4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
3R3VA 4Y2XA 3QMVA 3RARA 5E2IA 1XZJA 4ZXFA 3HRHA 1BN6A 1HPLA 4BP9A 1Y7IA 1G42A 3Q8WA 3W04A 3ESBA 2PKYX 2VSQA 1LGYA 5HFNA 4OYLA 5ALLA 1UK6A 1ZI8A 3HEAA 2AJLI 4G4GA 2HRRA 3ESAA 1PV1A 3DOIA 3E4DA 5ALVA 4AQDA 2QJRA 3V1LA 1FFEA 2WJ6A 3FVRA 3VISA 5HF9A 4B0OA 2QJWA 4X93A 1NX9A 4H7HA 1BCSA 1F8UA 4E11A 4B81A 3UMJA 5J3JA 3D2BA 1E66A 4B7ZA 1WB6A 3IULA 3L1IA 3ZPXA 4Y7DA 1QFSA 3WIOA 4EY5A 3H04A 1LPAB 5FOQA 2XMRA 4FOLA 4J0DA 2J4CA 1Q0ZA 1XLVA 4KJXA 4KRXA 4LXHA 1VOTA 3H2JA 5IH7A 3I28A 2V98A 2B9VA 1LPSA 3G0GA 4KE7A 1Z68A 1XFDA 3WK5A 2WILA 1XKTA 2WHPB 3KOOA 2RIPA 5AK6A 1XRLA 2OXEA 5LZ7A 5ALTA 1FFDA 2XLBA 3BIWA 3I2FA 4N8EA 3SC2A 2XUFA 1WCYA 4HAIA 2WQZA 1J06A 1TCCA 4BDSA 2XUHA 3VJLA 2WIJA 2PSEA 3LCRA 4P93A 3H17A 5EHZA 4Y2RA 1EVQA 1TK3A 3DKRA 3WA6A 4QE3A 4Y2PA 1QIGA 1O6FA 1LZKA 4PF1A 2XUJA 2WFLA 1QIHA 5HF5A 2XB6A 5LZ2A 1XRQA 3I6YA 5BWBA 7YASA 3IUMA 4UFPA 4OYYA 2FX5A 4UBOA 4BDTA 4UHDA 4AMYA 5DWDA 4FBLA 2BUCA 3HACA 1TRHA 2Z8ZA 2OGZA 3TEJA 1ZI6A 5JYCA 3WKEA 2Q0XA 5DNUA 4DNQA 3WLAA 4F0JA 4BZZA 1R9NA 1PJAA 3M82A 5JAUA 3K6KA 4EBBA 1GQSA 4Y2SA 1DQZA 1IZ7A 4TGLA 4L9AA 2E3JA 1YCDA 1HL7A 5ALZA 2OAGA 2C0QA 4K2AA 5LKAA 1J2EA 3LP5A 4J7AA 4O08A 5FP0A 1F0PA 4BCCA 4B82A 3OURA 3R40A 3PF9A 3PF8A 2O2HA 1IMJA 2V9ZA 3D0KA 5AKXA 4UBMA 4J0JA 6YASA 1IZ8A 1DINA 2WJ4A 2QM0A 4BVJA 2EDAA 3BF7A 5E4TA 1YAHA 3WJ1A 5DLPA 5DYYA 1C7IA 1J07A 3W9BA 4DGQA 3D59A 5ALUA 5KWJA 2OCGA 1VE6A 1CUVA 2Y1KA 3U1TA 4OU5A 2HU8A 1LPNA 3A70A 3DL7A 5DNWA 5FV4A 4G8BA 2O2IA 4G4JA 4BCDA 2PX6A 3I2KA 4MYSA 5DTJA 2HIHA 2XUQA 1I6WA 1YASA 1QFMA 2XQKA 1JU3A 2XUAA 2CJPA 4W9RA 5FRDA 3SK0A 4BC0A 1E89A 4H7IA 1E3QA 5IVDA 4UHCA 5C8ZA 1XQYA 4FBMA 3NUZA 3QMWA 2ZJ7A 2RONA 5AI6A 1DTEA 1GXSA 1SCIA 5IKXA 2WUGA 4OU4A 4YPVA 2Y6VA 2WG0A 1X70A 4UBIA 3AFIA 4EZIA 3FAKA 4W1PA 1DU4A 4H7KA 1UK7A 5D6OA 1BU8A 1N8SA 3WWDA 4WFJA 2C0PA 1BS9A 4M0EA 1CLEA 4GDMA 3O4IA 2AJDA 4KYVA 3Q0TA 3PUHA 4HVTA 5AKZA 5EHXA 5AP9A 2V96A 1DT3A 5LYYA 4UHBA 4BAZA 1EXWA 4JUIA 1SOMA 2RHWA 3FSGD 3SWWA 2IIVA 4HS9A 3W2TA 2WIKA 1BRTA 2GYVA 1LLFA 1UT6A 3IVMA 5AM3A 5EIEA 1YR2A 1XQWA 2WFMA 1DT5A 5FPPA 1E8NA 3QPCA 1A8UA 3TJMA 5C81A 4NMWA 1XLWA 1CUAA 3O9VA 1X2EA 3G7NA 3DQZA 2RHTA 3C6XA 4AN0A 1U8EA 3WK7A 4BVLA 2JGLA 5ALYA 4DNPA 3A2NA 4AXBA 2XMGA 5BWCA 1QTRA 2WTMA 4YK7A 2JGJA 1H2WA 2J4FA 4BTVA 3WL7A 3FYUB 5AOAA 4CG3A 3UUEA 5ALGA 1MX9A 5CT4A 1TCAA 2CMFA 1XZKA 4F21A 3AUKA 3OTQA 1JI3A 1LPOA 4P08A 5HK8A 3WMRA 1U4NA 4N5IX 1ZGCA 5T4HA 3NOXA 1QIEA 2WKWA 5ALIA 4OUKX 2HDWA 2HFJA 5LZ4A 3AINA 3HC7A 3IBTA 1UOPA 2WU4A 4FWBA 4GLBA 1EDEA 5CBKA 2ACEA 2CBGA 3EQ8A 4BTLA 4G1FA 1VA5A 3PICA 1B6GA 5HZGA 4BRZA 2G63A 4U2EA 4BRSA 1R3DA 2VA9A 2X8BA 5SYMA 4KAJA 2DHDA 2VJDA 1N1MA 1ORVA 5E4YA 4X7BA 3OOSA 5BOVA 4DMFA 4X90A 1MN6A 3C5WP 5JAPA 4BP8A 1JJIA 1MX5A 2JIDA 3WZLA 1Q84A 1QE3A 5A2GA 1TCBA 2PM8A 2HADA 1N5RA 4BBZA 1UXOA 1MPXA 3DYVA 4G8CA 2H7XA 2VEOA 1XZHA 3ZV7A 4KACA 4EB0A 3OC0A 4UUQA 3A2LA 2Z3ZA 2GYUA 4G9GA 1K8QA 1VLQA 3HSSA 3DJYA 4PSDA 4Y2JA 2G5PA 4BB0A 2WG1A 4FNMA 1VZ2A 3D4LA 5KBYA 1PFQA 2G4LA 3HXKA 5ALKA 4W1SA 4QLOA 1Q83A 4Q34A 3C6BA 1ZD3A 2O2GA 4OB7A 2OPHA 5C8VA 1VA4A 1S8OA 3QVMA 2PSFA 4WFKA 3VJKA 5AKKA 3TGLA 4FKBA 1QIDA 5JZSA 5DJ5A 3WK4A 4CIAA 4C87A 1EDBA 5AM1A 3D5EA 1JFRA 3M83A 5A6VA 2FUKA 5HQ3A 3G0BA 1KU0A 3IURA 4NZZA 4Q3OA 4RNCA 2GZRA 4P92A 2EEPA 4C6HA 3STUA 1K5PA 3ICVA 1RWQA 1XZLA 1DWPA 3IUNA 2HA2A 1EB9A 2OLEA 3V1MA 4ZWNA 3QITA 1D07A 1CUEA 1GPLA 4E14A 5JD4A 1UOOA 4UPDA 3G9ZA 4A23A 3JWEA 5CXXA 5ALHA 1MX1A 2FJPA 4DNOA 1UZAA 4X6XA 3IA2A 2Z8XA 5AKYA 3FLAA 1AGYA 1CPYA 1RYYA 1R50A 2IX9A 1FJ2A 1BE0A 3BIXA 4WDQA 3WK9A 1ZJ5A 2VTVA 1QOZA 1CUJA 1R4ZA 4OB8A 4WDRA 1ODCA 2HA4A 1XRRA 4X92A 4FHZA 1R9MA 1MU0A 3CN9A 2VAXA 3QPDA 5AK3A 2QMQA 5A62A 4ARBA 1F0NA 4U2DA 1KEZA 4NS4A 2CEKA 1AC5A 1ISPA 3CN7A 4ZGBA 4BATA 4L0CA 4LYDA 4G4IA 5IVKA 3H2IA 4QNNA 3STYA 5ALEA 3BF8A 3F98A 4PSUA 3LIIA 4HZGA 5FUMA 1CQWA 4QZVA 3CCBA 2OAEA 4BCBA 5ALXA 5CW2A 3MUNA 5K3DA 1IUNA 2BGNA 5CRIA 4W1QA 4EY6A 4INZA 3AIOA 3ANSA 5JALA 5CTAA 2D0DA 3EQ7A 3EBLA 1ODSA 2QOEA 1XKLA 3C5VA 3T4UA 1P0QA 4WJLA 2DCMA 2JEYA 5YASA 5JD6A 2ZYHA 2YASA 1UKAA 2WJ3A 1SCQA 1J1IA 5CH3A 4UBJA 5ALQA 3GBSA 5BV7A 1LPPA 2H1IA 1ZD4A 1ZD5A 3F67A 1WOMA 5ESRA 1CFJA 3FVTA 3GROA 4XIIA 2K2QB 4D9JA 1EK2A 3AZOA 2I3ZA 1IUOA 1CUDA 3FYUC 2VAVA 3WKAA 1OILA 2XUPA 3QBJA 3BE8A 2FJ0A 2WU3A 3GELA 4PV7A 1JU4A 3O9MA 5H3HA 3WYNA 1LBSA 1JT2A 2HM7A 3WJ2A 1QJ4A 5HKAA 2CUTA 1GKKA 4KE6A 1WPXA 1R88A 1BEZA 3I6ZA 3AIKA 4ITVA 4Z49A 5AO9A 4W63A 4JYPA 2XT0A 2WIGA 4CCYA 1OCEA 3M81A 4XWGA 1MAHA 2ROQA 1CUXA 1IUPA 1U2EA 4J03A 2WHQA 2HA3A 2OCLA 3V1KA 5EIAA 4DYHA 4DLNA 5DNVA 3BDIA 4G5XA 2ZSIA 4J0HA 5JD5A 3H1BA 5FPQA 3IB3A 3E1GA 1OXMA 4U2CA 1N5MA 5JADA 5ALRA 4C88A 2WM2A 3ANTA 1E5TA 4XJVA 4FDMA 1JMKC 1Y37A 3BJRA 4KAAA 5K5EA 4I19A 1XZCA 2Y6UA 1ZICA 4LXIA 4IHAA 2B61A 2BAGA 2XUOA 3I2IA 1BEEA 1G5FA 3FWHA 4FNGA 3WYDA 3STVA 3V48A 5K3FB 4C4YA 2QXTA 4LIPD 3FNBA 3O4JA 3UUFA 1HDEA 2H7YA 4E15A 4AO7A 1CUFA 4N5HX 2R8BA 1ZGBA 4ZREA 2HFKA 2B4KA 2WFZA 1XZFA 1YB6A 4JH0A 1EA5A 5JZ9A 5AHXA 4AX4A 5AKHA 4EY7A 3ED1A 4MQLA 3STWA 1XQVA 5E4JA 4FLMA 3HLKA 1NU6A 1O6GA 1WHTA 1EHYA 3DCNA 3U0VA 1EX9A 1ODTC 2WUDA 5AIAA 3M3DA 4UHEA 1VXOA 1CUBA 4C4ZA 4M0FA 1MAAA 1A88A 5HKBA 3RK4A 3H1AA 1B41A 4WFIA 4B0PA 1YS1X 1GT6A 4QWMA 3L1JA 3QPAA 3GUUA 3LLCA 1P0IA 3O95A 5IVIA 2XI4A 4FFVA 2WUEA 2IITA 3NGMA 4B9EA 2HL6A 2AXEA 4FFWA 3P2MA 2WFLB 1W1IA 5JZBA 2VJCA 1ZOIA 3ZLTA 5FLKA 4Q3LA 2V97A 2OCIA 4X71A 1HQDA 3BJMA 3G0DA 2XMDA 4E46A 4HXEB 4NVRA 3AIMA 4J0KA 5HCUA 2JGFA 2PSHA 4BE4A 3ZLUA 1EK1A 1Y7HA 3OM8A 2C58A 2WG2A 4AMZA 2DQZA 2HA0A 1CR6A 3RKSA 4DMCA 4K6GA 2WHPA 1UWCA 5ISMA 4UFNA 1FFBA 4H0CA 3WQHA 3DL4A 5CH8A 4GW3A 5AI5A 3A6ZA 2XMSA 3BXPA 4PNZA 4ETWA 3VVLA 3S2ZA 2ES4A 1L7QA 2PUJA 1T4MA 4IH9A 4GBGA 3A2MA 3DS8A 1H2XA 3G9XA 3G8YA 3EQ9A 3N2ZB 1CUIA 4Y2YA 4KAFA 3C70A 4J3JA 4QWWA 2R11A 4Y2QA 3D2AA 5C8XA 4QEKA 3WWPA 2VT7A 2C4HA 1YB7A 2XUDA 4HTAA 4Q1VA 3DLTA 1WM1A 3VDXA 3H0CA 1ZI9A 3GFFA 5ALDA 2DHEA 1C7JA 1FSSA 3VKFA 4UBLA 1H2ZA 5A71A 1CUWA 1AQLA 3HJUA 5I9IA 3C8DA 2DR0A 3YASA 5AKJA 1BN7A 1XQXA 4Y9SA 5K3BA 4H35A 1K63A 5JAHA 3VXKA 2XUGA 4LYEA 3GA7A 3TRDA 5AKLA 4HXGA 5CXUA 3WL6A 2J3QA 2GZSA 4BZWA 5AH0A 5T4EA 3DNMA 2NW6A 4FMPA 2ORYA 1ZJ4A 5JASA 4GWLA 3F96A 1GPKA 1CUYA 1XZEA 2XMBA 4H18A 5DTIA 4C01A 4FLEA 1QGED 3C6ZA 2XE4A 2ZVDA 1VXRA 5CURA 2X5XA 1CQZA 4ROTA 3WKBA 1TKRA 5D3ZA 1LPBB 5CT5A 1Q0RA 2OGTA 3BWXA 1YS2X 1QIFA 1XZAA 2VATA 3I1YA 2JGMA 4X97A 2C7BA 4H77A 5JARA 1M33A 2ZSHA 1H2YA 3CXUA 3WWEA 3R3YA 1CV2A 2OQIA 3G0IA 2WIDA 3R3UA 3F97A 4B83A 2QT9A 4UHFA 1P0PA 4L72A 2GBCA 3QH4A 4XX1A 3VVMA 3AZQA 4F60A 4CIBA 5CT8A 4CG2A 2QUAA 2ZJ6A 4J0CA 3WWCA 4I4CA 2RGUA 4EHBA 5FDFA 3MVEA 3B3QA 3W06A 2HA7A 2XQGA 4OB6A 3KXPA 5DYWA 2DFPA 2HA5A 4RE5A 3R3ZA 4I3FA 1DWOA 4OSEA 2BUBA 1XZGA 5AIBA 5D7BA 3AZPA 1XZBA 1YA4A 1YSCA 1HBJA 1UK9A 4Q3KA 1WB4A 4MWSA 1VZ3A 1DWQA 1UKCA 2VF2A 3FYUA 2QR5A 2XQJA 5D3KA 4MWTA 2JBWA 2BJHA 3HZOA 2QVBA 1VKHA 1LNSA 2AJBA 5C7YA 1GGVA 1EH5A 4KEAA 4K5QA 1SC9A 4TPKA 3G9TA 2C5GA 5HFAA 3I2GA 5AM5A 3MUOA 1GPNA 2PPLA 3O4HA 2GBGA 3ICWA 1KU6A 4AZ3A 3I1IA 3EIOA 1E8MA 4UHHA 3SX4A 5K3AA 4AB1A 3D3NA 3FOBA 2XDWA 1K4YA 5K3EA 2CB9A 3WIBA 1AMNA 3ZI7A 2BCEA 4EA6A 1MO2A 2OGSA 2CKMA 5AICA 1CUHA 3I2HA 4V2IA 2PU5A 3G9UA 4U2GA 5AK5A 2XQIA 4DM7A 5ALOA 1DX6A 4QDTA 5AK4A 4Q82A 4KE8A 3R0VA 2HA6A 1R1DA 2GBFA 4L3WA 4CG1A 5ALMA 4C89A 2XMZA 1LZLA 4W1RA 1MTZA 1QIKA 2HU7A 4OD0A 3V9AA 4LXGA 1QO9A 1QTIA 5HF8A 5A7HA 4HRXA 2XMQA 1MJ5A 4ZRDA 2WTNA 3KWJA 2WHRA 1DQYA 2Z5GA 5AI0A 3STXA 2QKYA 1GKLA 5DYTA 1VE7A 2C5FA 3ESCA 3O0DA 3DYIA 2X76A 3KD2A 1A8QA 5ALJA 2HU5A 4QDZA 4MQMA 1W76A 4A5SA 4RPCA 1ACLA 4TVKA 3PE6A 3KSRA 4H7FA 2BFNA 3WK6A 1IVYA 1XRPA 2XUIA 4Y2TA 2WSLA 4MEAA 5EIHA 2QUBA 1CIJA 3RLIA 1YAJA 2PSJA 2EDCA 2XLCA 1XRMA 3B5EA 1W75A 4OPMA 1ZIYA 1EINA 4EY4A 2ZJFA 3CCCA 4K6KA 3C8HA 5T4BA 1LPMA 5ALFA 4PO3X 2O7RA 4ZV9A 4X6YA 5EGNA 5I8PA 1ORWA 4AZ0A 1EI9A 3PDCA 1VJ5A 4A16A 5AM2A 3G02A 1EB8A 3X3HA 4KE9A 2I03A 4B80A 5CT9A 1CUUA 1W52X 3FBWA 5KREA 3IUQA 1G66A 2DSNA 4X95A 4G9EA 1THTA 4H7EA 4HXFB 5IVHA 1GZ7A 4GHWA 3FLBA 3WKDA 1DX4A 2XQFA 2YXPX 4J0IA 2UZ0A 1FFAA 2PSDA 3DEAA 5AKIA 4ZV7A 5LZ5A 4KRYA 1JJFA 3ILSA 1FFCA 2BUAA 2ACKA 1CUGA 4BAUA 3L1HA 1CUZA 5JIBA 2HRQA 3DDUA 1NU8A 2J3DA 5SYNA 2XMCA 1USWA 4F5ZA 3AJAA 3QM1A 5K3CA 1XROA 4RE6A 2OCKA 2VJBA 4MYDA 3D2CA 4AO6A 4DSZA 1WB5A 3ZLVA 4X6UA 3FSGA 4GXNA 2WLSA 3ZWQA 1C4XA 4MXDA 2PUHA 3EF3A 1UK8A 3R3XA 3WL8A 4N8DA 1QZ3A 5AOCA 3WA7A 1L7RA 4K6HA 4Y2UA 5AKGA 2RI6A 2D5LA 4JNCA 1XZDA 4IQ4A 5FXMA 3GZJA 2PBLA 3LIPA 1AX9A 2JGEA 3PFBA 4DTCA 2JGIA 1A7UA 2VT6A 2Y2VA 2OG1A 2JEZA 4BYMA 3MGAA 3H2GA 2BKLA 4QA9A 4U2FA 5JANA 4IH4A 4CI9A 2W22A 5AI9A 3G0CA 2OQVA 5A7FA 3I6MA 2H7CA 3C6YA 4PW0A 3H2HA 2P8SA 1JJBA 1W4LA 1ZIXA 4YASA 3PFCA 3D7RA 3JYHA 4AO8A 4IH1A 4ZI5A 2ECFA 1ACJA 5T4FA 3H18A 1EDDA 4PQEA 3RM3A 5JAOA 4X00A 3H19A 3VJMA 5LKRA 3PI6A 1JKMA 4CCWA 4GI1A 3BDVA 2GBIA 3NWOA 4Q05A 3HI4A 2CZQA 4QDOA 3JW8A 4M0MA 1QLWA 4FTWA 1CEXA 3K9BA 1CRLA 3FCXA 4UFOA 1QIIA 4KR0A 3W9UA 5AKEA 2WIFA 2AJCA 4J0GA 4BVKA 1AUOA 2PVSA 1G4HA 5KWIA 3QYJA 4P9NA 4B9AA 4IO0A 5CH5A 1U65A 4DSAA 5ALNA 3AILA 5A7GA 2O7VA 2XUKA 5HQ3B 4WCVA 4X3CA 5F4ZA 4BC1A 3HYSA 5EFZA 1BCRA 1SCKA 3C43A 3T52A 1TQHA 4EY8A 1JMYA 1UFOA 3V1NA 3N0TA 4CFSA 5AI4A 5CMLA 5AM0A 4YX9A 4UBKA 3E3AA 3HABA 4S0XA 2RAUA 4DMKA 5LIPA 1T2NA 4X94A 5HF6A 1F6WA 3BL8A 3FCYA 1P0MA 4JYMA 1QO7A 2AJ8A 1MNQA 3QMMA 3PUIA 4RGYA 2Y2UA 5AOBA 1UOQA 2QS9A 2DQYA 1CUCA 3K2IA 4ARAA 2WUFA 5CT6A 1ZD2P 3FYTA 2ZYSA 3WWOA 3WZMA 2QZPA 2HHAA 1MNAA 4HRYA 1XZMA 5AI8A 4DIUA 5AJHA 3QZUA 2QTBA 5FKJA 3OG9A 3IIIA 2YH2A 4GEGA 1WPRA 1TAHA 4AN1A 3ESDA 4QDXA 5ALWA 3R41A 5K3FA 3W05A 2PU7A 2JGKA 2H9YA 3E0XA 5AM4A 2ZYRA 1TIBA 2VJAA 5JATA 4Y2VA 4B6GA 1H23A 3OPMA 1E8DA 3C45A 1CVLA 1L7AA 4DMHA 3IUJA 1W6RA 1QIJA 2VQ6A 4B85A 1HKHA 1LBTA 1A8SA 2ONCA 2W6CX 4FLFA 4JEIA 2QRUA 3I2JA 4LKOA 2YYSA 5ALSA 1K6EA 4EUSA 1UKBA 4X91A 3KDAA 3B12A 1EVEA 2ZYIA 4C4XA 4U2BA 3F8SA 2JF0A 2G5TA 2PL5A 1QIMA 3LS2A 4H7JA 5EHQA 2DHCA 3KWFA 4N8SA 1YA8A 2Z3WA 3WKCA 2GYWA 4BE9A 3WI7A 3S8YA 1X2BA 2I78A 1XZIA 1ETHA 4WY8A 4GECA 1H22A 5LLSA 4XVCA 2QXUA 4CCYB 4H7DA 1XRNA 2B20A 4B84A 3WL5A 3H2KA 3FLEA 1CUSA 5HK9A 4LHEA 5ALPA 5LZ9A 3DD5A 1QONA 4WY5A 4G8DA 1AZWA 1XLUA 2BGRA 4MJ3A 1WHSA 3DKKA 4DNFA 5LP1A 4OCZA 4QLAA 3C87A 1MT3A 3IDAA 1GQRA 3O4GA 4X85A 1BROA 4PSCA 1AKNA 5LZ8A 5I7UA 4QDUA 1SFRA 4UBNA 5EHNA 1AURA 3R3WA 4MEBA 1THGA 3DOHA 3WK8A 2LIPA 4BAGA 3STTA 1HLGA 1RP1A 3F9CA 2I3DA 5EI5A
chains in the Genus database with same CATH superfamily
1BJTA 3HN2A 5DNCA 4JSYA 7AT1A 2ZSEA 4MDEA 4I8XA 1Y4AE 5I4BA 1JHAA 1UC5B 1WCXA 1XZJA 2D1FA 5GWXA 5I4KA 1CF9A 1BN6A 1YZTA 3OPQA 4OMFG 1TW3A 4B4DA 4BNMA 4BP9A 1G42A 3W04A 3A6LA 3S1AA 4XVUA 5JBNA 1XX6A 3MBKA 4HEHA 4L74A 3UGKA 3ESBA 4LPSA 1GPAA 2OA0A 2BEVA 4CV0A 2Q2WA 1V7CA 2H4FA 1PV4A 4XUCA 5BSEA 3F73A 2O0MA 2DG2A 2OD9A 1W19A 1I4DD 3ND8A 4K1XA 5ALLA 3MGGA 3KKEA 2ZJ4A 4FGLA 5KIAA 5LOVB 4KBGA 5EY5B 4KXUA 3FTCA 4LPKA 4CF6A 5J2UF 3OLCX 2Y9MB 4BO4A 4MTCA 1DBVO 2EV9A 5IN5A 1Y89A 4LY0A 4B3CA 1N3BA 3B36A 2BBOA 3ETGA 3EXEB 3KZVA 3PPVA 1O95A 1GFSA 1FFEA 1F38A 3IP8A 2YX1A 2FF5A 2R66A 4IVPA 4Q00A 5TQ2A 4JD5A 4BZPA 3R24A 1NRJB 2OZKA 1NTOA 2QJWA 2CV2A 4GAEA 3HS3A 2PWAA 4OUDB 4YN3A 5KVQA 4EW2A 2HF8A 1JLSA 1YS7A 1Q0UA 4GL4A 3L77A 4A8HA 4ARZA 4MUMA 4C0SA 1T3SA 1BCSA 1M6VB 5HOEA 3AXTA 4E11A 3W1EA 3D43A 3VNUA 1E79D 2GF9A 3H87A 4ZU6X 3FFTA 1P1CA 5FWAA 4BNTA 1XP5A 5CBPB 1S96A 1IRXA 1HQKA 1WB6A 3A1TA 4NE9A 3RSGA 1QM5A 2BISA 2HQ1A 2P2YA 3TTWA 4LXXA 5KTNA 3KU4A 5J47A 4Q0MA 3N7AA 1T2FA 1BXRB 3I2YX 5FOQA 5B6IA 5JY6A 2P7IA 4XTCS 2XMRA 4B3HA 4Z9AA 5C8YF 3N8DA 2Q1XA 2Z6UA 1NMXA 1P3DA 1XLVA 2JATA 4RGBA 1O94A 1TYBE 3O0TA 3G88A 4KRXA 4LXHA 4AL4A 3FPAA 1GV1A 1VOTA 2JI8A 3H2JA 3H4MA 3R3SA 2ZZNA 3SHVA 1VDMA 2AN3A 2NM0A 1LPSA 3AETA 4ECEA 2FZ4A 2YZGA 3ILHA 3ZTTA 4EA9A 5AVSA 1RQNA 3K96A 3CB2A 5G41A 5B58C 1REQB 1EHCA 1EFKA 4KE7A 2X22A 1XFDA 1FTGA 1DKLA 3DO8A 2VWHA 2WHPB 2OSBA 2RIPA 2Z9DA 3D3EA 2GGSA 3PGJA 4GR4A 2XAAA 2X41A 1MH1A 3GQVA 4MDYA 1FFDA 5LZ7A 3X43A 4YCLA 3HUFA 2YBDA 2FQWA 3MWJA 3REFA 4BNZA 1RJ9A 2C7PA 1VIAA 2O8FA 1ST2A 1N2OA 1RPNA 2Z9BA 4MWDA 2AA3A 4CUJA 2WD9A 4HEA6 3O2QB 4U3JB 1US8A 1WCYA 1YC5A 2Y1OA 2FCAA 4P36A 4D6PA 4ER7A 3MWDA 2WQZA 3G2PA 3EULA 3C39A 1DLJA 2PMCA 3I32A 4O2AF 2WM8A 4XCXA 2H4JA 4GC5A 4IUDS 3BAFA 3HB9A 2PZFA 4FD3A 1PWHA 4N0PA 4E31A 1AHNA 1QAQA 5T3YA 1V1MA 3PNOA 3JQEA 1PQYA 3ZD9A 2IEZA 2YWBA 3GCGA 4MOWA 4Y2RA 3BWVA 3PFWO 2UYCA 2PH1A 2AZXA 3TYXA 2C3OA 2MHCA 2O3TA 3WA6A 4EG4A 1THZA 2W83A 4RJKA 4DXDA 4A8TA 1QIGA 2A9QA 1LZKA 4PF1A 4CIYA 2WFLA 2ODNA 3KOUA 4RPLA 4WRRA 2C84A 5BR1A 2IUTA 1M54A 3KAKA 3UGJA 1XCOA 4Q03A 1EMDA 1BVYF 4C0XA 3I6YA 3H5RA 4B8WA 5BWBA 7YASA 2R9VA 4UFPA 1MDBA 1LEHA 4X9XA 1JJ7A 5JCOA 1Y1TA 1L7DA 3GNLA 1YDFA 2AL7A 5TB5A 5JFGA 1U8ZA 5JQGA 2P5TB 3KIPA 3IR5A 3KQKA 3A3NA 3KJIA 5JJIA 1Z6GA 2R68A 3BQ9A 2X1HA 3ZU2A 3TI7A 1FQJA 4LSZA 4H2DA 4C0KA 5CJPA 1XDUA 1F5SA 2AHOA 4KKVA 5KNLA 1S4QA 3SHFA 2YWRA 1QVZA 1TM3E 3OECA 3A3OA 3Q2KA 3EXHA 1ZI6A 3BMQA 4XAQA 2Q0XA 2EFHB 2FN7A 4PYIA 1DELA 1AN9A 1FMJA 4L7VA 4OIFA 3AEQB 4YI3A 3WLAA 1Q0QA 2H7VA 4BWYA 4CKCA 4F0JA 2VO1A 3ETHA 4TLEA 1VSUA 1AQUA 1R9NA 4H08A 5E1MA 2UVPA 5JAUA 4KX5A 4X65B 1HYBA 4WZBA 4Y18A 3E3OA 4Q9HA 1JHMA 2ZU0C 5D3QA 1AD2A 3VR5H 3IVAA 1FYVA 2QW1A 4QULA 4B4WA 3D8BA 4P58A 4AC9A 4UTRA 4YHHB 2W2LA 1A7JA 3KPWA 5SY6A 3EZ7A 3A4TA 4YRPA 2O8DA 3VI3B 4LOHA 1T9GS 3AOEC 1D2MA 4R7TA 1B1AA 4G41A 3A36A 5I45A 4JP3A 4RZIA 4MQEA 2ONJA 2G71A 1W34A 4B48A 3T5MA 3EOBI 1K7SN 5KDDA 3CEPB 2P40A 4P3XA 3WIVA 2X0RA 2I2FA 3WRYA 2R6DA 2B3DA 1Y6RA 1SM4A 2QRGA 3GYGA 5FTWA 4K2AA 3P0FA 2UYQA 3S8MA 2CY0A 2WEKA 3QBDA 4WLNA 4M9UA 2V7XA 3R6GA 4QPJC 2PWPA 5IABA 1H66A 1TLTA 3FPJA 5JJ5A 5G3YA 1RBZA 5K0TA 2KYRA 2PKEA 1F0PA 3ZJ4A 2QRZA 3A06A 4DSNA 2D7JA 3HJHA 2OZLB 3HDYA 4UVGA 4B82A 2G6TA 3MCUA 3OURA 3R40A 4BQRA 2C8JA 4EI8A 4URFA 5BUCA 4LF9B 4EP1A 3C3DA 4V03A 2V9ZA 3SJZA 3D3WB 4UPVA 4XIFA 5BWMA 1TL7C 4F4HA 3D0KA 1LDYA 4MI1A 3TE6A 2XADA 1PT6A 5BT9A 4LNUA 1QSGA 5GAJA 4RVUA 3PL1A 6YASA 2AVNA 1S3SA 2EFGA 2HXYA 4R1QA 4ZEXA 1IZ8A 4QNMA 1DINA 4RPKA 3AB7A 5HNKA 1M72A 3D0RA 4OHRA 1EZ1A 1L1EA 1RLJA 1XMQB 4BVJA 3RVQA 3AEXA 3OQBA 4L8YA 4TV8A 5KQGA 1YAHA 2HPZA 2JAXA 3ZE1B 2J87A 4NV1A 2BR3A 4B3DA 3JD2A 1JW9B 1Q0HA 3UFXB 4MUBA 3NWBA 5BSTA 4ZTBA 3WTCA 4KO3S 2FP4B 3GUYA 2ZBRA 5HRUA 1WW8A 4LNUB 3R7SA 1RXWA 2AOVA 3CNOA 2WTAA 1W94A 2VNKA 2OCGA 4J91A 4DSTA 1G55A 4OAOA 4CQLA 2YV5A 4EJ2A 1P9RA 3ON5A 2PFSA 1Y7LA 2VSOA 5JPIA 4C22A 1O4WA 4OSOA 5JJKA 1P17A 2Y1KA 4BKQA 2XB9A 3AVWA 1IULA 4CN8A 4OQXA 5KTPA 1UPFA 2GVNA 3ZBPA 2LDXA 1U9CA 1KDYA 5JPCA 5FYDA 2KM1A 3TLJA 2O3UA 4FDAA 1GAXA 2QU8A 4URWR 5D1HA 4A15A 3D6HA 4M0UA 5FV4A 3RD5A 2P5SA 2OM6A 4NU8X 1AXGA 3D54D 2JKVA 4JZYA 4LBVA 4G8BA 4AJ1A 3LZ6A 5FI5A 3QHQA 3RS4A 1FJXA 1P7WA 3S6JA 4JLPA 3AU9A 4QL3A 2PX6A 4M88A 4Z4FA 3GH3A 3IESA 1G8HA 1VJRA 4QQ8A 2AZDA 2XUQA 2QIOA 3WAJA 4BEBA 3B1KA 2AFRA 4X3PA 4CTKA 1IY1A 3M4ZA 1FJGB 3EEQA 2VCYA 4R3WA 3CGGA 4MMXB 4BTEA 1PO7A 3H1EA 4JI5B 1L7MA 5TQJA 4B2YA 4RTRA 2BEUB 1IMOA 3QU5A 5A4DA 2CJPA 2E55A 4IV8A 4W9RA 3K20A 5FRDA 4AK9A 5CB4B 2IKQA 1Q1QA 4DZRA 5LP6F 3KHKA 1E89A 1H5UA 1E3QA 2RAVA 4O02B 3LK7A 3J81A 2R2AA 2WJHA 1JFLA 3KYDA 4JLNA 2QY6A 4O1IA 1Z2CA 1RWVA 1Q7GA 1YQUA 2X3YA 4NRDA 3ZZTA 4RFSB 2HF9A 1NVDA 3GFQA 2YL2A 4QTUB 3QMWA 3WE7A 5C51B 4CL0A 4PRYA 3TIIA 5HILA 5LVAA 1UIMA 1UMCA 3KOMA 1TQ2A 4G8JA 4HQFA 2PFKA 5TC4A 4IMIB 3TH5A 4BZQA 1S01A 3HH8A 4DR5B 2IGBA 2YQ5A 2P6MA 2ZTHA 4XFDA 1XQ6A 3B2EA 1JU9A 2BE7A 3OFSA 3LE8A 4HDOB 2C3PA 3E3NA 3QEMA 4P53A 1Y3HA 4U7WA 3WV5A 2VK1A 2DWCA 4TS9A 1P91A 3QYAA 2C1ZA 1Q7EA 2QY9A 4UUAA 4W7HA 4XYMA 3W3AD 1JEYB 1ZJZA 2NV6A 4MVJF 3PD0A 3KPUA 2JLQA 2I3AA 3FAKA 3KQQA 4W1PA 4DUPA 1NYLA 2VUSA 4Q3EA 3PHIA 1LX6A 3PNQA 4MMZB 1ZM9A 5L3RA 3IJEB 4F1WA 4XGKA 4Z7NB 4HFMA 1GSOA 2IIBA 1C0EA 1M6NA 1RWPA 2O0LA 2Q0QA 2H18A 1QWOA 3IXMA 2QPTA 3JQ9A 5G2OA 3ETCA 5D6OA 1X8XA 4MV3A 4O2BF 4DC9A 3PDIA 3F74A 3BMCA 3QUAA 3WWDA 1YOVA 5DFAA 4KWCA 2C0PA 2NZ8A 1BS9A 5LQJA 2WV7A 2GKOA 1WEHA 3CF2A 5TSDA 1XTBA 2F67A 2G9VA 2J45A 3O4IA 3OLXA 2AJDA 3EZ6A 4LF8B 3L8ZA 4A0HA 1HGXA 4WCFC 1ZCZA 3OEYA 1ZX1A 2PZEA 2YWFA 3PUHA 2WKQA 5AKZA 3GLVA 4YXWA 2VK2A 1DPFA 5TEWA 1BMFA 2FLWA 1JR3A 2B35A 3WGLA 4B2PA 4UHBA 4LQCA 1ECLA 2PCLA 2VQ3A 3PQCA 4NENA 4L0MA 2WF9A 3QFCA 1W581 3GRKA 5JDCA 3FSGD 3SWWA 2WQ6A 2VPYA 1SMKA 3QXSA 1NXVA 3VZRA 4EI9A 4X20A 4IDDA 3A6KA 3K70B 3OWXA 3LQ1A 4HS9A 1E6KA 5DXAA 3KHTA 4D9NA 4OP2A 1DZ3A 2XCTB 4D92A 2WSYB 4OM7A 3F5FA 2FSHA 2B30A 4WKBA 1BRTA 3QKTA 2PX2A 4S0ZA 1OZAA 4BNJA 3QOWA 1FBTA 4MP6A 4AY4A 5AM3A 4EX7A 3IDSA 4MAAA 1GQFA 1XQWA 4IDAA 1OC4A 4PYLA 1WETA 2I65A 3QUSA 2VI5A 3RU7A 5I7FA 4OQDA 4DDWA 3EW9A 5FPPA 1IXSB 1DEAA 3CMMA 3SFVA 4A5OA 3QPCA 5IDQA 5LM3A 1KQGA 1XN4A 1T36A 2LDBA 1ZN9A 4NMWA 4J1TA 1E2IA 4WCFA 2OMEA 4AZ3B 4EELA 1XLWA 3OE4A 1Q3TA 3GV0A 3HL0A 1V45E 3OQJA 3SQOA 2BMJA 3C7KA 1FXWF 4NR0A 3VDNB 3J81k 3ZS8A 1JKXA 1GPH1 1NW5A 2J3LA 3TOSA 2V0GA 2QG6A 2RHTA 3DZJA 4MCIA 3W2IA 3ICOA 3HSKA 1BE6A 1GA4A 4WACA 1KMHA 3BXEA 3EGDB 4HS4A 3QEJA 4R2LA 3OFVA 4YRQA 5EJIA 2ZKIA 5ELXA 3M9LA 4FZ3A 1TKCA 1N1EA 2FPWA 3NIWA 1SBZA 3A2NA 4MV8A 5ALYA 1NE7A 1XD8A 1Y63A 4TUYA 4B45A 1YXMA 3N5CA 3O91A 3OJ0A 5CJ2A 3VU0A 2YV3A 1G1MA 1ZMBA 2D2XA 2NTEA 2XMGA 8ATCA 1U8UA 1RJGA 1M6HA 5HS4A 3QY0A 3PXAA 1R6XA 1RYFA 4JJIA 3LP8A 4CFZA 1BAPA 2I7CA 3PK0A 1LRJA 4GSKA 3VZDA 1H2WA 5KHAA 3VYVA 5L3VA 3LMKA 2LBPA 4AWXA 1QF9A 4X62B 3WL7A 2HUPA 1CY6A 3G7SA 3M6FA 4LMBA 4PLYA 3P7MA 3WDKA 2RH9B 5LUBA 3GLFA 3UUEA 3BZUA 3AVTA 1Z6AA 4C04A 5J2TB 3VVLA 2GAAA 4NFYA 4D97A 1SIUA 4OXYA 2JD0A 3EAFA 4F21A 3AY3A 4C0LA 5A04A 1Z25A 4O4LB 3G2LA 4NPCA 4OHUA 4P08A 4R8MA 4XQCA 5DGDA 4UVIA 3OJEA 3UB4A 4TYYA 4N5IX 5D6NA 2ZVJA 3R8FA 8LDHA 1BDMA 1TZCA 1PFWA 1X87A 5FEMA 2WKWA 4UNRA 4Q7MB 1E0JA 2MOKA 4EH1A 3ZR4B 4HAUA 1QQBA 4ZQHA 2OMKA 4BB5A 3AINA 4JLUA 5E95A 2WU4A 2FOLA 3BPSA 4YAKA 4ZYTA 4XM2A 4B3RB 2O3SA 2OT3B 2CBGA 1SCJA 2N42A 1FYFA 2Q5HA 3ZCQA 2WWIA 3FNQA 1H2AS 3NRJA 3WGIA 1RI1A 3EQ8A 3HDGA 2C2HA 3ISJA 4IHKA 4Z0HO 3VYWA 4KLNA 1VA5A 1EU1A 4OI4A 3MTAA 1A95A 3BSWA 2A35A 3OCCA 4J16C 4BRSA 3VTKA 1NVEA 2BV3A 4HWKA 1QZXA 4GOMD 3T7IA 2P3OA 2B8NA 3LM8A 3AUYA 4RLFA 3NV7A 3EVDA 2BEWB 1XR3A 2GBLA 3SIRA 4CMAA 4AY2A 2ZR9A 3MAGA 2QN3A 2IPXA 4PYQA 1YDHA 2XY4A 3CLHA 1GRVA 1L7EA 1ORVA 1ZISA 1RRGA 5B1YA 4RIFA 3FUXA 4BPBA 1J20A 4Z99A 3JALA 3PGXA 3LRTA 2X13A 4F3TA 5GVSA 5JCJA 2HSDA 1TJNA 4HZUA 3VU1A 3OQVA 5JAPA 4DIMA 3SDSA 1P5JA 3DFMA 2X2PA 1RM3A 1CJBA 2PL9A 3QG5A 4ZP1A 4LYFA 3NTUA 1CE8A 1YGYA 4D4GA 1UBJS 5DEOA 1OKKD 3GRPA 4FI3C 5DLDA 4DRXB 2IV2X 1G3RA 3OC6A 2PM8A 3EMBA 3VR2D 3VZCA 2HADA 4JDPA 3A1EA 4BBZA 1FU4A 1U8CB 2O50A 4QUGA 5HQTA 3LC1O 3PPXA 2ZSBA 2FZKA 3F7TA 1SXIA 4YJ2F 2G67A 2D7CA 3CE6A 4HX5A 1WRBA 2OR3A 3KYCB 1KO8A 2H7XA 5FPSA 5HCNA 3UATA 4DA0A 2WE8A 4MIOA 1GGFA 4Q9AA 4F8JA 5JTTA 4PTYA 4Q4LA 3ADBA 5FL7D 3V1YA 4HB0A 2VQDA 3OQ1A 1E3SA 1NI3A 2D3TA 3DBHB 3TIFA 4M38A 4KQWA 4MYHA 5FI3A 4EA7A 1Q3HA 3WFZA 2CC2A 3TDKA 2XNSA 2XE6A 3DXZA 2IWRA 3SOPA 5FCDA 2D2IA 3NBAA 3FA2A 3IR7A 3GFSA 1Z4LA 4HYTA 2ZBUA 5FO0A 1PKEA 1J2UA 2QG9A 2OENG 4XYGA 4PSDA 4Y8VA 4AKSA 5BNIA 4Z9XA 2G5PA 1YB4A 3H16A 1Y3CE 3NP7A 4IJMA 3IVXA 4GX0A 3U7EB 4BB0A 1A50B 4YROA 2X9QA 2ICAA 3W5DA 1QGOA 2A0FA 2J1LA 3D4LA 3W1VA 3ZVMA 2IYZA 2X19A 1GUAA 3QK7A 5HIJA 2D62A 3GT7A 1DEHA 4K87A 1D6SA 1MJFA 4UU8A 3M4XA 3ZW7A 1XZNA 1L5SA 2W6ID 4BGEA 1HMYA 3E7FA 2GERA 3GVIA 4A0RA 4Q34A 3RS3A 5FH9A 1D4AA 2WSBA 2AZ4A 2UYOA 1PFGA 5C18A 3UMCA 3Q9UA 3IPAA 2CXOA 1K6IA 4R2IA 4LISA 3RF7A 4OB7A 5ITWA 3T6KA 1TTTA 2XTZA 4PZYA 1RAFA 1DMSA 4I50A 2AV6A 3DVRX 4WZAA 1RM0A 2PSFA 3GLQA 1CZNA 2ZVPX 5CYFA 4HWOA 1HUQA 1KSHA 2F3SA 4QGHA 4ZHSA 4LXQA 3L4BA 1QIDA 2C4TA 2F8LA 5THXA 1BHJA 5F2KA 2AN9A 4EY3A 2OV8A 2YV4A 3FW1A 1MQSA 3EQ2A 5ICFA 3AB3A 2R1TB 2BCJQ 4JUBA 3UVEA 1MO5A 1UJNA 1O0BA 1SVLA 1X0VA 3DVAB 2FUKA 5ULLA 3R0QA 3BXHA 2VR1A 3V8MA 1SGWA 3T9DA 2ZI6A 3B6ZA 3QTTA 2JFUA 1XVAA 3PEYA 4P92A 1EVKA 2EEPA 4C6HA 5KOYA 2Y77A 3STUA 1Z0DA 1P4JA 1OAKA 4MQ5A 1VGQA 3IAM6 3SMVA 4D8XA 5IAAA 1U3GA 3FMFA 1LS6A 3PYXA 3LU1A 3IUNA 3T7SA 3DW1X 1USKA 2GCIA 1JIQA 2W6IA 1X38A 2LPMA 4BFXA 4CM8A 4DV7B 3ROXA 2FPXA 3F1LA 4GU5A 4ZWNA 4ENQA 1EXDA 2NVBA 4JYCA 3UANA 2QP3A 1CUEA 3M89A 3F78A 2G25A 3LPCA 3C15C 1GA1A 2FUCA 4UPDA 4D26A 4BWGA 4MRNA 1PR0A 1TPZA 5CXXA 3NHUA 5KI6A 4I4TB 4A23A 1KC3A 1KVQA 4DNOA 4OXQA 4MKZA 1EFCA 2AYXA 1H65A 2ZRNA 1LC3A 2JRLA 2Q28A 3OZDA 4M6WB 1EUCA 1QGYA 4HVLA 2G4CA 1AGYA 5DN9A 4UASA 1M1YB 4XIYA 1B0PA 1K5DA 1TXGA 1R50A 1UXHA 1QRDA 3L79A 4FW8A 1SVNA 3LY9A 4TS3A 1PFVA 4FIDA 3O1HB 1VHWA 2BEJA 3E9DA 3QFSA 2V7GA 2WWYA 1BE0A 5GINE 2AQIA 3R0JA 3LC7O 4TT3A 1A9XA 1C7ZA 1T6NA 2WAOA 2J4DA 2X2FA 3DB1A 3N2GB 2V54A 5B1HA 5IEJA 1TM2A 5AHRA 3DBHA 3ZOZA 1EFAA 5L6LB 4DANA 1M5RA 3LGAA 3HKBB 4BNIA 4ZZ2A 5JD3A 3IP1A 1NLZA 4NS1A 1ZW1A 1ODIA 4U0KA 1VP3A 3M4YA 4MAFA 5JJLA 1M73E 1R4ZA 1UBFA 4HYQA 1G8PA 3NMUF 3ZIDA 4UKDA 3E6AA 2P9GA 2HA4A 2FXIA 4HTFB 4BNUA 5TE9A 2WWRA 3FPBA 1JR6A 1MU0A 2JLWA 3VRHA 1OKKA 1X1RA 2XWQA 1LLDA 5CXQA 2XDQA 2VDUE 3KR1A 3IALA 3N2GA 5EA2A 1RJDA 2W2KA 1ZJJA 2EJTA 4JLOA 1NF2A 2QMQA 4AZTA 4DADA 3TZEA 1SIWA 3VKUA 2I4TA 4UOEA 4D4JA 3N39C 1V4BA 4B32A 5A62A 4ALIA 2A9OA 3EGDA 4KOAA 1XKQA 1F0NA 3OSUA 3I9OA 1FSZA 1WEKA 1MIHA 2CEKA 1BNCA 1AC5A 1ISPA 2R6FA 2GPTA 2RGEA 4GRDA 4PNHA 2ZUDA 1C3OB 3RS2A 3A9UA 4Z2YA 1M2NA 2OKGA 5AW2A 3WGMA 1S3GA 2GTPA 1E92A 1OXKB 2B78A 2HIMA 1TMYA 1PTKA 4WK2B 4NCJA 1MBZA 3HVKA 4CHGA 5EIXA 5JLJA 1GD1O 4L4XA 5HX7A 4O0MA 2ETVA 5E0KB 2HKIA 3RRMA 3W5AA 3O93A 4NCBA 1N33B 1GQQA 1G5RA 1NNUA 1Y9EA 2PH5A 3F98A 3KJEA 4RV9A 4G5GA 2VYQA 1QCZA 1YULA 2GN4A 3GK3A 4OA5A 4OIMA 3TN7A 1II9A 1CQWA 3USCS 5H68A 2OAEA 3PTAA 1EUDA 4PYJA 5CW2A 1KP2A 3MUNA 4MDHA 3NM4A 1FP6A 4LGMA 3TNDA 1P29A 1VLZA 2YS7A 3OMXA 5JYBA 1Z5WA 2Q9UA 1LBHA 3UHJA 2BGNA 2A86A 5CRIA 4X64B 2IELA 1IWOA 1GFWA 1DQNA 3QEKA 3HVJA 2IYXA 1JLLA 4KR9A 2BT4A 5CTAA 5JALA 5B30A 1DAMA 3A6JA 1CETA 2DUNA 4B6FA 2XXJA 3OKCA 4YB8A 2FX3A 3S68A 4FOSA 3EUFA 3CY6A 4V0KA 1OHHD 3N05A 3IDOA 3T1VA 1O97C 3TZLA 2FX2A 1NJ5A 2QNIA 1XLTA 2QOEA 1OWOA 4KVFA 4NNJA 1Y4SA 1XKLA 2QTVB 1GUYA 4QX6A 1JP7A 4WJLA 1JSRA 1LQTA 3PL5A 3NI2A 2Y0EA 5DHFA 4W5OA 5YASA 1YBVA 3U4IA 5K4GA 5EN4A 2GEJA 2YASA 3C3BA 4BMNA 2WJ3A 3RSCA 2GNAA 4E22A 2F90A 4PPGA 4Q24A 4R54A 4D4LA 4DIKA 4V0OA 1EFDN 4WJKB 4Q7QA 1SCQA 3LT5A 3AL3A 4O4JB 3RVJA 1QB8A 1QWSA 5L3SB 5CH3A 2E1PA 5H7XA 1YWGO 5TR9A 2PHZA 1XPJA 1EKXA 2RGAA 3HQ4O 1PQUA 1QBKC 1R66A 2Q2OA 5IU6A 1PZMA 1ZD4A 5J4HA 2ZSDA 4L5YA 3SF0A 3TCXB 3LP6A 4BJHB 1MB4A 1MO4A 1M34A 2CNLA 2QTWB 1BFUA 4L16A 3W8EA 3BXOA 5JZMA 3EVEA 1SHZA 1HKUA 2C00A 2ZATA 3HHEA 2XVAA 1CUDA 2C95A 1CY2A 2RBKA 2VAVA 1RHRA 1IPHA 1X7YA 3BE8A 1NIJA 4RF2A 3C1UA 2I91A 4JU9A 1RHKA 5FO1A 3JYQA 4J9UE 4MPJA 1PYDA 5H3HA 2P9ZA 4MLZA 3P97A 3WJ2A 3TEFA 3DAOA 3H6KA 3U1VA 2R87A 3ZBUA 4Z7QB 2EKPA 4HJXA 4KWTA 2HDHA 4D79A 1NN1A 5HZMA 1WPXA 1CR1A 1BEZA 4OK5A 5GJCA 2RCYA 2B4TO 4FYJA 4ZYWA 1TIPA 3GLIE 1OU0A 1U0BB 3WLTA 3I6ZA 1OFTA 4BVEA 1Q7BA 4B8ZA 1QB7A 4U63A 2PRYA 2X1LA 3TSYA 1TI7A 4NAHA 4Z49A 6AT1A 4CKEA 3DLHA 2CLOB 2OILA 4W63A 2HPAA 2EEZA 4JYPA 1NLYA 2ZE8A 1WUTA 5BW8A 5U4XA 2G77B 5EHGA 3EX7C 1A98A 2JLCA 1UDAA 3SS7X 2R00C 2NO9A 2LUOA 4AFNA 1K8YB 4BGUA 2ROQA 1RWOA 2X4LA 5KWSA 5IULC 1MENA 2V7BA 4P4SB 1VI5A 5KCZA 2CD9A 2CFRA 3JARB 3RSHA 1KIMA 3OZBA 1VPDA 3PSHA 4HDSB 1OPXA 1LD3A 1B6TA 3P32A 2BL4A 3DUFA 1GRNA 2NSJA 2PGXA 2WHQA 4J03A 5JY1A 1Z06A 1B16A 1BKSB 2WSSD 3T15A 3JZMA 1YR8A 1J2RA 3A1UA 1V5EA 3BERA 1Q14A 2FW0A 2C1XA 2C2BA 3IJRA 2VOEA 3KHUA 3OEEA 3R6WA 3WGOA 5E9JA 3UK6A 4R71A 4G4SP 1JIIA 4YP5A 2UUCB 3W90A 2FPKA 3EZLA 5DNVA 3E2PA 2GN9A 1SHKA 3QKWA 2ID9A 5JBQA 3GJTA 3QLVC 3NTOA 3H1BA 1YUNA 2ZAMA 3LW8A 1E7QA 5CVDA 1N2EA 1QTQA 4RMNA 1LQ2A 2E4UA 2FQXA 1JTEA 3IB3A 1R5BA 3CO5A 4X63A 3CT6A 4QQNA 3R76A 1VCNA 1W2WB 2HAEA 1J8VA 3E1GA 3VSCA 1OXMA 3SJUA 4U2CA 1JKJA 1L5OA 3IGFA 5JADA 2Q5IA 2GLTA 2W6ZA 2DTXA 5JH7A 2FWRA 2IEGA 1XCLA 1WZUA 4LECA 3FOAA 1SU7A 2J3JA 1E5TA 4X8HA 2O05A 4XJVA 1JR4A 1BS1A 1JMKC 1XE3A 1Y37A 1HEUA 4RVDA 3EWIA 3K5IA 4CMCA 2I5PO 1O9BA 4QXQA 4CUZA 5ITZA 1XB2A 4DV1B 3H8VA 2XTNA 4ZU3A 5ESXA 1E7RA 2W8BB 3H99A 5AXAA 3M33A 4I1IA 3GD7A 1XZCA 5A5DA 1Z0JA 3IJPA 3PS9A 4IHAA 2VHJA 3HCOA 1TLFA 1WULS 1EUYA 4MVJH 2DUMA 3OPYA 3CZPA 1GCUA 3N6RA 4EG8A 4ATNA 8MHTA 3IHKA 3ICCA 5JAQA 1UBEA 5K3FB 1H3EA 2D06A 1GVNB 1ABEA 1XALA 3A7DA 3T06B 3HG7A 3SDZA 2ATVA 5CAEB 2HHLA 2SCUA 3UXHA 5LP6B 2X5OA 4KIUA 4P8RA 4Q6BA 1MZPA 1XXHE 3B85A 1JFFA 4MGYR 4G84A 4JBLA 4ENWA 4BXOA 3UUFA 1PJLA 4E15A 1SQ6A 1FB5A 3GFTA 1BMQA 3IKLA 2PUEA 4LZJA 2YOGA 5JXIA 3K6JA 2XNCA 2AOUB 3VZPA 1EJ2A 1BGXT 3QA3E 3BZWA 3O4FA 3CA8A 3FKQA 3H8SA 1DO2A 4ZREA 1FSPA 2NU9A 4II7A 1RAHA 5EKSA 1ZD1A 1C30B 3V9PA 2PUWA 2PXAA 2W6NA 3B7GA 4ZALA 1XZFA 3TQRA 3VSAA 3OCJA 2ZRIA 3JQ7A 3PCRB 1WXHA 1X7YB 2P9CA 3ER9A 1VG0B 4MHTA 5AHXA 1RBQA 4U02A 2P6RA 2PMBA 1XZQA 1HTTA 3IPLA 4OLJA 4F5EA 1UBTS 2H2GA 3ZDQA 3STWA 4CYMA 1XQVA 1H42A 1JHXA 2ONKA 3JQDA 3KLMX 3L1UA 3QPUA 1O6ZA 1RM4A 3KOYA 4KR6A 1YVEI 4FLMA 2XVZA 2YN0A 1O6GA 3P0RA 1BWQA 1CJKC 4QTZA 4H6VA 1WHTA 3U0VA 1SEPA 3PQ3A 5TPWA 2FW9A 3O5AA 1EX9A 4IUBS 2O06A 2R8YA 2WAXA 3A25A 4MVJE 1HK7A 1Y98A 3TBHA 3ZHRA 3W0LB 3CNBA 3MLBA 5LA6F 3TM4A 5FUQA 1U2SA 2OSVA 3M3DA 2ZRDA 3UJCA 2WDZA 1P8AA 1G59A 3LWDA 2ZITA 2UUPA 1WD5A 2C8VA 4UD2A 1X1AA 4GZMA 2AQKA 4ZPJA 1ICIA 4PBSA 4ZT7A 3S2UA 4M0FA 4C4ZA 2ZS7A 3WXBA 4OBEA 3Q7RA 3RFUA 3LLUA 1KAOA 3KOZA 4CDMA 1CXZA 4GVXA 4R1MA 4S04A 2QT0A 4QPDA 3IEMA 2VK4A 3PLNA 8ABPA 1V48A 3FY4A 4JASB 4QREA 3HFJA 4IGIA 2V6FA 4R8LA 1XYVA 3ZYZA 1YS1X 2IVZA 5M7EA 1TTQB 2FUG1 1WF6A 2V5AA 1P5HA 4JJGA 4L27A 4QDKA 4ZODA 1KBOA 5FF9A 1IEVA 3IPYA 4TKMA 1I4TD 5IKMA 3GUUA 3TFQA 2QQFA 3RBZA 1JT9A 1IM5A 1ZK2A 1VBNA 2E4WA 2PL3A 3H65A 3O26A 1SXJD 2WV9A 1NF9A 3GLFB 3W4KA 3LFUA 4CMEC 3UAXA 4DCVA 2AQHA 2B6NA 2AYZA 1QKJA 2IOFA 3OKAA 1EFPB 1JVNA 3K09A 2AXEA 4TYPA 5DNEA 2IBSA 3PEEA 4E32A 5E1OA 5G1OA 1KNXA 1ZGJA 2EQBA 2GPNA 3GJXC 1XTUA 3U5ZB 1KYVA 2GILA 1P2TA 2GPAA 3Q10A 1ULAA 5KUTA 2G80A 2IZOA 3MCVA 4RD2A 3H4TA 5EC8A 2VJCA 2QD2A 2JIPA 4L6IA 1ZOIA 3V4OA 1G291 2A7XA 4DJDC 5EERA 1H0RA 2OCIA 3GLHE 1L7PA 2C5HA 4W6QA 3ULKA 5BYJA 3LZDA 1X9IA 4REQB 3UAYA 2PQ0A 1I7SB 1Z0KA 2BFBA 4Y9DA 1P72A 4WGGA 4G86A 4O3FA 3ZGOA 1AUPA 4FMDB 1YJ5A 4BL5A 2NUAA 5CCBA 1ZH0A 3ENZA 4NVRA 3QEMB 2QG4A 2Z98A 4FGZA 2NOAA 5EXEA 4P80A 3OM8A 2C58A 4AG6A 1MQ8B 2DQZA 3RYIA 1X1CA 2HA0A 4CIDA 4WXRA 1SA0B 1S1MA 2OWDA 2G09A 2PLFA 2RIRA 2VTDA 1IB0A 1KERA 2PXCA 1P61B 3ID6C 3IVCA 3NEPX 1ADGA 1MV5A 3IT2A 1ZOSA 3LNCA 4HGYA 1WE2A 3TIXB 2FEWB 4PCUA 2XCLA 4DS3A 5ISMA 1XDSA 5EWLA 4MIKA 4TLAA 4F9EA 1Z33A 3IKJA 6REQB 1YE5A 3HA3A 2VUUA 4BIMA 1ZGHA 3S1LA 5BMVF 2PGJA 2EZUA 2V6GA 1FNMA 5AI5A 3FOZA 3A6ZA 3NDRA 2YWCA 2JGDB 1H2HA 3QE3A 2XMSA 1JEAA 3OAAA 1NDQA 2WYVA 1WUHS 1XMPA 2RC5A 4RL4A 5SY4A 2HLNA 1Z8DA 3HPQA 3EZ9A 4P31A 4XB2A 1Y6ZA 2ES4A 1M8PA 2QTVA 2YW9A 3AJRA 3HEBA 3S2ZA 2D2VA 4YLEA 4E30A 3HCFA 4ND7A 3K0CA 2XBUA 3IEKA 3EXHB 2PCJA 2QW8A 3AF3A 3G9XA 3NUQA 2CYBA 3L6UA 1M2FA 3N2ZB 3H5OA 4TOIA 4TWJA 1MJHA 2JA2A 2C9BA 3BGDA 3WV4A 2C5AA 3K4PA 4KAFA 4WXEA 3RYIB 1W5TA 1XRJA 4XGQA 4IJWA 3JASB 3BGVA 4ENPA 2R11A 1SU4A 2QN1A 4FFBB 2YXEA 5EVCA 5KEIA 3OZVA 3UW1A 2Z5LA 3GAAA 4RZ2A 3D2AA 2P3SA 5JV5A 2VLIA 3DWFA 1QO0D 4HH1A 5EXDA 3T1YB 3MJSA 2MWMA 1OT5A 1N75A 3A6FA 4GRAA 4PPNA 4R0MA 3WWPA 2DVMA 4RKYA 4IGAA 2VZ8A 6NULA 3HEMA 2XUDA 1P7VA 3FUTA 3LUGA 4FYYA 4M53A 1WM1A 1THMA 4X1KA 3CPHA 1DJMA 3GFFA 3HP1A 4Y6LA 3GRAA 3AUJB 1JNYA 4P38A 3NNSA 4G25A 1GPBA 2ZG6A 4UBLA 5JNSA 2J0VA 4IRUB 1CUWA 1A4UA 1AQLA 1DXOA 2HDOA 2ZR7A 3HV2A 2EX0A 3GZNB 4DIDA 4Q1FA 3K0CC 3LUAA 1MRNA 4P3KA 1SN7A 1NRIA 5IKPA 1XQXA 4R9UC 2H4WA 2ZRGA 2A57A 1TT5B 3G2QA 3KELA 3RJZA 3SZUA 2C4WA 2E9SA 1S2DA 3IMCA 1WMEA 3Q2OA 5JAHA 4IIJF 3O38A 1R5JA 3VUFA 1FPQA 2VRCA 3MJCA 3SQDA 4AYTA 4LJAA 2JJ2A 4LYEA 3P52A 1RTTA 1ZMTA 3PQDA 4GMKA 4EDFA 4HNHA 1V5FA 4A1FA 4MV7A 2HXGA 3UN1A 1PS9A 3FB1A 2W2KB 3LKVA 4MVCA 2AG6A 4YJGA 4YQZA 2TRSB 2GHIA 5CXUA 3SZOA 5MFZA 3WL6A 3QP9A 4UXHA 2ZPAA 2Y76A 5KU7A 4BWVA 1Q2UA 5HKBA 4ZD6A 3D4NA 2L42A 1C14A 1P73A 3MPOA 3GMSA 4XSGA 1D9XA 4GKVA 1HFWA 4YXWD 2PZAA 1KWKA 5E9QA 2ORYA 4DCJA 1SUPA 4PANA 1ENPA 4GWLA 1VPEA 1MH9A 1QRRA 3F2IA 4HB4A 4KPUB 4B44A 4U7FA 2EFYA 4KV7A 1XZEA 3PT5A 5KTRA 3RSSA 4CETA 3HFGA 1OB2A 1K68A 4UXIA 4E51A 1LBIA 1F48A 3O47A 3SAJA 3LYAA 4F96A 2ZTMA 2W2NA 1N9ZA 4OKSA 1PNOA 4UDNA 4OQMA 5GZ3A 1DPGA 3DQQA 3C6ZA 3DV2A 4IQFA 4J76A 2OBNA 3HO6A 3K8ZA 3IT1A 3KS9A 4QOSA 1HC7A 1HDXA 4ROTA 3I83A 4RY8A 1JA1A 5DCWA 4BX8A 2RGYA 4CM5A 5KTOA 2NP6A 4D45A 1GR1A 3G1TA 3DDSA 3MWLA 5D3ZA 5EJ5A 1MAWA 2QD1A 1IXKA 3T7EA 1R15A 2AI2A 3WDMA 5KAPA 1QV9A 1GUZA 4MYCA 1U8FO 3SP1A 2H0AA 3BWXA 4GGPA 1YS2X 3QWBA 1GEGA 4C7XA 1R18A 5AUOB 4BQSA 4YRNA 3G0HA 4RQTA 4X97A 2CV0A 3W8RA 5I3CA 4H77A 3INNA 4OF4A 4AY6A 3P0IA 1DRJA 4D80A 3W79A 1P74A 1X3SA 4CVNA 2H2AA 3U7IA 3EUAA 2IPOA 1YR1A 1NP6A 2GEBA 2AG5A 5FYQA 1L5HA 1L5VA 1KA9H 2ZAOA 1CV2A 4XQGA 5CK4A 3T9BA 3WWEA 2EHJA 4FYIA 3KYCA 1XPRA 4E2FA 3LT0A 3V6MA 5F9FA 2A9FA 2JJ1A 3R3UA 5EQDA 1D2NA 4EQ6A 3M3PA 3U16A 1T6YA 2GN6A 1XAGA 3F97A 2VRBA 3GEBA 3SCZA 3C3KA 4EFKA 3DHNA 3FZNA 3ITKA 5KYYB 3VAZA 2BMAA 4O1HA 2GBCA 3LPDA 3CRVA 4XX1A 2NTYC 4OLBA 2GM4A 3B1FA 3DW3X 4TS1A 4G01B 5CT8A 4F60A 1UC9A 4V0LA 1Y8QA 1ZD9A 5F33A 3EIFA 1LY1A 3FJ1A 4XWAA 5HFJA 1RP7A 1LRLA 5KJEA 1ZBQA 3PGVA 3UAVA 1ELOA 1OU4A 2V4ZA 3R7BA 1H05A 3RAJA 3QE0A 1M8JA 3RRNA 1LI4A 3K1ZA 4E5KA 3BG5A 2Q6IA 5BQFA 1KI1A 5AVQA 3K1AA 1KQOA 1SUIA 1G4UR 3WYFA 3MVEA 4CMIB 2Q3DA 1OOEA 1G7RA 4KTVE 1E7WA 1ZVKA 2I7VA 2HA7A 1VFNA 1SXPA 3DMTA 4KSYA 1T9BA 2XQGA 2O8CB 2O6HA 4JLBA 5F23A 3H9EO 1KKUA 5A5VA 3MYRA 5JEEA 4UUMA 3MINB 3O2JA 3ODGA 5BV1A 2PT9A 3IP7A 2Z0MA 2VTBA 1KP3A 2G1PA 4WUTA 3RAEC 2DFPA 1BU5A 2IS6A 2I6XA 2A0YA 3EODA 3D8RA 5JDCC 1JECA 1U2ZA 2HA5A 3DBOB 3MMPA 1YZFA 4JEMA 1TA0A 2C2YA 4BO0A 3K9FC 3EVNA 1UP7A 3OJLA 4HATA 4OSEA 3RSZA 2GRAA 3UT6A 1ZUNB 1PHRA 1DHTA 1ISJA 1UFRA 4HN4B 3W3ZB 3ZQKA 3ZZUA 1DBQA 5CLLA 4C78A 3PJRA 2QAGC 2H9IA 5L7WA 3AZPA 3AGQA 3PX3A 4B6SA 2G6BA 1RNLA 5KVSA 2FNAA 3KQWA 3TPFA 1AO3A 4O4IA 1YSCA 3WHLA 3DEIA 2BFPA 3JQBA 4NOLA 4TVSA 3WQQA 4TKLA 3TQFA 4IZ6A 1WB4A 2ZETA 4CT0A 4ZZ3A 1D8TA 5CDYA 1Z4PX 2JFBA 4J4BA 3UNXA 3DA8A 4B8YA 1Z62A 3OLQA 4E70A 3W6NA 3B2NA 4KPUA 1HFKA 2IZ0A 4EHAA 2RGWA 1HDCA 3G5UA 4HT3B 4LRSB 1Z8FA 3AR5A 4IR7A 5TDHA 5SZKB 2XQJA 4Z4QA 4QFDA 4PZLA 4I6JA 2A7QA 4M8IA 4FS8A 2XE7A 5LYJF 1NTRA 4MWTA 3M3HA 3L7OA 4ISCA 2BJHA 3JWPA 2ODBA 4UNIA 3VOSA 1KRWA 3I9V6 3AR7A 2QVBA 3FOCA 3DKIA 2ZUTA 4ENUA 1SG0A 1ZNZA 3ANNA 2YYAA 5CXSA 4V2UA 1SCDA 3FROA 3O8OB 5C7YA 4YJGB 1CDOA 3IUBA 4K5QA 2JLYA 3T35A 1L1QA 3DLAA 1SC9A 1ZU4A 2JFXA 3GCWA 4J0FA 1EQ2A 3QLJA 1E2NA 2ZUUA 4JHLA 1OI7A 2NT4A 4DSOA 2PY6A 3NNDA 1KJIA 4RH1A 4UNPA 2NUAB 4CBVA 5AW0A 1DKUA 1PGQA 4WMLA 4OKIA 5MF6A 4HDKB 4CEIB 1PS8A 1BMDA 1GPNA 1M34B 4K81B 5KMGA 4M60A 4ZOLA 2JH3A 1UIRA 3JYPA 4NDZA 4P3OA 3CKLA 4QGAA 1D2HA 3RABA 4LBZA 1E8MA 2HHHB 4UHHA 4XCVA 4CV2A 1G5QA 2CEAA 2W93A 5JS2A 4V38A 5TY0A 1J0XO 2FN9A 3UG7A 4F3CA 3L4JA 1TYDE 2CLHB 3IPCA 4FMBB 4OJTA 3MD9A 2UZIR 4BP3A 4EYOA 2DEUA 2O2XA 4QEZA 1DE0A 3FDZA 1SU6A 1AMNA 3AOGA 4US1R 2YN2A 1F2TA 1IHDA 4D5GA 4DM3A 4ZMRA 2FMFA 2WWWA 5ILOA 2V45A 4XWYA 2XXAB 2VHCA 3ZDEA 1OROA 2JARA 4DJTA 4U9UA 3KVVA 4LTDA 2QRNA 4V2IA 1YDEA 4C06A 4ADSG 2PU5A 2C9YA 1Z5VA 2WOOA 3DAFA 5FOUA 4RUKA 4A4DA 3EPHA 4NCXA 3M6XA 3MIZA 3CEMA 3KXIA 4LZLA 1DQRA 3TBKA 3FKSD 3V3TA 4MR8B 4YH1A 4ZQBA 3I0MA 5DYIA 3COSA 3BK2A 2QMUA 1N7IA 4YJ2B 1F2TB 1J9EA 3QWFA 5FR2A 3F7MA 1GNQA 2FDXA 3U3OA 2NU7A 1CY4A 3PDIB 4MW1A 4URUR 2GBFA 5F2NA 3KSMA 1FEZA 2KBEA 1TO2E 3FUCA 1NAHA 4DYDA 3PENA 2NUTA 4G0UA 4QVKA 1DJQA 3LD9A 4EFMA 2R5WA 4Y0AA 4EIWA 4QGGA 2B2XA 2XMZA 3HUDA 4R1TA 4CM3A 4EZBA 3NJ4A 4FXOA 5K2OA 1KOLA 2HWUA 4MS1B 3R4VA 2HT1A 3MJFA 3H05A 4Y6PA 1QTIA 5A7HA 3TS1A 1HE8B 4HRXA 2WR8A 4JS0A 4RJ2A 5KSOA 3AEZA 2EWVA 3H5IA 3ROKA 2ORWA 2XMQA 1JPUA 4QPCA 2R6GA 3IOYA 4XE5A 4Y2HA 1SD1A 2GDJA 3A9TA 1QCDA 4OQYA 2WHRA 4J9VA 4UQPA 4DLTA 4KBYA 4NQRA 2AG1A 5EWMA 3HNOA 2Z5GA 3AM3A 3FDIA 4WW0A 5K8JB 2ECKA 2QKYA 4DV4B 1W36D 3WLOA 4HYYA 4V0NA 3W5SA 2P6UA 4LBWA 3LUJA 2I0FA 2XYRA 3CNLA 4RA9B 1J0DA 2FB9A 2XB2A 3AV0B 2X76A 3DYIA 4WCFB 3QVKA 4C76A 2R7MA 4RTLA 1A4RA 1KDRA 4MQMA 2BH9A 1ACLA 2IRWA 4RPCA 4TVKA 5EQJB 3DMTC 3KEFA 2BFNA 2P75A 4H7FA 2RGRA 5FFFA 1N2GA 4GL2A 3A6HA 4YMWA 5TQ0A 3H11A 4TL9A 3H6GA 3I1JA 2WSLA 4ZI2A 1DZIA 1C3LA 3GQBA 1EFPA 4JX8A 2QUBA 2ZE6A 1CYDA 2FWMX 3DPIA 1YAJA 5JHGB 3MRVA 1HLPA 3OKFA 5C1IA 4KRFA 2XLCA 4X44A 1QHYA 4JUCA 2O2DA 2J32A 2ZYUX 1W75A 1ZMRA 3PWSA 1UBKS 4OPMA 2XD4A 1DQSA 1ZIYA 4MRSA 4IIXA 1EINA 5DHPA 1ZA2A 2MYUA 4BWFB 2GOYA 4ACAA 4FVTA 1ONBA 1O94D 4K6KA 2LCIA 4XUGB 1I4EB 2AS0A 2ERXA 2R6AA 3ROQA 1GZVA 2IPLA 2BGWA 2B36A 2XOXA 4LDNA 1R3UA 1HT0A 2FK8A 2H17A 4NYJR 5TGDA 5FUYA 4RHEA 3RR2A 3DL0A 4NWIA 1VSVA 4PO3X 1HE1C 5ALFA 3OIVA 3ZJTA 2NP7A 5M2QA 3I8XA 6PFKA 4QUDA 2DJ5A 2L0XA 3IH5A 5I8ZA 3UIEA 1CS4C 2GXAA 1VPTA 2FFQA 4L28A 4WK6A 1NXOA 3ZW9A 3TZQA 4L8WB 4RVOA 1ORWA 3ZQ4A 4JC5A 4LTMA 1JAHA 4Q3CA 5AM2A 5KNDD 2PG3A 2N9UA 4FCTA 3OPNA 2ONZA 1KK1A 1EB8A 1OFIA 3L6BA 3DOEA 4RX1A 1YT5A 4Q4CA 5I5EA 2A9JA 3AYXB 5ITVA 4DQ0A 1HNNA 5FBHA 1E99A 1KI2A 1XTKA 2JFOA 1SC1A 5CT9A 5A1TA 4F6RB 2WYHA 1SUEA 2GA8A 3E7XA 3JR3A 1R0YA 4XOIA 1G2PA 4ARCA 5KREA 4ZVTA 5FEUA 3KL2A 1RI4A 2FPRA 3UAOA 4E03A 2R1VA 1O96B 1AU9A 3UJDA 4HDSA 1VYVA 2IBTA 5AESA 3AUAA 4GOND 2DSNA 2QGNA 2OYCA 4ZJZA 1FMCA 1NR5A 2D54A 4OQQA 2CLIB 4G9EA 4XKJA 5DNYB 1D5CA 2FSUA 2QRKA 3FVQA 4P7JA 1J49A 1JXAA 3QF4B 4M8LA 4GE3A 2EERA 2PV7A 1P19A 4HR7A 3Q2IA 3CLRD 5B64A 4N7MA 2O8EB 2N1MA 1GZ7A 3S5JA 1RADA 5CYGA 3ZCRA 4QU0A 4IOJA 1DP4A 1DX4A 1IH8A 2XQFA 3EZNA 1JFTA 1DKNA 2AI3A 5K9ZA 3TCNA 1JFFB 4RV4A 4MNTA 1FFAA 3II6X 2DGDA 3DEAA 1IPEA 3DZIA 4NJMA 4OYRA 3AWIA 2QVLA 2I66A 4ZV7A 5LZ5A 5IC5A 1JXQA 2DY1A 2HOQA 4PLHA 1EM8B 4KK4A 3L5OA 2OV4A 2QZ4A 3FFXA 3IO3A 3MCTA 4QTYA 1TM5E 2B5OA 1CUGA 3DZDA 2NNLD 3ZG6A 1Y8RB 4H31A 1YFJA 3UTDA 3EGWA 3BA1A 1CUZA 4FOOA 1RABA 2SECE 3PKZA 1NLFA 4N5NA 4O4IB 2W11A 2HRQA 3UWKA 1R00A 2I6FA 4NH0A 3DDUA 2UZ4A 2W8BA 5J1SB 2J3DA 1T9GR 1RU3A 1KMMA 3MTJA 5CYPA 5SYNA 2H29A 2DF8A 1N0WA 2I2CA 1RCUA 4JLAA 3AR3A 4XYEA 2PMDA 3ZHXA 3UF0A 4YEDA 5BQ5A 4EHDA 2YXDA 2EAUA 1B8OA 3ZOKA 4YRSA 1R37A 3CE9A 3GF4A 2VJBA 4P22A 3OU7A 3OE1A 4F85A 4BJ6A 1B42A 1SR8A 2OPBA 2ZYWX 3HR7A 4JWTA 4QYSA 1JDNA 1QHHA 2NUPB 2UUBB 1B2RA 1WP9A 4AZVA 5BNWA 1U2GA 2WVJA 3IMEA 5A4JA 1WXDA 2AQ8A 3AJ9A 5DM4A 1YJAA 1W5EA 3EARA 4GXNA 4WZBB 3ZWQA 4O2BA 3GT4A 4XW2A 4DZTA 3CV3A 4Q7KA 1QG4A 1AE1A 4YAUA 1PUIA 2Z1DA 3L8DA 2FETA 4QJ3A 5LBTA 5BWNA 2HSZA 3WA7A 3PQ4A 1Y8QB 2LKDA 1W85A 5I3ZA 1Z17A 3JATA 4JKIA 8OHMA 2ZIWB 1TX4B 3EGIA 4UTXA 1H1LA 1XZDA 4MPTA 2YVAA 3L8HA 4DV3B 2FWPA 1OLSA 2JCXA 3GZJA 4GLLA 4A03A 4Q47A 3G3EA 1LNZA 1MOSA 2I7DA 2PK3A 3B9BA 1J2YA 3HADA 1AKMA 3BTUA 3FFWA 3N0XA 4NZNA 5FLEX 3RYFA 2K5UA 1TA9A 1F1BA 3OE7D 4MW6A 3CH5A 4TKVB 5EIAA 4B3JA 2XWJI 4F6LA 5AUNB 1DIBA 1MHPA 1SHTX 2VT6A 2BFFB 1ZN8A 2Q29A 4P5DA 2VUIB 1UPCA 2Y2VA 1RFGE 4JR2A 2GN8A 1L6RA 2G9UA 2OG1A 3SEFA 1GL6A 1VE1A 1FMLA 2GK3A 4RABA 2EWMA 4UZSA 3WLLA 4CGYA 2P77A 1XUOA 3QMPA 5H82A 3HCEA 1NI5A 2BKLA 2VTKA 4WECA 4C6TA 3U62A 3ZU3A 3MJRA 1Q74A 4EJMA 1NR1A 4KXNA 2G7ZA 2XWBF 4MQBA 4GKKB 2XQVA 4CI9A 1FVFA 4KRGA 2WM9B 2ADOA 2OBBA 4WKCA 5AVJA 1JQEA 5AI9A 5IF3A 4C3UA 5CM9C 3RIHA 2OQVA 1SQ5A 2IU0A 1J7JA 3I6MA 1TMGE 2DMRA 4WBNA 2HPVA 3C6YA 4I1YA 3SQMA 2YKGA 3H2HA 4GPIB 3AKYA 3FXAA 3OZCA 4MLPA 4BO9A 1W4LA 4DWJA 4WZZA 1BJRE 2IHJA 3A14A 1EK0A 3RUAA 1X8LA 4AMGA 5EXSA 2QI9C 2ZYVX 4AS1A 4YASA 3EISA 1Y8CA 2J08A 4BV9A 4EG6A 4TLLB 1YR9A 4IH1A 3GLSA 3DM9B 1LVGA 1L8AA 3ZBQA 4P0TA 3KWLA 4B34A 1GO2A 2W37A 1T4GA 4P3PA 5M29A 5T4FA 2NZYA 3RIEA 3B3JA 2CDRA 2CB0A 3P8ZA 1EDDA 2PEZA 3UJ3X 5IXJA 3RM3A 4KXMA 4WOBA 1RWMA 2IZ6A 1H69A 3SS8A 4QSMA 5CK5A 3H19A 3IKVA 4US2R 6REQA 2XCSB 2P62A 1VKNA 2IYFA 4V0RA 3MLAA 3DVLA 3TD2A 5HJ5A 5LKRA 2VBIA 3GUCA 2FEXA 5C1PA 1P60A 4Z0PA 4BQNA 1Z2NX 3PI6A 4KODA 5BQ3A 1KMQA 2AR0A 1NA5A 3BOSA 1U7HA 4CCWA 1TUGA 2XITA 3C8ZA 4KG7A 3RYCB 1ZO8A 1JDSA 1K7CA 3BDVA 4GI1A 4PRKA 2C54A 2XVMA 3CF6R 4IV0A 5DIFA 4BNFA 4EHHA 4EYSA 4ZVPA 4B3BA 1I2AA 4MW2A 1TDJA 2CZQA 3DBLB 4QDOA 3JW8A 1VE3A 4DJAA 2JLUA 1KF0A 1T0UA 2EBUA 5E38A 4BO1A 1IBLB 1MVLA 4N9QA 3JALB 1DRKA 5IW8A 5DPMA 4UAVA 1NZFA 4ONEA 2CHFA 5KPDA 3WL3A 5FOXA 2ERYA 3V42A 1JZQA 3FCXA 3MTIA 3UUWA 4AJKA 2AK2A 2SKDA 2F1RA 1YIAA 3DMPA 3DUWA 3HWSA 2IS4A 3KUUA 1QIIA 4KR0A 1SHJA 4RS4A 2YJGA 4DOMA 3AVPA 1O8BA 2IOFK 4BVKA 3WBKA 3L7KA 4A0SA 4AW9A 3OLYA 3N6VA 3UMFA 1Z13A 1GITA 2WF6A 4GX2A 3P9RA 3EEBA 1AXRA 1EGVB 3RIYA 4IO0A 4QG7A 5CH5A 3TAUA 4CTNA 4DHWA 1K0FA 1YR3A 2D8AA 4M37A 3ELWA 4MUGA 4UUPA 4BVHA 3QWIA 4LK3A 3SYLA 1RRCA 2AVDA 2DLCX 3ZV6A 5PGMA 1WVGA 4XGNA 3OJWA 4KQEA 1EQAA 4C05A 2H9AA 3T94A 2XUKA 2OUIA 2QLJA 4WCVA 4ZVUA 2JEOA 4KYTA 5EZSA 1QMGA 3T3HA 3SFTA 4YYEA 3HXMA 1HDZA 2K2WA 1XMOB 4D25A 3OESA 5J5CA 1L5LA 4WNAB 3DBVO 1UMKA 5B6JA 4RH0A 1XO1A 4G0NA 2IW1A 1FTWA 3PLRA 4TTIA 3E3LA 4JGIA 1IM2A 4XSHA 1UJBA 2C5BA 4GSYA 4NY1A 1JMYA 1UFOA 3CJRA 3GLIA 4JLVA 3V1NA 3QEBZ 1WBJB 1REQA 4CFSA 3LDGA 5H83A 2E21A 1SG6A 5LJIA 3GNSA 3OZXA 4ND1A 3UPTA 1HA3A 1WWKA 1S8AA 1SCUA 4UBKA 1YKGA 3TQTA 4B3MB 5LIPA 5BW5A 4O2BB 4X94A 1K7EB 3P94A 1HYQA 1CRWG 4I14A 3FCYA 1P0MA 4R0VA 1GR0A 1Z7EA 3PI7A 4MPPA 3MXTA 4YP1A 1RE1A 3Q3HA 1SXJB 7ABPA 4FB5A 4LFBB 4HFRA 4JJEA 3MSCA 3QXXA 1NW4A 4XD7D 3ZBTA 5JU6A 2Y2UA 2AFIB 1CQPA 1SRRA 1UOQA 1RE0A 5F7ZA 3VR6D 4EG7A 4F45A 4O8CA 1J33A 5A0TA 2WUFA 4L8VA 1GADO 1H6AA 3ND6A 2K87A 4UMFA 4R8RA 4YRAA 3U3ZA 2XOEA 4IUCS 4N18A 4BJ3A 4URXR 4RTNA 1OFVA 3KG2A 2QZPA 4YALA 2ID8A 1MNAA 2YUIA 3OT1B 2NV0A 3BILA 1GRRA 1Z2OX 5LWQA 4KFUA 5E3JA 1Y5MA 2AUTA 4IZOA 4IZIA 5EZYF 2J67A 4ZVVA 4REQA 3UC5A 1U4SA 3EG9B 4UU1A 2PO7A 3PU6A 5F2EA 3ZE6A 2OK8A 1IPFA 4OJKA 1QOQB 2X8WA 1N1GA 4ZC1A 2ATEA 1MMFB 1I6MA 1D03A 2DKFA 3HHPA 2O1WA 5IZCA 2N3ZA 1J09A 1TYCA 3IX7A 4CGZA 3AHIA 3I9MA 2JLSA 2RD2A 3GGCA 5DBIA 3NHWA 2YH2A 5K0JA 4HHEA 2PKQO 3QXJA 4CM8B 1OBOA 2VZ0A 4L85A 5GJWC 4BNLA 3HKCB 5IJWA 3FYCA 4UC0A 2VSNA 5TLSA 4TUYF 5EZ6B 1ZQ1A 2AK3A 4O29A 3RV3A 2AOXA 3QJGA 3RLFA 3Q6IA 3TLMA 4F04A 5LQUA 3IV6A 2ZYRA 4Y2VA 5FWDA 1OAOA 2PWBA 4MR8A 4EKNB 4D3SA 2BF7A 1A1SA 3ZVRA 4PX9A 4X20B 1CVLA 2WIAA 1GPYA 1WJGA 2BDUA 2QN8A 4J29A 1NE2A 3I39X 4M9SA 3K0FA 3CU5A 3HL4A 4EHJA 1TE2A 4M7PA 1XCJA 2ZFUA 4LJ8A 3K0AB 3HLTA 2PGLA 3KTFA 1OIVA 3VNRA 1N7GA 3KFXA 4CIWA 2W6CX 3AQIA 3NVKI 4FLFA 3CZ9A 1F6BA 3DMHA 4F6RA 4K6CA 3OEHA 4L4ZA 4D3FA 4EHKA 3S2IA 2F9MA 3RUPA 1K6EA 4IHJF 4EUSA 1BH2A 1XVIA 5K0SA 1DO8A 121PA 5B1IA 3Q87B 2VNSA 3OSZA 1IONA 2YY6A 1M5TA 3F6CA 3FPCA 5CM8B 5FFMA 4ZT2A 4C4XA 4EPRA 5AW7A 3CLUD 2Y1CA 3F8SA 4HDQB 2JF0A 4HNAB 1ITZA 1SELA 4K9KA 2CYCA 4NJEB 5D3MB 3N28A 5LA6A 1T0BA 5KX5B 1RHMA 3T4XA 2F64A 2G5TA 4URYR 4J2OA 3P4UA 1F8FA 3WYBA 4KX3A 1QIMA 4PC3A 1JKIA 4ZOLB 5CA1A 1WABA 2DHCA 1CZRA 2OL4A 2QRVA 2EATA 4RF3A 4HC4A 3RC7A 2GF2A 1TMKA 5E3IA 1UT8A 2WMYA 5AXDA 2ZB3A 1ZONA 1P8JA 2E4AA 1TKBA 2AZMA 3AT1A 4P4TA 4WY8A 1R27A 3BMNB 1TRKA 3BORA 1EGHA 4WKGA 4YHBA 4R9NA 5IRCD 3ZKWB 4XVCA 2AD5A 4RZSA 2QXUA 4BB9A 2QJTA 2YY7A 1WHSB 3LQ4A 4AY3A 1SBCA 4JJ7A 2B20A 5JJBA 4B84A 1Y1KE 3IRUA 4UDXX 4EJSA 3NBXX 3OHSX 3PT9A 5JS1A 1SQFA 3H2KA 1BHO1 5BPFA 1M1YE 3WWZA 1S8FA 3V8PA 3C16C 5ALPA 3W6ZA 3H9GA 4BFLA 3W5CA 3DD5A 4WEQA 1LDMA 3TUJC 2CGEA 3FMIA 3GEMA 3O3NB 1ZIDA 3EIHA 1JLHA 1D4FA 5G0VA 4FYPA 4WKNA 1P9WA 3THSA 2P4UA 4WY5A 3HXTA 1GG5A 2IPNA 5D86A 1JLRA 4LV6A 4RA6B 2ZQ5A 4WASA 1Z6XA 2BGRA 2QF7A 3AHCA 1WHSA 2CVFA 1HEYA 9LDBA 5AW6A 1KFCB 1ZRMA 2C0CA 1PX2A 4C4TA 5AVKA 1MZVA 3C7DB 3NP9A 4YC7A 4EUNA 4L76A 1PZNA 3VNVA 4MULA 3DOCA 2QQ0A 1BX0A 3K72B 1ZGGA 3MTEA 1MT3A 3EG9A 1IU9A 3IDAA 3W3AA 4QOFA 2C4UA 4RIHA 1IZ0A 2W9XA 1T0IA 3JRNA 3UJAA 5JBIA 3PNLA 3EGEA 3PJEA 2PZMA 1HT1E 3Q15C 1AKNA 1NM5C 1XV5A 3PR3A 4XJXA 1KY4A 2E4XA 3IP3A 5DRTA 3BGWA 4N54A 1IWBB 3NHZA 4V24A 1SFRA 2I2BA 5JH7F 4D81A 1PR5A 2IPMA 2LWIA 3N59A 4UBNA 5BN4B 3JY6A 4BMXA 4CKBA 5IMSA 2ODEA 2PNFA 4MEBA 3CINA 2KX7A 2I29A