1DAEA

Dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
219
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 71
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daeA00
3CR7A 1VIAA 2J45A 5TV2A 4TLCA 3BXZA 2MSDB 1IQPA 3CF2A 4TMXA 3GJ8A 3UK6A 4CIDA 4Q4AB 4OBEA 1KK2A 5DNYB 1XJQA 4B34A 4ZI3A 5AJXA 3FMFA 3LXXA 3RWOA 4EFNA 2B21A 4RFSB 4V0LA 4HATA 2VHUA 2VYFA 4O25A 5AUQA 4KSBA 3MSXA 4PC1A 2R6AA 4HLUC 4M9ZA 3GP8A 1VG1A 5A5GA 3FVQA 5AR1A 5K8UA 4EPXA 1KNXA 3U7EB 2D2FA 3UPUA 1RPZA 3KDSE 2WWWA 2IA5A 5KNCA 5JMTA 1FTSA 4OHYA 4Q02A 2ZR7A 4HB3A 3ADDA 5AWFC 3P27A 3MCAA 3VX4A 1CU1A 1R8SA 5G53C 4P31A 4R7ZA 1LB1B 3UWOA 1XMSA 4PR0A 2QT0A 4OI0A 3UXMA 5EXXA 3VHXA 3TAUA 2Q6TA 2FPMA 2ODEA 2FPKA 3WNDA 2WPDD 3A4LA 4ARZB 3VKGA 2QGZA 4MRSA 3EARA 1D6JA 4DT1B 1QG2A 2ZE8A 4MA4A 2CE7A 4HLDA 3KB2A 3H1TA 5KNDA 3H86A 2C95A 2Z0MA 2WWGA 4JLPA 4Z54A 5JECA 3T1TA 4URWR 4MH0R 3VKWA 2IX3A 4LHYA 1HQYE 1COWD 2CJWA 1TF5A 2XOKA 1R4AA 1GKUB 1RKBA 3HR7A 3NWJA 4C2UA 3NVAA 2QTFA 4ZDKA 2BJVA 1DAIA 4L15A 2R44A 4AURA 3I8SA 4FIDA 1D8TA 3IEVA 5IRCD 1ZM3A 3Q7QA 4L16A 3WHLA 2R62A 3QXJA 4LC1A 4EPRA 4CT5A 4MYCA 2AK3A 3AKDA 2W6JD 2JIZD 5AJZA 4TT3D 3C5CA 3JZMA 1OSNA 2VBCA 3VR2A 2ZRDA 1YKSA 1GSIA 4MGZR 3BC1A 1FOEB 2QP3A 4YDHB 1GFIA 2WM9B 3LA6A 4KLNA 3CM0A 3HYRA 2GJAA 4EUNA 3LVQE 4BASA 4BEBA 4JLVA 2WMOB 4TMWA 4YDSA 2OFXA 4NCIA 5B57C 3FFBA 4JVNA 1G41A 4C0LA 1M34E 1E4YA 1OPXA 4NTZA 1IY0A 2EFDB 2ZRMA 4W5WA 2L0XA 4DRZA 1E9RA 1U9IA 2XAUA 3KFXA 5FOUA 5FPYA 2KWIA 3VR4A 4DEYA 4JLAA 5EXSA 3U44B 1E0SA 2HDNB 4HZUB 4WZ6A 5KDLA 3NBFA 2ZJBA 2P0EA 1E0JA 4CEIB 3FE2A 2BOVA 2IS1A 1Z2AA 5A4JA 2V54A 4QGHA 3FTQA 4CYMA 4IXMA 2QQEA 2V55B 2FSGA 4Q7JB 2UZIR 1NBMD 3K53A 1OKKA 3A1VA 3GCGA 2KB0A 3SJAA 4TZ0A 1L4UA 1NIJA 2OCYC 1RRPA 1Z0KA 2BBOA 4LJYA 3Q5DA 4RD1A 2DFKB 4KCGA 1JR3D 4N1AA 2REOA 4PANA 4OHVA 1KOFA 3CWZA 4NL4H 4U00A 3CO5A 5L3QB 4ZKEA 4DSTA 1FP6A 4JMPA 4XTRA 3QEJA 2C2HA 1QVRA 5AJVB 5F2EA 1YR8A 3I62A 4URVR 3LNCA 2A5FA 3MRSA 3AVOA 5CYPA 1PLJA 2OXRA 2AHOA 3NG1A 4JVMA 1K6MA 1E9SA 2H92A 1M2OB 3WYGA 4GOXA 1ODFA 5CB8A 4OK3A 3FPAA 4ITRC 2BKUA 3LO5A 4TL7A 4R2IA 1H8ED 1XF9A 2DPXA 3SJBA 4GOJA 2VF7A 1G6OA 4LK2A 2IXFA 1YE8A 2PBRA 4M22A 1KY2A 2OAP1 1NKTA 1U9IC 4ZDJA 1UKZA 1VG9B 3KFVA 5A0FA 2FEMA 3QF4B 4CRWB 2NG1A 2ZS8A 3UG6A 3KUCA 2WWIA 2P5TB 3EXAA 3HPQA 3QNUA 2A5GA 4XVUA 3VNVA 2YYZA 2YWFA 1ZP6A 2ZREA 3A8TA 4GFDA 1QHHA 4B76A 4GMDA 1AKEA 3WBJA 1GM5A 4Q9HA 2WTUA 3P32A 4BEJA 3CKLA 4URUR 2CK3A 2WMNB 3ZJYA 2WIBA 3HPRA 4TLBA 1XU4A 1E1RD 1MRNA 2FV8A 2GWHA 4Q4AA 2GEUA 4US2R 2UZ3A 3OE7D 1PZNA 3N5CA 4RFSA 1CJKC 4X8LA 2YWEA 1W48A 4O2LA 1XTIA 4V0OA 1DELA 2F7SA 4MGYR 4LRWA 3D6TB 2IYRA 3AVTA 5FBQB 4KBFA 3ZVMA 2BEJA 3IEUA 2ZSEA 4WOPA 2RGGA 4PC7A 1EG7A 4I99A 1UKYA 4N0EA 1E79D 4LJ4A 2Q3HA 721PA 1Z6AA 2NPIA 1NSFA 3WRYC 2BMFA 1M7GA 2NO9A 4L5BA 5KPDA 3DOEA 1FUKA 2RGCA 3K9HA 2N46A 3OIWA 3QG1A 4ARZA 4PQYA 1ZUHA 4B32A 2NZ8A 2W0MA 1Z0IA 2IYSA 3K70D 2GJ9A 2I1QA 2P67A 3T1OA 2H18A 1TU4A 3P20A 4TQAA 2PZGA 5CITA 2ZRAA 4AYTA 3WYAA 1N2CE 4UKDA 3RS7A 1FUUA 3TRFA 1RRFA 1KK1A 3K09A 4HLCA 4KYUA 3GJ5A 4C0HA 4KYIB 2BM0A 5JJLA 2Z6VA 3BGWA 2BMEA 3TUIC 3CRRA 1Z3IX 1GP2A 4Q00A 2GEDA 2C77A 5IK2A 1ZW6A 3WMFA 4H9GA 1QBKC 5M04A 3K0EA 1ZUIA 1Z28A 1XMJA 2YOFA 2GDJA 4DDWA 4BGDA 1CBUA 4R98A 4A8JB 2YJTD 4ON9A 5LB2A 4A0FA 4PO1A 1I2MA 1Z0AA 2VHTA 4B44A 1E1QA 3HR8A 5JCZA 3FHTA 4AKEA 4KAXA 4B75A 4XWKA 3W6PA 3LRPA 5KDOA 2ZU6A 4RSGA 2CCKA 2PEZA 4V0KA 4W9MC 1AZSC 2QMEA 2V1UA 1FW6A 1XJCA 2ZI6A 4HDQB 1VHTA 1ZM9A 1Y3AA 4KFSA 5L8VA 1G8YA 2VSOA 4CF7A 1ZYUA 1NBME 2F1JA 3IO3A 4LYFA 4PPFA 4HZUA 3U44A 1TF7A 2WKQA 2HF8A 4CEIA 4KODA 1FP7A 1HYQA 1EFRA 3F8TA 1L7VC 1JR3E 1OFTA 5GVSA 1YHNA 2VL7A 4BFZA 5E7JA 3DZ8A 1F60A 2P6RA 1CJVC 2IWRA 1BO6A 5F9HA 1NBMA 1XBTA 5DLQC 4PPNA 1LF5A 1BKDR 4K8OA 1S3SA 2ZETA 521PA 1DBSA 4O2RA 2BMJA 1XPRA 3RC3A 2QBYB 1XTQA 2QU8A 5L3QA 4ASUA 3QJYA 1NLFA 4BZXA 4LV5B 5FUYA 3W90A 1NY5A 5AUPB 1OJLA 4MRRA 2ZE7A 3CRVA 2D62A 1II9A 1U81A 1P6XA 4YQFA 3TGPA 1GL9B 2AXNA 2WV9A 3ZYCA 4JT2A 2WWFA 4AIIA 4NCKA 3P4YA 2H16A 2C9CA 4CEJB 4RD2A 1JAHA 3B5JA 1P62B 4QG7A 3GJ7A 4UNNA 2IUUA 3PV0A 1IXZA 2GZAA 3CRQA 2HLDA 5FR1A 3V9PA 4LC0A 1KDTA 3VR6A 3ECCA 4BFXA 2DR3A 2J59A 4TLAA 2A2ZA 3BB3A 3JVUA 1K8RA 3F3YA 1SVOA 2RKOA 3Q3JB 4X8MA 3QF4A 1RE0A 2J41A 4US0R 4QFMA 3D8BA 4IEIA 3U4QB 3AVWA 1B23P 5BYJA 4CDGA 4LJ9A 4Q9IA 2J7PD 3GFOA 4C0SA 4ZDWA 3A1SA 4O3MA 1SVSA 4OKSA 3EZ6A 2GA8A 4Q4HB 3RWMB 2GXUA 4RZUA 2FA9A 4B2LA 2JJ2A 3TBKA 5DO9A 2JJ8A 3TW4A 3ZQ6A 4QNRA 4XSGA 4ACAA 5HKKD 2OT3B 1QHIA 2PCLA 3ADKA 3GD7A 4QBHA 3BAFA 1KI6B 4Z1MA 3A4NA 4ZV4A 5FBRB 4DCVA 2ZSFA 3UWKA 5F98A 3R8CA 3CZQA 2UVQA 4JS0A 4L9SA 1P5ZB 3HDTA 2XB4A 3KX2A 3ETLA 5JZVA 3B9QA 3OE7A 3EPKA 2W83A 3LBNA 3PXGA 4DLWA 1GNPA 1G7TA 2CVHA 2IYYA 3KTAB 1X1SA 3OIUA 2QE7D 3EA0A 5H70A 2FNAA 1I4DD 2ZJAA 4M1TA 4UXHA 1XEFA 3OAAD 1DAHA 3N70A 4TYQA 1U8AA 2IL1A 1NVUQ 2QUZA 1P73A 3C16C 3C8UA 1M74A 1T3HA 4G01B 4NCHA 4A6PA 1E79A 1KAGA 2IC5A 3W3AA 2E9SA 4RVCA 4RFVA 2QEQA 2NOAA 3ADBA 1R6BX 1ZJ6A 3GEHA 4Q9KA 3CUEF 3B1XA 1F48A 1SVWA 5LPNA 3QKSB 5JEEA 2W2VA 3ZD7A 1W36B 3D3QA 1WF3A 4V02A 1A5TA 1NLZA 221PA 1KAOA 2H17A 5DGXA 2B92A 4DBLC 1AS2A 2QMOA 3QPUA 1E6CA 5C2JB 5EZ5A 1W0KD 4C9BA 2QZ4A 3BS4A 1JR6A 1E2MA 1UEIA 1S2MA 1X86B 2R65A 4NYMQ 3U3MA 3GEIA 1QHGA 1W4BA 4S35A 1L4YA 3EIEA 3Q85A 1HEIA 2XTMA 3GLHB 3RRZA 3TAHA 5BW8A 2ONJA 1XNJA 3JVVA 1NMXA 3CBQA 1W0JD 3G82C 3K9LA 3QF7A 1IONA 1XMVA 6Q21A 1NMZA 1YJ5A 4Q4JB 5C1BA 4ZO4A 1JJ7A 1UFQA 2QAGB 2ZAOA 4RD0A 1GKYA 2G77B 3AEZA 4BLPA 4QXAA 5SZKB 4B2IA 2ORIA 3CH4B 2WBLC 4WW0A 3R9WA 5JHHB 2ZU0C 3CPHA 4HB2A 621PA 2J0SA 2VP5A 4A2PA 1W5SA 4II7A 2XEXA 3VMFA 3K70C 1GG2A 4E22A 4C4PA 3EA5A 5JI3E 3ZVRA 4QJ4A 2H8KA 4LHXA 2JLRA 1XTRA 2XZLA 1G64A 1DS6A 1W4CA 1E69A 2VO1A 2ZR9A 4HUQB 2QGNA 3QVVA 1AKYA 2LCFA 2QRNA 3T15A 3KQUA 4M9SA 3DKVA 1HUQA 2JLQA 4CT4B 2QBYA 1FPMA 1R7RA 2D4HA 4C0JA 3OESA 2GILA 1DG1G 2JLXA 3CX7A 2ZRBA 4B3GA 3BOSA 4A8JC 2IS6A 1Q0UA 5KPJA 4J0QA 2WJYA 4MKGA 1LF0A 1NN1A 3AB3A 4AKIA 5J4YA 1WBDA 3EC2A 1E96A 3AGQA 1ZNZA 1WA5A 4IDPA 2PZFA 4CEJA 1N5JA 3PFIA 2O8BB 2FN4A 2XOKD 2Q3FA 1UBCA 4JLOA 1G3IA 3LAWA 1FQJA 1T9HA 4B35A 1G291 4BFVA 2D06A 4ILEA 3FHCB 3PUYA 1HY3A 1T4GA 4FCTA 3AUXA 1LY1A 1CLUA 3K0SA 4QBIA 5DI3B 1HT2E 3QVUA 1A2BA 1E2FA 3A1WA 4PSAA 4I1OA 4POAA 2W0SA 4BWYA 4N3NA 3LLUA 2EU8A 3U4QA 2X8AA 3CWQA 2G9NA 3L0SA 1KI7A 1IBRA 1NL3A 1W44A 2OSBA 1CRQA 3EZ7A 2J7PA 3OZXA 3I8XA 4Q4HA 1E2GA 2MSEB 2IK8A 1XD9A 5E95A 2R6CA 3F5FA 2NGRA 3T1QA 3L0PA 1Z6GA 1KI6A 2DBYA 3CW2A 5TY0A 3IHLA 4GP6A 1KI3A 1SHZA 421PA 4PQRA 4A15A 1XPOA 1J2JA 1LTQA 3PCRB 3U3OA 3THYB 1XZQA 1VIYA 4FXPA 1MKYA 2AD5A 4JYBA 4FI3C 3T5DA 4LSGA 2FZLA 1EFTA 4PPGA 1EXMA 2FJUA 3M4YA 3SJCA 3GLIE 4PAOA 2BWJA 2FFAA 1RJ9B 1TMKA 3KTAA 2JLYA 1A1VA 4JBWA 3BFXA 1N0WA 1Z07A 2UKDA 1W1WA 3IBYA 1OKKD 1G5RA 5KSPA 3OAAA 3QKTA 2EQBA 4MGIR 1G1MA 1ZD1A 2ODWA 3IIJA 2GK6A 1II8B 1P2UA 4D6PA 1EGAA 3I5YA 1JPNA 4A9AA 1ZD9A 1U90A 2CHQA 3EWSA 4B3DA 2WWYA 1T5LA 4PC2A 4NHOA 3QKSA 3TH5A 2DB3A 2E1RA 5FTJA 3NH9A 1ZBDA 3BFKA 3DM9B 1E99A 2WKRA 2C99A 3DDCA 5EE1A 3GFTA 2HJVA 1Q57A 5FTKA 2FFHA 2XITA 2B7CA 2XZOA 4R71A 4DLXA 1YZQA 3ZZUA 2HYDA 3EWAA 4V0MA 2QY9A 1E2KA 3A4MA 4Q03A 3RS3A 2FE4A 2JASA 4F91B 4P4SA 2F1HA 4H1VA 1Q1QA 2A3RA 1H65A 2OBMA 4URXR 5HE8A 2V4ZA 3QE0A 1AS0A 3OEHA 1TQDA 4RD6A 3GLHA 3U7GA 5B30A 4G5GA 1ZVQA 3TR5A 3VAAA 3EPLA 2ZRJA 4LCBA 4C30A 2PCJA 2REBA 3HYTA 2FZ4A 4Q1CA 3T34A 4ERNA 3B1VA 4PC6A 4XVRA 2OM2A 4KU4A 4Q4JA 4RZ3A 4B6EA 5CB6A 2QAGA 3GJXC 1U2RA 2J7KA 4Q9JA 3VTKA 4AKGA 4G5QA 1DEKA 5BYKA 2IEZA 2KI5A 1TPZA 1X8JA 2BC9A 4HUTA 4NKRA 4DB4A 3KKOA 2EWWA 2V7QA 1E9EA 2QQ0A 4KSCA 4RD4A 1LS1A 4M53A 1N6PA 2CMKA 2HT6A 4EPTA 5LD2C 4D4KA 5EXPA 2CCGA 3CRW1 3WP1B 1Q21A 1VYTA 2VLIA 5DH9A 1FMLA 2QMUA 1TADA 2RHDA 4OI1A 3SOPA 2IYVA 3IQWA 1BS1A 1EFHA 1HE8B 4CZ2A 2GZDA 1E2PA 3FMIA 4LOAA 2C9OA 4HUQA 2ASEA 2DWOA 2G1JA 5CYOA 4D82A 1YR6A 5EE9A 1JJVA 2IHYA 3AM1A 1IJFA 5FBWB 4BLSA 3RYTC 3LWNA 5JI2E 1X6VA 3AP3A 2GAOA 4HSEA 3NXSA 3W5IA 4B33A 2ZYTX 4W5JA 3K9GA 1U0HC 121PA 1Z06A 2GRJA 4UNRA 2IUTA 1E9CA 2ZM5A 3K0CA 5DE3A 1A4RA 5DIFA 5IF9A 1DVRA 3K0FB 5HZKA 3RHFA 2OILA 1DAFA 1GZSA 4QC2A 1SKYE 2YVUA 3AVPA 3TSZA 3EZ9A 2AKYA 1LNZA 1R5OA 1ZNWA 2QAGC 1WCV1 1S0UA 4NYIR 1J7KA 3E5HA 3MJRA 3PEVA 2KJQA 3U2QA 2AFHE 2O8BA 2VP6A 2PZEA 4IDNA 3AVYA 2IS2A 4ZCIA 3EZFA 1OT3A 3LD9A 2CXXA 5IK2D 4P3YA 4EPYA 4B3CA 3SZRA 1MOZA 3MGCA 2ZI4A 4K46A 2C9YA 2HJGA 1V43A 5DI3A 4B2PA 2OBLA 3MAAC 3WMEA 1D2NA 4HAWA 3M6AA 1ZD8A 2HV8A 4NYJR 1ZAKA 3KKQA 2PT7A 4HB4A 1JAIA 1F3OA 1SZPA 3RS4A 1P9NA 3T61A 4C7OB 2QSZA 5KOYA 1OXVA 5JBQA 2AK2A 1E1QD 1IAQA 4DC9A 2VP0A 4FCWA 1GNQA 4HAVA 2OESA 3ZQJA 4TLEA 5EUQB 2ZRPA 1EK0A 1DO2A 2GCNA 2Q3MA 4GPTA 4MGKR 1BH2A 5K8IA 3MLEA 3BORA 1KYIA 5GVRA 1LW7A 8OHMA 5JS8A 3AUYA 3THYA 2P6UA 2FX3A 2FWRA 1WDTA 4EAQA 4DB2A 1M7HA 4ZCMA 3BH6A 4JKYA 5AUOB 5L3RA 3CNNA 3PENA 4LV6A 4AG6A 1C1YA 1N0UA 4JVLA 1LVGA 2G6BA 5TXGA 1EFRD 4XVQA 4QOSA 1RJ9A 1VKJA 3GLFB 2JATA 3SI7A 3KXIA 2JLWA 4JL6A 1XEWX 4IOLA 4KITB 3C41J 1G3RA 3IILA 2R6DA 4IOKA 2DFNA 3Q5EA 5AK0A 3SJZA 3MFYA 1I4LD 1W5TA 4FW9A 2BEKA 1ZCAA 1II8A 1ZM2A 3CIOA 4OQMA 4ASUD 4I4LA 2Q9BA 2F55A 4C2TA 2OXCA 5KSZA 2JCSA 5KSYA 4CGZA 1Y63A 2IYLD 3PITA 2QL6A 1W4RA 1HURA 3A58B 4JLKA 5KHOC 1US8B 4R9UC 4G5OA 2IYZA 1QZXA 1I2DA 5GJVC 1QHSA 4KFRA 4YMVA 1TQ4A 5EUMA 1KSHA 4WVFA 2HLDD 4MKHA 5J5CA 3FOZA 2E87A 1VCIA 3KJHA 4AYXA 3PG5A 3E70C 4OK6A 1VYVA 4NH0A 5DHAA 4KHZA 3W8RA 4Q1DA 4QL3A 4D80A 3NBXX 1GNRA 2VHQA 1J8MF 4GOKA 5BXQC 3F0TA 4DJTA 4GL2A 4M0LA 3REGA 3QXHA 4M9QA 2XNDD 3ZVNA 4CW7A 1YZNA 1OH6A 1S3GA 2G83A 2J87A 2JJ2D 4M4SA 1M8PA 3ZD6A 3RS2A 5F3WB 2CLDX 1AGRA 2DHRA 4Q21A 4Z1MD 1CR0A 4DKXA 4PFSA 3OIVA 1RZ3A 3X1YA 1KO1A 2R2AA 3A36A 2A5DA 1ZC3A 3PUWA 4JBYA 2ZR0A 4DIEA 1CTQA 2VSFA 3GJ6A 1OIVA 1T8TA 4Q01A 2J46A 3AVVA 1Z47A 1KHTA 4Z8XA 1YR7A 2ZRHA 4E07A 1F6BA 3MUFA 4QRHA 4MKFA 1G3UA 1MO6A 3O8BA 5J47A 1WP9A 1U99A 2CEAA 1LFDB 3LX5A 3AF3A 4NYMR 1DE0A 2ZIAA 4NBSA 2D74A 3QQ5A 5G41A 4JLBA 5BN4A 5J40A 1CXZA 1WE2A 3AKEA 3KQKA 3SR0A 1HT1E 3VFDA 3OEEA 5J4LA 1S8FA 1JBKA 4GNKA 2QAJA 2Z4SA 2ZE6A 4FCVA 4B48A 3PEWA 3B1WA 2XXAA 1G8PA 2WJGA 2IS4A 4RJLA 3UMRA 4R2HA 1NRJB 1NVXQ 1Q3HA 3ONWA 3K0FA 3EIQA 3Q8XB 3NDPA 2QPTA 1MH1A 2YNMA 1AQUA 3ICQB 4ZDIA 1GOTA 4FWIB 1D9ZA 2YHSA 1N3BA 1TEXA 4IFEA 2GK7A 3KB1A 1X3SA 3TE6A 3VR1A 3VU9B 1CS4C 2CLSA 3CONA 1ZU4A 3SN6A 2P6NA 4L9WA 4OI4A 4RZXA 1TF2A 4A6XA 3HU3A 4JJKA 3OF5A 1SVIA 4GRAA 4Q18A 2KE5A 3ND8A 2IXEA 4A0GA 2IEYA 2N1BA 4URZR 3NC0C 1KKLA 3O47A 2VP4A 1CEEA 2Q9CA 4IJMA 5TVKA 3VX3A 4LHVA 4MUAA 4C7OA 4LBYA 1E2IA 3FDIA 5JS7A 1OB2A 5J4VA 1MT0A 1BYIA 2BKEA 2IF0A 1J8YF 2A30A 3CR8A 3DMDA 4M1YA 5KDDA 2YWHA 4YC7A 1E4VA 5FL3A 4EFLA 1OYYA 5FPKA 5FBLB 2IW3A 3SEAA 1G3QA 2OCBA 1EX7A 2DWPA 2GAAA 1ZM4A 5H8WA 4M2LA 3TMKA 2ZE5A 2G1KA 3GLFE 2J0UB 1AGPA 1U8ZA 2FMXA 2OE2A 3E2IA 2A5JA 2R6FA 4Q7MB 1R0XA 2OBNA 3EIHA 5C46F 4NYIQ 1RFLA 2X1VA 4TTPA 4G5RA 1IN6A 5FI1B 5KSOA 4TSFA 3GLFA 2AKAB 3SDZA 1XDBA 3EPHA 4V03A 3I61A 2ZTSA 2HUPA 1G7CA 5J4KA 3KKNA 2CHVA 3K09C 1E3MA 3X1WA 1GVNB 2B8WA 2F9LA 3I73A 4NYJQ 3TKLA 5D3MB 2O8DB 4LYAA 4P0TA 4MDEA 4LJ7A 1V5WA 4ZI2A 1R5NA 2PX3A 1XTKA 4DWJA 1YVDA 4KV9A 4IVPA 2BBTA 1UBGA 5IDVA 2IYTA 4OQXA 1A82A 4LBVA 3IIKA 2QORA 1HH4A 1H8HA 2PLRA 3LY5A 4OQFA 2I4IA 5H68A 5GJWC 1N6NA 4PTLA 1US8A 4JSYA 1KY3A 3THWB 4JSTA 1OYWA 1P7CA 3M1IA 4JIMA 1GRNA 1N6LA 4QNMA 1NVVQ 4QKQA 3TK1A 2IUSA 3QIAA 3R20A 2O8EB 2YOHA 4DLUA 4HZIA 4Q1BA 1Q44A 2ZVQX 4US1R 4C0QC 4XWOA 1VG0B 4GZMA 5KNBA 2Z83A 5GJCA 2Z5FA 4YMSA 5FL7D 5EE0A 1SHKA 3PEUA 2YWGA 1ANKA 5JFGA 1KK3A 1E98A 3IO5A 3I4LA 3L0OA 4IW3B 4E09A 1VECA 2EVWX 2XNSA 1W49A 1OXUA 2V6JA 1NP6A 2ECKA 2XNDA 3H2YA 3L8YA 4OK5A 1RYHA 3WRXC 1UEJA 3TQCA 2ZRIA 1S4QA 2VTKA 3P26A 2BCJQ 1VPLA 3C7KA 5SZIA 1NI3A 3U7FB 2GXAA 2ZSAA 3U61B 5G40A 4P32A 4HI0E 3K9NA 2D7DA 2NO7A 2I3BA 3EC1A 2EFHB 3FB4A 3LV8A 1P9WA 1NMYA 4KBGA 3FKSA 2YC4C 1Z6YA 2BV3A 2IYUA 1LS6A 2YZ2A 1G8FA 3PUXA 2JLUA 3SE0A 4AYWA 1Q3TA 1VHLA 1UPTA 3K0AB 3B2EA 3QBVA 5FUXA 2IF2A 2EYQA 3LW7A 1E9DA 4ZIRB 1KSFX 4EPWA 4DCTA 1JEDA 5JCPA 4OYHA 1GL7A 1A7JA 3I92A 1E9AA 5AJWA 1XCPA 5BWMA 2GCOB 1VMAA 3MWKA 2B8TA 1D2EA 2RGBA 4WIAA 1ZNXA 1D5CA 2V1XA 1TNDA 1P2TA 4ESVA 1XD8A 1W36D 4A92A 5FOVA 1G4AE 1JXOA 3CF0A 4TL6A 1XMIA 4A2QA 4C0AC 1KI1A 4KVAA 4Q66C 3PR1A 1JB1A 4TLDA 4TL8A 3VU9A 4WAUA 2F9MA 4ZPXA 3V00A 4DIDA 4XJXA 2O0JA 4TQ9A 3QG5A 3W34A 2JDID 2AR7A 4G0NA 4WXPA 3TUZC 1W2GA 2ZRKA 2YKGA 4OL0A 1G4UR 3ZZ0A 2OUKA 4P4SB 5JWHA 4HEJA 2CBZA 3DO6A 4GSYA 1NG1A 3B7GA 3L2OB 3O8CA 1YRAA 3OEHD 3GPLA 2FGJA 5B64A 3NIBA 3CLVA 2FPLA 4G3XA 2GJ8A 3CX6A 1DO0A 1RVDA 2AWNA 3SYNA 2G0TA 3DEFA 5ELXA 4DSOA 2FDCA 1KO4A 3QENA 4EQ6B 2NZJA 1II0A 2O52A 1T3SA 3NDBB 1Q20A 2REXB 2V7QD 1FNNA 1KNQA 2J0UA 2RB4A 5TMPA 4HAYA 3R9XA 3NKVA 4LDJA 3CNOA 4YXWA 1UKVY 3NBYC 2V9PA 4JLNA 4A2WA 1TUIA 2C8VA 1KO7A 2O8FB 5JEDA 2FEOA 4KVGA 5EJEA 3R7WB 4Q1EA 2EWVA 1VCOA 2OEPA 2WSSD 5TARA 2QENA 1KJWA 1RIFA 1Z6TA 2JA1A 4PXAA 1P9RA 1NY6A 5LB4A 1VCNA 1UDXA 2FOLA 1GUAA 3A1TA 4PHFA 3QBTA 1EWRA 4I1UA 3LQQA 2VEDA 4JL5A 4QJ3A 3VKHA 2MSCB 2O8DA 3CNLA 5D3MA 3TVDA 2OAQ1 1E2JA 4LI0A 2X19A 2SHKA 1VG8A 1RC8A 1UBEA 2YOGA 3IBGA 1UF9A 4GT1A 4NMMA 1UADA 2F6RA 4YMUA 3IQXA 1MV5A 3KJGA 1EESA 4U7DA 1ZCBA 4WZAE 1L8QA 4I1VA 1CR4A 4LPSA 1TQ2A 2IYWA 2OG2A 3THWA 3RC8A 1PLLA 1G9XA 5C4GB 2GCPA 3B60A 3N2IA 3GJ3A 4AI6A 1HA3A 2O8EA 4IDQA 2G88A 2VA8A 2GXSA 4D0GA 5JSZB 5HTKA 4BFYA 2ZRNA 4D0NA 1VYUA 1AK2A 2V6IA 4HDOB 3J81k 1AA9A 1N6HA 2ZAMA 1EWQA 1NVWQ 2HYIC 1XPUA 3KZ1E 4EJSB 2QTVB 5FUWA 2V8OA 2IWHA 4JVSB 5FL7A 4IDHA 1UM8A 4FMDF 1IN7A 4O0MA 4UXIA 2V3CC 3VNUA 3QI2A 4WZBE 2GJSA 4BFSA 4B74A 1PJRA 1FTNA 4D26A 4URYR 1JQLB 2KBEA 4PSVA 3B1YA 3WNBA 3WP0A 3MG9A 3HJNA 1G16A 4KLZA 2OHFA 5FTNA 4QJ5A 5EZ6B 1VCMA 1P2SA 2ZJ5A 4HAXA 1K5GA 2X77A 5EP3A 1U98A 1O87A 3SHWA 3W3ZB 4NE2A 1TAGA 4KFTA 4LBZA 4Z51A 1UKEA 1N5LA 4DEXA 5CJ2A 4F7WA 5FTLA 1CIPA 4NDZA 4GP7A 2GBLA 1N5IA 1XJ0A 5HCIA 3IUYA 4D81A 2P3SA 1N6RA 4WBSA 1U0JA 1G6HA 5FFMA 3K0AA 3QXCA 4B43A 1VDZA 3BBPA 1NN0A 1TQ6A 1ZINA 4JLDA 4C0KA 2VQSA 4ZIRA 2GJKA 1SKQA 3RSLA 1XZPA 1TTTA 5IT5A 3B9PA 1R5BA 1JI0A 1BIFA 2XJ9A 2GCOA 4M1SA 2O0KA 2OV2A 3FMPB 3REFA 3TW8B 3KUDA 2QROA 4V0ME 3T1VA 4Z8YA 4XH9B 1P60A 3BIFA 3FGNA 2BIFA 4UNSA 4EFMA 3HU1A 3QY0A 3ZH9B 4QGGA 2WOJA 1UJ2A 3LLMA 2NIPA 3L82B 2NO0A 2AD1A 4FMCF 2J0VA 2QM7A 4B73A 1KSJA 2PX0A 4OQLA 3H4MA 4ESHA 1WXQA 2PMKA 3SYKA 2QM8A 3U6BA 1Z83A 3GLHE 1DOAA 1MABB 1OXXK 2OO7A 1KI8A 4KJZA 4AWXA 4GDFA 1G19A 1S96A 1GRRA 1C9KA 2JDIA 3B6EA 5G3YA 3MMPA 1FFHA 2RHMA 3E1SA 3U3JA 2VPPA 4LJ8A 1U94A 1SULA 2GBLC 1UBFA 5FI0B 5EP2A 2H7VA 2GTPA 2NO1A 1ZU5A 4RCZA 1D9XA 4LJAA 3WHKA 4IFBA 4HB0A 3SQXA 4FWTA 1KI4A 1Q12A 3AH8A 2PT5A 2QTHA 4JLJA 4EQ6A 5H1YA 1KK0A 1RYFA 2J1LA 2OZEA 4XTCS 3ZIAA 2LWIA 2BVNA 2ZYVX 4LWZA 3LQRA 4E5UA 1E32A 3H0KA 2VIIA 3WXMA 1S9HA 3I1FA 2OFOA 1IXRC 2ZI9A 3DMNA 1QVAA 4IOJA 4LV8B 1NNEA 4W5HA 2XTNA 3SS8A 2IBMA 821PA 3GJ0A 3Q72A 2O8FA 1EFUA 2WAXA 4BECA 3TLXA 3GLGA 1PUIA 3R7WA 5FTMA 5HR5A 4TZ6A 5BQ5A 4LY6A 3SBEA 4QGAA 1W36C 4KXFB 2VP2A 4RKFA 2WSSA 2XJ4A 5C4MA 3RRYA 4LGMA 1W2HA 4B6FA 3OEED 3S1AB 4YMTA 1OH5A 1KDRA 4IHQA 1SVMA 3VQTA 2NMVA 1CULC 1NSTA 2FU5C 4ZCLA 3LXRA 5EE3A 3U6KA 2BMDA 4ACBA 4P4TA 4N0DA 2JLVA 2ZRLA 4MDFA 4NONA 4PQFA 4XD7D 2P65A 2XXAB 4F93B 3EW9A 3BRWD 4DLYA 3ADCA 5JLJA 3DKPA 4PX9A 5JHGB 4DXAA 1DADA 2JLSA 3ZGXA 4WXRA 4UJ3A 2WAYA 2ZPTX 1CJMA 1IN8A 1CKEA 1WB9A 3N2EA 2VSXA 4RZ2A 2ERYA 3KQLA 2ATXA 1T5IA 3WYFA 1F2TB 1SVLA 3B13B 3X1XA 2WVJA 1JALA 5JSZA 2ZITA 4DLVA 4Q9LA 5IHPA 4EDHA 2QPOA 4TTRA 4IXNA 1X8KA 3LDAA 2CHGA 4EJSA 3AKYA 3IKJA 1QHXA 2WHXA 4BZPA 2N42A 1NKSA 3UMFA 5GADl 3O8DA 1DAGA 4WA7A 4W7SA 1XCGB 4LYJA 4PC3A 1RRCA 1ZM7A 5LDDC 4F4CA 1KDPA 2C5LA 1U0LA 3DL0A 4IVRA 3IIMA 3EZ2A 4Q19A 2CE2X 3C4JA 2K5UA 4A0HA 1B0UA 1IXSB 1HV8A 4GMXA 5DHFA 3FHOA 2CNWD 4H1UA 1AQYA 1T6NA 1XEXB 4Q47A 1NVVR 2AL7A 3AVQA 3K0CC 2CL7X 1KZ7B 2ZUDA 2EYUA 4XIGS 2D3WA 4JBXA 3QSYA 1QG4A 4DLSA 2F43B 2ZVPX 1IJEA 1YZLA 2DCUA 4OJKA 5KYKA 2TMKA 4TSFD 2VH5R 5FBVB 2FGKA 2RGDA 2QRZA 2W00A 2HEIA 3D7MA 5EP1A 1Z8FA 5C18A 1G7RA 1GITA 2O5VA 3C14C 2A5YB 2F1IA 2C98A 3QKRB 1KSGA 2EFCB 2ZI3A 3RLFA 1WRBA 4F38A 2AWOA 3GFPA 2JJ1A 1YRBA 1FQKA 1KJYA 3BH7A 2EW1A 3QPVA 4NZYA 4QM6A 1F2UB 2HF9A 3AF1A 4PAMA 1GWNA 2DFTA 5TB5A 4EJSC 1CJTC 3QKUA 2VF8A 3UIEA 2WZQA 2CDNA 2H5EA 3FWYA 4TYWA 1P61B 1H8HD 1HE1C 1MO4A 3HWSA 4Q5IA 2XSZD 1IOZA 5J4HA 5E3HA 1SXJD 2FSIA 3MWYW 3B8HA 3CX8A 4LBWA 4M8NE 3EX7C 1SXJB 3RRNA 2QPAA 4PHGA 2VHCA 5DSZA 2GHIA 5B2ZA 3O8RA 1JNYA 1DAEA 1MABA 1R0YA 2IXGA 3LH5A 5CM9C 1NN3A 4AD8A 5F9FA 1TX4B 4BLTA 1IY1A 3U7HB 2PJRA 4F4JA 1N6OA 3L43A 2ANCA 2A78A 2HXYA 4HLQB 2PL3A 5FOWA 4BFWA 5K8LA 5HCNA 2RGAA 4XWAA 2JLZA 1FNMA 4HAZA 1XXHB 1BYUA 1OHHD 2CCJA 2DY1A 5SZJA 5CLLA 3RVBA 3UG7A 4B3FX 1SQ5A 4BFTA 2ZJ8A 4MQBA 3SU8A 4Q7KA 3NHBA 3FKQA 1WBBA 4X8OA 4A1FA 2BJWA 5E4FA 4BUJA 5FUVA 1AN0A 2FH5B 1KI2A 5DI9A 1YQTA 2ZUBA 1UDWA 1W47A 5HPYB 1JPJA 4TYNA 1FMJA 5KUTA 1Z63A 4TMKA 4UXJA 4LJ6A 2P5SA 3ZS8A 4JJZA 1CJUC 3KL4A 3VHLB 4B71A 3FKSD 3THXB 3B82A 1CF4A 2R9VA 2ORVA 2O0HA 2GETA 3ASYA 4LZZA 3BJIC 2RH5A 1T8UA 3QEOA 2ODNA 1J99A 4IRUB 4S2EA 3FFAA 4LHWA 4QHSA 5CK4A 5HE9A 2XX3A 3DM5A 1D2MA 3MJHA 1E9FA 3S1AA 2RMKA 2PLFA 3RAPR 3T06B 3AF4A 1RRGA 5JWOA 2JAQA 1NN5A 3RNLA 2RAPA 2NO6A 4LX0A 1KIMA 2YC2C 4Q7LA 1OH7A 3CZPA 4D4LA 4DDVA 2ZRCA 1IN4A 1K5DA 3Q9LA 4XD7A 1YZTA 2BDTA 4LPKA 2PMDA 3QUSA 4B3BA 1XB2A 5L3VA 2F3RA 2CL6X 1YZUA 3GJ4A 1M7BA 2G0NA 4NU0A 1FL9A 2FFQA 3U3RA 3TJZA 1DARA 1AZTA 1KMHB 4DZZA 5E7IA 4DHEA 2HCBA 1F2TA 1AM4D 4K81B 5LBIA 4M1MA 2R8RA 4AKHA 1G21E 3AF0A 2ZRFA 4PO9A 2QI9C 3W6NA 3BERA 3A37A 4PHHA 2CL0X 2MMGA 3DZDA 1N25A 3PUVA 4RY2A 2WWHA 3P4XA 2WPDA 5FR2A 4DT1A 2I1VB 3BD9A 3KXKA 2O8CB 4RKEA 2FF7A 2F3TA 3K70B 2HT1A 5UKDA 3A6PC 2ZANA 1HTWA 1LV7A 1SVKA 4A82A 2ZROA 4GBMA 4F4IA 1Q22A 1TUEA 3KKPA 1QHYA 4F92B 5BN5A 2FSHA 1YR9A 1P72A 4JKIA 3VR3A 1NJGA 1CP2A 1SGWA 1S1MA 1COWA 5EP4A 4OJQA 1T3LA 2RGNA 4GI7A 3UANA 2GF9A 2A7QA 3MWLA 4YXWD 3U60B 4JT4A 1XEXA 3BH0A 2ZQ5A 2J5XA 2CNWA 5JJKA 4G5SA 4TN1A 4YMWA 3BK7A 1OV4A 5AJYA 1P3JA 1T91A 3IPXA 4BQSA 2F43A 4DUGD 3CH5A 4JYCA 2W6JA 1HQCA 1M1YE 2JIZA 4TT3A 3TIFA 4HAUA 3V4FA 4LYHA 3G0HA 1R2QA 2GVDC 1OXSC 1NLYA 4OQNA 4DLTA 2AXPA 4L4UA 4TWZA 5BN3A 4MYHA 4P4UA 1G17A 1P75A 1KO8A 1Z08A 1MR3F 2NQ2C 3QKRA 4MRNA 1NF3A 3ND9A 2XB2A 1E2NA 3IPYA 4Q1FA 3K1JA 4M1WA 2H1LA 1G3MA 3GMTA 3ZDQA 4B3XA 1F2UA 3W8NA 3NTUA 3KXLA 2ZS7A 1TL7C 1SXJE 1WQ1R 4Y0VA 5GJBA 4FD2A 1EX6A 2WICA 3X1ZA 3I3SR 1Z22A 2BM1A 1YU9A 4A36A 1BOFA 2JGNA 3T12A 3QPWA 2FSFA 2BCGY 3NHAA 3B78A 4D4MA 4X8HA 1AS3A 2XSZA 4G1UC 3RRMA 4AK9A 1SXJA 3OFND 3R8FA 2OLKA 4HDCA 2WWXA 2JEOA 2RGNC 2WOOA 2BBWA 4MYTA 1KKMA 4ABYA 1XXHE 5AUNB 3AP2A 1ESNA 4D25A 2GVZC 1KI9A 3BWDD 4PZYA 4DCNA 3AV0B 4BLOA 1BMFD 1JR3A 1Z2CA 1ZNYA 2W2TA 1DG3A 2ZYWX 4BRUA 4TYYA 2LKCA 2ANBA 2Q0HA 3W9YA 3GEEA 4JZKA 3C15C 2ZI5A 1M6NA 5KTYA 1XXHA 1ZRHA 1JQJC 3BE4A 1S9DA 1YZKA 4IKEA 1XCMA 1OHHA 2VRWA 1G5TA 3WMGA 3BFVA 3CPJB 5B58C 1R10A 4BZQA 1PV4A 2AX4A 4EIWA 1R0WA 1TEVA 1XP8A 2ONKA 3RS0A 4PPQA 3DHWC 1G20E 1H8EA 1GL6A 4FMDB 4MUBA 5G3ZA 4TMVA 2B7BA 2ZSDA 1DTSA 2C04A 4BRWA 1ZMXA 1CR1A 1JEEA 2ORWA 2AN9A 1XWIA 2Q21A 2ZRGA 3I32A 1OE0A 3PJRA 4QHTA 4BFUA 1CR2A 2Z4RA 4NCNA 2W6ID 2NPFA 2VP9A 3THXA 3EG5A 3L0IB 2QP9X 4FMBB 4CEHB 2QN6A 2GZHA 3UATA 1QHNA 1GKIA 5CM8B 3H84A 4PSKA 1SXJC 4OI2A 2YINC 3LBIA 1Q1ZA 4EPVA 1Q1EA 5JRZA 1GTVA 1XTJA 3L8ZA 2DFLA 4KFUA 3AVXA 1XEWY 2CVFA 2ZXUA 1XD2B 2FFBA 5FPHA 1E1RA 5DYGA 3AGPA 5JRJA 4OHXA 3ZS9A 1ESMA 2H57A 2QNRA 3LVRE 1NJFA 1ZC4A 1N0VC 1Z6XA 2F1RA 4TTQA 4Y0AA 1E0KA 5CLQA 1L2TA 2HCJB 4LHZA 4CVNA 5EE5B 2LKDA 4QM7A 1GDDA 1OF1A 4A4DA 3TR0A 1KMHA 1XTSA 1OFUX 4RD3A 2OCAA 5L3SB 2IYQA 3LBHA 3RDPA 3PIRA 2BHRA 3P1JA 4TMZA 5P21A 3GLIB 2C96A 3QXXA 1E2HA 4E03A 3DOFA 3QOFA 4QGFA 2WJJA 4FMCB 1JXMA 4D0LB 2P2LA 1OIXA 1RW4A 4DCSA 5LD2B 2D7CA 1Z0JA 2ZJ2A 3D31A 3B85A 2O8CA 1OLOA 3NEYA 1I4TD 2ZS9A 2C78A 2KSQA 1G18A 3A1UA 3ZIAD 3TNFA 4D2IA 1DAMA 1OW3B 2X2FA 3UKDA 2XGJA 2ZI7A 3AVUA 3SYLA 3LFUA 4TYPA 5E7MA 2GEVA 2GNOA 2WJIA 2QMHA 1PLKA 4BLRA 4M1OA 3SC3A 1FX0B 3RANA 2WKPA 1C4OA 5DN6D 5ANRB 2ZEJA 1OFIA 4TQUS 2ATVA 2J9RA 1G8GA 4A8JA 1Z29A 4C0BA 2QSYA 1ZIPA 1MO5A 2IHBA 5D3QA 3GLGB 4JL8A 1MRSA 3RS5A 4Q4LA 4DUGA 4OHZA 3SQWA 3AF2A 3ZVLA 1T0JB 5K8TA 4DVGA 1N6IA 3TSOA 1P4SA 3NEJA 3IDQA 4PZZA 4M1KA 2QG6A 4KO8A 2RGEA 3AKCA 4BE7B 5KO2A 4IVQA 3KQHA 3G5UA 1XFAA 2QP4A 2PJZA 5SZHB 3NC1C 1A2KC 4I81A 2QA5A 5FOXA 1AJEA 3U3KA 4DSNA 1GRQA 4MKIA 4TMTA 3TVTA 1KDOA 1ZUNB 1DPFA 2ZYUX 4L8GA 1ETUA 1QRAA 3FYHA 2QT1A 4Q48A 1XX6A 3V4RA 1O3YA 4UNPA 1QF9A 4QBGB 2ZJZA 2C03A 4EKDA 1E9BA 3OFNA 3W5JA 2Q9AA 1E2LA 3OIYA 3SFZA 1IY2A 4PZLA 1X1RA 2ODBA 1YZGA 2A9KA 2W2XA 3PVSA 3CB4A 5FOSA 3UMSA 2IYXA 1ELOA 1KMQA 1G7SA 1N5KA 2GESA 2Z43A 1W4AA 1BMFA 2OLJA 2GKSA 4PO8A 4P33A 2GF0A 3C5HA 1FZQA 4RCYA 3X1DA 1KGDA 1N6KA 1W7AA 1S1CA 2DWQA 3ASZA 1IM2A 4D4JA 2YV5A 3TQFA 2WSMA 1OH8A 3LW8A 1TU3A 1Q1BA 2CJWB 4YLGA 1E2EA 1J70A 3R9IA 2IT1A 1OFHA 3K8YA 2B6HA 4LJ5A 3ICEA 1SKYB 3THOA 4PHTA 1AIPA 1VTKA 2KBFA 1E94E 2ZUCA 3KJIA 3AQ4A 1KZGB 5DISB 4B47A 4AY2A 3PUZA 4CEHA 3FMOB 2W6IA 4UJ5A 3T35A 3KJEA 3ZZTA 4U02A 4BLQA 1ZIOA 1R8QA 1JECA 5CIWA 1EFCA 2ZJOA 4XSHA 4IEEA 5FOTA 4YONB 4IOMA 2J3EA 2NTYC 5CJPA 5CK5A 1PUJA 1KO5A 2J0QA 1KJZA 1ONBA 2JJ1D 3T5GA 2CLCX 5HKKA 1XRJA 3WNCA 3JZAA 1XD2A 3HP1A 3IGFA 4M21A 3NBZC 2AFIE 3I72A 4TL9A 1WMSA 4M9XA 4Q1AA 2Y8EA 4UQOA 1OB5A 3IHWA 3ZLJA 1IN5A 3HU2A 5EQTA 5KU1A 4DCUA 4MITA 2XZPA 5HZHA 4DLZA 4DDTA 3W6OA 2ZJYA 2R6GA 3PEYA 1GIAA 3QXSA 1PVOA 3CPEA 3BB4A 2HXSA 2X2EA 4PAQA 1E2QA 1G8HA 3TUJC 3PQCA 3SHFA 2QE7A 1Z0DA 3TSWA 3EASA 3DVLA 4KI0A 3KKMA 1OXTA 4ZKDA 1NIPA 4IDOA 2PEYA 5L3SA 4C3ZA 4GZLA 2MMCA 2OFWA 2EFGA 3GLIA 5EXTA 3WBKA 1IHUA 3EPJA 1P2VA 3B1ZA 1CRPA 3U5ZB 3CRMA 4DDUA 5JWRA 4MRPA 2OCPA 1F5NA 1Z5ZA 4FN5A 1G5PA 3BB1A 3RABA 5CIQA 4I1SA 3X2SA 4QBFA 5TDHA 5FPSA 1GILA 2GXQA 3SFVA 1X8LA 4A0RA 4HLUA 3LX8A 1MO3A 1NG9A 4MRVA 2WJHA 4NPHA 2BBSA 4AG5A 4NCJA 4DSUA 4OHWA 1DAKA 3MD0A 4XOIA 4HYYA 2EFEB 3GLGE 5JJIA 3CF6R 4UNQA 2XTZA 2WJVA 1T0HB 3GQBA 4JLMA 1W46A 3WY9A 1W0KA 2G3YA 2W58A 3SBDA 4AC9A 4MYUA 4U5XA 5DYIA 1FX0A 1R0ZA 5CDFE 2FG5A 3MWJA 1UAAA 3M0EA 4DLRA 5FPTA 1E2DA 3NH6A 2RGXA 4FINA 4LUCA 3AP1A 4NP6A 1GAJA 5DN6A 2DYKA 3SNHA 1U8YA 2ZSBA 2PH1A 1J90A 3VR5A 1E0AA 2D2EA 2VHJA 2WIAA 3DPUA 1KTVA 4BPBA 2RCNA 3EAQA 3RSOA 4V0NA 2ERXA 5FH9A 1QHHB 5CDFA 3OHMA 1W0JA 2CK3D 3I5XA 3Q7PA 1Z0FA 3KQNA 1QDEA 1OIWA 4QHYA
chains in the Genus database with same CATH superfamily
3CR7A 1VIAA 3DEKA 4TLCA 3FETA 4IIEA 1PTJC 3HJBA 4YR7A 4HO1X 3WS7A 3GJ8A 3NYWA 3EVCA 3VHRA 4CIDA 2DP4E 5E3JA 1Y4DE 4LRXA 4EYGA 1XJQA 3IBSA 5DNYB 3VAZA 2W8BA 3LXXA 3RWOA 2B21A 1OWOA 3D54D 4PX3A 1DTWA 2HJHA 2VHUA 4O25A 4PC1A 1JQEA 2A0UA 2YYSA 3TINA 3ENKA 1IZ7A 4GEGA 1T6YA 4EPXA 4ZVNA 3UPUA 2DPYA 4H4CA 4DR2B 1HLGA 3PHIA 4H6VA 3WA7A 2AOVA 3JR3A 2DHCA 3QZUA 4UU7A 4QPPA 1FTSA 4TMFA 3SF8A 1VYHA 5FXMA 4CIWA 4HB3A 5AWFC 1ECBA 4EENA 1D7AA 1WD5A 2AEEA 3MCAA 3UMMA 5EWJB 1CU1A 2JANA 3F5DA 3HJCA 1WABA 4UBLA 3ZGYA 3C48A 3OC6A 4NNOA 4R7ZA 4UHEA 3SHOA 1NDUA 1S3IA 3FCSB 1AUQA 2JFOA 4OI0A 3VO1A 5ERXA 2Q6TA 5IT9A 4Y2SA 3WBBA 1L7EA 1WETA 3OFSA 1KP9A 1ATZA 3MA0A 3MJEA 5FV4A 3D4BA 5IYZB 2RC6A 1E4EB 3EARA 2E55A 1D6JA 1UQRA 3ORQA 2ZE8A 4GC9A 4WK6A 1E1DA 4H3SA 3OJLA 4DT1B 5KNDA 3H1TA 3H86A 3FHJA 3OQJA 1POWA 3QU5A 5CRIA 3UMVA 2Z0MA 4AUKA 1RABA 2QPLA 2Z8ZA 3GJTA 4M38A 2WWGA 3NWPA 4JLPA 4F56A 4Z54A 5JECA 3T1TA 1WDMA 1KZ4A 3LCUA 4ITVA 4URWR 2XF8A 3P0HA 2DBVO 1MN6A 1T5SA 1HQYE 4H3KB 5HF8A 2C5FA 3AFOA 3LMKA 2VT3A 2XOKA 4NEGA 1VE5A 2NACA 1GPWB 1CFJA 2BKAA 1RKBA 2B4AA 2V8BA 3HR7A 1Q6ZA 4ND2A 3FVVA 4L15A 1DAIA 1VJRA 2G17A 2PQ2A 2W98A 2AJBA 4C6TB 5KOJB 4FIDA 3R3WA 1D8TA 1P0QA 5IRCD 4XUCA 4KH0A 1FQOA 3R0VA 1T9DA 3D6FA 3R3SA 2YJ4A 4Q7EA 4IHAA 4DZRA 5TJHA 1T9CA 3BTUA 4MYCA 4BLVA 4CT5A 5CFQA 3ERCA 3MJTA 4S24A 2SBTA 4TT3D 5AJZA 1I6LA 1SBIA 2OC9A 2VBCA 2V7XA 3VYTB 3U7JA 2CDRA 1WCXA 1YKSA 3JW8A 1GSIA 2DTEA 3Q3CA 2ICAA 3LA6A 4NNPA 3CM0A 1IWOA 2RK3A 5HJ5A 3L6OO 4D3DA 4H6XA 3LVQE 1ZOSA 4Y2XA 3IV6A 2OFXA 4NCIA 3V8QA 5B57C 4HVAA 4C0LA 2BISA 3H83A 4EGQA 1P29A 2GO1A 1OPXA 3FRHA 6AT1A 5DWDA 2Q5LA 2H1VA 4W5WA 3H2KA 4UEJA 4RACA 3WHPA 4QATA 4DRZA 1EVIA 4DLLA 1K6IA 3ZE0B 4CTJA 1U9IA 3KFXA 4QSMA 2JJYA 1NMQA 4XCVA 4C7JA 4D3FA 2XKAA 3H11B 1V11A 3PQDA 5DHSA 3VR4A 2VXBA 1E0SA 1V6SA 5KDLA 4OP3A 4WZ6A 5KIAA 1ZD5A 2I6GA 2JVIA 2QRVB 1E0JA 1E0DA 3D2AA 1O95C 3FE2A 4YUVA 4URFA 3ZK8A 3W6UA 4FB4A 3OBBA 4PBTA 4JYAB 2ZZKA 1GTZA 2V55B 1X7GA 4W4TA 3JQDA 4JC4A 2WHEA 2R4QA 1XRMA 2YDXA 5LBUA 3FYUB 3ZXIA 5A4DA 4TZ0A 5SY6A 4PICA 4CHGA 4TWIA 3DUFA 4XGNA 4YV1A 4LJYA 1NJ8A 2XDQA 2DFKB 4KMSA 3CZCA 3C39A 4M0DA 4N1AA 5HGXA 1TYCA 4U00A 1FLDA 3CO5A 4EF6A 4ZKEA 4DSTA 4XTRA 2IZ1A 1L7RA 4CMIA 3TZEA 2VDNB 5ITWA 1WTCA 2CF5A 3LNCA 3GFRA 2YW2A 1H22A 1PLJA 3HBMA 1A7UA 3ORHA 1AUOA 1A97A 1KAHA 1KJ9A 2GBPA 1GZ5A 3WRYA 2H59A 1KFKB 3C97A 2HKIA 4JVMA 4PNPA 5G1NA 1UDCA 1E9SA 1OZFA 2FPIA 4IIJA 3WYGA 5IM4A 4GOXA 4NEQA 1ODFA 4UCQA 2XMGA 1L3CA 5EJIA 3RGGA 4BCDA 1PR0A 3I6IA 4ER5A 4B31A 3ABSB 3LO5A 4CNBA 4TL7A 1MHTA 1H8ED 2DPXA 1PWXA 4QYXA 3ZCVA 2L82A 3RYIB 3LIIA 4KXMA 4NNJA 2VF7A 1QP0A 2ZKIA 2PBRA 1KFBB 5AW6A 3LI2A 4AUEA 2OAP1 1RFGE 2CXTA 2XE8A 1T3GA 2C4VA 3KFVA 4KQ2A 4WXMA 4F4FA 2BFEB 2VTVA 3ASUA 3H1PA 4W8HA 4X64B 1E62A 5CW1A 4BU0A 4C4TA 1QCDA 4L4XA 5BSTA 3H2GA 4CRWB 3FUCA 4Z6KA 2RFLA 1JLKA 3EGDA 3LBYA 2WWIA 2P5TB 5AOAA 3HPQA 2YIMA 3QNUA 4ZT7A 3R7SA 5I7EA 3LKZA 1A04A 1Y6RA 2YWFA 4KO1S 3MUOA 4UDNA 4GMDA 1AKEA 1O6BA 2M1ZA 4LTNA 5BUCA 4Q9HA 2PIAA 4BBZA 1GTL1 3G3EA 4PG5A 1LW6E 3TD6A 3L0BA 2CK3A 4DG5A 3NIGB 5H81A 3ZJYA 1XL1A 3DFKA 3HPRA 5K0ZA 4B3TB 3KZCA 1ZISA 1JEAA 5EOVA 5EPUA 1E1RD 2FV8A 4ZQFA 2PR7A 1JQBA 1RXCA 2GWHA 4RIGA 4NZPA 1Y6QA 2WIGA 3T5BA 2HB6A 5IS2A 1E3QA 1V8OA 2ZBGA 5FQNA 1CJKC 4X8LA 4YRIA 3P9RA 1W48A 1C0EA 1PKEA 1U4SA 2UYGA 2X2PA 3F2IA 4GE3A 4HMQA 4NMHA 4MGYR 4LRWA 3D6TB 1LPMA 1BEZA 3E8SA 2AJ8A 4L0CA 4IZHA 1ZH4A 4KBFA 4TRNA 4WOPA 2CKMA 3H9UA 3H9CA 3HP7A 2AMFA 3QLUA 4NG5A 4X6YA 4BRZA 1EBFA 4N0EA 5EWJA 5LP6F 3HN6A 1DCTA 1YVRA 2P8JA 4M6WB 3F3SA 5DYNA 3P2YA 1NSFA 4EG1A 5KQGA 2KMLA 1M7GA 4AY6A 1X19A 2JCYA 5IN4A 1QJ4A 1FUKA 1JEOA 2RGCA 3IA7A 3S2FA 1NF2A 1W5EA 1EVQA 1U2GA 2GQ0A 3U0BA 4AN0A 2W0MA 5IYZA 1E4EA 3BDIA 2IYSA 3MYRA 4I66A 5I9BA 2I1QA 1DRUA 5ERYA 2P67A 4P4NA 4BHTA 5H16A 3R7AA 1HG0A 1QPBA 1E1KA 1Z88A 3P20A 4K3VA 3KO8A 2VWHA 3G0GA 3N6XA 2X14A 6REQB 2BLNA 4K5QA 1H93A 1JS1X 1N2CE 1P8JA 6PFKA 3HO8A 1YRHA 3EVNA 4UKDA 2ABWA 4QU5A 3H42B 4RZQA 1VSQA 2X0RA 5KJ1A 3GJ5A 1VJTA 2VEOA 4YAFA 2IZ0A 1JWLA 2ADFA 3I28A 5F1OA 4C6TA 3ELWA 4X54A 2Z6VA 3BGWA 1AZLA 2OC4A 4F6LA 5KOJA 1RKVA 4OL9A 2BE7A 3OUTA 5IK2A 3DWIA 2IIVA 3IAXA 4GH5A 1QBKC 3MT8A 5M04A 4KR3A 3W79A 2GDJA 3KS9A 1PNVA 1XDDA 3EEQA 5CT6A 1EUQA 2DR2A 4IDGA 4YWJA 2ZK7A 4CMAA 2A14A 1Z0AA 4QU0A 2VHTA 1CY2A 1O0BA 2PKRA 3D81A 2I7TA 3DTNA 5KVSA 4DG9A 5EINA 4IMIB 3FHTA 4AKEA 4YRFA 4PF1A 3R7NA 2QM3A 1KE2A 4N6OA 4KOEC 3PP8A 5H7XA 2JLBA 4NJMB 3W6PA 5JO0A 3LT4A 5J2UB 3LRPA 4BE9A 2H1RA 3DBLB 2ZU6A 3E82A 4LKOA 3OH8A 3RBAA 3VKFA 1L5OA 4RSGA 4A0SA 2PUCA 2PEZA 1M10A 4KQEA 3IP9A 5BSVA 3WWOA 2A67A 4XGIA 4R69A 3NRBA 4ZJPA 2GEKA 1HF3A 1XJCA 1FW6A 4F1WA 1NLUA 3IJRA 3LOQA 5DASA 2IW1A 5ISMA 4QDUA 3M7IA 4KFSA 1G8YA 1W52X 3H11A 4YQEA 5C3UA 5HWSA 1D2HA 3HFRA 5DN9A 1KQ3A 3PKZA 3BUSA 3I6MA 1H5NA 2QRVA 2HF8A 3N8DA 4KODA 4MJ3A 1YA4A 4R2KA 4YP6A 1HYQA 3QVTA 1EFRA 3K96A 4MI9A 1F0YA 4RMHA 4MUKA 1C0IA 1Y9ZA 3HK2A 1L7VC 3O2QB 4BFZA 2PV0A 3A1FA 3DDUA 4F3YA 5E7JA 4UDYX 3EBPA 1CJVC 4Q3DA 4MDHA 1IG3A 1WHSB 3FYUA 1IVSA 5KYVA 4GI3A 4QU9A 1BKDR 4K8OA 4AL4A 4CG3A 5HVNA 2ZETA 3JQAD 4HN4B 3IT2A 2XA2A 3CIFA 521PA 2JH8A 1BDBA 1YKFA 5TGDA 3AZOA 3FFTA 3KAKA 1UJMA 3PE4A 5ABPA 2QBYB 4KIJA 1SAYA 3QJYA 1TA9A 4QU8A 2YICA 3TRDA 1GZ4A 1NX6A 1NY5A 5AUPB 1USVA 2FX5A 3MCTA 3X1KA 1QKKA 1Q16A 2JH9A 3DBHB 5JSHA 2D62A 1J8VA 4DLBA 1A7AA 4GF5A 1LFAA 1P6XA 3TGPA 1VZ3A 2MOKA 3ZYCA 4JT2A 1I3KA 3QPBA 4CEJB 2C9CA 1FSZA 1ESDA 4RD2A 1QCZA 2D2VA 1JAHA 5CA0B 1P62B 4QG7A 5HP4A 3HJAA 5AKHA 2IUUA 4UUAA 1IXZA 1PUXA 2IYAA 3UGTA 2VDRB 3VR6A 4E08A 3JWIA 5CNMA 3RYIA 2VOEA 4L5IA 4GYWA 3RHTA 3HVRA 2J59A 1P0CA 4TLAA 2HI0A 1TCVA 2WQZA 5HQ3B 5AK5A 1DJMA 4ZRMA 1ZGAA 2Y4NA 5HKAA 1ZD2P 1MCZA 2BFEA 4DV4B 2A6PA 5T8KA 5A5FA 2J41A 2Q28A 4JI5B 5GQSA 2IZOA 5BWNA 2VDWA 2JBHA 2XAAA 3LUJA 2A0XA 5EVJA 3AVWA 3GXBA 3LDUA 2FOXA 4KLAA 4S2UA 4Q9IA 1SOWA 2GRAA 3CF4G 2XUHA 4HH0A 1WNFA 2OXFA 3AFIA 3T3NA 2GXUA 1CUSA 4FGKA 7ABPA 3PX3A 2FA9A 4KLCA 4DJAA 3TBKA 2WD8A 3DPSA 4J7UA 3ZQ6A 3E9EA 1K88A 1YCHA 5HKKD 3CY6A 1NV8A 2JFXA 2OT3B 2EJTA 1SVNA 1T9GR 3ADKA 5BUQA 1RAGA 1JT9A 3A2NA 5BV0A 1ICEA 3WYDA 4ZV4A 4ZXPA 1U2DC 2XTAA 1EIZA 1H9BA 3ZGOA 2R60A 1OJ7A 5F98A 3WLIA 5PGMA 1MZVA 3OE7A 4UDOA 3UJ9A 4GOND 2WSBA 3OJWA 1TZMA 2W83A 1Y1RA 3PXGA 2I7CA 2XQKA 2CVHA 3WJ2A 4ZJYA 3SICE 2B7LA 2IYYA 5EUBA 3OO0A 4FFOA 5LXTF 4WCFA 4U7PB 1UZAA 2ZJAA 2VNHA 4M1TA 1XEFA 3OAAD 4CKEB 1DAHA 3N70A 2GWRA 1UOEA 4I9HA 4YVFA 3ZXXA 3V97A 1NVUQ 1CUAA 2I3DA 2JFQA 1I8TA 1P73A 3GGCA 1OXKB 4G01B 1XLTA 2PDAA 2Z30A 4M6WA 2C5HA 1Q7EA 4C7KA 3SMVA 2ZT6A 1KAGA 3KPYA 2NM0A 3SVZA 5AM3A 4B3HA 1AHNA 4LXQA 4ZVOA 2NOAA 3DHNA 3HVJA 1YFKA 3ROGA 1FFXB 3K2EA 3IQDB 3B1XA 1F48A 3EMKA 5B7PA 2MJLA 4BBJA 1V3UA 4Y0NA 5L51A 2W2VA 3T7AA 1PFUA 3TLAA 2WG0A 3LP6A 1A1SA 3N39C 3OECA 3C3YA 4GPEA 1VE9A 3L7AA 4X3OA 6REQA 1EI9A 1A5TA 3T95A 2B92A 4RXMA 3UTCA 1GPYA 2Q9UA 4U8HA 3QPUA 5C2JB 1U3TA 1ZDMA 1ESZA 4RAOA 2E1PA 1HETA 1UBJS 2NVBA 1ATIA 2A7XA 2W6MA 4ENRA 5KC9A 3DB1A 1QANA 2O0MA 2VPYA 3SP1A 2Y1OA 1Y5LA 2UZAA 3AXTA 1HC7A 1KDVA 4UU1A 1D6SA 2ZPUA 3VBCA 1QHGA 1TCUA 3FZYA 4Z9XA 3SX2A 4S35A 4ZI7F 3U4AA 3EIEA 5JAHA 1V3TA 3MTEA 1DMSA 1HEIA 5HIKA 4D96A 4ENQA 2BZSA 3CINA 1PFVA 4EELA 1XNJA 1C8VB 2UYQA 1SHJA 4GX1A 3BGOS 3G82C 3K9LA 3QF7A 5FWYB 2WYVA 6Q21A 1NMZA 1YJ5A 4Q4JB 5C1BA 1MX3A 4BNVA 1JJ7A 1UFQA 2INGX 2QAGB 3KHKA 3IEIA 2FLVA 2PGJA 2ZAOA 2ZYAA 3C4QA 4NJMA 5K4AA 2EP8A 3IVMA 5J2UA 3DBLA 3TSCA 3KQOA 4ECAA 2ORIA 3CH4B 4IG4A 3R9WA 4C08A 3ET4A 5K2OA 4HT3B 1JE1A 3CPHA 3Q87B 3HZZA 5A62A 1Q0LA 2VP5A 2OYCA 3SEZA 1BC5A 4QLOA 5KNDH 3ITEA 3LLVA 4AUMA 1XTZA 3DCIA 3K70C 4JUAA 2QAIA 4RTQA 1B14A 2C58A 1ZZEA 5CYGA 2GHTA 5IXJA 3FCOA 3P9PA 1G64A 1DS6A 1E69A 4HUQB 5TSDA 4ZYYA 1EWYA 4BKQA 3QVVA 1Y89A 2QRNA 5SYAA 1WHSA 1JKJB 4NOJA 4L8VA 1RI1A 5BP7A 1SN7A 2AG1A 3DKVA 3BMOB 3PQ4A 3AUJB 4J7CA 1HUQA 4Z7NB 3NI2A 2JLQA 5JO9A 2QBYA 2XMDA 2G4LA 2D4HA 2JKYA 2IKQA 3OESA 1PJLA 3HFJA 2R86A 3DMYA 3RK4A 5U1PA 1SY7A 3WMXA 4ZVQA 3HXTA 3ZDRA 2JZNA 4A8JC 2VKQA 3K94A 3DBHA 3PX7A 1R64A 4DCJA 4Q6WA 4QD3A 4MP6A 4FJ2A 1F6WA 1GRCA 2G9QA 2JFUA 2L17A 1E96A 4K2AA 1O95D 1GNVA 2O7NA 2YRXA 1Z5OA 3AGQA 1D07A 3E9ZA 1PS8A 1EHYA 4IDPA 3K0HA 2PZFA 2XEDA 5A05A 3DG9A 4CM3A 3FSGA 4CEJA 1HT3A 4B6JA 1VRWA 5CA0A 2O8BB 1F7VA 2FN4A 3JATB 2D1QA 3K9BA 4XCQA 2B2NA 1F12A 3HA2A 3TM5A 1UBCA 2G4VA 3IQHX 4KP7A 3W5DA 3L9WA 3LAWA 3RHZA 1G291 1BKSB 2X42A 1YO6A 2IYPA 2D06A 3LGXA 4DMFA 4UCWA 1HY3A 4R8RA 3UJ7A 2DZDA 3PQ7A 1GQQA 4BB0A 3I01M 3NZEA 5HQ3A 2NVUB 1H0KA 4BTVA 1YF3A 3E3AA 1M33A 2JVKA 5DI3B 1PIWA 1VIMA 2RI1A 3OU7A 1H2XA 2W0SA 4HQKA 2AFHB 3AJDA 3NALA 1XDZA 4UAVA 3HJGA 1CWUA 1FP4B 2OVFA 2OUIA 4MVJE 1I4OA 3ILHA 4YFYA 1N3YA 1SK8A 2J7PA 4B2YA 1G5QA 2DPLA 1XD9A 3MGAA 3AM4A 5E95A 1XAHA 2PBFA 1LK5A 3F5FA 1Z5WA 3LK7A 4FFPA 3NW9A 3T1QA 4D5GA 4KW7A 3MGGA 5A5EA 4RHTA 1M54A 4GP6A 1PRYA 2UVPB 4JC5A 4PQRA 4QJIA 4PAGA 1XPOA 3P2KA 3P2EA 3PCRB 3QI7A 5ARBA 1D2GA 3B12A 3TNDA 1ZN9A 2IPNA 1XMOB 4V3BA 1QF6A 5CB4B 5DTRA 4LMPA 3T5DA 3D1JA 2POQX 2FZLA 5ES3A 2IDZA 5EJ7A 2FJUA 3VDXA 4PAOA 4J2TA 3TRHA 3KV1A 1RJ9B 1TMKA 5IX8A 3CH7A 3JR7A 5JTUA 2JLYA 1ZR2A 1IHOA 4RY0A 1Y5IA 4CKEA 5BSKA 1OKKD 2SICE 3F8WA 1QG6A 1APBA 1TDJA 1L5ZA 2CLEB 2G9ZA 3A9TA 3OQPA 2Q3JA 5FB3A 3TFOA 1G1MA 3EXEB 5ALOA 3S0JA 2XMRA 1JA0A 4F5DA 2GK6A 3H6HA 4LSMA 4UREA 4DSAA 5AW2A 1ZIDA 4W6ZA 1EGAA 1U1FA 3O74A 1JZTA 2FWIA 4HFJA 4YJ3F 1EP9A 1JPNA 1LXCA 2IH4A 5JVDB 2OHHA 1ZD9A 4MS4B 4A9AA 5KVCA 1FFXA 1Q1GA 2HHLA 1J33A 1T8WA 4CCYB 4H7JA 4NHOA 2CJFA 5DVZA 2H4XA 2JIDA 2E1RA 5FTJA 1S2NA 1MD9A 2Y66A 3DM9B 3L92A 3I9OA 3BDAA 3DDCA 4UDXX 3NHUA 3I05A 4MLZA 4NLLA 2XUGA 4Y6GB 4R16A 2HL6A 5FBZA 3WLOA 4PZUA 4DLXA 3ZZUA 4DLNA 5A4KA 2F8MA 4ZOLB 2QY9A 1Y8QB 1TTQB 3A4MA 1XFDA 5FX2A 4I1RA 4FFLA 2GD2A 4TN5A 4EZEA 4Z7QB 2OBMA 2XGSA 3UNXA 1RBMA 2KLHA 2JJQA 2OMKA 3C70A 3QE0A 4LVUA 1PZMA 1NUPA 2I71A 2W37A 1AS0A 2FPGA 2Y77A 3DLHA 4P0QB 5DK4A 3U7GA 3DHVA 3KTDA 3GGGA 4G5GA 3IB6A 5IH3A 3QRWA 5B30A 2VSNA 1FVXA 5ED4A 3QVJA 2ZAIA 1QYRA 1CJCA 2QVBA 2ZRJA 4E30A 3EPLA 1SIUA 1WD7A 2REBA 4MAFA 1VMDA 1CF9A 1FVFA 3GAMA 3O8NA 4PC6A 3ZBQA 4B46A 4Q4JA 1Y7TA 4ZI5A 4B6EA 3ZCUA 4D9JA 2QAGA 1RE1A 3GJXC 1TLFA 1QXSA 2BDEA 2WIJA 3VTKA 3DE3X 4BC1A 1DEKA 1J97A 2GAFA 4AZVA 4UUNA 1DL5A 2LPMA 2WFLB 3A32A 4X1KB 2Z9DA 1F38A 3KG2A 1QO0A 2BFNA 4UHHA 3KKOA 2AKEA 3E23A 2NV2B 2V7QA 4GWLA 3JAMA 4KSCA 1G63A 2NYAA 4ZYVA 2ID9A 2GPSA 4WFKA 2CMKA 2JLCA 2MIIA 2UUOA 5CBPB 2HT6A 4EPTA 1QQTA 5K8VA 1MOSA 1ORVA 1A88A 2XI4A 1J8DA 1Q1AA 3WP1B 1M6WA 2VPIA 1VYTA 1P0PA 2GTIA 4QPNA 5LQUA 1G1AA 2CFTA 4KIGA 2QMUA 2IV3A 5G1PA 3EGCA 3RPEA 3SXJA 1EFHA 1HE8B 1CDEA 1ORIA 3TDNA 4K6CA 4HUQA 4RHFA 4FBGA 4D82A 3E27A 1IZYA 1YR6A 2QUAA 1TFRA 3MTDA 3OP1A 4OVKA 1JKJA 4Y6PA 1WXEA 1IJFA 3P0RA 3GUHA 4BLSA 3AUKA 4PYNA 4LC9A 4M8KA 4U0JA 5JI2E 2DJ5A 3I9V6 5K6AA 2W2OA 2CUNA 2JAUA 3S5JA 1T2CA 1PJSA 1Y3CE 2ZYTX 1SD5A 3KT3A 4W5JA 3SQLA 1HLPA 4BV8A 121PA 1DXYA 3K2IA 2Y1WA 1E6WA 4UM5A 3N05A 3PNVA 3K0CA 5LBTA 5I47A 2WK1A 2ZM5A 4CV1A 3K0FB 3C74A 4J3JA 4IKOA 1GZSA 1SKYE 1PS9A 3AVPA 5TQ0A 3SZMA 2W70A 4BO0A 5DOZA 4JN6B 4C5BA 2Q1UA 3EFBA 1S0UA 4GYJA 1J7KA 3MJRA 1M1XB 3PEVA 3JATA 2O8BA 4I6JA 2VP6A 4WHMA 2ZUWA 3LFHA 3N9IA 5D3KA 3NAMA 4UM9D 1AX9A 3AVYA 2IS2A 5JAOA 2Z5VA 3EZFA 1OT3A 3LD9A 1MC4A 1NTRA 1SCDA 4J0JA 4P3YA 3OCXA 2NO5A 2HTEA 3SZRA 3MGCA 4W1QA 2NVUA 1AU9A 4B3SB 4B2PA 2C9YA 5DI3A 4EX7A 3NNDA 2HSWA 2OBLA 3MAAC 4HAWA 3VJLA 3WMEA 3M6AA 1D3AA 3HSSA 4NYJR 5GIOE 2PT7A 2AFHA 3KAJA 3R6WA 3Q2IA 4RV9A 4C7OB 4S0ZA 1NNLA 5KOYA 1N5OX 4PE5B 3IEPA 1JFSA 1KHHA 1FP4A 4WD3A 1E8DA 3GLRA 1YKGA 1JMKC 1PK7A 1XAJA 3JQGB 5EUQB 5I48A 2GCNA 4DG8A 2Q3MA 4RHXA 2QG4A 1KE1A 2ZUEA 2ZB8A 5ALUA 4HR7A 4DC1A 3Q4GA 3FG9A 2YJGA 3Q7IA 3MLEA 1EK5A 1OBVA 1J25A 2R6JA 4LHSA 4DUZB 4FHZA 1SU7A 2B4KA 5GVRA 2UVPA 4JUFA 5I9TA 2YYYA 1GHTA 1LW7A 1ZY2A 2W9XA 2ZXEA 2C3YA 3CE9A 4BJ5A 4AQ7A 5DNWA 2P6UA 1VPDA 1WDTA 1CUVA 4EAQA 4DB2A 4BAZA 3WIOA 4GIBA 1SCIA 5CB4A 3DTYA 4AG6A 5EJ9A 4M37A 1N0UA 1LVGA 3K9WA 4CMEA 1MA0A 4FONA 2Z5LA 3F78A 3OZEA 4FYXA 1RJ9A 3ZNPA 3GLFB 2GFIA 3A2KA 3KZOA 3PNKA 5E2AA 3IC5A 3OY7A 2MT9A 4EF4A 2PBLA 3MFYA 3T5TA 4B7ZA 2R8XA 4TTTS 3QHQA 2PRSA 1L8OA 1NZJA 1W5TA 1R15A 2BEKA 1EYZA 1V8ZA 1ZEMA 3EXEA 5AM0A 3W4JA 5AI6A 1ZHHA 3NM5A 1LNQA 2H00A 1QAMA 1I7SB 4Z4QA 5JPCA 4X41A 4PBRA 1TVKB 3NASA 5D6NA 2OXCA 4XKJA 1XK6A 5JVDA 4MS4A 5KSZA 1Y5NA 4CFSA 5FAXA 1EVLA 1ABEA 2FKNA 2IYLD 4WBXC 4CKZA 2CLHB 2QL6A 4CCYA 1MW8X 1SBHA 1W4RA 3MK31 1SHLA 1T8YA 2M6SA 3BTSA 3NT2A 4JLKA 2E49A 4EB3A 2RAFA 3GK3A 4R9UC 5EHXA 1J21A 2IYZA 1QZXA 1I2DA 3H05A 1QHSA 4JODA 2EFYA 2JHAA 1JDUA 5EUCA 5CG2A 2N3ZA 5TMBA 3N1UA 1KSHA 1CY8A 2WW8A 5AK6A 3AHFA 2IOQA 2Q2NA 3QP9A 4ZOLA 1CZRA 1P17A 3U9TA 1WMEA 2E87A 4CV2A 1Y8QA 3E22A 5JYBA 3V1NA 2VCYA 4EG4A 3K0BA 4G0OA 5HFAA 1SURA 4MWCA 3NHFA 1V4VA 2JI7A 2VUIB 2YY7A 3A2LA 4QAJA 5IVIA 1VYVA 3BL6A 5DHAA 3RJZA 1RLUA 3W8RA 4B09A 2AH5A 4Q1DA 1C9NA 5EFZA 4D80A 3NBXX 3EN0A 3JRWA 2QMYA 5CU7A 1DUVG 1U7PA 2L2QA 3F0TA 3H5LA 3MOGA 5AVSA 1NXPA 2H07A 3GY0A 1WU8A 3QXHA 4M9QA 4QASA 4C4SA 3KOZA 4OGFA 1S3GA 1U6IA 1PFYA 2G83A 2J87A 2JJ2D 3HY3A 3N2ZB 3MINB 2Q4RA 2CLDX 1QGAA 2W8ZA 3URKA 1RZ3A 1D7OA 2N75A 2WFLA 4X1KA 4IIVA 2C88A 4JBYA 3HV2A 2ZR0A 4HXGA 1H2FA 4U9HS 4QT0A 4DIEA 1ZN7A 1SH7A 1ML3A 1NZFA 3IAM6 3MT0A 1OIVA 3BCRA 3LUKA 3ROEA 5C32A 3IR6A 4G4SP 2LCIA 5CBPA 3H1BA 2ZRHA 3HYLA 3HR4A 4CDRA 5BVHB 5HF9A 1F6BA 3PD7A 1V8BA 4IJQA 3T9FA 1NQOA 3STHA 3CZ9A 4NOMA 3T4UA 5J47A 1WP9A 1HEUA 4GKKB 1LFDB 4JEHA 3KSZO 1XLVA 3LX5A 2JAHA 1KC3A 4JP8A 1UQUA 4JX9A 4NYMR 3NRCA 4NBSA 4RA9B 4F8JA 1AMOA 2C7PA 3QQ5A 5G41A 3QWFA 4JLBA 5HBRA 3WXBA 1BMTA 1XDGA 1JDBC 5F52A 3RUIA 3VOAA 5DM70 1HT1E 3Q41A 4QODA 4ZVPA 1S8FA 2IUFA 4XYEA 5CEFA 1M8JA 3OFKA 3W3AD 1GSHA 3ZU5A 2JARA 1OYOA 4MQMA 3QVGB 4HDMB 4LZAA 4KR2A 3LUFA 3OURA 2WJGA 4HOYA 3OJFA 4NFHA 8ABPA 4RVNA 3KT0A 3U1BA 2GJ4A 1OX4B 3K0FA 4HSGA 2HSZA 4HX9A 3IP5A 3NDPA 1MB9A 1P4JA 4GWGA 4BO8A 3VC7A 4QUJA 2E6KA 3HCCA 5E6SB 1TEXA 2PU5A 2HO5A 2B69A 4M7PA 2O1EA 3VVMA 1M76A 3GNQA 4HV4A 1RQPA 2P6NA 3LF2A 4L9WA 4ZV9A 4AP9A 2NU8B 3NTVA 3OF5A 5T41A 5EIXA 4HNSA 4Y2HA 5ADHA 3ILYA 3ND8A 3U56A 1ACJA 1MEOA 1QE3A 4FGJA 1L7AA 3HGQA 4UPVA 3H5RA 4GGPA 4A0GA 1GTRA 4GAEA 4GRIA 4HH4A 3V1KA 4A5SA 2CZQA 2Q9CA 2VXYA 5IWAB 3IP6A 4G63A 4GGOA 5AIBA 4C7OA 1D2AA 1E2IA 2IP2A 3DVQX 1Y1QA 3GJYA 5DBIA 1K7XB 5J4VA 5JCJA 1C50A 4QGSA 4UUOA 1BYIA 4H3HB 3NTOA 1CUYA 3TLEA 3BFJA 1J8YF 4CMGA 2FMTA 1P3DA 4R2XA 1JBQA 3JQGA 5IAEA 3I9KA 1KJIA 1ZJ5A 4H1WA 1KVTA 4IGKA 2C3MA 2OPHA 3GRUA 1UFOA 4ZOAA 1LD3A 5FBLB 2JGRA 2Z5GA 3I5UA 4R05A 1N2GA 3ODPA 2DWPA 1ZM4A 4MUMA 1QZTA 4M2LA 4PG7A 3TMKA 4RKYA 1OYVA 3IULA 1M0SA 1A72A 2EP7A 3AJEA 3DAFA 4JI6B 4CI0B 1U8ZA 3R9XB 4BMYA 2OE2A 4UVGA 2ORED 2A5JA 3BYZA 3E53A 1L1FA 2ID7A 2R6FA 1E3WB 3R40A 4RLSA 1S02A 2DT8A 2LUOA 1RFLA 4K7JA 5F7XA 2YNMC 3FA2A 2OXEA 5JXWA 2HLNA 1K9SA 3BXXA 2G80A 1DC6A 3NR2A 1T9AA 1BFKA 2CHEA 3F7TA 3HKEB 4B5KA 5KSOA 4Y2PA 3GLFA 2GR9A 3I61A 3KD2A 4PM4A 1ZH8A 5EJ2A 5D87A 5J4KA 2RGWA 3K09C 2P1ZA 2ZBFA 4GNRA 5DFAA 4YAGA 1OI2A 4R2LA 3WLMA 1E3MA 2ZATA 1JQKA 1U1IA 1EAMA 1GVNB 1UPAA 1YJBA 4BNHA 4CN9A 4TZTA 5JNTA 4KDCA 4P0TA 2I67A 4DNXA 4LXIA 3STXA 2MINB 1GZ6A 1V5WA 4K2HA 4UEWA 1TVKA 2PX3A 1XTKA 4Y8VA 4WNCA 3K8OE 4DWJA 4GBJA 1YVDA 2YCBA 4PLWA 5BORA 4HAIA 3CX4A 4MV4A 3PJFA 5D8DA 2QORA 2PLRA 3LY5A 3DNPA 3JYOA 4OQFA 2X40A 3QFHA 3LRXA 4MUYA 1IPHA 4L51A 5AVKA 3T9CA 4Y6OA 3FYDA 3W4KA 1SKBA 2HH9A 1C29B 2ONZA 4NBUA 1P8AA 3JQ9C 3PC7A 1P7CA 3M1IA 1J24A 3N58A 3P19A 5LNK6 3MJ4A 3N3BC 4HS9A 5LU9A 1AH2A 3B8EA 3TK1A 3R20A 2GUGA 2IU4A 3DF9A 5TS3A 2YFKA 1ZWLA 5EMJA 3K6RA 3DXFA 1FDRA 1N4DA 2ZVQX 4Y2YA 4Q82A 3MIIA 3P71T 5SY9A 5K05A 1VG0B 4WZAB 2EBUA 3PXUA 1AVTA 1WXXA 3FX2A 1NUAA 3F7OA 4QJBA 5F2KA 5IEBA 4BATA 1PN3A 1JHOA 1K7SN 1TOAA 3K6SB 4MV3A 1ZKMA 5EE0A 1M8KA 3M4ZA 4KMRA 5B2FA 3ZNNA 1G2QA 3PEUA 3AFGA 1NWCA 5JLAA 5IHXA 3CCBA 3GT4A 2EBHX 4HBGA 4PLGA 5EJ4A 3WYEA 3EH1A 4IW3B 4MQFB 1VECA 4J90A 1NUSA 5AYVA 2EVWX 2XNSA 2VHVA 3TTXA 1W49A 5C1PA 2V6JA 3WRXC 2XNDA 3H2YA 4LW8A 2HEGA 1RYHA 2QIPA 3MINA 5J2TF 3UXYA 3CVVA 3TQCA 2ZRIA 3KIPA 1WV0A 1QPGA 1ENZA 4A16A 3A6JA 4OQZA 2ZSAA 5IT4A 3U61B 2BEWB 2WTMA 3LA8A 4P32A 4JELA 3U13A 4J0FA 1PK9A 2HA5A 4N8EA 2DQYA 4IUYA 1ITZA 1FX1A 3MB5A 2H51A 1A8UA 4AQDA 2CUKA 2JD1A 2HPHA 3FB4A 4L7QA 4C05A 1DJPA 1YI8A 1TTPB 1FRQA 5BVHA 1RWNA 4M0MA 4HXEB 5DBOA 3UTDA 1FF9A 2EZ4A 3RTAA 4OU5A 1BE6A 1Z16A 4AICA 1Z6YA 2YRWA 3VZDA 2NYRA 1IRXA 1LS6A 1RHUA 5JQGB 1G8FA 4RA9A 3TMAA 1HEYA 5B53A 3PUXA 3CEHA 1XVAA 5FFNA 3SE0A 4DANA 1NBHA 4NV0A 2XH8A 4KQJA 1YDFA 1WCIA 4IDAA 4KJXA 4OB6A 1SXPA 3D4OA 1SQGA 1ZXLA 3DO5A 3I92A 1Q11A 1U6JA 3QVGA 4HDMA 4J0DA 4WASA 1YOBA 1FLAA 3PI7A 4XB1A 5ARCA 1CUFA 1SBYA 4N5MA 1KP2A 1IHXA 2QTWB 1STOA 2RGBA 1Y6FA 3LPNA 1XT6A 1J22A 1OX4A 3FW1A 1TNDA 3L1VA 1P7WA 3NBMA 4C7XA 1PNQA 4LNUB 3DZCA 2YV2A 3HRKA 1XD8A 1XPUA 5FOVA 2YXPX 3BN3A 1XMIA 1EJ2A 2PL5A 3G8CA 4MB0A 3IQZA 3PR1A 5E6SA 5LQCA 2LW7A 1Z33A 2P2YA 1DBRA 1Z4MA 3A4TA 4ENTA 3NHPA 1V71A 4TQ9A 5LZ2A 4XOUA 2JDID 4F2DA 1JHMA 4R8VA 4OMUA 5KYNA 2Y67A 4ZOCA 2YKGA 3STVA 1QU3A 2NU8A 3LGAA 2H2HA 5EWMB 1UXKA 4CQLB 5CNJA 4HEJA 4HXFB 2UUBB 4G84A 2XYRA 2FW0A 1NG1A 4B6GA 3L2OB 2HC9A 1YIOA 1CIVA 1UBUS 2B1RA 1A77A 1F8YA 2FGJA 2X1LA 3LDFA 4FLMA 1G2PA 2P90A 3CLVA 2YXNA 2GJ8A 2DMRA 1BDJA 3R24A 3TZQA 2HV9A 2QU7A 4TWRA 4DAEA 3DE0X 3GAAA 4DSOA 1A5ZA 3LPMA 1XDUA 4DWOA 2BHSA 3WYCA 2FDCA 3OPYI 3H5AA 4G0QA 2AXQA 1T5TA 1Z8NA 4E7PA 1QLJA 4MMXB 5JNWA 2A9QA 3PFCA 4QUEA 1BU8A 5E0KB 1VL5A 4INOA 4KVFA 2PVCA 5ULLA 4F06A 4Q4CA 1Z6PA 5TMPA 4HAYA 3R9XA 3FSEA 3NKVA 3B7WA 4IO0A 3WE7A 2OPBA 3W2HA 4A2WA 5KTSA 5KX5B 4G2NA 1E3WA 4ER7A 4YCLA 5JEDA 4KVGA 4JB3A 3K16A 5KC8A 1V8PA 3JQ7B 4Q1EA 2EWVA 3T54A 5BUSA 1IY8A 3GROA 4H16A 2Q7OE 4B7UA