3HDQA

Crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
total genus 114
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdqA01
1ZFNA 2PZLA 5A9TA 2OMEA 3L07A 2ZTUA 3AWDA 1WW8A 1QV7A 2DC1A 1YS4A 4AJLA 1MP0A 2PKQP 3HDYA 2QIOA 1HDOA 4FOSA 4NZ9A 2IODA 2VTEA 1A72A 1T2EA 4PCVA 3JD0A 3W8EA 1T1SA 4LMPA 1Q0HA 3OJ0A 4Y98A 1A9ZA 2PWZA 2FPGA 2GNAA 3QV1A 2GLXA 3CTMA 4BNUA 1U8FO 4CUKA 1WWKA 3CINA 3TN7A 3F5QA 3IP3A 4BO7A 3H9EO 1MV8A 2C0CA 4PZCA 5JYEA 5CDYA 1I2BA 4R1TA 2YDXA 3FPLA 4J43A 2D2IA 4AJKA 4B7CA 3FR7A 4YQYA 3QJ5A 3EMKA 3RFVA 4CM9D 4Z0PA 2Q2QA 4IDAA 4R1NA 3TNLA 4ID9A 2B4QA 4KZPA 2OZPA 4J7XA 1U4SA 3ITDA 5AVOA 1ISJA 4WGGA 1BWSA 3M2PA 1IULA 2BHLA 5L53A 4FFMA 4MVJE 3X2FA 4NFYA 4J0EA 5JMPA 2Q3EA 4R41A 4UVHA 1IZ0A 1ZSYA 3FWNA 3MEQA 2R00A 4UVEA 1JTVA 4XJTA 3WJAA 1YL5A 3F3SA 2P91A 5JO0A 3WGIA 5JC1A 3Q9NA 1M6HA 1JU9A 4RPGA 3HQ4O 4YR9A 3ZWAA 3INRA 4H16A 2FR8A 4M1QA 4CMEC 1A7KA 3PJDA 3QE3A 5T57A 3B1KA 4BNZA 2YY7A 3GDOA 1NPTO 4GBJA 4NI5A 4Z9XA 4CLOB 4WCFB 2JCYA 3PZBA 1QMGA 3A28A 4XYMA 4JJFA 3RQSA 4BKOA 5IZCA 1DB3A 2BFPA 1V3UA 3DZBA 3WGTA 4XR9A 1ADBA 1MLDA 3EVTA 4NK4A 1LI4A 4O1MA 1BW9B 4TZTA 4WCFC 4O59O 4MO2A 3NUGA 4FFNA 4GVLA 3U49A 2V7PA 3L6DA 1KC1A 2XAAA 3JQGB 3UICA 2VUSA 3ZU5A 3KBOA 3ZW9A 5F1KA 3I6QA 4EUHA 1N92A 3N58A 2XOXA 2VYND 1DC6A 1ZKMA 5G4KB 3CPSA 3GNTA 3S8MA 4FD3A 4PLVA 3ZGYA 2W2KB 1W0CA 1E6UA 3GFBA 1H2BA 1ULUA 2VRBA 1UZNA 1SZJG 1GPDG 1JWAB 1PJQA 3RD5A 2QHXA 3GAZA 4PLCA 4TKLA 4TRJA 3RKUA 3HB5X 3HSKA 3PHIA 4AJOA 3DXFA 2AG8A 2AQ8A 1HE3A 4EJ0A 4ZVVA 3OIFA 4LCEA 2GDZA 4DREA 4I08A 4BV8A 2AE1A 3W6ZA 5A4DA 3DONA 3FBTA 5JDCA 2E49A 5ICMA 1HYGA 4ZU3A 5TLSA 3BMQB 3EVNA 2AQKA 4I5EA 3SC6A 4TWRA 1ZMTA 4BO6A 4XYLA 1CJCA 1PJBA 4LVCA 3ABIA 2X0NA 3RI3A 1I24A 3EZLA 4R9RA 4PZEA 2VOEA 1RPNA 5JO9A 5TJHA 5HWSA 1I36A 1ONNA 1X14A 3EC7A 3PIIA 2Y1CA 5IZ4A 1Y8RA 4CLRA 3JQ7A 2JL1A 2H6EA 2CFCA 1E3IA 3GLQA 1QYDA 2B83A 2Z5LA 2ZB4A 4FPXA 3ZNPA 1Z6ZA 4KWIA 3LQFA 1RM5A 3BYZA 4MIEA 2NQ8A 3KSZO 4Z0TA 4CMHA 4FB5A 2HK7A 3HFSA 3JQAA 1YB1A 3K96A 1OBFO 2Q99A 4CLXA 4CODB 4EJMA 3H9JA 1LX6A 2J6IA 4ZQHA 3TZ6A 1LLQA 2HDHA 4LRSB 2CDAA 3G1UA 2PGJA 5JFOA 4CV0A 3ROPA 3ZNOA 4M87A 4FW8A 1E7RA 1XQ6A 5K9ZA 3KHUA 5L7YA 1YKFA 1ZW1A 2PFGA 4BMNA 4DWVA 4TVOA 3DOCA 3T7EA 4J9VA 5ENDA 2X0RA 4DVJA 3SEFA 3NDRA 2ZTLA 4ALNA 5C7IO 3LSYA 3AFNA 1HEUA 1YB5A 2Y99A 3E5MA 3LLVA 3Q3CA 5TIIA 2GZ3A 2WYVA 1E6EA 5I7SA 4Q3NA 1EFKA 4RF3A 1BXGA 2NADA 1PZFA 5TJ9A 4E5YA 2NVWA 2ILTA 3O03A 4L76A 5KKCA 3EZYA 1ID1A 4XDZA 3BMOA 5IXYA 4GX2A 5MGBA 1WDLA 1ZCJA 4NQZA 4ONEA 5EPOA 1IL0A 3PVZA 4EITA 5IJZA 4CLOA 5A3JA 4ALLA 4YAKA 1JWBB 3CH6A 3RJ9A 3WG9A 2CDCA 4A7PA 4S3MA 1XQ1A 2HQ1A 2X7HA 4FGSA 4CMIA 2AE2A 4I9UA 1Z75A 3C7CB 1A9YA 3TFOA 3A9WA 1LJ8A 3KLMX 1UJMA 3HB4X 1S6YA 3H9UA 2TMDA 5C7OO 2I5PO 1BW9A 4MKXA 1X1EA 3N74A 3FHLA 3D5QA 4UULA 4BNNA 1EDOA 3DBVO 4HKTA 2EHDA 4CMCA 3V2HA 3OJOA 2VT2A 1KEPA 4HFNA 4DXHA 2I76A 3NYWA 5DT9A 3WLEA 2EJVA 4D3FA 3GG2A 2FPIA 5TNXA 1P1IA 4I1IA 3QVOA 5BSGA 2FN7A 2G17A 4IQGA 1BGVA 1K2WA 2PY6A 3DZJA 1E77A 1OI7A 3LC2O 3B6ZA 1OZAA 3AOEA 3VZQA 4BIIA 5HM8A 4W99A 4CV2A 3ZNQA 1NQOA 3C7AA 1U8XX 4MDHA 3U5TA 1M75A 1YXMA 3FPCA 3ZV6A 5G4LA 5CG1A 3WTBA 1D7OA 4MIYA 1PWZA 1QYXA 4FIZA 3OA0A 4YJDA 1IHXA 5U4QA 4JXKA 1LC3A 2WE8A 1JW9B 4NIMA 4QQRA 4UVGA 3QA9A 2V65A 1YH3A 1I8TA 4CLDA 1QSGA 1AN9A 1B26A 2O2SA 3PHHA 3QVXA 4FCCA 2C20A 4J49A 1GPJA 2V6BA 3WGOA 1EEHA 1BVUA 1W73A 4BMVA 3UKOA 1MX3A 4ND1A 5DDIP 1U2DA 5A04A 1RWBA 2JAPA 3WQRA 4O0LA 4TVBA 2O3QA 3KV3O 3O38A 2UUPA 4AJNA 3GUYA 4GL4A 1GU7A 3VDRA 5A9SA 3AJRA 5IN5A 3CKYA 3U9LA 1ZH8A 3D1LA 3WWYA 1EBUA 4RO0A 2O3RA 2G5CA 3L4BC 2HUNA 2XXJA 3S2IA 3VHRA 1GUZA 3TJRA 3VZPA 3WIEA 2Q4EA 2X9NA 5AXDA 3D3WB 4MKRA 3WGGA 5KWEA 3K92A 3IAHA 2W90A 4RPHA 5AXAA 4U6QA 4KTTE 4XYBA 3UN1A 1W8DA 4J6FA 3OECA 4CQLA 1ZSVA 2HCTA 2DM6A 5ICSA 4FJ2A 4GPD1 4YCAA 4M55A 3BHMA 3OSUA 2VCYA 1IE3A 4BNTA 4DQXA 1Y9AA 4AJ2A 3M1LA 5A1TA 3WGYA 3WSWA 1EMDA 1F12A 2YHIA 4J91A 2DBZA 4FQ8A 2VWQA 1EE9A 2WYUA 4K26A 1IHYA 2B4TO 5JAQA 4W9NA 3EK2A 3JYPA 1UXGA 2VHZA 3IKTA 3FTPA 5B4TA 3G3EA 4Z0HO 1XLTA 3K2BA 3DDNA 3MTJA 2A94A 5TSDA 2W8ZA 4BO1A 2VN8A 4JP2A 4YJHB 2Y0CA 2Z1NA 3JQ9C 4YRAA 1LU9A 4RV9A 1R66A 2P5UA 3N7UA 3C85A 4NDNE 2BF7A 5GMOA 1U3UA 1DLIA 1MXFA 4TROA 1DRWA 3FBGA 4CM8B 2IDZA 2ZB8A 3GQVA 4OJNA 4YYZA 4FFRA 5L4SA 3DBHB 1JKFA 2C54A 3JYOA 4HP8A 4DIBA 3D4PA 2Y67A 5L7WA 2RBEA 1TI7A 4RF2A 3JQFC 3Q9UA 4CV3A 1DIRA 3BMNA 5HTOA 3STHA 2C5EA 3Q1LA 3I9OA 2X5JO 2D8AA 4IDBA 4UUNA 2EV9A 3JQBA 1NPDA 4A03A 5EN4A 2JCXA 3S2GA 2YQ5A 4UUMA 5JLAA 3R3SA 1JKIA 1HLDA 4W4TA 4RL6A 3KYBA 2BELA 1RYEA 3TZHA 5FYDA 5JCXA 2FHSA 3ONEA 4JBGA 2HAEA 4GLOA 4AG3A 2GN6A 1NQTA 1QP8A 1BTOA 4CMAA 5KJ6A 1B0AA 4GWGA 4Z3KA 5T8KA 1IB6A 1N2SA 4S1VA 4EBFA 1HXHA 3U4IA 2UYYA 3INTA 1MB4A 3VPXA 2BGLA 3GN1A 5EQFA 1AGNA 1Y7TA 3WFJA 4A0SA 2IZ0A 1U4OA 1ONPA 4IQ0A 4XX0A 1A4UA 5TX7A 4E3ZA 4ZHSA 1HDCA 3RVDA 1GYQA 1HZJA 4R3NA 1B3RA 3ST7A 4D0RA 1DEHA 1K89A 4JCOA 5G0UA 1DAOA 1DC3A 1U28A 3PTZA 4URFA 3UXYA 1HF3A 1DXYA 1C14A 4YA6A 4RCVA 3AY7A 2ZQZA 3RJ5A 4CV1A 5I8WA 4D44A 2DTDA 2J5RA 4DPMA 4XQEA 4Y6RA 3OICA 2ZKLA 3HFGA 4YDRA 3I9KA 1XU9A 5KCZA 4TZKA 1T2AA 3GC6A 4WCDA 5F1OA 2QX7A 2P9CA 3NDIA 1Y9EA 2NVUA 4YACA 1PGNA 4R3WA 4NH4A 1Y5MA 2EKQA 1OOEA 3NEPX 4N7RA 1R0KA 3CUKA 3ZI0A 1LDYA 4O63O 1NR1A 4PVDA 3A06A 3U3XA 3ENKA 4IM7A 2NWQA 1H6DA 1LA2A 1ONOA 3PLRA 4YJFB 1XA0A 2VZ0A 4PLGA 3AUTA 1NAHA 3IDSA 4QX6A 4AJHA 2WWRA 2XXBA 1ZK3A 3WX0A 2IEBA 2PGDA 4Y67A 1N7GA 2EKPA 5CDTA 2HRBA 2WJPA 4NBUA 4RVHA 4CLHA 2YHIB 3H8VA 3HNPA 2Q50A 1CDOA 1NBOA 3DMTC 3JTMA 3NJ4A 4BB5A 3U4DA 1PR3A 4OL9A 5A03A 1EBFA 2BI7A 3IJRA 4XYEA 1F0YA 3W8DA 4QEDA 4LK3A 4RLSA 5DNAA 2GF2A 4Z6KA 1GYRA 3PYXA 4OSPA 3FF4A 4MKZA 1X0XA 2Q46A 3GR6A 3FWZA 3H9GA 1U3VA 3ZU4A 3LC1O 1KY5A 5GY7A 4HX5A 2ZCUA 4PLHA 1SOVA 2HO5A 4BGEA 1GAEO 5BQFA 4CM4B 3AUUA 1HETA 2I65A 1I2CA 1VL6A 3VKVA 1E7YA 4B4UA 4E6PA 1PJ3A 2DPGA 4WLVA 3RUDA 2AG5A 4E33A 1HWYA 3PP8A 3GPDG 4R9SA 2RH4A 2G0TA 1UDBA 1K6XA 1Z7BA 3AI3A 4LW8A 5U9CA 3DEYX 3RFXA 4XB2A 2QRKA 5I9LA 2CD9A 1NX6A 3JQAD 4JNKA 4BNKA 3D3WA 4FN4A 4EW6A 3FD8A 5L51A 1HSZA 2IZZA 1MGOA 2DUWA 3DZFA 3OFSA 4GLLA 3ASVA 2LDBA 5CDGA 1CETA 1O5IA 3ANNA 3BXXA 5H81A 3I23A 2ZB7A 4NU6A 1PJSA 2CUKA 1YQDA 1B7GO 3DB2A 3JQEA 1P1JA 4ZQGA 4BKPA 4FGWA 1YONA 3NKLA 5JYDA 4GKBA 5CDSA 4WE3A 3U4HA 2GUGA 2GSDA 3QWAA 3WDSA 3MJEA 4IDFA 4WKGA 4GQAA 1DJQA 3RKRA 3WICA 3V1UA 1ZXLA 2QRJA 1Y8QA 1PQWA 1BRMA 5EQDA 5LDGA 1D4FA 2VHWA 2UV8A 2VYVD 4NMHA 4Q39A 2NLOA 1K0UA 1MC5A 3VKUA 3GRKA 3UVEA 4BKQA 4BGIA 5I7EA 3U4CA 4LCJA 1CRWG 3E8XA 3B1JA 1NYTA 2EF1A 2HK9A 2Q2WA 4RLHA 3KB6A 1ISIA 2X0IA 3CEAA 4J1SA 3E03A 3LLSA 2O7QA 4IZHA 2ZTMA 1WDKA 2VRCD 5THQA 1D1TA 4II2A 3QW2A 3F5SA 1ISGA 3JQ9A 4P38A 2Y68A 3QIVA 3SLKA 1VRWA 1R4MB 4BUCA 3A4VA 4IS2A 5F1PA 4Y6SA 2JFFA 3NGXA 1J49A 3LC7O 5U1PA 4AJPA 3ZWBA 1H5QA 1I0ZA 1XWFA 3IJPA 1R4NA 2DTEA 5DULA 2PD3A 4P4LA 4DC0A 1C1XB 4CR6A 3RC7A 4IS3A 1NTOA 4U6SA 5B4VA 4H15A 1FDVA 3ONDA 4HNHA 4XB1A 5A9SB 3WQQA 1U5AA 3QVWA 1D1SA 3HHPA 3D7LA 1Z82A 2ZCVA 3GVHA 3IOYA 1H94A 2C7GA 1F17A 3RBXA 2EJWA 1MXHA 4NK5A 2AMFA 2C7VA 2JAHA 3ZU2A 3S2EA 1UP6A 4OQZA 2ZYDA 4F45A 2YDYA 1UUFA 1AHIA 4YJGA 5T8KC 2W4QA 3MJ4A 2WD7B 3RU9A 4DLAA 1XELA 2ZB3A 3KYCA 1A5ZA 5J23A 2FY8A 5DBIA 4EEZA 4LISA 3RUIA 3KSDO 3RCBA 2JD2A 3K31A 1DHTA 3NRCA 1WDMA 3Q11A 3SC4A 1YOVB 2P4HX 1YDEA 3ZWWA 4I9NA 3FNHA 2RCYA 3TQHA 1UDAA 1R0LA 4D45A 1SB9A 1E1LA 3DBLB 1LRJA 1GTMA 4RQUA 4CLRB 1XU7A 1Q7GA 3ZHBA 3PQDA 2B37A 3RBVA 3F4BA 5JAZA 4OXNA 1F8FA 3GK3A 1NWCA 2NU9A 3H5AA 2PLAA 2NU8A 4E5KA 2DKNA 3BMCB 2FR0A 3WWZA 2YFQA 4E5MA 4XEHA 2AEFA 4Q3EA 1BHSA 3TZCA 4P4GA 4G2NA 3IUSA 2C82A 3GDGA 3TPCA 1DSSG 2OFPA 3WYBA 1P0CA 4J16A 1GEGA 3D64A 1IYZA 4J9UE 4ALJA 2D5AA 1T1RA 4HV4A 5IXSA 1KVTA 1WPQA 1B8UA 3BMNB 2EG9A 1HDRA 4R5MA 5TS3A 4BO9A 4XIJA 1R15A 4IDGA 1UZLA 4XWYA 5EERA 4CPDA 4RF4A 4KWHA 3GMDA 4NBWA 1P77A 3ZV3A 1HE2A 2WD7A 2JHFA 3DOOA 3JQBC 2E82A 3QVSA 1LQTA 1A71A 4PN3A 2OBYA 3AW9A 1VJ0A 2OP0A 4F46A 1M67A 1N1EA 3AUAA 4PLFA 4BOYA 2CDBA 3DHNA 1PS0A 4FOOA 3TWOA 3ORFA 4LSMA 4OKIA 1WP4A 3E9QA 3EW7A 1LSUA 3G49A 2H63A 1V9LA 1QXSA 3ZW8A 3RUCA 2VWGA 4CM1A 1B16A 1V6AA 4IMRA 4M86A 3K8ZA 2OO5A 3E9NA 4E0BA 1ISHA 1N9GA 2QYTA 1VJTA 4J4TA 1EUDA 2HK8A 4H7PA 3PQEA 3L4BA 3BMCA 5AXCA 3ROMA 3ZV4A 1ZIDA 2HU2A 1O8CA 4XZ3A 2J5QA 3GOHA 4DGSA 3W4KA 1G0OA 2V6MA 4ALIA 4B4OA 1KVQA 1KEUA 1HDGO 1YWGO 3PDJA 4BNVA 3DMYA 1VL8A 3NT2A 1DFHA 3ADOA 1NXQA 4FJ0A 4MIOA 1GR0A 3O9ZA 4E21A 3GPIA 4Y9DA 2NUAA 5JDIC 4BNMA 5TT0A 3P5SA 1LSSA 4HFMA 2P68A 1AHHA 5G0WA 3OQ6A 3L4SO 4BGVA 4PRLA 2OORA 4DBZA 3SX2A 1PX0A 3DQPA 1HE5A 1UAYA 4PG4A 1CQIA 1MFZA 2BFOA 1AUPA 3CMCO 3PJGA 4IBOA 5DOZA 4R68A 4MJLA 3QLJA 4J90A 3EDMA 4E4YA 3CIFA 3GHYA 4KDEA 5I7VA 4XA8A 1HDXA 1J4AA 3WBFA 1K3TA 4BQPA 1YB4A 1LEHA 3O8QB 4KUHA 1HT0A 1GZ3A 2PTGA 4C4OA 3L9XA 5EIOA 3GZ4A 4CQMA 1QV6A 5T64A 4BNIA 1ADCA 1UAGA 3LZ6A 1HZZA 2WSBA 4PLWA 4E2YA 4JBHA 2NU6A 4CMKA 1PS8A 4MVJF 2QRLA 1KERA 3AU9A 4J4BA 4N54A 5A06A 2WE7A 5CEFA 2DU8A 1KC3A 4IZIA 3LT0A 1J6UA 3LYLA 1PQUA 3DAPA 4RVGA 2QG4A 4QO8A 1KBZA 1PU2A 4NHEA 3G79A 2VWPA 3I9JA 3SXPA 4MVJP 3DOJA 1I3KA 4XIYA 4BO2A 4E13A 3BTSA 5ES3A 1XYGA 4RPLA 1EFLA 3GDFA 2BH9A 3E5RA 3WGQA 4MOWA 3R6DA 3WYEA 2V6GA 3MTGA 2Q1SA 3RC9A 3CE6A 4MP6A 4K6CA 1UXKA 1R4MA 3F46A 5JS6A 4RVUA 2D0IA 2PZJA 1QYWA 2CF5A 2PK3A 4ZICA 4C7JA 3NGLA 4BVAA 1SEVA 4GGPA 2H5LA 4HFRA 3PIDA 3GEGA 3HUDA 1PGOA 3GZNB 4RZIA 5AOVA 2QZ9A 1LDGA 5TC4A 1LC0A 5KIAA 1Q0LA 1FDWA 2HJRA 2HMVA 1SO8A 1QYVA 4A5OA 2BI8A 4P22A 3I9NA 4KOAA 2DVMA 1XHLA 4RPKA 1DRVA 1U1IA 2AXQA 2RIRA 4OXKA 3UH1A 3ZDFA 4HFJA 3SBOA 2JFGA 3H2ZA 3QP9A 3OA2A 2AEMA 2PR2A 4O5OA 3GUCA 2DBRA 4I5GA 3GNSA 5DCYA 4PZDA 3K2EA 2RAFA 4NFHA 3VH1A 1P0FA 4OYRA 2Q2VA 2X58A 3I5MA 4A27A 2ZK7A 4RVFA 1BXZA 2E48A 5GZ6A 2LDXA 2VNSA 2I66A 2VHVA 4AL4A 4MP3A 1N9GB 4RDIA 1MFPA 3KLPX 3OM9A 2GCGA 4DUPA 1ENOA 4R5HA 3KTDA 2GD1O 3AUSA 3TRIA 2BLLA 3WFIA 2O3TA 2WD8A 1T24A 2Q4BA 2EGHA 4DTIA 5DCUA 2Y1DA 3NT4A 4GKVA 4GMFA 4CM8A 1E6WA 1X15A 3SVTA 3GGGA 2AW5A 4KP7A 4UVDA 4TRMA 3RWBA 3HDHA 1U7TA 3GEDA 4L4RA 2DAPA 2J5KA 3PFFA 5JE8A 1K5HA 1LXCA 1XKQA 5JY1A 3UFXA 3LF2A 1FK8A 3KEQA 1E0DA 4PRKA 5F21A 5IG2A 4OSOA 3I83A 2E37A 4NBRA 3C24A 3MZ0A 1PJTA 3TL3A 1NM5A 2I6TA 2GN9A 2VT3A 1E1KA 4PGFA 2X6TA 4GSLA 3HE3A 4NNJA 1O94A 1A7AA 5COBA 2GZ1A 2HKIA 3HZZA 2EWMA 1GEEA 2A9FA 1PIWA 1AXEA 2Y93A 3GH3A 2VHYA 1YL6A 2CVZA 5CPBA 2Y0EA 2CF6A 2B69A 2GO1A 3G0OA 5HBRA 4P8RA 4HBGA 3JCZA 4P4NA 2OGUA 4OXYA 5IDWA 4II3A 2VNAA 1NP3A 5T6BA 1ISFA 1EZ4A 3IQDB 3ICCA 4I5DA 2HLPA 1B2LA 4UUPA 3ZZNA 2J3HA 1FJHA 2CMDA 5BNFA 4YBZA 1Y6JA 2IRWA 2Y0DA 4FS3A 3H7AA 2Q1WA 2UAGA 5IFLA 4BMSA 1J0XO 1CQJA 4HWKA 4YT2A 1GCOA 2XPCA 3VPSA 5L4LA 1FDTA 4DC1A 3BIOA 3VTZA 5K0ZA 2I9PA 4B3IA 3GVPA 2QYSA 3PEFA 3JD4A 5G2OA 1NWHA 5KOIA 5IDYA 4AJ4A 2YYYA 9LDBA 1TXGA 3P19A 2CY0A 4BNWA 2X0JA 3PQFA 3PWSA 1VLLA 4PG6A 5GZ3A 1JDJA 4XD2A 2O4CA 1I3LA 4WECA 3DR3A 4Y6PA 3QVTA 5JDCC 5DZSA 2DQ4A 1EUCA 5I9MA 1T26A 1Y8QB 2FWMX 1M76A 1RM4A 2NTVA 3DZHA 3RUAA 3MCVA 1I33A 4QTZA 4YVFA 3V8BA 3WSVA 1BDBA 4RF5A 3IUPA 1KETA 2HRZA 4FJ1A 1UH5A 1NASA 1G6KA 1SPXA 2VQ3A 5EINA 4NBVA 3WS7A 1U9JA 5B37A 3ANLA 3BMOB 4ZQBA 1NHWA 1TT5B 4GX1A 1DHRA 3GEMA 4HUJA 2R6JA 4WUVA 3ZU3A 2B0JA 3GFGA 4AJJA 1JAYA 4YT8A 1C1DA 1WMAA 3T4EA 1BMDA 4J1QA 4A73A 4BNGA 2NV6A 3UGKA 4KUEA 2F00A 4DYDA 3C1AA 1EQ2A 1FXSA 1S7CA 2O7SA 1PZHA 4WLNA 4QO7A 4OGWA 4R16A 1DFGA 2UDPA 4ZA2A 1HRDA 2YFHA 4U0JA 1PJCA 4IMPA 1LNQA 3K6JA 1HTBA 3KETA 4YRBA 4L0QA 5THKA 2HMWA 4CM3A 4J2OA 1P9LA 1PWXA 4OMUA 2B5VA 2NVBA 4XR4A 2P4QA 3TSCA 1UP4A 4ILKA 7ADHA 4YTEA 1ZVMA 1F14A 2J3IA 3AI1A 1HDYA 1LUAA 1LDEA 1TLTA 3JQDA 1QKIA 3ITKA 3W1VA 4WASA 1QR6A 4J4HA 3I9MA 1E3WB 1V3TA 5L45A 1R0SA 1TT7A 4G65A 1E5LA 2CZCA 1K6IA 4FR5A 1GQ2A 1ZSNA 4IGEA 3T7CA 2WDZA 4U5QA 1UDCA 2QW8A 5JW6A 3DTTA 3D4NA 3TDKA 2VUUA 2Y1EA 3G1TA 1WNTA 1V8BA 3BTUA 1UXJA 1RYDA 1KEVA 5L3ZA 3ZHXA 1VE9A 3UCEA 4FFPA 4RJTA 3ZN2A 4E30A 3OIDA 8ADHA 3IL2A 4J7UA 4RZHA 3T4XA 1A4IA 4YRDA 4IXWA 2YZ7A 1YGYA 3M6IA 3PXXA 3WYCA 1PR9A 4QUKA 2EGGA 3OF2A 4ND2A 3WJ7A 5ITWA 4YJHA 3QHAA 3FTNA 1YVEI 5A5EA 2OP1A 2GN4A 3QRWA 3ROKA 2EIHA 3MOGA 1GYPA 4M8SA 4ITUA 1JVBA 1R12A 5ADHA 3H65A 3JQGA 4HADA 1O95A 4AJIA 2IXAA 4CMGA 4FDAA 1KVRA 3D5TA 3F4LA 3A1NA 4BB6A 2YW9A 3LU1A 2GYYA 1H93A 2O4UX 4UEJA 4EEXA 3ZWMA 3VVBA 1IY8A 3F9IA 3O4RA 2ZYAA 1U5CA 4IGFA 4KUGA 1PJ2A 3DZKA 3S1LA 3S55A 4MINA 4BNFA 3NV9A 4BV9A 5KVVA 1H9BA 1DJNA 3U0BA 4J1TA 3PJFA 1ISMA 4CQLB 3GRPA 4XYGA 3ZHYA 4BGUA 2E4AA 3VZSA 1B3BA 4YT5A 3JYNA 1XG5A 5IF3A 4L4XA 1IZ9A 2X1HA 2B4RO 2YUTA 1D8AA 4TRRA 5FFFA 2J3KA 2IXBA 3TOZA 3PZRA 2FR1A 5CAEA 1ZK0A 2X9VA 1ZK4A 2IEDA 3CZRA 3P2OA 4ND4A 4D0SA 3KYDA 1PZGA 3BMQA 1OAAA 5AXBA 1NVMB 2AHRA 4NJMB 1GADO 2PKRA 2DLDA 2E6UX 3K73O 4YEDA 4YJGB 3RUHA 4OHUA 4GWKA 4A2CA 3KRTA 5GZ1A 1QLHA 3FI9A 2OUIA 2VRCA 1ZK1A 1L1FA 5FWNA 3ZWPA 1KVUA 1JA9A 2GRAA 3GT0A 3HDQA 3KOUA 2BGKA 5FI3A 3VAZA 2NVUB 3JD3A 4ESOA 4J3FA 4M89A 3FNEA 4GX0A 4UREA 3DWFA 3ANMA 4BO4A 3ZV5A 1HE4A 5K6AC 1AXGA 1P31A 5DP1A 1G0NA 1DBVO 4EZBA 2I99A 4PG8A 1KEWA 2Y1FA 1P1RA 3IKVA 1LDBA 2IYPA 1RM0A 3IMFA 4JX8A 3WMWA 5L9AA 3ZHZA 4RORA 3VPFA 4YXFA 3DBRB 3PPIA 3QSGA 4JN6B 3KZVA 3DBHA 4HXYA 4LSWA 1EK6A 3W6UA 3GMSA 4W82A 3A14A 1DIGA 3E82A 1DRUA 5EL0A 2VHXA 3AM4A 4UEKA 5G0VA 4DQUA 1K6JA 4YAGA 1SBYA 3KSUA 4E5PA 3PLNA 5JCJD 4AVYA 3KYDB 5L95A 4NG5A 3UCFA 3TL2A 1I32A 2AQIA 1DC5A 4K6FA 3B1FA 5T5QA 1LDNA 3L6OO 5HS6A 5JMWA 1GV1A 3PHGA 5JPIA 2BD0A 2D3TA 3KO8A 4JJIA 1NPYA 3WNVA 3NDJA 1NR7A 3RIHA 3FN4A 1C1XA 1SOWA 1Q1NA 3PJEA 4YAIA 4DLLA 4Y8VA 2OBNA 4IJKA 3F1LA 5B12A 2ET6A 3TZQA 4CLEA 2D59A 4IY1A 4W7IA 1UZMA 3S2FA 4IJUA 3UW3A 4IUYA 1HSOA 1GD1O 4Q3DA 4U0KA 3PDUA 3JQ6A 1LLDA 4WEOA 4F3YA 3P2YA 3HG7A 3WXBA 4D43A 3TF5A 5ITVA 4OAQA 1TB4A 1TT5A 2PZMA 2G76A 4FFOA 3PWKA 4L8VA 2DBQA 4FFLA 3H4VA 1KYQA 5BSEA 5B1YA 3FSRA 3Q2KA 1DIBA 1MA0A 2O48X 2ZYGA 3BHJA 3OHSX 5DP2A 4WJZA 3AY3A 3VOSA 4Q3BA 3WBBA 1ZK2A 1GUYA 4INAA 1ZZEA 3TOXA 5I9NA 1LRKA 4PIVA 1EVZA 3IIEA 2Q1UA 1T2FA 1PGJA 1YJ8A 3NX4A 1R16A 5A05A 3SJ7A 2X5OA 4FC7A 1BG6A 3OP4A 2BFAA 2HSDA 3ONFA 4ZQEA 3UAGA 4EJ6A 1WMBA 5LC1A 3RFTA 3KEOA 4A26A 2NU7A 2B5WA 4N5LA 1XIVA 5JBIA 2X86A 1PS9A 5A02A 2OHXA 4U8GA 5G0TA 3NTQA 3ETEA 4GGOA 3DFZA 1UXIA 1V0JA 4TKMA 4JROA 4BQRA 3GF4A 3DMTA 1H6CA 3UUWA 4PVCA 4KQXA 1DIAA 1OC4A 2Y1GA 4CM7A 2NQTA 1CF2O 3RSHA 3MWDB 4CUJA 4WK6A 2OL4A 3H2SA 3BTVA 5C37A 2DFDA 1PL7A 3SLGA 3ZCXA 1E1MA 2Z95A 4DA9A 1YOVA 3DFUA 6LDHA 4D3SA 5DBFA 4RVDA 1E7MA 1FDSA 5F3RA 4QT0A 3V1TC 1P1FA 1R6DA 2CVOA 1JVSA 1MG0A 3DBLA 3ENNA 2W2LD 3OJEA 1E3SA 4KQWA 1D3AA 2G82A 2P5YA 2IE0A 4PLYA 1GUFA 4WOKA 5AQ1A 2JCVA 1I30A 1IUKA 1H0KA 4XGNA 5CP8A 4BNJA 3GHHA 4Q3CA 3I4CA 1VC2A 4JBIA 1EK5A 2FOIA 4BO0A 1NNUA 1QRRA 3I52A 3L77A 5IAAA 4WNCA 2HJSA 4L73A 1O89A 2C59A 3R0IA 1YBVA 5KJFA 4ND5A 4DRYA 2V6FA 5CFZA 3WGZA 3D0OA 3HN7A 3KVOA 4EI2A 4EYEA 4XGIA 4BKRA 5KJCA 1O9BA 5AYVA 4B8WA 4MVJA 1P3DA 4MVJH 1X7HA 3JYLA 3G17A 3KUXA 1E3JA 4DPKA 2YHUA 4Z3DA 4G81A 4WCFA 1TA4A 3ICPA 1LDMA 3E9MA 1LLUA 3Q2IA 4E12A 1EDZA 1ADGA 5KJ1A 4A10A 4JLWA 5DBGA 4B3JA 1U3TA 1QLJA 2GZ2A 1LSOA 4CQMD 3Q0EA 3AM5A 3F1KA 3GVIA 4OH1A 4B7UA 3LF1A 4JGBA 1TVEA 1YQXA 4EGFA 3GG9A 3I3OA 4N18A 4UVIA 5L4NA 3W4JA 1GDHA 4U7WA 3ZWNA 4PLTA 1HKUA 1HYEA 4W9NC 3UF0A 4E2ZA 2CSUA 4BO8A 1GV0A 3FRJA 3H5NA 4AJ1A 4XGKA 1X7GA 3IP1A 3OEWA 5C3MA 1DDOA 3VDQA 5H83A 2QQ5A 1ZUD1 3OBBA 4I8XA 2DUUA 5CG2A 1PGQA 4R54A 3BHIA 2X8LA 3MJVA 5LDHA 5FI5A 3LT1A 5ER6A 4ND3A 3SJUA 1GQQA 1WXDA 3PK0A 3ASUA 4AICA 5KTKA 1YE3A 1NVGA 4B4VA 5DN9A 3ZWCA 3FNFA 1V35A 4LMRA 3HWRA 4G5HA 4DBVO 3NJ8A 2PA3A 1AE1A 3BTOA 4R4JA 2EKLA 2O23A 3O8QA 1KOLA 1YQGA 5I8ZA 3AOGA 1BDMA 4FBGA 1NAIA 3RROA 4OOEA 3RUEA 3ZWOA 3WTCA 3GGPA 2I3AA 3ETDA 4DLBA 5C7LO 1SCUA 4UEOA 4J1NA 3W8FA 1QG6A 4GVXA 1E92A 1WAMA 4Q9NA 3ULKA 3HN2A 1DOHA 4BNLA 1H2HA 1NFFA 4IIUA 2PH3A 1KS9A 2O50A 2JHGA 3ZWYA 3DO5A 1UR5A 3E1KA 1XEAA 2J8ZA 5KKAA 3X2EA 4DIFA 4ALMA 2X4GA 2FMUA 4Z9YA 4IPTA 4IIVA 4M49A 5H82A 1PTJA 1VL0A 2DPHA 2VYNA 4NR0A 1ENZA 3NTOA 1O6ZA 2OOSA 2Y66A 3DBRA 4WNIA 1JQBA 3OH8A 3V1YA 4CM5A 2D5CA 4QSMA 4D41A 2DFVA 3DC2A 1F06A 2EEZA 2IZ1A 2POQX 3E6AA 1PL8A 5IZCC 3RBZA 1CWUA 3DZIA 3E18A 5JCJA 3BAZA 1Z74A 3PHLA 3VH2A 2WEKA 3AI2A 5DCWA 1RJWA 1HYHA 2VOJA 3L0DA 3MJCA 1VM6A 2NM0A 4E31A 3DHEA 1X0VA 1VPDA 4IJVA 4BS9A 4XDYA 3FNGA 5HRUA 1P74A 2P9EA 3KM0A 4TRNA 1NQ5A 2IYOA 5KVSA 4D3DA 5BNIA 4DMMA 5KNLA 2Q49A 3AOEC 1A27A 2PGLA 1Z73A 4GI2A 4IINA 4RGBA 3JQ7B 1C3VA 1NVTA 3JQCA 2ZJ0A 3C1OA 1MC4A 1M66A 2A92A 4DPLA 2X9GA 3NTRA 3U62A 3LVFO 5JAIA 1N8KA 1NFQA 4YPOA 5JAMA 2PZKA 3PGJA 4IXTA 2FZWA 1Z7EA 1PL6A 4PLZA 4K28A 4DYVA 3ADPA 3GA0A 4OIMA 1EE2A 1I2ZA 3P7MA 3JD1A 2RHCA 5A9RA 1J5PA 1EVYA 3DAFA 2BMAA 1PEDA 3I4FA 4OOFA 3AY6A 2F1KA 3M2TA 4GSKA 1W4ZA 4J7CA 3VPHA 1CYDA 4R01A 1LQUA 4BKUA 1N5DA 1T2DA 2FPPA 2XF8A 4AFNA 1GCUA 1YBMA 3PGXA 2GPTA 5K6AA 1W6UA 3DTYA 3QWBA 4D7AA 4JIGA 2TMGA 1CEQA 2GN8A 2NTNA 1DLJA 4ZQFA 1WVGA 1T25A 1T4BA 1L7DA 3R3JA 5DF1A 4WOJA 2X5KO 1QORA 4YJFA 3OIGA 4PG7A 4ZJUA 1YRLA 3K9QO 3JSAA 1ZEJA 4DMLA 1ZNQO 3PYLA 1VJ1A 3WIDA 2BRUA 4NU5A 1C0PA 3WOHA 2PH5A 2GR9A 4L4SA 1H6AA 4E5NA 2JD0A 6ADHA 4OQYA 1BSVA 2Q1TA 3TZKA 4RVSA 3PI7A 3TFQA 3VH4A 4BHTA 2ZQYA 5EJ2A 1KY4A 3INGA 1Y5RA 2NNLD 2YV3A 3GY0A 3V5NA 4PG5A 4CR8A 1B14A 4TQGA 1YDWA 2CNBA 3JYQA 2Y05A 4XQ9A 2EW8A 1R37A 3JD2A 1UP7A 4NPCA 3CZMA 4MVJM 4XQGA 3PYMA 5EESA 1IPFA 4L74A 4ZRNA 1NQAO 4JP3A 4KTVE 4J0FA 2I3GA 4B3HA 3CXRA 2ZATA 1E7SA 1PQPA 5KJEA 3GAFA 2JD1A 3ROQA 5JY6A 5IDXA 1U3WA 1PZEA 1IOLA 2WM3A 1GFSA 3CMMA 3VC7A 1MUUA 1H9AA 3JQ8A 1ZXBA 3K30A 3C3XA 4UUOA 5T67A 1JAXA 4MVJD 4L75A 3OETA 3ON5A 1I3MA 4W6ZA 1HL3A 2EP7A 5TT1A 3RUFA 4XRGA 5TRTA 2QZZA 1ENYA 4RQTA 3HDJA 4GAEA 1JLLA 3QWHA 1EVIA 4R1SA 3QWFA 2X23A 3K5PA 1OC2A 4CMIB 3VTFA 1PGPA 4BNYA 4B7XA 1B8PA 3UCXA 1U2GA 4EUEA 1E7WA 1YBAA 4R69A 4AJEA 2C5AA 3L6EA 1WZEA 1E3WA 1Q2XA 4N5MA 1HLPA 3B70A 1DAPA 1ORRA 4O6VA 1ARZA 1PSDA 1QYCA 1VKOA 1ML3A 2GERA 2RH8A 5A5FA 4IDEA 2YJZA 3ZWXA 4QFDA 5IN4A 3VH3A 1G1AA 3AFMA 3CSDA 1DFIA 2PD4A 5HS4A 4MP8A 3R1IA 4CQMB 5KVQA 3PFWO 2Y1OA 3GVCA 4BNHA 2UVDA 1BVRA 5ER9A 4K9DA 3C7DB 3ZWVA 2DBVO 3C8MA 2H1SA 1PJ4A 3H5RA 5BSFA 2VZ9A 2D4AA 2OXIA 1EQUA 3RAJA 3WR5A 3MJSA 3IS3A 5I7FA 3RC1A 1DIHA 2PKQO 1I01A 4B4WA 1HDZA 1Y1PA 3D3EA 4LN1A 4N5NA 3UOGA 4Q3AA 1SEPA 2HMSA 4CM4A 4ZN6A 1R4NB 3V2UA 4CL3A 4DIOA 1JN0A 1LLCA 3H3FA 4B79A 5FEUA 4OO3A 3I9LA 2NACA 2B35A 1RM3A 2O2YA 1C0LA 1UXHA 1B8VA 4UAGA 4EUFA 1VI2A 3GGOA 5B4UA 4ZD6A 1FF9A 1CIVA 5CHEA 1X13A 3JQAB 1XCBA 2PD6A 4XCVA 1YO6A 2FSSA 3NT5A 5IDQA 4NJMA 5JXWA 5F5LA 5KVCA 4E2WA 5L7TA 1CERA 3VZRA 1GY8A 2EXXA 4W7HA 1GZ4A 5COAA 2R2GA 3GZNA 3NAQA 3O26A 2VYVA 1RKXA 1XR3A 2AQHA 3OMLA 3PWZA 5CEJA 2P9GA 2EW2A 1FDUA 3VVCA 2PV7A 1V3VA 4ROSA 1N1GA 2W2KA 3GVXA 4EDFA 4C7KA 8LDHA 1SNYA 2X22A 3OJLA 3HJAA 3F6YA 4BO3A 2I67A 1ENPA 3AM3A 3C1TA 3LK7A 2EP5A 1GZ6A 5BNTA 3U09A 4Z9FA 1BXKA 4ZRMA 3MOIA 5TGDA 1JKJA 4GH5A 4XJSA 1KIFA 2RHRA 3BA1A 1VSUA 4NJOA 2CVQA 4WPGA 1XSEA 1ADFA 1ZO8A 5BSHA 3H3JA 5C5IA 1DC4A 2BFMA 5LCXA 2A4KA 3E48A 3EGOA 4KDFA 4MVJI 4R1UA 1X7DA 1Y81A 2FZEA 1ZJZA 2DTXA 1H6BA 1LBEA 1LRLA 1N7HA 4CMBA 1SAYA 1YL7A 5A3VA 3W4IA 1MG5A 3VPGA 4WLUA 3WB9A 3BZUA 1Y8RB 1ZBQA 4GMGA 4JQCA 2UUOA 3EUWA 3LT4A 1OFGA 2D1YA 1C0IA 5JSFA 4XQCA 1P1HA 2FSVA 4OM8A 4CM9A 2JJYA 3KXDA 1TEHA 5JNLA 2C29D 1E1NA 2Z1MA 3H6KA 5F5NA 4YB8A 1E3LA 1E7QA 5DOVA 4OKNA 4D42A 2A35A 2BKAA 4K1LA 1OMOA 4TMFA 1I5RA 1C0KA 1ULSA 3COSA 5FF9A 3MJTA 1ZEMA 2NTJA 4BNXA 3DL2A 1T2CA 5CEEA 1P33A 3MWEB 3I6IA 1NHGA 5CDUA 2C2XA 5TF4A 3KYCB 1EUZA 3M1AA 3LT2A 5JDIA 4FSHA 4HY3A 1SMKA 1FMCA 2VTDA 3JQFA 3WMXA 2ZIZA 4HNGA 2H9IA 2YV1A 3HADA 3OEYA 2VWHA 4WLOA 1E5QA 4D46A 2C07A 2VZ8A 4PLPA 4RDHA 5ILOA 4QFCA 1Q0QA 1SC6A 4ALKA 2WYWA 3LDHA 3OJFA 1VSVA 4MPDA 3DHYA 2HMUA 1PJLA 3EAGA 4XKJA 2PNFA 2WMDA 4CMEA 3PHJA 3AK4A 3QWIA 3UHAA 1WZIA 2HMTA 4RPJA 2FRDA 1X1TA 4YQZA 4J2HA 2P2SA 4JK3A 3GN2A 4BL5A 4E32A 1Z45A 2AA3A 2JKVA 1Q7CA 2R00C 4IDDA 4X54A 4WLFA 1O0SA 1ZMOA 5TQVA 2C2YA 2G1UA 3WQSB 4KMSA 2DT5A 4JJGA 5ENVA 3D4OA 4F6CA 2Q45A 4NBTA 1M2WA 4TSKA 4WEQA 1Q7BA 2J3JA 5ILGA 2SCUA 4CM6A 4I9HA 2YV2A 4IQ8A 3EHEA 1XDWA 3V2GA 2ZTVA 1C1DB 2WTBA 3Q6IA 4DL9A 1YJQA 2FP4A 3IC5A 5EMHA 2O3JA 4WLEA 4D79A 4ZGWA 1P1KA 1E3EA 3RU7A 1P44A 1XGKA 2O3SA 3I1JA 2JFHA 4MVJG 4NFSA 3WNQA 9LDTA 3RC2A 1ZJYA 4M54A 4YWJA 4CMJA 4LVUA 4PFJA 5MDHA 3AU8A 4CJXA 3DAGA 5BT9A 3RASA 2NSDA 1KVSA 4IDCA 5COQA 5HA5A 4E2XA 1I10A 3B20A 3JV7A 3ZNNA 7MDHA 1LSJA 3OQ1A 1M6WA 4FC6A 2B36A 4GX5A 4I5FA 1B15A 3H9QA 1DO8A 5JC8A 1IPEA 1DPGA 1EVJA 2O3UA 3QY9A 3WLFA 1LTHR 1WLYA 1NFRA 1VKNA 2YQ4A 4YAEA 4CR7A 3ZH2A 1P45A 4CUZA 2ZJ1A 1GQYA 2GGSA 4QXMA 4YAJA 2EERA 3FR8A 1GL3A 1BXGB 3ETGA 5L40A 3EYWA 2AEJA 3OQBA 5G0SA 2W98A 3DZGA 4XRRA 2VUTA 1I3NA 4B8ZA 3GNQA 1L7EA 1T4DA 3L9WA 3EY4A 1F8GA 3PRJA 5BR7A 4YT4A 4LGVA 1SB8A 4IJWA 4F6LA 3F47A 3WGHA 1U7HA 4R51A 5G4KA 3QQPA 2GASA 4CL8A 3FCOA 4L9RA 3JQ8B 4LRTB 4BO5A 4QECA 2W2LA 5CPFA 2BGMA 4DQVA 4H3VA
chains in the Genus database with same CATH superfamily
3DB1A 4D9GA 5HOEA 3VR2A 4K8OA 1L4BA 1X8KA 4B3GA 4KE6A 1SVMA 2DC1A 1I2DA 1XCMA 2I8LA 2C9CA 3HDYA 4UE2A 1EFHA 1N6NA 1UK6A 3OZDA 3MAAC 1XDGA 4IILA 5ENZA 1NUHA 2VTEA 1UBTS 2WA2A 1Z17A 3WAGA 1G4UR 1T2EA 2CDNA 4PCVA 5G1PA 1T1SA 3PR1A 4EPVA 1EWTA 3W2IA 3EZ2A 3EXAA 1M6YA 1R9MA 3K71B 2IYWA 3TOVA 4HT3B 4BNUA 3I28A 4UD2A 4QNNA 2OCBA 3SC2B 3CINA 5ALVA 1GPLA 1PWEA 1N8NA 2HJ9A 2ZSUA 3CLSD 3F5QA 3DVSX 3TN7A 4IICA 1JFFB 3H9EO 4NY1A 1DAFA 5JYEA 4P2BA 1TYZA 4PO9A 2ETVA 3GRZA 4R1TA 1RE1A 4F5YA 3SIXA 2YXBA 3WWEA 1YTLA 3NXSA 4Z86A 4AJKA 3EMKA 3ESQA 4ZRDA 3RFVA 3FOEC 2Q2QA 3FCUB 3I73A 4IDAA 2X9QA 2V6JA 1OXXK 4R1NA 3WMRA 4PV7A 1ODIA 1FTQA 1W4RA 4B84A 3E7FA 4ID9A 4UMEA 4PSKA 5H4HA 1U8AA 2OZPA 4RACA 1C7RA 1Q1GA 1CUEA 1ISJA 3NC0C 4P4TA 3LBHA 1EXNA 2ID8A 2E3JA 2NXCA 1V4VA 2GYWA 3FLEA 4GI3A 1OH7A 4DARA 4MVJE 4Q16A 1OBHA 3ZS8A 1EFUA 3KE9A 3DPIA 5JMPA 2P4UA 4NYJR 1DCMA 4D0GA 1IZ0A 2QTWB 2C03A 1Z62A 2I1LA 2JG3A 2PJDA 1P0IA 4LZJA 4IOMA 2GQ0A 2R00A 3VJKA 4DJ5X 4NJEA 1J33A 2P91A 3GLSA 3OU7A 3P9RA 5H5JA 5JO0A 5HK9A 5KWJA 2EZ8A 3ECCA 2IXFA 4KE8A 4HNTA 1JU9A 3HQ4O 1NRXA 5KPJA 3ZWAA 1BCRB 4H16A 3GXOA 2BP7A 4O4HA 4D8WA 1JHVA 2BM9A 3ELYA 4RW0A 1SIUA 4PR3A 4C3ZA 3HP4A 3IMCA 3GD7A 5T57A 2B82A 2PUTA 4BNZA 1EESA 3EW9A 4CLOB 4NI5A 2I54A 1FX1A 2NO4A 2JCYA 3R5TA 1JAHA 1LFAA 1QIFA 3S7TA 1YZUA 2B9EA 3KZMA 4ZAWA 4B44A 5IZCA 1A97A 1SXQA 1CJVC 2NSYA 1RI5A 3D0RA 1PG5A 3ANYB 3L18A 3DZBA 4GXNA 3WGTA 1M10A 1W36B 1HPLA 3HEAA 1BW9B 2I4OA 4RPIA 2ZYHA 4HRAA 4MO2A 4O59O 4YWHA 5GP1A 3S2SA 1CE8A 3M8KA 3NUGA 4GVLA 2V7PA 5DBEX 2XA1A 3DVQX 3T9AA 3ZU5A 2VUSA 2GCEA 3B48A 5DTIA 5F76A 4E94A 5L3SA 3ZW9A 1L4MA 3MMSA 4EUHA 1YA4A 1N92A 3N58A 2XOXA 1F4VA 1BZYA 5LLSA 3ZJYA 3AVTA 4OP1A 1J5XA 4JODA 5G4KB 4KYTA 3PGA1 3O8RA 2I3BA 5ERXA 5FBKA 4JKOA 1VKRA 4O4JB 1E60A 1SD5A 3GNTA 2P4SA 2SKCA 5KO2A 1GNTA 1ZOLA 3D7NA 4LJRA 1E79A 3E0QA 3ETLA 4UOEA 1OKKA 5FX2A 3ROZA 4AXXA 3WA7A 1XEWX 5F12A 3B2QA 4Y2PA 4TKLA 1AB5A 1KO7A 4V0QA 4DEXA 4NJEB 4JQZA 4LZAA 1M34B 2F6RA 1ODCA 3P9IA 1Z4QA 4ZVRA 4TMWA 3SF0A 1JB9A 2AQ8A 4L3WA 1PJ8A 4KLCA 1PG2A 3HR8A 3EJ6A 1U0NA 2XB2A 2CJPA 2W0SA 1N78A 4TWIA 4QGHA 3W6ZA 3QZUA 1ZGZA 3D3KA 5A4DA 1UWLA 4UTRA 2BBTA 5ITZB 1H4VB 4DIEA 3DR5A 3WB2A 4F4IA 1K8QA 1L5KA 1UT8A 4RD3A 1O2DA 1PSZA 4ZO7A 4M1ZA 1TZJA 1E66A 2QNBA 2DH5A 4RY8A 3AIKA 3ZGZA 1EWVA 4FCTA 4B3TB 4C0LA 2VH5R 4OJYA 5IABA 4BO6A 5BVHA 3I9FA 1PJBA 3ABIA 1RAHA 3RI3A 2HRCA 4KJZA 3EZLA 4R9RA 4PHCA 4PZEA 5JO9A 1F2DA 4EB0A 1RJ9A 1EB8A 1W49A 3EC7A 4HEQA 4TSRA 4X1IB 4MW4A 3RV4A 2SCUB 3NKFA 4L28A 3A1EA 2PS0A 3F5MA 3FYUA 2JL1A 2H6EA 3SZLA 3TKYA 1E3IA 3GLQA 5F52A 6REQB 5KMGB 1XNHA 4FPXA 3ROGA 2BZ1A 2NUTA 1K68A 1RM5A 2NYRA 4AP9A 3FNBA 3KSZO 3OIVA 4CMHA 2UYOA 4D9BA 2VCEA 3ORRA 4CLXA 5AKKA 4CODB 4EI7A 4ZOLB 3VOAA 3KOOA 1AXRA 4REMA 3VU1A 3R9KA 1LX6A 4ZQHA 4H7HA 3JAMA 1N8TA 2GPBA 3H4TA 4GE0A 3A2NA 3G1UA 5CTAA 5A1JA 3ESDA 1KL7A 3O7WA 1E7RA 1T36B 1XQ6A 3CZAA 4ZAVA 4XVUA 3AR2A 4W1SA 2XVYA 3WL3A 5JH7B 1FPMA 1A5AB 1CUXA 2VF4X 4Z49A 3H1BA 4K9KA 4YMIA 1ZW1A 1KS2A 1SUDA 2PFGA 2YHAA 4BMNA 3MJDA 1D03A 4FEYA 4CF6A 3T7EA 4BUJA 4J9VA 2P1RA 2C61A 2X0RA 3PRYA 4O4HF 4Z2AA 2I4MA 3G13A 3JALA 1NULA 4WQMA 3NDRA 5CYPA 5KNCH 4ALNA 1U3FA 4HDRA 1L0BA 1IHPA 3UM9A 5LOVA 3TG2A 5TIIA 5BP7A 1BO6A 5CXQA 1YRBA 2Q27A 3UATA 4L08A 1XCLA 1Y6GA 3EVFA 1K5PA 1Z34A 4C30A 3DDCA 2WYVA 2GA9A 2A78A 5D5QA 5IULC 4EF4A 3EDQA 3RV3A 1L4YA 2IL1A 1UT6A 3IAS6 3W5BA 2IGTA 3G5AA 2ZE7A 2XIQA 2JFWA 1O9GA 1CJMA 3NPMA 1H1TA 2XWSA 1IBKB 1MU0A 1C9EA 1N1DA 2IEAA 1ID1A 3FYUB 3NB0A 3PQ3A 4JZKA 4KN8A 4LY6A 4WWHA 3ZXSA 3QY0A 5AW1A 1WDLA 2A0KA 4HGPA 4ZOBA 1IL0A 5DEIA 2CNWD 2C5GA 4YH1A 5KSPA 4XVCA 2I34A 4CLOA 5A3JA 1SOMA 2IC5A 4ALLA 4MB0A 4YAKA 1JWBB 3CH6A 4X44A 3DWIA 3WG9A 4P93A 3PICA 3G8YA 3LKDA 3QVGA 4DB2A 1RYZA 1N5JA 1AVTA 4CMIA 3HV2A 4M9CA 2AMVA 1V9CA 2W37A 2YJTD 3H8WA 1H85A 1LJ8A 2E1RA 1Y1LA 3KLMX 4UU8A 2DERA 3HB4X 3C16C 1U90A 1Z0SA 3WZLA 1FJ2A 5HQ3B 2F3QA 1QHNA 1S6YA 3H9UA 3T7RA 4KN5A 5C7OO 1EBBA 1PVOA 4UC0A 3FHLA 2FB9A 2GNOA 1N2CA 3D5QA 1QS0B 3OT1B 3DBVO 4HNSA 3ESXA 3LNTA 4K03A 3LVQE 2XDQA 4UM5A 1GLGA 4DDKA 4EG5A 5DSXA 1THMA 3GROA 3V2HA 4C0JA 1QO9A 4HWSA 4HFNA 5SYNA 1Q14A 1TCUA 2X13A 4B7AA 1XZ8A 3FTFA 3I2IA 1YQ9A 1V5EA 3N1UA 1UMCA 3L7MA 1P1IA 4PC3A 5TNXA 2ENUA 1BKDR 3ICQB 3B51X 2PWPA 3T61A 3GJ0A 3ORHA 3GGCA 1E77A 2FW7A 1IBRA 4EKNB 1Q3HA 5LVAA 5KEIA 4NARA 1J0BA 4C1BA 3IYLW 5DO9A 5HM8A 3B6JA 3EVBA 3ZNQA 4MDHA 3AUXA 5FLEX 3U5TA 2QUKA 4FMCF 1M75A 2BC9A 5CNMA 5E3HA 5E95A 3WWDA 3A6DA 1JJAA 1S7GA 4KQ1A 3ZV6A 4DSAA 1NNEA 3TW6A 4B74A 4MIYA 1SY7A 1GWNA 1QYXA 1A4RA 2YN2A 4Q3LA 4R8SA 4GFDA 1IHXA 5U4QA 4ARBA 1LC3A 4NIMA 3G02A 2BMFA 4O29A 1KZ9A 4QQRA 2IH5A 4Q9AA 3SQOA 3EWNA 3KOYA 3RJZA 3IR7A 4BCDA 2J0UA 3H5LA 2BISA 2CCKA 4ZPXA 1I8TA 2D7JA 4CLDA 1QSGA 1B1CA 2WUDA 3QVXA 4FCCA 5CU7A 1HL7A 2C20A 2D5IA 5J4HA 2AOVA 2NXJA 4HD8A 5CB4F 4KU4A 2V6BA 3HP7A 2JJ8A 3WGOA 4U2FA 1NT2A 4C4XA 4Z0NA 1MX3A 2QN3A 3JRNA 1P3Y1 4YV1A 1AOXA 1Q1EA 3WQRA 3TXYA 2XHZA 2GPYA 3DXYA 4CKBB 1QGZA 1XTTA 5KYUB 3CH7A 4KFUA 3BH7A 3PCXA 2Z2YA 4AJNA 2PUFA 3C14C 1GU7A 3CKYA 4BX9A 1DX6A 4TM7A 4O3FA 2G25A 4L2IA 2F3UA 4JWTA 3WWYA 1IAQA 3Q3HA 4XAQA 3L4BC 2HUNA 2XXJA 1E6CA 5E9JA 2GN1A 1TVCA 2RMKA 3OIWA 1XLUA 4ZYTA 4RDXA 3ET5A 4GZLA 5H9WA 3WIEA 4WKOA 1XZIA 3K2QA 1JEYA 2X9NA 1PLLA 4I1PA 3D3WB 5AJTA 1CDEA 5DYIA 3HVKA 3UT6A 4IOKA 5E9WA 2QW1A 3WGGA 4TL7A 1VG9B 4C21A 3IH5A 1U0FA 4RPHA 4DE5A 4U6QA 4KTTE 4QGSA 4XYBA 3M3PA 1RAEA 1W8DA 3G8AA 4J6FA 3I5XA 4QNRA 1AKUA 1KDPA 1M8GA 1T6NA 1OWNA 3RTGA 1CY8A 3SMVA 3AZPA 1E89A 1MDBA 3MTBA 2WIKA 5CX1A 1IE3A 4XOIA 4BNTA 1XEXA 2VTVA 1Z0DA 1Z7YA 1KJZA 2V58A 4I8IA 2MIIA 2V4UA 4X7MA 2AUMA 2QT1A 5JCPA 3Q87B 1F12A 4I81A 2YHIA 2BZ0A 3GPBA 3ZHQA 4F1WA 3D02A 1OX4A 3CKLA 3PT9A 3DOFA 3RIGA 5JAQA 1FFEA 1U3DA 2HXGA 3DNFA 3FVRA 5IKXA 4H18A 3X1DA 2BGWA 5EJ9A 1UXGA 3IKTA 2NO9A 3H5TA 5K4GA 3LP6A 2DFPA 1YNOA 3V8NA 4KX5A 2AN4A 3K2BA 4PXYA 1G6Q1 1Z0IA 4S05A 4TXJA 5TSDA 2W8ZA 2LGJA 4BO1A 2F1JA 1MNAA 1LF0A 5JFGA 1WULS 3L0OA 3FOWA 1WU8A 2P2ZA 4C7MA 1R0CA 2WWYA 3H99A 2FPXA 1ORDA 4MS3B 3WRVA 2C78A 2ZVJA 1QOZA 2PO7A 1MRSA 1QHXA 5GPBA 2BF7A 2CL0X 3K4QA 5GMOA 1RTKA 1U3UA 3Q7SA 3WP1B 4R2LA 4CNBA 2ZSBA 3FJ1A 2JBWA 4W5OA 4U7JA 4J07A 5AUOB 3FDIA 1GKKA 1TUIA 4AROA 3VKGA 1QHIA 1ZGCA 1II0A 3DBHB 3LBNA 3I05A 2ISCA 4F7WA 3IBGA 2Y67A 3SFVA 4EYKA 4Q4DA 1TI7A 4QUDA 1P9OA 3JQFC 4CV3A 4JR1A 3BMNA 3K1ZA 2BLNA 4KCGA 4UNIA 2MINA 5AVKA 1O58A 5C1PA 4IDBA 4MR7B 4RL4A 3SM3A 3JQBA 1HFJA 3CGGA 1YU9A 4N3BA 4JI4B 2FE4A 4MIKA 3LVBA 1C2YA 4B82A 3NLLA 1N8SA 2VSOA 3CQ9A 5GAJA 2XUAA 4RL6A 1ZH0A 3U6KA 4H1UA 3TZHA 1HV8A 1M0TA 4G1VA 2EP8A 5JS7A 1EP1B 2PBLA 4PRYA 4IZOA 3AR5A 4IIEA 4YP9A 4NXMB 4JBGA 3O2SB 4GLOA 4QQ8A 2I7TA 4OB7A 1NQTA 4DRXA 3HXQA 1BTOA 5THXA 1B0AA 1PLKA 1BCRA 4D4HA 4Z3KA 1W85B 2PH1A 1GL6A 3VYUB 1N2SA 2UYYA 1VL2A 1QG2A 2CYCA 1AGNA 2D1SA 4MXDA 4WSOA 3WFJA 2ACKA 3NHAA 4URVR 5KC8A 1U4OA 1AZTA 1ONPA 3ZCRA 3LW7A 1IIRA 4ZO9A 5FUWA 1JYSA 1GDDA 2PYIA 3QMVA 1DQZA 4FYXA 4TTRA 3ZY6A 4E3ZA 4RTSA 1HDCA 3MHTA 4HN4B 1JEOA 4OUDB 4R3NA 4HRVA 3A0UA 1XYYA 1TEZA 4B2YA 4DSTA 1V96A 2G1PA 1UOEA 1DEHA 4JCOA 1SOAA 2F8MA 5G0UA 2WUVA 2PG3A 1UODA 5F7OA 5ICGA 1U28A 2C8LA 5FI1B 4YK7A 3R3XA 4P35A 5AJXA 4F8EA 3RRJA 1THGA 2XYHA 1NJ5A 3AH8A 3UAVA 1YZHA 3M89A 4CKWA 2ZQZA 3AEQA 2VI5A 3P0RA 4D44A 3ZJUA 3RHSA 5H1YA 1QAQA 1WQ1R 2JGJA 5F2EA 3EIWA 3UJBA 4EJSC 1E2LA 1E2MA 2CCJA 3ESCA 1WZNA 2ZKLA 4GZ3A 1H4TA 2KHZA 5KCZA 4EMUA 1T2AA 4NQRA 2PSHA 5HDBB 3N75A 1AKWA 1QQ6A 3NDIA 3Q8LA 2O57A 3OZFA 2I2AA 3MCAA 3RF7A 2IHUA 1PGNA 4R3WA 4NH4A 4MLZA 3QLEA 5DSZA 4YRGA 1OOEA 2FFQA 4MARA 4DSZA 2QR3A 1OH5A 4K9RA 4ZDWA 5CGQB 4NEHB 5I47A 4LI3X 1J0DA 4M0DA 3ZI0A 4O63O 3IEKA 5GGYA 3O4JA 4DY6A 3SYRA 3UAYA 5I5GA 2DHRA 4HYQA 4DJAA 1H6DA 4FX5A 1LBQA 2CB0A 2VJKA 3CLKA 5K3FB 3GUZA 3JSXA 4YJFB 4YQEA 1FDIA 2QVCA 4U8HA 5KSOA 3IDSA 3HB7A 2OV4A 3WX0A 4OLBA 1P4HA 1ZRSA 2PGDA 1XZCA 3NALA 3MTIA 1Z18A 4Y67A 4ZJUA 7MHTA 4C6RA 4NBUA 2WHYA 3RVSA 4CLHA 5JQGB 2YHIB 3ZDRA 1AGRA 3HNPA 2XXAA 2Q50A 1NBOA 3CO5A 4EA9A 1EJBA 1YRHA 4PU0A 1MQAA 7REQA 4LOLA 2XOEA 3FGPA 5IHXA 2P3SA 2W2TA 3TS1A 4KR6A 2IKSA 4Q7EA 1P7WA 1AURA 3IODA 3FJYA 1YASA 2CJWB 2R1VA 4OL9A 3RYHB 1JFTA 4LA4A 2OD7A 2FVYA 1I6LA 4QEDA 4LK3A 4RLSA 2IYRA 5DNAA 4JLBA 4CQNA 2ZQ5A 4ZCLA 1B6GA 3BD6A 4HN2A 5JD6A 3FF4A 4TSFD 3VV2A 4HDMB 2CFTA 5I3ZA 1AQNA 2PSJA 1NOKA 3IDFA 2A3RA 1J2RA 2QL6A 3LLUA 1NDUA 2SICE 1ACMA 1U3VA 2C04A 5EVJA 2A86A 3G68A 1K8RA 1KY5A 2PT5A 3ZCSA 3QSYA 4HYTA 1H8HA 3MWJA 1G16A 4OKSA 1V47A 2IEIA 3IO5A 2RAPA 2NIPA 3QELA 4AKHA 3D6AA 3KAQA 1TM7E 1QAOA 1PJ3A 2DPGA 2UYQA 1RLTA 4BBJA 1DG3A 3TOCA 1OA0A 1Q5PA 4FYKA 1WY5A 2J59A 1ST3A 4R83A 3UMJA 4BFLA 1E32A 5FPSA 3ZTWA 1K6XA 2EZ4A 1U9IC 4RKRA 4DILA 3C4VA 4EKDA 4O02B 2P77A 4X7BA 3HXOA 3EOZA 2Z8YM 2ZR8A 3I62A 2F67A 4GMKA 4E11A 1NX6A 5EKTA 1XKXA 2W43A 4EW6A 1EM8B 3CR7A 3O95A 2VC2B 5I7UA 5JQGA 3EOBI 2IZZA 2DUWA 1MGOA 3AHDA 1JA1A 3HLTA 2VH2A 3OFSA 4P31A 5T3UA 2LDBA 2QT0A 3QEMA 5SY6A 4O4LB 1O5IA 3ANNA 3BXXA 2V4ZA 4K6KA 5TQ0B 2ZB7A 5BV0A 2Y27A 2Q9CA 1QYIA 1B7GO 3DB2A 2W6JA 1RMYA 1QO0A 2W2PA 4MWDA 3ZLUA 2EFGA 1O6CA 3GCXA 3KLOA 4PN7A 4EUSA 3VYVA 2FW8A 4WE3A 2H00A 2GUGA 3KK0A 4LGVA 1USUA 2FFHA 1OFIA 3T5TA 1YR1A 1HTTA 3IV7A 4KVGA 5AM1A 1G38A 4WBSA 2FXVA 3RK0A 4YDHB 1E1QA 1PV1A 4KSYA 2UZ4A 3WICA 4YV7A 3MHPA 3T4PA 3F71A 2A14A 1Y8QA 3TM5A 1ECCA 1I9GA 1Q0RA 1WXWA 5EQDA 3U7RA 1D4FA 2RI0A 1G21B 2VHWA 2UV8A 2VYVD 2P27A 2V45A 2H57A 1K0UA 1MC5A 2IYVA 2NLOA 1GILA 3BJRA 3HRIA 4LJKA 3TXXA 3UVEA 1W9MA 1WHTA 3ZXYA 1RQGA 4YPFA 3NHUA 4NP6A 4DA4A 2W00A 4BASA 1KAQA 2FFRA 3A4IA 3EVEA 2RE8A 4F9FA 2EF1A 2HK9A 2Q2WA 1K7SN 2HR1A 4XPZA 1ISIA 4J1SA 3LLSA 2LZ0A 5DNDA 1RS0A 1EG7A 2OOKA 3OTWA 3L6UA 1CULC 3I39X 1AS3A 1JU3A 2LTAA 2VRCD 1A9QA 2MSKA 4OI4A 1IEVA 5LLTA 2I03A 4TV9B 4EY4A 3DMDA 4WCVA 3JQ9A 1ISGA 3AF3A 1H5NA 2COEA 3MFQA 2I8CA 3TQTA 2A7XA 3QIVA 3SSAA 1VRWA 4F9TA 2QGNA 4UZEA 5JSZA 4DLXA 2I4IA 3CZCA 3A25A 2JFFA 4WY5A 5FWYB 2BSQA 1J49A 3VR5A 1MB2A 2X1MA 4NS1A 3P2KA 3W9UA 3ZWBA 2R8EA 3IERA 3MD9A 5JNVA 1DOAA 3IJPA 4YV0A 4BMYA 3UPDA 3VKFA 5KTTA 1C7JA 3LO5A 1D2HA 1E2HA 1V26A 4CR6A 4YRNA 2CUNA 5I4IA 4U6SA 2F55A 5B4VA 2GLUA 5IBQA 4BEVA 4BZXA 4FMPA 1PFKA 2ILVA 3DHVA 4HNHA 5A9SB 3MLAA 1XCJA 2QMUA 4XB1A 4BFUA 4DKJA 1A7JA 2ANCA 3TUIC 3JASB 1UMBA 2X41A 1Z82A 2XOKA 1NW3A 4YRRA 1H94A 1K08A 2H07A 2EJWA 2ZRNA 3EUFA 4RUKA 2AMFA 2PBFA 3A10A 2C7VA 4RXTA 1P6XA 4DIDA 2JAHA 4JT8A 4EI9A 5LIRA 2XQGA 3J81A 1UP6A 3RYIA 4G56A 5CA0B 4TLDA 4F45A 5KYTA 4ZCRA 3A3KA 3L3BA 4LTMA 3SVZA 4B3DA 3Q3IA 4FDMA 4HLDA 4ETWA 3K20A 5T8KC 2W4QA 4DTCA 4JBWA 5T7BA 4UAJA 3N0RA 5ALJA 5EXEA 4X3CA 4EW1A 2HB6A 2COUA 3ZE2B 4FYMA 3FBWA 4NL4H 3C3JA 2NAFA 1VLQA 3CLSC 5DBIA 1Y3HA 3FYTA 5K5EA 2VR1A 3O74A 4P54A 3B3FA 3ZIDA 3V1NA 1R0WA 3LOUA 3K31A 3EPKA 3TRKA 3O8OB 5HJEA 4MW1A 2CMGA 3ZWWA 1SKAA 3QUCA 1GKYA 1QGYA 2RCYA 5I9IA 1GTJ1 4MR9B 1GNQA 4R7ZA 3IE0A 5ULLA 2FWJA 2BSXA 1E1LA 5LZ4A 4QUHA 1GZUA 2F3TA 2QSYA 1GGMA 3CPHA 3GYBA 4X1OA 5TVKA 5KX5F 3B6MA 1ZNYA 1VKJA 3VR1A 2NU7B 3ZE7A 3CLUC 3ROTA 4HWTA 2L42A 3ITEA 3QGMA 1P4JA 2B37A 4L15A 2FG7C 2P4EA 4OXNA 4ZEMA 4MVXA 1KP9A 4PYLA 3DV0A 2HDWA 1NVFA 2FN9A 1G9SA 2FR0A 5FULA 2YFQA 3PXDA 2AEFA 3ZVLA 1BHSA 1A2OA 1MPXA 1T3HA 3EQZA 2A0UA 4E5SA 1DSSG 1DAHA 1P0CA 2I0FA 2I4TA 3WGUA 4QT4A 4A0GA 5AVSA 3D64A 1R6BX 1T2VA 5IT4A 4U7FA 5SYMA 3T15A 4KO2S 1RD4A 2A0FA 1B8UA 1HTWA 3BMNB 2BT4A 1WXIA 3JS5A 3L8CA 3KR9A 4GE3A 4BAUA 1X1AA 3G2QA 4D4LA 4ZHQB 1U8EA 2I78A 3MSXA 1XL1A 1FP6A 1HT1E 5EERA 4B85A 4F3NA 4YPVA 3KQOA 4OBXA 5ESRA 4UNSA 3NHYA 5H02A 4NBWA 4FZVA 2GAAA 3DEIA 1R7RA 3KUUA 5B1DA 2JHFA 2BRUC 2E82A 1LQTA 1E94E 1YZNA 2HLNA 4HH3C 3EIHA 3RK4A 2WU8A 1BMQA 3IOBA 2VAXA 1YVDA 4JEUA 4F46A 2IV7A 1XJQA 2KQUA 2QEQA 1JNXX 4M9RA 3T7JA 1W0KA 3T99A 2AS0A 2ERYA 2VP3A 4BNDB 1KMMA 3OLXA 5J2UF 5E4JA 4BOYA 1CW2B 3SZ3A 4Y9TA 2CHUA 2VTBA 4FOOA 3L43A 2ZJ6A 2PT9A 3NETA 2XR1A 2QV0A 5GINE 1RWKA 2EZ9A 4L5AA 5BRJA 4PZPA 1IWPB 1A5BB 1NI4B 1WR8A 3HJCA 4PQYA 1N6LA 3THRA 2R5NA 4XX1A 1JIIA 1V6AA 3UJ3X 4M86A 4OHWA 5H3HA 1Y6QA 1NKTA 3W1WA 1I6KA 2QYTA 3P5BA 4GC9A 2CBGA 5F2NA 3H75A 4OUDA 2PUJA 4PYQA 1JHYA 2II6A 3L4BA 1IN5A 2LKDA 4DV0B 3ZV4A 1ZIDA 3AYXB 1VIMA 4BYMA 5DK4A 1JALA 3HXLA 3KUDA 3W4KA 4DGSA 2FWRA 1G0OA 4ZK2A 2DQYA 3PDJA 2WJYA 5FEMA 3DMYA 1F9AA 3AWIA 2OCDA 4MIOA 2FWNA 1N0UA 3O9ZA 1NV9A 3AEUB 3GPIA 3ZLJA 4Y9DA 1E9EA 2NUAA 1NBIA 2CLEB 2VDNB 1BWQA 3ANSA 4X5OA 5TT0A 3P5SA 1CS0B 1ZCFA 4HFMA 4KZKA 1SKYB 2CE2X 4QATA 4Y2VA 1AHHA 3L4SO 1J2JA 2OORA 3COYA 1PX0A 2VDOB 4UZFA 5DOZA 1F8UA 1OLUA 4IBOA 4P4UA 5E8RA 2PUGA 2UXDB 3M33A 2BHTA 1TIPA 1IHOA 3QLJA 1ABEA 2ONYA 4J90A 2R1TA 3TD2A 1RCUA 3GHYA 4KDEA 4E4YA 2SECE 3I30X 5I7VA 1KQPA 4GF5A 1HDXA 4YFVA 1J4AA 3GCDA 3LDFA 4N41A 3L1HA 1JIKA 4IJ6A 4QU5A 5IC6A 4KUHA 5CVTA 4REQB 4B1FA 4KRGA 2NSLA 2Z1DA 4LJLA 3L9XA 1ZHHA 4C4OA 3BZBA 1H8EA 1UEXC 3GJ7A 1U31A 2WJ3A 4L16A 3K16A 4W1RA 4ZPJA 4QLAA 1MB3A 3PDWA 5T64A 2AH5A 3UT5A 4BNIA 2BR5A 3SZRA 2GTIA 4O4JA 4ILEA 5JJCA 1ZICA 3IT3A 1XRRA 3OI7A 2YCBA 1IY1A 2BKXA 4UPDA 4XIGS 2NU6A 4CMKA 5FQNA 1KAGA 3AU9A 2O2GA 2WZBA 5BN1A 1ORIA 3ADBA 2QK4A 2QWXA 3K0KA 1J6UA 2HHCA 4RJJA 3P0EA 3HBFA 3DAPA 2QG4A 4D2IA 2Y0PA 4ER0A 2WPDA 4W5WA 2F43A 1KBZA 1PO7A 4RWZA 3KAPA 3DYVA 2C2OA 2VWPA 3I9JA 4MVJP 4UZSA 1CG6A 1N2HA 4ENVA 5HPYB 1U1DA 4XIYA 5KYVA 2JAQA 3HMQA 1XTBA 4D8TA 1PR0A 5ES3A 3K4PA 1C7ZA 2ZRLA 3LCCA 4JT9A 4OQDA 4COKA 2BH9A 3T1TA 2NUAB 5K1ZA 1QGDA 3T3OA 3ZQJA 2GPNA 1K8YB 3MTGA 4P34A 1AUVA 3IAUA 5DMXA 4U7GA 1XZDA 5CB4B 4B6JA 4DQDA 3FHTA 4BJ5A 3NTXA 4Q4CA 3U3KA 4DR4B 3VNUA 1N32B 2IUSA 1XMVA 4YNBA 1UXKA 4HZGA 3A7EA 1LPNA 3F46A 3JWPA 3TZBA 4RVUA 4FNAA 4MULA 1SHLA 3KDPA 2PZJA 1QIIA 1A98A 3T3MB 1TA9A 1YS9A 4YMVA 1T9BA 3DGFC 3A3OA 1IQ0A 4ZC1A 4C7JA 2IQ5A 3NGLA 4L1KA 4GGPA 3GP3A 1CZLA 2H5LA 4BVAA 1OASA 3W5DA 1GVNB 4M1SA 3FTDA 3PIDA 2QRZA 2QTMA 4D5GA 4EA7A 3KKEA 4DA7A 4FFDA 7ABPA 1LDGA 3IBTA 1BRTA 1KORA 2XMBA 2EJCA 1FDWA 3OFND 4MR8A 1WPRA 1H2ZA 4ZHQA 3EH2A 5BUSA 3DAHA 2HMVA 4JKYA 4ZOLA 2JLAA 1XTQA 1EFAA 1WIWA 2XMDA 4NENB 2J09A 3KUCA 4HZUA 3T3DA 2DVMA 1UKBA 1W88B 1BX1A 2AXQA 5HQJA 3RVJA 2H1CA 4ZAFA 4HFJA 3WXMA 4C4SA 4BN4A 3NRJA 2HRDA 2AW3A 1BHO1 1HFKA 2JFGA 3AV0B 2AEMA 1XVLA 4B4DA 5JH7A 2R2AA 2PR2A 5A0VA 5D8DA 5EZYF 4G0WA 1E6KA 3GNSA 1KJQA 4CBVA 2Q3HA 4J6EA 6GPBA 1FMJA 4NFHA 1UBUS 1YULA 2TS1A 4QPZA 5HKLA 1OB5A 5JNSA 3QELB 4G67A 3I5MA 4A27A 4WBNF 1P5JA 1NRWA 1EFVB 2E48A 3GRCA 1DKQA 1PFWA 2C2HA 2I66A 3K0AB 2AI3A 4M37A 3A27A 1X1DA 4QJ4A 3LFUA 1SVKA 2GM9A 1ENOA 2OZEA 2R9VA 4DDVA 2F4NA 1VBMA 3PGVA 5EEGA 5FUYA 2GD1O 3TRIA 2QDKA 2O3TA 2OMKA 4IF4A 1ZM2A 2ZITA 3QU2A 2WD8A 3K2IA 3B5JA 1KP2A 3NT4A 4XUGB 2XWJI 4M8NE 1UFRA 1IXYA 4G07A 4H7DA 4CM8A 1E6WA 1RKBA 1X15A 2UZAA 3QUQA 2CJWA 2B4KA 4G5XA 4KP7A 4UVDA 5ALFA 2VK1A 1W5AA 2GXUA 2G70A 4QHYA 3D8TA 3H2GA 5TQ0A 3ZDAA 2NU8B 4HWPA 1Z47A 2DAPA 4IIFA 5EZSA 2CC2A 2DR0A 1XKQA 3RM3A 1CUCA 3TKAA 1FK8A 1FFHA 3LQ2A 4PRKA 3R75A 2ZR7A 3I83A 1J5EB 2IBTA 2GJ9A 3PIRA 1T2NA 4XUEA 3K9LA 1W88A 1U6KA 1USWA 2AOTB 4NBRA 2IHYA 1TRHA 3TL3A 3RAPR 3QKRB 2JIPA 1NM5A 5DX0A 4BFYA 1JEYB 3N0WA 4BCBA 3ZIAD 1PD1A 2VT3A 2WQZA 3LQ1A 2JIMA 1KMHA 1TUBA 3WRYC 3DT9A 4QXRA 1A7AA 5HF6A 3QFSA 2XDQB 3QKUA 3WI7A 2XVZA 3EDRA 2A9FA 4E2FA 4URZR 1DAGA 1PIWA 2Y93A 4TXNA 2DEUA 1QU2A 1Z4OA 1FIUA 2XE8A 1L5YA 4AUEA 2QJTA 1FS6A 4LC0A 2C58A 3ZQ4A 4BVJA 4YP6A 2WILA 2A0YA 1MF7A 5IDWA 4II3A 2VNAA 4MKHA 4XASA 2YMLA 5T6BA 2QROA 3F74A 1EZ4A 3H1FA 3ICCA 1Z2OX 3MWDA 1B2LA 4M0LA 3RT9A 1Y3BE 4CG2A 3I04M 4X62B 3QOYA 1QRTA 2IRWA 3HCFA 2AIRA 4FS3A 4TV9A 3JU3A 3QVJA 1XNQB 4R31A 1JJBA 5JD5A 2NTEA 3SI7A 4P5EA 4YT2A 5CD9A 1RKVA 1Z68A 5IWAB 2MSDB 2Z5FA 3OLCX 2XJ4A 4LXHA 1QIHA 1UJ5A 1YHYA 3FVTA 4NSNA 3VTZA 3L1IA 2AJDA 3RVPA 2QX8A 4AN1A 4B3IA 1GQFA 3QNWA 4DCCA 4FK8A 4I2NA 2IZ7A 4FYWA 3I32A 1NWHA 2AOWA 1HZZC 1XMXA 4BZZA 2G3YA 1TXGA 3VR6D 2CY0A 1FNCA 1YZTA 1VJDA 1E9BA 1MZVA 1NZFA 1VLLA 5E7IA 1YI8A 3A9CA 4PG6A 1TRKA 1JDJA 2VYQA 3KC2A 5EE9A 5GZ3A 2O5EA 4EPRA 2PEZA 3Q3GE 2DQ4A 1EUCA 4N40A 5D3ZA 1T26A 4EG7A 1HLFA 1L5NA 3KXPA 5MHTA 4M8LA 5A2QA 2NTVA 1RM4A 4DN6A 2BEUA 4BPBA 4W5HA 3MCVA 3HXPA 4YVFA 3V8BA 1KI4A 4F5DA 3UTCA 2O7VA 2AK3A 1VRCA 3IUPA 1XKLA 1FXWF 1KETA 4KIGA 1PG0A 3D3QA 5HG0A 3GRYA 5FTKA 4Z54A 4LWPA 4WJKB 3WS7A 3KL2A 4PHTA 3G0IA 4CEJA 1S01A 3NBMA 2QORA 2FMXA 1DHRA 4HUJA 4WUVA 1ZMBA 4AJJA 1KKUA 5SZKB 4DR5B 5FBRB 1JAYA 2YY5A 3CH4B 4CF5A 3UHPA 4R7GA 1KI6B 3G88A 2CFIA 2XUPA 3CEMA 1V6SA 3CUSA 2D4HA 2RG1A 2YOHA 3O94A 3SF8A 2VSQA 3ZE6A 2YZMA 2ZTHA 4FT4A 4YALA 2O7SA 1LNSA 4B33A 4OGWA 3THXA 1M1UA 4KK4A 1YA8A 3QVMA 1ZYUA 4ZA2A 3ZCQA 2YFHA 1AKRA 1LNQA 4MR9A 1HTBA 3I2GA 4JBNA 5EJMA 3WNZA 2WSSD 4L0QA 1ABBA 2FPPB 4B3MB 3M6VA 2EX0A 5CM9C 1HE1C 5TMBA 4M9UA 4CM3A 1T15A 1XQWA 3QF7A 4IV0A 3AVUA 3OZEA 3ENZA 3ZDXB 2P4QA 5LQKA 4Z4FA 1F7VA 4MYDA 2B78A 3TQOA 1UP4A 1EVEA 2HSZA 4YTEA 1XVUA 1GFIA 1JR2A 4ND8B 1E5DA 1M34E 2WNIA 5ARDA 3KALA 4CTNA 1RCFA 3JQDA 1YFJA 3ITKA 5F73A 2YFYA 3EQ7A 2XF2A 4INJA 4J4HA 4WASA 5AMXA 5LA6F 3W1VA 1OIWA 1TT7A 3BPSA 5EXSA 2PMKA 3STXA 3T7CA 4OYYA 2X0KA 2WDZA 1NE7A 4PAGA 3SQDA 4B75A 4D9FA 3LY7A 3WGLA 3DTTA 3LFHA 5UKDA 1QPBA 4ER6A 4LQ4A 3TDKA 3OQMA 4M1EA 2QP9X 2FDXA 2CJXA 1KI2A 3Q72A 1WNTA 1Y9DA 3PPXA 4P3NA 3KDSE 4EKIA 2Z6QA 3NIGB 3WBJA 1HO3A 4YP5A 4D56A 1PNVA 3S1AA 3QV2A 1NN5A 3ELUA 4ISBA 5FFMA 4DR7B 2CXRA 2MHCA 2BEKA 3ZN2A 3OIDA 5J4VA 1NJ1A 4YRJA 4AZ3B 3T4XA 4QDXA 4MKIA 4V2IA 1T6ZA 3NBFA 3FCCA 2RHLA 4QUKA 2EGGA 3CKKA 3PR3A 3E9YA 4WVLA 1Y34E 3W5VA 4DEYA 2N46A 5L6MB 4YJHA 3QHAA 1XDSA 3W2HA 1AUQA 4QIHA 1JT9A 4PYNA 2KW5A 2GN4A 3GWGA 1WL8A 3RF6A 3UENA 5I5EA 4JA0A 3O1JC 2EIHA 5YASA 1LVGA 1MAAA 3RT1A 3IXLA 1FLAA 3V7FA 4A8HA 4WFIA 2QN1A 3W05A 2P1ZA 4YGXB 2OBXA 5B7NA 3RRZA 4Y1RB 3NI2A 4KQ9A 2UVPB 5CM8B 3UJCA 1WCV1 2G6BA 1JHMA 4TTPA 2IXAA 3M4JA 4FDAA 1PK9A 1KVRA 2YWGA 4CMGA 3F4LA 3C6ZA 1YAJA 4ND6A 4RXUA 4CKBA 1GSHA 1KH1A 2GYYA 5C51B 3R8FA 3UNXA 3P4XA 1T4MA 4IGFA 4KUGA 5KNDH 3TBKA 3L7OA 1QFJA 4PFKA 5K4AA 5DNWA 3S1LA 3HKDB 3NWBA 2V5AA 3H1TA 4F4CA 4IWYA 4EO9A 2LWIA 3SS8A 3IEPA 4O0MA 4I55A 4TUYA 2LV8A 2ZXEA 4BGUA 4DA0A 2WYOA 2OVFA 2XV1A 2E4AA 3OF3A 4M6WA 5C8YA 4LWZA 4AQDA 2HZBA 4DR1B 2Y3IA 3GT4A 1IZ9A 4FR2A 1XRNA 2B4RO 2X1HA 4ZJYA 4TTAA 1VSQA 1D8AA 5FFFA 1K7XB 2GD0A 2CLHB 1KARA 3EGDA 3FPJA 5IVKA 3QE4A 2HRRA 4I46A 5TB5A 3FOAA 3O7MA 5I01A 4K81B 4RULA 1SQ5A 2XQFA 2RHHA 5LMUB 4D0SA 3KYDA 3B8EA 3BMQA 4NHOA 2PL3A 3NBKA 4X8MA 1BWRA 3GP5A 1JQLB 2JA2A 2XEDA 3ZI4A 3MGBA 3LI2A 1XXLA 2B61A 5HQTA 1WKCA 3DL0A 3UC5A 4ZI5A 2E6UX 3K73O 3L6BA 3UJDA 2Q5QA 3JR7A 3RUHA 3VBCA 1CZKA 2I1QA 1ECJA 4JLDA 3KRTA 3AJDA 1Z16A 3DEAA 4IMJB 5KYYA 4C9BA 2ZE5A 5FWNA 4D9CA 4I50F 3ID6C 5A4KA 3QIAA 4PONA 2D2XA 3BC1A 5TQ2B 3VAZA 4I3HA 5LR6A 2ZYSA 4J3FA 4JOQA 3TX6A 2XA9A 1H3FA 4XUCA 5GONF 1D04A 3DWFA 3PITA 4FHCA 4Q47A 3CM0A 2IV3A 2I91A 2D7CA 5CMLA 2H4FA 3ZHOA 1BQEA 1HE4A 2FLVA 4JJZA 4EENA 3UMMA 1ONBA 1JPUA 4IHQA 1DKPA 4H6PA 4G9GA 3W2GA 1HGXA 1KEWA 1AN0A 2Y1FA 3IKVA 1QVVA 4EABA 2DX7A 2IVZA 1VBNA 3GA5A 4O3MA 3IMFA 3F6CA 4WGFA 3CRZA 4YXFA 3LWDA 3PPIA 1EXMA 5EWLA 3ZCVA 3DBHA 4D98A 3Q8WA 4LSWA 4CEIA 1N6KA 3A14A 3IFSA 4P0PB 1FQKA 3IUMA 3TE7A 2GBCA 3TLGB 1G8HA 4MUMA 4UEKA 3FPEA 2K7ZA 2O9JA 5HIIA 1QQBA 4XFKA 3MYYA 3NBAA 3HPQA 3L6CA 4IFEA 2JI6A