3HDQA

Crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 114
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdqA01
2AQKA 3MWDB 4IJKA 4TRRA 5BR7A 1MV8A 3V2HA 2FR0A 4BOYA 1NVTA 1E7MA 1E7WA 3GEGA 1RYDA 4YTEA 3LT0A 1ZSNA 3AUTA 2CVOA 3EVTA 1I30A 1WMBA 1V35A 3RC7A 5I8WA 3ZWOA 4YQYA 1JKJA 3N7UA 2E48A 1H6CA 4KUHA 3X2EA 1XWFA 3FTPA 4OSOA 3Q0EA 3UH1A 2DPHA 4PLFA 2BLLA 3NDJA 4GMFA 2GN6A 2HJSA 3QQPA 3NTRA 3QVOA 4XCVA 5JAQA 3QWIA 1E5QA 2ZTMA 4AJ4A 1KYQA 2JKVA 2NU9A 1O95A 1ZO8A 4MKXA 4ZQEA 4Q3NA 1OOEA 3TZHA 2BFAA 4K28A 1YVEI 1D4FA 5HWSA 4J43A 3ZHXA 3DFZA 2Y0EA 2HO5A 4R3NA 2I76A 4U0JA 1YDEA 4ND1A 4PG6A 1DSSG 3GVPA 3GRPA 2BGKA 4FJ1A 4FN4A 1EFLA 3GT0A 1GYRA 4CMKA 3NTQA 1I8TA 5A3VA 2D1YA 4E5YA 3TSCA 4YT2A 2E37A 1DRWA 2ZCUA 4MVJA 1DC4A 4RVFA 5A5EA 4ID9A 3BMQA 4IMRA 4PZCA 1F12A 4ALMA 1LDBA 3F1KA 4CQMD 3ZNPA 5JC1A 4XYMA 1JAXA 3AFMA 2X0JA 1E7SA 4K1LA 2VRCA 4NDNE 1VSUA 3D3EA 4ZVVA 4BMNA 1CJCA 1XR3A 1U28A 1HKUA 2NLOA 4J6FA 1Y9AA 4TROA 1D7OA 2H1SA 1F17A 4CM4B 2GZ1A 3ROMA 1Q7CA 1NNUA 4FOSA 5IF3A 1N7GA 1QYXA 1T4BA 2HK9A 4GGPA 4BGUA 2IYPA 2BFOA 1EDZA 4AJKA 4E13A 4BNHA 1A4IA 1AE1A 3QRWA 1H0KA 1WLYA 1HZZA 4GL4A 4LVUA 4BNFA 4GX1A 4ROSA 2FMUA 3FWZA 5JO9A 1VL0A 2YFQA 4YJHB 1LRJA 4ALNA 1PJSA 4DBVO 1LQUA 2PWZA 4L0QA 3RBXA 1OI7A 3D64A 3IL2A 3G1UA 3OEYA 3ONFA 1C14A 4U7WA 2V65A 3Q6IA 3WYBA 3DZHA 2AHRA 4W82A 5ER6A 2AQHA 1KEVA 1JLLA 1JU9A 2EJVA 2NQTA 1PWXA 1DC3A 3G17A 1YBAA 1MXFA 1H9BA 4EJ6A 2W2KB 2J6IA 1FDWA 1GTMA 3GPIA 4FC6A 3WQQA 1I2BA 4XQEA 2EP5A 4DL9A 2RIRA 3VC7A 4JLWA 3V2UA 1PU2A 2Y1CA 3GLQA 4CUJA 3IAHA 3KTDA 4NI5A 3LC2O 1EQUA 1LSUA 4F3YA 5IDXA 3DTTA 4PRKA 3ZGYA 3H9EO 4WNCA 4CM9A 3A4VA 3UKOA 2VT2A 3F3SA 4QXMA 3HDQA 3WJAA 5L45A 3FBGA 4GLLA 3JQAB 3EMKA 1HSOA 4U6QA 1V3UA 4HADA 3QWFA 3U4CA 3X2FA 3LZ6A 5JMPA 2D4AA 5EIOA 2V6GA 1U3VA 2Y67A 3H4VA 3R1IA 2AQIA 3FTNA 4IGEA 3RUEA 1E7RA 4D44A 2Q1UA 4M55A 3OQ6A 3RI3A 4P38A 1P0FA 1YOVB 3JSAA 1UZNA 1YQGA 3VVBA 4TRMA 4MP6A 4YQZA 4ND2A 3QVXA 4LK3A 3WIDA 1AGNA 1GUYA 1MA0A 1NFFA 4NBVA 3WDSA 3CIFA 2OHXA 3TFOA 1TT5B 3RC9A 5DULA 2HMWA 1C0LA 4UVHA 1VJ0A 3GPDG 2FPGA 3MOIA 5KVCA 1PQWA 1E3EA 4CM8B 2BI7A 1FDVA 3CSDA 5ICMA 4IQ0A 1HDOA 2G76A 4J1TA 5CDYA 1IPEA 1X7DA 4FSHA 4OAQA 1KOLA 1NWHA 1Q2XA 2FR1A 1S7CA 4IDBA 5KKCA 4AL4A 3DOOA 5ENDA 2NU8A 1SB9A 1IHXA 3AOEC 3ITKA 3MJSA 4GGOA 4WOJA 4H7PA 3PJEA 3JQFA 3JV7A 4U6SA 1UXJA 2PKQP 1F0YA 2GF2A 2DUWA 1HZJA 2CF6A 3RCBA 3O26A 4TKLA 2VUUA 3ENNA 1WDMA 1EBUA 1H6AA 2QYTA 3FD8A 2FWMX 4NFSA 5LDGA 3K2BA 3DZJA 2JCVA 2NVBA 2VN8A 2DBRA 3PIIA 4WPGA 3JQDA 2GN9A 3WJ7A 4Y6RA 1CQJA 1YJQA 4P4LA 1TXGA 2OZPA 3K30A 4Z0HO 3GMSA 4CLXA 4CL8A 1G6KA 1B8UA 2NVWA 2BELA 3KSZO 3GFBA 1KY4A 3Q9NA 3ZWMA 5BSEA 3HQ4O 3WLFA 1E3IA 3D3WA 3DBVO 3TZQA 1PS8A 3NX4A 4F6CA 3COSA 3MOGA 2H6EA 1ENPA 4AJEA 1UDCA 5JAIA 3R3JA 1SOVA 4MINA 4BNWA 5CDUA 4HFNA 1SNYA 1TLTA 2GRAA 3BXXA 5T57A 4EGFA 2OFPA 3BTUA 2UV8A 2QRLA 1ENZA 2NU6A 1I10A 1F06A 2BRUA 1PX0A 3HB4X 2UDPA 4O5OA 2WJPA 4II2A 4PG7A 1P33A 3I9KA 4Y8VA 3WICA 4FBGA 2EJWA 3UFXA 3MJ4A 2PY6A 2AW5A 4IXWA 3RFVA 3DBLB 4J2HA 1LI4A 4CMGA 3ICCA 1SBYA 1PGNA 2O3JA 5DP1A 5AQ1A 3JQ9C 1T1RA 4N5MA 5A04A 3RWBA 3GGPA 3KOUA 5FFFA 2BGLA 3ZV3A 2UUOA 2Q3EA 4H16A 1K6XA 2PTGA 5A02A 1ADBA 1XCBA 4FC7A 1P44A 3V1TC 4J3FA 4EUEA 5CDTA 4ZD6A 2C07A 3JQ8A 1PJLA 4R68A 5TLSA 3GK3A 4ND4A 5TX7A 5B4TA 5B4UA 1T4DA 5THQA 4N18A 5JAZA 1MB4A 2C2YA 1Q1NA 2X0RA 2EHDA 4UUOA 1NM5A 2PR2A 1E3WA 4NBTA 5JCJA 2E82A 2ZKLA 2B4RO 4E5NA 3FBTA 3I4CA 5CHEA 1X7HA 2Q1SA 2QHXA 3VPHA 4Q3DA 1RM4A 5U4QA 4IDDA 2CZCA 4FQ8A 4XKJA 1LRLA 3F5SA 4YB8A 2DFDA 4IINA 1GEGA 4RPLA 2EWMA 2QX7A 1GPJA 4O63O 2UYYA 3K9QO 4XGIA 4J0EA 5KTKA 3C1OA 5T64A 3GG2A 1PJTA 4OO3A 4A7PA 2X0IA 4TRNA 1L7EA 5BQFA 2FZWA 3U4IA 2W90A 2EP7A 4B4VA 5KVSA 1X13A 2ZTUA 1E92A 3FRJA 4BNZA 1GUFA 3FPCA 1GCOA 2O4UX 1P31A 4PGFA 4F45A 4YJDA 1ZH8A 4PIVA 1E3LA 5L7WA 3L4SO 3O9ZA 3ITDA 1B8VA 1A5ZA 3CMCO 1H5QA 5G2OA 4RLHA 4BO1A 1EFKA 4G2NA 1ID1A 3RKRA 4FFRA 2YYYA 4RDHA 2Q2WA 3EDMA 3NAQA 1O5IA 2X9GA 1B7GO 2P91A 3VTFA 1LLUA 1YL6A 2NM0A 1UXHA 4I5DA 5IJZA 5EESA 6LDHA 1YS4A 4NZ9A 1R4MA 4ZRNA 5G0VA 1UDAA 4RVUA 3U62A 4XYLA 1M75A 1M76A 4AVYA 4XQGA 3M1AA 2VHYA 1RKXA 2XXJA 1GV0A 5T8KC 1HEUA 4I9UA 1MLDA 3KSUA 2HMTA 4MPDA 4I9HA 2NSDA 2G82A 3T4EA 3PDJA 2VYND 3WBBA 3QVSA 1EZ4A 1LUAA 4A5OA 1ZEMA 2IDZA 1W73A 2Y1OA 1Z74A 1B8PA 3JQ7B 4J1QA 4W7HA 5CG1A 3DONA 2YV1A 4UEOA 3G79A 2VUTA 1Z45A 1YJ8A 1DJNA 3TL3A 4AJLA 1GYPA 3RROA 4K9DA 2UUPA 1WZEA 3C1AA 3O8QA 1EVJA 3D4PA 1ORRA 1UR5A 3EZLA 3ADOA 1LEHA 1R12A 4W9NC 3PZBA 2Q1WA 1Y8RB 4JP3A 2JCXA 4WEOA 3WNQA 1B3RA 1U5CA 1LBEA 4MVJG 1LLCA 4BKRA 3DO5A 1NBOA 4ITUA 2NV6A 2FSVA 1B16A 4WCDA 3TPCA 4WJZA 1MC4A 1ZNQO 4OMUA 2WE7A 3DAFA 2JHFA 3AM3A 3DC2A 1DIAA 4YYZA 1RYEA 3RUDA 4J1NA 3BTOA 4W99A 1ZK0A 2EERA 1N9GB 3NDRA 2RBEA 4KQXA 4L9RA 4IUYA 1OC4A 2HDHA 4XJSA 1X14A 1OC2A 2J3IA 2TMGA 5TNXA 3F6YA 3NT4A 1HDGO 1C0PA 3UICA 3VTZA 4ESOA 5MDHA 2D8AA 1J49A 3MCVA 3JD3A 2FOIA 2JCYA 1PZHA 3IMFA 5AOVA 4E3ZA 3BMOB 3GZNB 1B3BA 4J9UE 4DLBA 1U8XX 5TSDA 3HFSA 4H15A 2CSUA 4Q3BA 1K6JA 3QJ5A 1TA4A 5HRUA 5CEFA 1NQTA 2QZ9A 1KEPA 4XGNA 5J23A 3WYEA 2PGDA 4WCFB 1GQ2A 3M1LA 1GL3A 2C7VA 4AJNA 4ZGWA 3RFXA 1LLQA 1KVQA 1PL8A 3OIGA 4IDFA 3S2GA 1DAOA 4AG3A 4PLZA 3QW2A 4YT8A 4MVJM 3E9NA 2Q1TA 1DPGA 2I67A 2NUAA 1MC5A 1WXDA 5ITWA 3E9QA 3ZU3A 1QLJA 3PYXA 3AOEA 2IE0A 2H9IA 3V1YA 4YAGA 4Z6KA 3PYLA 2LDXA 1JVBA 3CZRA 4RF2A 4CQLB 5DBIA 4B4OA 3OM9A 1HDRA 4GX5A 5G4KB 3GDGA 3VDQA 1NX6A 1Y9EA 4EYEA 1ISGA 1JQBA 1PZEA 1MG0A 4A2CA 3VDRA 4CR7A 4RPKA 5TT1A 3PWKA 2DBVO 3P5SA 1K0UA 4LSMA 3BTVA 2EF1A 1WVGA 4ZQFA 3ANLA 2PH3A 1P1IA 4ALJA 1HLPA 4IM7A 4D42A 3EC7A 1PGOA 2WYWA 4UEJA 2O4CA 4CMEC 1GU7A 4JROA 4BO2A 2VZ0A 2HRZA 1YWGO 4NJMB 5L51A 1ONNA 3SJ7A 2AE2A 3ZWXA 4IS2A 4E2ZA 2DKNA 5BT9A 2ZQZA 4JJGA 3KETA 4W6ZA 1NASA 4BO5A 5L95A 3FI9A 5EL0A 1I5RA 3GDFA 4BGIA 3UXYA 2NTJA 3F46A 4YXFA 2BHLA 5F21A 4UUNA 3LU1A 1LDMA 4HFJA 2VYVD 3WIEA 4IIVA 3GQVA 4JQCA 3H5NA 4YJFA 1R0LA 3OQBA 5EQFA 1HLDA 3W6UA 3G0OA 4DXHA 1DIRA 1ADCA 5CDSA 1HT0A 1PSDA 4FJ2A 4I5GA 3IKVA 1ISJA 3KEOA 5EERA 3SXPA 1B15A 3E8XA 3VKUA 5F5LA 3JQ9A 3M6IA 2NNLD 5L53A 1PQPA 3S2FA 3V5NA 3DMTC 3NJ8A 1Y8QA 3BMQB 2AMFA 1XSEA 2V6FA 3WWYA 4CM7A 1WMAA 4B3HA 4AFNA 4HNGA 1ZW1A 1NPDA 1KS9A 1IULA 4JCOA 2X58A 2HU2A 3OJEA 3LT1A 4CL3A 7ADHA 1PZFA 3DZBA 3ZU5A 5KVVA 4CQMA 3EHEA 1GZ4A 3FNHA 1ZSYA 2HK8A 1JW9B 1ULUA 2OUIA 3VZPA 4KZPA 2Y99A 2D2IA 2O2SA 4JX8A 4EITA 4N7RA 3WGQA 1I36A 2I5PO 3ZH2A 3RU7A 3UF0A 2P9CA 4PLGA 1NAHA 2CMDA 2O23A 2O3TA 4UUPA 5JY1A 2ZATA 4RJTA 1I3KA 3ZWAA 5ENVA 5IDQA 4GPD1 4LMPA 1KEUA 3ULKA 2V6MA 1JTVA 1K2WA 4IIUA 1YB5A 4FR5A 5JLAA 3TZKA 4QO8A 3WNVA 4BNYA 5JC8A 3AM5A 4PLYA 3PFFA 1D3AA 4Z0PA 3E48A 3QE3A 1SEPA 3IUPA 2J5KA 1LSOA 4KWIA 3QV1A 1XGKA 4OXYA 4R9RA 1I3MA 4DREA 3SLKA 2BI8A 3OH8A 2DQ4A 4JBIA 3DZGA 4S1VA 3OIDA 4A10A 1CYDA 1E1NA 3I9LA 1T24A 5A05A 3U4HA 4AJ2A 2J3HA 3RUAA 3RUFA 1VPDA 3ZWNA 1C1XA 3D4OA 1R15A 1IYZA 5T8KA 1LLDA 1R66A 4R1NA 2C7GA 3DZKA 5JDIC 5F1OA 4FFMA 1DDOA 2VTDA 3W8FA 2X5JO 3R3SA 4FOOA 2FR8A 3AU8A 4N54A 3ST7A 1NP3A 2G17A 4R51A 5EINA 3B1JA 1CERA 3HB5X 4XQ9A 5C7IO 1JVSA 2VWPA 1UDBA 1LU9A 1QKIA 5TJHA 2VUSA 3CXRA 3UUWA 4YAKA 1D8AA 1A7KA 2BFPA 2JFFA 4JP2A 1ADFA 1T2DA 4GSLA 5JBIA 1VM6A 4WE3A 2DTXA 1Q0HA 3F1LA 5DDIP 1PS0A 3ZU2A 4CMIA 4DQVA 3U9LA 1ENOA 2W98A 1WNTA 4BO6A 3PI7A 3I9NA 1I33A 4W9NA 2QIOA 5IN4A 1QYCA 3KYCA 1T2CA 2BKAA 1BRMA 3WGIA 2FPPA 3QVWA 1NQAO 1PR3A 3EAGA 1XEAA 2DTEA 3QHAA 3S8MA 1KBZA 2VRBA 3F4BA 4JBGA 5H82A 4J2OA 1DHRA 3M2PA 1YB4A 1C3VA 1V9LA 3VPSA 4I5FA 2B5VA 3NT5A 1PWZA 1NPTO 1ZK2A 2XPCA 4Y98A 5I8ZA 4FCCA 4IJWA 5B12A 5A9TA 4RF3A 1ZVMA 3H2SA 3WTBA 3GUYA 1GD1O 2PKRA 1IE3A 3NEPX 1NXQA 3OSUA 4DRYA 3DWFA 2C82A 2A92A 2Y1FA 1W6UA 4RGBA 1YE3A 4GLOA 4XYBA 1X1EA 4AICA 3U0BA 4IQ8A 3ROQA 3Q1LA 2VWQA 5BSHA 4JNKA 4ND3A 1LC3A 4RPJA 2CDCA 4YT5A 3BMCA 2O50A 1ZSVA 1DXYA 3OBBA 4IJVA 2RCYA 1DIBA 4YDRA 1A4UA 1R37A 5I9MA 5FF9A 5TRTA 1U3TA 3W4KA 5FEUA 4DPMA 4LGVA 4D3FA 5A1TA 4X54A 4OM8A 4F46A 4NK5A 3SX2A 3N58A 4HNHA 3MJTA 2VOJA 3K92A 5TQVA 2CUKA 1BXZA 1TB4A 3DFUA 1Z7EA 2QRKA 2VOEA 3L9XA 3AUAA 1UH5A 2VHXA 3AFNA 3PTZA 2BFMA 2UAGA 2ZB4A 3A1NA 3C24A 1IPFA 3C85A 2P4QA 4QT0A 4NFYA 5IZCC 3D3WB 1IZ0A 4DWVA 5I7FA 1VJ1A 4RPHA 1JWAB 4XA8A 2F1KA 1GPDG 4KUGA 3TF5A 1UP4A 3GFGA 3FN4A 1EMDA 5KWEA 4XD2A 1PZGA 5IFLA 3GHHA 1G1AA 2YV2A 1E1LA 3FHLA 1M66A 3ZWVA 4BKQA 4AJJA 4HV4A 2OGUA 4YJGB 1FJHA 1DOHA 3BAZA 4BNNA 2X86A 3E18A 4CMEA 2GGSA 3KLPX 1BVRA 4NMHA 2I6TA 1T1SA 3KYDA 5AXCA 4YRAA 2V6BA 1ML3A 4BV8A 4EUFA 2VWHA 1PGQA 3L9WA 1LDNA 1LA2A 4IDCA 2YHIA 4IQGA 1YDWA 5HA5A 5A03A 5JDCA 4IGFA 3LT4A 4O1MA 2GNAA 2HRBA 2FHSA 1RM3A 2IZZA 1LQTA 5ILGA 1MFPA 1NR1A 5KJEA 5IAAA 3JCZA 5TS3A 1F8GA 2CF5A 3GNTA 4N5NA 5C5IA 3PVZA 4TQGA 4GKVA 3FR7A 4HWKA 3MZ0A 4Q3EA 3L6OO 4DYVA 2WYUA 1BXGA 2EIHA 3ETEA 1E3WB 4TRJA 1N7HA 4E5MA 1QYDA 1SCUA 4GWGA 2NTVA 4PLTA 2PD6A 3I5MA 3GY0A 3PJGA 5DNAA 5FI5A 1F8FA 3DMTA 4UAGA 5F1KA 1NPYA 3WOHA 4QFDA 5BSFA 1DIGA 1QYWA 1UXIA 2CDBA 2WMDA 3AUSA 5C7LO 2OP0A 3TFQA 5L4NA 2HMVA 4O0LA 3PWZA 3QY9A 2X4GA 5DOVA 4J49A 3ENKA 2P5UA 3VOSA 5KJ1A 1MUUA 5TT0A 1YXMA 2J3JA 4YEDA 3RUHA 4DIBA 5HBRA 5U9CA 2AG5A 4OJNA 1MXHA 4CUKA 2R6JA 2NACA 1VKNA 1YGYA 4KTTE 1RM5A 2G5CA 4E33A 4LCJA 1C1DA 3BIOA 1MG5A 1XQ1A 3W4JA 2NVUB 4GKBA 3S1LA 1TVEA 1I3NA 1E0DA 3HDHA 1R4MB 4ZHSA 4XEHA 1ZMOA 2B83A 2IZ0A 4ZRMA 4PLCA 4BVAA 2X5OA 2IEDA 3ZV6A 2C5AA 1YONA 1BVUA 4I8XA 4J7CA 4M1QA 4XWYA 3AOGA 3I83A 3NDIA 4DQUA 3OICA 3OHSX 4CLRB 4CUZA 1OZAA 3VH2A 2C29D 3H9JA 4UUMA 4E5KA 1A9YA 2EEZA 3VPXA 3GMDA 4YWJA 1RM0A 2B35A 1IY8A 3KBOA 5F3RA 4YT4A 3AI3A 3GGOA 3L4BA 3ONEA 4WGGA 5CP8A 3WG9A 4E2YA 5KVQA 2VYNA 3ZW9A 2PZLA 4ALIA 4FFOA 3PHIA 1J6UA 1Z75A 1CQIA 1SEVA 2Z95A 3O8QB 3P7MA 2XAAA 4YPOA 1N8KA 4I5EA 1ZCJA 1W8DA 1KVSA 3JQGA 3H3JA 2DFVA 1A72A 1ISFA 4RZHA 2I99A 4XB1A 4RO0A 3GVCA 4OOEA 4L74A 3IC5A 1PL6A 1VL6A 1Q7BA 4EZBA 1ZKMA 5JDIA 4GI2A 2QRJA 3WYCA 2C2XA 1F14A 1QXSA 5KJ6A 4GMGA 3HWRA 2VQ3A 4WLFA 2WD8A 4HY3A 3PK0A 1U2GA 1UXKA 4LRTB 4DPLA 2ZB3A 1J5PA 1GCUA 5GZ3A 1XG5A 2P2SA 1HDCA 2WTBA 1KC3A 2HKIA 1M6WA 2ZIZA 5A4DA 2JL1A 1D1TA 3U09A 1QR6A 2OBNA 1ONPA 4TZTA 3B20A 3VH4A 3JQCA 4ZQBA 3GRKA 2PGLA 3AWDA 3U5TA 5A3JA 4FPXA 4HUJA 2C20A 2GERA 3EW7A 3WGHA 3GF4A 4BO4A 4R3WA 1KETA 4YAJA 3ABIA 3HNPA 3WWZA 1GUZA 1H94A 1MGOA 1YOVA 4GX2A 3HG7A 4JBHA 3OEWA 4NU5A 1HDYA 4PG8A 3WSWA 2D3TA 3HADA 3OJFA 1U1IA 3IOYA 1IHYA 1E3JA 5GY7A 2ZYGA 3RU9A 3KLMX 2I3GA 3Q3CA 1V6AA 4FFLA 4WLNA 4XZ3A 1YBMA 3ZZNA 1JDJA 4MVJP 2GO1A 2X9VA 3LLVA 4NH4A 1H6BA 3NGXA 4YACA 4NR0A 4M54A 4II3A 4EI2A 3JTMA 4BO3A 1ISHA 2NU7A 1NHGA 3BYZA 1UXGA 4MOWA 1WDKA 4WK6A 4XB2A 4Y6PA 4E4YA 2IYOA 3B70A 3KB6A 1WWKA 9LDTA 4D46A 2RH4A 1KVTA 1PS9A 3ZNOA 4KMSA 2PGJA 4B3JA 5KJCA 3IJPA 5JFOA 1P1FA 4RVDA 3RIHA 3RJ9A 1X0VA 3GC6A 3F47A 2YW9A 1FDTA 2VHWA 1BXKA 1J0XO 4P4NA 5FWNA 1DC5A 4RVHA 6ADHA 4MP3A 1KY5A 4Y67A 2B37A 2WE8A 1BMDA 2FRDA 1Q0QA 1A71A 5I7VA 1P3DA 1PQUA 4R5HA 3KZVA 4IXTA 3RC1A 1LDGA 3UW3A 3O03A 1PJ4A 1CETA 2ZJ0A 7MDHA 3TOZA 1DB3A 2A4KA 2CVQA 2DM6A 3B1FA 4J90A 4RQUA 5DN9A 4BUCA 2Z1NA 5K0ZA 3IKTA 1EEHA 9LDBA 3GR6A 1A27A 1E1MA 5IZCA 2A35A 3LC1O 2CD9A 3RQSA 4UEKA 4XIYA 2VTEA 3SLGA 1TI7A 4D0SA 3I6QA 4JJIA 5HS4A 1U4SA 1L1FA 1AHIA 5L7YA 3DL2A 1GYQA 4GVXA 1D1SA 3O4RA 4BNXA 4ZJUA 1NFRA 2YDXA 3BHJA 4J91A 2YZ7A 4O6VA 4E12A 4LRSB 4YJFB 1GV1A 1E7QA 3E1KA 3JQBC 3QVTA 4J4TA 4PVCA 3TRIA 3TZ6A 5DOZA 1ZXLA 1R0KA 3JQAD 3PHHA 2JAHA 1LSSA 4R54A 4WOKA 1GZ6A 1W4ZA 3MTJA 2VYVA 2PA3A 1B0AA 5B4VA 4UVIA 1P74A 1ZFNA 5HTOA 1DRUA 4B8WA 3GA0A 4GSKA 2X0NA 4JGBA 4ONEA 2EKQA 3ZHYA 2C0CA 4IMPA 5U1PA 1P1RA 3LYLA 1P45A 4DTIA 4TKMA 1E7YA 1LDEA 1UAYA 1S6YA 2JHGA 3EYWA 4OOFA 2OXIA 3GEDA 4A26A 1HDXA 4FGSA 2OO5A 1NQOA 2SCUA 1I2CA 4EEXA 5CAEA 2DBZA 4UULA 1MFZA 2TMDA 1U3UA 5G0UA 2NQ8A 1N1EA 2IRWA 3Q2KA 4CQMB 2DU8A 2JAPA 1FXSA 3KSDO 5JXWA 1FMCA 4C7JA 1YBVA 1YB1A 3DEYX 3CEAA 5CG2A 5JCXA 4ZU3A 3B1KA 3CZMA 1XKQA 2W8ZA 1Z6ZA 3Q9UA 2GN8A 3GVXA 2YJZA 2HSDA 3NUGA 3KRTA 3JYPA 2DBQA 3D4NA 2GDZA 2Q2VA 3ZHBA 5L7TA 4MP8A 4IBOA 4BKPA 3WFJA 4PCVA 2D59A 3WS7A 1BGVA 1ISIA 1N92A 3WGGA 3BA1A 3HZZA 3L0DA 3PLRA 5CEEA 1O8CA 2FPIA 1VJTA 3CINA 4WLUA 1W0CA 3PEFA 3KXDA 3SC6A 3W6ZA 1SC6A 2QW8A 3MEQA 2GSDA 1HSZA 2W2LD 4PLVA 5T6BA 4M87A 1CRWG 3KV3O 4RF4A 3LC7O 2GZ3A 1SAYA 3I9JA 3QWHA 1HE3A 3HN2A 1DAPA 4ND5A 5AVOA 3AI2A 3ZI0A 3RASA 4WLVA 3DAGA 3CH6A 3QWAA 3RBVA 5DBFA 1NTOA 3QLJA 2ZK7A 3HDJA 3GAFA 1P1HA 3SC4A 3L77A 5I7SA 5JY6A 5AXBA 3EUWA 4MVJI 1IZ9A 3ZU4A 5ES3A 5EQDA 4BIIA 2XOXA 1R4NA 3WR5A 3GVIA 2VT3A 1QV7A 2FZEA 2EGHA 1C1XB 4OQYA 4KOAA 3G1TA 4MKZA 1XA0A 1IB6A 3FR8A 3CKYA 2PH5A 4KUEA 1HYGA 1M2WA 3VZSA 2NTNA 3TQHA 1YO6A 4KQWA 1NR7A 4BMSA 5EN4A 4E31A 1Y5RA 4DLAA 3EVNA 5DCYA 3RBZA 3LDHA 3PXXA 4H3VA 3O38A 2AQ8A 3ASUA 1AXGA 4BMVA 1YL7A 1FK8A 1HYEA 1A7AA 1EE9A 3PFWO 3EGOA 4L4SA 3AM4A 5KNLA 1B2LA 5LCXA 3C3XA 5T67A 2WSBA 4N5LA 2HJRA 3E5MA 3QWBA 1LTHR 4PG5A 3KYCB 3ZN2A 3DR3A 1EK6A 1VI2A 1AN9A 1BTOA 2AG8A 4NQZA 1IUKA 3PIDA 1XYGA 3K5PA 2Y0CA 2XF8A 1DLJA 2ZQYA 1LSJA 3DB2A 4P4GA 3C1TA 1DHTA 1OFGA 1K89A 1ZZEA 2BF7A 3PDUA 1Y81A 4WLOA 4BNUA 5JO0A 4R1SA 1CDOA 1NFQA 3HFGA 1LNQA 2PK3A 4NG5A 4DMMA 2Q4EA 4BO9A 1BW9A 1NWCA 1KVUA 1N9GA 3MTGA 4HKTA 1ADGA 1L7DA 2C59A 1HTBA 5KCZA 2DLDA 1XDWA 3HSKA 1JAYA 4XRRA 3WGZA 3H5RA 2WDZA 4BV9A 3E5RA 4Q9NA 2PZKA 5L3ZA 3TOXA 1AUPA 2CVZA 3WQRA 5G0TA 3BMCB 2V7PA 4FJ0A 2Q49A 2P9EA 1Q7GA 1QMGA 3PHJA 5JPIA 2PKQO 1DRVA 3H9UA 4UVEA 2ZTLA 1CIVA 2ILTA 2GCGA 1HL3A 3NV9A 4UVDA 3ORFA 4GX0A 2PLAA 4LMRA 4CR8A 4D3DA 2BGMA 1OBFO 1X1TA 3AJRA 2GZ2A 1KVRA 3ANNA 4MIYA 1ISMA 3LK7A 4R41A 1OMOA 2YHUA 5DF1A 4ZA2A 3K31A 3OJ0A 4EDFA 4ZQGA 2JFGA 4XR9A 2VHVA 4RF5A 2F00A 3VH1A 3B6ZA 2VZ8A 3OFSA 5KIAA 3T4XA 3ZWCA 1P9LA 4S3MA 3G3EA 4JK3A 4EBFA 5G4LA 1DFHA 2Q2QA 4XRGA 4Z3KA 3VVCA 3IS3A 3LT2A 2D5CA 3DTYA 2QZZA 4F6LA 3TZCA 4LCEA 4XJTA 1IOLA 5COBA 1NVMB 4BGVA 3BMNA 4IJUA 4J16A 1EBFA 5AXDA 4Z0TA 4YAEA 5G4KA 2FY8A 2HAEA 4M89A 4FB5A 2QQ5A 1E6EA 3ROPA 5BNTA 2EW2A 2YDYA 1CF2O 2EXXA 4OIMA 1U3WA 1PIWA 2DVMA 2HMUA 1TEHA 2X6TA 2UVDA 5L4LA 1KIFA 2B4TO 3KYDB 3AK4A 4AJHA 4E5PA 5A9SA 2B4QA 4IY1A 5DZSA 1K3TA 1ULSA 3H8VA 3ROKA 4B4UA 1ZEJA 3DBHA 2IXAA 4EUHA 3DAPA 4GH5A 4MO2A 4DGSA 2O3QA 4I08A 2IZ1A 4LISA 4CPDA 1CWUA 4E32A 2XXBA 3VKVA 1XU9A 4U0KA 5IXYA 2YHIB 4AJIA 4FGWA 3L6DA 4HP8A 3DHYA 3V2GA 4EEZA 1NYTA 8ADHA 1I3LA 3WGOA 2YV3A 3ETDA 3KEQA 2RAFA 2E6UX 5C3MA 1V3TA 4CLOA 1XELA 3H7AA 2HQ1A 3JQBA 2Y1EA 5TIIA 1BDMA 4J7XA 1PTJA 2JD2A 4YCAA 4NBUA 3NT2A 1BSVA 4OQZA 1GZ3A 2Y68A 4NK4A 4GQAA 1P1JA 5DCWA 3T7EA 4J1SA 4YBZA 3WGTA 4AJOA 4B8ZA 1BXGB 3ZNNA 1SZJG 2FN7A 3DBRA 4WNIA 4G65A 1I0ZA 5I9NA 1PGJA 1FDUA 4RCVA 4U8GA 4D3SA 3GEMA 1MP0A 3V1UA 2P68A 1J4AA 4A03A 1UUFA 1ZUD1 2DAPA 4L8VA 3FNEA 3IJRA 2GD1O 4D79A 3WBFA 4J9VA 1E1KA 1RPNA 3UCXA 2PFGA 4W4TA 3PRJA 4I9NA 3FNFA 5ICSA 2G1UA 4HFRA 3A9WA 3GDOA 1WP4A 1XHLA 2C54A 4YRDA 3U4DA 4OKIA 1UAGA 2QYSA 1C1DB 5GZ1A 3IQDB 4D7AA 1AXEA 1SPXA 2ZTVA 2FSSA 3PHGA 1E6UA 1X0XA 2BMAA 3RD5A 3E6AA 3I52A 1N2SA 4BO7A 3JYLA 4U5QA 4XDZA 1ZXBA 5C37A 4YR9A 2WD7A 2X9NA 3WQSB 5BNFA 1LRKA 2DTDA 4YAIA 2J8ZA 1I32A 4RLSA 4CM1A 4YRBA 1PJ3A 2BH9A 5THKA 5G0SA 4INAA 3IP1A 2Y05A 1SO8A 2WM3A 4NFHA 1HYHA 1PJBA 4RDIA 3ANMA 3ON5A 4BNVA 2WYVA 4R5MA 5TF4A 3EY4A 3DDNA 3I9MA 1LJ8A 4NNJA 3I6IA 5TJ9A 5ILOA 4OXNA 5TGDA 1GDHA 2W4QA 4XIJA 2I3AA 5JW6A 2C5EA 2GYYA 3DOJA 1OAAA 3IIEA 1PEDA 3P2OA 1Y5MA 4IZHA 1PJ2A 4C4OA 1O94A 4E21A 3UCFA 1KEWA 3EZYA 2Z1MA 1LX6A 2DC1A 1Y1PA 3JQGB 1DIHA 1I01A 2YFHA 4Z9FA 3WX0A 4PN3A 4ZN6A 1PJCA 2X23A 4IPTA 3K8ZA 2ZYAA 4K6FA 4FFNA 4ILKA 1UJMA 3PHLA 2R00C 2H63A 2GN4A 4L76A 3ADPA 3KM0A 3ZWYA 4JXKA 1UP6A 1ZBQA 3Q11A 1T2FA 3I4FA 3LQFA 2VNSA 3F4LA 5JE8A 3C7AA 3FF4A 4W7IA 5CEJA 4NJOA 3JQ8B 3GVHA 1EUDA 1HRDA 3DOCA 4L4RA 1O6ZA 4DPKA 2O3RA 1ONOA 3KVOA 3HDYA 1YH3A 4CODB 5IG2A 2AEFA 2O48X 4R16A 4Z3DA 3UN1A 4CMBA 5IXSA 2O3SA 1PL7A 3PGJA 5T5QA 3KUXA 4CM3A 4WLEA 4RPGA 4CM5A 4BNGA 4MVJD 5JSFA 2CDAA 5K9ZA 1VE9A 1ARZA 3TL2A 2OP1A 3OMLA 3NGLA 4DMLA 2VWGA 3C7CB 4JJFA 3INTA 3WMWA 1DBVO 1VSVA 4XDYA 3U3XA 3WLEA 2IEBA 2VRCD 3CTMA 3RUCA 4B7CA 2OORA 1P1KA 2GPTA 1GEEA 4Q3AA 3D0OA 3W8EA 3FNGA 2PD3A 4MVJF 5JAMA 4EJ0A 5DT9A 5A5FA 3PZRA 4KP7A 2O7QA 4LVCA 4NHEA 4E0BA 1U2DA 3JQ6A 1SMKA 1DO8A 4J4HA 4KTVE 4B3IA 4MVJE 3LLSA 4QECA 3UAGA 4CM4A 3DHNA 3QP9A 3FCOA 3JYQA 1JWBB 2CNBA 4TMFA 3I3OA 1HXHA 1A9ZA 4E6PA 2RHCA 1HDZA 4RV9A 2Y1DA 4RVSA 5IN5A 4PLWA 3GZ4A 4R1UA 4D0RA 5MGBA 2ET6A 2P4HX 3ZV5A 4YJHA 1HE4A 3RJ5A 5L40A 3SVTA 1QLHA 1BWSA 3RFTA 3UCEA 2P5YA 3S2IA 1QG6A 4BKUA 1O89A 3H6KA 3ZWBA 3IP3A 2P9GA 3DZFA 3PWSA 1G0OA 3V8BA 3HN7A 1H2HA 2I65A 1PJQA 2Q99A 1JKFA 5JYEA 2DT5A 4TWRA 3OETA 2E49A 4NBRA 4PVDA 3BTSA 5AYVA 4UVGA 1X7GA 3ICPA 2B5WA 2W2KA 4WEQA 3SEFA 4XYEA 3VZRA 5H81A 3S55A 3WSVA 5COAA 4OXKA 3VZQA 2Y0DA 4G5HA 2O7SA 2VZ9A 4L4XA 2LDBA 3DZIA 3PGXA 3BZUA 4CM9D 4XQCA 4CMCA 4PLHA 3FWNA 2G0TA 4DLLA 1NQ5A 5LDHA 3UOGA 1GAEO 1H6DA 4Y6SA 5IDYA 3H2ZA 2Q45A 1XQ6A 4YJGA 1Z73A 4TVOA 3NKLA 1E3SA 3PJFA 3MJCA 4CV1A 1GQYA 4LSWA 2EGGA 3HHPA 4GWKA 5DCUA 5ITVA 3TN7A 3JD0A 4EJMA 4XYGA 5EPOA 3WXBA 3JQAA 1U9JA 3GN2A 2O3UA 2ZB7A 5JNLA 3IUSA 4P8RA 5F1PA 2JFHA 1EVZA 3WB9A 4ZQHA 2ZYDA 4CMAA 3CUKA 3D7LA 1VL8A 5A06A 3DHEA 1DLIA 3Q2IA 1T26A 3RC2A 2Z5LA 3D5QA 1JA9A 1E6WA 4RL6A 5G0WA 4IZIA 2EG9A 4PLPA 1UZMA 1KC1A 3AW9A 4JIGA 5K6AC 2J3KA 3S2EA 1FF9A 3PLNA 3K73O 5I7EA 2Y1GA 5B37A 1EUCA 3W1VA 4QX6A 1TT5A 3AI1A 1GFSA 1SOWA 4WCFC 3RVDA 5CDGA 3H3FA 2D5AA 3QIVA 3E82A 3WFIA 2DUUA 3H5AA 3K96A 1WAMA 4CM8A 1E5LA 3T7CA 5BSGA 3OF2A 5ADHA 1B14A 4DA9A 1HETA 2RH8A 1T2EA 4QEDA 4RQTA 1X15A 1M67A 5DP2A 3ZNQA 2B36A 4Q3CA 2X5KO 4HX5A 4CMHA 1FDSA 1NAIA 2WEKA 3HJAA 3TNLA 4IDAA 3GNSA 1U8FO 3TJRA 4R9SA 4OKNA 1R16A 2X22A 3PP8A 3EK2A 3R6DA 3PQFA 1YRLA 1RWBA 4NPCA 4BB5A 4DC1A 2CFCA 1Y6JA 1JKIA 2OL4A 2R2GA 3ASVA 3AY3A 1HE5A 3DMYA 2JD1A 3VPGA 4B7UA 3VHRA 3ZHZA 1V8BA 4BL5A 4E2XA 2AA3A 4PG4A 3NJ4A 3N74A 1YQDA 2GUGA 3MJEA 3JYOA 3WGYA 4BS9A 2QG4A 4WECA 3E9MA 2W2LA 3WTCA 4OGWA 3KHUA 5HS6A 3U49A 1H93A 3INRA 1H9AA 4J4BA 1DC6A 3HE3A 2NVUA 3KYBA 1N5DA 1R4NB 3GOHA 3PJDA 3H9QA 2J5RA 4OSPA 1Q0LA 4BO8A 4CV0A 4A27A 3BHMA 4BB6A 4FFPA 2JD0A 4GVLA 5KKAA 5EJ2A 3STHA 4DUPA 3JD4A 1N1GA 4R69A 3RUIA 1Y7TA 4BNJA 1BDBA 4M86A 3I9OA 4Q39A 4K26A 4R01A 4CR6A 4KWHA 3E03A 4CLRA 1BG6A 5L9AA 5ER9A 5BNIA 3JD2A 1GADO 2OBYA 4EW6A 1TT7A 3ZWWA 2EKLA 4D45A 2VCYA 1EUZA 4E30A 2ZCVA 1AHHA 2FP4A 2HLPA 4MVJH 1QV6A 2PD4A 4AJPA 4HBGA 3PYMA 2GR9A 1BHSA 1XU7A 5CPFA 4QSMA 4E2WA 3GGGA 5JMWA 1ZMTA 2B0JA 2R00A 3DBLA 5CPBA 4CLEA 1ZK4A 1UZLA 1ZJZA 2PV7A 3ZCXA 4OL9A 1H2BA 4BNMA 4R1TA 1ENYA 4ZICA 4MIEA 4CMJA 4A0SA 1Y8QB 1EVYA 2YUTA 4XR4A 2RHRA 1EK5A 5IZ4A 5LC1A 4MKRA 2BD0A 4PZEA 1O0SA 1BW9B 2WWRA 4QTZA 3GNQA 3ETGA 3TDKA 2VNAA 3W8DA 4B4WA 5JCJD 4FS3A 1DFGA 3OP4A 4IS3A 3F5QA 4BQPA 4FD3A 5HM8A 4BNIA 5DBGA 5KJFA 1C0KA 4ALLA 3ONDA 4OYRA 2A94A 4DBZA 2HCTA 1CEQA 2E4AA 5EMHA 1U7TA 1Z82A 1RJWA 4BO0A 4BNTA 3JYNA 5I9LA 1GR0A 4BHTA 3INGA 3LF2A 4K6CA 4M8SA 4PFJA 4PRLA 3AY6A 3H65A 1ZIDA 3I1JA 4YVFA 3JD1A 1JN0A 1EQ2A 4GBJA 4LN1A 8LDHA 1P0CA 3A06A 3VH3A 1EE2A 3LF1A 3D1LA 2Y93A 4FW8A 1KERA 4CV3A 3PQEA 4MDHA 1LC0A 2DPGA 1K6IA 3FPLA 1MX3A 4I1IA 4PZDA 4BQRA 3A14A 3IDSA 4B79A 4XX0A 2X8LA 4WKGA 4R4JA 5C7OO 3HUDA 1K5HA 4QFCA 3ZV4A 4NU6A 5B1YA 3ZW8A 3CE6A 3CMMA 4BKOA 5IDWA 1B26A 2J5QA 3PPIA 5AXAA 4BNLA 1I24A 4TVBA 4J7UA 3UHAA 3BMNB 5TC4A 4M49A 5CFZA 1PR9A 4HFMA 2VHZA 1VLLA 2PZMA 1T25A 2H5LA 2Y66A 1O9BA 1VRWA 1QP8A 3A28A 3LSYA 1G0NA 3GUCA 1C0IA 5JS6A 3C7DB 5KOIA 1E77A 4CV2A 2GLXA 3NYWA 4RORA 3D5TA 5A9SB 4ALKA 2B69A 1I2ZA 3DBHB 1NHWA 4DIFA 2AE1A 4YA6A 1DJQA 1WPQA 1R6DA 4Z9YA 3AUUA 3JQ7A 4OHUA 2HK7A 2POQX 1ZK3A 3WMXA 3ZWPA 2I66A 4CMIB 4URFA 4CLDA 2NWQA 2I9PA 3OA0A 3LVFO 3AU9A 4G81A 4LW8A 1WDLA 4DYDA 2YY7A 2HMSA 1DEHA 1ZJYA 5JDCC 1R0SA 3UGKA 1EVIA 1WW8A 3AY7A 4Y9DA 1NVGA 1QRRA 3UVEA 1SB8A 2Q50A 3GG9A 1YQXA 3MJVA 4CLOB 2IXBA 4DQXA 1Y8RA 3GN1A 3OIFA 2AEJA 3KO8A 3L07A 4FIZA 3M2TA 4WUVA 4D43A 3L6EA 3R0IA 4CM6A 1QSGA 4XGKA 4MJLA 5GMOA 2OMEA 2X1HA 1U7HA 3DBRB 2AXQA 4UREA 2ZJ1A 3F9IA 3SBOA 1VKOA 3MWEB 1LXCA 3GH3A 4MIOA 4P22A 3NRCA 1PGPA 1UP7A 1LDYA 2PNFA 4FDAA 5F5NA 4CLHA 1HWYA 2EW8A 3NTOA 1XIVA 3QSGA 4D41A 3FSRA 1QYVA 3BHIA 3CPSA 2JJYA 3OA2A 3P2YA 3SJUA 1QORA 2Q4BA 3QA9A 3C8MA 4QO7A 5FI3A 4BNKA 2AEMA 3OJLA 5COQA 2HUNA 4QUKA 3W4IA 3TWOA 3OECA 3JQFC 3BMOA 3GZNA 1IL0A 5H83A 1U5AA 3DQPA 4L73A 1GQQA 5K6AA 3JQEA 3VAZA 4RVGA 2X7HA 4AJ1A 3GAZA 4WASA 4WCFA 4JN6B 1VC2A 4RZIA 3ZDFA 2OOSA 2GASA 3RAJA 5GZ6A 2YQ5A 2ZB8A 4A73A 4DIOA 3OJOA 3RKUA 4DVJA 2YQ4A 3PQDA 4TSKA 4TZKA 1Z7BA 2EV9A 2A9FA 2WD7B 3K6JA 1V0JA 5L4SA 1YL5A 4Z9XA 5JYDA 1M6HA 4IDGA 1P77A 1XLTA 4CJXA 4GAEA 1DFIA 1EDOA 1ZK1A 2O2YA 4C7KA 2IODA 4O59O 4L75A 2Q46A 4CQLA 1GY8A 3I23A 3P19A 2D0IA 1HF3A 4IDEA 3DXFA 4KDEA 4NIMA 3H9GA 1WZIA 3VPFA 3GHYA 1V3VA 4BGEA 4DC0A 4B7XA 1HE2A 4KDFA 1T2AA 1U4OA 3OQ1A 2CY0A 2PZJA 3L4BC 4NBWA 5A9RA 1YKFA 4QQRA 3G49A 4HXYA 3RSHA 2EKPA 3K2EA 4OH1A 2NADA 4J0FA 5FYDA 4NJMA
chains in the Genus database with same CATH superfamily
1QUFA 3D6FA 1RBMA 2JIZD 3F8SA 4YRLA 3ID6C 3NG1A 2XR1A 3NC1C 4BOYA 4NMXB 3D7RA 1ZOPA 3DOFA 3ES9A 3ZVKA 2XGMA 1WBDA 1RYDA 3R77A 4KYUA 4YTEA 3AR9A 3LT0A 3UT0A 1TEXA 1WY7A 1TO1E 3EVTA 1YI1A 2FH5B 2B2NA 3AEKA 3KZXA 1L7XA 5I8WA 5EMMA 2CW5A 1WA5A 3ZWOA 2NP7A 1EVLA 1VB3A 4OSOA 4L22A 4MS3A 4GI7A 2HLNA 3S5UA 2CEAA 3USES 4EMSA 5LJIA 5A4JA 3NDJA 3TTUA 4R9VA 2JJ2A 4GOND 3NTRA 2A5YB 1TIBA 5C8YA 1SVNA 1W4CA 2ZTMA 2VF2A 2FN4A 2IZ6A 5HDBB 5B1SA 4Z8XA 4JWTA 4CEJA 3OE5A 1ZO8A 4ZQEA 1FYXA 4MARA 4Q3NA 1FQOA 3LSTA 1JX6A 1RMTA 2FOXA 4MEBA 4K7JA 4CE6A 4KWCA 5LN1A 3EDYA 5CM8B 4K28A 4KXYA 1D4FA 1NKSA 1GA4A 1UK8A 1SCUB 2Y0EA 1UFVA 2HO5A 2B98A 4GW3A 2P79A 3SKVA 3BD6A 2QV7A 2I76A 4QXRA 1ABFA 3E0QA 1YDEA 3R6WA 2PUWA 4WZBE 5IH7A 3GVPA 2WF9A 3GEIA 2BGKA 3RYCA 4FN4A 1EFLA 2HLDA 3CX8A 1GYRA 4CIDA 3USZA 3KKNA 1SZPA 3JZFA 5A3VA 1FFDA 4HQFA 4YT2A 1JEEA 4L9WA 2HNAA 2PL3A 2QT1A 2ZCUA 3DSRA 5AUOB 1YSCA 2VDNB 3B1WA 1H8ED 2C3OA 4M2LA 4OP3A 1F12A 2B34A 2CNKA 1OT3A 2DFKB 1UDRA 2VT6A 3F1KA 4UNIA 4OB6A 4CQMD 2B61A 3FTFA 4I4NA 4MA4A 1L8QA 5HW0A 4P3YA 1S8FA 3ZK7A 4O1HA 1E7SA 1Z0ZA 2VRCA 2AG6A 4NDNE 3LKVA 2H00A 3FNQA 4Z1OA 3FWHA 1X7ZB 4LJ6A 2QSZA 3ECSA 1HKUA 3I5UA 4HH0A 2LP4Y 4TROA 1D7OA 3URKA 4B7ZA 2EKZA 4FR0A 2DF8A 4CM4B 1Q7CA 2H7XA 4WKOA 2C9CA 2Z3VA 5IF3A 5KAMA 1AH2A 5DM2A 1AF7A 2IYLD 1VYHA 1NNSA 2ISCA 4P3NA 2CV1A 4YJ2A 1EDZA 4O4HA 4DIKA 3HP7A 3GGCA 4QOSA 5IM5A 5EP2A 4DMHA 5JSKA 3CF2A 3MS2A 3UMFA 2WDPA 4JYBA 2PL9A 4KN6A 5AI6A 1H0KA 3N6XA 1FFYA 2BZ1A 4ZOBA 4JVNA 4LVNA 4LS3A 4F4JA 4ROSA 3TFWA 1RP7A 2GPBA 3CW9A 4YJHB 4DBVO 3TE7A 1ZUIA 1PJSA 1U90A 1K4KA 1S9DA 2CLOB 2XE6A 2XSZA 3OTWA 4L0QA 2YWRA 4C78A 2DXIA 4DR3B 4RA9A 4TYNA 3G1UA 4TMYA 1FNNA 3DDUA 3ICVA 4NE7A 4DJAA 1C14A 3I42A 1VP3A 1C4WA 3O4FA 5AVKA 3Q6IA 3U3OA 3DZHA 3WYBA 4OP2A 2WTUA 2M6SA 1ZAYA 2AHRA 1TQDA 3DKIA 5ER6A 3W3AD 2G09A 5BYKA 1KJQA 1QIHA 1EVQA 4JU9A 3QKUA 1CR2A 1WXIA 1RRMA 1DC3A 1U0SY 3A70A 4Y1FA 5C32A 4QM6A 2W2KB 1DX6A 4WK4B 4UCFA 4NENB 3WQQA 3HNOA 4DL9A 2PMCA 3W5HA 1RXIA 4ODIA 4O4IB 3K8YA 3BJRA 5C5DA 2GNPA 4X91A 5ALVA 3ZLVA 1Y3AA 3HY6A 5KYWA 3FZNA 1CB7A 3UWMA 3WMFA 3DTTA 1BCSA 2WVGA 1J5EB 4EM6A 1P8JA 3ZGYA 1Y5IA 2I4LA 2JK1A 1BRTA 1HL7A 3H9EO 4WNCA 4CM9A 4UQLA 2QW0X 1MAAA 1X1DA 3F2IA 5JFTA 3F3SA 1E2JA 1V2HE 4DT1A 2YINC 1XVUA 4B6RA 2TMYA 4QXMA 4Z4GA 2H4XA 2R1TB 3N1UA 3HDQA 3FLAA 3OFJA 3T9DA 4ZFNA 2VQ6A 1EX9A 1PT9A 1KH3A 4NTZA 4U6QA 2W6QA 3B13B 4EABA 5JMPA 3I9FA 4XM2A 3EH1A 3HP1A 1MT0A 2BBTA 1YQWA 1A5BB 4YCBA 4J0CA 3H4VA 1E2QA 1RTKA 4G09A 4IGEA 4O08A 1PR4A 3M6UA 4WBNA 3PNMA 1A8PA 3OQ6A 1Z7WA 3O8OA 3UB4A 4EPRA 4YJKA 3JSAA 1SBHA 1YQGA 2ZQ5A 3VVBA 4TRMA 3JR3A 4E5VA 5AVXA 2V6IA 5E4TA 5C8ZA 1AY0A 5KOHB 3SY8A 3WIDA 1N1DA 3L7JA 3TM4A 3WQBA 1MZPA 3EUFA 3WDSA 3CIFA 4X85A 4DSZA 1NMYA 3RC9A 4CN9A 3ME5A 3X43A 2GA9A 1AZWA 2NUPA 3OOSA 1TF7A 1N2CB 1QGAA 5IZ4A 4LK2A 4CHTA 5JAUA 4M0MA 2D8MA 3BRQA 2ZR9A 4Y2TA 1FDVA 2O8DA 3CSDA 5TMDA 4IQ0A 3ABRB 1HDOA 2HNKA 1X7DA 2VCEA 1WOYA 2NU7B 4FSHA 1MA3A 1W5FA 1Q2XA 3L4JA 4DUYB 2VJNA 3KV1A 5CVDA 1S7CA 4IDBA 5E1MA 4RTJA 1W5TA 4ZT7A 1GGFA 1B8OA 3EZ9A 4NP6A 4H7PA 4HXGA 4JC5A 4YAOA 1P1CA 3HPQA 3SNKA 4B6OA 1R5JA 4U6SA 3ZIAD 1O97D 1GSIA 5E0KB 2CF6A 4I6GA 4KWTA 4LOIA 1J20A 3D8UA 3E1GA 3GJYA 1NRXA 1VHQA 4IIEA 4TKLA 1VPLA 5BR1A 1WDMA 3U3JA 3OHMA 1CTQA 2R1UA 5FPYA 5JJIA 3BILA 1OX5A 2Z8ZA 3GP3A 3FD8A 3GRFA 3IV9A 1CUHA 3ZHSA 3LBAA 3Q8MA 1NVKA 4MUNA 2XRFA 3K2BA 1T9CA 3G2JA 5JH7B 3DZJA 1KOFA 3NBAA 2VN8A 4BEVA 2DBRA 2GN9A 3NHZA 1CQJA 4H1VA 4EA6A 1JSZA 1TXGA 2GZDA 1A5AB 1JDBB 2OZPA 3KPUA 4KXLA 1XMIA 4UHFA 1AKVA 1K06A 1XWIA 3GMSA 5AW3A 3A6LA 4Y6OA 2PGIA 4JOQA 4WZ6A 1D6MA 3EXHA 1J22A 2NVWA 1WX1A 4TPKA 4E09A 2FPOA 1KY4A 4LF8B 3HA7A 3LK6A 5BSEA 1JYFA 2VHQA 1QX4A 4FUQA 1G4HA 3DBVO 1G8FA 1PS8A 3PRHA 1J07A 4F6CA 1NSFA 1BGXT 3OZTA 4AJEA 3G88A 3WK5A 1JMKC 1UDCA 4OM7A 5JAIA 3KAPA 5ANRB 3GH1A 1USWA 5JZMA 1I80A 4MINA 3FHJA 3NOQA 2IU0A 5I7RA 3LZCA 5CDUA 2JLUA 4G5FA 2QG6A 1S2MA 2V7XA 4TQ9A 3RF6A 4EGFA 4LY0A 1BMTA 3IEMA 1Z22A 2NU6A 2AFRA 1I10A 2BRUA 3NFRA 5L3RA 2FP4B 3HI4A 5CBPB 2Y27A 1DU4A 1PX0A 2UDPA 4V1CA 1WV1A 1DO2A 5DGIA 2FEMA 4C3OB 4PG7A 3I9KA 3MBKA 3NTLA 4FBGA 2I1QA 5JD4A 1JIJA 3MGKA 3N6VA 4M8IA 2J3DA 5DWVA 1K5GA 1HT3A 3VISA 3OCJA 3DBLB 4RTSA 2GPWA 3TW8A 1LI4A 2JASA 2A1IA 3ICCA 3Q0IA 5G1OA 4CMGA 1PGNA 5FTKA 4BJHB 2OWDA 2RK4A 1KDOA 3RLFA 1W36C 4B48A 3SGLA 4N76A 3JQ9C 1ZMRA 1XFAA 3V4LA 2Q0SA 2GMWA 4HDSA 1N6IA 3N76A 3UHJA 5FFFA 2BGLA 2EARA 2O0LA 2Q3EA 4KKVA 2ESRA 5JWHA 3PJRA 3BJIC 1XCBA 4QQFA 2Q9AA 4RS4A 1P44A 3K5IA 3V1TC 4RV5A 1A2BA 3V1KA 1XZIA 2AV6A 3BL5A 4OUDA 4ECEA 1OFTA 3RREA 1I7DA 5AHKA 5KUTA 4YRNA 1WO8A 1DUIA 1O77A 1T2UA 1MB4A 2VPZA 2XUZA 5FTWA 3O74A 4GOLD 2A1TS 2R66A 2Z3WA 3ZY6A 1NMZA 4DV5B 1EFAA 5AM1A 2V4ZA 3LO5A 3HUEA 4W63A 5EIXA 2H1LA 2X14A 2EFCB 2O8FB 2E82A 3IPRA 2B4RO 3JASB 3PXBA 3RARA 3TRHA 5CHEA 3VZBA 2IF2A 3EXFA 3PUWA 3QEOA 1J56A 1XZDA 4HUQA 4JD5A 4Q3DA 2YWJA 1RM4A 1G2PA 2CHVA 3CNBA 4R3UC 4EBFA 3IQWA 4PO9A 4IF6A 2CZCA 5E3HA 3BWVA 3DMGA 1LRLA 4XKJA 4JYPA 4TTRA 4IINA 1GEGA 4RPLA 3F9CA 3I6MA 2HRCA 4HQOA 4MICA 1KAEA 2XF2A 5J43A 5KTKA 3C1OA 2N42A 3DL0A 5BPHA 2G06A 4TRNA 2HREA 1DEAA 2FZWA 3ZJVA 5FOXA 2W90A 5REQA 2FFAA 2WU3A 3CE9A 4US1R 3W3AH 4X1YA 5KVSA 3FFWA 4BNZA 2ZTUA 5JTTA 3FRJA 2HQBA 2NZ8A 3GLKA 1NIPA 4ECAA 5CXQA 1DWPA 3FPCA 1BXRB 1RQLA 2GTHA 4WBXC 3E35A 4YJDA 1ZH8A 3V4FA 4YX9A 3L4SO 1QJ4A 4MI1A 1V47A 2OHFA 1B8VA 2HRRA 1U81A 1A5ZA 1H5QA 1DMRA 1JALA 2ZYVX 3G8YA 6REQA 1XMQB 2ZZNA 2EX1A 4LTNA 3EDMA 3X1JA 4D4IA 2X9GA 2CMKA 2P91A 3G7SA 3A4YA 3QG1A 1SXQA 3VYRB 2AS0A 4G8CA 5EESA 4X61A 3RVKA 1G5TA 1UDAA 4ZI3A 1QQAA 4ON9A 1M75A 1IZ7A 2ZT8A 5F1YA 4AVYA 4CDNA 3OPYA 4XQGA 5MF6A 2BISA 1NATA 2VHYA 3MCUA 1GV0A 4MB0A 2PANA 4W5QA 1CNEA 2LKCA 2IPOA 2PGNA 5FBHA 3LY9A 2X15A 3R3WA 2FEXA 4AROA 3KT0A 4UJ3A 2XCQA 2G82A 4R2LA 1M10A 3PDJA 4ARIA 3Q9SA 2OQRA 4CKEB 3OM8A 1NVWQ 2P1RA 1LUAA 3KQWA 1DG1G 3WP1B 1Z74A 1Q0PA 2R4TA 1U4NA 3NOVA 3UC9A 3FKSA 5CG1A 2P27A 4UEOA 4DR7B 4WK0B 4LYYA 1DJNA 5IZCA 1CRLA 3HCPA 1GYPA 4YO7A 3RU3A 4K9DA 5LB4A 2PKXA 3C1AA 5JWOA 3R3UA 3MD9A 2IHZA 3KVVA 3NVDA 2ERYA 1MJ5A 3EZLA 1GOTA 1GG9A 2I2BA 4C05A 3MINB 3QPCA 4V3CA 4L7VA 5F7XA 4WZBB 3T9BA 5LQJA 5FR1A 1I0LA 5FJJA 4MVJG 1NW5A 2HA3A 1LLCA 1RLTA 1NJFA 1ZD3A 3AEXA 3L1JA 3OPXA 1J0EA 3DO5A 3EDRA 3DCNA 3HP4A 4X1IA 1RABA 4ZOCA 4WCDA 1RI4A 4PZYA 3TPCA 3BULA 1MC4A 3AHFA 3K05A 4WJZA 5KB3A 1YR6A 2MJLA 3K5HA 1JA1A 3AM3A 3RNLA 1DIAA 1QGUA 2OXTA 5H3LA 5E38A 1WKCA 3SIRA 3FOEC 1WR8A 4BZPA 4BPRA 2GN2A 5K8IA 3FSGD 1FRNA 2H54A 1AX9A 1N1MA 3OIUA 1UPXA 4JKOA 1DE0A 2NSLA 2RBEA 1AKRA 4FI3C 3TSAA 5A5VA 2OHHA 4CF4A 1I51A 2C95A 4RMIA 2ZSUA 4MR9A 1KP2A 1HDGO 3JAKA 1G5QA 2XT0A 5DYWA 1C30B 1CNMA 1WMFA 1Z0DA 4KYTA 4CBVA 3JD3A 4DDWA 1U9ZA 4WY8A 4M1OA 1LD3A 2XMBA 1PW7A 3IMFA 3VC3A 4E3ZA 1B3BA 3IP6A 3U2QA 4IKOA 1R18A 3EGDB 3ZHVA 2K6GA 2WM8A 1XZAA 3HFSA 1WD5A 2HJ9A 1HH4A 1K6JA 1YDHA 1TA4A 3EVDA 1EFTA 4B2YA 2QZ9A 1FVOA 1MMFB 3WYEA 3LDAA 1GQ2A 1NN5A 5GONA 1GL3A 1CQXA 2IU6A 1NXWA 1JHZA 3MT0A 4NCNA 3AF3A 4M0EA 2FDRA 2AJLI 3O82A 4OU5A 5SZIA 1PL8A 4MDFA 1A9PA 3Q85A 2GN1A 5EXXA 4XOIA 4YT8A 3CGGA 3DL7A 4NMMA 5KEIA 3IE1A 4N82A 1ODCA 2ZRJA 2I67A 2ZYHA 2NUAA 2XA2A 4GFDA 3KZOA 1FMJA 5G3ZA 1UPAA 3SIWA 1J39A 1ZJJA 5BW6B 3VRHA 4BP9A 3C39A 3RRBA 1UKCA 2XJ4A 3PTLA 2GD0A 2WZCA 4BN4A 4DV4B 1L5KA 3PYXA 2ST1A 2IE0A 1MEJA 2H9IA 4IHAA 3V1YA 3ZDQA 4IXDA 4TX1A 3PYLA 3CUYA 3OE7D 4RF2A 4YPVA 1RXEA 5DBIA 2OXCA 1HDRA 1Z5GA 1QOPB 1NX6A 2QJFA 2HIHA 2VHEA 3BRCA 1XNHA 3BXHA 2GDJA 1KMCA 2FVXA 3EGIA 4JT2A 1MG0A 4WXYB 4IHJA 3VSAA 5AKZA 4D8WA 3FAZA 3K70D 2QBYB 1IONA 3R44A 2OC4A 5JG7A 2DBVO 2VAMA 4EATA 4LF5B 4LSMA 4QVGA 2EF1A 1WVGA 2OBLA 3ANLA 4L5YA 3C98A 1A50B 4I66A 4OF4A 1P1IA 4QUHA 4ALJA 1HLPA 3CNNA 3N8GA 2OXRA 3M6MD 1GU7A 1FYWA 1FNBA 1NLYA 2HRZA 3GEEA 3QX7A 4HAIA 5JHGB 4WGFA 1YWGO 2JK0A 4NJMB 3KD3A 3KTFA 3TQTA 1GN8A 1X7YA 2HYIC 4IS2A 1DJPA 1CUVA 3QA3E 2PUFA 4G85A 4C4AA 5D5QA 3EXIB 3B89A 5BT9A 3T3NA 2D2FA 4W6ZA 4KN9S 1XAIA 3SHQA 2A9OA 3GRUA 5EL0A 4ZOQI 2VLIA 2EJUA 3ND5A 1I5RA 2HDWA 1A8QA 1XEWX 3GDFA 4GP7A 2MSNA 3ELUA 3ILVA 1VHDA 4R9NA 4ZOLB 4YONB 5C8VA 1BVHA 1IXKA 2Q3LA 4B3SB 4KR9A 3LU1A 5LLSA 1A4RA 4KYVA 1N3YA 1ICIA 1R4AA 4KAFA 3JSXA 4BYMA 4LF9B 2W0MA 2QD5A 1WUYA 2WTEA 4I2NA 4LOLA 4RNCA 4LZZA 4JQCA 3DDOA 4E15A 1BEEA 3H5NA 3IE2A 4YJFA 3VC2A 4F9TA 4LF7B 5D1NA 3FX2A 4W5OA 2PYIA 3DV2A 3F8TA 4KAXA 1FQWA 1NJ5A 3MB8A 1N7IA 4ISBA 4OFWA 2AYXA 2WJJA 4G26A 1J8YF 3EHDA 3G0OA 2RSLA 2JI8A 3FY4A 4H0NA 5B1EA 2GAAA 1ADCA 1Z28A 5CDSA 5KMGB 4I5GA 3DW1X 3EIEA 4P58A 1FX0A 2HB6A 1ISJA 3Q7TA 4QBKA 4QYSA 1NIJA 5EERA 5FB3A 2X0FA 1R9JA 4BVFA 3CLSC 3SXPA 5K3EA 1RRGA 1OZ0A 4Y6LA 1DARA 1L7AA 3KKZA 3NDPA 4AI6A 1E8MA 4I1VA 5F5LA 3M6IA 1RPTA 2FFBA 1Z3CA 4Q9LA 5D3MB 5AM5A 3X1DA 1JA0A 1Q17A 3OOEA 4NAHA 3ZCPA 3DLAA 3RS0A 3S2FA 3V42A 4ZMBA 2RD2A 4XDHA 2OV2A 1RIFA 1Y8QA 3NJ8A 3BMQB 5KYXB 5J2UB 1IY1A 3N75A 1S8AA 4CM7A 2YJ5A 3G5LA 3SZUA 2OSBA 1ODFA 2BEUA 2Z4RA 2AN3A 2GB4A 4X8LA 3WDLA 1QOQB 1U8ZA 5EP1A 2JGMA 1KS9A 5DHRA 2H4FA 4BLOA 2CV2A 3NXSA 4WINA 5DN6A 3UZUA 2IYZA 4UFPA 2A9PA 4RW0A 2FF5A 1WM1A 1PZFA 1R0BA 3D59A 2RIPA 5T6MA 4BNDB 2EZTA 3I2IA 1CE8A 2Q2OA 1MIOA 4UM7A 2DP4E 4L4YA 1NRJB 2J32A 3V8QA 1ULUA 2V7QA 4GQBA 3CR3C 4KZPA 5FV7A 5LU9A 2PUDA 2O2SA 1GG5A 4B4DA 4JX8A 3ZS8A 4EITA 1KYVA 3WGQA 1RCTE 4HLNA 4JJ7A 1FCJA 3RU7A 1EZZA 4B35A 1B8NA 2FX3A 4I4LA 4PLGA 4F11A 1Y6RA 1J33A 1XL0A 2CMDA 3ZDYB 5JY1A 5L3SA 3E7DA 1TMGE 4XSGA 4RJTA 5ITZA 4ESEA 5IDQA 3CSSA 4GPD1 4UHJA 3N2GA 1RYHA 2VCHA 1Q0ZA 1HYQA 5D3QA 1XU4A 1UPCA 4OTZA 5J4HA 1JTVA 1K2WA 1ZOIA 2YRWA 1F9EA 1RWVA 4B40A 1XA4A 4FR5A 1CY6A 3CZ9A 3UV6A 4L85A 4PHGA 4BNYA 1RXWA 2P9TA 2XUIA 4LI0A 5AI4A 5JC8A 3DQQA 3TQQA 3OZSA 2A7XA 3AV0B 3SBXA 2VP0A 1CZLA 3BN3A 2PWPA 4QTTB 4S0XA 4IZOA 3MT8A 1I3MA 1U9IA 5ECWA 2BYTA 3ZCSA 2V98A 2YUIA 1P5JA 3NM6B 3WLRA 1HOTA 2A8YA 4BMDA 2E5WA 4CKWB 4X6XA 4ZQCB 1E1NA 1L9XA 1AMNA 1GRQA 1OYVA 4I46A 2GZAA 2NSJA 1L6IA 3TEFA 3U4HA 4FYXA 5JD3A 3BEDA 5J4VA 2AR0A 1A77A 1KIMA 1C7JA 1TJYA 5F4BA 5YASA 3ZWNA 3H87A 1IYZA 3Q5EA 5T8KA 3PV0A 1LLDA 1R66A 2GCOB 3HV2A 3QOFA 5LJLA 3DZKA 2GJAA 1IB0A 2PT6A 2WF5A 4FFMA 3B9QA 3E4DA 2X5JO 1N2OA 4JYZA 3AU8A 3GEPA 4N54A 2R60A 1NP3A 5EINA 3D1JA 3HB5X 4L5BA 4NCKA 4B3RB 3VJRA 1TEZA 2WNHA 1JVSA 2RFLA 3WDKA 2VWPA 5DNCA 1LU9A 1QKIA 1AO3A 4LSZA 4R8MA 5BSTA 3IT2A 2VUSA 3UUWA 3IURA 1Q50A 3DTVB 3HLTA 1T2DA 2LIVA 4GSLA 3SKYA 3ZZTA 3CVVA 1UWKA 2ZE7A 1WQ4A 3LQ1A 4U2KA 4YCDA 5DDIP 4JL6A 3U9LA 1V3QE 3ODPA 1XQWA 4BQIA 1ENOA 1P91A 2W98A 4BO6A 5EIFA 1VYUA 2FDXA 2H0QA 3B3QA 1M2OB 1D6NA 3LRTA 5BN1A 5LUBA 4B3TB 4W9NA 3ZQ4A 2G36A 2QIOA 2BMDA 2BKXA 2KW5A 3K09A 3L6RA 4IP0A 1CZRA 1QYCA 1Q91A 4DUGA 3DKRA 4TWZA 3OT1A 2VQSA 2PX3A 2IEIA 3AJAA 3R9KA 4J0JA 1QIIA 2DTEA 3S8MA 3T5PA 3PBKA 1OH7A 2Z6AA 1JR3D 4JSRA 2IYQA 2J4DA 1C3VA 3E84A 3VPSA 1R00A 2CB0A 1Q3KA 1VE3A 1QANA 2ZJ8A 3AF0A 3VJKA 4PICA 5A0TA 4FCCA 4ZYUA 3QKTA 1ZVMA 1R4ZA 5KOJB 1OQAA 1II8A 2PKRA 1K9SA 1KYXA 1NRWA 1NXQA 1S9HA 3HR8A 1K98A 4G4GA 4ZYZA 4OJYA 4HB0A 2C82A 1TA9A 4Q7MB 2Y1FA 1US8B 4GO1A 5BUSA 4RGBA 4F38A 2P2YA 4D5GA 1BO6A 5T7BA 1C1HA 2DLNA 3OT5A 2H5JA 1MGPA 3B9PA 4GLOA 1JMYA 3JW8A 2LBPA 2K2WA 5BSHA 3MWGA 3DE4X 1ITZA 4RPJA 2Q29A 5F35A 2FSUA 3FGPA 2I3ZA 2JAOA 5AVSA 3PPVA 3LYAA 1ZSVA 1DXYA 2XYVA 3OBBA 1UJ2A 2GTPA 2H29A 4IJVA 1DIBA 1X80B 4AD8A 4DBLC 2FZLA 1R37A 3M49A 1TRKA 2A30A 1AK1A 4EW2A 2ZUFA 5TRTA 1G7SA 4LYAA 1W5BA 3H19A 3W4KA 4Z51A 5FEUA 3ELDA 4DPMA 4BEWA 5C3UA 5A1TA 5BMOA 4QGGA 2Z57A 3ETJA 4F46A 3WL8A 3RG8A 4IDQA 2MSKA 5P21A 1NF2A 3K92A 4AQDA 4G0XA 1SXGA 2P90A 3IVAA 4QJ5A 2IS4A 3AUAA 3AFNA 5CCBA 2BSQA 2H57A 5JXHA 2UAGA 3KC2A 1YAJA 4MS4B 1QQBA 3QXHA 1WZNA 3FPFA 1IPFA 1VJCA 3KQMA 4QT0A 2ORED 5GWXA 4Q9KA 1R0CA 2H4ZA 4Q6BA 1IZ0A 5DMHA 4X84A 4DWVA 5JZ9A 1VJ1A 2AI3A 4RPHA 3I0ZA 4XA8A 1RI1A 1GPDG 4KUGA 4Y9RA 1P5HA 3AUFA 2YTZA 3GFGA 3K2IA 1EMDA 3PXAA 2YZGA 3DP7A 4RK7A 4ZPXA 5ICFA 3UXMA 2WJIA 4M1YA 4EB6B 3GHHA 4PSAA 5IFLA 5JQGA 1BWQA 2YYSA 2YV2A 4HJRA 3LHSA 4V24A 3UT5A 4IJMA 3TSZA 2VBCA 3R3XA 4FEAA 3ZZMA 4BKQA 5JNRA 2MYPA 3A3PA 3LUJA 1NDHA 4YJGB 5CA0F 3MCTA 1IN5A 2ZW9A 4N0PA 3MB5A 1XRNA 3B6KA 4CMEA 3BBPA 3KLPX 4LXGA 2DSNA 3DMFA 3UT6A 3KYDA 5AXCA 4QPZA 3A1EA 1X77A 3N2EA 4JNCA 5EE5B 5BQPA 2QNRA 1F0NA 2VWHA 3CY6A 3QBDA 5DMXA 4MHSA 1ZNXA 4IL5A 2QRNA 3LT5A 2W48A 2ZRFA 1NUPA 5K09A 3IDQA 1UMDB 3LCUA 1YDWA 4MYCA 3EGXA 5HA5A 5A03A 4O1MA 2IFTA 1YCHA 2HW8A 1YJ5A 1W87A 2IPNA 2HRBA 3HRKA 1WHSB 2B1IA 2OFOA 4K9KA 1AZTA 4MVXA 1CF4A 2L0XA 4K46A 3B78A 5KTNA 1SJ9A 4RV4A 4KQCA 7YASA 4LG1A 4GPAA 4OHOA 2Q3DA 3BWBA 1SOAA 5GJVC 2J3MA 1LQTA 4MR7A 1MFPA 5ILGA 3UG6A 4F9FA 4JXZA 2Y76A 4S12A 4YXWD 5JS2A 4BQQA 1GPNA 3GNTA 3H4IA 4R8LA 1HQCA 1DG9A 1WPRA 1USKA 1W76A 3FR7A 3EEFA 4LRUA 4AG5A 2C2BA 3RU2A 5I45A 3L6OO 4HTFB 4A9AA 4KRFA 3LGAA 3E15A 3P0FA 1Y1TA 1AUOA 1J8VA 4I1YA 5DTMA 5CUQA 3OHPA 4KO4S 3WMGA 4AMGA 2VP4A 4GECA 5ALTA 1RXSA 1W7AA 1EFCA 2XUGA 3FMVA 3G2KA 4ND8B 4ASUD 2G70A 4BAGA 3SD7A 1NXXA 3G9QA 2QX8A 3AR6A 3ITNA 2P6RA 2PD6A 3I5MA 1FUEA 2FRXA 3GY0A 4FI3F 2B8WA 1U7DA 2B21A 2PSDA 3BX1A 1RFLA 3DMTA 5F1KA 1NPYA 5CVJA 3UW1A 3WOHA 4AMYA 5HK9A 2DETA 3N7TA 1DIGA 1UXIA 2WMDA 3ROXA 4NWIA 1C3JA 4DM7A 1LCIA 3ESDA 1FRVA 5C7LO 5I8PA 2HMVA 2IQIA 3D43A 4O0LA 5JECA 3PWZA 1OJ7A 1OKKA 1KJNA 2GZRA 2WINI 1QH1B 1RJGA 1DTWA 3HB7A 2P5UA 3VOSA 1M0WA 2WTXA 2ETVA 4QJBA 3T1QA 8GPBA 1TDJA 4KH1A 4Q7EA 4U8HA 3IBTA 4XLLA 1YXMA 4YEDA 4DIBA 1M1XB 1P72A 3IUMA 3CZ4A 3VR5A 1UPUA 5CA0A 3KDSE 4RNDB 1QAMA 2R6JA 4IRXA 5HXAA 5I7OA 1M2NA 1ZA2A 1RM5A 3AFHA 2IZOA 4LCJA 1LX7A 3CJQA 2C83A 4IDNA 1ZVQA 1JF8A 1Z5NA 3M5WA 4GKBA 2W6JD 1TVEA 3OBIA 2F48A 1KNQA 1YHZA 3O0DA 5ELLA 1E0DA 2WAYA 3WV5A 1R4MB 2G71A 3ISVA 1MJGM 3OD5A 1C2YA 4ZRMA 3CX3A 1M73E 1ZAKA 1Y1SA 2XUDA 2I4IA 1D4OA 2VYCA 4EY6A 1PUIA 5D85A 1NSTA 2WPDA 3ZV6A 2OZLB 3OZCA 4D25A 5FUQA 5I51A 3KB1A 2IBTA 4IFEA 2JRLA 3A1TA 4O29A 4KR6A 3P1JA 1XXHE 2RHTA 3U4MA 1BVUA 1Q1AA 2H1CA 2IHJA 2QTLA 3E53A 2JIDA 1L7MA 1VGQA 4XWYA 3GA5A 3SHVA 3LPMA 2XMSA 3FA2A 2RGNA 4E5KA 1A9YA 4C7OB 2UXCB 2KPOA 2XZPA 2FF7A 3Q5DA 4YWJA 3VPXA 5FOSA 1OA0A 3NTUA 1H85A 3GGOA 4WGGA 1KYZA 2BMJA 1IWPB 4BVLA 2PL1A 3EF0A 2PZFA 3NP9A 1XCGB 2AVNA 4W7SA 3FDIA 1Q0RA 1CQIA 3F6BX 4HH3C 4RGVA 4M1MA 1IXYA 1I6KA 3B7GA 1SELA 1XD9A 2GAFA 1M2VB 3O8NA 1XD2A 2DJ5A 4V03A 1KZ1A 4LZLA 1LKZA 2I99A 4PNZA 5JADA 3JWGA 4L74A 2TSYB 3ANYB 1PL6A 3IC5A 4JMLA 3DUFB 1MKYA 5ULLA 4LVOA 3IEKA 3FVVA 3K5WA 4HWPA 4GI2A 2GYWA 4EQZA 1VMDA 4OATA 1U98A 4ACAA 3F97A 1QXSA 1W85A 3FI0A 4KVZA 2QRPA 4HY3A 2IOHA 1UXKA 1ND5A 4LRTB 4KO1S 3EIQA 3S3TA 4K9NA 1Y8AA 5FA6A 3RFUA 2J46A 3FGNA 2YRFA 1XG5A 2P2SA 3T5CA 1XZGA 2HKIA 2YXNA 3U09A 1UL1X 2AN1A 1Z47A 1VLQA 3PC7A 1QR6A 2Z2JA 1OBCA 3B20A 3QUTA 1NVVQ 3VHXA 3GRKA 4Q1CA 3JVEA 4QAQA 3A9VA 3UMCA 5A3JA 1P8AA 3FIUA 1U3GA 4MVWA 1HG1A 3OU7A 5EI5A 3WGHA 2PX2A 8ATCA 1MU0A 2FG7C 4R3WA 3WMEA 4EWLA 5BW4A 1LH0A 3T7KA 4YAJA 2JJ8A 3UUGA 2GK3A 1EG2A 1GUZA 1Z0KA 1H94A 1D0IA 2P77A 2BFBA 3I04M 4JFAA 3OEWA 1HDYA 4GIBA 5F78A 3G8AA 2D3TA 1OVGA 2X6QA 1RTTA 1E9FA 1ULHA 2ZM5A 1LJUA 2QPLA 5GY7A 4RTLA 3S70A 3KLMX 5A5DA 4FFLA 3Q3CA 1V6AA 3FCXA 4WLNA 5C5CA 1U5BA 3VR1A 3UAOA 2GO1A 5BYAA 2X9VA 3LLVA 3PUIA 1QQ6A 4JEIA 2R8RA 1AUVA 4NR0A 3FOAA 4P84A 3VDMA 4C76A 2XMZA 4U7FA 1V9SA 2FZGA 4G67A 4YYEA 2RBKA 4R0NA 1D1PA 4WZZA 2OCBA 1BVYF 2FN9A 3PC8C 4WK6A 3BYZA 4MI3A 5AHOA 1WDKA 1JBKA 5FHRA 1JVNA 3KJIA 3Q2OA 3G89A 3KB6A 3T34A 1E0AA 4MB6A 3JTEA 3MERA 2BFEB 1TM5E 2SECE 4H7DA 3AY0A 4P82A 3QPBA 2OBBA 4KMSA 1ECFA 2C9OA 2MYUA 1H2RS 3H8JA 1WZ2A 3S2YA 2BBWA 1QONA 2YZKA 4LKRA 2YIMA 5C81A 1O3YA 1ZD4A 1WXEA 1K97A 2ZETA 1P1FA 3R5XA 4RVDA 5JFOA 5K3OA 1IJEA 1G291 1X0VA 1Y42X 4QJIA 3V46A 1VE1A 4ENUA 5K6RA 3C16C 3ZDCA 3FYTA 2VHWA 1BXKA 1SHJA 2WHRA 1J0XO 3CUWA 4HNTA 5FWNA 4RVHA 3W90A 1YHNA 2I6XA 2QJOA 4K0KB 4AZVA 1QMPA 3VMMA 5FNZA 1QIJA 1FPMA 1A71A 3FYSA 4ITVA 3BOSA 3ODGA 3B52X 1E0SA 2BPOA 3UW3A 2C5LA 4A0GA 5CK4A 1MC1A 2BEWB 3HM9A 1DB3A 1F3OA 1TMOA 2AZXA 1YQTA 3BBLA 2DM6A 3A4LA 4GI1A 4RQUA 3RS7A 5LYJF 3A0RB 3LNCA 3AQIA 4R2WA 4D8VA 4FMCB 9LDBA 3H8SA 2J31A 4ND6A 4HNQA 4AMUA 1R6UA 1CR1A 4UOZA 4UEKA 2UZ1B 1WCWA 3SLGA 5HRAA 1TI7A 1TUBA 4H0CA 4U7HA 3ZQUA 3I6QA 3RSQA 3B60A 2FLVA 3UPDA 1O6GA 2D5BA 4ZAXA 1GDTA 4X94A 1ZJ6A 4ZJUA 1E5VA 4OQQA 3X1ZA 1JIQA 5IHPA 1GQSA 1B00A 2OV3A 3C0KA 3Q7IA 1QB7A 1LZKA 1KJ8A 3GLFA 1GV1A 3E1KA 4UBJA 2A0KA 3MWYW 3QVTA 1ACJA 1N0WA 1R3DA 2ZRGA 3F67A 1UZAA 4UXJA 1R0KA 3S99A 2V9CA 3CVOA 5C51B 2FUG1 3AVWA 2ZSJA 1LSSA 1W19A 5K8LA 1G20E 2V0NA 2WT9A 4XPIB 1O95C 2VYVA 2BHTA 4PPGA 2JNWA 3ZGLA 3Q15C 4BRUA 2IPAB 4LHEA 4EELA 5AIAA 4OJTA 3IPYA 2PSEA 3DMRA 4Q4LA 3EX7C 1UKYA 4GMHA 3PEYA 4IUDS 1DQRA 3N0VA 3ZHYA 2NXJA 3TH5A 1XKLA 4LF4B 5U1PA 4ZI7B 3PE3A 4RM3A 4KL8S 4C43A 4OLAA 4DTIA 4TKMA 1E7YA 3RWOA 2P6MA 1SZCA 1PT5A 4IIJA 121PA 5EY5B 2JHGA 2WKPA 1I4DD 2B1QA 1NBEA 1VJ5A 2O7NA 2QRMA 4FQ5A 4OOFA 5A4AA 3UMVA 3X3HA 2ORIA 4FGSA 3U3ZA 1SBQA 4CFSA 5K7SA 5GVSA 2SCUA 4P93A 5JYBA 1Z3IX 1I2CA 3OESA 4F1KA 2DBZA 1TM1E 3T3DA 3THSA 2DULA 5G0UA 2J7PD 3PQ6A 3P0IA 4Q12A 3TLXA 1OI2A 1PHRA 2P6PA 4W5WA 3VU8A 1JEOA 1M7BA 1II9A 4WT7A 1IHPA 2F3SA 3OCYA 3PUJA 2VF4X 2R751 1XKQA 1TOAA 2QTFA 2W6IA 3RG2A 5DCLA 4AMZA 1PEKE 2W2QA 4RJ2A 1GSAA 2Q2VA 3NTVA 3MVEA 3UH0A 1IVYA 4M9SA 5GOZA 3TNFA 4PCVA 1U0RA 4BKPA 5JSUA 3USCS 1NBAA 4GZ5A 2I7XA 1HZZC 1YZ3A 4OK6A 3LP5A 1N6KA 2FPIA 3V7UA 4WLUA 4PSDA 4C22A 1QCDA 1U7WA 3L6UA 3QI7A 2GSDA 1HSZA 2A9RA 3JZDA 4YRCA 4M87A 3AR4A 4DXAA 4U6NA 3ANTA 1DX4A 4FILA 4KXMA 5KYGA 5HKBA 2ZEJA 5FPTA 4AY2A 2R7AA 4U2GA 1ZOLA 1OYYA 2QZPA 3QKSB 3I9JA 4IUBS 4X8OA 3QWHA 1ZJ5A 1HE3A 5A6VA 5HVNA 1KY3A 2YJNA 1N2ZA 3AI2A 3CUTA 3JPWA 4RELA 4WLVA 3CH6A 1B6TA 3KEGA 3Q72A 3RBVA 3WJ1A 1ECPA 4MR8B 1NTOA 3F7MA 4H7FA 2ZPTX 2OZKA 1WBJB 3D6MA 5IK2A 1E5DA 1P1HA 2UUAB 2F43A 5I7SA 4D9FA 4DR5B 2XYRA 1WCXA 1SXJB 1H4QA 1XZKA 2I4TA 1U8AA 4ZEVA 5HDQA 4DBLE 1FLNA 2XOXA 1OU4A 4I4TF 3WR5A 3GVIA 1P2SA 1QV7A 1VSQA 2FZEA 2Z9BA 3DXYA 4IDHA 4OFZA 1C1XB 4OQYA 3PUYA 3KQUA 1XA0A 3HGMA 3EBLA 1M72A 4UQOA 2C94A 3AEKB 2X2FA 3PQ5A 5A4KA 2PEZA 3DJYA 4Z7OB 4G25A 3CLTD 4KUEA 4ZJYA 4IGKA 1F38A 2D1QA 2NTNA 4F3TA 1Y80A 1WXGA 4C6TB 1FNSA 1YO6A 1O2DA 3EH2A 4P32A 5IW8A 1SD2A 2FZKA 1P61B 2WSSA 5DU2A 4E31A 1Y5RA 4EH1A 1OLXA 2G1KA 4DLAA 2H1OA 2OFXA 5FBWB 2PHZA 4B33A 3NHPA 3PC3A 2JS7A 2O2CA 3K1JA 1P6XA 1UEIA 4H3VA 5DGTA 5FFNA 3O38A 3DQZA 1U0EA 1JEYA 4E46A 5JT1A 1YAHA 1YL7A 2ZROA 2EFYA 3PFWO 2KS6A 3EGOA 1EDEA 3AM4A 4D92A 1KTVA 3M4ZA 1IWBB 3TLCA 2ODAA 1FEZA 1YGPA 4OAPA 3HBMA 3NLLA 2IK8A 2Q7OE 2ZJAA 3DJFA 4KXNA 4GRIA 5L8VA 4QYIA 3KYCB 5DHUA 3EGVA 4LXXA 4GSYA 3U40A 3MA0A 3Q98A 2OY0A 3DG9A 2AG8A 4TV9F 1IUKA 1NOJA 4IZ6A 4Q47A 3K5PA 5ALUA 5LXTF 2HV8A 2XF8A 5HCUA 2XYGA 4HZIA 5ERYA 2OZVA 7MDHA 5AI5A 1JHUA 4FYKA 4GWLA 4HH1A 1DHTA 3FM9A 1CQPA 5H59A 4JZKA 3OEHD 4BNUA 5JO0A 4L0DA 2P7HA 1NF3A 4HPXB 2I1LA 4X6LA 1VIVA 3L49A 1DQYA 3IP5A 4UMVA 1TM4E 1ISRA 1PT6A 3UK6A 1KU0A 1QCZA 1U1CA 3DULA 2WNIA 3K4HA 4FFVA 1HLFA 4V3BA 5KYKA 3BWYA 5B3JA 1CRPA 5C1BA 3EDOA 4C2UA 2W8BA 1EB8A 1GQFA 1WS6A 2FFJA 3LW8A 2Q27A 1K92A 2HXYA 1BS2A 4QBGB 1XDWA 3HSKA 3I2FA 1XUOA 4IVQA 4KJZA 5CX4A 4BBPA 4RULA 3HYTA 4ZV4A 4PX9A 1UFKA 2QUKA 3B53X 3E5RA 3VV3A 1Z06A 2QR3A 4PPFA 4Q48A 4CVNA 2CVZA 3WQRA 2VDRB 2ZU6A