3HDQA

Crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-galactopyranose mutase
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
total genus 114
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdqA01
4AL4A 2OGUA 1UR5A 2B35A 2J3KA 1NQAO 1P77A 2HK7A 2YDXA 1TXGA 2VYND 2BFPA 2X0RA 4L75A 2B5WA 1E6EA 3INTA 1GZ4A 1ADCA 4HADA 3IKTA 2C54A 4L76A 2GGSA 2XXBA 4KDEA 3VPXA 1DDOA 4OKNA 1MXFA 1X0VA 4ND4A 4FR5A 1EK5A 3AOEC 5CDUA 2PH5A 4OQYA 3KO8A 1Y8RA 4ILKA 3I9LA 4N54A 2ILTA 2Q2WA 4PLPA 1GPDG 3CPSA 1EVZA 1P1JA 2VZ8A 4GMGA 3ZHZA 4BGVA 4QSMA 2Q1WA 2G5CA 5TF4A 3V1TC 2Y1FA 2OL4A 4ZJUA 3OEWA 1XIVA 2AQIA 3F6YA 3KVOA 4GVLA 4PLVA 2WE7A 1WXDA 4ROSA 4PLTA 5THQA 1ENPA 2POQX 3CIFA 3KRTA 1SO8A 1YBAA 2BLLA 3F3SA 2H5LA 4BGUA 3OBBA 1DIBA 1KY4A 4DUPA 2E48A 5B4VA 3HFSA 3IS3A 4RVUA 3NTQA 4BUCA 1H93A 4WCFC 5AXAA 2VQ3A 1LA2A 3F4BA 1QYWA 4FFRA 4Q3DA 4ZHSA 1PX0A 5HA5A 2RHRA 1LQTA 4ZRNA 2C29D 3VH2A 2Y1CA 1NX6A 3KYDB 4RPLA 3SX2A 3RUIA 4OXKA 5CP8A 3AFMA 2FOIA 4BO9A 4XGNA 3C7AA 4NBUA 4XIYA 3SBOA 3TSCA 1KVQA 3QWAA 4NHEA 2HMUA 3OIFA 1EVJA 4JBIA 3ZWCA 1KC1A 1TT5B 1XDWA 3RSHA 4CQMD 5JAZA 2V6GA 1KVSA 4OL9A 3WTBA 5F3RA 4CQLA 1HLDA 1RM3A 3H7AA 3U49A 2VHYA 1JWAB 5B37A 4J49A 4DYDA 4NBVA 3E5MA 1G1AA 3GVXA 2VZ0A 1R16A 3CZRA 3GEDA 4URFA 4CV0A 1RM5A 1ULUA 2D1YA 3NDIA 1Z75A 2FMUA 1VM6A 2B83A 2PR2A 4II3A 4OKIA 4J7XA 2P2SA 4QX6A 1NWCA 5DBGA 3ULKA 2UYYA 3D7LA 5ES3A 3V1UA 1ENYA 2PFGA 2VHWA 2PZKA 2FR1A 2C07A 3JQFC 2EEZA 3PGJA 2EW8A 4D7AA 3PJEA 2A94A 1KBZA 1DRUA 4BL5A 2X8LA 1JDJA 1W0CA 3ONFA 2JD1A 2JFGA 3OJLA 1IY8A 4EW6A 1ZO8A 1U2GA 4FD3A 4BNZA 2NU6A 5K0ZA 4S1VA 2HLPA 1SPXA 2WD7B 4DPMA 3A28A 1XELA 3JQ9C 4GSLA 4RPHA 3GDGA 4J0EA 3DAPA 3GOHA 4KOAA 4XYEA 2W8ZA 4RDHA 4OO3A 3UW3A 4FB5A 3GHYA 5JDCA 5KTKA 3KOUA 2Q4BA 3WG9A 2VYVD 4EUHA 5C5IA 3B70A 4HWKA 4HBGA 1LSSA 2O4UX 3FHLA 5KJ1A 4KMSA 3WNVA 4B3HA 3TOXA 3U4CA 3O4RA 4HP8A 1VJTA 4BB6A 1KYQA 1CF2O 2EWMA 3DBHB 3UCXA 2I5PO 1UXIA 3KV3O 5AYVA 4E32A 3PQFA 4XA8A 4RF4A 4QFCA 2AQ8A 4YRAA 4YT2A 5A3JA 1YRLA 2FRDA 4K9DA 3JYQA 2D0IA 4IGFA 4BB5A 1OMOA 2W4QA 4UULA 2Z1MA 4A10A 3TZKA 5JC8A 3M6IA 2ZYAA 2PTGA 2PGJA 2YJZA 1RYEA 2OP0A 3C7CB 4ZICA 2DUUA 5JAIA 1E3WA 1K89A 3IAHA 3R6DA 2BGMA 1H9BA 1NNUA 4MIEA 4OHUA 4E12A 3ETEA 2ZB7A 1N7HA 1LU9A 1VJ1A 5DBFA 3HWRA 5KCZA 4FJ1A 3SC4A 5KVCA 3VPHA 3PHJA 4UUNA 2EKQA 4R16A 4DC0A 1SZJG 2EF1A 1B15A 3O26A 3IUPA 1U4SA 3B1KA 1MLDA 4LVUA 5ADHA 5JXWA 3GEGA 2QRJA 1PQWA 3JYLA 5KVSA 1IL0A 1NTOA 3OSUA 3AI2A 4FIZA 1HXHA 4M86A 1H5QA 1MGOA 2C82A 3OM9A 3UGKA 4DPKA 3WSVA 4IQGA 1XU9A 1LSJA 3HG7A 3JD0A 4G5HA 4Z0PA 4AJ1A 1UZLA 1D3AA 1CWUA 1ENZA 3VZSA 1DRWA 1LX6A 3NV9A 3VPGA 1PJCA 3DZJA 2DUWA 3SJUA 4IXWA 1BDMA 5IDWA 2CZCA 3WWZA 1HDZA 2W2LD 4EGFA 5IXYA 4L0QA 4ALJA 2BMAA 4MP6A 1M67A 3KEOA 5F1KA 3EGOA 5I7FA 1XG5A 4JK3A 3RUEA 3LT1A 2R00C 1ISIA 5KJEA 2AXQA 1CERA 2JCVA 3H9QA 2DVMA 3BAZA 2G76A 4BNNA 2ZYGA 3RU7A 5T6BA 4AJJA 4BNKA 3HADA 1QRRA 4H7PA 4RZHA 5IDYA 1P33A 1NPYA 5TRTA 5C37A 2JD2A 2H6EA 1VJ0A 2VWGA 3LC1O 5EINA 4R9RA 3LVFO 1X7DA 3O8QB 4QT0A 4YAKA 3H9GA 1AGNA 3LT0A 3FCOA 4PLHA 5G0VA 2Q45A 3HFGA 5TC4A 4OOEA 5LCXA 5EIOA 3L9WA 1CQIA 3D4OA 3LC2O 3OH8A 1U28A 1JU9A 1GUZA 1OI7A 3QVTA 5L4SA 1CIVA 4ONEA 4IINA 3VDQA 3B1FA 4BOYA 3L0DA 2D3TA 4YA6A 3RAJA 4GLOA 3S2GA 1RPNA 3TFOA 2OFPA 4GI2A 4IMRA 2IEDA 4KQXA 5BR7A 2X0IA 3ZV6A 1U8XX 2WSBA 1ZW1A 2HCTA 3BHMA 4BNIA 1T1SA 3PZRA 2Y05A 3JQGB 1HT0A 3RC9A 1YB4A 4MVJE 1ZSYA 2O3UA 2QIOA 1QSGA 1ISHA 2VN8A 5JY6A 2Q2QA 1H6DA 4TQGA 3GK3A 4E0BA 4F3YA 4OGWA 4TSKA 3AY3A 3KLPX 2GZ1A 3DBVO 3I4CA 4UVGA 1DAOA 5ICSA 3JYNA 1O95A 1EMDA 2FWMX 2PY6A 1JKJA 4B7CA 2CF6A 1V0JA 1LC0A 1DFGA 4OMUA 1ORRA 3E9NA 5JDIA 3ENKA 3UHAA 1HKUA 4FCCA 1ADFA 1A27A 2HSDA 4J90A 5LC1A 2P5YA 5CAEA 3OJOA 3STHA 2Q2VA 1Y8RB 2BKAA 1L7EA 5L45A 1C14A 2C5AA 3L4BC 1KY5A 1C1XA 3AM5A 1E5LA 4YEDA 3OETA 4CMIA 2V6FA 2RBEA 4DREA 1B3BA 1HF3A 1N1EA 1PR3A 2YV2A 2C0CA 4A73A 4KUEA 2I67A 1C3VA 3ETGA 2GRAA 3WGGA 2C7VA 4WLVA 3JQBA 3FBGA 1I36A 4OQZA 1K3TA 1QP8A 4BS9A 4FOOA 3T4EA 4GX1A 2BI8A 2C7GA 3WB9A 3ZWVA 3DOCA 1DXYA 1GQ2A 3DXFA 1LBEA 4D0SA 4ZA2A 1O5IA 2YV1A 3DZFA 3ROQA 3KM0A 1ISMA 1FJHA 1LXCA 2IRWA 4I5DA 5AXDA 1LDEA 3PLRA 2Q1SA 2OHXA 1HE2A 2Q46A 4NFSA 3DZKA 4O5OA 8LDHA 2HRZA 1JVBA 2DT5A 1R4NA 3MJEA 1HTBA 2NVBA 4N18A 2A9FA 2YDYA 1NVMB 5CFZA 2OMEA 4CM8A 3UOGA 5HTOA 3DMYA 3WYEA 2X0JA 3JD4A 3NT4A 4PLYA 3JQ7A 1B8VA 3K92A 4U8GA 5JAMA 1B8UA 3AY6A 4CQLB 2R6JA 3KHUA 3TZCA 3HDQA 5CEJA 1TT5A 4WASA 5CHEA 2QQ5A 9LDBA 1GQYA 6ADHA 4XIJA 3GPIA 1CQJA 3JCZA 4LCJA 2HUNA 4OM8A 3ZNNA 3I4FA 4MKRA 4PLFA 1NQTA 4JJGA 1GD1O 5TLSA 1KEPA 1JLLA 2Y1DA 2CNBA 3FTPA 1LLDA 1BMDA 1H6BA 1PQUA 5EQDA 4OH1A 3KTDA 3WLFA 4AJNA 3EZLA 4D43A 3WGHA 4EJ0A 4MP3A 4HFJA 2XXJA 4J16A 1K0UA 2H63A 5C3MA 3OJFA 1R12A 3DC2A 4Y9DA 3TPCA 3X2EA 1E1NA 3C1AA 4BMSA 4CM7A 3KEQA 4OYRA 3A9WA 1F8FA 1GUYA 4H15A 4RPKA 5KVQA 1AHHA 1Q0QA 4WOKA 3P5SA 4MKZA 2GNAA 4FFOA 5DCWA 4E2WA 5KJCA 5U4QA 1U8FO 4GKBA 1UUFA 2VUTA 1I24A 1C0IA 3X2FA 1QYVA 3RBXA 3C7DB 1H9AA 1IB6A 3WMWA 4NU5A 3AK4A 3RC7A 2UUPA 2QG4A 2J3IA 1XWFA 1YONA 4FGWA 1HSZA 1D7OA 1GTMA 5I7EA 1F0YA 3DOJA 3PJFA 1ONOA 3CINA 2X9NA 3ROKA 4CLHA 3I9KA 5CDSA 1DFHA 1VKOA 4J7CA 2QX7A 1BG6A 3OEYA 2VZ9A 4K26A 3V1YA 3ZV4A 1W8DA 4BIIA 5JY1A 2CY0A 4N5MA 3GPDG 4NMHA 4Z6KA 3WNQA 1ZSVA 2NM0A 2PV7A 4PLWA 4QO8A 2X86A 3FR7A 2PZJA 2IEBA 3PIIA 5T8KC 4DIFA 3PDUA 3Q1LA 1NAIA 4TVOA 5JPIA 4BKRA 4Q3NA 2O3SA 1TI7A 3QP9A 5BNFA 3QIVA 2BD0A 3WBFA 4RGBA 1I01A 1F06A 3GRPA 3I5MA 2IXBA 4ZVVA 3PXXA 3NJ4A 3RD5A 1JTVA 5ER6A 3WIEA 1E3WB 4J4BA 2GF2A 5KIAA 5JW6A 1AUPA 4F6LA 4AICA 1I3NA 1H6CA 4GBJA 4CUJA 2XF8A 3HUDA 3RASA 2D5CA 4D3FA 1YVEI 1LDYA 2Y0EA 4BKOA 2JKVA 4CODB 3AFNA 2FN7A 4UVDA 3AM4A 3RFXA 4YT8A 3QSGA 3ZWMA 4GAEA 2D5AA 2P91A 4MPDA 2V6BA 4RCVA 3R3SA 4R3WA 3G0OA 5FWNA 3IMFA 4OJNA 2B36A 3VZRA 1Q0HA 3GG2A 5EL0A 2IZZA 2RHCA 5AQ1A 3SXPA 1Y5RA 2HKIA 1GR0A 3EW7A 4LSMA 2VRCA 2C2XA 1T4DA 3VDRA 4GX0A 1QLHA 3HDJA 2Y68A 3RUCA 2BFAA 1NPDA 3T7EA 3C85A 1PGJA 5COBA 1Z6ZA 5JCXA 1ZK1A 2ZQYA 3GAZA 3Q2IA 2G17A 4HFRA 4QEDA 3W6ZA 3WOHA 3OIDA 2JCXA 1DB3A 2WE8A 4XB2A 1LLCA 4UAGA 4J9VA 1ZBQA 3MOGA 1CYDA 1I3MA 3GNTA 5HBRA 4DMLA 1U9JA 2AHRA 5JSFA 2CMDA 1HE5A 3DTYA 2HK9A 1YB5A 3GGGA 1B3RA 2RCYA 3K5PA 1NFQA 2PH3A 3RCBA 4GGPA 1P1KA 3WGIA 2AW5A 3UH1A 1V3VA 3IKVA 4ND1A 3LU1A 2EP5A 3ROMA 4XQGA 1BHSA 4MJLA 3MWDB 3GRKA 4M55A 4DYVA 3DAGA 5JFOA 1KVUA 3MZ0A 5FI3A 1DC6A 5L4LA 2PZLA 1NAHA 3AI1A 3ZZNA 3K8ZA 1HSOA 3WX0A 4E30A 1XQ1A 9LDTA 3WJAA 1G0OA 2CF5A 1GFSA 3A06A 3CKYA 3LC7O 3OJEA 5ICMA 4Z3DA 3WXBA 2AE1A 4IIVA 3O8QA 3P19A 4KDFA 3S1LA 3B6ZA 3PHGA 4CMKA 6LDHA 1MA0A 1P3DA 4BO3A 4N7RA 1T24A 3JTMA 1DIRA 4EITA 4PRLA 1BGVA 1D8AA 5ITVA 3F47A 5EPOA 4CV3A 2BI7A 4JJIA 3P2YA 3PYLA 1ID1A 4M89A 3EHEA 3K30A 4RV9A 3DL2A 3RKUA 4JXKA 4CMBA 1R6DA 4NBRA 3ENNA 2QZ9A 2UVDA 5BSHA 4R01A 2PZMA 5A06A 1ZNQO 2JCYA 4A26A 7ADHA 2CVOA 3HJAA 1GCOA 1PEDA 1LRLA 1NR1A 5EJ2A 4DTIA 3TL3A 3S2IA 3GQVA 3D4PA 4RPGA 3C24A 5G0UA 4U0JA 1PL7A 4CM6A 4IDGA 1YO6A 3T4XA 1T25A 4L73A 2HRBA 4IJVA 3WGOA 3BMOA 1GZ6A 1K6IA 2D59A 4MIOA 5F21A 3VVCA 3U0BA 3LT4A 3LQFA 4S3MA 4GX5A 2CFCA 4PLZA 4YRBA 3GR6A 4P4NA 4RVGA 3EC7A 1NPTO 1K2WA 3A14A 3FSRA 3O9ZA 4CJXA 1C1XB 1HWYA 1XKQA 4CMIB 3KBOA 3PEFA 4RVSA 4FFMA 4MO2A 4A03A 4C4OA 1R4MA 1YQDA 3H2SA 2BFOA 2XOXA 4C7KA 5L9AA 2CUKA 4DVJA 1N9GA 1HYGA 4ND2A 1R37A 2JHFA 2O7SA 1Q7BA 1E7MA 1GZ3A 4XYLA 4ITUA 1E5QA 4IBOA 2FHSA 4CLEA 3PYXA 3DFUA 3HB5X 4DQXA 2ZB8A 4RQTA 4IZIA 1E1MA 3WQRA 1MX3A 4ZQGA 4W7HA 3H65A 5IZCC 3C3XA 3V2UA 4MINA 3ADPA 4CMEA 5ILGA 1E3LA 3RUDA 3A4VA 4CM9A 5KJFA 5CEFA 1MP0A 4MOWA 2EHDA 2VWHA 4I1IA 4NG5A 1H6AA 4DL9A 5EESA 1T1RA 3FNFA 5JLAA 1R4NB 5DNAA 1ZH8A 2BFMA 1EBFA 4FOSA 4I08A 4KTVE 1KEWA 4D41A 1O94A 4B4OA 1NXQA 4MVJI 4CM8B 1EQ2A 3BXXA 3U09A 3TFQA 4I5GA 1CDOA 2DC1A 2P9EA 3JQ7B 3V8BA 4L4SA 2WEKA 5KOIA 1Z45A 2Y1EA 1NM5A 3ASUA 3FNGA 4YYZA 2GN4A 1WAMA 3GGPA 3RUAA 4YJFA 2ET6A 4MVJM 3ZU3A 1SCUA 2VNSA 2CVZA 4IGEA 5EMHA 3WFIA 1E6WA 3ZH2A 1J0XO 3DHNA 3MWEB 3JSAA 1WDLA 1ZK4A 4WEQA 5HS4A 1E7SA 4JJFA 3E03A 4W9NA 1HL3A 2CDCA 3IJPA 3RIHA 5FI5A 4FC6A 1UP7A 5HS6A 2YY7A 2J5QA 2BH9A 4CUKA 2J5RA 1GU7A 3HSKA 5JCJA 3ZU2A 5BNTA 2GZ2A 3NGXA 3S2FA 3EDMA 3QWIA 3ADOA 4OOFA 4FW8A 3W4IA 4XGIA 4E21A 2E49A 5C7OO 2JL1A 5G4KA 2NSDA 4WNCA 5I8WA 3Q6IA 5MDHA 3GC6A 5EN4A 3SJ7A 5BSEA 2AEJA 4JGBA 3MCVA 3DMTA 3GUYA 3RI3A 3GZ4A 4JN6B 5TSDA 1GYQA 1JQBA 1DRVA 4R4JA 4U0KA 2AQKA 1H2BA 4DLAA 3FWNA 2HDHA 3E82A 3VTZA 1HDYA 1J6UA 4XX0A 3DR3A 1HLPA 1I0ZA 2WMDA 4B4VA 2PNFA 1M75A 3EVTA 4GH5A 1PWXA 2PA3A 4Q3CA 3GMSA 1BVUA 4NFYA 4WCDA 1H0KA 4FQ8A 3IOYA 1JAXA 4BNJA 3W6UA 3K2BA 4R1TA 1P44A 2B0JA 2IZ1A 4BKQA 1Y81A 1EUCA 5CG1A 5JMWA 3H9UA 4PIVA 3IJRA 1V3UA 1DIHA 2WJPA 1MB4A 3M1AA 5JYEA 4GSKA 4GL4A 1P0FA 2JFFA 4CM5A 2FPIA 5A4DA 5EERA 2FZWA 3WWYA 2QRKA 3QVXA 1ISGA 2YQ4A 1B2LA 3ZWXA 1ZVMA 2V65A 3ANMA 1U3VA 3IUSA 4ZQFA 2OUIA 2O3RA 5IF3A 3PQDA 2DFVA 3U4HA 3I9JA 4UVEA 3GT0A 1BWSA 4BGEA 2YQ5A 3VVBA 1DC3A 1E3SA 4WOJA 3DBRA 4K28A 3ZWWA 4CM4A 1EDOA 2QW8A 1F17A 1KERA 3WQQA 1ZFNA 1A9ZA 4LSWA 3OMLA 1DOHA 3RBZA 2PGDA 3OJ0A 4IZHA 3W8EA 3HHPA 3GNQA 2ZB3A 2VCYA 4LRTB 1BSVA 1DPGA 4WLFA 1DSSG 5DBIA 1VL8A 4LGVA 4RVFA 1IYZA 1LDBA 1I2BA 4YJDA 4D44A 2I66A 3GN2A 2Y99A 1NASA 4TZTA 2NTVA 1PS0A 3W4KA 2GLXA 5JDCC 2VOJA 3FR8A 3O03A 3Q11A 5TS3A 3H8VA 1GEGA 4WLNA 1L1FA 2NVWA 4G65A 3CMCO 4PG5A 1FK8A 1QV7A 1X0XA 2E37A 2H9IA 3Q2KA 2I3AA 4B8ZA 5L53A 2Y93A 1BDBA 1RM4A 1G6KA 1P74A 3GH3A 1T2FA 1K5HA 3VH1A 3F9IA 3LLVA 2VTDA 1SMKA 2ZCVA 1ZMOA 4XDZA 1J49A 2CDBA 2JHGA 5JO0A 1U5AA 5A9SA 1HDOA 4Q3AA 1AXGA 1PZFA 4QXMA 4AJHA 3NEPX 3ST7A 1R0LA 1WMBA 2AA3A 3GF4A 3R3JA 5F1PA 4XEHA 4OXYA 3RU9A 4UVIA 4MVJA 1GYPA 5FF9A 3JQAA 3TZ6A 3W4JA 2DBZA 4YJGA 1GAEO 4Y98A 1NR7A 3MEQA 5G0TA 2ZATA 3Q0EA 4Y6RA 1LDMA 4NIMA 4XZ3A 3ZNQA 3I52A 3ZU4A 5MGBA 4YBZA 1GV0A 3D1LA 4UEOA 1PZGA 4B4UA 2VT2A 3G1TA 2Z95A 3B1JA 3GVPA 4YJHA 1ZSNA 4TWRA 3PPIA 1PJSA 2VHVA 1JN0A 1HZZA 4Z0HO 4D0RA 5THKA 5I7VA 3OQ1A 3COSA 1ZCJA 2VUSA 4RDIA 1EQUA 4Z9YA 2H1SA 2J6IA 3EZYA 4QQRA 4PGFA 4Y67A 4WLUA 3C1TA 4E33A 1IULA 3PHLA 2IDZA 3UCEA 5IDQA 1BXGA 3LYLA 1KIFA 5CPFA 1V9LA 1U1IA 4B4WA 3GFGA 1UXGA 4CMGA 4DQVA 3WLEA 2PD6A 2GUGA 1SEVA 2WYVA 2NTNA 4KTTE 4HFNA 2HJSA 3BMOB 4KQWA 2DLDA 1WP4A 4PLGA 1SBYA 1NWHA 5JMPA 3ORFA 5LDGA 3NYWA 3ZW8A 4NJOA 4B8WA 4Z9FA 3PYMA 1VPDA 4PG4A 1DJNA 1I30A 1E3IA 1ONNA 4XGKA 3S55A 1DHTA 5HM8A 2X9VA 4UUPA 1PJBA 3H9JA 3LLSA 3PHIA 4O1MA 5JE8A 3A1NA 4GGOA 4ALNA 3TOZA 1RM0A 1BW9A 1LNQA 1YOVA 1R4MB 2HO5A 3GG9A 3E8XA 1X1TA 2J8ZA 3G79A 1YJ8A 1WPQA 2X58A 3OQ6A 5KVVA 3AJRA 3GN1A 3PDJA 3EUWA 4LRSB 1N9GB 3OECA 3NTOA 2EKLA 4MDHA 3ZCXA 4TROA 1P1RA 4D45A 4MVJH 5B12A 2E82A 4YQYA 5A1TA 2GD1O 2IE0A 4K6CA 2Y1GA 3I6QA 4F6CA 2CDAA 4GWKA 2I3GA 4Q3BA 3H3FA 4UEJA 4NR0A 3INRA 4J1TA 3IDSA 4B7UA 4RVDA 1TA4A 3IIEA 1R0SA 1ML3A 3RC2A 3WFJA 3OA2A 3OQBA 2NU8A 4IS2A 5U9CA 4I5FA 3OFSA 1PIWA 3L6OO 1WDKA 2VRBA 3BTSA 3WR5A 3BIOA 3CE6A 4FFPA 3BYZA 4IJWA 5DULA 2LDBA 4JP3A 1ZMTA 2JD0A 3GEMA 3WGQA 4TRRA 5AXBA 4LK3A 4Y6PA 3BA1A 1Q0LA 1ISFA 1SC6A 4DMMA 4E3ZA 1CJCA 3EY4A 2PLAA 4MP8A 2NU7A 3F1LA 3FNEA 4ZQBA 2AQHA 1ZUD1 3IC5A 4MKXA 1PGNA 2DFDA 2GZ3A 4YJFB 2ZTVA 3I23A 3Q9NA 1KEVA 3KB6A 3AUUA 3DWFA 5JDIC 2EJVA 4NH4A 3GAFA 5CPBA 1Y6JA 1B7GO 4CV1A 5L4NA 4NI5A 1I10A 3M2TA 3DHYA 4GX2A 3QE3A 1LTHR 4BO8A 3AUAA 1RKXA 3WQSB 1YDEA 2Q4EA 3MJCA 4FBGA 3B20A 1B14A 3H3JA 3QJ5A 4CMHA 3VHRA 3C8MA 4IMPA 3U3XA 3HNPA 1C0PA 2DBVO 4DXHA 3K96A 2BGLA 4JLWA 2G1UA 3VZQA 3FN4A 2J5KA 3JQBC 5G4KB 1QYCA 4IXTA 5L3ZA 2HQ1A 1DHRA 2FPPA 3MJSA 3K6JA 3ANNA 2GPTA 1MUUA 5T64A 1A7KA 4PZCA 1ADBA 1JW9B 5BSFA 3EYWA 3UF0A 3Q3CA 2DPHA 3QHAA 2DBQA 1EEHA 2ZB4A 3DQPA 4BGIA 3E18A 3V2HA 4YWJA 1LRJA 1QV6A 3PVZA 2O50A 2NACA 3I1JA 1EZ4A 3ZGYA 4YT4A 1LQUA 2GN6A 3CUKA 2PKRA 5IN4A 3MTJA 1NP3A 3NT5A 4XD2A 1T4BA 3D4NA 2Q99A 5F1OA 4A27A 1PL8A 4EJMA 4JP2A 3GNSA 4YAJA 3DHEA 3CXRA 3DZIA 3DTTA 5IJZA 1Q7CA 2EV9A 1A4UA 4F45A 3KSDO 5K6AA 4TKLA 1EDZA 4J2OA 4R9SA 1Z82A 5ENDA 1AN9A 3W8FA 4BNWA 3FF4A 1AXEA 2C2YA 1O0SA 1XEAA 4WNIA 4PN3A 3ZHXA 4TZKA 4YRDA 4UVHA 1UH5A 4IS3A 7MDHA 2X5JO 5IN5A 4WJZA 4CV2A 4OAQA 3RBVA 2TMDA 3HDHA 5LDHA 3SLGA 1XSEA 4BO2A 3I6IA 4BO0A 1KS9A 2DBRA 3SVTA 1VE9A 3ITDA 4QECA 1OAAA 3UCFA 2C20A 4HNHA 3DBRB 4R68A 4CM4B 3KZVA 4C7JA 4YPOA 4IQ8A 1B8PA 5DCYA 4LW8A 1OFGA 1XYGA 3PP8A 4IY1A 3I83A 3PFFA 3ZU5A 1GEEA 4RO0A 5ER9A 4WKGA 4BQRA 1K6XA 5F5NA 3L07A 1YDWA 5AOVA 5TT1A 3TN7A 1U2DA 2EERA 3CTMA 1UZNA 2ZTMA 5AXCA 2GSDA 3JQEA 3JQCA 4WLOA 4LMPA 4YQZA 5G4LA 1VSUA 1DJQA 5FFFA 4EJ6A 4B3IA 4MIYA 2A4KA 3KXDA 3VPFA 2NNLD 5BQFA 5GZ1A 1I32A 4CLDA 2FP4A 4QO7A 4CR8A 2OP1A 2HK8A 4MVJG 4AJLA 3GHHA 3JD1A 2IYPA 1GY8A 1YL7A 5G0WA 2JAHA 4I9HA 2HMWA 3U5TA 4BNHA 3L4SO 4QTZA 4JBHA 3VAZA 5C7IO 3GY0A 4ESOA 1YXMA 1P1FA 4GQAA 4LCEA 1I5RA 1PS8A 3TRIA 1Z74A 3ZNPA 1F12A 2RAFA 4W7IA 4NK5A 4CPDA 1XLTA 3ZV3A 1W4ZA 4W82A 4BNYA 1MXHA 4TRNA 2VWPA 1N8KA 2PWZA 3U4DA 5C7LO 5CDTA 2B4RO 2CD9A 4FJ0A 2HAEA 4XWYA 5HWSA 4P8RA 3DONA 1IPFA 1I33A 3WGTA 5A9SB 2E4AA 1YB1A 1I3LA 4BO4A 3GGOA 4A5OA 4YAIA 2CSUA 2X7HA 4YACA 3VC7A 1NBOA 2W2KA 3JQAB 4KUGA 1ZIDA 2VNAA 2ZTUA 4YJGB 5H83A 1BXZA 3DB2A 3RROA 4DWVA 5A9RA 2AMFA 4DIBA 3F4LA 4HY3A 3NT2A 3WIDA 3V2GA 3L6DA 1B0AA 2B69A 1QR6A 1WNTA 1LJ8A 2VYNA 4HKTA 3PI7A 2XPCA 3BTOA 1DC5A 3IP3A 4YJHB 5A5EA 1HEUA 1A5ZA 1E7WA 1KVTA 4UUMA 3K9QO 5I7SA 4EYEA 3WS7A 3OICA 4INAA 3E6AA 4ND5A 3RKRA 1Y8QB 1F14A 3G3EA 2JAPA 3AOEA 1WDMA 3LDHA 4N5LA 3GA0A 3ZWOA 4BQPA 3QRWA 2HMTA 3FPCA 5TJ9A 4E2XA 1WW8A 3VPSA 2VRCD 4Y8VA 3ZWAA 3N7UA 1BXGB 2OBNA 3NUGA 4FS3A 1SOWA 3QQPA 3H5RA 2P5UA 4P38A 3WYCA 4HX5A 4XYBA 1LUAA 2Y67A 3JQDA 4W4TA 4KZPA 3NDRA 4MVJP 1TLTA 1YQGA 3D3WA 3DO5A 4D3DA 2C59A 1OC4A 3DFZA 1ARZA 2EW2A 4IDDA 4EDFA 1GCUA 4HV4A 2VT3A 3FRJA 1MC4A 1KEUA 1LDNA 2TMGA 3I9OA 3MJVA 4GVXA 1ZXLA 3GZNA 1UP4A 1PJLA 1FF9A 1RYDA 1P9LA 3CSDA 3HN2A 4AJOA 5CDYA 4G81A 3H6KA 3UXYA 4WCFA 4DC1A 1L7DA 5ITWA 4CM1A 2NVUA 4J6FA 5CG2A 1BW9B 1VSVA 1YOVB 4TRJA 2UAGA 1UXHA 3UVEA 4NK4A 4LVCA 4QFDA 1VLLA 1E0DA 4UREA 4EI2A 1PZHA 3E5RA 1XR3A 1QXSA 3OP4A 4NZ9A 4P22A 4R3NA 3AUSA 4RORA 4WGGA 4CLRA 4Z0TA 4CQMA 2YZ7A 3Q9UA 2B4TO 3QV1A 4RL6A 4KWIA 5IAAA 1Y5MA 3HQ4O 5G0SA 4J43A 1H94A 1EE9A 2X4GA 5COQA 4DRYA 1M6WA 2O3TA 3S8MA 2GCGA 1ZJYA 1A7AA 1E7RA 3QVWA 4KWHA 4PG8A 2DQ4A 5IFLA 2FSVA 3ETDA 1NYTA 2GASA 2GDZA 3D5TA 4WUVA 3P2OA 2J3HA 4CLXA 4CR7A 1ZK2A 2JFHA 1D4FA 1IHYA 1LLUA 4FC7A 4IDAA 2PD4A 4NBWA 2NQ8A 2HMVA 4A0SA 1DLJA 5J23A 3L9XA 4J4HA 1PGOA 3JQFA 3S2EA 3F46A 3ZWNA 3AY7A 1OC2A 2QHXA 1YE3A 3DAFA 2NV6A 1NVGA 3RJ5A 1PJQA 2BHLA 1N2SA 1QKIA 1GV1A 2HMSA 1Q7GA 3PGXA 4YXFA 1M6HA 4HFMA 4IDBA 4Q9NA 4GMFA 2FSSA 3QY9A 4IQ0A 4E31A 5U1PA 1SEPA 1YH3A 4P4LA 1R66A 3WYBA 1Z7EA 1M2WA 3ICCA 4IUYA 3JQ9A 4O59O 4TVBA 3U9LA 5L7WA 4JROA 2VYVA 4XYMA 4ALLA 2I9PA 4ZU3A 1T26A 3I9MA 3T7CA 1HDRA 2NUAA 3C1OA 1E77A 2EXXA 1FDTA 3ZN2A 5L40A 3ZNOA 3LSYA 1UDCA 5A3VA 3IL2A 3AWDA 3EAGA 2RH4A 2YUTA 1JKIA 3R1IA 1PTJA 1FXSA 4DBZA 1CETA 2GO1A 3KYBA 3KYCA 2VUUA 1LSUA 1NVTA 4D3SA 3NKLA 3GVHA 4M8SA 4D79A 1VL0A 2IODA 1PZEA 4DQUA 4BO5A 5L7TA 3JQ8A 4E2ZA 2J3JA 1NHWA 1P1HA 1P1IA 1DIAA 3WBBA 3O38A 3SC6A 1UXKA 4RF5A 1VC2A 1XCBA 2FY8A 4CMEC 1WZEA 1ISJA 3AI3A 4WK6A 2R2GA 3AUTA 2BGKA 1PWZA 4ND3A 3BHIA 4TKMA 4EBFA 4CM9D 1EVYA 4KP7A 1LSOA 2EKPA 1YS4A 2DTDA 3BMQA 4PFJA 5F5LA 4NJMA 2X5OA 2PKQO 4BKPA 1FDWA 3WSWA 3U4IA 1IPEA 3H9EO 1KVRA 3ZDFA 5I9NA 5JBIA 2VTEA 4D42A 3BHJA 4FFNA 4R54A 3UN1A 1A71A 4FSHA 4NQZA 1HYHA 4U6QA 3WGYA 5DCUA 1PGPA 2JJYA 2Y1OA 1PR9A 4IDCA 3GDFA 1GDHA 2X23A 1HDXA 3PWSA 4R51A 2C5EA 2HU2A 2V7PA 4PRKA 4JNKA 1GADO 2X22A 4B7XA 3QW2A 1LLQA 2P4HX 4XR9A 4XCVA 2I99A 4CM3A 3QWHA 2X5KO 4FDAA 4LN1A 2DTXA 1XQ6A 4W9NC 2FR8A 2YHUA 3IQDB 2W2LA 5I8ZA 5KKCA 1N5DA 1ONPA 3JD3A 5G2OA 3PJGA 2D8AA 2YFQA 1ZK3A 3DBLA 2NQTA 1H2HA 4L4XA 4PG7A 1R15A 2G0TA 4E5PA 3QVSA 5JCJD 1GQQA 3RWBA 1P0CA 3TWOA 2YFHA 2R00A 2YHIA 3PRJA 5TQVA 4R5HA 4K1LA 1U7HA 2NWQA 1YBVA 2A92A 4CLOB 3ZWPA 4NU6A 4X54A 4YTEA 1UDBA 1RJWA 3DMTC 4U7WA 5A9TA 2VWQA 1ZKMA 3PHHA 3JV7A 2Y0DA 1T2DA 3PWZA 5KJ6A 3GVIA 5DZSA 3K73O 1FDUA 3R0IA 4XDYA 4ZGWA 1M76A 2Y66A 1X1EA 3VKUA 1OBFO 1JWBB 1D1TA 5TNXA 3QA9A 2D4AA 2V6MA 3VKVA 5JYDA 3GDOA 2IYOA 4LISA 4OIMA 1NQOA 3BTUA 3ASVA 3RFVA 3ONDA 1Y1PA 3HZZA 2O23A 3BMCA 4R5MA 1C1DA 3JYOA 1PJ2A 5L7YA 1BTOA 3W1VA 3NDJA 2NADA 3PJDA 4J1QA 3GLQA 4IDEA 5KKAA 4AJEA 3G49A 1U4OA 1G0NA 3AU9A 2OOSA 5T67A 2QYTA 5L51A 3ICPA 3NJ8A 3ROPA 3VH3A 1D1SA 4QUKA 2YYYA 3H2ZA 1UXJA 3V5NA 1EBUA 1QG6A 3GUCA 1P31A 4XQEA 1ZK0A 2P68A 2EG9A 2EP7A 3FI9A 5A03A 1N7GA 3WJ7A 2W2KB 3AM3A 3INGA 1KETA 2G82A 4BKUA 4JQCA 3HB4X 2BRUA 4BNXA 3HN7A 5T57A 3QWFA 1YL6A 2P9GA 3NX4A 2PD3A 4L4RA 4TMFA 3RUHA 2O7QA 4E2YA 1SOVA 1W73A 4CMAA 1LI4A 1O6ZA 1V8BA 1OZAA 1Z73A 4XQCA 4XRGA 2AEMA 1V6AA 4KUHA 1U7TA 1I8TA 2OO5A 1DEHA 3PK0A 3JQ6A 1B16A 5DP2A 3TJRA 2I6TA 3WTCA 3NGLA 2PKQP 2WM3A 2AG8A 3G1UA 1S6YA 1VKNA 3TL2A 3DEYX 4WLEA 3NAQA 1FMCA 2WYUA 4GWGA 1DO8A 3L4BA 1WLYA 4OSPA 2UUOA 1Y8QA 3LZ6A 4BO6A 4E13A 3HDYA 4F46A 4YR9A 3ZV5A 4NDNE 2ZKLA 3PZBA 2I65A 4CL3A 4ID9A 1XA0A 3TQHA 2DM6A 1EFLA 4UEKA 1ZJZA 3D3WB 5H81A 2O3QA 1LEHA 4PZEA 4R1UA 2Z1NA 4R1SA 3PIDA 4P4GA 2B37A 2O3JA 2VHXA 3ONEA 1BRMA 4B79A 3GZNB 3RJ9A 2UV8A 3GVCA 5DOZA 4B3JA 1HE3A 3M2PA 1WMAA 3UKOA 4DGSA 4PCVA 5FEUA 4GPD1 5FYDA 3DOOA 2I76A 1E7QA 4JIGA 4WCFB 4BV9A 3ZI0A 4E5KA 5H82A 4DBVO 5EQFA 2NVUB 2ZK7A 3P7MA 1QYXA 3GFBA 1X14A 3ZWBA 1HZJA 1PJTA 5JC1A 3DZGA 1KC3A 4PLCA 3BMNA 4DIOA 2PGLA 2W90A 1MG0A 3TF5A 4CUZA 4R1NA 4RQUA 1IHXA 4CL8A 4BNFA 3E9MA 3D5QA 3K31A 4E4YA 1A4IA 4CLRB 4BVAA 5BT9A 1PSDA 4CQMB 2O4CA 3ON5A 4K6FA 3VOSA 2PK3A 3OIGA 4RJTA 4FJ2A 4MVJD 4ZN6A 1F8GA 2VHZA 3JQAD 5L95A 2Y0CA 1PL6A 3TDKA 4BMVA 1M66A 1HDCA 3I9NA 2EJWA 2O48X 1A72A 5A05A 2RH8A 1DLIA 4DPLA 1UP6A 2WYWA 1HDGO 3RUFA 2SCUA 4YAEA 1DBVO 1IZ9A 2NLOA 1Q2XA 4J1NA 3PFWO 1HE4A 2AE2A 5AVOA 3MJ4A 3EMKA 2EGHA 2CVQA 3CEAA 3H5NA 4DA9A 4EZBA 1QLJA 2BF7A 4UUOA 3DZBA 1I2ZA 4A7PA 3KLMX 4NNJA 4E5YA 3M1LA 4EUFA 3FD8A 3DZHA 5COAA 4OSOA 1QMGA 1Z7BA 1J4AA 2AG5A 2IXAA 4PG6A 2RIRA 1N1GA 1ZEJA 4XB1A 3PTZA 3WGZA 1ENOA 3N58A 4FGSA 3UUWA 2DKNA 1JAYA 4M87A 3AOGA 3NRCA 1PGQA 1S7CA 2GERA 1T2CA 2NTJA 5CDGA 1Y9EA 5DT9A 4J2HA 4ZQHA 4IJUA 4N5NA 3WMXA 1EUDA 1IOLA 1GPJA 2X0NA 3FBTA 4IPTA 3AU8A 1PQPA 3TNLA 2DU8A 2XAAA 4RF2A 1QORA 5TJHA 3K2EA 2BELA 2VOEA 1NHGA 4RVHA 3EK2A 1O8CA 3KYDA 4W99A 1OOEA 1WVGA 3QLJA 1YQXA 1AE1A 2F00A 4WEOA 1V35A 4R41A 4U5QA 4BO1A 4DLBA 5A02A 2OZPA 1AHIA 1UZMA 5DOVA 1E6UA 1NFFA 4YCAA 3HE3A 3KYCB 3E9QA 4BNGA 1UDAA 1E3JA 1GYRA 1PJ3A 4O6VA 1IE3A 4YAGA 5K9ZA 1SB8A 5T8KA 1EE2A 3VH4A 3JQ8B 3D0OA 1UAYA 1VI2A 1NFRA 1O89A 4NPCA 2OORA 3L77A 2P4QA 2Q1TA 4WPGA 3SLKA 3ITKA 1GL3A 1VRWA 5IZ4A 1MV8A 1HRDA 3JYPA 3ZW9A 3TZQA 1HYEA 1E1KA 3BMQB 3UICA 3BZUA 1I2CA 4JCOA 4NJMB 1T2EA 2IZ0A 4M1QA 2Q49A 1E7YA 5DN9A 4ALMA 1WWKA 4FFLA 4L9RA 1E1LA 2Z5LA 4H16A 4I9NA 3CMMA 5JNLA 3KETA 1JA9A 3ZWYA 1PS9A 4BO7A 3CH6A 4BNUA 1B26A 2WD8A 1U3WA 4J91A 4RF3A 3FNHA 4HUJA 4I9UA 5JO9A 1V3TA 5HRUA 4GLLA 4IM7A 3VTFA 2O2SA 5T5QA 1O9BA 1DIGA 2DPGA 4FN4A 3E1KA 4BMNA 1SB9A 4PVCA 4IJKA 4I5EA 2WD7A 4AJKA 2X1HA 4J4TA 3H5AA 1DAPA 5I9MA 2DTEA 3RVDA 3BTVA 2W98A 2QZZA 3ZHYA 3DBLB 5A5FA 2EIHA 3FPLA 4A2CA 1Y9AA 4XJTA 3FTNA 4CMJA 2WDZA 5ILOA 2E6UX 3OHSX 4BNTA 5DDIP 4PZDA 4TRMA 2YHIB 2ZJ0A 3FWZA 4E6PA 1EK6A 3LT2A 2OXIA 4BHTA 4XQ9A 5TX7A 1LDGA 4L8VA 3DBHA 2P9CA 3LF1A 4WECA 5GZ3A 1K6JA 2WTBA 4EEZA 4OXNA 4RZIA 1N92A 5IDXA 3ZHBA 4ALKA 1IZ0A 4D46A 4M54A 5B4UA 3RQSA 4CLOA 4XJSA 3E48A 1Y7TA 1EVIA 4W6ZA 1W6UA 4CMCA 4G2NA 5A04A 1IUKA 2NU9A 1U3TA 5GY7A 3LK7A 4IIUA 3DDNA 1YJQA 2X6TA 2D2IA 4AJ2A 2B4QA 3MJTA 3AW9A 1CRWG 3D3EA 2ZJ1A 2GN9A 4LMRA 3U62A 4O63O 2B5VA 1UAGA 1I3KA 1C1DB 3BMCB 2OBYA 3RC1A 3F1KA 3H4VA 2ZIZA 5TT0A 4XR4A 3N74A 2UDPA 5BSGA 1MFZA 5B4TA 1MG5A 2AEFA 3LF2A 4AJPA 1PU2A 5K6AC 5KNLA 4Y6SA 1DC4A 5KWEA 1P45A 3MTGA 1SAYA 1X7HA 4Z9XA 2FR0A 1YL5A 2GR9A 1MC5A 1JVSA 1TEHA 4RLSA 4AG3A 3PLNA 4BV8A 1UJMA 1HETA 1RWBA 4BNMA 5ENVA 4J7UA 4Z3KA 4PVDA 4NFHA 1LC3A 1TB4A 3RFTA 8ADHA 4HXYA 1E3EA 1E92A 4R69A 1BXKA 1WZIA 1XGKA 4XYGA 5DP1A 2A35A 3WDSA 4M49A 1XHLA 4E5MA 1ADGA 5IXSA 1YWGO 3KUXA 1CEQA 3MOIA 2QYSA 4Q39A 3TZHA 1X13A 1LRKA 4ALIA 4II2A 4YDRA 1ULSA 4EUEA 5BNIA 3KSZO 4ZQEA 2ZQZA 3KSUA 1KOLA 4O0LA 4AVYA 3GMDA 4ZRMA 4J0FA 4YT5A 2YW9A 1T2AA 3G17A 4AJ4A 1MFPA 1U3UA 2HJRA 1Q1NA 1X7GA 3F5SA 4AFNA 2F1KA 2Q3EA 2X9GA 3PWKA 3VZPA 1YKFA 3PQEA 4BNVA 5JAQA 1J5PA 1YBMA 1U5CA 4DLLA 2FZEA 2QRLA 4Q3EA 3NTRA 4J1SA 2ZCUA 3UFXA 4YVFA 3QVOA 1TT7A 2ZTLA 4MVJF 3I3OA 1ZXBA 5IG2A 4J3FA 1GUFA 4H3VA 1SNYA 3L6EA 5GMOA 1FDSA 5DF1A 4U6SA 4XKJA 5I9LA 4YB8A 2EGGA 3OF2A 5CEEA 4J9UE 3ABIA 3F5QA 1DFIA 5TGDA 4XRRA 5JS6A 1ZEMA 4IDFA 1YGYA 4JX8A 2YV3A 4RLHA 5IZCA 1EFKA 4AJIA 2FPGA 5TIIA 3CZMA 2Q1UA 1QYDA 1JKFA 3OA0A 4NBTA 1XU7A 4EEXA 3JQGA 3BMNB 1VL6A 1R0KA 2WWRA 3QWBA 1A9YA 2GYYA 4ZD6A 2DAPA 1NQ5A 4HNGA 1C0KA 3ANLA 4FPXA 4I8XA 3EVNA 1TVEA 3JD2A 2ZYDA 4L74A 2O2YA 4RPJA 2Q50A 4E5NA 1EUZA 1BVRA 1X15A 3W8DA 3IP1A 4JBGA 2GN8A 4WE3A 4BNLA 3WICA 1C0LA 1ZZEA 4GKVA 3D64A 3UAGA 5GZ6A 5B1YA 3SEFA 1PJ4A 4CR6A 1FDVA 2LDXA
chains in the Genus database with same CATH superfamily
4B3BA 2M9MA 2J4FA 2ZAYA 4TYWA 2UYHA 2JAUA 5JNTA 1P77A 1WDTA 2PLNA 1TXGA 1UJ2A 2BFPA 3V8EA 2EAUA 3IQGX 2B5WA 4ZYLA 5ADWA 4D9EA 2I3BA 3INTA 3PC7A 1ADCA 2XE6A 2PEYA 4AO7A 1WXIA 4KDEA 1JWLA 3C3MA 1MXFA 1X0VA 1F0NA 3HGMA 4RC9A 1GDTA 1KZ1A 4I1PA 6AT1A 2IOYA 5D5HA 4ENQA 4DUYB 1Y8RA 1QIKA 1K1EA 3RVMA 1Z35A 2ZT5A 3BWXA 3B6JA 1ZESA 1EXVA 5SY9A 2ILTA 3FUXA 4IMJB 5BVHA 1GPDG 2GTHA 5FOUA 3HC7A 5TPZA 3ZXXA 4RD6A 3CBQA 4H7FA 1JB1A 4QJ5A 3NEJA 4GMGA 4MA0A 3R7WA 2W4IA 1FDIA 1IWBB 1MO5A 5K0FA 2CMFA 3OEWA 3RS7A 3WISA 4IFBA 2E6KA 2ZIAA 2WE7A 4DLRA 1ZM3A 5L6LB 2PRYA 4PLTA 5EIBC 3EEOA 5AR1A 4W5HA 4Q9LA 3WHKA 3IIMA 2X2OA 3QE4A 1FJXA 3Q9LA 1TOAA 3CSSA 2FZ4A 5ISMA 1P39A 4YRTA 1WU7A 2AJTA 4DUPA 2E48A 3EQ7A 4P3PA 3IS3A 4WN9B 4E21A 1T0JB 3BL8A 3R3VA 5LQSA 4GIBA 2BIFA 2OAQ1 3NTQA 4BUCA 1CCWA 4F21A 1QRDA 2P3QA 5AXAA 4RAQA 3LVRE 5JFGA 5BN3B 2ZUVA 3DB1A 5LFAA 1CX9B 3Q72A 2C95A 2KSQA 1TRKA 3FCUB 2GKGA 2Y1CA 3KYDB 1RACA 3SJAA 3VH2A 4GZLA 4BTEA 4OI1A 5IH7A 4Y0VA 3SX2A 1SU7A 3BERA 3RUIA 4W5QA 1DAMA 2W2TA 3G9ZA 2A7QA 2FOIA 3QKRB 4XGNA 3C7AA 4TPKA 2R0QC 2GYVA 4OATA 2PNJA 4OF4A 3PQ7A 5EJ8A 2WICA 1EVJA 4QBFA 1I4OA 1KC1A 5EJ9A 1L4HA 3EWNA 2IH4A 2WILA 2R8BA 4CQMD 1EFUA 1VE7A 1XC7A 2V6GA 2ZKIA 4LZLA 1M83A 4ZO8A 2B1JA 3RAPR 1KS2A 5E3HA 3OPXA 3PUWA 3HZHA 1MJGM 2GBLC 3A9SA 1W76A 3H7AA 1DG9A 1RM3A 3DKIA 4L5JA 5HIIA 3BUSA 2BE9A 3O2JA 2EIXA 4A0QA 2AUNA 3S5JA 1U8TA 3VBEA 4ZDIA 5BNWA 3CZRA 1R16A 3OP1A 4HHEA 3N70A 3NJRA 1J8YF 1XDDA 5C8ZA 1HDIA 3MW8A 3FKSD 4K03A 1KO4A 1OKKD 1ZPDA 1EB8A 4H4DA 4WERA 3ULKA 3V7UA 2B7LA 4RTJA 3RGWS 5JI2E 1XPRA 1JPVA 3IIIA 1ENYA 1OFUA 3GRYA 4FEGA 5NULA 2J3MA 1E9BA 2PFGA 3KUDA 2XX3A 4E5UA 3QLTA 2WOJA 3CUVA 2LWIA 2PZKA 3CUUA 2RI0A 3JQFC 2CXOA 2CLFB 2PCJA 1XKXA 2EW8A 4MQEB 4ZV4A 1K27A 3NWEA 3PJEA 4RMHA 5FPSA 3SPXA 3GJQA 3LYAA 4NBNA 1PLJA 5GM2A 4MUFA 2JFGA 2GM9A 1S0UA 3OJLA 4XUCA 1T6YA 1Z29A 3DE2X 1N6RA 1U2GA 2FN8A 1TPZA 2WK1A 1H2RS 3P71T 3VSEA 3HRKA 1TU4A 3P26A 5J63A 5K0ZA 1SH7A 2HLPA 4JYAB 3EJ6A 1SPXA 1NLYA 1K8QA 4UUBA 5FFMA 3A28A 4DPMA 1W94A 2O57A 4M7OA 2JHPA 1ZVJA 2B8TA 4RPHA 5EZYB 5LP6B 2J0UA 1JQKA 1RFGE 2PUTA 3C43A 3DAPA 4KOAA 2W8ZA 3GBVA 5I01A 1Q3KA 2FUCA 1IM5A 1DDGA 3LP6A 4CIBA 1GJRA 1RWVA 4PR3A 5KSOA 5CVDA 2WIDA 5KJ1A 4GO1A 4KMSA 2DBYA 3A3PA 4IOKA 1POXA 5IKPA 3TOXA 4EG5A 4Y0AA 4OYLA 4QYIA 2CB9A 4IAOA 5C4MA 3QYAA 4PXYA 4IHKA 4DLKA 1JDTA 2EWMA 2I5PO 1ECCA 2F4VB 3PQFA 1NOKA 1MOSA 2F3QA 1BVYF 2QWXA 4TTIA 3ESAA 2RD2A 2GPBA 3F2VA 3LHSA 2AQ8A 1RD4A 4LSGA 1V5FA 3U1VA 3GLIE 4YY3B 3ZLUA 4BJ3A 4ZFNA 2YMQA 5FUXA 3LS2A 1CZRA 5T4FA 3PI6A 2IPNA 3DVAB 4OLJA 3GT4A 2OC4A 1RC0A 4UULA 5AI6A 2IV7A 4A10A 2HIGA 4RSGA 4UBKA 2P4EA 1R3UA 2PTGA 4QU9A 2R7NA 3GRZA 4C87A 1HQKA 1FQWA 3WNZA 3HDTA 3CLUD 2WAOA 1SUPA 5FA5A 1TK9A 4FEAA 4N8EA 3C7CB 1WXXA 2AOUA 2HPVA 4XVUA 1OJ7A 1VJCA 3EZ9A 1UPXA 1UBRS 2AS0A 3IAHA 3OTOB 1HG0A 2BGMA 4HB4A 4MWCA 4PO9A 4MIEA 2R751 4JGIA 5HUHA 1LH0A 2ZB7A 4JA0A 5DBFA 1VJ1A 1UPAA 2YFYA 1JHUA 3SF0A 1TUGA 3ROZA 5KCZA 1H2EA 4MQ4A 3SC4A 4JBLA 1W52X 5KC8A 2XNDA 2DG2A 4LPKA 3O26A 4B87A 2HF2A 2P9FA 3IUPA 3T3HA 4ZZ1A 4FSXA 1F9EA 2XIQA 1UC9A 2ODWA 1Y3HA 3KLOA 5JXWA 2E5LB 2VPWA 2QRJA 2QVLA 3GEGA 2BVNA 1IL0A 3QLUA 4M86A 1HXHA 3WYFA 1H5QA 3KR9A 5LP1A 2O7RA 4ZGGA 4HS9A 5J2TA 4DPKA 3OLCX 1ZGJA 4F8EA 4IQGA 4Q5IA 4GSYA 1NA5A 2GEKA 3WWPA 3FKJA 1IAVA 4KYIB 3VOAA 1U1CA 2R86A 5BW6B 1QH8B 1UZLA 3FDXA 1SU6A 4YPFA 3R41A 4X90A 4TM7A 4Y1RA 3VKWA 2DUWA 1XDZA 1XMIA 4LJSA 1XPJA 3I53A 5EZSA 3WWZA 4PGMA 1VHLA 3E4DA 5C5DA 3Q0TA 5JH7A 2J33A 1T6BY 3SIWA 3A1TA 2YV4A 3M9LA 4LDZA 5IUKC 1IJEA 3HVUA 1YE5A 1UKCA 3B7GA 3DZCA 4MP6A 1MB3A 5HFAA 2VC2B 3HA3A 3KEOA 1J0CA 5F1KA 3AJDA 4OQDA 4LOIA 4RQBA 1ZI8A 2D74A 4KRFA 1TEZA 3LT1A 4ZAXA 4C21A 3EVZA 3PNQA 3TQFA 5BNZA 2AXQA 4H6XA 3RWOA 1SIBE 4OFZA 2WPDD 2PUAA 5TGTA 2Q28A 1M8GA 3RU7A 1BX1A 3BBLA 3DSRA 4H7PA 1QRRA 1JIUA 1Q22A 5CK4A 1LPBB 1WS6A 3MLAA 2WHXA 1NPYA 2PZFA 2MSKA 5IDYA 5C37A 1JSXA 3KE9A 1VFPA 1KJ9A 2HSWA 4IHQA 4F4CA 1Q6ZA 3THWB 1VJ0A 2OHHA 3RABA 1SA0A 4KGXA 4ENVA 5TMBA 1FZTA 4ITRC 5EINA 2YWGA 4TUYA 3LVFO 1OR8A 1RXSA 1X7DA 2ZRHA 4H0FA 3O8QB 5CNMA 3T9BA 2A67A 2GD2A 1ETHA 3UFXB 2A9OA 3KNZA 1MJGA 3MT7A 1E1QA 4RJKA 1WSBA 5G0VA 2XKAA 1ZY2A 1GSOA 3HCPA 5LDDC 2B1RA 1OXKB 2ZIGA 4ZCPA 5H7XA 3D4OA 4GI3A 5EZ5A 3UM9A 1RXCA 2ZXUA 5LXTA 2BKXA 1CYEA 1XRJA 2HDOA 1A9PA 3VR5H 1JU9A 3QW4B 1P7CA 3O3MB 3U6BA 3C3EA 3RRMA 3WZ2A 4O2BA 3VDQA 2G1PA 1N5MA 2OC9A 3N6VA 3DQZA 4HDRA 4BOYA 4DLTA 1FFEA 2HGZA 1RABA 3IO3A 2JB9A 3PDCA 2XF2A 3I12A 4GLOA 1CEEA 4CKWB 4ZI7B 3P9YA 3KWLA 1OV4A 1AF4A 1X38A 4W7SA 5BR7A 4AIIA 4D26A 3JRNA 3KOWA 2JIOA 1ZG3A 2WSBA 5D3MA 2C7OA 4JI4B 3O7WA 4PC3A 1T1SA 3PZRA 1J2RA 3OPYI 4IYRA 5LYJA 1VL2A 4KPUB 4BFTA 3F78A 4C20A 5LUBA 2XRZA 3ZHQA 3ZR4B 5JY6A 2QLMA 1O54A 2AD1A 2Q2QA 3GL9A 1KZ4A 2EVWX 4TQGA 3FFBA 1N78A 2B3TA 1P72A 1DQZA 3VU9B 3AVTA 3H2JA 3QVGB 4UNPA 4UVGA 2GK3A 3PKJA 2RH5A 4MPTA 1QG2A 1DOAA 2XQJA 2C94A 1Y4SA 4N0PA 4ZDJA 3EUFA 3CVXA 3VI3B 4AROA 2UZ1B 4G0ZA 1V0JA 2PLRA 3BSWA 1M54A 2VSQA 1A8IA 1R5OA 1WMDA 4G5GA 2DFPA 1R6BX 2EFYA 3ENKA 3IUQA 3UHAA 3RLFA 4BIMA 4ZQIA 3VYVA 3QK7A 4FTWA 2O54A 1BE6A 1IPHA 4LIPD 1QZXA 2IK8A 4ZRDA 4ME6A 1WTCA 3CKKA 4KIJA 1Y1TA 4JSTA 1XI2A 3RS2A 1QQAA 2BFCB 3QVMA 3FCAA 1OA0A 5IBQA 4UQLA 1C1XA 3AM5A 3D7KA 1L8LA 5JYCA 4JJZA 3DDHA 4UEQA 2YV2A 2XZDA 2XWBF 3QG5A 5AQEA 2A59A 1L7XA 1UBFA 3N2LA 1VCNA 4NENB 4OB8A 2DPLA 4US1R 5IM5A 1A0OA 1G1MA 2ZSAA 3FRHA 4HTFB 5A0TA 4PQEA 4GX1A 2BI8A 3T4EA 1L7MA 2A7XA 2FKNA 4NH0A 3WB9A 1DXYA 2V9CA 3JWJA 1NMSA 2YMPA 4DQ0A 2QW1A 2BGTA 2WWFA 1XTIA 1GL9B 1FVXA 2IPAB 2ZBRA 3KM0A 5DCLA 5AVXA 3NBMA 3SQOA 4BEWA 1JFVA 3OY2A 1JDPA 2WZQA 3ENQA 3OFND 2QUAA 3OZXA 5AKGA 3WKCA 3ZEAA 4BBPA 3GYGA 1P81A 1SWWA 1L7OA 1ZQ1A 3PLRA 4HVCA 4P98A 2OHXA 4MV1A 4OSEA 3A1EA 3DEFA 3IAXA 4U2DA 3PX7A 5CFOA 1NLFA 3DEKA 1C80A 2HRZA 2DT5A 5F23A 3LFTA 4N18A 4PNHA 4A15A 5CFZA 4GKAA 1L1QA 1BS9A 2NP7A 1MBZA 1OWOA 1QFYA 3DMYA 3K0CA 1EWTA 2X0JA 2QORA 3MAGA 1JQJC 3CNOA 1E1CB 4KO1S 4M9UA 4UFNA 4D74A 4BLUA 1Z2NX 2NGRA 1H3NA 3ROXA 2KQUA 4OA8A 1WUKS 3E5NA 1B8UA 1HDEA 2M6KA 3KHUA 1KYVA 5AUNB 5KINB 1U7DA 2FOLA 1JDSA 1ZL0A 1IAQA 2WG0A 1VSBA 1PG0A 3MNFA 3Q87B 4WASA 2QQ5A 2NW6A 9LDBA 2GPSA 5JS7A 4GDFA 1XKLA 1Z4NA 3GPIA 3EVDA 3OEEA 1KAOA 1TVMA 3NCTA 3OWXA 4LCBA 4OM8A 3I4FA 2GESA 4PLFA 1PK9A 1TJ4A 3IVRA 1Z8NA 1ABEA 3CW8X 2L19A 4HH3C 3QX7A 1BMDA 5EQDA 3RSFA 1ZC3A 3EZLA 2N1BA 3WGHA 4MP3A 3EGIA 4C3VA 3ISVA 3O8BA 2WYHA 3QY0A 3KJNA 5CYFA 1X80B 2XXJA 3K9GA 3TTWA 3K20A 3KJZA 4V0KA 4AYXA 3F6RA 2PUDA 1L9KA 2B2NA 4WNYA 1EYZA 3SZMA 1IVNA 3DC2A 1ORTA 1N7JA 4Y9DA 1WW3A 4DR3B 4JLDA 2JZCA 2H1LA 4BMSA 4CM7A 3KEQA 1YBFA 2BZSA 4AS3A 5E95A 4H15A 4I50F 4RPKA 4BVHA 3RYCA 3KTAB 3MCTA 5KVQA 3GLIB 4LHVA 3KT0A 4ZJYA 4DR4B 1QX4A 3DFFA 3AVXA 3PG5A 4M6WA 2GNAA 3AL0C 3K72B 4B44A 5DCWA 2NV0A 1U8FO 4GKBA 2QNIA 1UUFA 2H2DA 4JC0A 1C0IA 4R81A 4RK1A 1QYVA 4V03A 4WZAB 5IJXA 5SYAA 3C7DB 2WIBA 2ALJA 1X7YA 1ECJA 1OLOA 4F6RB 2QTHA 5EMKA 2UUPA 2XLBA 2FRXA 5IABA 1YONA 3KD3A 4KDCA 1GTMA 4PFSA 2MSWA 4M1MA 3DOJA 1JT2A 3CINA 1TLLA 2X9NA 2XR1A 1O9HA 2B8NA 2QRVA 3PNKA 3ZJYA 1DFHA 2BZ0A 1CV2A 3ZYZA 1BG6A 1GAXA 4X3OA 3RK4A 3I8XA 4CCAA 4BIIA 4JUBA 4EBBA 3MCAA 1EP1B 1XMJA 2Q9BA 4M2LA 4OVKA 4QTTB 3UHFA 5JY1A 1SXJD 3GPDG 1KNQA 1IJBA 3TOSA 4G0PA 5AJVB 3U7IA 4CFYA 3LWNA 4CKBB 3DUWA 4DABA 5C32A 6PFKA 3G5AA 3WNQA 1ZSVA 2NM0A 3RUPA 1ORWA 1E4OA 1XZKA 5KPJA 3OE1A 4WXHA 2MYPA 1GRNA 1CDDA 2CXPA 4F38A 4Q02A 5T8KC 4TVOA 3Q1LA 2AN5A 2DSNA 3BXEA 3R6LA 4XD7D 2C4UA 1SFRA 1ZH2A 3LW8A 1MOZA 1WIWA 2WFZA 3QP9A 3L8CA 3QXXA 3QIVA 2R9VA 1V25A 2FB9A 1X1BA 2NSHA 3ESCA 1U7WA 3RIGA 1VG0B 3EVCA 3GRPA 3I5MA 4OCZA 3CRRA 3OOYA 2F6RA 3DVAA 3NJ4A 2GHIA 4IILA 1GCIA 5HGJA 1BXRA 1W36C 4ZOLF 4B9EA 1ZNZA 2GF2A 4HYQA 2GK7A 4MGKR 4F6LA 4WFKA 1PWEA 2L2QA 1H6CA 1U2SA 1QG0A 3BWYA 4LBWA 5HRCA 1V1RA 4BKOA 3ELWA 1BU8A 1DWUA 1VBFA 2XBLA 3AFNA 1VHJA 1Z4IA 4EUKA 1SVNA 2H57A 3AM4A 4OI0A 1OD6A 4LEIA 4YT8A 2QOEA 1V7QA 1ZS9A 4S0ZA 2P91A 2YNMA 5FD8A 4RXTA 4BX8A 3R3SA 2FPSA 2GTPA 3TTVA 1NXVA 1KJJA 2WTXA 2KHZA 3IMFA 3NC0C 4OJNA 4CKXA 4G8JA 3VZRA 3QEMA 5TE9A 2JLCA 3QUAA 4Z1MA 1X42A 2XGMA 3INYA 2A33A 1UPFA 2JA1A 4LSMA 5E9QA 4IFEA 2FUKA 1EJ2A 3G8CA 1A9QA 2C2XA 3K9HA 3JATB 3VDRA 3RUCA 5BW4A 3VKGA 2JI6A 5COBA 5C8YF 3QFCA 4BLRA 2OZEA 4NS1A 1FUIA 1OXXK 1BO6A 2F64A 2WTNA 4M1WA 5BV0A 3CYFA 4P54A 2CNKA 2CB0A 4N3AA 1A50B 2FFAA 4ARVA 3OIDA 3T38A 4ETWA 2JCXA 2WWTA 3Q3JB 4UAGA 1M6YA 4ANFA 1I3MA 5HBRA 4XFKA 2QT0A 2AHRA 5EZQA 5JSFA 2CMDA 3DTYA 2C9CA 3GGGA 4FR2A 1B3RA 2RCYA 3K5PA 4U8HA 4B3TB 3RCBA 2Q7XA 1RAFA 4GGPA 4W1QA 4NTZA 5CB4F 2RCNA 3NM5A 4OU5A 1O6BA 4JI2B 3UHJA 1SKQA 1Z3IX 4QC2A 4IG4A 3ROMA 4OHVA 4DCOA 4X7PA 1U3CA 5B7QA 1B41A 4M55A 2BZGA 3DBIA 3F8TA 2W6JD 2O5CA 5JFOA 2QTZA 3ZJUA 4NP6A 3KPVA 3LX6A 2PZLA 3PF9A 4N8DA 4GOMD 2Q5HA 1ZM4A 2C04A 3R24A 1E4YA 3FFTA 4W1RA 1WO8A 2XECA 1L5NA 3UK0A 4E30A 5JTTA 1G0OA 4XWWA 3LC7O 2YW2A 3HV0A 4KRXA 4ZGBA 3WXBA 1BOOA 3QYPA 2AOTB 4WBXC 1GAQA 1CQIB 5CNIA 3O8QA 1TX4B 3NDPA 1XCMA 3CX6A 3P19A 4HXEB 3CF4G 3PHBE 4KDFA 4IO0A 4YFYA 3BDVA 3UT5B 1CHNA 2Z4SA 4NOJA 6LDHA 1MA0A 4U2FA 3ZVKA 2WKPA 3KQWA 5JRDS 2I33A 3HKDB 4BO3A 4N7RA 5EI5A 2WWXA 3TIXB 3WNDA 3JTMA 1X8LA 1DIRA 4EITA 1E32A 2Y1WA 4F06A 1U8CB 1NNEA 1IN8A 1D8AA 1E9EA 3F47A 5EPOA 1L4BA 3UMRA 2Q4TA 2FE4A 5BQPA 5B1EA 4DLXA 3CN7A 1ID1A 3VA7A 5AW9A 1XRPA 2CCGA 4RV9A 4KBFA 4RA9A 1V45E 5BR1A 3DL2A 3O93A 1II0A 3T3EA 1O6FA 1XZGA 1ZUIA 2Z2KA 3NNDA 4QOJA 4RMNA 4CMBA 2H4WA 2QZ9A 1EFVB 1U5BA 1W85B 1U2TA 2PZMA 3EG9A 1NY6A 3AKDA 4R01A 5AH0A 3BE5A 4ZVKA 3NATA 3VR4A 3ICOA 1SPBS 3TNYA 3D3QA 1XJ0A 1PEDA 1YCDA 1QANA 2DT8A 3AEKB 3LOQA 1NR1A 3ESDA 5EJ2A 2F67A 1SQ5A 5EWJB 3TL3A 3NNNA 2E87A 1P4JA 3UIEA 1U0BB 5EMLA 2GPWA 3QNMA 1OLUB 1RU3A 2QM0A 2C5BA 3C24A 1IWOA 2WSMA 4C5BA 2C0QA 4BVKA 4YGXB 2BV3A 3WNCA 3T4XA 4CF6A 4CM6A 3IHKA 1G8KA 2HK6A 5K0GA 1WCWA 2PCLA 4Z8YA 2C8LA 2W6PA 2IS6A 4OGKA 3DV2A 2WWWA 3NHFA 3RS8A 2ZB2A 3SZLA 3JZAA 4IJVA 5ES4B 5F21A 3PR3A 4MIOA 4OHCA 4Q00A 3TQOA 5EEGA 2C4KA 1PDWA 3ZG6A 3D8UA 3IOMA 3LQFA 3LT4A 4GX5A 2CFCA 4ZJPA 3SDZA 4MS4B 1OHHD 1PG5A 2DKOA 4YRBA 4AYTA 5HRAA 1IEXA 2QE7D 4FZJA 4WN3A 3X1DA 1MAVA 2ZE6A 3DWEX 4DRXB 4QZVA 4O2LA 1NPTO 1K2WA 3A14A 3O9ZA 2QKYA 3GLSA 1ODCA 2F1IA 4CMIB 2ORWA 4HF7A 4HQNA 4WQMA 1G5TA 1AGRA 4TWAA 3HA5A 4OI4A 3MWGA 5FA8A 2FZ5A 1JUDA 1P18A 1R4MA 1Z8HA 2IPOA 3HCWA 1RI3A 3ANTA 4HDQB 3TGWA 2O19A 1UKAA 3CH5A 3MCWA 1W96A 2HGSA 3JVVA 1KP2A 4J0GA 4C7KA 1YA6A 5F3WB 2HW8A 3TD6A 3RRXA 1KFJB 4FT4A 3AHIA 3SOZA 4NENA 3GYBA 2D5IA 2DFTA 2XTJA 4U2KA 1W4BA 2O7SA 3KUUA 2JAOA 4G5XA 4JYCA 4WZBE 1EHIA 1YQWA 1DCFA 4YV2A 1YF3A 2DECA 4P5EA 4OJKA 5BSRA 4XYLA 5G1OA 1E5QA 4IBOA 3D8NA 4K86A 2BHTA 4KMMA 1ADYA 3I45A 1YDHA 3DFUA 4KRGA 1YASA 2P90A 2X77A 4IZIA 1MX3A 4ZQGA 4CM9A 3LUGA 4IIDA 4RZSA 3V2UA 5ILGA 5ALVA 3UB2A 4UU0A 3R0VA 3W5VA 1X1CA 4RYLA 1SC9A 1XZAA 3GUHA 4HEA6 2VWHA 4I4TF 4IKPA 4MOWA 4Y2VA 4L4YA 1U6KA 1EIWA 2IXTA 1Z5PA 3IP7A 2IP1A 3K70D 1GT6A 1TIBA 4QUJA 1R4NB 1ZLXA 4Q16A 4D41A 1VPWA 2CNWA 1KEWA 2HMAA 3QLVA 3SQNA 3ONVA 1DOZA 1MX5A 5DMHA 3BXXA 1NJ5A 2GNOA 3URKA 5JYBA 4JI1B 3TFQA 3USES 5KDOA 4KN8A 4D0NA 4NPHA 4L4SA 2WEKA 1E2PA 4I46A 2Y1EA 3BIXA 4IV0A 2KE5A 2AI1A 1BOFA 5TEVA 2GN4A 1R5NA 1THTA 1WAMA 3GGPA 3RUAA 3ZU3A 4H7JA 1S5PA 5H5JA 5A6SB 2WQ6A 1YZ3A 2VNSA 3D8TA 2CVZA 3ZH2A 3M89A 2W48A 1WX1A 3JSAA 3L7AA 1QCCA 5JAHA 5TF0A 3A6FA 3V6MA 1JLLB 4M1SA 3E03A 2VCEA 4FBLA 4HRVA 3WE7A 4G0UA 3T3GA 1V43A 5FR1A 3RIHA 4E7OA 1WY5A 4FC6A 2XOEA 3GEIA 3ZOZA 4G0WA 2PH7A 2YY7A 4Y7DA 2M32A 4AZTA 3ZU2A 2KS6A 2MMCA 4YC7A 1ABBA 5IS2A 1QF9A 1QAQA 2XGOA 2QAGA 4A36A 1QIFA 3REFA 4QUAA 1UJBA 5F2KA 2QROA 2Z0MA 4I50A 4WXPA 1AHPA 1G8JA 1XD8A 1S2GA 3Q6IA 2OAP1 1X86B 3GC6A 5ALFA 5EN4A 1ZU5A 2REOA 2WP0A 2AEJA 5L3RA 1SK9A 3P9PA 1VGQA 5GPBA 3GUYA 4MW5A 5CFLA 3EGDB 2ZBFA 1Y6GA 5TSDA 2AVDA 4MVYA 5LLSA 3T3MB 3TINA 5BV2P 3FAZA 5HF8A 3ZWQA 4DLAA 2PJZA 4MS3A 3WV5A 3AL2A 1ZD1A 4TSFA 4V0RA 4YO7A 4C08A 4WW0A 4OHOA 1MJ5A 3A05A 2JGRA 3HVIA 4IXNA 1HLPA 4HWGA 4XWKA 1KKLA 3X1ZA 3DE3X 1K7CA 3LBNA 5ALTA 5KTPA 1SXHA 2NZ8A 4P6VF 4CNQA 1QHEA 5MF6A 1N3LA 2DHEA 1FNSA 1WXHA 1PL0A 2IEZA 4I9FA 2ERXA 3F9CA 1Y82A 3HEMA 1TC2A 4H60A 1CUXA 1BFKA 2C4MA 4Y2HA 4BNJA 1YBHA 3QPUA 1E0JA 1OXMA 5EUMA 1RRKA 2D2EA 5JNUA 5CG1A 1FMFA 5JMWA 1Q57A 4OEHA 2J31A 2AD5A 2YXDA 3WL4A 3VKHA 1L3IA 3EXIB 1DIHA 2WJPA 5E9AA 3U13A 5A7HA 2VI5A 1QQ7A 4MICA 4CM5A 4PBTA 1NKVA 1PSWA 5EERA 2B9EA 1N8TA 5FOWA 2QRKA 3PFHA 1P6QA 3UMCA 1ECFA 3ITEA 4L85A 4D8XA 3A3OA 3ZWXA 4HMOA 2V65A 1E8DA 2ZAOA 3ANMA 4GZMA 4LDAA 1K8YB 2ID4A 3C8HA 4MYTA 2FG5A 2REQB 3CRZA 5F4ZA 3D4LA 5FTJA 2OUIA 2O3RA 1IXZA 3MVEA 4Z2AA 1YDFA 1HFJA 5FX2A 1KI3A 3U4HA 2YINC 3I9JA 4GPBA 1BWSA 4BU1A 5GGYA 1KTIA 2DPYA 3MN1A 1DC3A 4QOSA 5FQNA 4EZEA 1SKBA 1Y98A 2X9QA 3L7NA 4INJA 4K28A 4D4MA 2QW8A 3QFFA 2F7SA 3ZLJA 1ID8A 3CLTC 4KQKA 1ZFNA 3GFRA 2WTEA 4MQFB 4H1VA 1A9ZA 3ZY6A 1CVRA 1YRWA 1L4UA 2NSLA 3I64A 3SG0A 3GLRA 1JHDA 2HJVA 3TW4A 5K05A 3RBZA 3NW9A 2I1LA 3IIJA 3OF3A 4CTNA 1SOAA 3FMOB 1F4PA 3HHPA 1FFDA 3W8EA 3LGXA 2CD7A 3OKCA 3PR1A 3TOVA 4LRTB 2GM3A 1CB7A 4LHYA 1ZVQA 1S96A 1U2GC 2TMYA 1EZZA 4M4SA 2JH8A 3BWDD 1B23P 1LPPA 5DBIA 2EF0A 4MYCA 2QX8A 4RVFA 1IYZA 4X91A 1QK5A 3F96A 1LDBA 3BB3A 2ATIA 3DVLA 5CLLA 3WAKA 3R9WA 2YX1A 4LFCB 1V11B 1YTLA 4Y3UA 1MO4A 5IAEA 3RG2A 1ORIA 3AGQA 1RXVA 3GN2A 4FW9A 2IZ7A 3O8OA 8ABPA 1YZUA 1L4KA 1K4KA 3JATA 3W4KA 1Z2EA 3UJNA 4R1PA 5REQA 3RYIB 1NRIA 4AT1A 1A9RA 1HRKA 3KV1A 3O03A 3NVDA 1Q84A 3Q11A 3VDMA 3VPBA 4EHBA 4YIHA 4D9FA 2A4MA 1Q12A 1XROA 3H5LA 1J21A 3KIPA 5CB4A 3SAJA 3KFVA 2E37A 1Y3AA 1VA5A 4JR1A 2JH9A 3IULA 4D3ZA 4PC2A 1CUSA 1SUFA 3RVJA 4KWEA 1XCJA 4F9FA 1RM4A 3MQ4A 1G6KA 1E0AA 1P74A 4QGFA 3YASA 1UJ6A 1ONSA 4BJ1A 3HJCA 1JA1A 3F9IA 2IZ6A 4HSGA 2K87A 2WV9A 2OD2A 5AMXA 1MAWA 2VTDA 2ZCVA 1ZMOA 2I03A 2QTTA 5KWVA 2F8SA 4JXZA 4OGGA 1NQVA 2EJUA 1J49A 1NULA 1YR2A 2JHGA 2RH9B 3C41J 4M0FA 2WU8A 1RIFA 4DSOA 5JO0A 1PZFA 4NCIA 2OCXA 4WA8A 1UWVA 4C29A 5IMSA 2JW5A 3EIFA 2WAYA 1R0LA 1RHRA 4C06A 1Z5WA 1LFDB 4QSHA 3IEXA 1A04A 4KL8S 3ZHRA 1UIRA 5FF9A 4FN5A 4Q05A 1RSZA 5AWFC 4YJGA 3FYCA 2AV6A 1NR7A 4BAUA 5JD4A 1I13A 4OUDA 3VTAA 4L4ZA 4MWTA 3NWJA 1GKKA 3P94A 4C3ZA 4RZ2A 5JAPA 1RP7A 3ZU4A 4RV4A 1T2UA 1Z47A 3KKLA 4GR4A 5MGBA 3KT6A 2Q0HA 2F59A 3NIGB 4D1YA 4ZI3A 3R7FA 1D2MA 2ZUBA 5LZ8A 2I29A 1XRMA 1CRZA 2VT2A 3HKDA 3O91A 4R40A 4EQ6B 2BN4A 4ENWA 1LPMA 1EG2A 5BSUA 1TM7E 4TWRA 2WJGA 5KTNA 3PTAA 4M8LA 3U26A 2RI6A 4D9NA 3VQTA 1EDEA 2YMMA 4R1LA 1KOFA 3PPIA 4TTQA 1JN0A 1ND6A 1U7PA 2MSDB 2YVLA 5D5QA 3R8FA 2W6IA 3QLUC 3SM9A 5KEIA 4QELA 2WAAA 3I4LA 5THKA 3TE7A 16PKA 2XUHA 4JNCA 3TD9A 4RDIA 3FAKA 4Z9YA 1DQYA 3BGVA 4Y2GA 1EFTA 2H1SA 1Z26A 2R2AA 3AGPA 3FSGA 4QQRA 2F3PA 4FM9A 1Y4DE 3AP3A 3C1TA 4MB0A 4C9BA 1BXGA 4DILA 5BMVB 1V9LA 1U1IA 1C9JA 2DHDA 4CI9A 1L5QA 4LV5B 5EWJA 1GNLA 3IT2A 4NECA 4BP3A 3FDIA 4CMGA 4URHA 3WLEA 1PV2A 1KH3A 5FI1B 1N2GA 2R1TB 1WBJB 2WYVA 3EGXB 4YP5A 2WU1A 2P9HA 4KTTE 4GUAA 2ZT8A 4NE2A 5HFJA 3BMOB 2QUHA 5FOQA 1E2KA 1JECA 4PLGA 3MMZA 3ELUA 5LDGA 4OK3A 4DV1B 2HXGA 3NYWA 4JH0A 1ZWKA 3WB0A 1E1YA 4G1VA 3I8SA 2XMQA 4XM0A 1B8OA 4Z9FA 3CUYA 3P9NA 4MUYA 4PG4A 5FLYA 1G8HA 5FO0A 5I9SA 3QE2A 4LOLA 1DHTA 1YCHA 3MGBA 4G07A 1OH7A 3ICQB 3NETA 2IW1A 4UUPA 2H52A 2P1ZA 1AN0A 1PJBA 1XQXA 2HSGA 2X0KA 3EOZA 3N9IA 3PHIA 4XDGA 5FRDA 3TVDA 5BYKA 2BDTA 1NT4A 2VF8A 1XMPA 3ZY2A 1GVNB 2Q3MA 3PNYA 1RM0A 4DRXA 2WQZA 2H7XA 5JQWA 2HO5A 3GG9A 3PV0A 1X1TA 2HA6A 2CFRA 4L8YA 3KR2A 2XUGA 1B6GA 4GNKA 4AULA 4FB4A 3LVBA 1ESZA 4FFWA 3WTBA 1U63A 1ODTC 2ZUFA 1XZQA 1V1MB 3ZCXA 2VG8A 3GCGA 1P1RA 4XWOA 4MVJH 3PGMA 4D96A 3UWSA 4KOEC 2A30A 4P4UA 4I4NA 4D98A 3GLIA 1DX6A 3VNAA 3CVOA 3SYLA 4F92B 3JZFA 1NW9B 2MU1A 2CDAA 4M7RA 4DR1B 5DGDA 4I4TA 1P7PA 5EAIA 2VNHA 2R66A 4J3JA 4RS3A 1J99A 5E38A 5JWRA 2Q3CA 3O1HB 3G8BA 4EYOA 3NKVA 1TA4A 2ZI5A 2PYDA 1D6JA 1ML3A 2OHGA 3OA2A 4C0JA 5FBLB 4LYGA 2QJTA 3O31A 5FOTA 3RAFC 1WMEA 1TUEA 5U9CA 1G7SA 2OCIA 1MKYA 3KAKA 3OFSA 1PIWA 4GEGA 1WDKA 2N75A 4AYWA 4GOLD 3ZIAD 3MAJA 5DULA 4TN1A 1BZYA 1NYLA 4HH0A 4GT1A 2JBAA 1W0JA 3NBYC 1ZMTA 3QU5A 4GXNA 4FWTA 1SU4A 1POWA 5LMCA 3TAXA 3GJ4A 4GM4A 3MJDA 4QULA 4Y6PA 5EIAA 4I5IA 1SC6A 4QDZA 4E3ZA 3BPSA 2GEVA 4ZQBA 5BN4B 2IOHA 1NIPA 2GZ3A 5JIBA 2PJDA 5AM1A 1L5YA 4CN8A 3Q9NA 3KQPA 5JROA 2MINA 2AX3A 3DWFA 3RVNA 4H18A 4CL0A 4JU9A 2EJVA 2BZ1A 4KYTA 5AHKA 3SI7A 2IYEA 3ZV7A 3CNNA 4CV1A 2OCGA 3U7RA 3AKEA 4GX2A 5BQXA 3O8LA 2COKA 5K51A 4GVPA 5K3CA 4BO8A 3AESB 2AXPA 1RKXA 4ERXA 2QN1A 3MJCA 2LKCA 3QJ5A 2GS9A 1XHEA 1G2QA 1NXTA 3N59A 3U3XA 1UM9A 2IBTA 1H2XA 3CLHA 1W0KA 3HNPA 1WEHA 3ZUPA 4CKYA 2CWDA 3QENA 4JLWA 2O2EA 3IEIA 3VZQA 3FN4A 2J5KA 2BR4A 4BQEA 1X7WA 2P2ZA 3OD1A 4UMFA 2M6SA 5JATA 5KZMB 3MBKA 1HX7A 3TQIA 3K6JA 5B2EA 4INZA 2OQVA 4OLBA 1TC1A 3AG5A 2ZSBA 5E0KB 4ZALA 4Y6GB 1A7KA 3PCRB 5T64A 1ISPA 5B57C 3EEFA 1OW3B 4IDPA 5UKDA 3HXOA 3H4IA 4U9HS 3UF0A 4X92A 1UKEA 3GPLA 1Z0UA 4R2WA 3PVZA 2P2NA 2K4MA 1NNLA 4INOA 4RIGA 1XZHA 2ZW9A 1XZDA 1EZ4A 2SNIE 1FTSA 3MRXA 1JDBC 4XX0B 3P9RA 1SXJE 3TJMA 3CUKA 1UWCA 2PKRA 3NHZA 4N9QA 3WLMA 4LJYA 1L7PA 1Q0SA 3IYLW 5BXQC 5IK2A 4GXRA 5E4JA 2V3WA 5C8YB 1SULA 5FCDA 4HDMB 1FRZA 2FUG6 2Q99A 1KAQA 1FNDA 1PL8A 3Q6NA 1H4SA 1Y3IA 1Z5ZA 2GKSA 3U7QB 3KWFA 3VJKA 1WF6A 5IJZA 3RF6A 1FFHA 1ZUNB 3GJ3A 4NCXA 5DI9A 5K6AA 2Q9UA 3SC2A 3K0CC 1AN9A 2FRVA 5ENDA 5IDVA 3VJMA 3W8FA 5ENZA 4EHDA 4AKIA 1ZZGA 1QFJA 2AOXA 5AKIA 1XEAA 4LVNA 4P53A 1MJFA 3DCNA 4BRWA 4MQLA 3GW8A 4XVRA 2EW1A 2ZVQX 4TZKA 3M33A 1A82A 3RHFA 4C43A 3EXIA 4ZHQA 1UH5A 1PR6A 1YR8A 4IS3A 3EIXA 7MDHA 4RY0A 4G63A 4CV2A 4YJ3F 1W4AA 1TMKA 2PBLA 1I4TD 2Q3JA 3OZIA 3DV0A 3FA2A 1XSEA 1KS9A 2UXCB 1JDNA 3ITDA 4EB6B 3H0EA 4J6EA 2OQRA 2QSUA 4HNHA 3CH4B 5FNVF 2Q6VA 3DBRB 3L0BA 4CM4B 5BOSB 1OZHA 1HOXA 5CNJA 4KFCA 3T5MA 1B8PA 4W8HA 5ICCA 4KPFC 4W5NA 4LW8A 1OFGA 1ONBA 5H70A 1H8EA 1GEEA 1RQGA 3HXQA 3OSZA 3ZIUA 2Q9CA 3A11A 1VG1A 1YCFA 4TLMB 3BEDA 5F5NA 3KL2A 5A0FA 4C7XA 2OQIA 4EY6A 3NUQA 3UJHA 1P4AA 5I7OA 4TLBA 1J8MF 3UGTA 4RKWA 2WM8A 1G2PA 4LMPA 5G4LA 1DJQA 4V0ME 1PWYE 3ND8A 5FBHA 4AN0A 4B3IA 1XHFA 1GL6A 2YY5A 4MCAA 5BQFA 5GZ1A 3C5VA 4B35A 2WF6A 1NI5A 3FYSA 3WLLA 1Y48E 3T3IA 4CLDA 1ZC4A 2I4OA 4MVJG 4AJLA 5FJJA 3D1VA 2IYPA 1GY8A 4QBIA 1JR2A 1GVHA 2JAHA 5HUQA 4OPMA 4BNHA 4Z8XA 3COYA 1V11A 3LQKA 2I2CA 1OVGA 3L4SO 4QTZA 3VAZA 1K6EA 1YXMA 2G7MC 1P1FA 2JLQA 3DLTA 3FDZB 1BKYA 2BCGY 2ZJYA 4GQAA 4IEFB 4RH0A 3B85A 1X94A 4P35A 1O97C 4W7IA 2ZS7A 1PQYA 3OE7A 4BLPA 3ZV3A 2GRUA 4IQFA 4D97A 2ONKA 2AN1A 2JGJA 1EFPA 5PGMA 5K8LA 3SIPA 2RKBA 5CDTA 2H4HA 1KMIY 2JF0A 5EYPA 3VAAA 4BZXA 1LWNA 1X3LA 4NYMR 4PQYA 4DQKA 4E5VA 4FJ0A 2D1QA 3C8ZA 5JVDB 5C1OA 1R8YA 1IPFA 3BGIA 1EI9A 2UKDA 1CVLA 2QZJA 3QPWA 4I0WB 2E4AA 1TTQB 2VR1A 2BDUA 2WU4A 3G6WA 1EESA 3VC2A 1S4QA 3QA3E 2DFNA 4YAIA 3KKMA 4XGRA 2X7HA 4YACA 2OBXA 3VC7A 4RACA 1CS4C 4RD4A 3OQIA 4KUGA 1ZIDA 4MEAA 5IC4A 3TPFA 3L0ZA 1BXZA 3HXLA 3RK1A 1KWGA 2EJCA 2Q8QA 5J1SB 4F11A 3WLIA 3TQTA 4ZO9A 4JQYA 2YWEA 2CUNA 1Q74A 2ETXA 3NT2A 2XVZA 3R76A 4FIDA 3AJAA 1RC1A 1QR6A 1X7XA 3RSOA 3CWCA 3HI4A 4BVJA 2RBKA 3SYRA 1Z2DA 3JXEA 4MI6A 4EO9A 3T7KA 4DDKA 1OYVA 2YNMC 3SHVA 3PF8A 2GK6A 3K9QO 4FDLA 4BASA 4D02A 1Q95A 1YR1A 3OJXA 4RXUA 1SUDA 4B34A 3HBJA 2JJ8A 3H9CA 4AY2A 1W8IA 4HN2A 2CHGA 1I9GA 3LDHA 4N5LA