4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
4FLEA 3NOXA 5AIAA 5C8ZA 5ALGA 3OOSA 4DMHA 5LZ4A 5C81A 4V2IA 5FDFA 3PI6A 3PUIA 4LXGA 3VISA 1EINA 4PSUA 3I2IA 4BZWA 3AZQA 4G9EA 3O4JA 5ALTA 4ARBA 1U2EA 3IULA 4BC1A 1DT3A 4X71A 4X91A 1C7JA 3D3NA 1XZAA 1VJ5A 2Y2UA 1UK6A 4P9NA 3V1LA 1R50A 2HA6A 3ICWA 4XWGA 5JALA 2WUEA 1JJIA 4BTLA 1SOMA 2XUGA 2J3QA 2X5XA 4WDQA 3BJRA 4X95A 2BAGA 3WKCA 1EB8A 2VAVA 2YYSA 4BDTA 4K2AA 4BYMA 4G8CA 1CUEA 4B9AA 2OPHA 3PFCA 3C6YA 3DKKA 4QDOA 3G9UA 2EDCA 3JYHA 4J0HA 1PJAA 4XVCA 4MXDA 4S0XA 3V1KA 4UHBA 4G8BA 3I1IA 4EY8A 5F4ZA 1FJ2A 4FLFA 3KWFA 3N2ZB 4DMFA 3GZJA 4J0JA 5BWBA 3KSRA 4QEKA 3R40A 3I2FA 1LBTA 3IUNA 1VZ3A 1NX9A 3K2IA 3D2CA 3F8SA 2WG2A 3DS8A 1UK8A 1VA5A 3D4LA 2HIHA 2HA2A 5C7YA 3MUOA 4KAJA 4FFWA 1MN6A 4EY4A 4Y2RA 3IUJA 1VOTA 1AMNA 4E11A 2FJPA 2G5PA 5SYNA 2K2QB 4N5HX 4KYVA 4P92A 3WLAA 1DQZA 4Q1VA 4UUQA 1DWQA 5JARA 2HA4A 1CUDA 5BV7A 5D7BA 1BRTA 1CUSA 1VLQA 5CH5A 1CR6A 2QUBA 3O95A 5AKLA 4N8DA 4UBNA 3BDIA 4C89A 2OGTA 2PBLA 4U2EA 1DINA 4ROTA 2PSHA 5AI8A 1K63A 4BBZA 3EF3A 4PQEA 2RONA 3KDAA 3FCYA 2JGJA 1L7RA 5CBKA 5DNVA 4CFSA 4KAFA 5LKRA 2WIJA 1TCAA 2B20A 1JU4A 4L9AA 1L7QA 3AUKA 2VAXA 4Y2QA 3FLBA 4J0CA 4X85A 2WUDA 3FLEA 3QMVA 2PX6A 4B0PA 3STXA 3PF8A 2JGFA 5ALDA 1CQWA 4Y9SA 2Z3ZA 1SC9A 1BS9A 1PFQA 1WHSA 1J07A 1Q0RA 5HCUA 3ZLVA 4DMKA 5KWJA 4W1RA 2BFNA 1R4ZA 3BDVA 1Y37A 1YAHA 3BJMA 4QDUA 3WK6A 4QLAA 2OXEA 3EQ7A 4P93A 4BC0A 5AKIA 1VA4A 5HFAA 2HA0A 4HRYA 4YPVA 5EFZA 5DJ5A 4DLNA 4BRSA 1QTIA 1SCQA 4H7JA 5DYTA 2VQ6A 5AOCA 3D0KA 1N5RA 5HQ3A 4X93A 3M82A 3WWCA 4EY7A 1KU0A 2NW6A 1LLFA 5LYYA 3WL7A 2C4HA 4ARAA 1HDEA 3JWEA 5AOBA 4LXHA 3ZLTA 3RK4A 2Z8XA 4QA9A 1EA5A 1W76A 3H2HA 4BVKA 4AB1A 4UBKA 2WFLB 1CUIA 3ILSA 3STVA 1QFMA 1JT2A 3A70A 5EHQA 4EB0A 5JAHA 4U2CA 5EIAA 5A2GA 2H7CA 4NS4A 5FPQA 4A23A 1TQHA 5FOQA 2XUKA 5FUMA 3KXPA 1J2EA 4PO3X 3KD2A 2C5GA 2QVBA 5CT4A 5ISMA 1KEZA 4PSDA 3G8YA 3MVEA 4U2DA 2YASA 2QR5A 2VA9A 4Q3OA 3D2BA 5AKYA 3WA6A 2ONCA 2JIDA 4DNQA 3UUEA 2H7XA 4JEIA 4X94A 3C8HA 3WZMA 1AUOA 2XUOA 6YASA 1MNQA 5JD5A 2JF0A 3FYUB 2XB6A 3PDCA 4ETWA 1F6WA 4B0OA 4H0CA 5AM0A 3D59A 5DYYA 2WSLA 4H18A 2H9YA 1WPRA 4UBMA 4Y2XA 5DTJA 4G4GA 5JZ9A 4FNMA 2VTVA 1UOPA 5ALYA 1F8UA 1PV1A 1CUVA 4AZ0A 2CBGA 3I6MA 4EUSA 1H2WA 3HSSA 3U1TA 5I8PA 4QDXA 1UKAA 1WB5A 2VEOA 2JGKA 4FFVA 3AINA 5AI6A 5BWCA 5AM2A 1GPNA 2VT6A 2XLCA 2WU4A 3E1GA 3QZUA 1CUBA 1XZDA 2I3ZA 2ECFA 2AJBA 1XLWA 2O7RA 3WJ1A 5CURA 1OXMA 4J7AA 4BAUA 1ZICA 1X70A 3R3VA 3WIBA 2QOEA 1JJBA 3AIOA 1CFJA 1GKKA 3HRHA 3G0IA 1E5TA 2XQJA 3ANTA 4X00A 2OGSA 5A6VA 1ZI6A 3VJKA 3DYVA 2HU7A 2Y6UA 3IUQA 2FJ0A 3IURA 4ITVA 5HZGA 5AI4A 3R0VA 3WL8A 3V1MA 4K6KA 2ZSHA 5ALZA 4UFOA 4BVJA 2Y1KA 1XZEA 4AZ3A 2HU8A 3ESDA 3O4IA 5DLPA 4PSCA 3G0BA 5I7UA 3TGLA 2HDWA 3DL4A 2C5FA 2ZYRA 2BUBA 3BXPA 3VJMA 5CXXA 4NMWA 3JW8A 5JZBA 4HAIA 3NGMA 1AX9A 2UZ0A 4M0EA 3H2GA 4F0JA 2HA5A 1XZJA 3IVMA 5K3FA 5AIBA 4Y7DA 1CV2A 5FV4A 5AI5A 1YAJA 3WWDA 3VKFA 1DWOA 5AKKA 1LBSA 1EI9A 1YSCA 4L0CA 1VE7A 2BJHA 2WG1A 5IVHA 1XKLA 3H19A 5IVIA 1SFRA 3X3HA 1AQLA 2W22A 3WL6A 5ALSA 1N5MA 1ZD2P 2V98A 4W9RA 4X92A 1M33A 1FFEA 4I4CA 1R3DA 4XJVA 2OCGA 4FLMA 4KRXA 4H35A 4ZI5A 1BCRA 1CVLA 3H2JA 2BGNA 1TCCA 1UT6A 1CQZA 1QIFA 3WK7A 1AZWA 3NUZA 3AZPA 4OYYA 2HRQA 2ZJ6A 1BEEA 5DNWA 3WK9A 1VZ2A 1UWCA 1DWPA 4HVTA 4YASA 2JGLA 2XMBA 1FFAA 2ROQA 2X8BA 1YB6A 4CCYB 1UKCA 2OCLA 5AKHA 1XZCA 4OSEA 2PSDA 1QJ4A 1QIEA 4FKBA 3DJYA 4UHHA 2VATA 4YK7A 3H17A 2QXTA 4GLBA 2JEZA 3ESAA 4E14A 3C45A 5ALVA 5LZ9A 4IHAA 2QRUA 1QE3A 1ISPA 4HRXA 5ALNA 1Q0ZA 4A5SA 3A2LA 3LS2A 4UHEA 3SWWA 3ZV7A 1Q83A 4DTCA 1EDDA 5I9IA 4GW3A 5CT5A 1THGA 4MJ3A 4AO7A 5HKBA 4KE8A 4B7ZA 1HLGA 3N0TA 4HS9A 5C8VA 2QZPA 3BIWA 4Y2JA 2XI4A 2BGRA 3GUUA 5AI9A 4MYSA 2P8SA 3M3DA 5ALOA 3FBWA 4J3JA 1XZKA 5ALUA 4KE7A 4B85A 1ZD4A 5EHZA 3WL5A 3GROA 5A7FA 4IQ4A 2GZRA 4KR0A 3EIOA 4MYDA 3FOBA 4WFKA 5J3JA 2VSQA 1QOZA 2EDAA 1XQXA 1LPSA 3FSGA 3T52A 1EHYA 1XZGA 4ZV9A 3HI4A 3WMRA 2E3JA 3QPCA 2XDWA 2XMDA 4JYMA 2AJLI 3QMWA 4F21A 2YXPX 2RHWA 3W05A 2OLEA 4KE6A 4TVKA 4DSAA 5JAOA 4OU5A 1TIBA 4J03A 1JKMA 3G02A 3PICA 3HJUA 4KEAA 4CG2A 2H1IA 5ALFA 4EY6A 1IUOA 4KJXA 4Q34A 5ALHA 3T4UA 2O7VA 3EQ8A 3ZI7A 4H7DA 1RP1A 4IH1A 1HKHA 2YH2A 1USWA 2RGUA 2ZJ7A 3WJ2A 2CUTA 2XUQA 1MX5A 3LCRA 1IVYA 5SYMA 2OQVA 2XUAA 3QVMA 4MWTA 4QZVA 4LKOA 5JD4A 2CB9A 3W04A 1H2XA 2AJDA 3IB3A 3PF9A 4F5ZA 4X6XA 3FVRA 3C43A 5KREA 2BUCA 2GBCA 4OB7A 4AX4A 2ES4A 1R9NA 3D2AA 3M83A 1MPXA 4BRZA 2VF2A 2X76A 4H77A 3O4HA 1K5PA 1QONA 1DTEA 2ZJFA 5CXUA 4LYEA 4UHCA 3H2KA 3Q0TA 3HABA 1W52X 3DDUA 3L1IA 5CT6A 1QIGA 2FUKA 1CUYA 1UK9A 2V96A 1E3QA 4MEBA 1BROA 1QIDA 4J0GA 1ZGBA 1DQYA 1EVEA 5A62A 1K8QA 1T2NA 1YA4A 2HADA 5AK4A 4RE6A 3WK8A 3WYDA 1GQRA 3QPAA 4IH4A 2IX9A 4GDMA 1XRLA 5BOVA 4Y2PA 2OGZA 4B80A 1ODCA 5CW2A 2XMCA 4PNZA 5ALPA 1CEXA 1YCDA 3WKDA 2PVSA 2J4CA 1JI3A 2GYUA 3STUA 3WI7A 4B84A 4ZGBA 1CUHA 3WZLA 4Q82A 4B9EA 5LKAA 3AILA 3UUFA 2DFPA 4G8DA 3U0VA 2OAEA 3CCBA 3ED1A 1JMYA 2VJCA 1BN6A 1UKBA 5A7GA 3WQHA 5AH0A 3WWPA 1WCYA 2Y2VA 2DHEA 2ZYSA 3WKEA 1VKHA 3I2GA 1VE6A 1CPYA 1WM1A 5C8XA 3DD5A 3C5VA 2O2HA 5A71A 3KOOA 3S2ZA 2PSEA 1P0QA 2WILA 5FPPA 4H7HA 5K3AA 5JZSA 1ZI9A 2I3DA 4X6UA 1I6WA 5ESRA 5CH3A 3MUNA 1GPKA 5AICA 4AO8A 1CUGA 3WYNA 3W9UA 1MAAA 1W75A 3EQ9A 3G0GA 1GKLA 3L1JA 1THTA 3LLCA 5HFNA 3VVLA 2WLSA 4QE3A 4K6GA 1QIHA 2XMGA 5AKJA 1BEZA 4GBGA 1P0MA 1MTZA 4DSZA 2GYVA 4MQMA 4PF1A 3QH4A 2C58A 4EHBA 3OC0A 3F96A 5AJHA 1P0IA 4CCWA 5CH8A 5LP1A 2OQIA 2C7BA 1TAHA 4ZREA 3RM3A 5AM4A 2RIPA 4C87A 2CKMA 2WFZA 3HXKA 2QM0A 1EX9A 2V97A 1LZKA 2W6CX 3FLAA 3H2IA 2CEKA 2B9VA 4X6YA 1XZHA 3AZOA 3H18A 1P0PA 2HM7A 4OPMA 5EHNA 4CI9A 4WY8A 1JJFA 3V48A 1IZ8A 3I2KA 3ZPXA 4CIAA 4OD0A 1A8UA 3ANSA 4TGLA 5HF8A 1ZD5A 2VJDA 4C4ZA 2XQIA 5E4JA 4BP8A 4LIPD 4M0FA 4FDMA 2GBFA 4I19A 5LZ5A 4WJLA 4ZRDA 3FYTA 1LPBB 1F0NA 3W2TA 1EK2A 1EK1A 4C01A 1XZMA 4RE5A 4UHDA 3FCXA 5IKXA 4GI1A 4IO0A 2WUGA 3DCNA 1CUCA 5K3BA 4UPDA 5T4FA 3STTA 2WUFA 2ACKA 2J4FA 3F9CA 5JIBA 3NWOA 4YX9A 4J0IA 3K9BA 1JU3A 4QDZA 4WDRA 2WKWA 2RHTA 4GWLA 3GBSA 3IIIA 4UFPA 5DNUA 1Q84A 5AM5A 1GQSA 1XRPA 1HPLA 4X90A 1A7UA 1EDBA 3WK4A 1YB7A 5AO9A 2OAGA 2WHPB 1GZ7A 5FXMA 2B61A 1XQWA 2OCKA 3FSGD 1TKRA 3V1NA 4BTVA 3QM1A 1R9MA 1AC5A 4G1FA 2C0PA 2ZVDA 1QTRA 3I6YA 2DHDA 3IUMA 4ZWNA 4ZV7A 5ALJA 4IH9A 4GXNA 1BN7A 2WFLA 4QLOA 1SCIA 1TCBA 5EI5A 3R3WA 4HXGA 4D9JA 5HKAA 1LPPA 5HF6A 4N5IX 3STYA 2OCIA 5CT8A 4X97A 2WIFA 5CRIA 3A2NA 3V9AA 1C4XA 4UBJA 4L3WA 2WJ4A 1E8MA 5AM3A 1UXOA 3R3UA 2I78A 1ZIYA 4XIIA 4BAGA 1LPOA 2J3DA 4B83A 3ZWQA 2HHAA 2G5TA 4U2GA 2GYWA 2WTNA 5JD6A 4H7KA 4MQLA 2WG0A 3LIIA 3BWXA 4B82A 1ZGCA 3AIMA 2O2GA 4U2BA 1YS1X 3BE8A 1G42A 3VXKA 3DNMA 3DQZA 1XRNA 2PUJA 3IBTA 5EHXA 1ZJ4A 3CN7A 1W6RA 3G0DA 3FYUA 3EBLA 4B6GA 4FTWA 1MAHA 1Y7IA 5IVDA 2LIPA 4LYDA 3W9BA 2ZSIA 4W1SA 4CIBA 2IITA 2EEPA 1YA8A 4G4JA 1K6EA 5CTAA 2DQYA 5HF9A 4C88A 4H7FA 5K3DA 4BB0A 1E66A 2AJ8A 5CMLA 3I1YA 2CJPA 4K5QA 3WWEA 1LPAB 3SC2A 5IVKA 2QUAA 4L72A 1IUNA 3S8YA 1ODTC 4BDSA 3DLTA 2O2IA 3QPDA 5AKZA 4C6HA 1EXWA 3B5EA 1EH5A 1UOQA 3K6KA 4X7BA 1ZI8A 3AFIA 4OCZA 2BKLA 2PSJA 7YASA 4AMYA 4BVLA 2GZSA 3DL7A 3IDAA 1A88A 2DSNA 1EVQA 2HU5A 4H7EA 3OG9A 4MWSA 1W4LA 2Y6VA 1U4NA 3BF7A 3H1BA 1N8SA 1AGYA 5LZ7A 5JAUA 4QDTA 2D5LA 3WKBA 1E8DA 2HL6A 2PL5A 5AKGA 1NU6A 2XMRA 2WQZA 1GT6A 4M0MA 5DWDA 3WKAA 1LZLA 1ZIXA 4B81A 5EGNA 2WHRA 2ACEA 2HFKA 5FKJA 3E4DA 4AO6A 4WY5A 2Z5GA 3E3AA 2VJBA 3H1AA 4JYPA 5A7HA 3VVMA 1OCEA 1BU8A 1RWQA 2R8BA 4BCBA 4WFIA 4GEGA 5AKEA 4AMZA 3LP5A 2WIGA 3ICVA 2B4KA 2XQGA 4AXBA 1SCKA 2CZQA 1ORWA 5K3CA 1R88A 5ALEA 1EDEA 5HK9A 4HXEB 5HQ3B 3FNBA 2Q0XA 1B41A 1D07A 3DOIA 2XUHA 4HTAA 3DOHA 2PKYX 3FWHA 1TRHA 4XX1A 3A6ZA 1CUWA 5FP0A 2JEYA 1H2YA 1K4YA 5ALQA 4UBOA 3WIOA 3O0DA 5ALMA 2Z3WA 1E89A 1O6FA 1XQYA 3E0XA 3BIXA 2G63A 3F97A 1QIJA 4OB6A 1BE0A 4OB8A 2XUPA 4QWWA 5JANA 4Z49A 1VXRA 4CCYA 3RKSA 2R11A 5ALRA 2QT9A 5CT9A 4TPKA 4UBLA 1ZOIA 1CIJA 3DEAA 5IH7A 1ZD3A 1IMJA 3QYJA 3O4GA 3ZLUA 4Y2YA 1MO2A 1AKNA 3A2MA 4INZA 1L7AA 4G4IA 4Y2TA 2WHQA 4AN1A 5D3KA 1UZAA 3O9VA 5ALKA 3YASA 3I6ZA 4FWBA 4UHFA 3VDXA 1XZIA 4BE4A 1F0PA 4HXFB 4FOLA 1MT3A 2PSFA 5JATA 3D5EA 1HQDA 2QJWA 3PFBA 3R3XA 4OUKX 4FBMA 3FAKA 1H23A 1DX6A 3H04A 1BCSA 1FFCA 4DIUA 3BL8A 5ALLA 2D0DA 1H2ZA 1N1MA 1IUPA 5E4TA 3C87A 5FLKA 4EY5A 2XUIA 4K6HA 4LHEA 4Q05A 1CUUA 1CUJA 1H22A 3G0CA 1X2EA 2RAUA 1Z68A 2JBWA 4Y2VA 1CUXA 3P2MA 2ORYA 2QS9A 3ESCA 1GXSA 3PUHA 5D6OA 1UFOA 2WM2A 1QO9A 4BCCA 4AN0A 2OG1A 4GECA 2CMFA 3SX4A 5T4BA 2VJAA 3UMJA 3VJLA 1XFDA 5HF5A 2HA7A 4G5XA 1LNSA 4FHZA 4JNCA 3TJMA 2BUAA 4E15A 3OTQA 3SK0A 2DCMA 4CG1A 4DMCA 4RPCA 4P08A 3IA2A 4DNPA 4BE9A 2HRRA 4QWMA 4DNOA 1XRQA 5AM1A 1QFSA 4JH0A 3B12A 3WK5A 3L1HA 1QO7A 5FRDA 1OILA 1DX4A 4AQDA 2XMQA 3DKRA 1CUFA 3MGAA 3HEAA 2PU7A 4GHWA 1U65A 4BP9A 2XQFA 2XQKA 3OPMA 4JUIA 4KACA 5ALWA 3D7RA 3TRDA 4PW0A 3RARA 5E4YA 3WA7A 5K3FB 1YR2A 1ZJ5A 1WOMA 3FYUC 5DTIA 1CUZA 1DU4A 1WB6A 1G66A 3CCCA 4HZGA 2WJ3A 1GGVA 4OU4A 1QGED 2JGIA 3C6BA 2QTBA 3C6ZA 4J0KA 5LLSA 3DYIA 2QXUA 4Q3KA 3G9XA 1WB4A 4W63A 1T4MA 1EB9A 4WCVA 1E8NA 2XMZA 3M81A 5AI0A 1FFBA 2VT7A 1IZ7A 2PM8A 5JYCA 3G9ZA 4EZIA 2BCEA 4EBBA 4ZXFA 1GPLA 2ZYIA 3OURA 4F60A 3R41A 2JGMA 1QIKA 5T4EA 3RLIA 1XZLA 4BAZA 5T4HA 1KU6A 4UBIA 4DGQA 1XROA 2PUHA 1Y7HA 4H7IA 2WIKA 1YS2X 3QBJA 1CRLA 3KWJA 5ALXA 3AJAA 2H7YA 5DYWA 1R1DA 4E46A 4RNCA 4CG3A 3R3YA 1XLUA 2WFMA 4N8EA 4A16A 2HFJA 3QMMA 2HA3A 3B3QA 5HK8A 4MEAA 4C4YA 3C8DA 5K5EA 3LIPA 2Z8ZA 5E2IA 3HLKA 2G4LA 1MX9A 1O6GA 3R3ZA 5AK5A 1QIMA 1B6GA 2PU5A 3OM8A 4N8SA 1UK7A 2XUFA 5KBYA 3C70A 1JMKC 1G4HA 4W1QA 1HBJA 1LPNA 1QIIA 4WFJA 2FX5A 3C5WP 3GFFA 1ETHA 1XKTA 2QKYA 3HYSA 2XMSA 1RYYA 4DYHA 2XUDA 1HL7A 4J0DA 3TEJA 4QNNA 3GELA 5KWIA 2QJRA 4BCDA 5AK6A 4G9GA 3AIKA 4UFNA 1ORVA 5AK3A 4PV7A 1UOOA 2ZYHA 4I3FA 3PE6A 1NU8A 1W1IA 4Y2UA 3WWOA 3G7NA 2WJ6A 3GA7A 1WPXA 4NVRA 2DR0A 2WIDA 1ACLA 1DT5A 1ACJA 5AP9A 5LZ2A 3H0CA 3C6XA 2I03A 5JASA 1C7IA 1JFRA 4KE9A 2GBGA 1WHTA 1XRRA 3CN9A 4FNGA 4C4XA 3F98A 5AHXA 3G9TA 4NZZA 4OYLA 2WTMA 3I2HA 4DNFA 5EIEA 1MJ5A 3BF8A 2JGEA 1X2BA 3Q8WA 4KAAA 1J1IA 3ESBA 5YASA 2QMQA 1QZ3A 2RI6A 1XRMA 3FVTA 4Q3LA 1MNAA 2PPLA 3I28A 1LPMA 4BZZA 1U8EA 1VXOA 5AOAA 5AKXA 3I2JA 1XZBA 3HC7A 2AJCA 1TK3A 4LXIA 4FMPA 1XLVA 3HACA 5JAPA 5D3ZA 1LGYA 2XT0A 5EIHA 1J06A 1YASA 2IIVA 1XQVA 3STWA 1G5FA 1FSSA 3QITA 1MX1A 5ALIA 1MU0A 5K3EA 3O9MA 1CLEA 1AURA 4KRYA 2XLBA 2C0QA 2AXEA 2V9ZA 1CUAA 1A8SA 4W1PA 4EA6A 4FBLA 2XE4A 1XZFA 4U2FA 2XUJA 4RGYA 1ODSA 3CXUA 2DQZA 1FFDA 3W06A 5H3HA 4BATA 5JADA 5LIPA 5LZ8A 1A8QA 1S8OA 2WU3A 4O08A 2DHCA 3HZOA 3F67A 2WHPA 4X3CA 4Y2SA 1QLWA 4DM7A 2GBIA
chains in the Genus database with same CATH superfamily
4WLNA 1A8HA 3R7WA 3KQYA 3MGCA 4BP1A 4B3IA 5K0GA 1PSWA 2EKBA 1WETA 1P6QA 2DFVA 3ZWXA 1PI3A 4NYIR 3U48A 3PENA 2Y4NA 3AU9A 3OECA 1U2PA 1LB1B 1MO4A 5TLSA 4Q4AA 4TVBA 5C81A 2I6UA 4HNUA 1VSUA 5BN1A 4MQ6A 3TKLA 3M3PA 4EGSA 4DV5B 2F48A 3PI6A 4BO1A 4EW3A 1WB9A 4D5GA 1U4SA 2PMFA 1WXIA 4EJSC 2VXYA 1A76A 4P2GA 1KH1A 2C31A 4RANA 4N3GA 5IYZF 4F4UA 2Z4TA 3KS9A 1OTHA 3HJGA 3I2IA 4BB6A 4LBWA 4BZWA 3IIEA 3H2ZA 4G9EA 1X42A 2XTJA 2W70A 1EQUA 4P7JA 5EPOA 4BLUA 2RGEA 1J0EA 3D1JA 3LFHA 4AMBA 4A73A 1L5VA 2R00C 3GBVA 4X71A 4DUYB 4H1WA 4JOCA 1U7PA 4Z0PA 2O1SA 3B38A 4R9UC 2C5HA 1UK6A 3IBYA 4OJMX 2YZ2A 4IZHA 3UHPA 1YZLA 4P7BA 3KXIA 2C4TA 4Q1DA 5JJLA 4R8RA 1R50A 4MNTA 5M34A 3RIGA 2VPTA 3GDWA 4QD3A 4XWGA 5DNYB 2X0KA 5HTOA 2BGLA 1KP3A 1TCVA 1Y9EA 2V7BA 4KIWA 4U3JB 1JDTA 5H83A 2CSXA 5ADVA 1ZLYA 4NNOA 2FPPB 4OO3A 1JL3A 3VOAA 2P3OA 1ICIA 5L3QA 3OIVA 4QQFA 4OHKA 3K0SA 4YTEA 1FE8A 2QTVB 2G77B 4UOEA 4PXAA 1PJBA 4WDQA 1E69A 1HDZA 3DKVA 1EB8A 1Y1KE 2R5FA 2VAVA 2YRXA 4M0LA 4XCXA 1E1RA 3EPKA 1FVHA 5FFFA 5TX7A 5J4HA 4QJBA 1RWKA 2Q0HA 1PFVA 2UZ1B 1RJGA 1U99A 1HL3A 4YRKA 5ARCA 3E84A 4LJ5A 2BCJQ 4HUQB 4Q3EA 1Q1NA 3PFCA 2DR3A 1US8A 2EW8A 1PJTA 1PFWA 1FQKA 2F1RA 2GPWA 4G09A 4R71A 2OSBA 4WY2A 4X20A 5BWLA 4BX2A 4RVFA 4BEBA 1GA4A 3SHOA 2B9EA 3VM6A 3I62A 4WLOA 1BA3A 4ACBA 5T3UA 4LI3X 2ARKA 5IJ0B 4MXDA 1QAOA 4HAWA 4BV8A 4HQ0A 1UBMS 4S0XA 2W2VA 1H6CA 4P5EA 4UHBA 3I1IA 4FLFA 1QS0A 3SC4A 1A9OA 3KWFA 4PIPA 4HWSA 3TPZA 4AURA 5ITWA 1MOPA 2IH4A 1RJ9A 2BFWA 3PXUA 4HMOA 2X4GA 2XH8A 2X3FA 3GMSA 1W4RA 3UFXB 2V6MA 4IZ6A 4J0JA 1D6MA 3R40A 4X1OA 2HEIA 1NOIA 3I37X 3AVYA 5H82A 4GR9A 4IILA 1Q0HA 2RD2A 3B51X 1NX9A 3S2YA 5CLJA 3F8SA 3MJRA 5CU7A 3WYAA 3PGVA 5A5DA 2WG2A 3LG2A 3C15C 1U7OA 2B36A 3BG5A 2ZUBA 1ZOLA 4OP3A 4WA8A 1LDYA 2RCNA 1PBTA 3DS8A 3UANA 3FSJX 5J58A 4NK5A 5A03A 1UCFA 2BSXA 1UFRA 3D4LA 5A3RA 5TQ2A 2HA2A 1ATIA 4DTIA 1FU7A 4FFWA 4K6CA 1MJHA 4H1HA 3A31A 4RL6A 4ZK6A 1Z26A 5JXIA 1IC6A 1AKYA 4BVGA 3K71B 3Q3GE 4AKGA 1QPBA 4IDNA 4R1OA 4XE5A 5LD2C 3LL4A 2QLLA 3N7TA 3CZAA 2R6CA 2JZOA 1W35A 4WJKB 2FJPA 3ZJ5A 2QUHA 3R9KA 2DHQA 1J49A 4N5HX 3QVXA 2OTCA 3FMIA 4KYVA 2W0SA 4EB6B 3WRXA 4PPNA 1H85A 1Z4QA 1SUFA 2ESRA 1XHEA 2X8JB 5BSMA 3ZNPA 3WLAA 4M0CA 2ZI3A 2ZSEA 4EJMA 4Q1VA 4GI5A 1DWQA 2HA4A 3KBBA 5LQSA 4MUBA 5BV7A 1BRTA 1CUSA 1DC7A 4TUYA 5EJMA 2IY9A 5CH5A 5A02A 2IYFA 3NVMB 5AKLA 1KPIA 3BDAA 3CF2A 4ILEA 1M75A 2G83A 2WSSA 1KA9H 1N2EA 1RQGA 3NTUA 1QCYA 1DIOB 1DINA 1V7PC 3O84A 3TLMA 2C03A 1K63A 4OHOA 3WB0A 3B1VA 4YY3B 2H65A 2HBZA 3E9NA 4BBZA 1ZJWA 4NOJA 1ZVKA 3KKNA 1NWHA 4Q1BA 1L7BA 2RONA 5AXAA 3E18A 3KDAA 4BU1A 3HVRA 3UCEA 1F0YA 2YZGA 2P2ZA 4J0QA 5EZ5A 3VR1A 2P4HX 7MDHA 5KWEA 4MS3B 1Z2OX 1N4AA 4CFSA 3HEMA 2O8CA 1N6KA 4QUEA 2NSJA 3RC9A 3ZHXA 3EA4A 4YJ3B 5FULA 2XYRA 5FPYA 4CQMA 5L4SA 2ODBA 5JSZA 1JIIA 1ONSA 2NPOA 5LYJF 2R44A 1Z83A 1JU4A 2AFVA 3IX7A 2ABWA 3UXYA 2OL4A 1G19A 2CLHB 3F47A 2LD4A 3C3KA 2YJGA 4MQBA 1NBME 1ZM7A 3SKYA 4B8YA 2J87A 3FFTA 4QREA 4BN4A 3LUFA 3NW9A 4L02A 4AMVA 2IK8A 3AVWA 3AKCA 3U80A 4JLSA 3UK1A 4J3NA 2AWNA 4IR7A 4ND8A 2WUDA 1SUBA 4DV6B 1SXGA 1QRRA 3OWOA 3N87A 4OGFA 1UKVY 4OP1A 2FG7C 1RI3A 4XM1A 3VNQA 4CUKA 4LE1A 4B0PA 4QARA 2FK7A 4YMTA 4II2A 2D0OB 5AVRA 2VH2A 2YXEA 3N07A 1KWKA 1JXMA 4A10A 4Z86A 1U63A 1V8PA 4QODA 1DTWB 4KL8S 1PFQA 4ESOA 3KSUA 2WZQA 1J07A 1QKJA 1P60A 4XWAA 3BSSA 5CA0F 2HSDA 1Q0RA 5HCUA 4LF7B 1CETA 1EUCB 4AG3A 2IXGA 5KWJA 1G2IA 3RUFA 3N3AC 3IP8A 5EKUA 3QI2A 1Q22A 3EGEA 2C5SA 4NOMA 1TUBB 3BDVA 2I91A 1Y37A 4XOUA 3VR2A 5AVZA 1LK5A 3BJMA 3OQ6A 3WK6A 1RP7A 1UJ5A 2PYDA 5F21A 4QLAA 5REQA 2QGZA 3CX4A 3U17A 5JSYA 3H83A 3K2EA 5FBLB 1RMTA 5IASA 4FE4A 1SHJA 1OREA 3ZE1B 3TIFA 4ZVUA 5HFAA 5T67A 1RRCA 4UMDA 3MMNA 4PPYA 4RFSB 2ISSD 3LUAA 2PIDA 2W90A 1W2WB 2YMMA 4EKNB 1T5BA 4KGVA 1XLTC 1TQ8A 4ZI7B 2G71A 2JEOA 3PL5A 1HT2E 4HLUC 4TWJA 4BPBA 2J30A 1U7UA 1RQPA 2PD3A 2W11A 3MLBA 4LX0A 1IAVA 5EN4A 3K70C 3U1BA 2J9FB 4BRSA 2ZJ2A 4PLCA 1IG0A 3NRJA 4H7JA 3ZV4A 1B0ZA 1MQAA 1OAAA 4MWBA 4D8XA 4FHEA 3H2YA 3MS7A 4H4EA 3LK7A 3SIRA 3HGQA 4CLDA 3T5GA 1UBUS 2B2XA 3UXHA 4YR9A 1E4OA 5D5PA 5DI9A 4ZDWA 2NUTB 4QAJA 4DUGD 1G6KA 1RJWA 1Z88A 4EY7A 3PPXA 1VKRA 3MAGA 4R1NA 3UK0A 1FDSA 2FEOA 5LPNA 5FO1A 5AR1A 1YU6A 1LLFA 1C0EA 1PKXA 2HHJA 3P9QA 1YOVA 4FWIB 4ARAA 4B35A 5BORA 3LQFA 3BD9A 1WO8A 3FBGA 3JWEA 4D3SA 1KMMA 3NTVA 4Z1MA 3UAVA 4WCFC 2YJTD 2A2ZA 3W5HA 4JJGA 3ZQKA 1A9PA 3DLAA 3TR5A 1QM5A 5AW7A 2Z8XA 4QA9A 5DLDA 1EA5A 5JZOA 2YDYA 2BEJA 3ET5A 3OUUA 2MYPA 1P3JA 2WHEA 1X87A 3B9BA 3KU1A 3URMA 2IXTA 1NQOA 2WFLB 1GUBA 4J29A 4MIOA 5I7AA 5BYJA 2XT9A 1OXUA 4YRTA 1QBGA 3PXGA 3UK2A 1YR8A 5TC4A 3UMMA 2DPXA 4OP2A 3DZ8A 4EHNA 4JT4A 3TLZA 3STVA 1QFMA 1JT2A 3A70A 3VNBA 5DHAA 5KYUB 3MSXA 4EB0A 1HX7A 3CRQA 2NTNA 2AXPA 2B37A 3KQVA 5ULLA 4JC0A 4FCCA 3RS5A 3EXHC 3B3GA 1MT0A 2P1RA 5AXDA 3EGCA 3USES 1GL3A 2H7CA 1R27A 4H59A 4YGXB 4ZPXA 1K7EB 4MR8A 1EZ1A 2F4NA 3B6EA 3JYLA 2OC4A 2AVDA 3LL7A 1V1JA 1QV7A 1Y8AA 2WE7A 3NPMA 1GU0A 2D62A 1BS2A 2PZBA 3NEPX 1JAZA 3DDCA 3LLSA 3OUZA 4PSVA 1Z4OA 3B70A 3OZEA 1P91A 1WCV1 1AS2A 1B3RA 4P7FA 5FOQA 1AKMA 4GPBA 5KOHB 4GU5A 4WCFB 1JKJA 2C8JA 3EPRA 4K6MA 3LYAA 3BWVA 2GYYA 3KD2A 4GSYA 2C5GA 1F5NA 4M53A 4U7WA 4EMUA 5CT4A 5CA1B 1J39A 2VDWB 4BY9E 1U9ZA 5IVPA 2YUIA 1NNLA 4M2LA 3PNYA 1FXUA 3RUPA 1PHPA 4HD8A 2BJWA 2JIBA 1Q0UA 4KLZA 4NCNA 4NJMB 3MVEA 3W6UA 4P4LA 4UEWA 2X6TA 1NFFA 1XDBA 1QE0A 1DXYA 2CMHA 1AT1A 2OB1A 2Z4RA 3K2BA 3JTMA 2YASA 1RQLA 4U2DA 1M34B 3V2UA 5JXGA 4NYIQ 4G81A 1KWGA 3SHVA 1C0PA 4GMGA 3SX2A 4CKEA 2ONCA 3V1YA 2SKEA 3NV7A 4HNAB 2GFIA 3A37A 2ERXA 4N3NA 1KP9A 2YHBA 3O8OB 5C5CA 3DQPA 4JEIA 4YREA 2CNLA 2CHEA 4LDZA 3TBKA 1T5TA 5HG0A 4OA8A 2RHDA 2GCOB 1OIWA 3EFBA 3QRWA 1TNDA 1Z8DA 1AUOA 3W2IA 4R2HA 2FF7A 4HDCA 2FWAA 3BD7A 1M2VA 3S27A 1NGSA 3U2QA 3T9CA 4MUMA 4CV1A 3LWDA 5JD5A 4NI5A 2JF0A 4KIUA 1U2RA 1LA2A 3A6LA 3EY9A 4EG8A 2SCUB 1E5DA 2XB6A 4MZXA 1UEIA 2ZJ4A 1SVMA 4ETWA 1Z3IX 2A14A 4B0OA 3GJSA 2OM6A 2QPAA 4NCXA 3D59A 1Z8HA 1XALA 4UCWA 3L8MA 5AVSA 1VI6A 3JVIA 2YW9A 2WSLA 1NXXA 4H18A 2C4VA 3GLQA 4R9RA 2FKNA 2BV3A 3D3WA 1MC8A 1K3TA 1ODJA 3HCFA 3R4VA 4D56A 2OXCA 1MVLA 2ON6A 3P19A 5JNSA 4EWLA 2NP6A 2CSUA 3E05A 1UBCA 4LGMA 4GKJB 3QJGA 5LOVF 1GPMA 3WC4A 2EWVA 5JZ9A 1SCBA 1YOBA 3KOUA 3G13A 3B9RA 4HDSB 2RGXA 4YI3A 5A6SB 1U2ZA 5F64A 3ZGXA 4BUZA 4ZZ3A 2VTVA 2F3RA 3FPAA 5C8YA 3SJ7A 1NFQA 4ZZ2A 5ALYA 1QDEA 5F3DA 3PRHA 2EJUA 5BY2A 1KOFA 1E2DA 3AEXA 1C3OA 1AVTA 3I64A 3EXG2 5KI6A 4PNEA 5KCZA 3PHLA 1S9DA 2GXQA 1YNSA 4NP6A 1G5RA 4KPYA 2XCIA 3V7FA 1UFQA 2VA8A 4M9RA 3HSSA 1QF9A 4MW9A 4RA6A 1ZN7A 4Y1GA 4YNBA 4ZYXA 3ER8A 3F90A 2FN3A 4J91A 2V59A 4M6WA 4QDXA 2E82A 4U39A 2BEWA 4BJ6A 2FN8A 4E21A 4YUXA 2JGKA 5EXPA 2VDKB 1A2QA 3GLHA 3ZE0B 5AM2A 1GPNA 2VRBA 3NJ8A 2R6JA 4A92A 2QIOA 4EOGA 3CGGA 1T8YA 2XLCA 3ESQA 4TXHA 1BVUA 2BZSA 2WU4A 3E1GA 4CU5A 5TXGA 2D7JA 4WVLA 3TVYA 1VECA 3H42B 1DPFA 2AJBA 1Y98A 2J9GA 4WSOA 5HGJA 5DNEA 3WJ1A 4EG7A 1SIWA 1JLHA 1K0UA 1FQJA 2QAGA 2XDQB 3KSDO 4FFOA 5CURA 1O94C 3DZCA 3Q3IA 1NF3A 4QATA 5CIQA 2R8ZA 2DBQA 4IG9A 2HMTA 3LRPA 4JP2A 2GM4A 4RZQA 2CF5A 4B44A 3ZD8A 1ZBQA 1HV8A 3JPWA 2A1UB 4HX2A 4U7JA 2JATA 5GM2A 4N9WA 1V95A 4EP1A 3M33A 1CJCA 2A33A 3IHKA 2EQAA 3KTDA 1GKKA 1TM5E 4NPAA 4CT5A 2X9QA 3H9EO 4DB2A 5DHSA 2C4NA 3FR8A 1E5TA 2XQJA 4AKEA 2BOVA 4PANA 5DBHX 3EEOA 1YKFA 1QPZA 3B78A 1EVZA 4QUDA 4TOIA 5FUYA 2ZTUA 2YIJA 3CLTD 4KQFA 4RXMA 2HJSA 5FWXA 4DC9A 2V5AA 3OT4A 2VNKA 4ZAGA 3DLHA 2A1TR 1FVFA 1QQBA 3FHLA 3O1LA 3JQBC 5JV5A 5HA5A 4GDFA 3MA0A 2WUVA 4ITVA 2NAFA 4GSLA 1GCAA 1P1KA 1QR2A 2B5VA 3AR4A 1NMSA 2WBLC 3WL8A 6Q21A 2JCYA 3UJNA 1JIKA 2ZSHA 1LBIA 4IG4A 4K6KA 4UFOA 3U6BA 4RTNA 2YV1A 4Q37A 2P65A 2Y1KA 3WL4A 3SQOA 3X44A 1X1AA 3CH4B 3ESXA 3FGZA 2A94A 1H66A 2NUAB 3VO8A 2V7QA 1O96B 1YZYA 4JJ4A 2R96A 5IT4A 1G3MA 3G0BA 1DO8A 2ZSJA 3K8YA 3NTQA 1T1GA 5K0BA 1QAMA 3O4VA 4NENB 4PU0A 5C4IA 2AZMA 4MWEA 2QX4A 3RYHB 4EVSA 2FPXA 3BXPA 4E51A 3W7VA 2XXAA 5CXXA 4NMWA 3JW8A 4OHYA 4R83A 2PLRA 2VXCA 1GCIA 4HAIA 3L4BA 4LZZA 1KIMA 4B46A 3R24A 1N6PA 2VDNB 5FWYA 2UZ0A 3O73A 1LI4A 1Z0FA 2XAAA 3I0ZA 2DU8A 3WSVA 5AW6A 1NM5C 4QYXA 5LFAA 3PPVA 2MTBA 4ZCRA 4F0JA 3FD8A 2PMCA 2D1QA 2V45A 3FPGA 4TQUS 1VRVA 2Q5JA 3UJHA 3EXHA 4JLOA 4DILA 4BU0A 4U2KA 1E6KA 1ORDA 3IELA 2Z4SA 2YWBA 1G18A 3ETHA 1WS6A 1A1VA 3W1EA 2YRFA 2QZSA 1SXJB 1M6VB 3MG9A 4WUTA 3UAOA 1NYRA 3V8QA 2I7TA 4F04A 4ENPA 4LSMA 3O2SB 1R9JA 5KYYA 1KIFA 2DRIA 3CVOA 2RHRA 1VKZA 2WG1A 1C30B 3K72B 4DZZA 5IVHA 1IG3A 3WIUA 1INLA 2W98A 3H19A 1HMPA 4ALNA 4LSWA 3IEVA 2FSUA 1UIMA 4GE3A 4WWHA 4JI5B 3UJ3X 3IUEA 1UODA 3Q7PA 1PEAA 4WADA 2V98A 2Z5LA 3I4FA 1M33A 3N0RA 4I4CA 1UT8A 1PIWA 2W2LD 1ENZA 1YUNA 2YWFA 3BXXA 3OZUA 3L7CA 4YECA 1NI4A 2YBDA 2FN7A 3TRFA 4DBZA 2P9GA 2PUCA 4H35A 1Z36A 2ID9A 3HO8A 4RTQA 3G82C 4LHVA 5K0TA 1YF3A 3TUZC 1J8MF 1P80A 2BFEA 3H1GA 5G1PA 3DB1A 2VPWA 2ZM5A 3H2JA 1YQUA 4RSRA 2QMUA 1T0UA 2PGOA 3WGIA 2REBA 1RXVA 2VRWA 4EYSA 1EFRA 1UT6A 4QPNA 2FWBA 3DOOA 4RVUA 3ZE7A 4YP6A 1R37A 4WNIA 1GZUA 1KSJA 1NW8A 1LQTA 1QH8B 4K1LA 4PWZA 5M3BA 3SM3A 1H65A 3THRA 3TM5A 3DF9A 2EFHB 2Y76A 2ZJ6A 4CN8A 3HY3A 5DNWA 2C2KA 3ZE9A 4UUBA 4DDMA 3LT1A 1FLAA 1Z34A 3U7GA 3JQ8A 2GXSA 4AF7A 2XMBA 4BNVA 3HCAA 2CL6X 3M1YA 3ZH2A 3EA5A 1H9BA 4J49A 1YB6A 1RBZA 1V1MB 1RCUA 3G8AA 4RJJA 3A6GA 4CCYB 5IYZB 1S2DA 2FK8A 2FQ1A 4MPDA 3AT1A 1AIPA 1S8FA 4GD3Q 1FSZA 1ONNA 2PPVA 2FR0A 1FLVA 1XZCA 1GYRA 3AEKA 4OSEA 3Q2IA 3EQZA 5CJJA 3W0LB 3NVAA 2G28A 4V3CA 3H8JA 3NHKA 1L8OA 3EUAA 2QMHA 4D6PA 4DA6A 2H1SA 2QMEA 2V7PA 2VXOA 3A1NA 3JSXA 5K3OA 1TAUA 3T3MB 2VATA 4YK7A 1FYFA 1EP2B 4HR7A 4GLBA 4OGKA 3ESAA 4E14A 2H5IA 4F85A 3OIUA 4ZEMA 2P5YA 4RHTA 4NU8X 2WWFA 1Z6YA 4WHMA 5A3QA 3N9IA 5KO2A 4JYAB 3GVXA 4OHVA 5CNMA 2OYRA 2IOHA 5FI0B 1QVRA 4FDAA 4G0OA 2D0PB 5LWHA 2WWHA 1UMCA 3ADKA 5J40A 1L5KA 4FN5A 3F7MA 1VKJA 1GYPA 1JWAB 4A5SA 1Q0ZA 4CI0B 1Q14A 1BH6A 2P91A 1EWRA 3IAUA 3LS2A 3TUJC 5IAKA 4GXRA 1PUJA 4UHEA 3UC9A 3RAFC 3WGGA 3EH2A 1DDIA 2MWMA 3ZV7A 5CFRA 3AC0A 5B58T 1DP4A 1WXWA 3GIDA 4A8JB 1G38A 5FO0A 4OLFA 5CT5A 3OZXA 4QQ8A 2HREA 3V55A 4LV8B 1KETA 3A0UA 1KR2A 4RYDA 2OQ2A 3NXSA 3VKGA 2VZ8A 2VQFB 4L08A 4A5OA 5HKBA 1CZOA 3CNEA 5K03A 2ZKIA 1GU7A 4KE8A 1LVUA 2CLCX 2CK3D 4KUEA 2OZLB 4JI3B 1E61A 3GT7A 3GJ3A 3Q9UA 4B7ZA 1HLGA 4YV1A 1LNZA 3P4UA 4C0BA 2J8ZA 2VHUA 4HS9A 4JOBA 4RS4A 3HJRA 2P3SA 2ODEA 1DKMA 3FOWA 2RHLA 4NTZA 4L27A 2QLTA 2PZ8A 4AUMA 1B4DA 1Y80A 4QVKA 5JISA 3GUUA 3V8BA 4D8VA 1KJQA 3UQZA 5AI9A 5FI1B 4YMLA 3GX1A 1R5OA 2GEFA 3PPWA 1ENOA 1EX1A 3M3DA 2OOSA 4JB8A 5L6MB 3OBIA 2ZITA 4C0HA 1ZR4A 1PQWA 2N3ZA 5J63A 5A4JA 2BT4A 1X0XA 1XZKA 3FCOA 3RVPA 3AUFA 2OFPA 1Q1BA 2I7CA 4D81A 4ENSA 3DVSX 2JI9A 2O3JA 5H68A 3B2NA 1CB0A 1CJSA 1JU9A 1EFPA 4NS1A 3G49A 4W9NC 4YAGA 2IXFA 1BDBA 1DUVG 1GNPA 1TL7C 3NHUA 5JNWA 3JQPA 4E5DA 3GLIB 1R15A 3NC4A 4KR0A 1O9HA 3SSOA 3HXTA 4MYDA 3UH1A 1OTYA 5J3JA 5K4AA 1Q1EA 5LQDA 3CT6A 4IV8A 2F3UA 1UQUA 4NRDA 3UV7A 1N1GA 2D74A 1XQXA 4L57A 5ICGA 2CXXA 3FPJA 1GHTA 2AC2A 4OMUA 5C80A 3U9SA 4IQGA 1K5HA 1Z25A 4TKMA 1YCFA 3EG5A 3BREA 4TUYF 1GPYA 3IR5A 4M9QA 3RIHA 5CIYA 1W6UA 4QPDA 1EFVA 2AH5A 2QYOA 2HF2A 1DV2A 3GOQA 3HBLA 5KZMB 2JVJA 1X92A 4ER0A 1K0FA 4Z53A 3JVDA 4M9SA 2XMDA 4IDQA 5CLQA 4QJ3A 1ND6A 2PHZA 2ASEA 1AO3A 1RYFA 4HTFA 2BRUA 2C3UA 4I50F 4PZYA 1FPQA 4DMLA 4YA6A 2RHWA 4UASA 3EK2A 4CL2A 2O06A 4HGQA 3DNFA 1T8RA 2QIPA 1JG6A 3KYJB 3FPSA 4GM4A 4KE6A 3W5IA 4C4TA 1Y9ZA 4C21A 1L7VC 4OU5A 5LM3A 2R48A 3PFNA 3G2PA 2JHPA 3QU5A 3KFVA 1JKMA 4JX8A 1ID1A 2WMOB 3VPDA 1NBOA 1IM5A 1GPWB 1S9HA 1VBNA 5AHKA 3FRHA 3I9NA 2ZDGA 1LRJA 5G2OA 1EKXA 1U2DC 3PQDA 2J0EA 1B0UA 2NXNA 1TM7E 5JFGA 3TZCA 2RHHA 4R9SA 2ZYGA 2E55A 4JEHA 3I45A 5E8RA 5ALHA 3VKWA 1KDRA 3O82A 1UMBA 3OTWA 4M60A 3T4UA 3ELWA 3GP3A 3NM5A 4YMUA 1RWPA 1PEDA 4H7DA 2O19A 3H1PA 3MC1A 4KX5A 3GLFB 1VJ0A 3AEQB 1RLUA 3BX1A 1THMA 1H6DA 1K75A 1KFCB 4IH1A 4MCJA 4R8VA 2OXIA 3RUHA 3GB9A 4BRUA 2XVXA 2YZKA 1HKHA 1TKCA 4IM7A 2PBRA 4RK7A 3ANXA 4X8HA 2B6NA 4BVBA 3AOEC 4BFUA 1AGXA 3G1UA 2O0KA 4M8KA 2CUTA 1XWWA 2XUQA 3QWHA 1PT8A 3U3DA 4BMZA 5JCXA 5K99A 1XNQB 2MIIA 5LYJB 4TN1A 5BSWA 1IVYA 2OQVA 4ABTA 4ZGWA 4ICIA 1DELA 1RIFA 3P27A 4NBNA 3T54A 2H1OA 1O58A 3LT2A 1SH7A 1DPGA 2PL1A 2AUMA 1RCFA 3CX3A 3H65A 5JD4A 1VE9A 4P33A 2Q50A 2NZ2A 4FD2A 1PWHA 3PFWO 3TL3A 4DANA 2I9PA 3B48A 4GVXA 4QU0A 1FK8A 1O54A 2M2IA 2W2MA 3FPFA 4QEDA 3S68A 3MWDA 5CEFA 1GEGA 2TMKA 3DMRA 3FKSD 3QU7A 1D1PA 5HJ7A 4YAIA 2XGSA 2ZE8A 2BUCA 1KVQA 2GBCA 2JJ2A 4KFSA 5CA0B 7ADHA 2QRKA 4XGKA 5HHTA 4HPWA 3O6VA 1HKUA 1XHFA 1ZY2A 2QLNA 2IP2A 1OFTA 2JFNA 3TQTA 2BE7A 1FW6A 2GEUA 1MPXA 3PYMA 4DCSA 1NZDA 1LK0A 2CGEA 3LECA 3NUGA 5FUVA 4C2BA 2X76A 4JLDA 4E3ZA 3H0KA 1GSHA 4IIFA 1JSXA 4Q7EA 1XV5A 2ZGVA 3JWJA 5HILA 3TW6A 5M5BA 2FSPA 4NH0A 5GGXA 2PZLA 2ZJFA 3NFRA 3N2GA 1G5IA 3SKXA 3SZGA 2Q4BA 3Q6MA 1V11B 3BQMB 3HXQA 3ET4A 4IVRA 3GDHA 1WSWA 2ZAIA 3PJFA 1M66A 4JGGA 5FUBA 3ZKWB 3LT5A 4LZAA 3FM9A 4NZMA 2EKLA 3IBSA 1BYUA 1DL5A 3T7JA 1U0LA 3AL0C 1DGQA 1QIGA 3H16A 4BNWA 2YJNA 1J23A 3L0OA 2DQKA 3QJYA 4NESA 2C2GA 1RHQA 3CUUA 3SGLA 2VCEA 4ER7A 4D9GA 2QVXX 2QHXA 3KPYA 5CDSA 1KH2A 5AYVA 3NBKA 2MINA 3K35A 1SMKA 3ELDA 4HK4A 1B8PA 4B3FX 3H9BA 4IOLA 2PLNA 2LRHA 1K8QA 5A62A 3VI3B 4AROA 4LXQA 2GCNA 3QX8A 4G26A 4RE6A 1R0SA 4EELA 5BWMA 4CRWB 4FVTA 4MYHA 5AW2A 3Q8XB 4M89A 4IH4A 1JIJA 1NPDA 2HAEA 4FDUA 1T8TA 2X8AA 3CLKA 4LJ6A 3RKRA 3AM5A 3ETEA 4TKUB 5CPFA 3NIBA 4R2XA 2YOFA 3PWSA 2W6IA 3E22A 3PUJA 4A2PA 5K20A 3EEQA 1L7OA 1F7UA 1YJBA 1Q1ZA 4Y2PA 4B6SA 3DXYA 5LR6A 5FHQA 1ODCA 3NU1A 1S3GA 1UDXA 2R5WA 3NYIA 3BE4A 3BH7A 3QVUA 5B6PA 4GUAA 5BXQC 4BGDA 4MRPA 5ALPA 3GNQA 1GPJA 1J5EB 3FFAA 4IXDA 5CLFA 3PZBA 5I7EA 4Q0MA 3KQKA 5LJIA 4D3ZA 2PVSA 4DIDA 1U0JA 3GP5A 3QXXA 4CM8B 3F6CA 3ONFA 4J16C 3BMCB 4Z4GA 4TQAA 1EXVA 3FVVA 5HM8A 1R6DA 5C34B 1A72A 5GZ6A 4MRVA 2QBYB 1JB1A 4Q19A 2GM3A 1WEHA 2FMKA 2QNRA 4Q82A 1P5RA 2ZS8A 5CFNA 3RAPR 1KGSA 7ABPA 3AF4A 3ENNA 1C7QA 2XZPA 3A26A 3UUFA 3JZIA 4G8DA 3EOAI 1WBJB 3OLWA 4JA0A 2ATXA 3IQFA 1I24A 3QF7A 1JQLB 3VZSA 2ST1A 1C50A 4IKEA 5A7GA 2H4WA 3WWPA 4I4TA 1E9DA 2O8FB 1LW6E 1NY6A 3K0KA 4TV9B 1KYZA 1G1AA 3WKEA 1E1QA 3QNMA 1NQAO 1IIRA 4YO8A 5T7BA 1F4PA 1QZTA 1VE6A 2C59A 4OXXA 1G291 1AH2A 4IX9A 4RF4A 1XVAA 4QFBA 4MKFA 1TRKA 1S02A 4OJYA 4G8JA 3KUDA 5C8XA 1NP3A 4FM9A 4LRWA 5IK2D 2NM0A 2ZXUA 3THWB 5DGTA 2QRVA 5E1DA 1U0FA 3K92A 3PFHA 1KNQA 1ZGAA 5KCMA 4BL5A 1Y7LA 4QYIA 4BNKA 3QU2A 4WCDA 1RFGE 4Z2AA 3B8HA 3U3JA 5BNIA 5EZ6B 3HVIA 2ZE7A 5I9TA 4UOQA 3MTDA 2YWHA 3K1AB 3UMSA 3LX5A 4G5RA 3EN0A 1T1EA 1PO7A 4PZZA 4I8XA 2O59A 1U8FO 5FPPA 3VPXA 4H7HA 4YI5A 2V7WA 2PIAA 4CLXA 2VAMA 5H59A 2I3DA 4EB3A 4DQVA 1H2EA 4UNQA 4NABA 1Z0KA 5HIJA 2A0WA 2Q29A 2HQSA 1SB8A 3Q85A 5JCJD 4MHTA 1W5TA 4QO8A 3LPAA 2GKGA 4TXJA 3OPYI 2PDAA 1PG2A 2FRVA 5FIUA 4OA5A 3FHOA 1QHIA 1W75A 3GLKA 3SLRA 1KEUA 4MITA 3G0GA 4KMMA 2ZUUA 2L0XA 4ZC8A 5C8YF 5G4KA 1NL3A 1Y9AA 1DKQA 2FW9A 3NJRA 4YN3A 1THTA 3PUVA 4KNWA 3OMLA 4FHDA 3V6MA 1MOQA 4B33A 2WW8A 3OZGA 1I1QB 5H7XA 3W9YA 4BQOA 2A4KA 4QE3A 1FFGA 3E2PA 2ZR9A 3FPHA 3H2SA 4K6GA 4AT1A 1QIHA 4CJXA 1MXHA 1WUYA 2RH5A 3PJEA 1V6AA 5AKJA 3MXTA 5JBQA 1T3GA 4UE3S 3DONA 1X7DA 3REGA 5C37A 3GLUA 4PQRA 4R01A 5B3KA 3COVA 1L0BA 2GYVA 1NC3A 3BZBA 4YAEA 4DV4B 1YWGO 5LOVB 1LDGA 4PF1A 2RBEA 2C58A 3NZEA 3P0JA 3OC0A 3TWOA 3CVJA 5K8UA 4IIDA 1FVXA 1WA5A 1P0IA 4CCWA 4URYR 4L2IA 2OQIA 1B8UA 3HLYA 1PQ4A 3MWEA 3KOYA 1TAHA 2GA9A 4ZREA 1FFXA 2UKDA 3VH3A 5DTRA 5CUQA 5A3SA 3IUPA 2AFRA 2C9YA 2RIPA 2IVFA 4BVAA 2JGNA 3ANNA 1MABB 3L07A 3MCWA 3RV3A 4BFLA 3ABZA 4UDOA 3CPJB 5CTJA 3UOWA 2ID7A 2FP4A 3B6MA 2RKOA 3QVGA 3VKVA 5JAMA 2QM0A 1EX9A 2V97A 2BFCA 5J5CA 2II6A 2P9QA 1LZKA 3WLPA 1J8DA 1RMQA 2YHAA 1JYFA 3EOBI 3NOQA 3EIUA 4WQMA 3U7FB 4LPKA 1PR6A 4PGFA 1ZUIA 3OPYA 2N0SA 2XXJA 1BQ4A 1IVNA 3A06A 4X6YA 4BNJA 1PEYA 5GV7A 4NAHA 1Z9BA 3ZQ4A 3SQXA 4EUHA 3AMVA 2BM9A 2V4UA 1RHMA 3Q12A 2UV8A 2NYVA 5D1HA 1VIMA 1PJQA 1P0PA 1R4AA 3B7WA 2FHPA 2YVAA 1OI7A 3GCXA 4BMPB 5A0FA 1A71A 2RC5A 1AHIA 2AN1A 3CW9A 1W36B 1JJFA 5JEDA 4G0NA 5HWSA 3P71T 1HDIA 1ZU5A 4MB6A 2WMYA 1ZIOA 4JDPA 1DQSA 4ND1A 3KZNA 1RZ3A 5FL7A 2Z5VA 4WXMA 5JLJA 2QU8A 2WQ6A 1XMOB 2X6RA 3OKCA 1ZD5A 2VJDA 2PCJA 4GP6A 5CB6A 3BT7A 4C30A 2PH5A 1A9RA 4M0FA 2GFQA 3WWZA 3ADCA 2VYND 3K30A 4ZZ1A 2YWRA 4TRMA 1MEOA 2LDBA 5LZ5A 3ROZA 1EP3B 1L4UA 1UAGA 4PBSA 1VGRA 1WXFA 4P3YA 3ECSA 1T3SA 4XOIA 4B5LA 2WYIA 3FYTA 3JS5A 3NX4A 3RVNA 1F0NA 2I1QA 3ELUA 1ECBA 4GOXA 2ZYDA 1JDSA 2FX3A 2B5OA 3MAJA 4GMFA 2DY1A 3S5JA 4YPOA 1WSDA 1C1DB 2UAGA 2FFJA 4KQ9A 4RE5A 4MYCA 4ZT7A 2B92A 5ILQA 3REQA 5IU6A 2PJRA 3QFSA 4CETA 4MA4A 4JBYA 4KPUA 3UTCA 2IXAA 3FCXA 5JOQA 4ESVA 1W2HA 4H6VA 2O8DA 1EESA 4FHGA 1MIOA 4TKLA 4FKMA 2G3YA 3L3BA 3A6FA 4NL4H 3STTA 2ZIUB 4JUAA 2J4FA 1T2AA 3WIDA 1JQJC 1DUSA 2O23A 3DVRX 3F9CA 5JIBA 2E4ZA 5EMHA 1OZFA 1I36A 3CYFA 5IJ9B 2QDXA 2IUYA 2YWJA 3ONVA 3QY9A 4BNXA 1N3LA 1CR4A 1GTJ1 1Z74A 1JFFA 3O92A 4LJ4A 4LEIA 1VQ1A 2H59A 2BELA 1Z6PA 3IAS1 1J7JA 1JQ3A 4RM3A 3VNAA 3V6LA 4AECA 3EDMA 3MWGA 3KD3A 4ZVPA 1EGVB 3SVZA 3THYB 1D6JA 3CSDA 5K0SA 3IIIA 1OFGA 3ZGLA 4UFPA 1JEJA 4QUHA 4I55A 1RHUA 3GFOA 4ZKEA 5D8DA 4QQKA 5AW8A 3N86A 3RO7A 5K45A 1KTIA 3CF6R 4FFLA 3NS7A 3SS7X 5CYGA 3I1FA 4NQRA 1X1BA 3ECCA 1VMAA 1FSGA 3CH7A 1MW9X 3PPIA 1QHXA 3I8XA 2HJVA 4KVZA 3TD9A 3L8DA 4MS4B 3B6ZA 1Y8RB 2XKBA 2ZIAA 1GZ7A 1R00A 4MK4A 4TYMA 3ZY4A 4BLVA 2JFGA 3FNRA 1G8JA 2B3DA 1U04A 4RIEA 5DT2A 4DLYA 3R7WB 5JVDB 5IXJA 1N3BA 2B1QA 1R9MA 1AC5A 3LHIA 3VMMA 2C0PA 2AWOA 1WV0A 3T0FA 1IL0A 4Q9IA 1E20A 1BYIA 2NUBA 4FEYA 5TT1A 2FPGA 2REQA 1G6HA 1RYEA 4RMHA 4QT4A 3MGKA 5KQGA 1A69A 3BTOA 3QFRA 5EUQB 3ZBUA 3KZMA 4L5IA 4IDHA 4KXMA 4KXYA 3AP3A 4O2RA 5EIBD 3ME5A 1WXEA 1BN7A 1Z2EA 5F78A 1SKBA 5K05A 4QGAA 4JIMA 2JGRA 2PKEA 3PTLA 1UJ4A 3C0KA 4KQ1A 1Z62A 3ND9A 2A3NA 1PR2A 4TSFD 3WGMA 3CLUD 3FFBA 4D9JA 3UHJA 4Z9FA 3FOFC 1ZK3A 4KIGA 3NIFB 5EY5B 4GLOA 1ORRA 2HDOA 3M9XA 3OO1A 5CT8A 5E8JA 4CLRA 4GRDA 1TX4B 2EQ5A 3AB3A 4PR3A 3RANA 4F72A 2ADOA 4JQSA 4KBFA 3SBXA 2WIFA 4GLFA 5CRIA 1TLLA 2QL7A 4FFMA 1VPTA 4RD2A 3UAXA 3V9AA 1LH0A 4YFVA 1W25A 4L3WA 3LQQA 4E13A 4XGNA 2DECA 3EXIA 1NVFA 3HTXA 4Q7LA 1W87A 3IDZA 3JQCA 3FZGA 1W1WA 4FMCF 2A0YA 2PMKA 3FCAA 5HP4A 3LK6A 2AK3A 3IIMA 4QYSA 4UM5A 1RTTA 3WRYC 1GU1A 2B7CA 2IYXA 3LI2A 1OAKA 2Q9AA 2GTIA 5EQTA 2M6RA 1Z63A 4J4BA 4KLCA 3FSEA 4CDMA 3PGA1 1ZO8A 2CDBA 3KWLA 1VLJA 5C35A 2ZJAA 1E99A 4YJDA 4AJPA 3RRMA 3VVCA 1TPYA 1W93A 2QX8A 4GX0A 1C41A 2QEQA 2V4MA 1PX0A 3L05A 3HKCA 4JZYA 1WY5A 1AXEA 3KV3O 4PZEA 4UEQA 4D43A 1KYQA 4RZXA 3BWXA 3CKYA 3KUKA 1E1KA 1EG2A 4B82A 4KITB 3UCXA 2XBUA 4FCVA 1FFYA 1IOWA 1IATA 4DDKA 4LZPA 4U2BA 2AZXA 4EW1A 3JYNA 4X20B 2WFAA 2O8DB 1ZKMA 3BE8A 2IDKA 3IDSA 3U7HB 1UBRS 1M8FA 1JXOA 1W4BA 3OJLA 1RPAA 1NLYA 4JBGA 1NJ5A 1YJ5A 821PA 4IGIA 4RGVA 4YXWA 3UGJA 1TA9A 4DIKA 3FYCA 4R9VA 3ZCXA 1TYAE 1DKPA 1O4VA 3KCNA 4DRXB 4JYBA 4C7OA 1WQ1R 3SQLA 1YV9A 3CN7A 1W6RA 3R8FA 1RJ9B 3A1DA 5I7VA 3EBLA 1LSJA 1FRZA 1QHYA 2I99A 2ZQZA 3PD0A 1GKIA 1L7EA 5FNZA 3BCHA 3HCPA 4MUIA 1MAHA 1ISIA 1RJFA 2D4HA 3K0AA 4XIGS 2G1UA 5IVDA 3UJPA 2LIPA 3HZZA 4QDJA 2Z30A 3BB3A 4LCJA 5AWFC 4LZJA 4DM3A 1ZMOA 5EMJA 3VYSB 4LQ4A 2GI4A 2C94A 2PQ0A 3LQ1A 2HWUA 1S2GA 2OMEA 3Q1LA 4UTZA 5CEEA 1YA8A 3DE7X 2VHYA 3CA8A 1G21E 1VP9A 4ACAA 4BTEA 5JJCA 4AKHA 2VPIA 4P35A 3H0EA 3R0IA 5JXHA 4LX8A 4BO2A 1SIOA 3PC6A 2PKQP 3U44B 1WU8A 1VYHA 2Q5OA 1F8GA 3ZHYA 2PQ2A 1SQ5A 3LWZA 3SZ3A 5KQSA 1QRTA 3N58A 2I2FA 4X41A 5TQ2B 3RKUA 3H11A 5CMLA 1FUEA 5CFLA 4ZRNA 3AKDA 3HBMA 2Y9PB 3G1WA 4KQMA 3EJWA 4CODB 2VTBA 1SAYA 2ZTHA 1T1IA 3FJOA 1TTHA 2BVNA 2WZDA 3HKDA 4LJAA 1J21A 5CYOA 1H5QA 3H05A 3QE3A 1HT0A 2ZI9A 3RSSA 2FR8C 3THXA 2YKGA 3U60B 1ZG3A 4REOA 3E2IA 4KWTA 4D4MA 4C0AC 2XA2A 4HNVA 2GNOA 1FRNA 1OV6A 1VBKA 3B5EA 3O93A 4YDSA 3DFUA 1UOQA 5L3VA 1A95A 3NDIA 1YVEI 4MYTA 4RIFA 1ZI8A 4V2UA 2NU9A 4TUYB 2RMKA 2BKLA 3AV3A 3D31A 1AS3A 1JSCA 4P36A 1E9EA 4AMYA 3C5CA 4KVAA 4QUKA 4F3TA 3DMDA 1A88A 1NNSA 4PHFA 2OA0A 1R8JA 2VZ9A 1BXZA 3BSYA 4WLUA 4DF3A 5IKOA 3L0YA 1ZHHA 4H7EA 4F7WA 3X43A 3FF4A 4I50B 1W4LA 1YQGA 1U4NA 3F78A 3NBMA 2XGMA 3BF7A 2W6JA 3H1BA 1VGVA 1CY6A 1QYDA 1N8SA 2Y1OA 4UDYX 4XDYA 4ZTUB 2E18A 2YXBA 3KTFA 1KI8A 1G20E 4QDTA 3DZHA 4WACA 4CQMB 4V02A 5JAUA 5KYGA 2J6IA 3DV0A 1EFDN 4DV3B 5JSZB 1FMLA 1E0SA 2Q3FA 4V0ME 4ZT4A 3ZJYA 4ITRC 1L5LA 3WGJA 3NHWA 5DGXA 4K6OA 5ELMA 2C84A 5A5GA 4L5YA 1G3RA 3UBMA 2I87A 2GASA 3PYXA 1NU6A 3SXUA 1N57A 3H6GA 1P8JA 1BVYF 3CUWA 3PX2A 2DUUA 4ND8B 3H8VA 4YB8A 2BMFA 3QF4B 1UJMA 5ERYA 2H63A 4XM2A 2OV6A 3FGPA 3K31A 4AM8A 1C3JA 5BV1A 3MGGA 4HNRA 1VLVA 1IVSA 4P38A 4OH7A 1XZ8A 1YNOA 3ANLA 1YS4A 5EGNA 5LLTA 4LRYA 3SEAA 1UEJA 1P77A 2AIRA 3GEBA 4K9SA 2SECE 1QWSA 3BTSA 5EYPA 1XA4A 3LCCA 3BWYA 3RJ9A 1OASA 2M98A 3H5LA 4UVGA 2P0AA 4JJZA 1COWA 3OC6A 5REQB 1QG4A 2A35A 5EZYF 1WNFA 2GPNA 1TD1A 3CUVA 1KSHA 4QUBA 5E3JA 4I1VA 3AFOA 5TMDA 4UM9B 1I2CA 3H13A 5A04A 3L4JA 5LC1A 3AKZA 1X8KA 5KYVA 1U1DA 5JWRA 2VI5A 1R0BA 4KB5A 4BCBA 1II9A 2XVZA 4H17A 3OOYA 4WFIA 4U6QA 2C7VA 1YQ9A 2ZDQA 3KE8A 5AKEA 2VL7A 3P4XA 3PHBE 1UBJS 3D6TB 4AMZA 4G1CA 4RLHA 3ORQA 3AP2A 4UD6A 2J5KA 2B4KA 3V1TC 1SCKA 5KNCD 1Z73A 2JPDA 1LLUA 5B6IA 1ECCA 1CEEA 5FNVA 5FOUA 3TLXA 3VOSA 4YAFA 2RHOA 1SZPA 2ZIGA 3TR6A 5K3CA 1KQFA 3TIGA 3H4TA 1O87A 2B3TA 5I48A 3QKTA 4RZUA 3PSHA 1FYEA 4R54A 1W1UA 1M1XB 4EAAA 5KQPA 1G9XA 1CERA 4HWGA 3WGVA 4ENUA 2VDVE 1EGQA 3KQUA 4JB0A 1NYLA 1TMYA 5F23A 3U16A 2Q0XA 4IUCS 1OQAA 4B2YA 1E6WA 1T0JB 3PUKA 3T41A 3Q7TA 2GEJA 2NPFA 3SQMA 1E3JA 2ZETA 4CMHA 4TLAA 1QGAA 4D4IA 1YOVB 4OLAA 1ID8A 1XG5A 2HLHA 1TT5A 5KWSA 3P1JA 4IV5A 4HEQA 1E3EA 1ESCA 2WWWA 3A6ZA 2BEVA 1FU4A 3FI9A 3W5SA 4UTPA 4RPIA 4MVJM 5FP0A 5CX1A 4EPTA 1H2YA 1ISMA 2AHRA 1EFKA 3OCZA 4C0LA 5C7IO 2P6OA 3IEUA 4F4HA 1QV6A 4JBIA 4BLOA 2FX2A 3CT4A 3NAQA 1JIXA 1XZQA 4HMQA 2QB5A 2IA5A 4YCBA 5DXAA 3W7BA 4L8VA 4YRQA 1C8KA 3KALA 2CDAA 4ARUA 3DPUA 4LTNA 2ZJ5A 3RBAA 4BO8A 1QE5A 4JBNA 2FFBA 3LP6A 5T8KA 1FQWA 2Q9CA 4ZEOA 4EYGA 3G2LA 1M2EA 2AK2A 4NE7A 3H3FA 1NJ1A 4XKJA 5ENVA 2CNOA 5E4FA 4BMOB 1XD2A 3ITKA 1JIVA 1XQYA 3GDGA 2G63A 3NDRA 2V7TA 1NULA 4MR8B 4EH1A 1BE0A 2DUWA 2QGFA 3G0HA 1VPLA 4ND7A 2OR3A 2P4QA 2REXB 2XUPA 4FW8A 4OB8A 1V7ZA 3NHYA 2BHLA 2P40A 4CLOA 2CFOA 4ZU1X 5K0ZA 3KKZA 1JFTA 3LQRA 4LRSB 4Y9DA 1M9NA 4XVHA 2R85A 4Q7QA 4L73A 4I4TF 3JY6A 2BGMA 3L5OA 5DGDA 5E3HA 1G5PA 1N3IA 2F1KA 3IOMA 4RL4A 3RKSA 5DXFA 2W6ZA 4AUKA 3I9JA 3D7MA 2QVGA 3D54D 2J5BA 5CB0A 5CT9A 4R3WA 3CHYA 4TPKA 2HQOA 3PCTA 1SUEA 3KFLA 3WG9A 2BEUA 1C0IA 4I99A 4UM8B 4C78A 4YJ2A 2B83A 4FT2A 4X9XA 5JCZA 5A9RA 2NO7A 1YBHA 4JLKA 2LDXA 3RAEC 1ZPDA 1C8VB 4GKKB 4D9FA 1CRQA 3AHEA 4CKEB 4WRRA 2C1ZA 2C57A 4Y2YA 1MO2A 1RMYA 5TVGA 1I3CA 3IKMB 3Q5EA 1A0OA 3MYRA 4NDNE 3AH8A 3ZZ1A 5F3WB 3IDQA 3A9WA 4G4IA 5DTEA 4RLSA 2K5UA 2KSQA 2X7HA 5G4LA 1NONA 4A6PA 4AN1A 2DERA 5D3KA 4KQWA 1ZMTA 1UZAA 2Y8EA 1ZWLA 3UMBA 1F2UB 2Y1CA 3I6ZA 1FRFS 4UHFA 5E2AA 1T9HA 3VDXA 1B7GO 2P9YA 4TSRA 2IQ5A 4QG3A 3DFMA 4FR0A 4C2TA 5ER6A 2Y0DA 1K2WA 2YOGA 4HWRA 4R81A 4FOLA 2H8KA 2GCIA 5T57A 4EFLA 1B1CA 2KM1A 4WFQA 9MHTA 4QQRA 2CLSA 1H2HA 4HLCA 4QELA 4YFYA 1E0JA 3P9YA 3C3BA 4G3XA 4BPRA 1BWQA 3FZNA 4KQ2A 4B3BA 4EYKA 1P9LA 4AQYB 4H1VA 2EIXA 4FGSA 1PUIA 3L01A 2ONYA 4ZQEA 1H2BA 3IDFA 2RGNA 1P1BA 3E1SA 3UAGA 1LEHA 4EAQA 1GG5A 1HDGO 3ZHOA 4CYMA 4WKCA 4FBMA 1YHNA 2G80A 2YY5A 4RF5A 1OUMA 2O3RA 3FDJA 3OLYA 1VFNA 3DBVO 3L6OO 3L82B 4MUAA 3C8MA 2CLFB 2IZ0A 1BCSA 1ESEA 2OENG 2OV4A 3KJGA 4Q02A 2FSIA 5JHHB 2B1RA 2R87A 2HDHA 4DSOA 2BWJA 2QX9A 3FJ1A 3ILYA 1CJBA 5HSGA 1SHKA 3OTIA 5IBCA 5C8YB 5BT8A 3HCDA 3L8EA 4WI1A 2VOEA 3CQ9A 3DVAB 2D0DA 1C3OB 2NTJA 1L8AA 2R7KA 4MZDA 2DPLA 4GZ5A 1DOZA 1U28A 5CLHA 4E5YA 4ZT6A 3AL3A 2V6IA 4RA6B 1TVCA 1MAUA 4K6HA 2ERYA 5JAQA 3N2EA 1CUUA 1E7SA 1JF8A 1E6UA 1KEEB 1QG0A 2H5JA 3OFJA 1PS8A 1Z4KA 2BEWB 2I7XA 3JWHA 4QEZA 4FT4A 3G0CA 2PKQO 2BHSA 1A1SA 3WV5A 3GLHB 5F2KA 3W3AD 4CM5A 1FTNA 2Z1MA 3FWPA 5FORA 4KFRA 1IN1A 3JWPA 5HZMA 5JJKA 4K8OA 5HUQA 5BMVA 2Y1DA 3BE5A 3P2MA 3EASA 1NUUA 3KNZA 1QWOA 2GNPA 3E7WA 1B8NA 2HK9A 3EMDA 4TROA 3RT1A 3HV0A 4PGAA 1GXSA 1N1DA 2CLKB 1ONPA 1UFOA 2KB0A 4INPA 1QXSA 4OMFG 1KNXA 5D6OA 4BV9A 4CR7A 4HDMA 4UZEA 2QAGB 4E12A 2OG1A 4GECA 3I0MA 1ZUD1 2Z43A 3B1YA 1XR3A 2OT3B 3A4LA 4FZVA 1FBTA 1QSGA 1TQDA 2R25B 3ZGVA 1PW5A 2ZUFA 1VRCA 3ZWMA 4TMTA 4RD3A 1CC1S 5BNFA 5A9SA 1GFZA 4RTPA 2O3UA 2XWJI 4WK6A 2ZREA 1XDGA 5DVZA 1E2LA 1IJEA 2CBZA 5DK6A 4ZALA 4EKYA 2P30A 4G5XA 3HVJA 1YD7A 4OFBA 2ZJZA 5GY7A 4OGGA 4D0RA 5I4KA 3LNCA 1QH1B 1VYVA 4FHZA 4S12A 3F6RA 2DH5A 3D6VA 3IUSA 1DBPA 5TT0A 3TJMA 5MDHA 4YV2A 4DR6B 3DAHA 2C8KA 1NF9A 4I8IA 1PJ4A 2B98A 3UHOA 1UDBA 2VO1A 4TTQA 3RE1A 3SK0A 3WKCA 4QFCA 3M3HA 1U0SY 3KZXA 1FYWA 1NQXA 4BJHB 2O48X 1XUOA 1KAOA 2FW1A 4GWGA 4DMCA 3GYGA 2RIRA 1IWOA 2I6XA 3DA8A 2ZB7A 3IA2A 5SZJA 2O2ZA 2P6MA 5L45A 5IX8A 4BE9A 4F8EA 1BHJA 2HRRA 2B1GA 1E4YA 4Z9XA 1NSYA 4QWMA 5DGIA 3HPRA 5JH7A 1DQRA 1Z0SA 1CDEA 2OZEA 2NO0A 3FPCA 4KR3A 1GCUA 4FZ3A 4UEJA 5HTKA 4K9LA 5A4IS 1OGJA 1PS0A 4YRFA 3WAKA 3SDBA 5EQDA 1LDBA 1KSFX 1TJNA 1PGQA 3GJXC 4B3CA 1MMFB 3PHHA 2HQRA 2PGNA 2ZR8A 3ECAA 1LSOA 2NYRA 2IUEA 2IV7A 4IY1A 1NAHA 4HDNA 4GF5A 1QO7A 1T8WA 1E9FA 1TGYA 5FRDA 2GGSA 4E88A 2XXAB 3BHIA 1LC3A 3N6VA 3LT0A 4R5HA 1DKUA 1JHRA 3MGAA 3IR6A 3TNDA 1MAVA 1AKTA 5FWYB 1SOVA 2PU7A 4LE0A 1RIIA 1I4LD 1OBCA 1XAGA 3F71A 3QLJA 4GHWA 3ZK7A 2DR2A 3OPMA 1JPJA 4JUIA 1GZ5A 4KACA 3D7RA 1L1FA 3TRDA 1BDMA 1QQ6A 3GGOA 4J2OA 3HY6A 4I55F 1G4AE 2EFCB 2IEYA 1NBMA 4BWYA 3OFVA 3NG1A 3V00A 1MHTA 4LDRA 3A32A 3M4XA 2PZFA 2UZAA 3MIZA 4A15A 4LHXA 1ORHA 4E31A 4F45A 5BR4A 4DS3A 5K6TA 1FDRA 1DU4A 1YKGA 2ZJ0A 8OHMA 3RS9A 4AP6A 1H5NA 1U90A 3ETGA 5KYYB 1JG3A 2AOWA 1G66A 4FE3A 1JTFA 5KNLA 4TMXA 1UPAA 4M98A 2HI0A 5EUBA 2VT3A 5DBEX 2A0FA 2NAPA 3GO4A 3EC1A 4GPZA 4CIVA 4GKBA 4TV8F 5LB2A 3U1VA 4DCVA 5CFMA 1ODIA 2AN9A 3GQBA 2DFDA 2NVUA 3EXEB 2OC9A 4O4IF 4RH0A 4D25A 5EOVA 4KCGA 4CW7A 2QYHA 4GPIB 3OZBA 2ISQA 4H27A 1ULUA 4J43A 3PKZA 3PVCA 3WADA 4U7FA 2Z2YA 1G41A 3QXHA 3QVSA 4IIVA 4ZEXA 4I1OA 3WGLA 2RJ3A 1AZTA 1FFBA 1NLUA 2VNAA 2BFEB 5H16A 3TAUA 3WOHA 1Q2UA 4GZ3A 1QZUA 3LBNA 1X8XA 2P78A 5JPIA 4LBZA 4YO7A 5JZMA 1Y48E 1R5NA 1FS4A 2ZPUA 4KXQA 1JSZA 4AN4A 3BWDD 3A9VA 4RMIA 4EBBA 4CHGA 2WA1A 1IN8A 4JFRA 4XARA 5AMXA 3FI0A 5C0OE 4CXMA 4IOJA 4TYQA 4UUAA 2ZYIA 4B4VA 3B2EA 3OX1A 3FTFA 4LXTA 5T6BA 4AW9A 1BFKA 5EJ9A 2DT8A 4BMYA 4FWTA 2YX1A 5T4EA 4EG6A 4BB9A 1XZLA 3HXMA 3OQMA 2K6GA 3WLIA 3KT6A 2ZAMA 2B5WA 3MCZA 2JBAA 2ZUCA 3NV9A 5H81A 3TRHA 1OFUA 3JQ8B 3L6EA 5KJ6A 3AVTA 5M7EA 3IEXA 3AYXB 1V1RA 2FLVA 4HYEA 1L4HA 1KU6A 4JV5B 1PR4A 4D4GA 2X1VA 4I5EA 3D8HA 3ZBQA 3FVQA 3PCXA 2BLLA 2VSOA 1R0RE 3A4NA 5FPTA 1H4TA 5JPCA 2IHYA 4H7IA 2MCFA 1Q20A 4CNBA 1KFKB 1H2AS 1IU9A 3AEKB 5KYWA 3NHJA 3PGXA 4MDYA 2WLTA 4AS2A 4EKEA 2R4UA 4KFTA 3LHKA 3R6GA 1OAOA 2IPAB 1QMGA 1CRLA 3QYAA 3HDTA 4O4LA 5ALXA 2FUEA 1YDEA 3AJAA 2XB4A 1E4EA 1H69A 2JHFA 2YHIB 3F9IA 2PGXA 5EZSA 4BNYA 4F2DA 5IANA 4EO4A 1N6IA 1Z4MA 4JOQA 4FSDA 4MULA 3GRKA 3GJ8A 3R5JA 3QX7A 4Z4IA 2G8NA 1RAHA 2JI8A 4S1VA 4DSTA 2EG9A 3K4QA 3PEVA 3ZHVA 2N46A 1D0SA 3EWAA 2WFMA 2NZVG 4FMCB 1Y1RA 2Q4RA 4N8EA 1GGNA 1SU7A 2OD7A 2XSZA 5DNAA 3WB2A 2ATIA 1UBNA 3I6QA 3M6UA 4HQOA 4UATA 4ETMA 4RCYA 5HS4A 3JAMA 4YBZA 1Z8FA 3MTAA 4K46A 5K0CA 1H9CA 1DEKA 4C4YA 1ZVQA 2A9PA 3OE5A 4TTJA 4MUHA 1ZUNB 2D59A 2IZ6A 2O4CA 2VHCA 1GNVA 3FA2A 3LWBA 4FZJA 4G84A 4M4SA 3PV0A 2HHCA 4S24A 4YJFA 4E5PA 3K9HA 4X60A 2RHJA 1HG0A 5F2EA 2WZCA 2FPSA 3T3DA 5BP7A 4ISBA 2Z8ZA 2WPDA 1OIVA 2NVBA 1IJKA 4BKRA 4EFMA 2F8MA 3CEMA 4I5DA 1ZIDA 2G4LA 3WMWA 1E2FA 1D1QA 1QH0A 2P1DA 2QQGA 4MUXA 4LXXA 3DQQA 5J2UA 4PYNA 3SS8A 2R1UA 5BRJA 1X14A 3EGOA 5B30A 5KPJA 5AW0A 1UK7A 4EPVA 1ITZA 4B6FA 3PXBA 1E9VA 2DPHA 2TSYB 1OKKD 2XUFA 3UKDA 2FWJA 4DLBA 3C70A 4LZOA 1OHHA 3ZCQA 3TOVA 4WFJA 2P2SA 1ETHA 1XKTA 4X7PA 3T94A 2WP8J 2RSLA 2XIJA 3GFTA 3GT4A 5JO9A 5FA5A 3VH4A 3OZAA 4JEMA 2XODA 3TG2A 4L3VA 1NPTO 4HATA 2XUZA 3PD7A 1PYOA 2WSYB 3JD2A 3K5PA 4DDHA 5MN5A 3HSKA 1R10A 2V58A 1EBBA 2R1VB 2FPOA 1RE1A 3L7KA 4R8KA 1SXJD 2XMSA 2QWXA 2JFFA 1WMBA 2IDJA 2MDTA 2VPYA 2WINI 3W8NA 2IODA 2Q3CA 4DYHA 1WR8A 4FFBB 4QU5A 2I65A 4J0DA 2HJWA 1D4ZA 2J45A 3D3JA 2QP3A 4HAXA 3TEJA 3R0QA 3WLJA 2OBXA 3TRJA 5ESWA 3RC2A 2CFRA 4DL9A 2HZ7A 4FQ7A 2PV0A 1DIHA 4B3MB 1X15A 4PC2A 3GELA 4MUYA 5FWDA 2AKEA 4YLYA 1NFRA 5HUHA 4BFSA 1G60A 1L6RA 1PJLA 3AG6A 3DZFA 2EJCA 3O91A 1XTUA 1MPTA 4NBSA 1KJZA 4L8YA 1E79A 3OSUA 4BCDA 4UDNA 4AF8A 1EFVB 4P6VF 3LCVB 2PEZA 3AIKA 1FX0B 1ORVA 2WTXA 2J3JA 4Z7NB 3MPUA 3QOWA 5AK3A 5FF9A 3ZXYA 1SHZA 4W4TA 5L9AA 3GLGB 2PUFA 3TW0A 1UEXC 4OYRA 3VPFA 1NSTA 3FZEA 1U3WA 2XB8A 1W1IA 3X0DA 5SY9A 4HTFB 5B1IA 4L8LA 4LK3A 2HCRA 2J5XA 2JS7A 2AMFA 3OEED 1HE1C 1L5HA 2BHNA 2FMTA 4HB2A 1TU3A 3QUCA 4DW8A 1I0ZA 1UAAA 2D3TA 3TTXA 2QN6A 2IU4A 3LFUA 3KPJA 1P44A 1QQAA 1D5WA 4RV5A 3ISVA 1ACLA 3AHCA 1ACJA 2R8PA 3EZLA 3PEEA 3MTIA 2Y68A 3MLEA 3WL3A 3C6XA 1V2GA 2I03A 2B8WA 1KVRA 1MO3A 4WNYA 4EQZA 1CF2O 1X3LA 4N0DA 1X1QA 5HJ2A 3L9XA 3EB9A 3N2LA 4W6ZA 3O8LA 4EJ0A 3DE4X 1GZ4A 3OZFA 1WHTA 2JLVA 4OHCA 1FL9A 2LWIA 3HB0A 3H9QA 4FNGA 5GQSA 5LQAA 3W5BA 5AHXA 1KYIA 2BPOA 1IM2A 2YNMA 3G7UA 3I2HA 3OY2A 4V0RA 4F71A 4JC8A 5BN3A 4CKWA 5EIEA 4ZRMA 5FOVA 1XU4A 5BSTA 3BBLA 1U0BB 3E27A 3BF8A 5F77A 1VDZA 2VYVA 5HRCA 1H1TA 2PGAA 3VHLB 4R41A 2JH9A 3MTBA 4E2XA 3T5PA 3HB1A 2O8EB 3S70A 2DAPA 2CNWD 5A5EA 2QMQA 2JNWA 1Y8QA 2QI9F 2RI6A 1Y6FA 2L19A 4LJ7A 1T5IA 2I9KA 1CJTC 1XRMA 3EQ6A 4CMIB 3GYBA 3IPRA 2R62A 1MNAA 3AY6A 4HQ6A 4UAGA 4XCVA 5DCUA 4ENTA 3NHSA 3AF2A 4X1IA 4JZKA 3DJFA 4XASA 5AOAA 5AKXA 2PT6A 5GJWC 3JRNA 3M9LA 3MWDB 4EJ2A 3CMCO 4ZJZA 2BONA 3ZXSA 5ECDA 4OSOA 3VPHA 3Q11A 3VAZA 1TK3A 1OWMA 4IS3A 4DBLE 4FMPA 3GCWA 5K1ZA 1TIPA 4OLHA 4QM7A 4WOKA