4GEGA

Crystal structure of e.coli menh y85f mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
LVPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGFSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gegA00
3QPDA 4UHFA 1J2EA 3FLAA 1AQLA 4Y2PA 5ALTA 1YASA 3KWFA 2WG2A 4V2IA 2DSNA 4K2AA 1GKLA 1I6WA 4PNZA 1T4MA 4XJVA 5HF6A 3KWJA 2Z8ZA 1YB7A 3IBTA 1W75A 5IKXA 1L7RA 5LYYA 5I7UA 4A23A 3WK6A 3IUMA 3C6BA 2I3ZA 4FNMA 1IUPA 1QONA 4XVCA 4W1RA 1HQDA 4F0JA 3DEAA 2XUAA 3L1JA 5FXMA 4W1SA 5A62A 2CBGA 5I9IA 3UUFA 4J3JA 1Q0ZA 2V97A 1TRHA 1XRNA 4AN0A 4F60A 1G5FA 4DSAA 5C8VA 2QTBA 4FKBA 1SFRA 5EGNA 2WFMA 2G4LA 1SOMA 2ZYRA 2H7CA 5FPQA 5AKYA 3VISA 4D9JA 1DX6A 1CUWA 1U2EA 4YASA 5HFAA 2Y6UA 1UT6A 3MGAA 5T4HA 4EHBA 1DWPA 2R11A 1X2EA 2YYSA 3IVMA 4FWBA 1BEZA 1MJ5A 1CR6A 3ESBA 4C4XA 4DIUA 5AKEA 4DMCA 4Y2VA 3LIIA 1XQYA 3H2JA 1LGYA 2XMZA 4EY8A 4X91A 2ROQA 2HDWA 4BBZA 4NZZA 3I6ZA 1WPRA 2WJ6A 4L0CA 4X95A 3IIIA 2VA9A 4LXIA 3QBJA 1CQWA 4O08A 2JGMA 3DD5A 2Y2VA 5LZ8A 3HACA 4BVLA 4B81A 1BROA 3ANSA 2XQGA 3VDXA 2D5LA 4OB8A 4QDXA 4H18A 2WHRA 1YSCA 3FAKA 3I2GA 5CT5A 4HS9A 1LZKA 2ZVDA 3PFBA 2PSEA 1EH5A 2ACEA 2WLSA 1XQWA 5AKIA 3BXPA 2VJCA 5AM2A 4UFNA 2GBGA 4OCZA 4Z49A 4DTCA 4Y2TA 3A2LA 5K3CA 4C4ZA 4KAJA 4F5ZA 4KRXA 4PW0A 1N8SA 1QIJA 3VXKA 4BTVA 2CKMA 2QXUA 1XFDA 4RE5A 3TEJA 2XMBA 1W76A 4G9GA 1Y7IA 1UWCA 3U0VA 5AKJA 2PM8A 5BV7A 5HQ3B 4B6GA 5JAPA 4X93A 4CCYB 3MVEA 4U2DA 4K6HA 2WFLA 3BDIA 1R4ZA 2XLBA 3K2IA 5CH5A 3WWEA 2GYUA 4X6UA 5CRIA 1QIEA 2ZJ6A 1JJIA 1WB4A 1UXOA 4ROTA 2OLEA 5EHZA 2OXEA 4CIAA 1EHYA 5LKAA 3ESDA 4EY7A 2CZQA 1CUAA 3PICA 1JJBA 1AZWA 1CUGA 3DKKA 3ILSA 1EK2A 1VZ2A 3V1KA 2G5PA 1HPLA 3HABA 2P8SA 3KD2A 2WJ4A 5DNVA 2PU7A 2PSFA 2OG1A 1UK8A 5AI8A 4GEGA 4FLMA 4QDUA 3WKCA 4MXDA 3EQ9A 3DDUA 3G0CA 2VAVA 3MUNA 3WMRA 1N5RA 2V96A 3WIOA 3OTQA 2RGUA 3GBSA 2PVSA 1E3QA 1Y7HA 2E3JA 3G0GA 1C7JA 3QZUA 1P0MA 3C5VA 3QITA 3EQ7A 5FOQA 3G7NA 4IH9A 2XMQA 3DYIA 3FYTA 1KEZA 1HBJA 4MWSA 1IZ8A 3R0VA 3BIWA 3LLCA 3B3QA 3UMJA 5DNWA 2XT0A 3STYA 3G8YA 1CVLA 1ZJ5A 2PSHA 3C70A 5E4JA 4IO0A 4DLNA 4OB6A 1DWQA 1N1MA 3C6ZA 1GQSA 3C87A 3WL8A 4BCCA 3BJMA 1UK6A 2WIJA 4GW3A 4Y9SA 5ALEA 3IA2A 1XZFA 4LKOA 2DHDA 1T2NA 2XQFA 3L1HA 5AP9A 2C58A 4BB0A 2OAGA 4FDMA 3WWCA 3T52A 1ZICA 2XUGA 1UK7A 3I6MA 5HKAA 1YS1X 1ORVA 2QRUA 5AOAA 4H35A 2D0DA 2QM0A 5BWBA 2BUAA 2JEYA 4PSUA 1XKLA 3FYUC 4WFIA 4J0HA 3U1TA 4KJXA 4FFVA 4MEAA 4RNCA 3F97A 3H2IA 1G42A 1YR2A 4OUKX 5EIAA 5AIAA 2QR5A 4LHEA 3PUIA 4OU5A 1CUJA 1DX4A 3IDAA 4ZXFA 4BZZA 3DJYA 1ZGBA 5DJ5A 1U4NA 2AXEA 4KE6A 2GBCA 2EDCA 1EI9A 1JT2A 2HU5A 3O9VA 1XZIA 5H3HA 2PPLA 3PE6A 5FKJA 3QPCA 1UOPA 3ED1A 3EIOA 3W06A 4H7KA 4TVKA 2HFKA 2HIHA 4J0DA 1ODSA 5EHQA 4UFOA 2GYVA 3DNMA 3D2AA 1DU4A 5AM4A 3R3ZA 3G9XA 3F9CA 1HLGA 5JALA 5AKXA 5ALSA 2HA0A 4G4JA 4J03A 3R41A 2BFNA 4FTWA 5HK8A 4CFSA 2CUTA 5AH0A 3HEAA 1YA8A 4X97A 4UPDA 2QJRA 3K6KA 5ALUA 4UBNA 3AJAA 1XQVA 2OGZA 4OB7A 1XZHA 2G63A 1EK1A 4UHEA 4FOLA 3FLEA 5A7HA 3W9UA 3WK4A 4XIIA 5CH3A 4AO8A 2XUHA 3O9MA 2DCMA 1PV1A 1XROA 2C7BA 2WG0A 3YASA 3OM8A 1XKTA 4WFJA 3C45A 4MYDA 1EDBA 3FNBA 2ZYSA 3C6YA 4I4CA 1HL7A 1XZAA 4M0EA 2IX9A 4QEKA 1QFSA 3N0TA 2K2QB 5AI9A 5ALRA 2QKYA 3DL7A 5AIBA 2QJWA 1CUHA 3I6YA 1F8UA 3G9TA 3AZPA 3NGMA 2VQ6A 1DQYA 1UZAA 5AKGA 2XLCA 3SK0A 2FUKA 4KE7A 4N8SA 1D07A 2VAXA 4EA6A 4BE9A 2V98A 2OCGA 3L1IA 2Z3WA 3OPMA 4KACA 5IVHA 1WB5A 5CW2A 1DT5A 2HA2A 4E14A 3PF9A 4G5XA 5AO9A 4FLFA 5ALYA 3V9AA 4HRXA 3KDAA 4BRZA 4CCYA 3WQHA 1EB9A 3W2TA 1VXOA 2Z5GA 4B7ZA 4YPVA 4JH0A 3C5WP 2VSQA 4HZGA 1TKRA 4FFWA 4W1QA 1XZMA 5C7YA 3A2MA 5DWDA 1VJ5A 3VVMA 2VJBA 2ACKA 2PUHA 4W9RA 5J3JA 2XQJA 4JEIA 2OAEA 4UBLA 1NX9A 2HL6A 4AXBA 1QTRA 2WIKA 5JD4A 5AI5A 5E4YA 1J07A 4N8DA 4UBMA 3TJMA 3A70A 2BGRA 3AIKA 1YAHA 2WIGA 1H2ZA 3MUOA 5HZGA 4QDOA 3S8YA 4NVRA 5JZ9A 4DMHA 1Z68A 2WUDA 3WYDA 4UFPA 3Q8WA 3M82A 4KE8A 5LLSA 5K3AA 1AC5A 1LBSA 3HSSA 1E8MA 4KYVA 1JU3A 5SYMA 1WOMA 1ACLA 3VJKA 4P08A 4B85A 3DOIA 3PFCA 3WWOA 1BS9A 4ARBA 5C81A 2WM2A 4KEAA 4LYEA 3STUA 5AKKA 3H19A 3H17A 5HF9A 4Y2QA 1L7QA 4Y2RA 2I3DA 2IIVA 4EBBA 4L72A 3ZPXA 4G1FA 3WI7A 1SC9A 2FJ0A 4CIBA 1HDEA 3SWWA 2HA7A 4BYMA 2OGSA 3NOXA 5KWJA 5ALLA 5BOVA 1ZD3A 5CMLA 2B9VA 3ZLVA 1EDEA 4E11A 2DQZA 4ARAA 4WY5A 4HXGA 1G66A 2AJDA 4UHBA 1XQXA 4BATA 3FWHA 2VEOA 3QPAA 1ZJ4A 2GZSA 2WQZA 2YH2A 2QVBA 2O2HA 1H2WA 1U65A 3A6ZA 2WHPB 2J3DA 2BAGA 3KSRA 3BE8A 3WYNA 1FFDA 2PL5A 4GECA 1GXSA 4QZVA 1BCSA 2OQIA 5JYCA 3TRDA 4G8CA 1JI3A 3AFIA 1DTEA 2OCIA 3R3UA 5HKBA 4GI1A 4U2BA 3D7RA 4BVKA 5A2GA 1THGA 2PBLA 1FFCA 4AMYA 3O0DA 2O2IA 2O2GA 2HFJA 2NW6A 4C88A 4H7EA 4OD0A 3R3VA 3D2CA 4G9EA 4L9AA 5C8ZA 5AM1A 1LPBB 1VE7A 2ES4A 2VJAA 3T4UA 4C6HA 1YCDA 4BDTA 1DT3A 1BCRA 4HXFB 1XZBA 2X5XA 5DYTA 4EB0A 4M0FA 1ORWA 4H7FA 4PSCA 5CH8A 4ZV9A 1QIKA 1FFAA 3WWDA 4NMWA 4AQDA 4MYSA 1MX5A 4CG1A 3DL4A 5LKRA 5D3KA 2ZJFA 1QIMA 4ETWA 2C5FA 4LXGA 1RWQA 3STTA 2PSJA 3PI6A 3F96A 2J4FA 1J06A 5DNUA 4M0MA 1AGYA 2ZJ7A 4X6YA 4WY8A 1F6WA 3WA7A 1BRTA 4JYPA 4DNFA 5K3DA 1THTA 4LIPD 1CEXA 1KU6A 5DTJA 2DFPA 4FBLA 3FVTA 2AJCA 5AM3A 1TCAA 5CURA 2JGLA 5AI4A 1VZ3A 3AIMA 3G0BA 1H2YA 1LBTA 2XMSA 4RGYA 4AN1A 2XUKA 3I1YA 3AUKA 4DYHA 1ZIXA 4X6XA 4GHWA 4UBJA 2IITA 1PFQA 4Y2UA 2G5TA 2Z8XA 3RM3A 4AX4A 2XQKA 4N8EA 4B84A 3C6XA 2XB6A 1CUXA 4EZIA 4YX9A 4OSEA 2WUGA 4W1PA 4ZREA 3LIPA 2HRRA 5AK6A 2ZSIA 1ZD4A 2UZ0A 2RIPA 4KAFA 1UOQA 3G9UA 1CIJA 3F98A 4BP9A 3IUQA 3NWOA 5AICA 2WG1A 2H7XA 5CT9A 3TGLA 2RI6A 4BDSA 5JAUA 5E2IA 4HXEB 4BE4A 3O4HA 4H7HA 1QO7A 4Q3OA 1OILA 2WU3A 2XMRA 1EINA 3O4JA 3OG9A 1O6FA 3E4DA 3WLAA 4P9NA 2WTMA 3VJMA 1UFOA 4MQLA 3JWEA 1JU4A 4Q1VA 2AJBA 1HKHA 1AKNA 1K63A 1W1IA 1DQZA 2WFZA 4OPMA 1X2BA 5EIHA 1XRRA 5ALNA 1R50A 2CB9A 4FBMA 3WJ2A 2HRQA 4K5QA 1EA5A 1RYYA 5K3BA 2HHAA 4QDZA 2VF2A 5ALMA 1CRLA 2ZYHA 2OCKA 4X00A 4G8BA 3WWPA 1VE6A 4BC0A 4H7IA 5IVIA 3HZOA 4I19A 5JIBA 4YK7A 2DHEA 2C0PA 3X3HA 4Q34A 5DLPA 3OC0A 2CEKA 1GQRA 5ALKA 3H1AA 3DQZA 2ZYIA 4UHCA 1MU0A 2Y1KA 3SX4A 1CUBA 4LXHA 5IVDA 1WCYA 3R40A 5AK5A 1QGED 4WDRA 5AK3A 3WZLA 1FJ2A 1EX9A 1SCQA 4X94A 5JD5A 2BUCA 4U2CA 4AMZA 2CMFA 4DMFA 3WZMA 3FOBA 4FMPA 5A7GA 4JYMA 1ZI6A 2DR0A 4BAGA 3ICWA 1A8UA 3STWA 2H9YA 2LIPA 5K3FA 3WK5A 5JZSA 1CUDA 3P2MA 3S2ZA 1MPXA 1Y37A 4BCDA 5ESRA 2O7RA 2HU8A 3QMWA 4XWGA 4RPCA 5ALZA 5JASA 4X7BA 1JFRA 5IH7A 2WJ3A 4JUIA 3DS8A 5AM0A 2RAUA 2QUBA 1CUYA 1XZKA 4MWTA 2XUFA 1E8DA 5K3EA 3W9BA 4IH4A 4DMKA 4G4GA 4Y2YA 1EVQA 2WHPA 5JZBA 3V1NA 2OCLA 4CG3A 2XMDA 3I2JA 3OOSA 4J7AA 2RONA 1UK9A 3F8SA 1SCKA 2XUDA 6YASA 1E8NA 1F0NA 1UKAA 2JEZA 2XDWA 2XUQA 4J0KA 3G02A 3V48A 3E1GA 1TIBA 5ISMA 3B12A 1MN6A 3C8HA 4H7JA 2QOEA 2XQIA 4Y7DA 2VJDA 4BAUA 2WTNA 4J0GA 4BTLA 1W52X 3LCRA 1RP1A 1YS2X 1C7IA 1DWOA 4DNPA 4C01A 5ALVA 3HI4A 3B5EA 2X8BA 3FCXA 4BP8A 3WL7A 3ZV7A 2XE4A 3CXUA 3ZWQA 1EVEA 2XUOA 5F4ZA 3I1IA 1TQHA 1EB8A 3I28A 1K6EA 1CUCA 3V1MA 1GZ7A 4K6KA 2RHWA 3ZI7A 4QE3A 3ESAA 1OCEA 5FLKA 1TK3A 4FLEA 3GROA 2GYWA 1X70A 5DYYA 4QLOA 4EY4A 2YASA 2VT7A 3LS2A 3AZOA 2QZPA 1ODCA 3CN9A 2HA4A 5A71A 4OYLA 1XLUA 4UHDA 4A16A 1W4LA 1H2XA 1LPNA 2Z3ZA 1Q83A 5CXUA 4UUQA 2BGNA 2YXPX 3O4GA 1LPMA 4B0PA 2JIDA 5AOBA 1BN6A 5LP1A 5DYWA 3GA7A 1O6GA 4BZWA 1MX9A 2QXTA 1B41A 5FPPA 5ALFA 4UBOA 1AX9A 1Q0RA 2FX5A 5C8XA 2ZSHA 1LPPA 4B9AA 5A7FA 1P0PA 4KAAA 3IUJA 1L7AA 4JNCA 2BCEA 2JGFA 1MNAA 4P93A 5ALWA 2W6CX 2HA3A 4Y2XA 1H22A 3RK4A 2WUEA 1TCCA 3FSGA 3G9ZA 5FRDA 2VT6A 2I78A 2DHCA 1K8QA 5HF8A 1VA4A 3O4IA 4Q82A 3QM1A 4A5SA 4G4IA 5AKZA 4I3FA 3STXA 5JAHA 1JKMA 3A2NA 1GPLA 3WK9A 4X92A 3H0CA 4E15A 2RHTA 3BJRA 5HF5A 3FLBA 4EY6A 1GKKA 1LLFA 1R3DA 5FP0A 4H77A 4KR0A 3BIXA 1QLWA 1ZI8A 3GZJA 4QDTA 1TCBA 2QUAA 5ALPA 1BU8A 1NU8A 1R88A 2AJ8A 3D5EA 1F0PA 5K3FB 1XZGA 3LP5A 1GGVA 2PSDA 2XUPA 4BCBA 2H7YA 1A7UA 1FFEA 1LPAB 1AUOA 1CUIA 2FJPA 1CLEA 3K9BA 2JBWA 1J1IA 3E3AA 2XMCA 3EQ8A 1ZOIA 1GT6A 5AKHA 5DTIA 3WA6A 3WJ1A 4Y2SA 1MO2A 5EHNA 3VJLA 2PUJA 2XMGA 4DM7A 2EDAA 2PKYX 4WFKA 4DSZA 5JAOA 3C43A 5K5EA 4WDQA 4AO7A 1XZCA 3GUUA 1IMJA 3KOOA 5AI0A 1UKBA 4C89A 3QYJA 2HM7A 3ICVA 4B9EA 4ZRDA 5ALQA 4Q05A 3WKAA 5EI5A 1CUUA 3H2HA 3FYUA 3DKRA 4BRSA 2V9ZA 3QVMA 1YB6A 5AHXA 1IVYA 5LZ4A 3QH4A 5SYNA 3IULA 1CV2A 4PSDA 4PV7A 5D3ZA 4QLAA 3HLKA 3I2HA 1BE0A 4GWLA 3WKEA 2JGJA 5JD6A 3ZLUA 5LZ2A 1VA5A 4UBKA 4DNOA 2BJHA 4W63A 3I2KA 2B61A 1JJFA 3CCCA 3ZLTA 4ZWNA 3R3WA 1ACJA 4ZGBA 1R9MA 2QT9A 2B4KA 2GBIA 4KRYA 3DOHA 5T4EA 2J4CA 5ALJA 5CT4A 1S8OA 1JMYA 1QTIA 4DNQA 1M33A 2VATA 4WJLA 1JMKC 2OQVA 1MAHA 2W22A 4IQ4A 4UBIA 1QJ4A 1WM1A 1ZD2P 4LYDA 4MQMA 1CUZA 2WIDA 3VVLA 1QIHA 4UHHA 5CXXA 2PX6A 3G0DA 1VLQA 2WUFA 3NUZA 1CUFA 5AI6A 5JARA 1IUNA 2Y2UA 2J3QA 1YAJA 4OYYA 1U8EA 4QWWA 1XZJA 2QS9A 4H7DA 2HADA 1ISPA 1QE3A 4EY5A 2VTVA 4ZI5A 5LIPA 5AJHA 5E4TA 3RLIA 5HFNA 5T4FA 1LNSA 1A8QA 5LZ7A 5CTAA 3CCBA 1LPSA 1XRQA 3BF7A 3G0IA 1N5MA 1WB6A 3BL8A 5YASA 3Q0TA 5JANA 3AZQA 1ZI9A 4X85A 5HK9A 4EUSA 4PF1A 3AILA 4MJ3A 4ITVA 4U2GA 5IVKA 1IZ7A 1Q84A 5CT6A 2X76A 2PU5A 2WSLA 1E5TA 3BWXA 2ECFA 4Q3KA 4J0CA 3ESCA 3KXPA 4GXNA 4U2EA 4L3WA 3UUEA 1A88A 2B20A 1MX1A 2WU4A 4GDMA 5KWIA 4NS4A 3WKDA 1MNQA 1YA4A 4N5HX 5FUMA 4H0CA 1TAHA 4HAIA 5AM5A 3H18A 3I2IA 5AK4A 2JGEA 3FBWA 1WPXA 5EIEA 3STVA 3FCYA 4QNNA 2AJLI 4B82A 2JF0A 3HXKA 3GFFA 4XX1A 4AZ3A 1UOOA 2CJPA 2BUBA 5JADA 4BVJA 5KREA 1QFMA 2ORYA 3V1LA 2DQYA 2R8BA 1QZ3A 1W6RA 1PJAA 1NU6A 5A6VA 3M3DA 4HRYA 1XLWA 4INZA 3R3YA 3EF3A 4X90A 1XLVA 4Q3LA 3FYUB 5D6OA 1BN7A 3WL5A 2WHQA 2OGTA 3GELA 2JGKA 3HYSA 1CPYA 1OXMA 4QA9A 1BEEA 4X3CA 5ALOA 3IURA 2WKWA 1A8SA 3BF8A 2XI4A 5ALGA 2GBFA 1SCIA 1QIFA 1XZDA 5AKLA 1ZIYA 4GBGA 4F21A 4B80A 3D3NA 1K4YA 1QIDA 5JATA 3FVRA 1QIGA 1USWA 2O7VA 3HJUA 4BC1A 4B0OA 3HRHA 4DGQA 5LZ9A 3RARA 3C8DA 3R3XA 4BAZA 3RKSA 4WCVA 3VKFA 3PF8A 3M83A 4GLBA 3E0XA 3H04A 4PQEA 1CUSA 3ANTA 3H1BA 3M81A 1CFJA 4IH1A 3OURA 3EBLA 3WL6A 2EEPA 3D2BA 1G4HA 3SC2A 3AINA 1IUOA 4HTAA 1VOTA 1VKHA 2WFLB 1ETHA 3AIOA 4C4YA 4S0XA 1ZGCA 5AOCA 1GPNA 1LZLA 1XZEA 2OPHA 4IHAA 4AB1A 4AO6A 3QMVA 5ALIA 4K6GA 4C87A 2GZRA 5T4BA 4RE6A 4N5IX 2XUJA 1WHTA 4Y2JA 1XRMA 1ZD5A 4E46A 5FV4A 4CG2A 2QMQA 1VXRA 3WIBA 4OU4A 5CT8A 4PO3X 3I2FA 3JW8A 3JYHA 1AMNA 1AURA 4MEBA 3O95A 3CN7A 2C0QA 1FFBA 4KE9A 1XRLA 2I03A 5LZ5A 1E89A 1XRPA 1MTZA 4J0JA 3DCNA 2C5GA 1CUVA 1EXWA 3HC7A 1K5PA 3IUNA 2WILA 4CCWA 3N2ZB 5BWCA 1QIIA 3DYVA 1MT3A 4FNGA 3BDVA 4TPKA 2Y6VA 5ALHA 1XZLA 3PDCA 3WK7A 3IB3A 2Q0XA 2C4HA 1MAAA 3H2KA 1E66A 1QOZA 3D0KA 2JGIA 5EFZA 1EDDA 4AZ0A 1CQZA 1WHSA 5KBYA 1LPOA 2WIFA 4P92A 1DINA 1R1DA 2HA6A 1B6GA 4X71A 3PUHA 2XUIA 4CI9A 2ONCA 1P0QA 2HA5A 1KU0A 3FSGD 5I8PA 4J0IA 3H2GA 1FSSA 5CBKA 4G8DA 4ZV7A 3WKBA 2HU7A 5HCUA 1ODTC 3QMMA 3D4LA 5HQ3A 4U2FA 1H23A 5D7BA 5ALDA 5FDFA 4FHZA 7YASA 3WK8A 3DLTA 2BKLA 1GPKA 3W04A 3W05A 1C4XA 1QO9A 3D59A 4B83A 4HVTA 4QWMA 1R9NA 5EHXA 2H1IA 5ALXA 3F67A 4TGLA 1CUEA 1UKCA 1P0IA
chains in the Genus database with same CATH superfamily
4GOXA 1BU5A 4MUKA 1YB2A 3BWCA 4G0OA 2GA9A 3KKEA 4R7TA 4RJTA 5DE3A 1WO8A 4M9UA 3ZXIA 2V55B 5TRTA 2VUSA 3S29A 1PGPA 1QV6A 1RR6A 1Y8RA 3FROA 1L5HA 5BR8B 1K8XB 1YASA 3A6EA 3RQIA 4V2IA 1QYVA 3TLXA 3A9SA 2AOUB 3C2QA 3FLMA 3NASA 3NM4A 3PUYA 4OMFG 5CIQA 4PNZA 4XR4A 1KR5A 2WC1A 4FD3A 5B1IA 2IUUA 1A7KA 3CJTA 3WIDA 5KTNA 1YB7A 3A6FA 5TQ0A 2ZRNA 2VP3A 1W75A 1KK2A 4KV9A 2EGHA 4HZUA 4FVTA 3CH5A 2IBMA 1NSFA 2ZRDA 3GLHA 4ND2A 3ZLBA 4B09A 3GXBA 1LBQA 3LUFA 4NV3A 1DLJA 1WDTA 2WDZA 4UCQA 1DRWA 3AKZA 4BVFA 4RMJA 1ZSNA 2IY8A 4FNMA 1IUPA 1QONA 4K1LA 3REGA 1RNLA 1PS8A 1ZA1A 3G23A 2ADMA 4F0JA 3GQVA 1KO5A 3L8FA 3CR3C 2C20A 3B2QA 3IXLA 4EGFA 4LJ9A 1D5WA 2DKOA 5KKAA 4HAYA 3C3XA 4G5OA 1BXGB 4J3JA 4UM5A 3IQHX 5KOJA 2ZZMA 3N86A 5KYGA 1M5UA 1B4DA 1O2DA 4A6DA 3KOUA 4PQGA 2V54A 4OFBA 4R8LA 1RC1A 1JSCA 1QYWA 4C05A 1TEHA 3JAWB 5MFPA 3UH0A 2GTHA 2OCAA 5KDLA 1A9YA 1TDJA 3HYRA 4DSAA 2VA8A 2O3SA 1D6SA 3TQOA 2P40A 3UPDA 2HJHA 1JIXA 2QTBA 2PDAA 3TCXB 4QKQA 5BSEA 2H07A 4FKZA 3IDOA 2WFMA 2G4LA 3K70B 4X60A 1ZCAA 3TINA 2GSWA 1L6RA 1QQTA 5SY4A 3QVVA 4PLFA 2ZIXA 4R2JA 3LI2A 1XA3A 2Q1UA 3BKXA 1P72A 4CDNA 4CQMB 4ZI2A 3INGA 1RRFA 5FYDA 4B46A 2H4YA 4HQ6A 4KXQA 3VISA 1T9GR 1CUWA 4YO7A 2PPVA 1SG0A 3LQRA 4PYNA 4EPTA 4C0SA 3S2GA 2WWHA 2E21A 2Y6UA 3OC6A 1CR1A 5JE8A 1UT6A 4GXTA 3A1EA 4MVJM 2RHJA 2BLNA 1ZJWA 2H9AA 1MGOA 4JI4B 2V9CA 1CEYA 3NHUA 4A92A 1QF7A 4EB6B 5AVUA 4KSBA 1P91A 4BKUA 3N7TA 3ZJ4A 1HE8B 1MXHA 1LDBA 3V3KA 3E9RA 1SKQA 3UGTA 2UKDA 1GARA 1YQ9A 3MC1A 3LK7A 4R1PA 4PSAA 4CUJA 3KL2A 3FNGA 1WUYA 5DCWA 2PUAA 4IDBA 3TSYA 4EQ6B 1L4FA 3PJDA 3C7KA 4OXNA 5AKEA 3JSAA 4X9XA 1KAOA 3RC8A 4JLWA 3I42A 1YBMA 4ZMRA 1B16A 3H2JA 5BV2P 1HOTA 3FIJA 2XMZA 1WS6A 4M54A 2C3UA 1ND5A 2X41A 4RFVA 4EUNA 1SOVA 2EGGA 5DU2A 1GFIA 3ESRA 3ETHA 3UKOA 2Z9BA 3M89A 5BRNA 4MS3A 3NZEA 1GQQA 4CDMA 5F9FA 4NZZA 3RV3A 1NT4A 1UUFA 1AA9A 1XQ9A 3HV0A 3HY6A 1H69A 4L0CA 1Q50A 3ETLA 1AMOA 2ZEJA 3NANA 2O8DA 4Q1AA 4LXIA 2FPLA 4O08A 2JGMA 2Y2VA 4BNDB 4AUKA 3AY7A 5JNWA 2AMFA 3FHCB 4IP0A 3WNCA 4CMKA 2ZKIA 4M8LA 3HACA 2PUEA 3ZNOA 2XYHA 4D4GA 3LL7A 1HG1A 4F2DA 2O2XA 3EGXA 4D9MA 1OI4A 1YIAA 2XPCA 4XDYA 3ILXA 1F2UA 1FP6A 5IDVA 2P35A 1KYQA 1KORA 1K3FA 2Q2VA 3FFWA 2FGKA 2ZJAA 4FYWA 1W5BA 3OEYA 4MUYA 1R12A 3MJDA 3R4VA 4H60A 5F4BA 3IA7A 3W3AD 4XASA 4D6XA 1NBWB 3DO5A 2IHVA 4MITA 1QRAA 2GPYA 1OFVA 3B3FA 3WRWA 1JDTA 1G5HA 2ACEA 2WLSA 3Q7RA 4BZPA 2J6BA 1P9WA 4N01A 3H5WA 4UFNA 1T6ZA 4Z49A 5IW8A 1DUVG 4JXJA 3ZCQA 1ZRMA 1QHGA 3FWZA 3U17A 1W49A 5BPHA 1I0LA 1H42A 1PFGA 2BC9A 1OLSA 2BKVA 2CLOB 2Q2OA 1F38A 4BLPA 2UUAB 1KZ1A 1QGOA 4AZTA 2JCVA 1CZHA 4ZAFA 4LWOA 4KAJA 1CX9B 1V35A 2QHXA 4LRWA 4QYWA 2ZUWA 1BFDA 2VPQA 3G8DA 1D2MA 2HX1A 4XUGB 4PW0A 3R9WA 4IVNA 1QIJA 3VXKA 3B7GA 4ICIA 2QXUA 1YVDA 3M6FA 4HB3A 1JLMA 1I3NA 1ZHFA 3DOJA 1R0LA 1KYTA 2UZ1B 1JG1A 2IELA 1ANKA 4XYEA 5C4GB 3GDGA 5AVTA 1XFDA 1WDKA 4RADA 2GOYA 4RE5A 3CJQA 2R6JA 4DCJA 1E5XA 1RKUA 2XMBA 3IVGA 3OIGA 3TEJA 3FPGA 3NALA 3TD9A 3OH8A 4G3XA 3W3AA 1OKKD 1BSVA 4J4HA 3U0VA 1TOAA 2FR1A 2B83A 4Q47A 5BSUA 2NQTA 5IDXA 1IPEA 1B7GO 3WE7A 4PTLA 3DF9A 1QYRA 3LCVB 3FXAA 1QU2A 4KDRA 2GLTA 1KARA 1GADO 2CXXA 2X8JB 1GL7A 4B6GA 3KSAC 2QAGA 4X93A 4I9NA 3U3OA 5IUKC 2CLMB 2IEZA 4U2DA 4UAVA 4K6HA 1VIYA 2ZUDA 3EQ6A 1NQOA 2KS6A 4NONA 3TDKA 2HIGA 3MTIA 5CH5A 3THXB 2AKEA 4MA4A 4X6UA 4HYYA 4AG3A 4DZTA 1I1QB 3KPUA 3EMKA 4QQNA 5CRIA 1PNOA 1G3UA 1TT7A 1JJIA 4FYJA 3ZK8A 2QI9C 4ROTA 2FI1A 3ZDAA 2OLEA 4M7PA 4CIAA 2D2VA 4B73A 5GV8A 3RODA 1DKPA 5LKAA 3JQ8A 3LBNA 4RANA 4EG5A 1VDMA 1X74A 5BP7A 4HWGA 4A8JC 3UPTA 3AUXA 1CF4A 3PICA 1SUBA 4ZYTA 1PS9A 2ZUEA 1JJBA 1CQJB 1RMTA 3N05A 1JJAA 4YGXB 5J1TB 1CUGA 4C6TA 1KRWA 3AKDA 4FI3F 5AYVA 3B9QA 3ILSA 3CPEA 3V1KA 4TV8A 1PJ3A 1HPLA 1OKKA 4ZI7B 1HLFA 3KD2A 2F59A 4D4KA 1VL2A 4M37A 2HJ9A 3DMTC 3EGOA 4GSKA 1IN5A 1MIOA 1XDDA 2WEKA 4D02A 4IFBA 2C31A 4ZTBA 4ACAA 2CSUA 4N76A 1E3TA 5JNTA 4OH7A 3O3OB 2E1PA 4FLMA 1Q1EA 5LDGA 3SXUB 4EFKA 3BXEA 3SR0A 3WKCA 1EBBA 5CCXA 4MYHA 2QA5A 5AUQA 1N5JA 5EQDA 1O9BA 1U0OC 1WSBA 3EQ9A 3ZU2A 4P7KA 4BWFB 1ND6A 5KSZA 1J25A 2RSLA 4M8SA 2C4UA 3OM9A 2A9OA 2J9YB 4BB9A 2V45A 3WMRA 2V96A 3OLWA 4UULA 3IQZA 3Q0IA 5GZ1A 4ZIRA 3O1IC 5FUXA 4ZHQF 9ATCA 1U2SA 3BWDD 3R3SA 4I36A 3LWDA 1I6KA 3WIOA 1HDXA 5KJEA 2P2SA 1I10A 2IYOA 4RACA 1SUFA 5DXJA 2VJOA 2PVSA 3CLTD 1H4TA 1IY9A 1VL6A 2CJYA 2P1ZA 2UAGA 1E3QA 3BCUA 3MBKA 1L8XA 2E3JA 4HPJB 2B37A 4DJAA 2QP9X 1J2JA 4KAXA 1DE0A 4RETA 5ICSA 5K8VA 1AZSC 1U6IA 4XAQA 3FSEA 2B7CA 2XNDD 4W4TA 3C5VA 4XPZA 3W1VA 2YMLA 3EPPA 4WZZA 3K09A 3EQ7A 5FOQA 1BGWA 4OFXA 4Z0TA 5JDIA 3PITA 1SC1A 2CMHA 3I6BA 3CKMA 4QUBA 4NPHA 3V2IA 1QGUB 2DOKA 1SQFA 2BGMA 3UWDA 3O2NA 2DLNA 4LHYA 3TRKA 2Q0SA 3ZYZA 4MWSA 1K06A 3R0VA 5EOVA 3BIWA 1E9DA 2WTAA 1RWWA 1Z0IA 1Q3KA 3ESYA 3LLCA 3B3QA 3EGWA 1EQAA 2O5RA 1SCNE 4H59A 5EJ6A 1L5FA 3U31A 3WIEA 4JOQA 1P73A 2EJTA 3HYCA 1DPGA 1TO1E 2DUUA 2PSHA 1BXRB 1KEEA 3IEVA 5IS2A 3OZSA 3NB0A 4CMIB 4DLNA 4EELA 1PNQA 2A1TS 3R5JA 3K9FC 3PCTA 1DELA 3C6ZA 2H5LA 1GQSA 4PPQA 5DHAA 3SHFA 3UKDA 5KJCA 1FU8A 2BEKA 5LBIA 4YRTA 3IQWA 3DL0A 2KLBA 4Q1BA 4Q7JB 1RKVA 4BCCA 4JI0B 4YALA 1JLHA 2WF6A 3BJMA 2XY4A 2WIJA 4EGSA 3PVZA 3VDQA 1H4SA 4FDAA 4OVKA 4ALMA 2H2DA 2DHDA 2XNDA 4B4OA 1T2NA 3CVVA 2UZ4A 3NHYA 4GC9A 1MB3A 3GH1A 3L1HA 4M9QA 4LF4B 4IL5A 4BB0A 4CLRA 4DR6B 2ZYWX 2W6PA 3M6VA 4JDPA 3HB1A 1JFVA 2AXPA 3KJQA 4HLUA 3ID6C 2YFKA 3E3OA 1EFVB 1ZBDA 1HO3A 3CEPB 4HAUA 1U8UA 3J80A 2MSLA 4CKCB 4HUQB 2DFVA 4DQVA 5HKAA 2CLIB 2CEAA 2AUNA 2XSZD 3CSSA 3E7DA 5EIBC 2LCFA 3A6PC 2P5SA 5AOAA 2D0DA 3OTOB 1KJ8A 2W5UA 2AC2A 3EGDA 1NV8A 3MJSA 5F2EA 1I2MA 3CIOA 4C22A 3L8DA 3R44A 4ND7A 4ZCIA 2DH5A 2JEYA 4DDUA 1JS1X 5HZHA 3TZCA 4D9EA 1XKLA 2BF4A 1XVTA 2EIXA 2IU3A 3FYUC 3OPVA 1WF3A 3FTCA 4R6XA 4YQYA 3NEJA 2CVPA 1QRTA 3AYXB 3WYEA 2QIOA 2ZIGA 1GRNA 1XAHA 3OZRA 3F97A 3PXAA 4RNCA 3U16A 1B3RA 1YQXA 3H2IA 1DADA 1EP2B 2IVZA 2PGJA 2VP0A 2OWDA 3EQZA 4GOOD 4EHDA 1E98A 2PGLA 5LU9A 2EFYA 4Q4LA 5AIAA 4EX6A 4ENQA 2PT5A 3K70D 3R3HA 1YRHA 2AOUA 2VYCA 2YN4A 3IV9A 2HCTA 1OH8A 4DPLA 1DX4A 5JCOA 4WJKB 3IDAA 1TZKA 3NYWA 4MUNA 4BKPA 4CQMD 4Q4AB 3A36A 3SQNA 1IDN1 1Z45A 2W37A 3JWHA 2OHIA 3OUUA 2X8WA 1NXWA 1EZ4A 2M1XA 4IEIA 2P6UA 1U02A 4MRRA 2XSZA 3MTJA 1Z2CA 2EDCA 5BWMA 5IXYA 2IYPA 1EUCB 2YRFA 3GY0A 1HT1E 3X2EA 2VZLA 1I7LA 1W2HA 3DM5A 3FWNA 4TROA 3DB2A 2ENWA 1C9JA 4OQXA 3REOA 3E9ZA 2Q3JA 3DKIA 2A30A 3G8AA 3DB1A 1V26A 1Z33A 3EF0A 3CVJA 1BXGA 4N03A 2Q2NA 2RK3A 4M1SA 1KIFA 3QRWA 3KQNA 1WW2A 5CG2A 1KS2A 1YT5A 4J7XA 4CTNA 4CLDA 3DZIA 1XF9A 3PFFA 5BW5A 4ABTA 1W2GA 2GF9A 1M6VB 1K27A 2OK8A 3QPCA 3JAWA 5FKJA 1PSZA 4I5DA 1UIMA 5EWJB 4GXRA 4BKOA 4YXWD 5KQGA 2QNIA 3ZDDA 4A2PA 4Q4HB 2ZIVB 4H7KA 2AZTA 3OLYA 1K6XA 1G2OA 2IOFA 2O3UA 4D56A 2HMSA 3FKJA 2PUFA 1CU1A 5EHQA 1ODSA 3QLEA 2QIPA 2YS7A 3U19A 3ORQA 4TV9B 1FDWA 3LX4A 4YAJA 1C4KA 1IHYA 1BX3A 4CQMA 5B30A 3RS2A 4O2RA 1CVRA 3D2AA 1DU4A 2EL7A 3QSYA 2ZBDA 3FAZA 2J41A 2JLBA 1GWNA 4UUMA 3F9CA 2FG5A 3EAFA 3L8MA 2VSXA 2XD9A 5HDQA 1HLGA 4YJ3B 3IR7A 3V7UA 3P9ZA 2Y4OA 2SCUB 3HGQA 4ARVA 4AL4A 3RABA 2QLTA 3ELBA 4O0MA 5DBEX 3UAZA 4EB6A 1ZCJA 3X44A 2NADA 3CE6A 2JIZD 2IW1A 4RA9B 2DERA 3EA0A 1SBYA 3PDJA 4CFSA 3DV0B 1CZOA 1AQUA 1K2WA 2CUTA 2X9VA 3EZ7A 3HEAA 3TAHA 2EW1A 4B31A 2CXTA 1NJ6A 4LOLA 4UPDA 1XAGA 4X97A 4YXWA 1OJ7A 1ZUWA 1WCWA 1JBQA 1TJ5A 4EQ6A 4G0VA 3I5AA 5J4VA 1FMTA 1ZUHA 4PWYA 1VHJA 4PG6A 3LBAA 1JLSA 1K0UA 3L5KA 2YC2C 2FN8A 3OHSX 3RUHA 2JLRA 4PIPA 2QLBA 2OGZA 1EFPB 3JWJA 4AJIA 5EE0A 3TSOA 2CL7X 4R83A 4NEGA 4Z9XA 4FOLA 3VAAA 4WBNB 5A4IS 5BSFA 1E5LA 2VQSA 2YZMA 2A0WA 1BXKA 2IOFK 1K1EA 2BMEA 2YWJA 3SLRA 3WB0A 3EGCA 4Q9LA 3P32A 2DKNA 1V5GA 3ET5A 3O9MA 1I4DD 3R4CA 4G0ZA 1M2NA 4OATA 4LJRA 3ASUA 2B36A 3N2KB 4URWR 3RVPA 1E2LA 4RDIA 2J0VA 1QRUA 4G37A 2O3TA 2ZS9A 3H11B 1M1ZA 3GH3A 1V8DA 2VKTA 4E7OA 4YV0A 3SYRA 5IJWA 3OWHA 4IZHA 4WLNA 4CE6A 3K0KA 1FYXA 3P0HA 1RFGE 2X86A 1Y1SA 4UM9D 1XPRA 3VI3B 3RAJA 4CEJB 2XAAA 4DANA 1TJ3A 1ESCA 2X4DA 2XZDA 2JIZA 2VT2A 3AF2A 3OM8A 4K9SA 5L4LA 5DTEA 4RHYA 4B6EA 3E58A 1XKTA 4GU5A 3RC3A 3FZYA 3QIVA 2DT8A 3E70C 4LJ4A 1BMTA 3C45A 3OIUA 4LW8A 5FTNA 1ODLA 3QVOA 1EDBA 1CHDA 1N6PA 3JYNA 3FNBA 4MRAA 2ZYSA 4UCFA 2H5EA 5P21A 2I4MA 4JVNA 2PVCA 2ZI6A 3IQDB 1JU9A 1G8HA 1TE2A 1E3WB 3T9DA 3KZKA 4REQB 3CUUA 1DCMA 5AI9A 4MX8A 5J4HA 3LLSA 3BMOA 1GNLA 2K4MA 4Q3BA 2DEUA 1AS0A 1QHSA 2DBVO 2VHYA 4Q1CA 2GQ0A 3HFRA 4MUAA 3PSHA 5EQJB 1C3OA 4US2R 3AZPA 3I39X 1APBA 1RPJA 4MQ5A 3KHSA 1NA5A 1QYXA 4Y0AA 3UHPA 3AG5A 2PH3A 3EASA 4U5XA 2CDRA 3QLUA 1HNNA 2VQ6A 2YHSA 1DOAA 2QEQA 5F98A 4TL6A 4Y6OA 1I51A 1PEAA 1UZAA 1IVNA 3ZHSA 4RXUA 2P9EA 3SK0A 5LQMA 3FHOA 2IYYA 2ICAA 1TZJA 3D43A 3DCYA 4L8FA 2XE6A 2YINC 4UZFA 3RSZA 4F46A 5JXHA 1SURA 1QE0A 4JKIA 2AFVA 2VAXA 5A3SA 2E5FA 4RFSB 1E1NA 4IWNA 1NOIA 4EA6A 3KQHA 1UT5A 2UZ1A 3MGGA 4TSFD 2QRVB 2C9CA 2Z3WA 1JSZA 3OHPA 3OPMA 3MTBA 5LVAA 1KFKB 1M10A 1WB5A 5G40A 4CLOB 2ATVA 2I4OA 3M5DA 1CQPA 2AL7A 3FWYA 4FSXA 3FUCA 3TW0A 1AS3A 2HA2A 1G8YA 1M6WA 3NC0C 2C2HA 2A5JA 3OBIA 1CZNA 3BD7A 3PF9A 3CM0A 5AO9A 4FLFA 1SA0B 3MMXA 2ZSFA 5BVHB 3BH7A 2FFQA 3RUEA 2BMVA 1ZM9A 3V9AA 2X8JA 4HRXA 5BN5B 5HMLA 1EUYA 2C2ZA 4U00A 4ILEA 2TRSB 5D5QA 1EB9A 1TEVA 3HNOA 5A4JA 2WWRA 4TYNA 5DMXA 2VXOA 1DHRA 1RDFA 4RH1A 4YTEA 2OFWA 1FRZA 2GT1A 4R71A 3EDMA 4ZA2A 4M0LA 4CL8A 4CMCA 4LK3A 4EHKA 3THXA 1UT8A 2OBMA 2P11A 4KDCA 4WL0A 1FVFA 3RS8A 3NUGA 3S8EA 4L28A 3C5WP 3K96A 2A86A 1UQUA 3EOZA 3RPEA 3RWMB 4FFWA 2M1ZA 5C31A 1QCZA 1WOYA 4MLDA 1NXSA 3QE3A 1PJLA 2FPKA 1W5SA 4ZC1A 1RBYA 3IHKA 5I9TA 1RQNA 5EESA 4ZVSA 1LRLA 4H9GA 2EGUA 4Q7LA 4WN3A 2WJIA 4TSFA 3FCOA 4JEIA 1CQJA 4CGYA 2V8BA 2VHTA 4O2BB 2E82A 3O74A 3LUCA 2C2BA 3LWNA 5MGNA 4QBTA 4DQLA 4CI0B 1QTRA 5AR1A 4FEAA 1BE1A 2FB9A 3NHFA 2GI4A 4Z1MD 3CKLA 4IQGA 3WAJA 4MV5A 5IM4A 2QW1A 3H7IA 4Z9YA 3A70A 2BGRA 4J0FA 4L15A 3MXTA 2Q4BA 2J7KA 2WHXA 3G2QA 2WIGA 3MUOA 4ND3A 5EP1A 4E51A 3VR6D 2Y3IA 1B73A 3IPLA 4C0QC 3BN3A 3SXUA 4Q37A 2FE1A 4KVGA 1IOVA 1QCCA 4XDHA 1TYEB 3WLTA 2CUZA 3O8LA 3KR0A 3SSAA 3CLUC 4IFTA 1LSUA 1KMQA 3M82A 1B43A 2A4MA 3ECCA 1ZY2A 2WMDA 3HSSA 5K3AA 5K20A 1E8MA 1H0RA 1ZJJA 2BFOA 4GLFA 3NGXA 3F3MA 3OLCX 4GWGA 4YNBA 3HDTA 4PC1A 3PHHA 3ETGA 2RGRA 1MA0A 2NACA 3HUDA 4N41A 4X5OA 3ZD7A 2IHKA 3GEDA 2DUNA 3QWBA 3TMAA 1ISJA 2AV6A 2EG5A 2Q99A 4MV7A 4UNNA 1PI3A 1S9DA 4FCCA 3AEXA 3RFCA 1XVIA 1RIFA 5B2ZA 2PD6A 2F1IA 2QWXA 1JHZA 2VK8A 2QTCA 4H3HB 4MWEA 5AFSA 1OC4A 4L4SA 1DC4A 2P5YA 1KDRA 2XADA 3RREA 5FTJA 3SKVA 3SJUA 5CB0A 3DE3X 3STUA 3N75A 4Z1MA 4XCXA 3ROZA 1W1WA 3QW2A 1RWMA 4M2LA 1L7QA 1A71A 2C4NA 4MR7B 4G41A 1XAJA 2I3DA 1X1BA 3O1HB 1J33A 121PA 1Z12A 4FE4A 4KVZA 1NVBA 4RHFA 2VXCA 4L5YA 3VR6A 2FPPB 4NH0A 4UU0A 1QGUA 2NIPA 3SZRA 1SC9A 1JQEA 4NH4A 3VSDA 4HNUA 1LK5A 1Y5MA 4CIBA 1ETUA 1HRKA 1Z29A 2EG9A 3A9WA 4MKFA 4DTIA 4EJSB 1Z5PA 1NXPA 1OJLA 4UU8A 4Z4CA 4H6WA 1NJ1A 3F4BA 1CS4C 2HA7A 1XTTA 3Q7EA 4I4NA 5DBIA 3U2QA 2OZPA 4X8HA 1P9RA 1QCYA 2BHNA 4JENA 1IONA 1M1UA 1Z4PX 2FDRA 5ALLA 3W77A 4TRJA 1BXRA 1QNFA 1BDMA 3V7FA 4XSHA 2ZM5A 2DQ4A 3GA5A 4AJLA 2J07A 2EC5A 4DRYA 2MT9A 5F9MA 3ZU6A 1UZLA 1Y63A 4PAWA 2A35A 4Z7JA 4KR9A 2FLKA 4JL5A 3EOBI 2GJ9A 2Z0MA 4O2AB 5DH9A 5KDOA 4P0QB 1VLJA 2XYQA 1I0ZA 2RGYA 3OQVA 3PU6A 5A0FA 3UM9A 3FOCA 1VKRA 4LQDA 2W2MA 4ZK2A 3EFHA 2GNAA 3E3LA 1YBFA 3V4FA 2OHFA 4ARAA 4IFEA 4WY5A 3UT5B 4OXQA 1HDRA 1SVOA 1Z2PX 3ELDA 5EY5B 1KQGA 3O8DA 4HP8A 5LU8A 3U5TA 2QB5A 1O3YA 1JLKA 1N5IA 1Z6XA 2R00A 4MQUA 3H6KA 3LVRE 3QOWA 2QMZA 2PXXA 2ZSDA 3DVAA 3KB1A 3M4JA 4XUEA 5GM2A 3T6KA 5CEEA 1NQUA 3EBPA 4YV7A 3WGUA 1BA2A 1UZUA 1KQNA 3IEPA 1YRAA 2CDNA 2DPMA 4K6FA 4NBUA 4NL4H 4Y9RA 2O2HA 2QLNA 3VX3A 5DNYB 2B6HA 3REQA 4UDYX 4HNSA 4UU1A 2VZEA 3NHSA 4YBRA 3TZ6A 1Z4QA 2FW1A 4OLHA 4KQKA 1DOZA 4KMSA 3PXBA 4AY5A 4FCWA 1S2LA 4QZVA 1PL8A 4YJHA 1NR1A 1TTPB 1EEXB 2IYLD 1RC0A 2KMLA 1KHTA 2XB8A 1EVKA 1WXFA 1BTOA 3JQCA 1U3CA 4LTMA 1ZLXA 1G9XA 3IVXA 2I91A 3F0TA 4K3VA 1OW3B 2JFNA 3KSDO 3CNBA 1OC2A 4MWDA 3UOWA 1D2GA 5KJ6A 1FVHA 1P1IA 1SY7A 1EM6A 1P6XA 3ROTA 1JEOA 8LDHA 2PXHA 4DVGA 2BZSA 4ND5A 4Q4AA 4TM7A 3QKSB 4BN0A 1DV1A 1WMSA 2B92A 2OCIA 4H4EA 2BKEA 5C0OE 5IHXA 2QQEA 4CUKA 3AJEA 1UBKS 1D4FA 1T5TA 3L07A 3D7RA 2BM8A 3EXHC 5DGHA 3TQQA 4Q3NA 3W6NA 4NDNE 4AMYA 1MOSA 4FDVA 1T3SA 1DEKA 4JUCA 4ZXPA 4D8TA 1LJ8A 1EUCA 3AC0A 3OEED 3ZVNA 1YXMA 2PQMA 3AHCA 4LJKA 4ND6A 1U9JA 2H6EA 5DWVA 3OQIB 1E5VA 1QOPB 2QRKA 4C30A 3W5CA 4M7RA 4C88A 1GG5A 2FMFA 5AVWA 2FSVA 1IM2A 4H7EA 4OD0A 4F4JA 4D99A 5BVGB 1TTTA 3IP7A 1DBSA 3ZWCA 2YVQA 1M6VA 3FSJX 3AETA 1FUYB 3HA2A 4GOMD 3KQQA 3QK7A 3PNQA 4GXQA 2RI1A 4ZQGA 1W4BA 2B5WA 4I1UA 2EHDA 1YK0A 4YLYA 3I5XA 4FXOA 1LEHA 3F7TA 2OQ2A 3R9IA 1H9CA 1U1CA 1NLUA 3KQSA 2J33A 2VJAA 2V9PA 5C2JB 3RAGA 3T4UA 4ZGGA 1YCDA 2YIVX 1P1JA 4TV8F 3GLVA 4XQEA 5IAGA 4TV9A 4UCXA 4BVHA 5LR6A 2RE8A 3DE2X 3Q8MA 4YIHA 3W5SA 2CNLA 3R5SA 3ESXA 4HXFB 5J4KA 1WLSA 3MPOA 2XTAA 4H31A 1M2JA 4V0NA 1JLLB 3NM6B 5B7QA 2HCBA 4H4CA 4LF6B 2O8BB 3HKBB 4D8YA 2CXRA 1GNQA 3A4TA 4BEVA 3GFSA 2VJYA 1N78A 4M1EA 4YJ3A 3OEEA 4WQMA 1QU3A 3IUPA 4F6LA 1M7HA 2LDBA 3C3YA 4FQ5A 4CCAA 2AF4C 5B37A 2GMWA 3T1YB 3DL4A 3KTAB 3OTGA 2ZJ3A 5D3KA 4E5SA 1WCIB 4FYHA 2XJ4A 4YMVA 2CFOA 3HB9A 4Z9FA 4RA9A 3JS5A 3TRIA 2AVDA 4BFXA 3DV0A 2BTOA 1HZZC 3Q3IA 2VBIA 4XZ3A 1SBHA 1XXHE 3STTA 3UJBA 3OICA 1L8OA 3LT0A 4QGBA 3W8RA 4UZEA 4MI9A 3WC4A 1ODKA 2J4FA 1ZJZA 4J07A 2BKAA 3IAFA 1L1RA 4WWHA 1DKUA 1Z15A 2GZDA 4QTZA 1R0XA 5JECA 3L4BA 1V9CA 4OP3A 1EFPA 1Q0LA 3PWSA 1M1NB 3EISA 1L2TA 3BOSA 4QJ5A 2D06A 4X6YA 4YRLA 3SIRA 2AT1A 1WJGA 5EVJA 3GPBA 1EX7A 1CP3A 2GETA 2P30A 2Q07A 3KUKA 4XYMA 5IJXA 3ROGA 2XH8A 4WBNA 1K7FB 3ADKA 3WA7A 5CVEA 2ECOA 1ZBQA 2QTZA 4LRSB 1ZQ1A 3HR7A 2CF6A 3A1UA 4IJ6A 4JYPA 3RROA 1THTA 1ENYA 2X14A 1GTG1 2PUTA 1PNVA 1CRWG 4PBTA 5FI3A 3WYAA 2JAHA 3ZY4A 2OHGA 3O8RA 3N2KA 1E0SA 4F3RA 2IUYA 3LSYA 2JZOA 1IL0A 3H11A 2NPOA 2O06A 2C8JA 2WU8A 3D4BA 2XKKA 4JYZA 3K6RA 3ISTA 4K1XA 5EKTA 2PBZA 4HGPA 3F3SA 1GDTA 5G1OA 2WJZB 4CEJA 5AI4A 4D46A 2LNDA 1SC6A 3G8CA 4EFLA 2XMSA 2X19A 2P4QA 1EDZA 5KTPA 3HVJA 5BSRA 3FPBA 2CY0A 3UK0A 2RAFA 4RF2A 4KN9S 5DXFA 2QTLA 3CNLA 3LW7A 4L8GA 2ESRA 4MCJA 4X1OA 5K3OA 1BQ4A 5LDDC 1PTJC 2CHQA 4N48A 1QZTA 4FT2A 4MVJI 3O38A 2C00A 4Q66C 3PC8C 4Y2UA 3SBDA 2QG4A 2Z8XA 3OO0A 4KUGA 1W9MA 5TQ2B 4DCMA 1Y81A 3G1WA 4XVUA 3QNMA 1C0LA 3BWVA 1E9BA 1WNFA 3QF7A 4WZ6A 3QWHA 3T5DA 2A0YA 2BGTA 5IXJA 1QP8A 3SHQA 3LT2A 4OSEA 2WUGA 3VR3D 2G25A 4BASA 3LCMA 2ZQ5A 2I4TA 4FONA 1NUPA 1UQTA 1BH6A 2HRRA 2BONA 3F49S 3MQFA 1OXVA 4KAFA 5A6SB 2R60A 4H0FA 3G5TA 3ZDBA 2G0NA 4RIFA 3RJZA 1QK4A 4NENA 1OLXB 3OPYB 3G9UA 3RFUA 4KGDA 1PUJA 2VPYA 3FVWA 1DQRA 3H2SA 1IJKA 3NWOA 3GJZA 4E4RA 1NNUA 1J5PA 5FFFA 1J20A 2X9LA 4RFSA 1IK4A 3MELA 3TCNA 3KHTA 1M1XB 4AYXA 2A1UB 5EPEA 5FTKA 3ZQJA 3AIIA 5CP8A 1TLTA 2QRVA 2NZJA 3LA8A 5ICEA 2RI6A 4BDSA 5IAAA 2H8KA 4JJAA 4CLOA 2IV3A 2XNCA 3W4JA 2WF9A 4I9UA 5CX4A 1YDMA 3ADCA 4M86A 5A9TA 5KCZA 2EBWA 2CJWB 3A8TA 3UHAA 4Q3OA 4RULA 1QH0A 3SS8A 4JR2A 3ORRA 3EDQA 2CK3D 1XALA 2WU3A 2ZUTA 1ZM7A 1A9RA 2H51A 1SA0A 2A14A 3BILA 4ZVVA 3VH1A 1OXXK 2FG7C 3O4JA 4CV2A 3THWB 1Y1PA 3DM9B 4J9UE 3FDZA 3VJMA 2J9FB 1CB0A 2ADFA 1UZMA 2JKZA 4Z3DA 3GJ4A 3JWEA 3N87A 3KB6A 3KU1A 4HQOA 3VPHA 3C4VA 3A1CA 3VR3A 5FBRB 3U7FB 3ZV5A 4Q1VA 1DV2A 2YXLA 4G4SO 4RD1A 1F06A 5EUBA 2UYCA 2CFSA 2ATXA 1X13A 2BFMA 3GNQA 1AKNA 1E9AA 3KZNA 3QXJA 4EGJA 3DLHA 1ML3A 2A0FA 3T1TA 3JALB 1DQZA 1FFGA 1H66A 2V3VA 1X2BA 2WD9A 2B3TA 3FCUB 3GDWA 4N6OA 5GWXA 2AOXA 5IG2A 1QFXA 1XELA 1WEKA 2C9YA 2OYRA 1SKMA 3WAGA 3EPLA 5T57A 3PIIA 5C7IO 2GKGA 2AJTA 2G40A 2D2XA 1A98A 2NP6A 3FPEA 3ZDQA 4ERXA 3CUKA 5K3BA 2ODQA 1I8TA 2JI6A 4ZCSA 4O2BA 5K99A 5DNDA 2P0EA 4IUCS 4IBOA 4MIKA 3D0RA 4MZDA 2VF2A 4TKMA 4C08A 1G9SA 4K0RA 1J9EA 1FDIA 4IOLA 1WULS 1ZS9A 3L82B 3PQ6A 3IP1A 4MVJD 4RSHA 1XSEA 4TOIA 3ZE2B 5B3JC 5CEFA 3TQIA 4DV0B 2CT8A 3MT8A 2CK3A 2XVZA 1Z6TA 1OI2A 2YYYA 2BHTA 2BW0A 1QQBA 4N65A 2IBTA 2PZ8A 1G41A 4UMEA 4YMHA 3IOCA 3PQ4A 1LNZA 2Z9DA 4G97A 4H7IA 5IVIA 4JB8A 1DBWA 3HZOA 4I19A 3WB1A 2XCQA 1RQ2A 1VL8A 4PRYA 5IDQA 5KEIA 5BWOA 1BS1A 1YK1A 2VHXA 4RTMA 2C0PA 3AUFA 3HJAA 4MNTA 2D5CA 2AI2A 3X3HA 3NIBA 1KI9A 4MUGA 3U3JA 5E6UB 1Z26A 4HPWA 5I4IA 1JH9A 1JUDA 4HEJA 3K20A 2PUBA 3DQZA 2ZYIA 1GNPA 5AW5A 1HDZA 3KQOA 4TT3D 1I3LA 1MU0A 1LI7A 4RZIA 3FUVA 1SXPA 3D3KA 1P77A 1P44A 4JGIA 4LXHA 1Q22A 1NW3A 3AR5A 1G8PA 5AJYA 2ON6A 4GPBA 3FNHA 4B2LA 1ZNWA 1DAFA 3DYBA 2O8NA 2ILTA 2W43A 1QLJA 3JQAB 3KFLA 3DEYX 4TWZA 1RXIA 2WT9A 5DISB 3THRA 1DTSA 3AFMA 5EZSA 4MKIA 3SEZA 4KRFA 4MVJA 4R9SA 5BR7A 3UQZA 4AUNA 2E18A 1IQ0A 1QR2A 3LBFA 5B36A 4LV8B 2MSWA 5I7OA 1SCQA 3KSUA 3W7BA 3LHIA 1V3UA 4A73A 3QEOA 4CF6A 4MR7A 3OE1A 3SKYA 4S2EA 1K68A 2AFRA 2WA1A 1UQRA 3WZMA 821PA 1JTVA 3FOBA 4FMPA 1PRYA 1K08A 1X1DA 1EWRA 5TGDA 1YL5A 4EI8A 1ID8A 3LBHA 2YOHA 4C7JA 3U9TA 1AG9A 1Z7GA 2AS0A 4RK7A 5EEHA 1BCRB 4EJSA 2ZE6A 1EGHA 1TK2A 2ZAOA 1Z18A 2HSEA 3ZV6A 5IC5A 3B8EA 3H9JA 1WAMA 1LXCA 1LW6E 1UAGA 4CU5A 1A8UA 4HBGA 4TT3A 1I9CA 1NFQA 2E4UA 4M38A 3TBFA 3PPIA 4DLPA 3OPNA 5EWMA 3FRIA 5FWNA 1GT91 1Y37A 1L3IA 4MPTA 1PGJA 4BCDA 1W8DA 5ESRA 2POCA 1TVMA 2IEGA 1G38A 4YHHB 2HU8A 5M04A 2V59A 1Z39A 1QXSA 4XWGA 2XCIA 4YGYA 1XHLA 4Z7QB 1N8TA 5B12A 1AU9A 2E5WA 3Q3JB 3GMIA 4O2AA 1XKXA 1OFIA 5ALZA 4AG6A 1JFTA 4G0WA 3KR1A 3OU6A 3WGKA 3VR4H 3DFUA 2QE7D 4TWAA 4EA9A 3RJMA 3QOYA 3VOTA 4JUIA 1JAZA 2HQRA 4Y9UA 4ZVOA 3N0WA 4F93B 4LY9A 3EPHA 3CUYA 2AYZA 4D0GA 3C7AA 2GBLA 1QFZA 5L3VA 1HTTA 5E2AA 2IHTA 3ORYA 4KNWA 1R0SA 3WRVA 4EVIA 1E8DA 5BNTA 2P2NA 1TD1A 5DM2A 4KIFA 3F5MA 4V39A 4N0PA 4Z7OB 3D02A 2ZAYA 2IH5A 3KETA 4I55B 4PNPA 4GX2A 3AR4A 5G0WA 1GG2A 2QMEA 4ZOLA 1AKTA 5DOVA 4OGFA 4TRRA 1IXYA 1ZNXA 3HSKA 3QX7A 5JFTA 3ENQA 1VE1A 2JD1A 1K8YB 4ZAYA 2B30A 3NBMA 4Y2YA 5EINA 2ZBFA 2BRUC 4CM7A 1CQXA 3OQOA 1G4AE 3AR9A 4P4NA 3RTDA 1CERA 2WTXA 4UTPA 4GYWA 3GQBB 4JOSA 3LT5A 4BMZA 3RKRA 1Z37A 4FB4A 2CLHB 3JWGA 4TWIA 1L4YA 2CL0X 4HGOA 2MTBA 4FCVA 3QJYA 3AP2A 5JMWA 4JMLA 1L3BA 3S28A 10MHA 3VHRA 2XUDA 2IGTA 4EO4A 2RGAA 5C37A 1GHTA 1UKAA 2BFWA 4H2DA 4NAHA 4OXKA 3A25A 2Q9CA 2QE7A 1R5JA 2GJ8A 5K8IA 3KIPA 1C8BA 4MUIA 3ZZ1A 1KYIA 1J56A 3V3TA 4EYSA 4Q0MA 1TIBA 2XWPA 3NOOA 2AOTB 2GEFA 4F06A 4FSHA 5ISMA 1YOBA 5ILGA 4IRMA 2WWYA 1JKFA 1SBTA 2QV7A 2XQIA 4Y7DA 4S1PA 3QKSA 1DRVA 5DHFA 1QS0A 3L8GA 5DHRA 2Q6LA 1RZUA 4H6XA 3KJFA 3VYUB 3EVTA 4EATA 5JJCA 1B8VA 2JGDA 3VPFA 5F2OA 3KJZA 5WRFA 5BQXA 2ZXEA 3DG9A 4GP7A 4XIJA 2AYXA 4G01B 2JAPA 3ZJYA 2FU5C 1UXHA 1JW9B 1W52X 3LCRA 3ESZA 3O0TA 5DPMA 3EVAA 3I12A 2RAPA 1DWOA 4RZ3A 4YI5A 5E8RA 2H5IA 3OPYI 4C01A 1Y6ZA 3IFSA 3OQIA 2HZBA 4KXVA 2W98A 4INAA 1CQIA 3GL9A 4DYVA 2QTNA 5ILOA 4KJZA 2EZUA 5BVGA 3NTXA 1Q12A 1XJ0A 3VO1A 2QRNA 2ZS8A 1NJGA 1C1YA 1OH6A 5JSQA 4N3AA 4ECEA 4AKGA 1GNVA 1Q1NA 3B5JA 3IE0A 3KUCA 3UMVA 4B3GA 3I1IA 4J0EA 1EB8A 1NSTA 2FW9A 3DZHA 1Q91A 3N0VA 5FFMA 1CUCA 3NHRA 1JTFA 3RVSA 2ZB3A 3IHTA 2YVAA 2HRZA 1PLKA 2Y71A 3RB8A 3PHIA 5C3UA 4FT4A 3WB2A 3SR4A 4DDVA 5CCEA 2ODTX 1E2JA 4U9UA 3GGPA 3GROA 2A3NA 2HJVA 3NC4A 5LP6F 2YN2A 3WLLA 3IJRA 4ZI7F 4LHXA 1YB5A 2NU6B 2QY6A 4WCFC 2VHWA 5TX7A 1OWNA 3V2GA 4B8ZA 5F33A 5KB3A 1B23P 4IRUB 1FSPA 4B35A 1K66A 2YXNA 3KKOA 5IM4F 3FN4A 1EBUA 1GTZA 2IEIA 2O8BA 4LJAA 1ICIA 4TKLA 3V46A 5F1YA 3HKBA 2FNAA 3THSA 1EM8B 4NQRA 3RU7A 3FPHA 3TG2A 1ATZA 2G6BA 2HA4A 3DVQX 1OAKA 3LA6A 5E9JA 1AJEA 1IN8A 3ORHA 4JXXA 3OFKA 4CG0A 2EBFX 3L8EA 4A16A 5EN4A 3X0DA 1N0IA 5JWRA 3KTAA 3Q7IA 1KO4A 1LPNA 2HNAA 3JWPA 4S05A 4LA4A 4QQ8A 1KNQA 1WCIA 1Y7LA 3J81k 4TSKA 2BGNA 3CNNA 4HL6A 2Q7OE 5LQKA 4D0LB 5BQPA 2E0IA 5DYWA 1KZ9A 3VPSA 3NT2A 2PWPA 2HDHA 3PQEA 4ZCMA 1GYRA 5HRUA 2XXAB 1W59A 3OU7A 5AVVA 4PO1A 3RNLA 1QVRA 1WABA 2HEGA 3CUTA 4YMTA 4QBGB 4A27A 1AHIA 5DLYA 1PZMA 4D98A 1B41A 2V7VA 5U1PA 4PN7A 1VPDA 1M1NA 1X38A 3G3EA 1AX9A 1C41A 2FX5A 3LNCA 4DIMA 4E31A 3ROPA 3JPWA 4R05A 1KC1A 1Z34A 2YJTD 4HDQB 5B1HA 1W36B 1PUXA 1YZ3A 1Z5ZA 3PQ8A 3EULA 5CM9C 5FBZA 1NI4B 4NIMA 3PFKA 2QL7A 3U7EB 1LSOA 4AT1A 1SPXA 1LDGA 2B8EA 4BO5A 2H4HA 5BURA 3A4MA 1DKOA 4P93A 4PN3A 4R6WA 2L69A 5E7QA 2W6CX 1CR0A 3PC4A 4OHBA 3WYBA 3DO6A 4ZO8A 4K9DA 3KAQA 3R8CA 4AKEA 3H9BA 4RF4A 1I2BA 1Y1KE 3BGWA 1RP7A 1TCCA 2HKIA 3EZYA 1DBQA 4BWVA 2VT6A 3DBLA 5DBOA 1ORTA 1D6NA 2DHCA 4IJUA 3RBAA 3PQFA 4XH9B 1T9GS 1FTNA 1AKVA 5KQPA 1Z22A 4MAMA 4TN5A 2BMFA 4DEXA 3E27A 4QFDA 2Z08A 4YR9A 2ZR0A 4D8UA 2PRIA 2J85A 3PEFA 3DULA 4CQLB 1GUZA 1NTOA 2FN4A 2PZGA 1C0EA 3DMTA 4DJJA 1HFWA 1XX6A 1OX4A 2RCNA 2JJ2D 4YP1A 3STXA 3SYNA 5JAHA 3V7YA 2VSOA 2DCUA 1WXEA 5TQ2A 4YR7A 4H1TA 3WK9A 1TA4A 2PX4A 5ERXA 2RHTA 1WUKS 4QJIA 5H1YA 3T7AA 1MVLA 4GMHA 4Q9IA 5K51A 3AOEA 5KAPA 2ZITA 2WSIA 4D5EA 5T8KC 2MINB 3V34A 1CTQA 1GAQA 3KYJB 3L7BA 5K8LA 1D1QA 5ESDA 4EB8A 1GKKA 2PGAA 3H5RA 3DA8A 1LLFA 2QE6A 5FP0A 5FJIA 1UXIA 5CA1B 3P2OA 3TNFA 5E3IA 3UXEA 5A6SA 4EHAA 3TIVA 3CMMA 1PD0A 3TNJA 1M83A 2AZMA 2G83A 1U5AA 3KK0A 3OCZA 1T3LA 2YJ4A 1D0IA 4FN4A 1OLXA 3OPYA 2B7BA 4G6ZA 3FRJA 4HADA 3TVYA 5L3QB 2QUAA 1S3IA 4MUMA 5B5SA 1FEZA 2Q45A 1S2DA 4DIDA 3S2SA 4OKNA 2XE8A 1R88A 3D5EA 4RQTA 3G6WA 5FI1B 4RJ2A 4DYDA 3AVTA 3GT0A 4HDSB 4YUAA 3NUQA 2K6GA 2B94A 5C52B 4N4AA 4CLXA 1FCJA 3FTNA 3K1JA 4X62B 2CXSA 4UEJA 5EPUA 4A8PA 1M76A 3LP5A 3KYDB 4IIYA 1ZWKA 3V9PA 1PR6A 2AIRA 3AXSA 4BCBA 2JJ2A 1AVTA 4OJKA 4K28A 3DHEA 3O4FA 1TQ2A 5DMHA 1KRXA 3E8MA 5TVGA 3THWA 1XZNA 1SU7A 1AUOA 1NP6A 3T06B 4RVSA 3GT3A 4OGGA 4C04A 1YJAA 4GR5A 3KLBA 1KDVA 4RIHA 5TIIA 4JYAB 2NT4A 1OFUA 5F35A 4EYQA 4KR7A 2JBWA 1J1IA 2RC5A 3EXG2 3AHGA 2QBYB 1WZIA 5FO1A 3JX9A 4HJXA 1G5QA 3ZWMA 3QV2A 1ZOIA 1AKWA 1X8JA 2D00A 2FPGB 2QJTA 4MUJA 4HDKB 4V0SA 2CHFA 3WICA 3TYXA 2FEWB 4MPRA 1ZRSA 4JKOA 4TWRA 3SFTA 1DI0A 3WFJA 2PUJA 3MYYA 5EIOA 3G2KA 1RRKA 4BMPB 4DM7A 5B6JA 3K0BA 4AQ7A 1SKYE 4FOPA 3K73O 3PCXA 4MV8A 5DCUA 2H4ZA 4QXPA 4FEEA 5DKFA 4NATA 3AI7A 3BL5A 3ZU3A 2BTQB 4CF4A 1GTRA 2W4IA 1IFXA 3JQAD 4ZO4A 1QPGA 1OXBB 1AK9A 3L7LA 3WO0A 3AM5A 1ULBA 4AO7A 4BNWA 4J91A 1DAGA 1DBPA 3UPUA 3PIRA 3VR2D 2JI4A 2XB4A 5B7PA 1VIMA 4A6XA 2NSYA 1ZW6A 3DR5A 4TLBA 1XP8A 4XM1A 3KOOA 4P7FA 1V4VA 4MUEA 2YWFA 1A1SA 3EEFA 3DE4X 2EIHA 4FN5A 1KY4A 2GZ1A 3QYJA 4FGZA 4KYIB 1M67A 4C89A 2HM7A 2CNWD 3ICVA 4TV9F 1Y1QA 1Z17A 2IWRA 2YJ3A 1KDYA 3PGLA 1T9ZA 4OQEA 4Q05A 4C9BA 3T0GA 2Z6UA 1ESMA 2ZCJA 4NMXB 4W7HA 1T6NA 2GEJA 5E6UA 1FP1D 3JD3A 4M7WA 4O1MA 3FYUA 4Y8VA 3DKRA 3EFBA 4UDNA 5DIZA 3DOUA 1XMXA 1L5MA 3PG5A 5E3JA 4YJ3F 1W85B 1S6YA 1JRLA 2O1SA 2ORWA 3NS7A 4HFMA 4UCWA 1D8TA 1E1LA 3AKEA 4N3BA 2OV3A 2AQIA 4OBBA 4YCNA 4LBWA 5I48A 3GCXA 1KMHA 4PCUA 4DA8A 5FTLA 4IDHA 4DDTA 5SYNA 1JQDA 2QMYA 2VHCA 1C3VA 4MR9B 3MWYW 3WR5A 2ODBA 1YR6A 4ZN6A 4UD6A 3JQAA 3ZE1B 4PSDA 3EVEA 3DDNA 4PV7A 3IJPA 4CCSA 2PMBA 1LC3A 2QZSA 5D3ZA 1RWNA 4MYRA 4J16A 2PKWA 1EK6A 3HLKA 3VR2A 2OG2A 1IEQA 2ZJOA 4LJ7A 5CLJA 4RJKA 2O8FB 3M6LA 1I4LD 3VAZA 2FCRA 1QKKA 2QTAA 3AP1A 3IQFA 4O3FA 1Z38A 3FB4A 3UBMA 3ZLUA 4JJIA 4M0DA 1VA5A 3RIYA 2GPJA 2BJHA 4E0BA 3SX2A 2XTNA 3QENA 4V03A 2CNWA 4EJ2A 1SIUA 4V0LA 1RHJA 3I2KA 5CM8B 1JIQA 4BX2A 3WGHA 3CCCA 4FQ7A 1KPIA 5K0TA 2MCFA 1X1QA 3T7IA 2OYSA 2DLCX 4AAYA 3FYDA 1XXHA 4RLQA 4D3XA 4CMGA 4FOTA 2HV8A 3KEOA 3GFQA 4QOHA 1XR3A 4J43A 4B40A 2UU9B 5AQ1A 2VCHA 1N0VC 1G6OA 5ALJA 2CBZA 4LJLA 3WQQA 3S0JA 4TTPA 1QTIA 3GEHA 1U6KA 2GNOA 4M1OA 3DR3A 4RZSA 1YFLA 2YWGA 3LX5A 1SBCA 2JANA 4WY2A 4EZBA 4DKXA 1VBMA 2P2ZA 1UPFA 2XBUA 2ZYAA 4ZARA 5L6MB 4BGDA 4LDZA 1TCUA 1EJ2A 1JMKC 2B2XA 1DBIA 1MAHA 3FHLA 4P0TA 5C1IA 1NPDA 1VI2A 3NJ8A 4NU5A 4XR9A 4GM0A 5HCIA 1NFRA 3R20A 2F6RA 1DKNA 1V11B 3CZ4A 1UJCA 1O9HA 1B6RA 4P6VF 3UGKA 2AG1A 3ZQKA 4B2PA 1XO1A 4QELA 4QYIB 2FR8C 4ITUA 4LYDA 1M66A 4ARCA 3HU3A 1NVFA 2WIDA 1A5BB 3LU1A 4BMCA 5KC8A 1U7UA 3E5RA 5JAQA 3N5CA 4Z0NA 3UT6A 1C3LA 1NOJA 3GFOA 4FW9A 5AW4A 5K01A 4I55A 4FMBB 2ZYDA 2V7XA 2P68A 4JT9A 1YC5A 5D7NA 2PX6A 4RMNA 2WJAA 4LDRA 1POWA 4RHEA 4YRPA 2FRVA 4D4HA 2G70A 2PGIA 4EW1A 1CUFA 3HCOA 4DJFC 1LBHA 1MORA 1KEWA 4WEOA 1J2RA 3UJDA 3RVJA 1TM3E 2PTHA 2DRIA 1SUIA 1VHDA 3E4CA 3OFSA 1YAJA 5JC8A 1PR1A 3GP3A 1SPBS 3UWSA 1WW8A 4P3NA 4YMLA 1YUNA 1YQEA 1BYIA 2RGNA 5K8TA 1NJSA 5D84A 1N32B 1WTAA 1IYZA 2FX2A 1W0CA 3DDSA 5IARA 5LQNA 1I3OA 1GUYA 1LSJA 1QG4A 3NBYC 5E7JA 2HPHA 5DDIP 2DGDA 3H83A 1W93A 1ISPA 4J3FA 3DOEA 3WXMA 1JNYA 3I9NA 3HBNA 4PHCA 3EZ6A 4DNXA 1K3TA 3AL0C 3P0RA 4DCSA 2QT0A 3MIIA 2VOEA 4QOGA 4CQJA 3DT6A 2YV4A 3C0KA 4QTXA 4AIIA 2ZM6B 4LF8B 3WRYC 1B0ZA 1ZEJA 1QBGA 1PHPA 2GCEA 2QX9A 2FW8A 2VYFA 1JHPA 3ZHCA 1E3SA 1VM6A 1IB6A 2Q5OA 3H8VA 5E4TA 4F56A 1O6BA 4GM1A 4GX0A 2P9BA 3JRNA 4I1YA 1QRDA 4CMJA 3D81A 4H1VA 4FHFA 1W8IA 5FLEX 3AB8A 5GONB 5T4FA 3UAXA 3MFQA 1A8QA 1WNTA 4NMHA 2X42A 1T10A 2EJUA 3BA6A 3CGGA 5DEOA 5GGYA 1XRQA 4F2PA 2CFTA 3TXXA 4YMGA 2NPFA 1I4EB 3TLJA 2XKAA 3G0IA 1VIVA 2WUWE 3EPKA 3DLBA 4NCAA 1C1HA 1YQWA 4EKNB 5FORA 1XCLA 5KX5B 4HC4A 3LCUA 1PJCA 1M72A 5IBRA 4Z8YA 4EFMA 4UNSA 4GYJA 4BJ1A 4JLNA 1FNDA 3Q0TA 3CZQA 5JANA 2BCJQ 4XD2A 1BVHA 2VRCD 4HX2A 3G17A 2AW5A 2VJPA 2ZYUX 4E30A 4GRIA 1DDOA 5EWLB 5HYVA 1L5WA 1F8GA 4KYUA 1EXDA 4FBGA 2Q28A 4GLLA 4PINA 2JVKA 4QD3A 4IVPA 1ZIPA 2FLVA 2Q3DA 4MJ3A 4UPEA 2IL1A 1K75A 4AF8A 1L4MA 4O2BF 1P61B 4BNJA 2PWZA 3BRCA 4WKGA 2RK4A 3MAAC 2AGVA 3L4KA 3FUXA 1F4LA 4IKPA 1XPJA 3DLPX 1DAMA 4FIZA 3H5NA 3F6SA 4MIEA 1K86A 2JAWA 5CFLA 5JMTA 1Q0UA 2WOOA 1G7CA 1DQPA 1W36D 3KXPA 2HK7A 2H5JA 4HMOA 3CRNA 2VP9A 3RC9A 3VU3A 3G7UA 3ABRB 1EM8A 1TUEA 3AR2A 3H9EO 1SKYB 1YZYA 1P7VA 2GXSA 3LKBA 4L3WA 2BEWB 2G72A 1T1RA 4K9LA 3EIUA 5GVRA 3GNLA 3UUEA 1VI5A 4KBFA 1LA2A 1TNDA 1MX1A 1WMEA 4MJLA 1XWIA 4X64B 4XB1A 3R6LA 1Y4DE 4FGLA 4NS4A 3WKDA 4R2IA 1YA4A 4JVMA 2X2FA 3ZHXA 5K03A 4YAUA 1XK6A 3KAJA 2VRCA 3HFSA 2MSKA 3GFPA 4H0CA 3PR1A 1KAGA 2D74A 1PT8A 2NSLA 1GEEA 1TAHA 4HAIA 1S9HA 4WKCA 1SAYA 2XXAA 1QWSA 2OXRA 3IXQA 2D54A 3FBWA 4ASUD 4RJIA 1M2OA 1SVWA 4KWHA 1SBQA 5KNCH 1YJXA 3OCUA 4QVGA 3IKMB 1BJKA 2QP4A 4DIBA 1EDOA 1GA6A 1PEKE 2X22A 3Q9UA 3GFFA 4MVJF 3ROFA 3UEOA 1GN9A 2QN6A 4F9EA 4OX9Y 3QEMB 1KQPA 2BR5A 3C7DB 3NAMA 1Z7EA 2FEMA 3E1SA 4EHLA 1SOAA 4EFNA 1FDSA 1Y3FE 2ZWMA 1MEJA 1P1FA 2J48A 3A05A 1NI4A 4I5EA 4OQDA 2XW6A 3ASYA 4JLAA 1DIAA 1IBCA 2BUBA 3GUVA 4LI3X 3B3GA 1AZLA 5KPDA 3BRQA 1O87A 4EO9A 4DV2B 1SH7A 1YHZA 1XN1A 2DQYA 4XFDA 5FLYA 4HFJA 1PNRA 1QZ3A 3TB6A 1A3CA 4GQAA 4MH0R 1A9OA 3OZUA 3QUBA 4H6VA 1RJWA 1XLWA 2IXBA 1RQ7A 4X71A 3I9KA 4WLVA 1JP7A 4ZCRA 4QARA 2YBEA 3EZGA 4GX1A 3FKSD 2B1RA 4A0QA 3CF6R 4FJ0A 2ECPA 1BZYA 2EX1A 1E1CA 2NVWA 2JGKA 1LBIA 4CQLA 2RHRA 2NTYC 1TJNA 3CWZA 4N47A 5C51B 1T34A 4ASUA 1CPYA 4R8VA 3FG9A 2J0UB 1BEEA 2Z2ZA 4RUKA 2HC9A 1S8NA 4MVWA 1JG7A 4FC7A 1B76A 3MS7A 4A36A 2CYAA 4IFIA 4QGAA 3D8HA 2VPXA 3IURA 5C4MA 1Z2OX 1NFFA 4PZCA 2WKWA 1A8SA 3BF8A 4V0QA 5CYFA 3B3JA 1GYQA 1C9NA 2GBFA 3ASZA 1CF2O 3B78A 5ADUS 1AO3A 3KX2A 1H8HD 2OD7A 2MINA 1P18A 3OEHD 3K30A 4DBVO 4HVLA 2FDXA 2YWCA 1AQJA 1H8ED 2ANCA 3A9TA 5CA1A 2UXDB 1PBTA 2PCJA 3UJ9A 3RVMA 4B80A 1KGSA 3AL2A 3D3NA 3A2KA 1SR8A 1GPWB 4HMPA 3UCEA 2OV8A 1SC3A 1E6LA 2ADOA 2Q3CA 3NDIA 4QRIA 5FTWA 4DG5A 5JATA 4PGGA 2I54A 3FVRA 3HKCB 1QIGA 4IUDS 1W5FA 1QG0A 4IIBA 1C29B 3W7VA 5JOQA 1GSOA 1ZUD1 2O7VA 1OBVA 4LMRA 3FKSA 4NZOA 1IHDA 4Z4FA 1EFKA 5HM8A 3PEYA 3ESQA 5B6IA 3QU4A 4FDUA 3KLPX 2QYHA 3RARA 1GDHA 1LS6A 5I6DA 3C8DA 3KYDA 4HAWA 2R65A 5JNLA 5LOVB 3HL4A 3ZDCA 1WXDA 2HHLA 2NN3C 4D3ZA 3CZMA 2DB3A 1AOXA 4WN9B 3WSWA 1FYFA 3HO6A 1V8PA 3TQTA 4F4DA 1A9SA 2I6FA 2OPBA 3ANTA 2IV7A 2Q0HA 3MHPA 4AWXA 1L3CA 5CEJA 3BWMA 3EBLA 2CV2A 2BHLA 1H8HA 1G4HA 2QTVA 4PRKA 2PUVA 1ZMRA 2ZBPA 3OEHA 3DXYA 4WT7A 4L57A 4ZALA 5GOTA 2I3AA 3JQ9A 4KVFA 3VU9A 3G1TA 4HF7A 3ZXXA 4W9NC 4CTMA 3KBOA 3P94A 4XSVA 1H8EA 1IUOA 1WSWA 1X3LA 4LOJA 2H63A 4P54A 3RH0A 3ZH2A 4JIGA 3TZKA 2B34A 2FPGA 3AIOA 2Z6VA 4C5CA 1ZNYA 4HDKA 4BMXA 2I3BA 4WVFA 1HUQA 4E1AA 3ZCVA 1QHEA 4GI2A 4RK1A 1S1CA 1RQPA 5AOCA 3WYCA 2B0JA 1IHXA 2Q6TA 4YWHA 1LZLA 2Q7XA 1XZEA 3INYA 2OPHA 7AT1A 1W34A 2YOFA 3UVEA 2TMYA 1VLLA 2AN3A 3OIDA 4OK3A 4XTCS 3PX2A 2X4GA 3R2JA 4B6JA 1TK9A 3HWRA 1NN5A 2CE2X 2GZRA 4DADA 1UFQA 3MM4A 5T4BA 5KSOA 1ZMOA 2Q6KA 1OFUX 1P1RA 3AYZB 1PO7A 2WJWA 1UBHS 4ZYWA 3LJKA 5F2NA 1A8PA 1F0KA 5FV4A 3I0NA 2QMQA 1RTTA 3GEBA 3JQ6A 3VRHA 1FYVA 2V7WA 1U9ZA 5EG5A 4CTOA 2AR7A 5K45A 2H4WA 4O1IA 1QQ6A 1J0XO 3JYHA 5DO9A 4WEQA 3ZDEA 1V7QA 1AURA 2GK4A 4MEBA 2OD2A 3CN7A 2GYYA 5K1ZA 4E1VA 2DUWA 3RFXA 4KE9A 1PSWA 1N6NA 5L6LB 4Q9KA 4I1SA 2I03A 1RHMA 4R40A 5L3RA 1T4DA 5LZ5A 1F9AA 4MO9A 3RHZA 2PKQP 1FS5A 1MB4A 3RVNA 2I1QA 2FW0A 1J1UA 4HXYA 4J0JA 4LK2A 4OHRA 5M3BA 3TZEA 2H0QA 3BHJA 2Q2WA 2GXQA 2ONZA 3RE1A 1AF7A 3IUNA 2PT6A 4GKBA 4XPIB 1Y3CE 1W85A 2CD7A 3BORA 3DE5X 3N2ZB 4FYIA 2A5YB 4KN8A 4PYMA 4UE2A 2ZGVA 4FP9A 4MKGA 1G291 4XDGA 1LDEA 4MV3A 3A6GA 1ZO8A 4FNGA 2UYYA 2Y6VA 3RSGA 3VNVA 4MR9A 1GCGA 2P0YA 3F46A 4DILA 1PJ2A 4FI3C 3HUTA 1X9HA 4BJ5A 3UGJA 3ABOB 3O91A 1ZVMA 1EWVA 1NPTO 2GFIA 1X7WB 4D74A 2O8FA 4EJFA 1SVLA 4YREA 1NZJA 2VK2A 4IZ6A 4YRFA 2QBYA 1J2TA 1TQ8A 1NAHA 3DPSA 3EH2A 2COEA 4ENWA 4RTSA 2HHHB 1FS6A 3S2IA 2JIPA 3GPDG 1RI5A 1W4ZA 3TTWA 1YZNA 3BSSA 5EFZA 1UKYA 3C3KA 4X8LA 5EMNA 1CQZA 1LCIA 3HJCA 5C8DA 5KBYA 4Y6SA 3C5HA 3MMZA 4G5SA 5BO5A 3UXHA 2BTEA 1FRQA 4PZPA 1MQ8B 2QVZX 1K7EB 2RHBA 3L6CA 4DR1B 1P81A 1QF9A 3MMPA 1NF3A 2FQ1A 2J67A 3NOQA 1Z0KA 5F52A 3PPYA 1QVAA 4YIKA 1J99A 3HXLA 5EYPB 1EJ0A 5CLQA 3V7NA 2JB9A 2CXHA 1R1DA 4QVKA 2QQGA 4BTEA 1F2TB 1R18A 3A04A 4IIVA 4XJSA 2B69A 1NR5A 3IVAA 4WCDA 2PLNA 4P4UA 2YRWA 3PL1A 3DTNA 3HCEA 4OHMA 1Q0QA 1ZESA 2M2IA 2XUIA 3M4YA 2AQHA 4HOYA 3C85A 2NTJA 3ORSA 4OKSA 1KU0A 3FSGD 1USIA 1UWLA 4FR0A 4OGKA 4JOCA 2VH5R 4P5EA 4IIJB 3GLIE 2OAQ1 5DBGA 2V7UA 5CBKA 3RADC 3NVKI 4ZV7A 3ZTTA 5F77A 4PAGA 3QYPA 2XUZA 4QVIA 5BOSB 1B14A 1JQLB 2HU7A 3AVXA 3CZ9A 3JRXA 2K87A 3GLFE 3LDGA 3RYCB 1GPBA 3UAOA 4EHHA 1WCV1 1YVEI