3HDQA

Crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
total genus 114
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdqA01
3IP3A 2NVBA 3NV9A 1LTHR 3FR7A 2VRCA 4W6ZA 4O0LA 1R15A 2NU7A 2O4UX 4AJIA 1U3VA 4ONEA 4B79A 5JAZA 1A4IA 4LSMA 5T5QA 2DLDA 2AE1A 4XQEA 4CM3A 3TZCA 1P1HA 3DEYX 3HG7A 2XXBA 3C24A 3FNGA 4J16A 3IUSA 1IB6A 5A3VA 3QW2A 1E3WA 3M1AA 5KJCA 3JQAD 1RM0A 4RDIA 1NFFA 1I3MA 1V3TA 2I5PO 4H16A 3TNLA 1BG6A 1Q7CA 4JK3A 1VM6A 4ZQFA 2PA3A 2WTBA 2OP0A 1EVIA 4BNKA 2E48A 1JDJA 4CM7A 5HBRA 4Q39A 3G3EA 1XQ1A 5JSFA 5DNAA 5IDXA 3JQFC 3WQQA 4ZD6A 5JCJD 2NQTA 4RCVA 1F12A 4CM4B 4DUPA 1BMDA 3EW7A 1KYQA 1XKQA 3OA2A 4AJPA 1HDOA 1DLJA 1YXMA 3L6OO 3QRWA 4IJUA 3RIHA 2YHIB 2XPCA 4R01A 1XR3A 2D59A 4XYGA 3GRPA 1GEEA 3LSYA 4FGWA 5DP2A 2HCTA 2PLAA 1ZEJA 3OJFA 4D41A 2Q2QA 1V9LA 3B1FA 1GFSA 4I9NA 4J90A 5JO9A 2UAGA 4CMIA 1QLHA 5A9RA 1B8PA 2QRKA 2HO5A 4E31A 1LDYA 2ZB3A 4XDYA 1N8KA 2X9GA 4WEOA 3RUHA 1DAOA 4XYEA 4XA8A 1U7TA 1LDBA 5L40A 5IZCA 5H81A 1TEHA 2GO1A 1OBFO 4HP8A 4QFCA 1B14A 2BGKA 1BRMA 3AY7A 1BHSA 2HK8A 4BO9A 3GUYA 3JQFA 3E9NA 3CINA 4MDHA 3GH3A 1HDGO 3WYEA 2Y1OA 2AMFA 1JKJA 2JHGA 4N7RA 2RBEA 3ZW9A 4BKQA 2CVQA 1BXZA 3B20A 3DBLA 4YJGA 2BD0A 1HLDA 3WGTA 4XQ9A 4DXHA 2IZ1A 5L4NA 1SNYA 3D4PA 2PY6A 4KQXA 5KIAA 4TWRA 1O94A 4R16A 4PLZA 4L74A 4TKMA 3TOZA 4M89A 5JDIA 5JS6A 4E12A 4G65A 2A4KA 2G17A 1M67A 3HDJA 1O5IA 3MJVA 4O63O 3AI3A 4NFYA 4QSMA 2IRWA 4QX6A 4XWYA 1S6YA 1ZXLA 3CE6A 3DC2A 4R1TA 5ITWA 5JMWA 1L1FA 5LDHA 4EW6A 1NPTO 1B3RA 3ZHYA 2JFHA 4WOKA 2HRZA 3KYCA 4E0BA 1Z82A 1N7HA 1K89A 4WGGA 3ZU5A 3TFQA 1LDNA 1G6KA 1XIVA 1PX0A 3F4BA 4BNGA 4BS9A 3KEQA 2PH3A 3GZ4A 3ZWAA 2Y1EA 5T57A 3WGGA 3FN4A 1W8DA 3KYCB 2DM6A 4R5MA 5JW6A 4XRGA 3BZUA 1MP0A 1T2EA 5ADHA 2VWGA 1Y5MA 1SAYA 3RKRA 1O6ZA 1EMDA 1V3VA 1HRDA 1X7HA 1XSEA 3FTNA 3F47A 4J7XA 1QP8A 4Z3DA 3V1YA 1PSDA 1NASA 4YACA 2FSVA 2GDZA 3DZHA 1DEHA 3KOUA 1IUKA 5F1KA 4HFMA 4BHTA 3A1NA 4YT8A 4NBUA 2OOSA 2Z1NA 3ENKA 1AXEA 4BMNA 1FDSA 3HDHA 1HDZA 2CF5A 1PZHA 4YJGB 1MG0A 4XR9A 1NQTA 4JGBA 5HWSA 5MDHA 1P0CA 2O7QA 3H4VA 2NV6A 5DCWA 3GF4A 4W9NC 4B4VA 1PQWA 4LISA 5JLAA 1E0DA 1T2FA 1WVGA 3T7CA 2R2GA 1PJTA 4GWGA 5C7OO 2B4QA 3I6QA 2NNLD 1CWUA 1W4ZA 1J49A 1WNTA 4CL8A 1PWZA 2BH9A 3I9KA 4MVJD 3NTQA 4MO2A 2X0IA 3WLFA 4OKIA 3B1JA 3RUEA 2IZ0A 1DB3A 4Z3KA 1NM5A 4A26A 1QYDA 1QORA 2BGMA 1KVSA 3IKTA 1H9BA 3VDRA 4ALLA 3DDNA 3B6ZA 3F3SA 4NBTA 4XX0A 4NH4A 1M66A 3CMMA 3GEDA 5BNTA 3A9WA 5U9CA 4HV4A 1YONA 3B70A 1ZXBA 3GT0A 3AY6A 5L7TA 4EUHA 3TZHA 5A02A 4CV3A 3AU9A 1NAIA 4FGSA 1H6BA 3VC7A 1DRWA 3H9UA 4AG3A 1U4OA 4UUOA 4RPLA 4CMKA 1E7YA 3HFGA 5IJZA 4E2WA 4Q3EA 4YPOA 4LN1A 4CM9D 3X2EA 3AY3A 1YS4A 3QHAA 4C7KA 1BVRA 4MP6A 2O3TA 1PQUA 1YE3A 4HBGA 4IGEA 4JNKA 3N74A 5DT9A 1NVMB 3WR5A 4ZGWA 1JN0A 1NHWA 1RJWA 3F6YA 3SLKA 3D4NA 4DGSA 3JD3A 3HQ4O 2FZWA 3GOHA 1QV6A 1GAEO 1R0KA 5ER9A 3WJ7A 5DZSA 4M87A 1DIBA 4BGIA 2A35A 1V0JA 2JFFA 4GKVA 4YJFB 3ZWYA 3MTJA 1DJNA 1KVUA 2YV2A 3P5SA 5I9MA 1ZK2A 4P4NA 1YB5A 1VJTA 4PG8A 1I2BA 2JHFA 4D79A 1MG5A 4LRSB 1HL3A 2PKRA 4ZICA 1PS8A 3LT2A 5HM8A 3ABIA 1WW8A 1GZ6A 1LSSA 4C4OA 1PS9A 1R16A 2J3IA 3WMWA 2GPTA 1UXIA 4BGUA 4BNJA 3RUDA 2QX7A 4YRBA 1R4MB 2O4CA 1VC2A 2PH5A 3GMDA 2QRLA 4I5EA 2DUWA 3PYMA 3U4IA 2DAPA 2HMWA 3AUUA 1PWXA 3AJRA 1BSVA 4UVIA 3S55A 3AK4A 4YT4A 3CZMA 1B8VA 2D5CA 2NM0A 3SC6A 4XGKA 1PGNA 4YAJA 2I3GA 4K1LA 2VUTA 3TF5A 1LNQA 2GNAA 4NBVA 2W8ZA 4XIYA 2Q2VA 2JJYA 3JV7A 4JN6B 2GYYA 3EC7A 1ZCJA 5EIOA 3RFXA 1QLJA 4R54A 3UH1A 3K9QO 1Z75A 4XGNA 2NU8A 2JD1A 2RAFA 5F1OA 1IPEA 3O38A 5KWEA 5IN5A 4L4XA 1QV7A 2I66A 4Z0TA 3SLGA 3U0BA 4CM5A 1T4BA 1UP4A 1Y9EA 3L77A 4JIGA 5FFFA 3OJLA 3VZSA 4EYEA 1XGKA 3PPIA 1YOVB 3LZ6A 2ET6A 3ZNPA 1I8TA 3PLNA 2VUSA 5FYDA 3IUPA 2R00A 3VH4A 4QEDA 2YQ4A 4GVLA 4I5FA 3FHLA 4J9VA 4DQUA 2OBNA 5A04A 3GHYA 2Q2WA 2GF2A 3JD4A 4NDNE 3V2HA 1C1XA 3TZQA 1WAMA 1T1RA 5KVSA 3MOIA 2AHRA 1DJQA 4FB5A 2OUIA 4XJSA 1ZEMA 4L73A 2X9VA 3AUSA 4R68A 4IDAA 1Z73A 1NWHA 3OH8A 4M49A 1WDLA 1GY8A 1Y8RA 3GDGA 1DRUA 1MXHA 2ZYDA 3JYOA 4IDGA 1YQXA 2PZJA 1IHYA 1DBVO 5JPIA 5L4SA 3I9OA 2FP4A 3F5SA 4HFJA 3DFZA 3O4RA 4QT0A 5CPBA 4PLVA 4JP3A 3PQDA 1KS9A 1G1AA 4U8GA 4Y6PA 5IF3A 2IEDA 3JQ7A 3PRJA 1HKUA 4YRAA 1LBEA 3I5MA 5GMOA 2HJRA 3GPDG 3ROQA 5TGDA 1R4MA 1QYWA 5T64A 2JL1A 4AJLA 1Z45A 3ITKA 1O8CA 4EJ0A 4D46A 1HDRA 4M86A 1FDWA 1F0YA 2D2IA 3E6AA 3KYBA 1D8AA 1DIHA 3CH6A 4J91A 4WLNA 3A14A 4J1NA 2PV7A 4B7CA 2GASA 3PDJA 5BSFA 1BW9B 1O89A 3RD5A 4OHUA 1IULA 3O8QA 3DQPA 4XB2A 3KXDA 2PD4A 2V6FA 1NWCA 4BNVA 3I23A 4EI2A 4PRKA 2AQHA 4EITA 4RPJA 3VVBA 2IEBA 1RWBA 3BMQB 4ESOA 4MVJF 4AJ4A 1DC6A 2P68A 3FPCA 4YJHB 3DZIA 2YYYA 3WG9A 1K6JA 2YFHA 4PG7A 1TVEA 2OL4A 4NFHA 4XZ3A 2P9EA 4JX8A 1X0VA 5TQVA 1FJHA 4UREA 5I7EA 3S2EA 1LDEA 1IOLA 1LDGA 2P5YA 3JYLA 3W6ZA 1SEVA 3ASVA 3OM9A 1R0SA 3SX2A 3GVCA 2HRBA 3DZJA 3UGKA 1H6CA 1Z7EA 2VZ9A 5DBGA 3ONFA 4K28A 4FDAA 5ENDA 4YT5A 1LA2A 4RVFA 1X14A 3AM3A 3FTPA 2IODA 4YR9A 2VHVA 1ZBQA 4PG5A 1B3BA 3ZV3A 4EJMA 3R3SA 2I76A 4ROSA 1ISGA 2HAEA 3CTMA 1A7KA 1NQOA 4ALNA 1WMAA 4TVBA 3RASA 3IOYA 5ES3A 1K6IA 2ZATA 3ZWXA 4HADA 2PNFA 3DAPA 4M54A 4F45A 1GUYA 4BNYA 4GQAA 3K2EA 1UUFA 2J3KA 4BO4A 1PJQA 3GY0A 4PG6A 2G0TA 4YA6A 4NBRA 5AVOA 4RF3A 3MWEB 4WNIA 3M1LA 3S1LA 3F46A 3I9MA 3W6UA 4YBZA 3CPSA 4RVGA 1TI7A 2DPGA 2F00A 1VL8A 1YL7A 4ZU3A 3PFWO 1AHIA 1MB4A 3PFFA 4B4WA 2X5JO 2FY8A 2WD7B 3IIEA 1XCBA 2GD1O 2BFPA 4ZVVA 1K3TA 3I9LA 3RCBA 1G0OA 1VL0A 2NVUA 2YZ7A 3DOOA 5L7WA 4GVXA 3RC7A 3G17A 3WGOA 1UZNA 1BXKA 3QWHA 3RSHA 4CQMA 4GX5A 4Z9YA 4FOOA 5TIIA 3C85A 2DVMA 2H63A 5G0WA 1E3IA 3D64A 3A06A 3BTUA 4HKTA 5L4LA 1NR7A 4MIYA 1DRVA 1KVQA 2Q50A 2HMVA 3INRA 3QV1A 3B1KA 4BV9A 5A9SA 3AWDA 1B26A 3GNQA 4S1VA 3L6DA 2WJPA 3GG9A 3KO8A 1X13A 2IYOA 2J3HA 1B15A 3JQ8A 5ICMA 5G2OA 2JD2A 4TZKA 3I4FA 4CLDA 1DC5A 2C7GA 3JQEA 3HSKA 5A5EA 3MJSA 4RQUA 3U4CA 5CEFA 4NU6A 3KZVA 3BMNA 5CHEA 4I9UA 4BO5A 3R3JA 4L9RA 1MFZA 2YHUA 1PR3A 1MC4A 1SCUA 2CMDA 3DB2A 4UEOA 2O7SA 3DBRB 5G4KB 1ENPA 3H5RA 1OMOA 1MUUA 3AFNA 3ZWVA 4K6FA 6ADHA 4P4GA 4FFRA 1DHTA 1OC2A 3EK2A 3ZN2A 3IJRA 3KUXA 2I65A 2VYNA 1U5CA 4LVCA 1Y1PA 1C0PA 5JY1A 1HLPA 4YT2A 2Z5LA 4RF4A 2FPIA 1PIWA 3PHIA 4G2NA 2HMUA 3DFUA 1QMGA 1NYTA 2FN7A 4NPCA 4KWHA 1SBYA 1DOHA 3H2SA 4FSHA 3FD8A 1GTMA 2X0NA 4MVJI 5G4KA 4FS3A 4O1MA 2VT3A 3GVHA 3OECA 1U4SA 4EEZA 1ML3A 1T2DA 3GVIA 4L8VA 4OGWA 3WNVA 4PZCA 3KHUA 3NEPX 3PGJA 3GUCA 1TT7A 4DLAA 1DFGA 4PIVA 3VKUA 3HADA 3RUFA 4BNXA 1K6XA 4GSKA 4DMMA 1M2WA 3PJEA 1CERA 3NT5A 1H5QA 1PGOA 1Y81A 3UVEA 4A73A 1EUZA 4D44A 1ENYA 2FR1A 4DTIA 2VYND 1SO8A 3JQGB 3K6JA 4JP2A 3EHEA 3CUKA 1Y8QB 2Q46A 1UDBA 4GMFA 4LRTB 3ZH2A 3SVTA 4CJXA 1HSZA 1ZK0A 3IC5A 1Y8QA 3MOGA 3TZ6A 3ZV6A 2Z95A 3RUIA 3KB6A 4CMIB 5KVQA 2C59A 2BGLA 2IYPA 1H9AA 4J7CA 4M1QA 1ONPA 3TJRA 1ENZA 2C5AA 4AJ2A 3H9EO 2BI7A 4PLYA 2LDBA 1VPDA 3PP8A 4FFLA 1VRWA 4KUHA 5AXBA 5EINA 3K8ZA 3Q9NA 3P2YA 1YQGA 3PWSA 3KYDB 4JBGA 1M76A 1J4AA 4INAA 2XF8A 3TZKA 4JJGA 3UCXA 2DFVA 5ENVA 4YXFA 3UICA 2EV9A 1D3AA 4PLPA 2VOEA 3Q1LA 1GYQA 1HSOA 2EJWA 4WLFA 4CM8B 4PLWA 1P1JA 1ULUA 3NKLA 2Q3EA 4DQXA 4YWJA 1VSUA 2D4AA 4QO8A 4QQRA 2PZKA 2V65A 5ILOA 1XU7A 2FWMX 5ICSA 4Q3NA 3KRTA 3RUCA 4TRNA 1BWSA 3PWZA 4NJMB 1XWFA 2HK9A 1DSSG 4IS3A 3UOGA 3KSZO 3AOGA 4IMRA 5TLSA 3EZLA 4NK5A 1DLIA 3JD0A 3OIFA 4IBOA 3DBRA 1NNUA 2Y1CA 4I8XA 3D7LA 4M8SA 4IQ0A 2CNBA 4HFNA 2B5VA 3V5NA 3BMOA 3FWZA 4G81A 4R41A 4OQZA 4UULA 3PJGA 4LVUA 5DOVA 1YJ8A 2OXIA 2NWQA 3ONEA 3KTDA 3AI2A 1N2SA 4TSKA 3JQBC 5LDGA 1KOLA 4DPKA 2QYTA 3JCZA 3PZBA 3ICPA 5A9SB 5T67A 3HN7A 2UUOA 1C3VA 4CLHA 3Q11A 5B4VA 1X15A 2PD3A 1BXGA 3Q6IA 1OC4A 5TS3A 4K6CA 3OJOA 4D0SA 1B7GO 3DTYA 3LLVA 4FC7A 3GVXA 1U2DA 1GQ2A 1TT5B 3LDHA 1JAXA 2WYWA 3BMQA 1PJ2A 4J2OA 5T6BA 3ROKA 4ND5A 4TKLA 4WCFB 3WFJA 1YBMA 1OFGA 5FI3A 2NVUB 3BMCB 3KSDO 1E3SA 1V35A 3PI7A 3GR6A 4YAGA 1NXQA 3WB9A 5L95A 3EYWA 5CDSA 4U5QA 5TC4A 4DLLA 3E9MA 1CEQA 3M2PA 1XYGA 4DYDA 2QHXA 1EDZA 1KVRA 1H6DA 2W2KB 4RVUA 5IG2A 1BVUA 3WDSA 1I32A 1EFKA 1P1RA 1GYRA 1T24A 3NDJA 1IYZA 4GH5A 4IUYA 3JSAA 4BMSA 4GKBA 5CDGA 3ZGYA 3NAQA 1YL5A 3U62A 4XEHA 4OQYA 4B7XA 4BO7A 1XELA 1PJSA 2JAPA 3IQDB 4PLCA 2JCYA 1AUPA 2ZB4A 1L7DA 1LSJA 2CDCA 2FRDA 2HUNA 1DXYA 1LRJA 3MEQA 5COBA 4CV0A 2J3JA 2J5QA 4WLVA 2W2LA 5B4UA 1XU9A 1HE5A 5CAEA 1R12A 4BNZA 2NUAA 5L3ZA 1T4DA 5LC1A 3ON5A 4PFJA 3H9QA 4WOJA 4PLFA 3EVNA 3UFXA 3MJ4A 2VT2A 4NJMA 2HQ1A 1ZUD1 5F3RA 2YW9A 2GN8A 2QIOA 4I5GA 3JD2A 2P4HX 1GQYA 2X8LA 3W4JA 4DMLA 3WIDA 3TL2A 3EUWA 5I8ZA 3FCOA 5IZCC 1PGQA 3GFGA 3TN7A 1DAPA 3ZWWA 3OMLA 4CLXA 1GPJA 2B4RO 2WE8A 2DBQA 3RU9A 1ADFA 4OXNA 4U0KA 3U4HA 1YOVA 4WECA 4R5HA 1E3LA 4YAKA 1JKIA 3WFIA 4HY3A 3GAZA 2YDXA 3W4KA 2HDHA 3ZHBA 1EUCA 4HNHA 2NLOA 2P4QA 4XR4A 1JLLA 3JQDA 3KYDA 3TOXA 2D3TA 1NPDA 3GFBA 4FFPA 1LC3A 3LC1O 4MVJP 1XG5A 4WEQA 3D3EA 5I9NA 1P33A 4R69A 2WWRA 3OP4A 3NGLA 4Y98A 2X0JA 1N1EA 4C7JA 5FEUA 4MVJH 5C7IO 4GBJA 1QYCA 5L45A 2P9CA 5G0VA 3WTBA 3ZWNA 2YY7A 2VYVA 1HZJA 3M6IA 1HYHA 4GI2A 4CQLA 4JJIA 4CMJA 1XA0A 3JQAB 4ALIA 4RF5A 4ZRMA 3G49A 4DPLA 1K0UA 2C2XA 4ZN6A 1QG6A 2EG9A 1QR6A 2IXAA 1NFQA 3SJ7A 4Z9XA 3UCFA 1AHHA 2IZZA 5B1YA 4WUVA 3C3XA 1ADBA 2ZCVA 3AUTA 2DKNA 3OQ6A 2AXQA 5C37A 1QYXA 3PYXA 2EP7A 4W9NA 4EBFA 3ZWPA 5BSGA 1VL6A 4OOEA 1RYEA 1ZH8A 4BNIA 3RUAA 4OL9A 1A7AA 4CQMD 2R6JA 4TRJA 2X5KO 1P77A 2G82A 3BAZA 3STHA 3U49A 2OGUA 4Q9NA 4Z6KA 2OORA 1P45A 2IDZA 3ETDA 3QJ5A 3K31A 3SXPA 4D3DA 2VZ0A 1GZ4A 1V3UA 2WDZA 3WGIA 2EIHA 1I2CA 4U0JA 4BKUA 3DZFA 4HFRA 4QXMA 3C1TA 1CETA 3GA0A 3PZRA 3QVTA 3Q3CA 1MXFA 5H82A 1AGNA 3DMTC 4AJNA 1GCUA 2ZJ1A 3JD1A 5IN4A 2BKAA 3D5TA 5CDYA 5EERA 4NHEA 4CM8A 2PZLA 4BO0A 1ID1A 3DHYA 4CL3A 1NFRA 4HX5A 4IS2A 4YRDA 2O3JA 5BR7A 3FR8A 2RH4A 4CLEA 4DQVA 1WPQA 1GR0A 1PZEA 2BFAA 3BMNB 1Y6JA 5JO0A 4F6CA 4LGVA 5C7LO 3PIDA 5DP1A 2WD8A 1YL6A 3UW3A 2BHLA 4RV9A 3HDYA 1Q1NA 1A72A 1HZZA 1YBVA 3DO5A 5CEJA 3LT4A 3ZU2A 4TZTA 1I2ZA 2IXBA 4EGFA 5IXSA 4FN4A 5EMHA 1N5DA 4JJFA 4W7HA 5KCZA 1P9LA 4E32A 4BGEA 2FSSA 3QWIA 2GGSA 2ZTVA 1KIFA 3NTRA 2XXJA 3LVFO 3E82A 3MWDB 4BMVA 1A5ZA 2JCXA 2SCUA 2AG8A 1CJCA 3EY4A 4UVDA 3JQ9A 1H2HA 2HKIA 4NQZA 3GN2A 5DCUA 1UXHA 4KMSA 1FF9A 1NPYA 5C3MA 4CV1A 4ND3A 4FFMA 3GDOA 4IQGA 5CPFA 4BL5A 1Z7BA 1E6EA 4DIFA 1QRRA 2ZTLA 3CKYA 3ZWMA 3TRIA 2GZ3A 5DOZA 3BTSA 3LC7O 2VQ3A 3U9LA 2NVWA 1ADCA 3GRKA 4KZPA 2O23A 3NT4A 2B37A 3H8VA 4DIBA 3AI1A 3K2BA 3TSCA 4IINA 4NK4A 1P74A 4NMHA 3TL3A 3RAJA 1JWBB 4CMEA 1MGOA 2CZCA 2C54A 4NJOA 3F5QA 3DOCA 3K92A 2RHRA 5DDIP 3QVWA 1VJ0A 2X23A 1GV1A 3G1TA 3GMSA 3RKUA 2AQIA 2VRCD 3UUWA 4XB1A 2JFGA 2J5KA 5BT9A 2B4TO 3NDRA 4B4OA 5MGBA 1JTVA 3RJ9A 4AJOA 4JBHA 2OMEA 2P2SA 2DPHA 4CUZA 4XQCA 4GSLA 1N1GA 2ZK7A 4RPKA 1EFLA 3PHJA 1WLYA 1QKIA 1ZK1A 4A2CA 2NTNA 1OAAA 2Q45A 2PWZA 2VTEA 4PLHA 4YVFA 1FDUA 4PGFA 3MJEA 4HUJA 3JQ8B 2QRJA 4W82A 3RROA 3RVDA 4TROA 1ISIA 4YQYA 3OQBA 5KKAA 3RC2A 1H0KA 3Q0EA 3QVXA 4OIMA 4OSOA 4P22A 2X4GA 4Y8VA 3OJ0A 2A92A 4IM7A 4E2YA 2GN9A 3DZKA 3ANNA 2EP5A 3NGXA 2BLLA 3E1KA 3PYLA 1O95A 4XYMA 1MC5A 4N18A 4FJ0A 4FCCA 1Q0QA 3O9ZA 3PIIA 4XGIA 1LLQA 1AE1A 2OO5A 3AUAA 4IDEA 4CQMB 4BIIA 1MX3A 3FNEA 4D7AA 4HWKA 5GY7A 4IPTA 3ZU3A 2XAAA 1ARZA 1ZMTA 1PTJA 2B83A 4H3VA 1T26A 4I9HA 3NTOA 4KWIA 4EJ6A 1T1SA 1I3NA 1L7EA 1ADGA 1TA4A 5B37A 2W4QA 4IZIA 4XD2A 5BSEA 1I10A 4ALMA 1GPDG 4AJJA 4FQ8A 2Z1MA 1DDOA 1DPGA 3EAGA 4S3MA 4D45A 4MVJE 1DHRA 4KTVE 2PKQO 1LRKA 3WYCA 5CG1A 4Z0PA 4NBWA 2BELA 1KEUA 2FZEA 5TSDA 3W8DA 4LCJA 1U3TA 2DTXA 2EGGA 2G5CA 4R3NA 3WNQA 2QW8A 2VNAA 1H94A 2GRAA 1U2GA 4ND1A 3VKVA 4IGFA 3JQBA 4NU5A 3DZBA 2TMDA 3HWRA 4Q3CA 2ZTMA 1C1DA 1M6HA 1ENOA 1JQBA 1XDWA 2CVOA 1Y5RA 2B35A 2CUKA 5JNLA 5EN4A 4ZQHA 4G5HA 4OOFA 5JE8A 1YO6A 3VH3A 2O50A 4R51A 1C1XB 1X0XA 3P7MA 3S2GA 5DCYA 1RYDA 4BO1A 4E5NA 1D1TA 2C0CA 1A9YA 5TF4A 4CM4A 3R6DA 1EVZA 4LMRA 5AXDA 4A10A 4F46A 4FW8A 4XIJA 4AJEA 1E7RA 3H5AA 4E13A 2OZPA 4MP3A 4JCOA 4NFSA 4R1SA 4EUFA 2VUUA 1PJBA 1GD1O 4RPGA 4B4UA 4LSWA 3SJUA 3E5RA 5JYEA 1J0XO 5KNLA 2PGDA 1EZ4A 2WMDA 3ZHZA 3A28A 5U4QA 2HMSA 5CDTA 4UVEA 2JAHA 3ADOA 4BNWA 1I0ZA 1W0CA 1JAYA 1Q0LA 2BI8A 3DL2A 4HNGA 3I9JA 5EJ2A 2UV8A 4BO3A 1HDXA 1R6DA 4PRLA 3QVSA 3H7AA 4I1IA 1GDHA 2Q1SA 3QWAA 1ISHA 2GZ1A 4WPGA 3PHHA 2EERA 3C7AA 2EW2A 3I3OA 3WIEA 4GX0A 4CR8A 1BW9A 2QG4A 4BNUA 4D0RA 4XJTA 4RLSA 4DREA 2HSDA 1E3JA 2ZIZA 1ZW1A 4XYBA 1PZGA 1A27A 2J6IA 1F14A 1I24A 2ZCUA 3OETA 4GGPA 4BUCA 3O26A 3U3XA 3RU7A 4CLRB 3ETEA 2EKQA 4EUEA 1P0FA 1UZMA 5JFOA 4OH1A 1YWGO 5GZ3A 2DQ4A 3ZNNA 3NT2A 4R9SA 1RM5A 3N58A 1DIAA 2A94A 4CQLB 3UCEA 3DAGA 3BIOA 5T8KC 1GEGA 4J0FA 3ENNA 1QXSA 4WLEA 2CVZA 1YJQA 4E30A 4WE3A 2V6GA 3ZDFA 2Y0CA 2EW8A 5KJFA 3D5QA 1F06A 4AVYA 1MV8A 2PGJA 4J49A 1I36A 5DBIA 3WSVA 3NX4A 1X7GA 4MP8A 1HE4A 4IXTA 1F8FA 2EWMA 3HFSA 3MZ0A 1HE2A 1U1IA 2GN6A 4H15A 2V6BA 2RH8A 2Y1GA 1X1EA 4DL9A 4MKZA 2JD0A 3SC4A 4DYVA 1LLUA 3WICA 4KOAA 4WASA 5TT0A 1KEWA 3JQ6A 5B4TA 4UVHA 4KUEA 3Q2KA 3V2UA 1CQIA 2D1YA 5AOVA 3LLSA 1D7OA 5JDCA 1E3WB 1HDYA 2V7PA 2WSBA 5AYVA 1RKXA 1CF2O 1NP3A 3I1JA 4GGOA 3ZWBA 3VPXA 4E5YA 1O9BA 3EZYA 2YV1A 5IDQA 3PEFA 1LJ8A 1TXGA 4MKXA 2ZYAA 4FD3A 4BO6A 3F4LA 3ASUA 5IAAA 4RORA 5A1TA 1WDKA 3ONDA 3S2IA 5A5FA 5JBIA 1YQDA 4URFA 8ADHA 3INTA 5LCXA 2BFMA 1GU7A 4NI5A 4BKRA 1AN9A 3RBZA 2ZB8A 2DTDA 1IPFA 3HHPA 2FPGA 4PVCA 1ISJA 4M55A 3LF1A 4U6SA 3AM5A 3OQ1A 1J5PA 4DPMA 1VKNA 4ZJUA 1VKOA 4NIMA 1I3KA 3GC6A 3S2FA 3KVOA 4CPDA 5BQFA 1E6UA 2H1SA 4MIEA 1E7SA 1PJ3A 2VN8A 5F5LA 4B8ZA 1ZIDA 2DBVO 3ICCA 4WCFA 4EZBA 1N92A 2O3RA 2BF7A 4XDZA 4Y6RA 4FC6A 3ADPA 4YEDA 1R4NB 4BQRA 4FFOA 1BXGB 1ZSVA 4YJFA 3JYNA 4FBGA 4ITUA 3GVPA 1GYPA 4XCVA 1U3UA 3ZZNA 3OHSX 5IDWA 3DONA 2UDPA 3RC9A 1RPNA 3CIFA 4N5NA 4N5MA 2DBZA 3WYBA 2UVDA 4GWKA 4UUPA 2GZ2A 1KEVA 2DFDA 4CR6A 2EEZA 4QFDA 2VWQA 5T8KA 3WXBA 4BKPA 3L07A 1UDCA 3IP1A 5CG2A 2WM3A 4MKRA 1MFPA 4MPDA 5COAA 6LDHA 1E92A 4KP7A 1YDWA 3LQFA 1FK8A 1ZO8A 5A9TA 1NQ5A 3LK7A 4UAGA 2GR9A 3QWFA 2AQKA 1I5RA 1Q0HA 1EDOA 2PR2A 5AXCA 3U09A 3WOHA 1F17A 1ZNQO 1ZFNA 3K96A 3QVOA 4FJ1A 4HXYA 1P1FA 2D5AA 4BV8A 4E4YA 1LEHA 3PLRA 5THKA 4BKOA 4YTEA 4J1SA 1SOWA 3MJTA 2FMUA 1LX6A 4WCFC 4QO7A 2CDAA 5EQFA 1YDEA 5HTOA 2X22A 1KBZA 1O0SA 1A4UA 3AFMA 4OXKA 4U6QA 3UXYA 3DMYA 4CMAA 2Y68A 3WBFA 1ZKMA 3AU8A 2Y67A 5TX7A 3LF2A 4FPXA 2CDBA 1VI2A 3WGQA 3RFVA 1XQ6A 1WZIA 1OI7A 2DTEA 2GLXA 2Q4BA 1U3WA 4I08A 3ORFA 4ILKA 4ND4A 1LXCA 1LLDA 3GAFA 1IL0A 1NX6A 1BDMA 5IFLA 5K0ZA 1D1SA 1Q7GA 1CYDA 2Y0DA 4R3WA 3ZWCA 1S7CA 4ZQBA 2OHXA 4GAEA 2EXXA 3GK3A 4TMFA 2ZJ0A 2PZMA 2ZYGA 1FXSA 1YB4A 2VOJA 3QE3A 1E1NA 1JU9A 4RPHA 2CD9A 3D4OA 1ZK4A 2EHDA 4J4TA 3VOSA 2ZQZA 3HB4X 9LDTA 2HJSA 1Q2XA 4IQ8A 5BSHA 1PJCA 3NJ8A 3FBGA 2O2YA 4MIOA 2Y66A 1ONOA 3E48A 4D3SA 3I9NA 4J7UA 1YBAA 4AICA 5ER6A 3BYZA 5L51A 3BXXA 4YQZA 4GX2A 5BNIA 1SEPA 1TB4A 4DIOA 2AA3A 3HDQA 2C20A 1CIVA 4N5LA 2RHCA 5L9AA 3GQVA 3IJPA 3DOJA 3HB5X 3K73O 2HK7A 3QWBA 2X0RA 2Y05A 4ZRNA 1NVGA 4J43A 4CMGA 3E8XA 1W6UA 2CF6A 1WZEA 3PGXA 3WS7A 3TFOA 3WTCA 4PN3A 3C7CB 4PLGA 4CLOA 4EEXA 3GLQA 3RBXA 3VZQA 4FJ2A 1V8BA 3RI3A 2B69A 4W4TA 1JVBA 3INGA 5EL0A 2W98A 1ZJYA 4E5KA 3FSRA 1JWAB 1U5AA 3DBLB 3P19A 4OKNA 1P44A 1EK5A 2EJVA 3K5PA 3QA9A 5JC8A 4BNMA 3PTZA 3JQCA 2YV3A 1KETA 2RCYA 4WCDA 4E3ZA 5A06A 4E2XA 3OIGA 4BOYA 5HA5A 4BB6A 3AM4A 4DVJA 3FNFA 2H5LA 1C14A 3DBHA 3GZNA 2NACA 3HZZA 1HYEA 4UEKA 2I3AA 4BNTA 7MDHA 2G76A 4D42A 1LQUA 3WBBA 1PJLA 3OA0A 1IZ9A 1E5LA 2EGHA 4BNFA 5HRUA 1ISFA 1PL8A 1LI4A 3GNSA 5U1PA 5I7VA 3PJDA 4XKJA 5I8WA 1GUZA 1ULSA 1EQUA 4ZQEA 5K6AA 4E2ZA 2EKPA 2FR8A 1LUAA 1XHLA 3K30A 4BNHA 2O3SA 4DA9A 5KTKA 3SBOA 3KEOA 2Y99A 1B8UA 2QZ9A 4WNCA 4IJWA 1P1IA 2YHIA 1H6AA 5EQDA 3T7EA 2P9GA 5K9ZA 1PGPA 3G1UA 1B2LA 4O6VA 1M6WA 1HYGA 4EDFA 2O48X 3IL2A 1UP7A 4E5MA 3I52A 4A5OA 2X58A 1SC6A 4W99A 3WGZA 4P4LA 2CY0A 3DAFA 4ZA2A 4BNLA 5HS4A 4MJLA 1FDVA 5CP8A 3WLEA 2VHXA 2E6UX 1U8FO 4OMUA 5KVCA 3ROPA 3WWYA 2WEKA 3VPSA 4Q3BA 4J1QA 2GERA 4DWVA 3IMFA 4WJZA 4L0QA 5TRTA 3H3FA 3HNPA 4OM8A 3L4SO 3ITDA 4RO0A 3OBBA 4LCEA 4U7WA 4BO2A 4GLOA 1HE3A 1UP6A 1B16A 2I9PA 3WSWA 2AQ8A 2PTGA 3E9QA 2C2YA 1GL3A 4FIZA 1T2AA 4PG4A 1IZ0A 2Q1UA 3BTOA 3AOEC 4MVJG 4RGBA 2FPPA 1P31A 1OOEA 4UVGA 3PJFA 3VPHA 3F9IA 4JXKA 4CV2A 3WWZA 3UF0A 5ILGA 1CQJA 5BNFA 2DT5A 1IY8A 5L53A 4RLHA 1GZ3A 1I01A 1EQ2A 4CLRA 4PVDA 3V2GA 4XYLA 4W7IA 4CM1A 2A9FA 2PD6A 4A27A 2C29D 2NADA 4O59O 4Y9DA 5EESA 1K2WA 2C07A 3DHEA 1TLTA 3JQAA 4N54A 4PLTA 4R4JA 3ZNQA 4RVSA 3WQRA 5JAIA 4RZHA 3RQSA 3BMCA 3BHJA 3WMXA 2Q1WA 1P1KA 3O8QB 3KM0A 4JQCA 4NR0A 3WX0A 4II3A 1TT5A 3D1LA 4IJVA 4LK3A 2BFOA 3GHHA 1FMCA 1X1TA 3PWKA 4YCAA 3HUDA 4AJ1A 4BVAA 3OSUA 4L4SA 3ZCXA 4Z0HO 2VTDA 4L76A 3ZWOA 1U8XX 4R9RA 4GLLA 1LU9A 4DC0A 3PK0A 2FR0A 3BA1A 2UUPA 3CEAA 3ZV5A 5FWNA 3EDMA 2CFCA 2B0JA 3JTMA 1GUFA 4QECA 3DXFA 4MVJM 3UKOA 1BDBA 4TRMA 3GEGA 2C82A 5G0UA 4F3YA 2AEFA 2X9NA 3VZPA 1E7MA 1WWKA 1XLTA 4MINA 2E49A 5ITVA 1KC1A 3ZV4A 4CODB 4TQGA 3W8EA 4ND2A 3WGYA 3D3WB 1I30A 1UZLA 4UUMA 3GGOA 5CFZA 1UDAA 2HLPA 4R1UA 1PQPA 4K26A 1I33A 5EPOA 2HU2A 4FOSA 4NG5A 3C7DB 2E82A 3V1UA 1EUDA 1ZSYA 1N9GA 2CSUA 4YDRA 1DC4A 2VHWA 3ANMA 2AW5A 4LW8A 1N9GB 1U7HA 5KOIA 3V8BA 4D43A 1C1DB 3ROMA 3IAHA 5KJ6A 3COSA 1JW9B 1QSGA 3OIDA 5HS6A 4R1NA 4J2HA 5G0TA 5A3JA 4JBIA 2OFPA 4WK6A 4I5DA 4IDCA 5H83A 3RC1A 3L0DA 4Q3DA 4CMEC 1UAYA 3I83A 4RQTA 2ZQYA 5TNXA 5DBFA 3LYLA 2J8ZA 2H6EA 3H9GA 3WGHA 4OJNA 3OFSA 3E5MA 1HWYA 1NR1A 2EF1A 2ZB7A 1KY5A 1YRLA 2I67A 1Y9AA 4AJKA 4K9DA 5A05A 4ALKA 2AE2A 1PZFA 2DC1A 1C0LA 2W2KA 3AOEA 4MOWA 3GG2A 3JQ9C 3MJCA 3VAZA 7ADHA 4IIVA 3DBVO 4PZDA 5JDCC 1ISMA 1KC3A 5G4LA 3L4BC 5IZ4A 3VH1A 3NRCA 2VYVD 3X2FA 1YH3A 1SZJG 4GL4A 1GV0A 1PR9A 2X6TA 4ZHSA 3ZHXA 2P91A 4WKGA 5JCXA 5DN9A 3WQSB 2JKVA 3O03A 1IHXA 2YDYA 1EE9A 1LLCA 2WYVA 1EBUA 3N7UA 3TPCA 1R66A 3FF4A 2VHZA 3EGOA 1I3LA 4A7PA 3RBVA 1B0AA 4DC1A 4J0EA 1NTOA 1LSUA 3DHNA 4RF2A 2DU8A 1AXGA 3DBHB 2J5RA 3F1LA 3GZNB 1NBOA 3QSGA 3W1VA 1UR5A 5JDIC 4IIUA 4AFNA 2OBYA 4KTTE 3NJ4A 1R0LA 3VTZA 4L75A 1E1KA 9LDBA 1NHGA 3PQFA 4GMGA 4WLOA 1W73A 1SPXA 3BMOB 4CMHA 2W90A 1CDOA 5JCJA 3DZGA 4ZQGA 2I99A 2PK3A 4JROA 3ST7A 1JA9A 1VJ1A 4F6LA 1D4FA 1DFIA 2Q4EA 2C7VA 3KBOA 5JAQA 3RJ5A 2Q99A 3BHIA 1RM4A 3NUGA 3UHAA 1SMKA 3H9JA 1DFHA 3C8MA 3FPLA 3H6KA 4RVHA 2P5UA 1DIRA 3NYWA 3QIVA 4B3HA 3VDQA 4B3IA 4RZIA 1F8GA 3HE3A 4IZHA 3TWOA 5KJ1A 2E37A 4J9UE 1EEHA 2X7HA 3IDSA 3ZNOA 1WP4A 1LDMA 3LC2O 3LT1A 1PL6A 2NQ8A 4IMPA 3TDKA 3GGGA 1U9JA 1UXGA 1UXKA 1NVTA 2D8AA 3BTVA 1YB1A 2O3QA 4CUKA 3OJEA 4IDDA 1C0IA 1Z74A 4UUNA 1LSOA 2PKQP 4BQPA 1BTOA 2YQ5A 1DO8A 2VHYA 1IE3A 4OO3A 4YAEA 1UXJA 1SB9A 4O5OA 2Q49A 3H3JA 3T4XA 2BMAA 4CUJA 5J23A 4LMPA 1DC3A 1HF3A 4ALJA 1YKFA 3PDUA 2WE7A 1E6WA 4J3FA 3FRJA 1E7QA 1JVSA 3DTTA 3RFTA 2IE0A 1ORRA 3QP9A 3AW9A 1KVTA 4Q3AA 4YAIA 4CM9A 1PGJA 1HEUA 2I6TA 1J6UA 5TT1A 2YUTA 3JQGA 3QLJA 4GX1A 2AEJA 4OSPA 2YJZA 3KLPX 4P38A 5FF9A 3CXRA 4B7UA 3DWFA 5AQ1A 2WD7A 4J1TA 5DULA 1YGYA 2HMTA 3T4EA 2C5EA 2DUUA 4KUGA 1RM3A 1GCOA 3L9WA 3PQEA 5KKCA 3KV3O 3G0OA 2R00C 2DBRA 5A4DA 2YFQA 5GZ6A 4UEJA 4PCVA 2QQ5A 4TRRA 4KQWA 1P3DA 1Z6ZA 8LDHA 2Y1FA 4NNJA 2G1UA 1UAGA 3U4DA 2X86A 2H9IA 1E1MA 1LC0A 2QYSA 3ULKA 3R1IA 1EBFA 3UAGA 2B36A 3V1TC 5IXYA 3ANLA 3KETA 3U5TA 4QTZA 3PVZA 2JCVA 4CLOB 1NAHA 3VPGA 1ZZEA 2VNSA 5C5IA 2D0IA 5DF1A 3F1KA 4Z9FA 3Q9UA 3A4VA 3I4CA 3GN1A 3W4IA 1OZAA 3C1OA 4BGVA 1GQQA 2VRBA 2VZ8A 3C1AA 3D0OA 4YB8A 1H2BA 1KERA 3H2ZA 5CEEA 1EVJA 1LRLA 4IXWA 2QZZA 5KVVA 3L6EA 1DIGA 1HTBA 2NU6A 3DMTA 1R37A 5K6AC 1H93A 2ZTUA 2GSDA 2W2LD 3L4BA 1U28A 4YYZA 1PEDA 3MTGA 1T25A 4AJHA 4RL6A 3LU1A 1E5QA 2F1KA 2Y0EA 1C0KA 5JXWA 2UYYA 2BRUA 3I6IA 4H7PA 4MVJA 1E77A 3PHGA 5TJHA 2X1HA 1E1LA 3VH2A 5I9LA 3OEWA 4GPD1 1NQAO 1G0NA 1WXDA 4B8WA 4WLUA 3QQPA 1SOVA 4YJHA 4BB5A 3CSDA 4P8RA 4CMBA 4II2A 3HJAA 1A9ZA 5JAMA 2GUGA 4DLBA 3NDIA 4JLWA 2Y1DA 3KLMX 1HETA 4DBVO 1UJMA 4IDBA 1M75A 2GCGA 3BHMA 3UN1A 3W8FA 3TQHA 4A03A 4DRYA 4J6FA 1JKFA 4B3JA 3GDFA 2PFGA 5CDUA 2AG5A 3EMKA 3H5NA 2NSDA 3IS3A 1VSVA 1UH5A 1PJ4A 4E5PA 3S8MA 1ONNA 2B5WA 5JC1A 1ZMOA 3EVTA 1XEAA 2NTJA 1KEPA 3MCVA 3VZRA 1HDCA 3H65A 3ETGA 2X5OA 4J4BA 3JQ7B 5F21A 5KJEA 3SEFA 1LQTA 5IDYA 1YVEI 3ZI0A 5I7FA 3FNHA 1ZJZA 3QY9A 2RIRA 1Q7BA 3PXXA 2WYUA 1Y7TA 3JYPA 3G79A 3IKVA 4Y6SA 1Y8RB 1MA0A 4Y67A 4CR7A 4RVDA 1MLDA 5FI5A 3FWNA 3PHLA 3KSUA 2E4AA 1ZSNA 4X54A 1EK6A 1VE9A 4IY1A 1PL7A 3ZW8A 1EVYA 4XRRA 4J4HA 1HXHA 4OAQA 4OYRA 4D3FA 3HN2A 2Y93A 2FOIA 2VCYA 1ZVMA 4QUKA 1V6AA 3D3WA 3RWBA 1BGVA 3GEMA 4XQGA 4OXYA 4BO8A 1N7GA 5GZ1A 2POQX 4ID9A 4IDFA 1GADO 1A71A 1PU2A 5JYDA 4YJDA 3VPFA 2PGLA 3CMCO 2GN4A 2VWPA 4DBZA 3ZU4A 4RDHA 2ILTA 2VWHA 4RJTA 3OEYA 4E6PA 5TJ9A 2OP1A 3GPIA 2AEMA 5L7YA 2EKLA 3LT0A 5F5NA 4L4RA 4CMCA 4KDEA 3VHRA 1PS0A 1KY4A 1EE2A 3E18A 3M2TA 1R4NA 2NTVA 4E33A 1SB8A 1ZK3A 5THQA 5COQA 5G0SA 4A0SA 3WJAA 1K5HA 5AXAA 2FHSA 3OICA 1WDMA 1FDTA 4FFNA 2LDXA 1T2CA 4IJKA 1WMBA 2V6MA 5A03A 3L9XA 1QYVA 4FR5A 4E21A 5F1PA 4PZEA 4AL4A 3R0IA 2O3UA 3VTFA 2NU9A 4NZ9A 4TVOA 5JMPA 1HT0A 3GGPA 4CM6A 3CZRA 1X7DA 2Q1TA 4BNNA 5I7SA 5JY6A 1E3EA 3OF2A 4KDFA 2TMGA 1VLLA 1CRWG 1E7WA 3DR3A 3Q2IA 3FBTA 3FI9A 5B12A 3GNTA 3VVCA 2XOXA 3JYQA 2ZKLA 2O2SA 3P2OA 3E03A
chains in the Genus database with same CATH superfamily
3IP3A 2NVBA 3B1XA 4R7TA 2WIJA 1U0HC 1LTHR 3FFAA 1T4GA 3NCTA 4V2UA 4TYQA 1N2EA 2FLKA 4MI6A 4CDGA 1AGYA 1Q7TA 3QG5A 5GJBA 3HK2A 1UPUA 3O74A 4ZAZA 2VK8A 4LSMA 4RS3A 5T5QA 4KNYA 3QEOA 2LIVA 1IBMB 3ZIAA 1MQ8B 3NZEA 1P2GA 3OFNA 3OTWA 3QH4A 4G6ZA 5IKMA 3LX6A 1P1HA 2GXQA 1K4YA 2F1IA 4GLFA 3HG7A 4Y6LA 5DYYA 3FNGA 5HTKA 1H1LA 3V9AA 2R47A 2AXPA 5JFGA 2O59A 3BDAA 4ZZIA 3AUYA 2B1IA 3FOEC 1DTWB 3UM9A 3LY9A 3RLIA 1CQIB 4YO8A 3NBUA 4NS4A 2I2XB 4F3KA 1V3TA 1B2RA 3TW6A 4H16A 2WMOB 3TNLA 1G4HA 4PIPA 4QJ5A 1Q7CA 4JK3A 2PA3A 2WTBA 5A6SB 4C4RA 2P0AA 1EVIA 3DEAA 2E48A 4LYEA 4BNKA 5HBRA 4Q39A 4DA4A 1CUVA 4R8KA 1LPSA 1GIAA 2B4AA 5JSFA 2XA9A 1M9NA 2PWAA 1HOXA 3COZA 3DM9B 3ND9A 1NJFA 2EFJA 3WQQA 1D1QA 4C3VA 2JF0A 3PNPA 1MOPA 4RCVA 4YJ3F 4DUPA 4TYMA 3EW7A 1JE0A 1KYQA 1UPBA 2DKOA 2I6GA 2ZR7A 4AKEA 1E2FA 4ROTA 4ZEVA 6ABPA 2VRNA 4HWRA 4FFBA 4F85A 4CIBA 3QRWA 3HKDB 4IJUA 3FGOA 3RIHA 1D0SA 4HRYA 4JQOA 3RIYA 4J16C 1XR3A 3EBOA 5FT9A 5JXGA 1M5TA 3OT5A 4XYGA 1J5EB 3K15A 4P5PA 3T3DA 2PLAA 1DZIA 3OJFA 1GFSA 4I9NA 1MO2A 2R86A 5LD2C 4QD3A 1SQ0A 1MDFA 2ASVA 5A9RA 1SWWA 1ID8A 3G8DA 4ZO7A 5ECYA 4AO8A 1TCVA 2WQ7A 2WJJA 1FNCA 2NUBA 2ZB3A 1N8KA 3DO8A 3LKBA 1MB3A 3Q9SA 4PYIA 4WEOA 4WH0A 4Y18A 5JPDA 1M8PA 1M0WA 1YNOA 1E9DA 2YUIA 1CS4C 1NRXA 4X66B 1SUBA 4HP8A 4QFCA 1L5RA 1NLUA 4KVAA 3MWJA 3OZUA 1H23A 3MHTA 1L2TA 3RRNA 5DM4A 3H1GA 4EG3A 1V6CA 4DLSA 4KXXA 3B3FA 4U2CA 1NXVA 3E9NA 4NBLA 4MDHA 2DERA 2FEAA 1YZGA 5FL7A 2VATA 4P81A 2AMYA 3WYEA 2QLJA 2V7WA 2NPFA 1T0PA 3C8DA 1YR8A 3HYRA 1GPAA 1YBFA 2JBAA 3FCEA 3QKRA 3ZXXA 3FDIA 3IR6A 1GAWA 4EW3A 1QRSA 1HLDA 3FIUA 3GCZA 3K0HA 4W8OA 3WGTA 5AI9A 5L4NA 3D4PA 3T3IA 4F84A 1FTYA 2PY6A 1EFHA 1KI1A 2I78A 4QZVA 4E09A 1WRBA 1YB7A 4WBXC 3V1KA 2BUCA 2GS9A 4J75A 2BGJA 3V34A 4G65A 2QRGA 2BTQB 4OVKA 5CVCA 2WQZA 1TZMA 2UZAA 4HPXB 5DE3A 5DMXA 1HO3A 1QIDA 3VYWA 2V0NA 3MJVA 3ND6A 3NDBB 2WF5A 3T1OA 4Q3KA 1IWOA 2IRWA 4IVNA 3RYFB 4CW7A 4EOGA 4EW6A 1NPTO 3ZOZA 2LKDA 1B3RA 1P5HA 1DTSA 5K03A 3CLTD 4XDYA 4B9AA 1QB8A 1NY5A 2GK6A 1VYTA 3PDHA 1JEYA 2NSYA 2WJVA 1ES9A 2H08A 2Z3ZA 1LDNA 1G6KA 2BEWA 4UJ3A 2J4DA 3HSYA 4WNYA 1KH3A 1W6RA 1XZIA 3DEIA 3QXJA 4QTUB 5AJTA 2HADA 2J0QA 2K2WA 3T34A 5T57A 2XAUA 2FEOA 3WGGA 1KZ6A 3FN4A 3GJRA 3M7IA 4Q4HB 4Y7DA 2DM6A 2D0PB 1GL7A 3EMDA 4PC3A 8AT1A 5JW6A 4XSGA 3FVQA 4EQ6B 1DINA 1WCIA 1ZW6A 7MHTA 3PPWA 3Q4GA 2GCEA 1E2PA 5J4VA 4ID3A 3IE1A 4Q9DA 1Y5MA 5ICEA 3ACBA 4I0WB 5A7GA 4KPGA 3CBGA 1CQPA 1ZH0A 3FTNA 1QQ6A 4J7XA 4KN9S 1QCZA 1OXXK 2A0UA 2JIZD 4Z3DA 4ERXA 5LD2B 2DGDA 2ZSDA 1MDBA 4OSEA 4CEHB 2XZDA 3EBPA 4BZZA 1HEIA 2GDZA 1FPQA 4F4CA 1DU4A 5H4HA 5F52A 2PH1A 1F7UA 4QM6A 2ZJYA 4PC7A 3REQA 1XMSA 3A1NA 4AZVA 2PO7A 4NBUA 5K09A 3ENKA 9GPBA 4BMNA 1PWHA 3HDHA 5CA0A 1CUBA 1PZHA 4EG0A 1PWEA 2UYQA 4XR9A 5DLPA 4JGBA 4JBWA 2HD4A 2O7QA 3H4VA 1V71A 3GF4A 4W9NC 4JLKA 2ODBA 3LNTA 4X65B 5AOAA 1F0KA 1T2FA 2V58A 1MT3A 3F8WA 4PFQA 5JLAA 3RV4A 3UWMA 1Y48E 4GWGA 3TW8B 3RRYA 5U4XA 5C7OO 2PZGA 3UK0A 1NQWA 3I6QA 2C4WA 4D9JA 1W4ZA 1WNTA 2QJWA 1T0BA 2JPDA 2ZSAA 3FWPA 1VHLA 4OX9B 1BCSA 3WLFA 1JPVA 3B1JA 4E5VA 2EG5A 1SPBS 1BH6A 2IOHA 3SE0A 4URVR 4Z3KA 4U6NA 1YRYE 4ZMSA 2IEZA 4JGIA 3LQYA 5KC8A 2A88A 2QTFA 3OTOB 3RWMB 3RTDA 2OILA 1UKZA 1YSCA 2OSBA 2Y6VA 3BSYA 3MT8A 4N9WA 5C1BA 3SQXA 1J2EA 2B6NA 4J0HA 4NBTA 4XX0A 4ZO6A 2DLCX 3CMMA 1XNJA 4RJ2A 5BNTA 5U9CA 3W5AA 5CXUA 4QJ4A 1GO2A 3GRRA 1M8JA 1XPRA 1YONA 3B70A 1Y9JA 4QREA 3TRDA 4ZARA 1OJ7A 1VSBA 2DULA 4L4YA 3LIIA 4S2EA 3RS0A 1K3UB 3X43A 5L7TA 2CN1A 3TZHA 1YMQA 1OFIA 1H69A 1SC9A 1SXIA 4KHPB 1ZA2A 3VC7A 1DRWA 3WZLA 3H9UA 4AG3A 1U4OA 1SULA 3TW4A 4RPLA 1UBKS 3HFGA 5JRJA 1QP7A 4NENB 5FBKA 4F9FA 4CM9D 4QUAA 3LNCA 1ZGHA 2NGRA 2P3SA 1YS4A 2OV3A 3JRXA 4N01A 4C7KA 2Z57A 3AERA 1Z4OA 2JLCA 3QX7A 2O3TA 1PQUA 1YE3A 4V3CA 1KL7A 1GLVA 4JNKA 4Z8YA 5DT9A 1GRNA 3RARA 3GT3A 4HK4A 1SG6A 1NVMB 4KXMA 5EWLB 3WR5A 3DD1A 1RJWA 2YX1A 4KL8S 4YMHA 4DGSA 3HQ4O 2PMDA 2PRIA 3L7CA 4JNCA 4JI5B 2HH9A 4IH4A 4EL5A 2EVWX 2GBLC 1QV6A 3AUXA 3B1ZA 1TW2A 3KOZA 3L8CA 1R0KA 3F5FA 4G4GA 4NZNA 5ER9A 3WJ7A 4DW8A 4KFCA 5JSKA 3LPAA 3BG5A 2ZUFA 1DIBA 4ERNA 3F7NA 3CW2A 3VKGA 2JFFA 1VMIA 5FBRB 3OWHA 2LV8A 4YJFB 4FB4A 5A5EA 3B3GA 2O0KA 5DVZA 3ME5A 5IWCA 3LO5A 2YV2A 4L07A 4Q3OA 1ZK2A 3HJBA 4FUTA 3NWEA 4TV9B 3WZ2A 1QG2A 5FOWA 1YNSA 3H87A 1U6IA 2PBLA 3CF6R 4GYKA 4ZU1X 4ZIRA 1I2BA 1NKSA 2FHPA 4JL6A 5AHRA 2CLLB 1JJAA 3K1JA 2I4IA 2G4CA 3T38A 1XAGA 1Z2EA 2ZRIA 4K0RA 5E6RA 4L8WB 4ZICA 1PS8A 2A86A 3HA7A 5HM8A 3ABIA 1AKEA 1WW8A 3FMPB 3VM6A 4V38A 5FAXA 1PS9A 2FSVC 1FVHA 4V1CB 2XSZA 4ESHA 2HA6A 1C9YA 1N2HA 2JLZA 1D4ZA 2FPGB 1H2XA 3VKWA 1PVDA 4YRBA 3OZDA 2QRLA 3NLLA 1WKCA 2HEGA 4C7VA 2VQFB 1AC5A 1WQ1R 2NYVA 3HRIA 4CCYA 4D3YA 5GOZA 1TUBA 4YT4A 1Z7YA 3BK7A 4OH7A 4F06A 3SC6A 4C0KA 1U0LA 1RRFA 5AUPB 3M9WA 3IOMA 1ZL0A 2X2FA 3CM0A 2I3GA 3EG9B 2R1VB 4K1LA 4URUR 2C8JA 2VUTA 3TF5A 1LNQA 4Y0NA 5HMLA 5CCXA 4NBVA 3RTEA 2W8ZA 3BGDA 2Q2VA 1ZRSA 5JSZB 5EIOA 3QKSA 1FCJA 2GYYA 1ZCJA 2V7XA 2P7IA 2X19A 4W1QA 5FPSA 4L3OA 3RFXA 3OTGA 4R54A 2E87A 4BB0A 2AN4A 3A3YA 2WF9A 3D7RA 3GRFA 4GXQA 1SIUA 3D31A 2B8TA 3FYSA 4XVQA 4CEJA 1EPUA 5ALUA 3REOA 1XNRB 1X1QA 4RK1A 5EKDA 3O38A 2JHAA 3RRZA 1ZCBA 1GPUA 4CNBA 1W76A 5KWEA 3C3CA 4RY9A 3ROFA 4X6UA 4ER3A 1Y9EA 4JIGA 4BNVA 1FBTA 4G56A 1G6HA 3R77A 2A9PA 3GJ6A 2PL5A 4DDVA 2FI1A 1JQJC 1ECFA 2GB4A 1AZTA 1JHYA 2H8GA 3D2LA 1RYMA 2ET6A 1PT9A 2WDPA 1I8TA 2EGUA 3MS7A 4J0IA 3UMBA 4CIVA 1O96B 2FDXA 3GLTA 2R00A 5A4JA 4DEVA 3MGCA 4JMLA 4MCIA 4WXRA 3OZIA 4ZDIA 3VH4A 4QEDA 2JGRA 4I5FA 5FR2A 1YFLA 3A4YA 5A04A 1A9PA 1UKEA 2Q2WA 2NO7A 5H3HA 3H99A 3V2HA 1UM8A 4GMKA 2RONA 1T1RA 3MOIA 1VL2A 1BH2A 1OHHA 2B30A 2LKCA 4XJSA 1FJXA 5ALDA 3GO4A 4L73A 3GA7A 2X9VA 3O95A 4XI9A 3SX0A 1QNFA 3JRWA 2NUAB 3SOPA 1L1EA 3X1KA 1NWHA 1SQSA 1F6DA 3OH8A 2BEVB 1X39A 3E9RA 4IUDS 3PFIA 4Y9UA 2G3YA 4DUGA 5DI3B 1PEAA 2PZJA 2ZW9A 1LCIA 4FZRA 1IHYA 4G0PA 3TLXA 4EVSA 5KQGA 3UATA 3TE6A 1L6IA 1JHPA 1NMQA 1Z56C 3M1IA 3UUFA 3PQDA 4K6HA 4Y6PA 5LQCA 1V7CA 2V74B 4RHUA 1W9HA 2IEDA 2ST1A 3SK0A 1ZYUA 4A6XA 1M54A 1QWOA 4WI1A 4W63A 3V4OA 1GFZA 1ZIOA 4MGIR 3GPDG 3UXHA 3STYA 1JILA 1C7IA 4N7MA 3ROQA 5KI6A 5MN5A 5AUQA 4Q4DA 3V55A 4JU8A 1CY0A 3CZPA 1OFUA 1CZUA 2QMQA 2XMZA 4MUEA 1Z6QA 2J09A 3CNHA 1HDRA 2OGTA 1FDWA 1O54A 3KJXA 4M86A 3V3KA 5FUMA 4M7WA 2IHYA 2GVZC 1E98A 4KJZA 4K7JA 4CT5A 3I6BA 2DY0A 3T41A 4XJXA 1ZA1A 4XWAA 1Z13A 1CB7A 3R3UA 1WVMA 3U37A 5BSFA 4BX2A 1O89A 1J2JA 1CFZA 1GQSA 1PK9A 1BYIA 2PD4A 3G5AA 2HBZA 3HGMA 1UBOS 3IVXA 1NWCA 4M0FA 2OD2A 4RETA 5DV9A 3RRFA 3CRQA 4A92A 2MMCA 3OTQA 3VVBA 1DCMA 3IMEA 3BMQB 3KT3A 4EITA 4QOJA 4MVJF 3MFQA 1DC6A 1DKUA 2G67A 4EO7A 3CPJB 3KAPA 1ST2A 1HRKA 3PG5A 4D56A 3S8EA 3WG9A 1K6JA 1KNQA 2QORA 4YO7A 1NUSA 2YWXA 2XMSA 2YFHA 3PQCA 2Q3LA 1NXTA 4JLAA 1HFJA 1AS0A 2OL4A 4NFHA 1AV6A 4ISBA 3BXOA 4I4NA 1X0VA 4PYKA 4YALA 2QP9X 4FNMA 3VNUA 1UFQA 2OD9A 5C8DA 4JQSA 3AF6A 1PNOA 3DW3X 1F51E 3CR8A 3DFKA 1FA9A 5AVWA 2XVMA 1J00A 1JI0A 3BX1A 2BP7B 3JYLA 4GT1A 2ALJA 1CZOA 1IEQA 1V48A 3LUHA 3SX2A 1R0SA 4FILA 3QELB 3IO5A 5A0FA 3UGKA 5F23A 5L3VA 2FPPB 3L8DA 1UPTA 3UOAB 3ONFA 1R0RE 3L8ZA 1YQWA 3DTVA 2A0FA 3FTPA 4I5IA 4YRSA 1G5PA 2W7TA 5ALKA 5B1HA 2ODQA 5EZYF 3ZE1B 3EVEA 2VHVA 1ZBQA 2IYVA 2QNBA 4PG5A 4Q47A 4EJMA 2KE5A 3K0SA 2QSUA 1AQIA 3AX6A 1CZHA 2I76A 2AWNA 2L69A 4K9MA 1I4EB 4QXQA 5FRDA 1SCQA 2EBHX 3ZY3A 1C41A 1KSHA 4R8MA 3CTMA 2UXDB 1XN4A 5LBTA 1UM9B 2TRSB 3P4XA 3Q6MA 3ONNA 1K6IA 3HGQA 4FX5A 1G3QA 3CFYA 4JJ7A 5ES3A 3O8RA 1U8ZA 2RSLA 4ZZ0A 821PA 1YK1A 3O94A 4M54A 1OREA 3SBEA 4F45A 1GUYA 4PR0A 5HUQA 1YJBA 1W44A 5DLYA 4JBXA 3G2JA 1RVDA 2JLRA 2TS1A 2J3KA 4NOJA 1TJ4A 4FWTA 4PZUA 4B3CA 1BD4A 4PG6A 4YA6A 2PS1A 5AVOA 2DPLA 4Q1FA 2NZUG 3GJQA 4H3SA 4REQA 3CLVA 3S1LA 4E88A 2DPMA 5E2AA 3W6UA 2IZ5A 1IMOA 1BVHA 3HYTA 1VLJA 1MJNA 2X3YA 3BORA 3DWIA 2DPGA 1Y4DE 1N0HA 1JF8A 2REOA 5EP1A 5KNBA 1ZC3A 1K5PA 5E4JA 4KI0A 3TSAA 4DCNA 1YL7A 3HN6A 5GAJA 4WOCA 3O90A 3VHQA 4ER0A 1W87A 2H5JA 4H7FA 3WB1A 4B4WA 7REQA 2OA0A 2WD7B 3IIEA 3EEYA 2X9LA 1XCBA 2FPXA 2BFPA 2GD1O 5B2FA 1VCIA 4BV2A 3CNOA 4TWJA 4J03A 4N8SA 3U17A 4F3RA 5ENZA 3KOYA 3OPYA 1USVA 3QLUA 3F73A 5HXAA 1UZNA 2NAPA 5IKPA 1EIZA 2WV9A 5BN4A 3QWHA 2OBXA 1KZHA 3D6VA 4LHSA 2RD2A 5JZSA 1NIPA 1SHJA 5TIIA 3ZHVA 4JUBA 1AKQA 5L4LA 4F72A 4Q6WA 4WBNA 1Y3BE 2H65A 4MHOA 4MIYA 2J7PA 3OKFA 4ECAA 4BV9A 5A0TA 3U44B 2FFRA 3AWDA 4PBTA 2ZRAA 4QNNA 5AJXA 5A9SA 3UUGA 4YJ3B 4DANA 2JFPA 3KO8A 3EPKA 1XZCA 2CDRA 2IYOA 1NDHA 1X86B 4U2BA 2AYZA 1A8HA 2CXXA 3ACCA 3JQ8A 4UQPA 5G2OA 5SZJA 2JD2A 4L7VA 4TZKA 4CKEA 5ICMA 1R7RA 1XXLA 1AS3A 3GJ7A 3MJSA 1SVKA 2Y6UA 4LGMA 5DW3A 3U4CA 4ZK2A 4UTNA 3BMNA 4D25A 4AI6A 5AKLA 3R3JA 1MFZA 4JY7A 3KQLA 4UEOA 1FLVA 1MC4A 1SCUA 2JATA 2Z9DA 4E1BA 3ER8A 2JI7A 1JZTA 1RS0A 3B51X 5G4KB 2ECKA 1ENPA 3IHTA 3L01A 1OMOA 4HCJA 4PHFA 3HU3A 4PZYA 2CVHA 2ZSEA 4FFRA 1DHTA 1OC2A 4ZO9A 3EK2A 1G291 3O4HA 4U2DA 3KUXA 3G2LA 3NB0A 4OTZA 5D86A 2H0RA 2XNKA 4LVCA 4AMYA 3H0CA 2JLVA 1BKDR 4UBNA 1PIWA 3PHIA 1FFBA 5SZHB 1QMGA 3ZXYA 2ZR8A 2GRUA 3NIBA 1DOHA 4F9EA 3Q3GE 1K8XB 4BJ1A 1Z4PX 3B1WA 4JLSA 3I62A 2HX1A 3L2OB 4DLNA 4L8VA 5A7FA 2V7VA 3DWGA 3WNVA 3TIXB 1YZHA 3H16A 4PZCA 2JFXA 5FOSA 1KK0A 3O1LA 3NEPX 5A4AA 4DQKA 3N05A 2GO7A 2JA1A 3GUCA 3HI4A 3I42A 1Q84A 4TQ9A 4KE8A 3K9GA 4ZALA 2BMWA 1DFGA 3SYKA 2I62A 4L85A 3PPYA 2BOVA 5C8YA 4H4CA 4L8LA 5IT4A 3VKUA 3N75A 4JB3A 4BNXA 4PX2A 2IWRA 4DMMA 5CT4A 5HG0A 3PJEA 5HUHA 1YT5A 3LC0A 4UHDA 1QH9A 1Y81A 3UVEA 4D44A 1ENYA 1G3UA 3H2GA 4NWIA 1SO8A 1Z5VA 2FXVA 4DTIA 1EGMB 4CKCA 8GPBA 5REQB 4CBVA 3KXIA 1ZN2A 3TAHA 2MWMA 4AP6A 2Q46A 3T7JA 3DKIA 1V1MA 2OKCA 2W6JA 4Q7EA 4FXOA 3R7LA 2WKRA 4JVMA 4HDSB 3SZMA 2Q5HA 3IC5A 2ZWPA 3N76A 3ZV6A 2C83A 2FF5A 3OEHD 4AS3A 4CMIB 3TOSA 2J3DA 5F98A 2Q9UA 2C59A 2G4VA 2W37A 2OXTA 1LPNA 1LZLA 2H48A 2REXB 3GH1A 3V7NA 1FFXB 3P9CA 2PYDA 1WPGA 2H54A 3WGJA 4AG6A 3OFVA 2G63A 4RESA 5FL7D 3RREA 3GLFA 3AHIA 1O08A 4ZOEA 4PLYA 3TQQA 3PP8A 1C8LA 1H1DA 3D6NB 3OJXA 5AXBA 1MW9X 3P2YA 4ZEOA 1YQGA 1JHDA 4DSOA 3KYDB 4UBMA 3PF9A 1S2LA 3GBSA 4JBGA 1DBIA 1M76A 4KAFA 2HIMA 1CF9A 2O0LA 4JJGA 4KO3S 1ACLA 3UCXA 3LUAA 3GJ4A 5ENVA 3UH0A 3AP3A 1D3AA 2R11A 3OD1A 2VOEA 3U40A 3LFHA 2KPOA 2OMKA 5SY9A 4GQBA 2IW3A 4HT3B 1HYQA 2A0XA 1HSOA 4LOHA 1LFAA 4CM8B 5T4EA 2RGAA 3I8SA 4X7MA 4PLWA 1KOFA 3PVSA 3K8OE 5MFZA 1P7ZA 2P2NA 3UHJA 4YWJA 2X0EA 4QQRA 1JVNA 3BRQA 2PZKA 2V65A 3T9FA 3TZLA 5K01A 5ILOA 3MTIA 3H2BA 4AZ3A 1S4MA 1YZUA 5ICSA 3NIGB 1EYZA 3E58A 3KRTA 3DLHA 2J45A 4TRNA 5D01A 2RBGA 3PWZA 4NJMB 3VZBA 4ZYVA 4DWOA 1JU4A 1U9ZA 1QIEA 4RHXA 2FN8A 2HK9A 3AF4A 1KIMA 3IR5A 3PL1A 4K86A 4RXMA 2I2AA 4EAQA 3B38A 3QVLA 1LWNA 1QHIA 3L41A 1GPLA 3RYTC 3R75A 4D4IA 1VJGA 3R41A 4GZ5A 2ZXFA 4PNZA 3EZLA 3T3GA 3B7PA 3BRSA 4JUIA 2X3UA 5BOVA 3UAZA 4EGSA 6CHYA 1VBFA 3PV0A 1GARA 3PFCA 3SJZA 4AG5A 3T0IA 1FU4A 4IQ0A 2CNBA 5DWVA 1IU9A 2B5VA 5E1OA 3FWZA 3I09A 2H9YA 4G81A 1T8WA 3AB8A 4R41A 4UULA 4LFBB 3PJGA 2B0CA 1BCRA 3PDIA 5DOVA 1MAUA 3NHKA 2H3EA 4ETWA 3BFVA 4NJEB 4Y1RB 2QVZX 3ONEA 4P3OA 1N6RA 2H52A 3R5TA 4FGJA 3IKJA 5IAKA 5LDGA 1IM2A 3C5VA 3JCZA 1DNPA 3PZBA 2YVUA 5KEIA 5A9SB 3BHNA 2YRXA 5EE0A 5T67A 5IP5A 3WLLA 5ARCA 4WN3A 4MW2A 1BXGA 2A0YA 3LY5A 1QIJA 4ANFA 3LGSA 1ZOLA 2DWUA 3TM5A 2D6FA 4D0SA 5HFJA 5E3JA 5GONB 3T8YA 1RYHA 4X84A 2J32A 1CW2B 1GGHA 3LLVA 3UJHA 3LDHA 5KHLB 2JJ1D 4FEYA 4ND5A 4LJ9A 4WCFB 3ZZUA 1YBMA 2ZB2A 2QJRA 3MM4A 4MGKR 3IKMB 4U7HA 4YAGA 2DWPA 3GP5A 3OHMA 3EYWA 5JJKA 1KMCA 4HF7A 4KREA 2XBLA 4EG1A 4BZXA 3BXPA 1YUNA 2G1KA 3NEAA 2BT4A 2VBCA 4LJAA 3TDMA 4K03A 5JMTA 4OYLA 4QYIB 1GYRA 1ORWA 2IPAB 3JVDA 2CWWA 4EDHA 4IUYA 3JSAA 4G3XA 4LWQA 4O1IA 2IU3A 5IT0A 3HCPA 3OCJA 4MS3A 1WQ4A 1PYOA 5B64A 3KKEA 3BXHA 3NAQA 4J0CA 1YL5A 3CEPB 3RK4A 4BO7A 1L4NA 2IIPA 3E84A 3FCCA 1PJSA 1EFVB 1VLZA 4PLCA 1CC1S 5GADl 2JCYA 3P94A 2CDCA 2FRDA 2LGJA 3A1WA 1LRJA 3CKMA 4QULA 5COBA 5GJCA 5HIJA 3U3MA 2EL7A 1T0HB 3SMVA 2F8LA 4C0JA 4JENA 3AFOA 2W2LA 2GN1A 3N5CA 4AN1A 1IZZA 1XU9A 2FFBA 4YCSA 4YRMA 3ZD7A 4QXRA 1Z5OA 2B5OA 2R4UA 4QLAA 3S2ZA 5LQRA 3NGMA 3TXAA 3OG9A 1UADA 2YN4A 2DFNA 3SMQA 2LCQA 2QMHA 4HNQA 1M1NB 1CIJA 1GA4A 1ULTA 1WV0A 2B7LA 1EA7A 2WVHA 4H6PA 4RKYA 4Q9KA 1DKOA 1YQ9A 4H7KA 3JD2A 4I5GA 2AN9A 3THSA 1B4DA 1NN5A 3W5UA 3KAJA 1ZINA 3EUWA 3TL2A 3AH8A 5I8ZA 3VR6A 2WC1A 4X45A 2QBYA 4K81B 1PGQA 3TN7A 1G2OA 1QCCA 2CKMA 2J3LA 2QX4A 1YFJA 4Q1VA 1DAPA 1HH4A 3ZWWA 4F2GA 1GPJA 5K20A 1QO7A 3H8WA 5ARBA 3RU9A 3KQHA 3PQ6A 3W5JA 3BSFA 4WECA 5DM70 4R5HA 3N2LA 5FO1A 2VHCA 4O4LB 4YAKA 4CTKA 4MHTA 1LW7A 3WFIA 4HY3A 5FNZA 3ZD6A 2WAOA 3W4KA 5KMGB 3GT7A 4HNHA 1E3QA 2AFHB 4XR4A 4BXOA 2WHEA 4RTNA 2GBIA 5BPHA 3D8HA 4F56A 2HRCA 4FFPA 3FBWA 3LC1O 1AY0A 3MRXA 4I4TA 4LXGA 3TE7A 3NI2A 3BSWA 3GQBB 5I9NA 1HFKA 4TZ0A 3OP4A 4EO9A 3NGLA 5IC4A 5J58A 5IT9A 3L4JA 2MR6A 1WDTA 5FEUA 1UEIA 4MI3A 5KUTA 4P2GA 4GBJA 5C8ZA 2P9CA 4FEAA 4RNDB 3LPMA 4B3RB 3ZWNA 3OT4A 3I9V6 1XQXA 1G41A 2YY7A 2BFDB 2VYVA 1O87A 3GNLA 4GI2A 4ZDKA 4CMJA 2GN2A 2KI5A 3JQAB 3AP1A 4WMLA 4ALIA 1PYDA 4XVHA 2Z6VA 4DM4A 4EL0A 3DE5X 3L82B 3G49A 2FW6A 4DPLA 2C2XA 3O4JA 2GKSA 4GZ3A 4IAOA 3UJ9A 4KR7A 2AOXA 3WIBA 2EG9A 3I28A 1GFIA 2P5TB 2VSFA 3SJ7A 3ZZ1A 3CYFA 4H0NA 3AKYA 4WUVA 5DEIA 2IY7A 1USWA 4WJLA 4K6OA 4P34A 3VDMA 4Z1OA 5JD4A 1GZ7A 1T15A 3BC1A 6AT1A 3QQ5A 5JI3E 3KX2A 4REOA 4EMSA 2WR8A 1MJGM 5EZ6B 4DLPA 1I6LA 3ZQJA 2GCOA 3N8HA 1VL6A 3RYHA 3U7QB 3X0DA 1M6NA 3T4UA 3NTXA 1GPNA 4UQOA 2FA9A 4QGFA 2BRUC 1UIMA 3EQ7A 3EWSA 4CQMD 5I47A 1S1CA 2AX4A 3BAZA 3GJ3A 3WRYC 4CIXA 1MJFA 3QMMA 3DG9A 3ETDA 1OTHA 3QJ5A 3SXPA 4D3DA 4YQEA 4DLVA 1GZHB 1GZ4A 3KTOA 3QPBA 2A30A 1E9VA 4B47A 1HMYA 2F3RA 4C08A 4U0JA 4X1IB 1LBHA 4M9CA 5ITZA 4QXMA 5KTOA 4B76A 3C1TA 1CETA 3QVTA 3PZRA 4GPTA 4YFVA 1MXFA 5H82A 1SKAA 1TYZA 4N49A 3SR3A 1C2YA 1Q7EA 3I5AA 2UYHA 1N6KA 4IMIB 1WMSA 2ZJ1A 4QUGA 3TTUA 4EPXA 5T7BA 5IN4A 1ZUHA 1V6SA 4NARA 3RH0A 3DVSX 2H1CA 2PZLA 2OG1A 3G2NA 1P9WA 1NFRA 4HX5A 1T36A 2O2JA 1KAGA 5BR7A 1YF3A 5TQ0B 1ZUNA 4XTCS 1GR0A 2XB6A 1SHTX 4XDGA 4EI9A 5AFSA 3V1YA 5JXIA 2Q4RA 1NJ5A 1Y6JA 4KFTA 1DT3A 2GHTA 2DRIA 1DKNA 1ECJA 1MENA 4EX7A 4F6CA 5DP1A 2R97A 2QR3A 1E1DA 2AZDA 2P40A 3M6AA 4MYDA 2QD4A 1QZTA 2QNRA 5B3JA 1CQWA 5BWMA 1HZZA 1S02A 2O2HA 4TZTA 3OUUA 5DHAA 2FB9A 3ILHA 4Q82A 2IELA 2M1XA 4U3JA 4FN4A 4EGFA 4BN5A 1FNNA 2COEA 5GM2A 1M2HA 2VHTA 3A1EA 1BEUB 4Y6GB 2EF0A 3HCOA 3R8CA 4JD5A 3EPRA 3Q5EA 1H2FA 1P9LA 3P9NA 4FZVA 5A0VA 2JVIA 2VPIA 2A9QA 1FP1D 3EIUA 2XMGA 2ZTVA 4V39A 4YPFA 3D3NA 3QENA 3UJPA 3MWDB 1V7QA 2JCXA 4B3XA 2AG8A 2WWIA 3IESA 2WWWA 4RL4A 2RCNA 2IL1A 1OYYA 3FZGA 2HKIA 3PUWA 3TTSA 4ZXPA 1PNTA 4X9XA 5ELXA 3RG2A 1SRQA 2OC9A 1ZISA 2FWIA 2YVQA 1EI9A 3V4ZA 3VUFA 4XPIA 4BMPB 2CWDA 5DMHA 4DIFA 1QRRA 3H1BA 1NNI1 3TRIA 1Y3AA 2H1RA 1ZGBA 3ZWKA 3VDNB 1XRJA 4DRXA 3AM1A 1TMGE 3HXLA 1PLJA 5E6RB 2B37A 2BFCA 3KPWA 4O4JA 3H8VA 3AI1A 4IINA 4ZDWA 3NNNA 2CXUA 1ESZA 1P74A 3N2IA 5KYXB 1JWBB 1VSTA 2VH1A 1C9JA 4X20B 1MGOA 3H5TA 4GKAA 4IF6A 1ZOPA 5HFAA 3QBEA 5ICFA 3U81A 1EX1A 1M6YA 4EHIA 1IY0A 3QE4A 3C4VA 4G63A 4GEKA 1M34A 3R9IA 4OB6A 1Z2CA 4RFVA 3GRAA 1UPFA 4U8HA 3RKUA 2H9AA 1N5RA 4ZMRA 4KAXA 2VRCD 2QLNA 2XADA 3ZXSA 3KQKA 3L7AA 5T41A 3K3PA 1TQ6A 4QELA 4XIIA 1XZHA 2GDJA 5BT9A 5MGNA 3AHJA 3WKBA 1CFJA 5J2TA 1JTVA 1RYBA 4FMCB 4YJKA 4AJOA 4JBHA 1RT9A 3K1AB 1K97A 3A1UA 5CYGA 1VSQA 2R7NA 5C7YA 2OMEA 2P2SA 4G9GA 5G02A 2ZUTA 3EVAA 3EGIA 2EZ4A 4IIJB 4BGDA 4FGUA 1R1DA 3FSGA 1UAAA 2ZGVA 3BGIA 3K20A 4ENQA 4TXNA 1US8A 3ADCA 1ZNYA 4HH4A 3NATA 2G77B 1FNMA 2Z2KA 3B36A 2PWZA 2VTEA 4GM0A 4C6SA 1FDUA 2PJRA 4W82A 3S7ZA 4D8YA 4KDRA 3HV2A 2D1QA 4XTRA 5BRJA 3RRMA 4YQYA 1EFRA 2JGLA 1HT1E 2WWFA 2XHZA 3K1AA 3IEIA 3OQBA 4NYMR 2GHIA 1H0KA 2C2OA 4ND7A 2XYGA 4RYDA 2YJ4A 2VXBA 3OZTA 5BNZA 3PNLA 4YMIA 2GN9A 5HKKD 2O1SA 3ANNA 3KTAA 3E1KA 3JARB 2I34A 4XYMA 1PP4A 4LXTA 4Y2UA 4LFCB 2YBDA 4FJ0A 4OBXA 4FCCA 1QDUA 4UE2A 4AKHA 1PV2A 1Q0QA 4DCUA 3PIIA 3OTHA 4HGZA 4RD6A 5EAIA 2QTTA 1HQCA 2O7RA 3AUAA 4HQ6A 3FNEA 1XTZA 4X20A 2FEMA 4OAPA 4Z51A 4XSHA 4IPTA 3ZU3A 1Z06A 2UZIR 1ZMTA 4XASA 4H3VA 1T26A 2H0AA 3SDZA 2ZYWX 1Y4AE 4HQ0A 3X44A 2BFCB 3A27A 4QDUA 521PA 1PSZA 4UNSA 1JKMA 4O02B 5F4BA 4OLHA 1E61A 1VHDA 3O5AA 4XD2A 2ECOA 2FDRA 4AJJA 4FQ8A 4RXUA 4L9AA 3OOSA 4IICA 1CRQA 2NO0A 3O8BA 5K8IA 4J76A 3JAKB 5CG1A 3EODA 2HY7A 4NBWA 2RK3A 3CE9A 3G9UA 4UNNA 2FZEA 1A4XA 3KQPA 2XODA 4FYVA 5D3MA 2R44A 3LCRA 5TSDA 3VYVA 4BN4A 1BN6A 3MWDA 4R3NA 4F4UA 3OIVA 5FXMA 3K70D 1L5NA 3Q2OA 1V9SA 2EJTA 3CQ9A 5EHIA 3JSXA 4CI9A 1DIOB 2IW1A 2NUPB 4R2IA 5IJWA 3BUSA 4IGFA 1XPUA 1N75A 3JQBA 4BMZA 3A70A 1ATZA 1YS7A 3DZBA 1RHUA 2AB0A 3HEMA 4LDZA 3MMXA 4AP9A 4D57A 1M6HA 1ZD3A 1ENOA 1YZKA 1JQBA 2X5NA 2QF7A 4WA7A 3RU3A 1XDWA 2CVOA 1J8VA 1Y5RA 2EX4A 3JR7A 5M34A 2JEOA 3BH0A 3BZBA 3CSUA 1TQ2A 3PNKA 4OOFA 4ZQHA 1D07A 3PR1A 4UTXA 5JE8A 3V97A 4BB9A 1V5IA 3VH3A 3N0WA 4B1FA 3P8ZA 3VR4A 5HRAA 1NYRA 5HZGA 1C1XB 1X0XA 2W6JD 3P7MA 3BL5A 2RHJA 3UC5A 1EP1B 3TRFA 3BCSA 4C4PA 4E5NA 1IAQA 2WKQA 1A9YA 5TF4A 4EPTA 2BEWB 5MN6A 4B83A 3KJGA 3L0PA 1JE1A 4YBRA 5AXDA 3WLAA 5TVKA 3WJ2A 3GCDA 4KFUA 5TQ0A 1QFSA 3EZ7A 1GKKA 4NYIQ 1JB1A 1FZQA 1RNLA 2OZPA 1KWGA 3KJNA 3HP1A 2F4VB 3QU9A 2V4ZA 4MWBA 2V7QD 3TX6A 4BMYA 5FP0A 1TJ5A 1X77A 3E5RA 2QQFA 4YV0A 2CZGA 2NZJA 2PGDA 1YS6A 2WMDA 2XQKA 1TAUA 2VAMA 2Q6KA 1JQAA 1I2DA 4MGZR 4XGRA 5EJ5A 1ZC4A 2PPLA 3S6JA 3MSXA 4LOIA 1T3GA 2OCAA 2VZEA 3KQWA 5ITZB 3U16A 2WU1A 2XR1A 2B8NA 2Z5GA 1MF7A 1SXGA 4ENSA 3OIUA 1WSBA 1DXQA 4MA4A 4HNGA 5EJ2A 4O29A 2Y92A 1QIMA 3W7AA 3P0EA 3FLEA 3N28A 4BO3A 3L0CA 5K0JA 1C50A 1R6DA 4PRLA 3VSAA 1KAHA 1Q74A 1DQZA 2ERXA 2Q1SA 3CF2A 3AR6A 4WTOA 2G06A 1M10A 2OGZA 3CBQA 4WPGA 2NTEA 4RM3A 4DQ0A 3AVTA 1F2TB 2EW2A 4EMUA 2HZ7A 3CLTC 1Q15A 1KMIY 2YOFA 1BW9A 1LTQA 3PFNA 4Y2HA 2X77A 4RLSA 4JDPA 2H18A 3DCIA 3O8OA 2ID7A 1QHYA 1ETHA 4TPKA 1B6TA 2ZIZA 4LZWA 2ONKA 4D4LA 5BSMA 2C5LA 3LHFA 4O2RA 1UKYA 4BUCA 4PBRA 3NWJA 1NF3A 2W4MA 3RU7A 4UXIA 1L8OA 1TTHA 1Y82A 1ZOOA 5E8RA 1H9CA 3LH5A 5DFAA 2FRVA 3K2QA 3MVEA 5JFOA 4OH1A 4DXAA 4Z5XA 3NT2A 1RR6A 2GCNA 4KBGA 1FSPA 4R9SA 5ESRA 5FX2A 1LBQA 1PYGA 3LWZA 1CX9B 2BKXA 3IO3A 3UCEA 2D7JA 5LNK6 3WQBA 3ABSB 3GJYA 1M2VB 1MQ9A 1C5KA 3P9SA 1R0ZA 2RHDA 2L19A 4WLEA 4EVIA 3FJ1A 4X63A 1CQZA 3L1HA 4WE3A 2P6MA 1USGA 2Y0CA 3PKIA 4HUTA 2HNAA 3D5QA 1F06A 4PAGA 3LOQA 4ZYZA 1IQUA 2P5SA 2B61A 1MV8A 2ERCA 4AVYA 3KKPA 2O8NA 3KUCA 4ISCA 1TGVA 1I36A 4V2IA 4Y2XA 5HZHA 3WSVA 4OQLA 4K9RA 1WCWA 2I2WA 1X7GA 1KHTA 4P7JA 1ODLA 1HE4A 1L1QA 4TVSA 1AU9A 2EWMA 3HFSA 5CW2A 5DN6A 4I1UA 4C9BA 3AF5A 1Q1AA 3SBDA 2GN6A 1IN6A 3PCRB 1H2AS 4DILA 2BJHA 2RH8A 4V1CI 4L9SA 5JZBA 4R71A 1A2OA 5D6OA 2QP3A 4UAJA 2Q1YA 2NYUA 3OX2A 1JHMA 3JWGA 4E4RA 4JYMA 4EKDA 4AKTA 3ZC3A 4C5BA 5TT0A 4OA8A 4IIDA 4MYUA 3PQ5A 4KUEA 3B5EA 2CMKA 3LMKA 1CQIA 3FE2A 1DTWA 1TZ2A 5AOVA 1A5TA 2QRPA 3LLSA 5JDCA 4YRFA 2I2DA 1C9MA 1JPUA 1ZHFA 4INZA 1CF2O 2RH5A 2RGNC 1V1RB 4ZMBA 2WB4A 5IDQA 2YV1A 1SY7A 2HRQA 5FL3A 4MKXA 1AKYA 2DMRA 2ZYAA 4NMMA 2IH2A 4M8IA 2J0UA 2GQ0A 1M2VA 3KU1A 4R6WA 3OZFA 5AW5A 1KYXA 1LQ2A 3MUNA 4A5SA 1IQ0A 13PKA 4HWTA 2OLKA 3ONDA 3S2IA 5DWQA 2YOGA 3NAZA 4F6RA 1JG2A 1YAJA 4URFA 4BP8A 4YCCA 1P2BA 8ADHA 1USIA 1K8QA 3N2NA 4HVTA 4MS3B 1T6NA 2FP3A 1UBHS 2R5NA 3QLVC 4GFDA 2CFOA 1X2EA 2DTDA 2ZB8A 5IF9A 1W93A 2WJAA 5KINB 4DDUA 4NCNA 3AM5A 3KR9A 1J5PA 3CHYA 2Z5FA 5AM2A 1VKNA 1N5LA 5EP4A 3EZ2A 3N8IA 1E94E