 4G4GA 4F60A 5AOBA 5AKJA 3C5WP 5FP0A 3RK4A 4J03A 1YSCA 3M83A 5DYTA 1EK1A 2XDWA 3IB3A 4WJLA 2VJCA 5FOQA 3CCBA 3KXPA 3W9UA 1QIDA 4Q05A 4FTWA 1O6GA 1ZIYA 5CBKA 3IBTA 4DNQA 1R1DA 4Y2JA 3PFBA 1ZD3A 4U2BA 3I1IA 5JD5A 1VE7A 5T4EA 1KEZA 3G8YA 4HVTA 4K5QA 3LIPA 1XQVA 2I78A 2GZRA 1FJ2A 1GPNA 4C87A 1XZAA 3TJMA 3VVLA 1DX4A 2YASA 4NMWA 5CURA 4UBNA 1C7JA 4MJ3A 4GECA 2X76A 4OB6A 5FRDA 1ZGBA 4UPDA 2RAUA 5LZ7A 2XUIA 1UKCA 5DNVA 4CCWA 4BVJA 1LLFA 4QWWA 1GT6A 2WHRA 5H3HA 1LPBB 1XZHA 3PF8A 4MYDA 5CT9A 5JASA 5JIBA 3AINA 1JJBA 3CCCA 3AUKA 1LPSA 1W75A 4QDTA 4KR0A 1GPKA 3F9CA 5HCUA 1LPMA 5JALA 2VATA 3DL7A 5AI6A 1NU6A 1R3DA 2WIGA 1Y7HA 2HDWA 1WHSA 2XE4A 2O2IA 1ETHA 2GYWA 2VSQA 1QONA 2Z8ZA 4ITVA 1UWCA 1D07A 1BEEA 5C8VA 3LCRA 3G0CA 4U2FA 1XROA 4F21A 4FDMA 4KACA 3WL5A 4MWTA 1R9NA 2O2GA 3GUUA 4X00A 1ACJA 3DKRA 4DLNA 4N5IX 3ZV7A 1EDBA 4CIAA 4AZ0A 2JEZA 4FBLA 1RP1A 4EY7A 2QS9A 2BAGA 5DNUA 5ESRA 1XRRA 3SWWA 4PSUA 5AKLA 3IURA 4BP9A 4JYPA 4BCCA 4ZI5A 1IZ8A 4OU5A 4WFJA 2WFLB 3ICWA 5AK6A 3PDCA 2IX9A 4C01A 6YASA 1A88A 5AJHA 2ZJ6A 4BTVA 3FWHA 5EHXA 4X95A 1XQYA 5JZSA 4KRYA 5ALLA 3H2GA 1E8DA 5ALQA 2C58A 3DNMA 3I2HA 4RE6A 3VJLA 1F6WA 4UHBA 3I2JA 4U2CA 4B6GA 3WZMA 3WL8A 1VOTA 1G4HA 3OOSA 3FSGD 4AQDA 5AKHA 1QIKA 1WPXA 4ZV9A 4UHDA 4UFNA 2HA7A 5FUMA 4JYMA 1N5RA 4DM7A 5JATA 1CRLA 5HF6A 1VZ3A 4Y2YA 4Y2PA 2XMCA 1QTRA 2WILA 4I3FA 3EQ8A 3A70A 2O2HA 2HFJA 5HK9A 1R9MA 1JJIA 4GBGA 1OILA 5AICA 2ZJ7A 3VXKA 1AMNA 2QTBA 1EI9A 4BBZA 3WK4A 3QPDA 1MX5A 5CW2A 1TCCA 4MEAA 5FPPA 1K63A 1F8UA 1XQXA 2OQVA 1JJFA 1DWPA 3OPMA 4L3WA 1JMKC 1OCEA 4YX9A 1EVQA 3HXKA 4J0HA 3F98A 1BU8A 3HJUA 5LIPA 1ZI8A 1WM1A 3DDUA 3H2KA 2XLCA 1CIJA 4ZXFA 2CB9A 1VXOA 1ZJ4A 5HF8A 3A2NA 1ZI9A 2EDAA 5KWIA 1B6GA 4X90A 4FWBA 3V48A 4X85A 5HQ3A 4BP8A 4QLAA 1C4XA 4QDOA 1HDEA 3FCYA 1MX9A 2QM0A 1BCRA 3DKKA 2HL6A 2XUOA 3C8HA 1JT2A 4L0CA 2C0PA 3WK6A 3O9MA 5JAUA 4A5SA 3D2CA 2BCEA 5A7HA 2HRQA 3W05A 3KDAA 2I03A 3DS8A 1G5FA 2VF2A 2XQIA 3PE6A 5D6OA 2XQGA 4PW0A 4B85A 5JADA 2ES4A 1XRPA 1H2XA 1QTIA 5ALNA 1UFOA 3FVRA 4JUIA 1CUSA 4FOLA 3W9BA 1SCQA 2V97A 3DOHA 2VAXA 1THGA 2XMQA 3VVMA 3H2IA 2QUAA 1SFRA 2R8BA 1GQRA 4RE5A 1XZMA 1DTEA 1J1IA 2XUGA 4Y2QA 1Y37A 5ISMA 3WK5A 1CUVA 1EVEA 2WKWA 1UOOA 1XZIA 2QJRA 2PSJA 2IITA 4DSZA 1DINA 4CCYA 3C5VA 3C87A 3QMMA 5K3FB 3ILSA 1XZGA 2QR5A 2VQ6A 1UZAA 1YR2A 4H35A 3PI6A 1U4NA 4WDRA 1CUBA 3BL8A 2OQIA 3IDAA 4DYHA 3WKEA 5HFNA 3C6ZA 5JAPA 1DQZA 1CV2A 4KEAA 2DQZA 3N2ZB 4OYYA 3ESDA 1AURA 3GROA 3UMJA 1CUCA 1YS2X 2HM7A 4Y2SA 4KE6A 3ESCA 1CUXA 3AIOA 1FFDA 5ALJA 3HACA 2HA4A 3H17A 5CT8A 1XZDA 1IZ7A 1LBTA 1XLWA 1G66A 4F0JA 4UHHA 3W2TA 3G9ZA 1WHTA 2JF0A 3AIKA 2DHEA 5LKRA 4B84A 5JD4A 1LPPA 2HA0A 4KYVA 1DX6A 1GGVA 4BCDA 3BE8A 4BAZA 4ARAA 4AZ3A 4UHFA 5AM4A 1TCAA 3VISA 1E8MA 3U0VA 1QFSA 3R3ZA 1CQWA 2HU8A 5D7BA 3HI4A 4BATA 4LXIA 2FUKA 4H7EA 2WG1A 4NZZA 1OXMA 4G5XA 4DIUA 2PKYX 2ACEA 4QDUA 4Q82A 1ZOIA 2GZSA 2X5XA 3JW8A 5CH8A 4Q3LA 1U8EA 1XZCA 3HC7A 2PL5A 3DYVA 4W63A 3NUZA 3A2MA 1CUFA 2PUJA 3WYNA 3WK7A 4LKOA 1WB4A 2PSFA 4AB1A 1QIIA 5K5EA 4H7DA 4H7JA 4N5HX 2HU5A 1X2BA 1YCDA 4LIPD 1GQSA 2FJPA 1UXOA 4GEGA 4GWLA 4OPMA 1AZWA 5FPQA 2YXPX 1TQHA 3ANSA 3CN7A 1T4MA 3U1TA 2WUFA 1SCIA 1Q0RA 1R88A 2OAGA 4G4JA 3DOIA 5E2IA 3I6MA 2CJPA 1KU6A 3R41A 4KAJA 2PU7A 4INZA 2GBIA 3OG9A 7YASA 3ZLTA 2RONA 4X7BA 3E1GA 2HU7A 4K2AA 1IUNA 3ZLVA 1H2YA 1CLEA 4GXNA 4H7IA 5EHNA 1YAJA 4EHBA 4AMYA 4AX4A 4MYSA 2VT6A 2ZYSA 3D2AA 3P2MA 5CMLA 4BC1A 1SC9A 3D5EA 3WWDA 1P0IA 3HYSA 2C5FA 2ROQA 2QXTA 1XZEA 2O7VA 1QE3A 3WK9A 2RGUA 4B0PA 2G4LA 4J0CA 5EIEA 3OM8A 5AKYA 1PV1A 2WQZA 4G1FA 2ACKA 2XUAA 5HQ3B 2VTVA 1UK6A 1Q83A 3ED1A 3WJ1A 5AK3A 1YAHA 1H2WA 3E0XA 5AI0A 4L72A 4ZWNA 4FNGA 4WFIA 3A2LA 1K5PA 2XMZA 5K3AA 1F0NA 1KU0A 3UUEA 3IUMA 1CUHA 3I6ZA 4WFKA 4XVCA 5JZ9A 2UZ0A 1XZKA 1FSSA 5LP1A 4LHEA 5HKBA 3FYTA 4J0DA 5EI5A 2PM8A 1MAHA 4QDZA 3RLIA 3WIBA 3WI7A 3R3YA 5AP9A 3SC2A 3W04A 1WCYA 1CUAA 5HZGA 4MXDA 3T52A 3DD5A 2G63A 2JEYA 2H9YA 4RGYA 3R40A 1TRHA 1GXSA 5CXUA 3LIIA 4N8SA 3VDXA 4C4ZA 1EX9A 3F67A 4HZGA 1K6EA 3V1MA 4BDSA 2PU5A 4LXHA 2XQKA 1CUUA 5ALZA 4DMCA 4EY4A 1Q84A 4B82A 5DLPA 3F96A 1VJ5A 5JD6A 3STXA 4M0MA 2FX5A 5C8XA 1N5MA 3STTA 4OU4A 1LPAB 2C4HA 4DMKA 5AIAA 4C89A 3AFIA 2D5LA 3G9XA 5LLSA 1PFQA 5I9IA 2YH2A 3WYDA 4QA9A 1H23A 3C45A 4YPVA 2QMQA 2W6CX 1BEZA 3O4JA 5ALUA 1JMYA 2JGEA 1N8SA 1K8QA 4PF1A 4J3JA 4C6HA 2EEPA 3R3WA 2QOEA 5ALKA 3BDVA 1FFBA 2WLSA 1DWQA 2JGJA 2WJ6A 1EXWA 3DYIA 1DT5A 2H1IA 4KAAA 3V1KA 2HRRA 5HKAA 1YS1X 3OC0A 4BVLA 3EBLA 4FFWA 1ZIXA 3B3QA 2QVBA 2NW6A 2JIDA 4HAIA 4X92A 5IH7A 2QJWA 2WJ4A 3G9TA 3LP5A 1MNQA 1FFEA 5LZ8A 4ARBA 3BIWA 3ZWQA 1CUYA 3WZLA 1Q0ZA 1GZ7A 5KREA 3O9VA 3MUOA 3WA7A 3Q8WA 4Q1VA 4UBIA 1HL7A 3NWOA 5AI5A 1AUOA 4EUSA 3DEAA 2Z3WA 1IMJA 4W1SA 2WUDA 1W6RA 1CUDA 4HTAA 5AK5A 3H1AA 3T4UA 3G0BA 5IVIA 3KWFA 5CT4A 1EA5A 1XZFA 5AIBA 3O95A 1XKTA 5IVHA 3MGAA 3TRDA 3D3NA 5A6VA 4AN0A 4N8DA 5I7UA 1UK7A 2C0QA 3I2IA 2HA3A 5ALWA 2B9VA 2IIVA 2XMGA 1ZI6A 1X2EA 3IUJA 4UBKA 2I3DA 1H22A 3YASA 2WUGA 5D3ZA 1W4LA 3BF8A 4WY5A 2DR0A 2JBWA 4B81A 4IO0A 4M0FA 1XZLA 3S8YA 4C88A 3WWPA 3I2KA 1BN7A 1A8QA 5JANA 2BJHA 3PFCA 1QIFA 1BE0A 4MQLA 4AXBA 5K3BA 4FHZA 1DWOA 1O6FA 3K6KA 5BWBA 1S8OA 2QXUA 4FLEA 5C8ZA 3HSSA 1SOMA 3K2IA 4XJVA 3H04A 4AO8A 1HPLA 3QITA 1RYYA 1AX9A 1LNSA 1XRQA 3VJMA 3OTQA 1R50A 2Z8XA 2XMSA 3GA7A 1THTA 3R3VA 4QNNA 5CTAA 3O4IA 3WKBA 2AJCA
chains in the Genus database with same CATH superfamily
1G2OA 2CHQA 5F5XA 5JS1A 3NOQA 2NQTA 2WSBA 4RZ2A 1NL3A 2ODBA 2VRBA 4DCGA 4ROTA 4ZVSA 4H3VA 1KSJA 3KTFA 5CDSA 3OCJA 3KCNA 3AVQA 4DV5B 1PYDA 1KVRA 4ZICA 4K9LA 1ND5A 1ACLA 4HAYA 1M0WA 2JGFA 3L6EA 5EGSA 4BKRA 4QM6A 4XPIA 1TO6A 3I28A 5DGIA 2QAGA 3IP1A 1KYTA 3GV0A 3M49A 3U3XA 2FW9A 1SUFA 3I30X 1CERA 4TT8A 1GDDA 2G9QA 4B4VA 3NC4A 1C0LA 4N3BA 4PHFA 3WIUA 2PZLA 4CG3A 1U0TA 1E0JA 2GYYA 5AJZA 3WBKA 3T1HB 2ZBUA 1T2EA 1E5VA 1RADA 1Z5UA 2B2NA 4IH4A 3ET4A 4QE3A 3HRHA 2EQ5A 1PE0A 1YHYA 4UHKA 1XEWY 4HGYA 3RV3A 5K0FA 4AURA 4UQPA 2A35A 1QGED 3PNPA 4IINA 1P9WA 4Y2UA 4V0MA 3FBWA 2QRLA 3BJMA 2HKIA 2O1SA 3TBHA 2UYCA 3DEIA 4X62B 1AC5A 1A3CA 1GAJA 2RJOA 4ZHQB 3ZHVA 2NYAA 4RFSA 5JCOC 2BUCA 1T24A 2H06A 2BFEA 2M9MA 4EP1A 4CKBA 4E14A 4D9JA 1AGRA 1DJQA 1MO2A 2BF4A 4HC4A 3W9SA 1SG6A 1TCUA 2W6OA 1VGVA 1NJSA 5DNEA 3N8KA 5H68A 5FKJA 3ROXA 3VPSA 1YGPA 4EPYA 4JP5A 2H2HA 1ONPA 2C7QA 3P2JA 4DAOA 4Y6QA 3SX0A 4Q6WA 3KKPA 4XDHA 4XYMA 3Q15C 2CMFA 2PHZA 1RHJA 3H5LA 5A2GA 2AA3A 5JPIA 2PH1A 2R7MA 3IULA 2BHLA 3REGA 2GPNA 3NOXA 1QO0A 1TMGE 4D9HA 3DAPA 5BSRA 3FAZA 4MQ5A 5BSGA 4YP6A 4Q00A 5E9JA 4DIKA 1DDOA 1FY2A 4Z1MD 1OGYA 2Y0BA 4Y9DA 1ULSA 5SYNA 1OFVA 3GGSA 1MTOA 4P86A 4RLSA 2J4DA 1B00A 1LV8A 4JU9A 4PGFA 3DT8A 4E46A 2OCYC 2RHGB 2ZK7A 3DHVA 1RLIA 4ZVOA 4F4CA 1XDSA 2ZBRA 3DLIA 3SQNA 2NPFA 2XLBA 4U2DA 1DAHA 1P4AA 2E87A 3D8HA 1AZTA 4NMXB 5T6BA 1QO0D 3MCWA 3THSA 4EA6A 1I4TD 3H5TA 1LQ2A 1Y1TA 3ADOA 3BMCA 4LGVA 3HFGA 1GL3A 3T0GA 1X7DA 4CR7A 1HF3A 1OZGA 4ZARA 2B9EA 2VK1A 4TKMA 5KOIA 2P3QA 3AKEA 1D03A 3A6PC 1MENA 4M1TA 4F56A 4X1KA 4FNMA 2CN1A 3DAHA 1DOHA 2VF4X 1CY7A 1EP9A 3QI2A 5HBGA 5AM2A 3EPHA 1U28C 1ID1A 4XQEA 3A4TA 5FYDA 4JIMA 4XDZA 821PA 3AOEA 3NHMA 2AIRA 2BKLA 1V1RA 1P0QA 1MD9A 2ZIEA 1UBUS 2BSQA 5DP2A 2FW0A 2G28A 5LZ9A 3NJ4A 4RANA 5LA6F 1EAMA 3VC3A 3DE4X 1SUSA 1H0HA 3MOIA 1R6XA 4TV9F 1DP4A 3MB5A 3ZY2A 4IGFA 2VPXA 5EPOA 2PNFA 1NLZA 3ONEA 3THRA 1JEYA 2G88A 3CUKA 1UAAA 4XUCA 5JAHA 5K09A 2Y6VA 2AW5A 3ROZA 5AKEA 1PQ4A 2D0PB 2QTCA 1WUKS 2YFKA 3TNDA 2YCBA 2A1IA 1WSDA 3DZ8A 4H27A 4QEKA 4AY5A 1EG7A 4F8JA 5HGJA 4DW8A 5JRDS 4ROSA 1N9ZA 1E3QA 4CG2A 5K0CA 1KO8A 2HHCA 4P6VF 4XYEA 2QVGA 5FJJA 2X7JA 4HX5A 4DQDA 4HWGA 4DARA 5K6RA 4ILEA 1G7TA 4ENTA 2RH8A 6ADHA 4BZZA 2GSDA 1YTUA 2QYOA 3I9NA 3MQ4A 1M0TA 4PZYA 1AMUA 4EW2A 4K0RA 2AXEA 2V9ZA 3FR8A 3L8HA 4NQZA 5F4BA 4YONB 4DA0A 3SC4A 4DS3A 5A03A 3PX2A 2XA1A 2F43A 3IVGA 4XKJA 5EFZA 4Z4CA 1KYWA 1R18A 2TYSB 4JP1A 5I9TA 2PUCA 3DPSA 4ZCLA 4MCJA 1D1TA 1NPYA 4ZALA 4R7ZA 1RWXA 1WPQA 2Q0XA 3P0EA 3WGJA 5DTJA 3DMDA 4EHIA 4ZVLA 1E2FA 3BMNB 2Y68A 3KEGA 3CNBA 2VPPA 1B8UA 1YE3A 3ZXYA 3FCEA 2CVZA 4U7TB 3R5SA 3TSYA 1PLLA 3H0KA 3QOFA 4C0SA 1FTQA 1DEHA 2XV1A 2W8BB 1NBAA 4G41A 1OR8A 3KR2A 2Z30A 4F5WA 2AYXA 1ADGA 4BKPA 4C4XA 3GEMA 4GPBA 3OKCA 4REOA 5D87A 1BZYA 2RHBA 4S0XA 3W5AA 5F2OA 1AD2A 5DZSA 3NDRA 1Q22A 2IYXA 4CIYA 1F20A 4JLAA 3WFZA 1VA5A 1G20B 1TUBA 2PX8A 1UOPA 3MNFA 1L2TA 2BI4A 3IOBA 4JXZA 2PKQO 3T54A 1NBME 4OJYA 3D3EA 3E53A 4UBJA 1GCOA 4R8VA 3MTBA 4XQ9A 1FPQA 3UVEA 3ZXSA 1CY8A 5K7SA 3QFSA 1Y80A 3UNXA 5DX8A 4DV3B 2EZ9A 3OFSA 4HTFB 3VBEA 4E12A 3KEOA 2VQFB 5JY1A 3PVSA 4XAQA 2PGIA 1Q6YA 4OVKA 5ALNA 4K81B 5AHKA 2WD7A 1RQGA 3TMYA 3PXEA 3QBTA 2EX0A 5CG1A 1FFSA 1ODTC 4QARA 4QXOA 1R0CA 4HZUA 5D84A 4AFNA 2ECFA 3UJ6A 4AJ4A 3O74A 2HK7A 3DW3X 3FKQA 3FZYA 4IWXA 5JZVA 3SC3A 4S2EA 1I6LA 4Z4QA 4UEWA 1Y7IA 4TMXA 1T2FA 4YS6A 1OLUB 3CVJA 2NX2A 5B6IA 5JV5A 1FOEB 1BU5A 3HY4A 1J0CA 4YASA 4OQLA 1C2TA 2REXB 4BXOA 2RI6A 3EPJA 4LDPA 3OIFA 4HXGA 4KQHA 3P9ZA 1VMEA 5CCDA 3UAVA 3F71A 3RG8A 4RMIA 4J29A 2EATA 2NSYA 2XB9A 3C6YA 5H8WA 1E3JA 4UFOA 1VPEA 3BHMA 4ZCPA 1ZMTA 4EY3A 2AJBA 2BHSA 2YY6A 1Q21A 3QVMA 1CZRA 1SU4A 2JJ2A 5AHXA 4FOOA 4C5BA 4BNZA 1QO9A 2WB2A 1YCGA 1SQ0A 1YA6A 1FMFA 4CU5A 2PK3A 5HP4A 3PUIA 2J4CA 1Y34E 1BQ4A 2JCGA 3QQ5A 3U62A 3CZCA 3V55A 1MA3A 1GDHA 1W47A 3CRRA 3GLIA 1J4AA 4OHWA 1OZFA 4NFYA 1P2DA 4AZVA 4RPHA 3D6AA 1ZA2A 1V8OA 3A1CA 4LXUA 4G1VA 1VHTA 1YZHA 2ONCA 5C4GB 3P8ZA 5L3SA 5E2BA 1NUAA 4Z51A 3KJNA 1NVVR 3AL2A 3FHJA 3IMCA 4PFJA 4M0CA 2X0EA 3D59A 2CYBA 1P17A 3OX4A 1HEYA 1GN8A 4TS1A 1CXZA 5ER6A 1PTJC 4DKJA 3B1KA 4WD3A 5AKIA 1FW8A 2ZVQX 2AG0A 5JS2A 5BRJA 1NUUA 1CF2O 5CW1A 3WQHA 3R4CA 4TQAA 4HPWA 3FX2A 3ZWYA 1SBTA 1M72A 4CT5A 3NATA 5FR2A 1ZKMA 2XWQA 4M0PA 4BNWA 2X0JA 3NHYA 1Y9AA 3QW4B 2C29D 1IVYA 2XVMA 3QELB 5EIOA 5BSWA 4GSKA 5FO1A 1ENPA 2ZJ5A 4UMEA 4AMVA 5I3CA 4J0JA 1M5TA 1GU1A 1JKJA 3GX1A 4DSAA 3QXGA 3S2IA 4KG7A 1QGZA 1JIQA 1WUYA 2IPOA 3ADKA 3BGOS 3JATA 3ZCUA 2FMTA 3CHYA 5DCLA 2D1RA 3FFXA 4OGKA 4FW9A 4CMIB 2OFFA 1ZCBA 4PNZA 4TKVB 1PDOA 1PT5A 1IOWA 1JG7A 3DVLA 3SX4A 1Z0UA 2WMOB 5BT9A 1AV6A 4CDRA 1IU9A 1U2TA 1REQA 2Y76A 4RFLA 4LCJA 4ABYA 3H8VA 1GIAA 1Q50A 4RDIA 3KQQA 4Q7EA 1DU4A 2REBA 4GFDA 4X5OA 3TS1A 3JPWA 1KKLA 3EZ6A 1UM8A 3VA7A 5FOSA 3AHCA 5F64A 4B6QA 4ME6A 1U4OA 1VJDA 4L4YA 3ZWWA 1WJGA 3BHIA 1OFIA 3T5GA 5A0TA 2R68A 1FRNA 4RIIA 3DE1X 4CG0A 3B8HA 4MVWA 1DAGA 4B4OA 3R6GA 1K8YB 4M38A 4BUCA 5DEOA 1XNGA 2GAIA 1K86A 1EJ0A 4WKGA 3SYKA 4WX2B 5DIZA 1UM9A 3I9OA 5F77A 4K6KA 2J6CA 3LW7A 1IUPA 3ABRB 4YJFB 4X84A 5JH7A 1JFFB 3O31A 4C30A 3PGMA 2ZIWB 5AHWA 5THKA 1B7GO 3VZQA 1EFDN 4HKTA 2H7YA 2Y66A 2G9VA 2VJDA 5F7ZA 3EY4A 2IY8A 3ILHA 2QENA 4H7PA 1MCZA 4G56A 4NULA 1TA9A 3SHFA 2R25B 2ZTVA 4N1AA 3CVUA 4QPZA 3HJNA 3KKNA 3OQBA 2AHRA 3CH6A 3RUFA 4UJ3A 2WWWA 3TXXA 1H8HD 5EIBD 3PT5A 3HCAA 1ZUD1 3F3KA 5IX8A 2PZMA 5LXTB 1ECFA 2GBLA 4BY9E 1LBEA 3LYHA 2C0CA 1QVWA 1JFRA 4IJ6A 4GQAA 5K99A 3DLTA 1T5LA 2V54A 4G4IA 1LSSA 2AFIE 4X8HA 2ZIXA 3OJXA 4PIPA 2QY6A 2R5FA 5JSFA 5K3CA 3EASA 2Y4NA 3L6OO 3IQZA 1DTWB 2A1TR 2PGAA 3M4NA 4H7KA 2Q1YA 2O8CB 1QZ3A 1L4EA 2P1ZA 1FQJA 1GR1A 1T4GA 2DHQA 1LSOA 2UV8A 1MH9A 4U00A 3W90A 3IB6A 4DMLA 5KC8A 2QVYX 2XHZA 1G8PA 4N0QA 1JKFA 1G3UA 1VI6A 3R4VA 2PGJA 3W6ZA 5JZMA 4MUKA 3QLVA 3UPTA 2O8VA 1F2UB 2EKLA 2ET6A 4I55A 5IVKA 5C51B 1WCIB 4GDMA 1GXSB 1DBVO 1V6CA 2HPAA 3PHBE 3B2QA 2GEDA 5JSYA 1LLUA 4H6PA 5B3JC 4JOQA 2CUZA 3UTCA 2ASVA 2OCKA 2Q7OE 3BC1A 3H7AA 1ABEA 1VPDA 4UUAA 3NNDA 2A59A 4FHDA 4W4TA 1DG1G 4ZZ1A 2GPJA 3TQSA 5B53A 2HO5A 1CY2A 3VH2A 1GKYA 1FS4A 2HPVA 2IPLA 5CYOA 4ZAXA 1XCGB 3HL4A 1UIRA 1MFPA 4V0KA 2DKOA 3DDHA 3DE3X 4GBED 1QQTA 2FVXA 3H9QA 1XVAA 2JFZA 3HMQA 1IULA 1JA1A 2WFLA 2VQ3A 3HJGA 5BW5A 3IP8A 5GWXA 4TTSA 2RB4A 5HIIA 1FSFA 4PTZA 1EE2A 1YQDA 5EMMA 4DR3B 3EF1A 2OKGA 4WESA 1Y8QB 1F6DA 3FCSB 2QZ4A 2VH1A 4PYKA 1RYHA 1OF1A 3WL7A 4FGKA 1MT0A 3N2KB 3QM1A 4QUIA 3GGPA 1KDZA 3IPXA 2WG2A 2HNKA 2D54A 2OY0A 2P4EA 3GU3A 3LLSA 3RS7A 4TM7A 4BQPA 4ZZ3A 1SUAA 4X44A 3V1YA 1V3VA 2JH8A 3SIRA 5EP4A 5CB0A 1LQUA 4INJA 1YFJA 4R8LA 1CZNA 1ZN9A 4EG5A 3V4SA 4QDKA 4MNTA 2HA5A 2SKDA 5AKKA 2X5OA 3PBKA 3R6TA 4N3NA 2C5GA 4TV9A 5ADWA 1CEYA 4QYMA 3BQMB 1E1QA 2FQWA 1KHTA 1UK8A 4G0PA 4EJFA 4EKDA 2DYKA 3RIMA 2E4UA 3ID6C 4W8GA 2FW1A 3TZ6A 3W2EA 4TXLA 3OZAA 3N7AA 2HT1A 4DVGA 2CCJA 5EHZA 5IK2D 2HCRA 2CUTA 4RSGA 5DB4A 5LOVF 3B6JA 5LZ4A 2J3QA 1NJGA 3CNLA 2O7QA 2WQ7A 1HSZA 1M8PA 1VIVA 1TW2A 3NC0C 3HBNA 3CH7A 1N9GB 4G65A 1VC2A 1W0CA 3DLAA 5MGNA 1X7XA 3AZQA 3IVAA 4DCTA 1OLUA 1WXIA 1YJ5A 3OU2A 1ZH2A 1JHZA 1Z26A 4Y2HA 4AW9A 4RZQA 1AK1A 2IYRA 2PZKA 2R2AA 1W0JD 2WAMA 1JTEA 3RRBA 4ECEA 2X3UA 4D8VA 2A4KA 3DSRA 3P2YA 3E48A 4MP6A 4NYIR 1EYZA 3VDMA 4KH1A 3RWMB 3LJKA 1JDBC 4U39A 1VJTA 1QHIA 3AI7A 5HHTA 5ALOA 4HEQA 2G9RA 1GUBA 2PWYA 2V4MA 3BT7A 1U7XA 2VP2A 2WFAA 1NAHA 3NV9A 2PPVA 3JYQA 3LY7A 3UHOA 1P8AA 2YNMD 3T5DA 3DL4A 1BH6A 3SY8A 2KLHA 3JTMA 4GRAA 4BQNA 3O26A 3WTCA 1GG2A 1HLPA 1YJAA 3IGFA 3MINB 4D6PA 3GQBA 3EUFA 2Z9DA 2ZJBA 1TF2A 1DADA 1JLMA 3MMPA 4D9BA 4DRYA 1VLQA 4F5DA 3KQWA 4RJJA 1IPEA 1W59A 3KVNA 2RIPA 3AQIA 3BGIA 3DDCA 3EA4A 1E59A 3VSBA 2WUEA 3NBUA 1BX3A 1A7UA 2X15A 1RM0A 2PS3A 1F6BA 2ZYIA 5F9MA 2OCXA 3AERA 4C14A 4PV7A 4F9GA 4Q48A 1G16A 1DPFA 1ORIA 2BSXA 3ZVRA 5LPNA 4KPUB 2QGFA 4OKNA 5M5BA 2CXPA 2VXYA 1EGVB 3M6WA 1XJCA 3G8CA 3NH6A 4NYMR 3CRNA 3F7TA 4UDXX 5GM1A 3WFIA 2XYHA 621PA 3GXBA 5F2KA 2V5UA 3ZBTA 2WYHA 4BNVA 3UXHA 3OX3A 3NVDA 4CVNA 4JKOA 3CR7A 4R69A 4GD3Q 1RQPA 4IDDA 4ZQBA 1V5EA 5J4HA 1OT3A 4NYJQ 5KAPA 2ZT7A 1Q1QA 1QYRA 3FRJA 3RTGA 3BXOA 3WLIA 2YYZA 5BRAA 4Y2XA 3TWOA 3WL6A 1GKKA 1Z45A 4GMFA 1U90A 5A62A 1CR4A 4EGJA 3FIUA 1M54A 1MB9A 1XP8A 3QZUA 3VHLB 3SVLA 4EX6A 4YCSA 2JC3A 2R9VA 4MK4A 2GBLC 3FTCA 2SICE 4CM3A 4MDFA 2UXCB 2CXHA 2K5UA 3CG0A 2FN8A 1IQUA 1S5PA 1QHSA 4MO2A 5A5GA 2GPYA 1X8LA 4W82A 1T10A 2JI8A 4MRMB 1W0KA 2OXFA 4JSYA 1SKYB 1YJCA 4CHTA 2YW9A 4QRHA 5G4KB 5ED0A 4DLRA 2AFVA 2SKCA 2GHQA 3GJZA 3UEOA 2VCEA 1Z75A 1L8QA 3IJRA 1XKLA 3O73A 1I7LA 3UHFA 1DKLA 2JFNA 2FUCA 2FW6A 2QG9A 3IAAA 4XFJA 4JC8A 3IBGA 5HR5A 2I3ZA 4CZ2A 1E58A 1P2TA 4NS4A 2OA0A 1Q0HA 3GLSA 5HDQA 2V7UA 3BMQA 2X14A 5FADA 3QLUC 5BXYA 2TMYA 3S2ZA 3UGJA 1PJ2A 4RD4A 4X1IA 4LZZA 2I2CA 4AUKA 1JB1A 1SJ9A 4LE0A 2NO4A 4AMZA 1I6WA 4JDPA 3ZDFA 1JH8A 1F3LA 3UUFA 1SVLA 1YONA 4TL8A 5EWMA 3SJZA 4URXR 4HGQA 1WUTA 1N2CE 2RBGA 4GZ5A 3WG9A 2GBGA 2PUGA 4MI1A 3I04M 3MBOA 3F8SA 3ZW8A 4Y9UA 4KQEA 2XNKA 5AWFC 2V7EA 3RF7A 1XRJA 4Z4GA 3STYA 3HKEB 4EM6A 1O2DA 4MB2A 5H16A 5GINE 3MS7A 3I64A 1QWOA 3UG6A 1C9YA 2QJTA 2XWPA 3SNHA 1COZA 4C0LA 1Q7EA 5KOHB 4Q5IA 3URKA 3RTEA 3RI3A 1ZIPA 4GL4A 1N36B 1C8VB 3E03A 2XDYA 3R2JA 2Q5IA 4OB7A 1ZH0A 5E6RB 4BAGA 4EPTA 1HT3A 4DE5A 3QYPA 4EMSA 1VBMA 2DCUA 2OFWA 4MQEA 2IPMA 3BB3A 4IXDA 5JNVA 3SVZA 3IKJA 4UAUA 4C3VA 1R6DA 4KTTE 3FHCB 3KIPA 4ZT7A 3UCEA 4EDHA 4PYLA 5KEIA 2QU8A 4L8GA 2ZP1A 2ALJA 4BWYA 1XRMA 5CX1B 2XUHA 4IS3A 4YGYA 5CDHA 5KC9A 5EKTA 3JX9A 1XTUA 4B3TB 3SN6A 1ICIA 1CJSA 5CB4B 2YR0A 4DL9A 1XPJA 3NM5A 4Y2TA 5DGCA 3VYVA 4I1OA 3A3KA 4V0OA 7ABPA 1K0UA 3HLYA 2C03A 5EWJA 1CR6A 2OE2A 3IDZA 2B4QA 3B6EA 4M1MA 1XFDA 2FWJA 5FXMA 3HXTA 1IBLB 2JGKA 1W8IA 1N5LA 3FETA 3FMGA 3UT6A 1OH5A 1OIWA 5LQUA 4I9HA 5A0FA 2J9XB 3TQFA 2PYDA 4ZJUA 4AQYB 1DC4A 2FFBA 4GZ3A 3D1LA 4I6GA 2VAVA 3D4LA 3HUFA 3ITDA 1OE0A 2GAJA 5IUKC 1ZUWA 4FI3C 4RQBA 2ZBPA 3EDOA 1BKYA 3T12A 1Z4JA 1ZM7A 4PE5B 1UMDA 5F3DA 1OTXA 1I1HA 4NPCA 3R7DA 3SE7A 5IJAA 4W9NC 4Y9SA 2Z4RA 5DO9A 3L0BA 4DIDA 1IDN1 2DJ5A 3JYHA 1JLHA 1DUIA 3FLEA 3HS3A 3T1YB 2QTAA 2Q2OA 1XGKA 1Z2PX 2OGTA 3F6YA 2VP3A 4N5DA 3LLVA 4IH1A 5G1PA 3O8DA 2FRVA 1AKYA 1BS2A 1GGKA 2O1EA 2QRQA 4KO1S 2BTOA 2G7MC 2A3RA 3AW9A 4MKRA 5HF9A 3D2BA 3ZVLA 3VJKA 4AYWA 3FDZA 1ESEA 1IN8A 5BOSB 1MX3A 2A9FA 2MSEB 1LVGA 1B15A 1T0HB 3RABA 3B6IA 5JSKA 1ZHHA 3T3OA 3MFYA 3MTDA 1OW3B 1A9PA 3AV0B 1NF3A 1EEHA 1JR4A 2XDQA 1CLUA 4E5DA 1CJTC 1TAHA 3PHLA 2ONZA 1Y3FE 3MCVA 5IF9A 1ZOSA 5CH3A 2B7BA 4ZREA 3AJ8A 1QIGA 1M1ZA 2DPMA 2FE4A 2WTNA 2VS1A 4JCOA 1W4RA 2COEA 2QTVA 3EJWA 4A3SA 1UK9A 4F4IA 1EUYA 2OORA 1L8OA 2FUNB 1TM2A 5DHQA 3TE7A 5KJCA 2UYHA 5AW6A 2QPOA 3SZUA 2BM1A 3W6PA 1CUZA 5L40A 3EWSA 1YQGA 5F5LA 3P71T 1P3Y1 3R0IA 1VJ0A 3ABSB 3BKXA 3PC7A 3ZI4A 4BUJA 3DMTA 2WF9A 3EVAA 3TLXA 1BH2A 2D8MA 3B9BA 1E7SA 1I2DA 5EQFA 2LVBA 4KJZA 1RKUA 4W5JA 5DHRA 5EIFA 2QI9C 4POAA 2G1PA 4EB0A 2AK3A 1BTOA 3ZE2B 1KYQA 3OCYA 4UEKA 2PPLA 3INNA 2QORA 1EFRD 4KAFA 4RSHA 2PWBA 3GQBB 1RYFA 1ZD2P 4ETWA 2PUHA 5F9HA 4MEBA 4KE7A 5DP1A 4QU0A 2YRWA 2NN3C 4DIOA 4EJ6A 2D5AA 5JNTA 3TAUA 1QRAA 3HU5A 4OA5A 1ITZA 1IAQA 3W8NA 4QUDA 1DCFA 1R27A 3I9V1 2FSIA 1P5HA 2H2IA 3PS9A 5IH3A 1IOZA 4D97A 1TIPA 3KQNA 1QZZA 2XRYA 1VTKA 2EBFX 3IV7A 4KITB 4OQYA 3KWMA 2P41A 4IYRA 5JI2E 1N6PA 1OWNA 4Z54A 2ZAYA 4BX0A 4CTOA 1DQPA 2HRDA 5FAKA 2JGIA 2WU0A 2O3UA 1Z4LA 1OXVA 1USIA 3OECA 5AKXA 4D41A 1RWPA 4HPJB 3TGLA 2MYPA 2I1QA 4X7RA 4PSKA 5A1JA 1NR5A 2W58A 3EOZA 5KTRA 3E82A 1UF9A 1OFTA 4IXMA 5BW6B 3Q9UA 4DMRA 1XNQB 1CPYA 1IAVA 4QICA 3OLXA 1RXSA 1PL8A 4ZAGA 2EBWA 1PQYA 3JVIA 4DC0A 4GOKA 1YGYA 5F1YA 3Q1KA 2N46A 1G38A 4JELA 5AQ1A 1MTZA 5D3QA 2DFVA 1TADA 2JJMA 1Y89A 3PL1A 2VJAA 1ECBA 3EW7A 3H19A 3L0DA 5LQCA 1XO1A 1XZ8A 1S1CA 4O1HA 1W1IA 3C6BA 4UUBA 4Q9DA 2EP8A 4M49A 4WY8A 2O1XA 1OH7A 1O6BA 3SHWA 1ZUNA 4ZOCA 5D1NA 4NJEA 4RD6A 5TMPA 1GM5A 1W36C 2DPGA 2PE5A 1NYTA 2J7PD 3TBKA 2HUNA 2J3IA 2XAAA 2QYSA 3RGWS 5K3DA 1DQNA 3VC7A 4NG4A 2HJ9A 3KKLA 4QATA 3LGSA 4NBUA 3NTXA 5F35A 3TVDA 5FWYA 1WV1A 3QKSA 4JOBA 4DGSA 5M34A 1M6EX 1KK1A 3WXMA 1GZUA 1F2UA 5ALRA 3L1HA 4YAWA 1IBMB 3I32A 1WCIA 3AEKA 2V6BA 1X87A 1Z6GA 4C4YA 2ZATA 1QLWA 1E6LA 3BMQB 4RSRA 4WJKB 1PWEA 4J4HA 4CCYB 1JECA 1I14A 3PKZA 4QOHA 4RCVA 4DC1A 4F4DA 2PQMA 2YUTA 4D25A 2OZLB 4MUJA 3WWZA 1DKUA 5K8LA 4ER5A 1KAQA 3PQ2A 1P8JA 2AFIB 3F4KA 4B3GA 1NBEA 3PLNA 1N6KA 1G6HA 1X7YB 3GEBA 4PHGA 4WPGA 4CQLB 1QRSA 3ZDBA 1IIBA 1Z2AA 3F0TA 1D4AA 5AW9A 4EFDA 4O4LA 1D8TA 1FVHA 5DK6A 5D8DA 2X8WA 3EQ7A 4FIZA 3WVNA 4EAAA 5H59A 2AEFA 1X70A 3CB4A 1LF5A 3B6MA 1DEOA 2FSHA 3NDJA 4OAOA 3W5SA 4PZZA 1OV6A 1KI1A 5IN5A 4GE3A 2CL6X 4TMVA 2VAPA 1Z8HA 2D2VA 1JAHA 2XY4A 2GBFA 1G60A 2RJNA 3BK1A 3K09A 3WRWA 4QBKA 4FD3A 1Y1PA 4GKBA 1ZZGA 2ZRAA 3RUEA 1KNXA 3VKFA 5LXTF 4ZHQA 2ZIZA 1X3SA 3JWJA 4IUDS 1KBOA 3RFCA 1CIPA 3LD9A 2X7XA 4ZOAA 3WLPA 3U6KA 4MV7A 4MLPA 4ZV7A 5KYWB 4A2QA 2HXSA 2PBLA 2A14A 5J5VA 4GVLA 4CLDA 1QO7A 3M1YA 2EDCA 1IOLA 4CN8A 3A04A 4EK9A 4URWR 5JVDB 1JDPA 2X9GA 1UC5B 4LA4A 3IKVA 5K03A 3BJRA 1EINA 1BROA 3GY0A 5IJWA 3V4LA 1CX9B 3LP8A 4D46A 1B26A 1BFDA 1OWLA 1FDOA 2PSDA 2X9NA 3L1JA 4DDKA 2O8CA 4A0RA 3KWJA 3H13A 1AQIA 1JG6A 3I53A 3O8LA 3BL6A 4U63A 2J09A 1L5OA 3W06A 2LNDA 2OCIA 2WM9B 4FC6A 4OV6B 3H5OA 1T2NA 3NHJA 1K66A 1WRBA 2OZLA 3BDIA 3R5KA 4ZAVA 4EL5A 5AKGA 1L5GB 5EL0A 1TRKA 2GJAA 3KKOA 2GK7A 3NDIA 2NZYA 4IF6A 5EKUA 1IQRA 4LWOA 4CDGA 2P3LA 4IXTA 2Q4DA 3DHYA 4AJNA 3I9JA 1XHFA 3K92A 1CDOA 1UBGA 5CH5A 1GNQA 3IVXA 1L7OA 3F4LA 3FVTA 1FUKA 5EKDA 5TT0A 1N75A 4FWIB 1T6YA 3D7RA 4XWGA 4ZRNA 1IWBB 1P75A 1X74A 2QNIA 3ZJTA 3U3JA 3IBCA 4DIFA 1RE1A 1FXUA 2BBSA 1OWMA 2IXBA 1QB7A 5KI6A 5J2UA 3ESAA 5IVDA 3IP9A 3HJBA 4KWIA 4W1QA 5DH9A 5KSZA 4M9ZA 5EFOA 5GIPE 2I1VB 2QTNA 3T7CA 3W1VA 1TUBB 2ZB2A 1WXQA 3HGQA 4EFKA 3U16A 5KQPA 1SBCA 3TIXB 4ZMSA 4GRIA 1PGNA 3WLSA 4LMRA 2QRJA 1QS0B 1Z37A 3ICVA 3UC9A 1RZRA 5ERGB 3RKSA 4QQKA 2XVZA 3DBRB 3AR8A 3FE2A 4EHJA 3NVKI 3CX6A 3X2FA 1EHYA 1QC5B 3DAFA 2QRMA 1T15A 2YICA 1P31A 2QA5A 1GYPA 3D4PA 5TE9A 3L01A 1I3MA 2H6EA 3F6SA 2VR1A 3E23A 3LO5A 4QPJC 5G41A 3TIFA 4QVIA 1U0OC 2V1UA 1WR8A 1Y1RA 2J48A 2QX4A 2GAFA 5DM4A 5JSZB 2PSHA 4FEEA 4XPZA 3V9AA 4G9GA 1KMIY 1L5KA 4KV9A 5JISA 1VA4A 4KIWA 2H1FA 3KRTA 4QTZA 3AF3A 4AK9A 5BMVF 4LMBA 4Z5XA 1M34B 1N9KA 3HDYA 1YA8A 3TEMA 2ZS9A 2ZB8A 1NQ5A 5IKXA 2DTDA 4B9EA 1X7HA 2Q46A 1H69A 4BEWA 2GPBA 4Q34A 4Q0MA 2BM9A 1Y33E 4QSHA 3SYLA 1ESDA 3SK0A 4EVIA 1Y8ZA 1PTKA 5AOBA 4I3GA 4ALKA 5H1YA 5CK4A 4J03A 3TTWA 3IEKA 1VPLA 1IG0A 4IIVA 3K2EA 2XDWA 4ZYXA 1J5EB 4JI7B 1N92A 2GCGA 2GR9A 3IB3A 4CMKA 5FOQA 2H3HA 1T3LA 4ZYUA 2OB2A 5BR4A 4NJMB 2Z95A 3KBOA 3L6RA 1Z0KA 2IEYA 3H97A 3PXXA 1R5JA 2CLFB 3LHDA 4IIJF 4R9VA 2B0CA 3Q7EA 4FTWA 1O6GA 1YOBA 1XJ5A 1FU8A 3DOOA 4A03A 4MVJA 3HN6A 4EKNB 5JJ5A 5T41A 2CJYA 2PEYA 1R1DA 1MQ9A 1K06A 3U19A 2VEDA 2FR8A 4B2LA 5DXJA 5FBZA 5EKXA 3UCFA 4ERXA 1JEQA 1XVVA 2DRIA 3I1IA 1NVDA 1LD3A 4ZI7B 1BVHA 2QR2A 1P9OA 3VR1A 4P0QB 2P62A 2BBOA 5T4EA 3MLBA 4F4HA 4LZPA 3KC2A 2VHYA 3ZQUA 4C0KA 4DCCA 4K5QA 3UMMA 3UMYA 1SELA 3PGXA 2AMVA 3CURA 1UPFA 1X92A 4G1MB 4C0JA 1FJ2A 1EK6A 3HKDA 4PANA 4EI8A 1I13A 4EKIA 1TX4B 1XZAA 3TJMA 1HDIA 4C7KA 4B45A 4M9XA 4AD8A 1KTIA 3NWBA 1E3MA 1C7JA 2VHJA 3L46A 4MJ3A 1F51E 4MOWA 2VPYA 1ZGBA 2ZBFA 3HDHA 2J33A 1H6CA 2YHBA 3K9HA 4L16A 3DE6X 4PRLA 4YROA 2GFQA 3H6HA 1TLTA 1X9IA 4QBTA 4HWOA 5EJGA 4FE4A 3T1QA 1MOPA 1BXRB 1Y4AE 4BVJA 2A86A 1EFLA 1ETUA 1WQ4A 2LTAA 2QTMA 4QWWA 2B4AA 4XLZA 4KPEC 3NTVA 3H2YA 5G02A 4KFUA 4C0WA 4B75A 4TWRA 2CNBA 3EUAA 4KYUA 2DY1A 2R8PA 2GAAA 1HE1C 2WE7A 3E5NA 3LPAA 5KDLA 4CKEA 3AINA 5JIBA 4UATA 4O33A 1SC3A 3UJAA 3EVEA 4NEHB 2BI8A 2FPMA 4ZQGA 4MS1A 3K20A 5K6TA 1JBEA 5SZKB 3FMOB 1VI2A 4YAOA 2AJTA 2PMWB 3VNAA 3KNZA 3RNOA 1M83A 3S2FA 4KQ1A 5HEKA 1GZ4A 2XXAB 1SQFA 2EKDA 3T6KA 1L3IA 5HCUA 3NYIA 8AT1A 3KSMA 2JI7A 2YY5A 2NU7B 3SE0A 4N82A 5JH7B 3QWHA 3AJRA 3QHPA 1NW7A 2FFHA 3N7TA 2HT6A 4QULA 3SZMA 3VPHA 2C7VA 4E5UA 4Q37A 5TQVA 3TZQA 3UICA 3ETDA 4FFMA 3GEIA 3UT5A 3C3JA 4BWVA 1KFCB 1EFVA 1MJGM 1RLUA 3F90A 4K9OA 1KJNA 3C85A 4CQLA 3T7TA 4BNJA 4HHEA 1QG6A 4BP3A 1W93A 3GMSA 2NWQA 3E2MA 5JG7A 5LQAA 1LWNA 1FX0B 1M2VB 4M98A 1VIMA 1QONA 1JP7A 3DMGA 2Z8ZA 4ITVA 1OQAA 3FNEA 1E2GA 3QUCA 5KB3A 1Y63A 4JI1B 4DV1B 1GJRA 2YZ7A 4RULA 5EJ4A 1W4CA 2GPWA 4ZU6X 4NCXA 1BEEA 3K0SA 5C8VA 1PP4A 3T5TA 3UW3A 2ZSDA 4U2FA 4OFWA 4QUBA 5BUSA 2PUTA 1W88B 2Z04A 4N3GA 4JI0B 2CNDA 4FMDF 2C1XA 2PD4A 2EC5A 1DXHA 5L4NA 2CW5A 4AJHA 4YREA 2X13A 1NXSA 3DZKA 4DR7B 1X9GA 1QCZA 3GUUA 2OEPA 2PUBA 1AHIA 2REQB 3U2QA 4UD2A 3UW1A 3O03A 2O3SA 3WNQA 2PBFA 1AU9A 3IH5A 3OAAA 3WNVA 2EYQA 3QUSA 4L51A 2CXRA 4EI7A 4RZ3A 4F2GA 3CVYA 4JQYA 1VYUA 5FUBA 4UUNA 3E6AA 1AHPA 3GDHA 4WIAA 3UJBA 3B2EA 3KYIB 1GO2A 3TLCA 4AP5A 2R7LA 1RFLA 2QS9A 5AW8A 4L74A 3W5CA 2GHIA 3H9BA 2BMVA 3V8MA 4LF5B 1Z38A 4Q1CA 1VIYA 1LUAA 5LMNB 4R2HA 1TIKA 3NT2A 2O3QA 4ZYTA 3PYLA 3SIXA 2J67A 2G4VA 3KYDA 1GU0A 1XLTC 1Z88A 4WCFC 3S6JA 4XX0B 1U7ZA 3AJDA 1ZKDA 1R16A 3IPRA 4ALIA 1T9BA 4TTJA 3BEOA 7MHTA 3U7IA 4R2IA 2QXYA 4I9UA 2IWHA 4ZCQA 2C82A 3R77A 5KMGA 4ZI5A 4DYDA 2XCSB 1YU9A 1R4NB 1EXDA 1E9DA 4OU5A 1IZZA 1OBHA 2K6GA 4EF6A 3HCPA 4WFJA 2M6LA 1B42A 1DC3A 2CJFA 3A7EA 3Q3EA 1DIOB 3R09A 5AK6A 3ZU4A 2HF8A 2FEPA 2JCXA 5TGDA 2P4HX 2CCKA 4A15A 2YWXA 4EHAA 4HEJA 1L5WA 3UFBA 1I5OA 1HI9A 2C61A 3EGXA 3K8YA 3I09A 5DM70 2OZEA 1MRZA 3JQCA 3BE6A 4Q1FA 3X0DA 2ZJ6A 2ZJOA 3ILYA 1T0BA 1C41A 2X7HA 3RKUA 3QX7A 5HRCA 4RTPA 2PMFA 1M8FA 4RPKA 5EZYA 1M74A 1NWCA 1DE0A 5FA6A 3ZN2A 5EHXA 2DWOA 5HE8A 2CXSA 4FBGA 3ETJA 3IQEA 5ALLA 5IWCA 2UXBB 3DBRA 3SKVA 4K6CA 4E5VA 4R5HA 1ML3A 2ZUDA 4RE6A 4KWCA 1T26A 1SHTX 3DDOA 1JR3D 1CYEA 1F7UA 5EJEA 1WXXA 5HNKA 3I2JA 3FTNA 3UK7A 1A72A 1RMTA 3O7WA 4U2CA 4CHGA 1Q0TA 1D4FA 1RLMA 3OPNA 5B4UA 1Z39A 2Q4EA 3NBAA 3HU3A 3VUEA 3WL8A 1SO8A 3WZMA 4D9IA 2PZEA 4C29A 5KYNA 5E1MA 4CTKA 4QNMA 3W3AD 3EIXA 5FOTA 1PR1A 4D9KA 1BHJA 1U5CA 1PIWA 3OP4A 3JAWA 1QIKA 4MS4A 2ZUVA 4FPXA 3C74A 3MC1A 3CH4B 4YAFA 4ZV9A 3GUHA 4F84A 4YCMA 3ADPA 1N1GA 5I7VA 3M0EA 3LGAA 5T7BA 2WDZA 2FPRA 1PHPA 1WF3A 3JYLA 1PZGA 3F6RA 1XEAA 4TL6A 2CE2X 3WNDA 3P19A 2OFPA 4LYYA 1TZBA 4MKHA 3VGPA 1AKVA 1W8DA 2G09A 3ACCA 3BRCA 2A67A 4CEIB 2OGWA 3GAFA 5JATA 5FV7A 3JQ7B 2H52A 1YQEA 4MIKA 1A98A 3UANA 1KRHA 1YBHA 3GDWA 2EERA 1SA0B 1T2DA 1XU9A 3KX2A 2X0DA 3TCKA 5M04A 1NBMA 1ZVJA 1M67A 4KN6A 1QNFA 3D6VA 3PC2A 5GVRA 4ZCIA 1QTRA 3RU9A 3ROTA 2WILA 4I3FA 3EQ8A 2N3ZA 3KPYA 3TRFA 3F5SA 4YLYA 4P7JA 3A70A 3K1YA 1H2FA 3WLOA 2HB6A 2O2HA 3CF4G 4CLRB 2JEOA 3T7SA 2WAYA 1KEEA 2JK1A 4OO3A 2B34A 3JASB 3GA0A 3RVKA 4B43A 1H8ED 1HLFA 4BFSA 3E3LA 4ZOLA 3DZGA 5HTKA 3LXRA 4D9GA 1TJ3A 2JK0A 2RI1A 1AMNA 2QTBA 5FQNA 1FS5A 1EI9A 2F9LA 5K4AA 2TMKA 3S55A 1YQTA 1P7YA 1A8IA 1N3IA 1T0JB 2I7CA 2PLNA 4V0SA 3N8DA 3WB0A 3AKZA 1YH3A 4QUEA 1NTOA 3M5PA 4GXQA 4L57A 4P98A 4PC2A 2V4ZA 5LWQA 2JZCA 2N47A 3L8YA 1FC0A 1K63A 4BNHA 1F8UA 2I91A 4NHOA 2OQVA 1BKSB 3ZU3A 1XMXA 6Q21A 3LUBA 4HFRA 5IN4A 2NVBA 3HJUA 3RS0A 1OLOA 4Z2AA 1R2QA 3NBYC 1ZI8A 2R86A 4XSGA 5TC4A 2Z56A 4RD0A 4OXYA 3DDUA 4LSMA 4YMLA 2F1RA 1IC6A 1VPVA 1S3SA 5GP1A 1XQ6A 4HDNA 1ZINA 2FDCA 4MINA 2VXCA 2VHCA 4HVAA 1W48A 4FYKA 5HF8A 2AF3C 1AQ6A 2PZAA 4KXFB 5FL7A 1Q5PA 3PRJA 5BR7A 2GZAA 2BELA 3KOXA 4L7QA 3UCXA 2IZ6A 2BFFA 2FQYA 3L41A 3R5TA 2NU6B 1JYSA 2ZI3A 1FF9A 2DY0A 4M6WB 1D6MA 5GJWC 5TMBA 2RGXA 4KREA 3AEUB 4BJ1A 4BX9A 4R0VA 1PL6A 1ZR2A 3FRIA 4PCAA 1U98A 1EXMA 3N59A 4EJ0A 5K8UA 5EQDA 3KO8A 1RACA 3V8EA 1WAMA 1P18A 2ZYUX 5HYVA 4P31A 4BP8A 4GO1A 5EUCA 2HHHB 2FLKA 5BN5B 4GGPA 1U1EA 4QLAA 4KRFA 1L5NA 2IV7A 4ZANA 4GC5A 4Q02A 4WINA 3TZCA 1BCRA 2QG6A 2YHAA 3LF2A 2J7PA 1JVBA 2OHGA 4HFMA 4D8YA 3VPCA 5AVXA 4YLGA 1YL7A 1T0IA 2YWEA 2XB8A 1ZIOA 2BT4A 1PLJA 2XMPA 4H15A 4QEZA 4LBVA 4RKYA 1US8A 2YOFA 1UDXA 3IVCA 3QPVA 4JUFA 1ESMA 1SXHA 1XYYA 1SIWA 3UMGA 1JT2A 5D7NA 4QJ3A 5LFAA 1SNYA 5KYYA 4ZI2A 2AK2A 3LVBA 1P19A 1EWQA 3O9MA 3AHFA 3VR6H 3ORSA 4FYIA 1TYBE 1K7YA 1QGOA 5EWMB 5JAUA 4JOCA 1A82A 4RH0A 1HO3A 2EF0A 2IEDA 3INGA 1UXKA 2H1CA 4NBTA 5ECGC 4OGFA 4MA5A 4YH1A 3UQZA 4ZV4A 1HR0B 5FWXA 4UVGA 3I1JA 3I8XA 3W78A 3DOUA 3FH0A 3RTCA 4FC7A 2P9TA 1S96A 1Z7BA 3ASVA 4ES6A 3KDAA 5E3HA 2X4GA 3T5AA 1L4UA 4B1FA 3SQWA 1WXFA 4MKXA 1SCNE 3AF2A 1ELOA 3RT9A 2FF7A 4F9EA 4P2GA 2GO1A 4CUZA 2FQ1A 2IKSA 2UUBB 4QECA 2QRHA 3LKBA 1OX4B 4YRBA 4MIOA 2Q27A 1VP3A 3A28A 3Q3IA 3KVRA 4JB2A 3PIIA 1ZK3A 4JZYA 4ZT3A 1U0LA 4ZQHA 4U2KA 5JFOA 4PW0A 4JVLA 4R84A 3U4CA 2QUHA 2GPTA 3HHPA 1NR7A 1DHTA 2ZVJA 4G5YA 1QTIA 4R68A 4Y1FA 3H2ZA 2IK8A 2GQ0A 1HZZA 1CG6A 3C8MA 4RPJA 3FVRA 1RQRA 2GZDA 2X41A 4JUIA 4Z7JA 2ZWPA 1ZMBA 3DLHA 2QP9X 2VP5A 1OLSA 5GGYA 1QF7A 2RB5A 1NKVA 3BD6A 1NXXA 4WGGA 3K0FB 4KIUA 3CF2A 4RLQA 1T4CA 4DMGA 2DBVO 4RK6A 2XXJA 2P1DA 4OBEA 3F6EX 2QG4A 3E0QA 4M4SA 4Q4DA 1HG0A 2R8BA 1GZVA 4GP7A 4JLOA 3KB1A 3DV0B 2ILTA 2CLCX 2WZQA 4MUAA 1MAUA 1BOFA 1ONNA 1PG0A 1K6IA 4PYOA 4GEKA 1LK5A 3AQ4A 3PD7A 1K97A 4MV1A 5H9VA 9ATCA 1U2RA 3IEPA 2I76A 1GCIA 4HX9A 2WKWA 3JARB 5B36A 2C8JA 4M1EA 1BXGB 5CX4A 3IJ5A 5LQSA 4S05A 3SFZA 4Q47A 3I04A 2QJRA 3RRMA 3UGTA 5IM4A 3DWEX 1DSSG 4E2FA 2FZKA 4QPCA 1NBWB 2IITA 3MWDB 1PJ3A 2I2XB 2A5GA 3I37X 1P61B 2YWFA 3NHKA 4AJLA 1LJ8A 1NNUA 2WR8A 4MHSA 4F9TA 2EIXA 1VKNA 2Q50A 1C1DA 4HN2A 4KI7A 4NONA 2BVNA 3CUWA 2OFXA 2ZJ1A 4LX0A 3V34A 4ZI7A 2DH6A 2QR5A 1SZPA 3ECAA 4BKUA 5IC4A 2OZVA 3IQHX 1YR2A 3JAKA 2C97A 4FMDB 2GHRA 2GXUA 2H2FA 1KQ3A 1SBIA 2X6RA 3OUZA 3Q3JB 5JCJD 1IN1A 2DPHA 2BTQA 1E2EA 4KNVA 4AZWA 4M0LA 2I2WA 3CGWA 1CUBA 1W5TA 2G70A 2Z98A 3QVKA 1OSNA 1QH8A 3KTAA 3PCTA 5ESDA 4CLHA 3I5XA 1PHRA 2BHNA 3OZUA 1QCYA 1CV2A 1XXHB 4KEAA 4OHRA 1VQ1A 1B8NA 1Z34A 2FSGA 3EW9A 3QYAA 3N2ZB 4EVSA 5F7XA 5DRYA 2H8GA 4AQ7A 1XTKA 4QRDA 3ESDA 4NCAA 1EWVA 3T9FA 1IEXA 2JFHA 3P2KA 1CUCA 5B3JA 3QX9A 1YL5A 3J7TA 1JJVA 1YS2X 2HM7A 1W7AA 4RPLA 4URHA 3OPXA 3U49A 4KE6A 4KDEA 3GLIB 4C06A 3VO2A 4YRDA 1RNLA 5ALJA 1H4TA 5TY0A 1UDWA 2P2YA 1Z7WA 3G82C 1VB5A 3HACA 3ZGYA 1W5AA 2HA4A 5BWOA 3L9WA 3VDRA 3QOXA 1DJLA 4PZCA 2O9JA 1GT91 3K4HA 3QU7A 4ZD6A 1Y5IA 1RXWA 3MK31 4YJ3F 3QUQA 1CS0A 2VWQA 5P21A 2OUIA 2R6R1 2W2LA 1XLWA 3FZQA 3UXMA 1GTG1 2IYEA 4M53A 1R6AA 3W6OA 3JWPA 1LB1B 1H6BA 4CM5A 3CE6A 1CVIA 3GMDA 4JL8A 4BJ5A 4QX6A 1RAGA 3CLUD 2QD3A 2K7FA 5H9WA 2DHEA 2Q7XA 4IMIB 3DC2A 4B84A 3FDJA 5JD4A 1Q0PA 3KJQA 3X1YA 4LQLA 2V9PA 1VRCA 3TOVA 3PU6A 1A9TA 4UCFA 3KJXA 1FYFA 3X1DA 2WJAA 2X4DA 1DX6A 1G8MA 3L7CA 2YINC 3I6QA 5BORA 2YDYA 3IP3A 3K0AA 4LVUA 2RKWA 3NKFA 5J2TA 4MR8B 1WBBA 5BSUA 1QH1B 3PNOA 4CM1A 2A0KA 3IE1A 3ZGVA 4AZ3A 2E4VA 2IEAA 1BD4A 1YI0A 5JBQA 3AH8A 4LSWA 3VISA 4RF5A 2IS4A 1CRPA 4YO7A 4YMWA 3ONFA 3MMZA 1CQWA 1N3LA 1UEXC 3TD2A 3OUTA 4Q7QA 1J7KA 3HI4A 3BZBA 3ZEIA 5EWLB 4BATA 5FFFA 1SUEA 2FUKA 1AV7A 5JBIA 4ND2A 1Z16A 1ZK4A 4H7EA 1JLSA 1JW9B 2QPTA 3ZV5A 4BLUA 3RVMA 4IF4A 3UQYS 4H3SA 5DEIA 3JWIA 2YVKA 4B71A 4YRPA 4DIUA 5D1HA 2ACEA 1OVGA 2BFAA 2XB4A 4LG1A 4HDRB 1G8FA 4P5PA 5JAIA 1Y0BA 2QT1A 2RHLA 3D0QA 4HP8A 4Q3LA 4QNRA 4E33A 4KIGA 1N0VC 1PEKE 3TSOA 4RY8A 4HZUB 2X4IA 5AVWA 1EIWA 1V1MA 4IAOA 1G63A 1BNCA 2OHHA 3NANA 4W63A 1LTQA 5J23A 2JIZA 3L7LA 1UT8A 1XMOB 2ZWVA 1I9GA 3AEQA 2A9PA 4EEXA 1C29B 4HEA1 1G5TA 2VYNA 2W2VA 4ZO6A 4AECA 4J3NA 3AUTA 6ABPA 2J31A 1UPTA 1LF0A 1QIIA 2IDKA 2RKOA 1ZRNA 4WZAE 5JD3A 3SJ7A 4RQUA 4FKZA 3QU9A 3I4FA 2C42A 2HU5A 3SQMA 5BW8A 4JEHA 2HO4A 3U7GA 3OPVA 3RVJA 1APBA 3N3AC 5F23A 4HMQA 3D6HA 5KU7A 1VPWA 4Q4CA 4K9QA 3SBEA 3PD1A 5E6UB 5LR6A 3U9LA 4I6JA 1R10A 1A7KA 4KQXA 4MGKR 5DGDA 4CKEB 4U5QA 4XB2A 4P7GA 3A9CA 5CD1A 1G4AE 1EE9A 3P4XA 5LP6F 3WYCA 1YIAA 1YRHA 2A1UB 2IXAA 4TVOA 2HWKA 3QF7A 1N5OX 4LOLA 1DC6A 2CYCA 3RSZA 3L7YA 5CVVA 5BNZA 4B40A 2CJPA 2GJKA 1ZUHA 1KU6A 2NZVG 2FK7A 3JU3A 5HE9A 3AESA 4XLLA 2PU7A 5DX1A 4DHEA 2A7QA 4HLUC 3DAYA 4KAXA 5K2MA 1JTVA 1K98A 1NSTA 3SQLA 3URMA 3OG9A 1H5QA 1MZVA 4NE9A 3IEXA 4OLJA 4RK0A 5ICEA 1DPGA 3K73O 4JXJA 1Z2CA 3TJZA 4PLVA 1WULS 3F3MA 3OCWA 3VUFA 2W2XA 5DCYA 2ERYA 1TYCA 3MSCA 4IIGA 3U1BA 1IUNA 1OGJA 4LYJA 1H2YA 4LQCA 4KVFA 5EHNA 5DNCA 3LZDA 2R3SA 3HB9A 1YR9A 1DKPA 2ADMA 3NWEA 5DV9A 4AMYA 2ZRLA 1EKXA 1H94A 3OKPA 4P38A 3LM8A 3OH8A 2O4CA 3QVSA 3OLCX 1M6YA 2WICA 3D8RA 3KJFA 2EZ4A 3FDFA 2OUKA 4O4IF 2P30A 1NI5A 4BC1A 2BF7A 3ECCA 3S28A 2IYWA 2IEIA 1CHNA 3HCWA 1KY2A 1J0EA 3RQIA 1RQLA 3GO4A 1C3OA 3PNQA 3R24A 4G25A 2C5FA 2ROQA 2QXTA 4D9NA 4URFA 1FFXA 1PN3A 2H2DA 4J90A 1NE2A 4MGZR 2JIMA 2HAEA 2P6UA 2RGUA 4KLAA 4B0PA 2G4LA 1NY6A 2PD6A 3CMMA 4J0CA 5REQB 1FA9A 3ZD7A 1TCVA 8ADHA 3QJ5A 5H82A 3GCZA 4EEKA 3OM8A 2M6SA 2PRJA 3P9YA 4O2RA 1D0IA 3R7WB 5TF4A 2HJSA 2ZE5A 5GJBA 4G0UA 4OHMA 1QH0A 3G88A 2X9LA 5GONB 4LAFA 5MN4A 1EU1A 3ED1A 4IUCS 1ULTA 3C3EA 1WQ3A 3E0XA 2DFNA 2JB9A 3GYGA 2HSEA 2FP4A 4PBSA 3ER9A 3OJWA 2YRXA 1XOIA 1X1CA 3ER6A 1C50A 3E9CA 2W6QA 2GS9A 3GPIA 4WFIA 2OVBA 2B69A 3A2LA 2E6KA 3CVXA 1B6SA 4MPDA 5FJIA 3RBAA 4HY3A 5KU1A 4JI4B 1R4NA 4OHCA 3WHIA 1J39A 3RC8A 4BNDB 4PYMA 2XYGA 3JQGB 3K2BA 4WFKA 3LNTA 1B43A 4QOSA 2GN1A 1ATIA 1TUIA 2R4UA 2KI5A 4D8XA 4QYWA 2DPYA 2GN6A 2WYWA 1UBHS 4PCVA 3R7WA 4D9CA 1OU4A 1LNQA 1YTLA 3PPVA 3ZWBA 3H2BA 1U8UA 3Q1LA 4KUHA 1KYIA 2D13A 3SF0A 4O2AF 3PIRA 1SBQA 2PZJA 1UWKA 3OOWA 2R62A 3ROGA 2IUEA 2BZSA 3N6VA 2JLUA 3WI7A 3VTKA 4LYAA 3CGGA 1DO8A 1SXJB 1W5BA 2XGGA 3S7TA 3RODA 4HDNB 3TDKA 5K0SA 5SICE 5IXSA 3M6XA 5C8YF 4PRZA 2V3VA 4Q7LA 1XFAA 1KJWA 1LLDA 1FQKA 1K0FA 4Z8XA 2JEYA 2FHPA 4G81A 3N3BC 3PSAA 1Y82A 2QL6A 3RJMA 2QNBA 5TQJA 4TQUS 3R40A 4EDFA 3W5BA 3N8IA 2YJ3A 1TEHA 2YMMA 3TRKA 2C9YA 2PGNA 5CXUA 3EZ2A 2BFEB 3VDXA 1VE1A 1A7JA 2XD4A 2A78A 2FMXA 3AVTA 3KZXA 4EA7A 4DZTA 4BPBA 5E95A 3EAGA 4HZGA 1ZNZA 4N0MA 5FOXA 3HBAA 1I0IA 2R5NA 3KSDO 3L8GA 4TS3A 4BN5A 5BMVB 4JZKA 3U5TA 1K6EA 4IKPA 1LNZA 3CEAA 1WXDA 4B8WA 1XA4A 3P27A 1K6JA 2H1LA 1PJ4A 3TRHA 2GF9A 2P9FA 2PQ6A 2ONKA 3IR6A 3A9TA 4QFBA 4DMCA 4R8SA 4D3DA 3EWIA 1RYNA 3W8RA 4PLHA 2YKGA 4B82A 2ZS7A 1VJ5A 2FRDA 3QVOA 3STXA 1A04A 2H29A 4BVFA 2PLWA 1JE1A 3IQDB 3L2OB 4OU4A 4B34A 4DOMA 2XR1A 4DMKA 3EPLA 3A2KA 4PICA 4Z1OA 3KETA 1YACA 3N2LA 4DLBA 4YJ2B 1IJKA 2D5LA 3C0KA 5GGXA 1PS8A 4BMSA 2QQFA 2X2EA 2VP6A 3RR2A 1KEUA 3EPPA 3GLQA 5BQFA 2IYSA 2YL2A 2YH2A 4P83A 3DGEC 2QE6A 1CQPA 2O14A 1W96A 4Y1RB 1HTBA 1ORTA 2HLDD 1WD7A 3OAAD 4NU8X 4E13A 1GPJA 5ITZA 4TYNA 2BEWB 1G7RA 5K8VA 4XSVA 1HNZB 2AOUA 1ID8A 3HK2A 3UFXA 1NVMB 1GNPA 1R8SA 4BX2A 2AN1A 3M6MD 1P3DA 3ROPA 2WT9A 4DT1B 3VU0A 5BVGB 1LS6A 3OEHA 2RGRA 5CDTA 3COWA 5BW4A 5D5HA 1KFEB 3JQ8B 4I14A 1NUQA 3FSRA 2WJGA 4C6TB 5WRFA 4ZFNA 2V0CA 1L8AA 4C6HA 2JFGA 3FNFA 2WYIA 3F8TA 2QOEA 3D7MA 5J40A 3FPAA 4HQNA 5HKLA 2Q29A 1JEAA 1NP6A 3DYIA 1NBHA 4J0EA 3V8NA 3VR4A 2QTWB 1DAFA 3T4PA 1KA9H 1X1BA 1JDUA 3CO5A 4PPNA 3RU3A 5I8WA 3BB1A 1J0DA 3JATB 2ODNA 3K16A 2M6KA 4AS2A 3NXKA 2RGWA 1YS1X 4CMIA 4ZRMA 1DFGA 3KQPA 1TW3A 2X23A 4BVLA 4NXMB 1TEVA 1L5RA 1NGSA 1GQOA 4Q4JB 3KZ1E 3A26A 3NHLA 2PH7A 1QTQA 2Z2YA 4KFTA 3N2KA 4KIFA 4FFWA 1ZIXA 3TZHA 1EA7A 3VU1A 5KO2A 2N1MA 2XRZA 4ZVVA 3N0VA 2PUDA 5IH7A 2GH1A 5JJCA 3LWBA 3LQ4A 1N6OA 1WCWA 1E9FA 1S4QA 3GUVA 3PVCA 1XD9A 1ZWKA 5AVUA 1LFDB 1NXQA 3G79A 121PA 2CDAA 3O6VA 4GUAA 5I7OA 2GPSA 3H16A 3RS9A 3ZNOA 3K1ZA 3ED5A 3SJAA 4ARBA 1BCRB 1H05A 3BIWA 2DH5A 2RC5A 1AN0A 2XSZA 2ZJ0A 1PYOA 1NP3A 3TD9A 2BFOA 5DVZA 4DR5B 2A0UA 3O1LA 4EW1A 3MMSA 4KO2S 1SWWA 1E32A 5CDFA 3QVWA 4BKMA 1A8PA 3EWAA 5JNWA 5KREA 1Z5GA 1E7QA 1WUHS 1TQ4A 4M83A 4DEXA 4FZ5A 2ZDHA 3SEZA 5B6PA 3KZCA 2UDPA 3MRSA 4HR7A 4QQFA 5AI5A 4R1LA 3E15A 2Z08A 4W5OA 3CKKA 3CLSD 3FTPA 4XQ0A 1WNTA 4EW3A 1S2NA 3QKRB 2R1VB 3DEAA 3M89A 1RXYA 1PZEA 1IMJA 4MWBA 5TIIA 5EXPA 2WUDA 3O3NB 1NDQA 2JAHA 3VR2A 3VZDA 2ZRGA 4O63O 4YCCA 1CB0A 3ZGOA 4J16C 3HXOA 2C5AA 1DO0A 2V6FA 2WUWE 2D6FA 2RGDA 4UARA 4RPIA 5F2NA 2FXIA 2R8RA 3CWCA 4LV6A 1IB0A 5COQA 1O57A 3ZWVA 3RVLA 2ZM5A 1AKUA 1NMYA 5KSPA 3EMVA 5IVIA 3HCEA 1X1AA 1O94C 3VO8A 3NX4A 3HUTA 4OHKA 5E7QA 1N32B 1VSVA 2ISCA 4FN4A 3SYMA 5FEUA 3OLYA 2FUEA 1JE0A 5C1IA 2VZLA 1U8CB 3A4IA 4CMBA 1AB5A 3KXIA 1XZFA 3Q10A 1C8BA 4IFEA 3T9DA 4DUGA 1W0KD 3O95A 3NYQA 3PR2B 5KYUB 1JNYA 1XKTA 3ESQA 3RJTA 5IVHA 1W9MA 1TMOA 1PR4A 3BSYA 4QBFA 1P7WA 4HTFA 4MI9A 1UFRA 4B8YA 5MHTA 4B3CA 1Z0AA 2WHXA 4A0FA 1E9CA 1RP7A 1X3LA 3LXUX 3OJOA 3IT1A 5GOZA 1N6LA 1LI4A 3AIIA 4MPPA 2A0WA 4FWTA 3ILXA 3DDSA 3TKLA 1Y9DA 4D92A 2QPAA 1O6ZA 3HRKA 4NI5A 4ACAA 1INLA 1G21A 5FFNA 3TLMA 1X38A 4DCJA 2H0RA 3EG5A 5FWDA 1ZCJA 1S7CA 3OJEA 2ZTSA 1ONOA 2C2MA 3ZG6A 3HR8A 2PJZA 4W5RA 2BJVA 2A57A 1ECCA 3QKRA 3AUYA 3QNMA 3UWMA 4A1FA 1J97A 2XMGA 4EVQA 1EFHA 1KVTA 4CDMA 4FJ0A 3IDFA 3K96A 3B3JA 3GCXA 3G2NA 5DYNA 3WAKA 1UKEA 3DNFA 2PS1A 4P7KA 1RC1A 1S8AA 1M1YE 2NXEA 3CCFA 3R8CA 4C20A 1O97D 5CPFA 5DTQA 4LRXA 4DNXA 2OL4A 3V9PA 1B8PA 3X1MA 4JLWA 5GJVC 3GJ5A 1KOJA 2B5WA 1J56A 1H22A 1QDEA 1V7PC 3IT0A 2EX4A 4MGEA 4PZAA 5CUQA 3U3DA 3DT9A 3YASA 4NMLA 4F12A 4ITUA 1FZTA 4I5IA 5D3ZA 5CJ2A 3WHPA 4MULA 3LXMA 4TLAA 4BV8A 4AY4A 1SUBA 1YZTA 4GQIA 5KNCH 1U3VA 2JBWA 4LN1A 1R6TA 2DFTA 1U5BB 4URVR 2PYIA 1XCJA 1KI4A 1NNSA 4KXQA 4OYHA 3PXBA 4KN8A 3S8YA 1II0A 4JB8A 4K8OA 4MR9A 4CXMA 4JI5B 3VHXB 2M1XA 3GLRA 5E7JA 3O38A 2GKSA 1XLTA 2Z43A 4QUHA 2N1BA 4EYKA 4Q1EA 2P1RA 3W5IA 2KMLA 3ORYA 1I9CA 3IPAA 3MJHA 1V96A 2JIPA 2J9FA 2WAXA 4X8LA 5EXXA 2BKUA 2WUVA 3N87A 3Q41A 3ZWPA 4CIWA 1ZH4A 3BGVA 5JANA 1QIFA 4CMCA 1T9DA 3KXDA 5DYIA 2JLAA 1OWOA 3CX7A 4OL9A 2XITA 1E3TA 2C3PA 2MSWA 1DV2A 3LWDA 3LCMA 2ZTLA 5BSTA 4JT8A 5BVHB 2WSSD 4WBNB 2XF8A 5K3BA 4AWXA 3AFNA 2ZIVB 3MF4A 4YRSA 3VMFA 2OVFA 3L4JA 2EG5A 3ZE8A 2SECE 3U31A 2CLSA 3L8MA 3FBTA 4OLBA 1YFLA 4TXHA 4YIKA 1O6FA 5KQGA 5BWBA 2XOEA 1J70A 1QM5A 2QXUA 5TGZA 1XTPA 3PQ6A 1PEAA 2Y27A 3GP5A 4NJMA 1Z73A 5HQTA 4LNUA 2QD2A 4ZVRA 5B2ZA 1RMYA 4OHZA