1DAEA

Dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
219
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 71
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daeA00
1FZQA 1TL7C 2IYYA 3K0AA 4LPKA 4GOJA 5JECA 1JPJA 1SQ5A 1HH4A 1Z0AA 1S9DA 1UBGA 3MWYW 2VHQA 2PMDA 3CNNA 1E3MA 2C9YA 3AUXA 4TMTA 1XBTA 3TGPA 1OH5A 2IUUA 4KFUA 1RRFA 1G20E 4JLKA 3I3SR 1XEWX 3OFNA 4A1FA 4FIDA 2WWWA 1W1WA 3CKLA 1SXJB 2NIPA 3IHWA 2ZR9A 3EPLA 2G9NA 4DLWA 5CDFE 2D7DA 1G6OA 2ZJ5A 1E2PA 4LYHA 1RIFA 1UKEA 2AFHE 4AI6A 4ZKEA 4C0JA 1S3GA 3DHWC 2Y8EA 4KCGA 3MGCA 4U5XA 5GJVC 5EE5B 2W2VA 1NMZA 4PZZA 1OV4A 2NO6A 2J9RA 4NE2A 2O8CA 1SULA 2BCJQ 1AS2A 2R6FA 1P75A 4OL0A 3QG5A 4JBXA 4EFLA 1P2SA 2ZI6A 3PUWA 4QJ5A 1TF7A 2D4HA 3U7HB 2JIZD 3VAAA 1XCMA 1NBMA 5EUMA 4FCTA 4FW9A 3EZ9A 4XSGA 2VL7A 3UANA 4BECA 2D2EA 3W9YA 3ZVNA 5K8UA 4PHHA 4HLQB 1G8FA 2IW3A 4C0SA 1E2IA 3LA6A 5CM8B 3GLHE 3L8ZA 2YNMA 3RNLA 3VTKA 1L4UA 2CEAA 1KY2A 3U2QA 1UBFA 1II9A 4WZAE 1VYVA 2NGRA 5CLLA 2JCSA 4YQFA 1G5RA 2GZDA 2N42A 4EIWA 4LRWA 4DDVA 5FPYA 2G1JA 1AIPA 5EP1A 1F2UA 1OYWA 4KJZA 3PG5A 3T5DA 1W0KD 2ZTSA 1SVMA 5JJLA 4Q7MB 1BIFA 3CBQA 4M1KA 2V8OA 1G3MA 1TF5A 3VR5A 3BAFA 1ZU5A 1AKEA 1M74A 2EFHB 4S35A 1A4RA 1MO4A 4IFEA 4JLPA 1LY1A 221PA 4TT3A 3A1WA 1U98A 1ZNXA 3P1JA 3GLGE 4OI2A 4PPFA 1UKZA 4JVNA 1F2TA 3A1UA 4Q4LA 1XXHE 4TMKA 4B3GA 3SJCA 1IM2A 2VO1A 2X2FA 3SNHA 4TL6A 3C8UA 3OAAD 1NY6A 2ZRIA 3K1JA 4OI4A 1JECA 1JAHA 1VG1A 5JSZB 2GJAA 4CIDA 4KLNA 4ZCIA 1NG9A 1KAOA 2AD1A 2P0EA 3AF0A 4Q47A 4GP7A 5KDOA 1OYYA 2P6NA 3PV0A 3LY5A 4ZCMA 4XD7D 4ON9A 4KHZA 1Z22A 3NBZC 2JLYA 1OB5A 3TKLA 4KYIB 3PCRB 5BN4A 5JHGB 3OIVA 3KX2A 5AR1A 1NLYA 1RZ3A 4BLRA 1HYQA 1HY3A 1IQPA 1T9HA 2ZVPX 1IOZA 4MRSA 3EA5A 1AQYA 2YWFA 2WAYA 4B2IA 3X1XA 1TEXA 4L9WA 4NH0A 3ASYA 4HLDA 4L15A 3O47A 1UFQA 2IYQA 3MUFA 4FCWA 2KSQA 3I5YA 1K6MA 2J0VA 2WWFA 3I62A 1CR2A 4QXAA 1NLZA 1DELA 2YC2C 2NQ2C 4R7ZA 2REBA 5H68A 4IEIA 4YDSA 5TB5A 3DM5A 2W0MA 1SXJA 3GJXC 4IVPA 4BASA 1J7KA 1IY2A 5J4HA 2HF9A 1IONA 2BDTA 2QMOA 3KB1A 4HUTA 3FMIA 1AN0A 2JDID 3FDIA 4GL2A 1ZC4A 1RJ9A 4JL5A 1P73A 3O8CA 4FWTA 1R0YA 2G88A 5LDDC 3MWLA 5BN3A 1E96A 3I32A 4CGZA 1KI9A 1W47A 2XSZD 3IPXA 1Z6YA 3EG5A 3B8HA 2IWHA 4DLYA 4BLQA 4KVAA 5KDDA 3FYHA 4L4UA 2A5JA 3PEVA 4LHXA 3LWNA 4PC7A 1GP2A 3W3AA 2ZJZA 5SZKB 3IIJA 2QM8A 2QU8A 4QBGB 2OESA 4M22A 1FOEB 1T0JB 2C99A 5FBVB 4LYAA 2QAJA 2PLFA 3HU2A 1VTKA 2B7BA 2IBMA 1XTJA 3CH4B 2JATA 5FTMA 2NPIA 2IF0A 4KXFB 2AWNA 2JIZA 2RKOA 2QPTA 4AD8A 2FA9A 1NY5A 2R6AA 4N1AA 4B32A 4P4SB 4EFMA 3CF2A 2O0HA 2ZJBA 1E2EA 1OFTA 3RS0A 3EARA 3PJRA 1NN1A 2ZAOA 1E2NA 1IN5A 1ZD8A 1KKMA 2GA8A 1UDXA 2ZI4A 4M0LA 4A9AA 3U44B 2EYQA 2QM7A 3K0SA 4RKEA 5E7MA 1YJ5A 3PXGA 1TTTA 2HUPA 3Q7PA 1KO5A 1QHYA 2JAQA 2UZ3A 1A2KC 4QL3A 5EXTA 3FB4A 1UBEA 2ZE8A 4K81B 5B30A 3SZRA 1VIYA 4Y0VA 1JPNA 1ELOA 1M7BA 1KDTA 2ZJ2A 3IIMA 4YMVA 2HYIC 2YWHA 2ZRLA 3X1WA 1Z2CA 1G3QA 3ICEA 4QGGA 2VQSA 4M21A 1I2MA 4LJ4A 1IY1A 4DLSA 1W0KA 1UJ2A 2FFQA 3H86A 1DO2A 2R8RA 4JMPA 1EX6A 1C9KA 1IJEA 1NVWQ 2MSCB 4V0KA 5FTKA 1NN5A 3H84A 3DM9B 1HV8A 2ZSEA 1RYHA 4JLAA 2PCJA 4F91B 1LTQA 5AJYA 4Q1BA 3WHLA 3U3RA 1GWNA 2Q9BA 1YZLA 5JSZA 1JR3E 2ATXA 4M53A 2IS4A 3BWDD 1EK0A 2IYUA 3U3KA 3R7WB 3WY9A 2LKDA 4DLRA 4U7DA 1M7HA 3KJIA 4Q02A 3OAAA 1DAKA 3BD9A 3BH6A 3GLIA 1DAEA 1TUIA 5TV2A 4OQNA 4GZMA 3TSZA 1LV7A 2Q3FA 3C41J 2OBNA 3TRFA 1A82A 1KDPA 3IEUA 2EU8A 1ONBA 4CEIB 1KI6B 2IYSA 3QIAA 4Q18A 2F43A 3PUZA 3AKDA 2ZITA 2HCBA 3BJIC 3Q5DA 3A1TA 3N5CA 4US1R 4C0QC 4KVGA 4UNRA 1GFIA 4FD2A 4MKGA 1E32A 4GNKA 3WYAA 1VDZA 5J5CA 4PSKA 5KU1A 1OHHD 2DWQA 4JLBA 3TJZA 4XH9B 4A0HA 2GVDC 4OJKA 3KQKA 2GK6A 5BW8A 3LW8A 1OH6A 1U99A 5EXXA 4A2WA 4GP6A 1ZM2A 2E1RA 4TLBA 4XWAA 2W6IA 1DAHA 4M1YA 1AKYA 1SXJC 1KO1A 1EFTA 2RMKA 4HLUA 2R6DA 4B2PA 2PJRA 4AKIA 3KJEA 2AKYA 4W7SA 1W36B 1JI0A 1JNYA 2GK7A 2RGAA 1OT3A 1KI8A 3P32A 3A6PC 2I1VB 2W2TA 1BO6A 4TLEA 1XJCA 3HR7A 3B6EA 4EJSB 2QQ0A 1XRJA 1HA3A 2JDIA 1GZSA 1M1YE 2ZIAA 4TL9A 5CB6A 1D5CA 2C78A 1CTQA 2GHIA 2QL6A 4WZ6A 3RS2A 4DEXA 1HT2E 1NVUQ 1Z5ZA 1JEEA 4BZPA 5JI2E 4S2EA 2YHSA 1IJFA 4B34A 4DT1B 2J0UA 1W4AA 5FFMA 4JT2A 2AK2A 4BPBA 3E70C 3A4MA 2VP5A 5F3WB 2IXFA 4CDGA 1OH8A 5JS7A 2VP2A 3IGFA 1U9IC 3GD7A 2PX3A 4P4SA 3S1AB 3TLXA 5JEEA 1G6HA 4XJXA 1QVRA 1E9SA 1EWRA 3LVQE 2CVFA 5FR2A 3D6TB 2V55B 4QC2A 2ZXUA 1OW3B 3HPQA 2CE7A 1GITA 1KI4A 2JEOA 2JGNA 4IEEA 2CNWD 3ECCA 4PPGA 4Z8XA 4A15A 1WBBA 1SVIA 1F6BA 1VMAA 2PL3A 1EFCA 2IEYA 2EQBA 3I73A 4DKXA 1MABB 3BIFA 3KDSE 1G3IA 1DEKA 3F0TA 1Q20A 2BM1A 5F98A 1VHTA 1XDBA 4R9UC 2VP6A 4DIDA 3PEYA 3TK1A 2QI9C 5DLQC 2RGDA 2QSZA 3CR8A 5EZ5A 5AJXA 5DH9A 4M9QA 1YZUA 2VA8A 2ZR7A 2W0SA 1QHXA 721PA 2WSMA 3AEZA 2J59A 3I8XA 1BMFD 3QQ5A 4OHXA 5AWFC 1ZC3A 5TDHA 2ONJA 4C0BA 4BLOA 3K0FA 2BM0A 4URVR 5EP3A 4GBMA 1JB1A 3AVPA 1M7GA 1W46A 2ODNA 4WW0A 1DG1G 2ZS9A 3BK7A 3P4XA 4NCHA 2R44A 3D7MA 4BLTA 4Q9KA 2GEUA 3ND9A 4V0ME 5A5GA 2F3TA 1KIMA 1W2HA 2GXSA 2VH5R 4KV9A 3AP3A 3W6NA 1OXUA 2ORIA 4DCVA 3VR6A 3QXCA 2IYXA 3NDPA 4QJ3A 4EFNA 1Z0JA 3IEVA 2A3RA 1KOFA 2QT1A 2JJ1A 1C1YA 4DXAA 2NO1A 3DKVA 2OFOA 5BXQC 1FP7A 1DO0A 3QF4B 2C5LA 3X2SA 4EKDA 4US0R 5DE3A 2C03A 1NKTA 1ZU4A 3CPHA 1Z2AA 3EIEA 4RY2A 4FMBB 1NLFA 4P32A 4BFWA 5AK0A 1ZMXA 5F9HA 1LNZA 1XTIA 2FMXA 2ZSDA 1NN3A 2OO7A 1J90A 2NPFA 1G8YA 2PCLA 2DY1A 2ZR0A 4QRHA 3QPUA 2C98A 5SZHB 1GRRA 2QSYA 2BWJA 2FF7A 4US2R 1VCOA 3QKRB 4G3XA 3PENA 1TQ6A 3KZ1E 1XF9A 3LBHA 2IHBA 2Q0HA 4QM6A 4IFBA 4MYUA 2IYWA 1ZM3A 2P6UA 1XTRA 2CJWB 2G83A 3Q85A 4ILEA 5B58C 3ZLJA 5JJIA 1X6VA 2QUZA 1GVNB 3W6OA 1YRAA 5TVKA 2O0JA 2GDJA 2OXRA 2E9SA 1G8PA 3N2EA 2AXNA 4RD0A 4HZUB 4QBHA 4HLUC 2RGXA 3B85A 2ZU0C 3C14C 2ZM5A 2RGNA 1E99A 4BE7B 2IL1A 4WIAA 2HEIA 2HJVA 5KSZA 3IUYA 2DWOA 3P4YA 1UBCA 4Q5IA 1GL6A 4PR0A 4ZPXA 4BFXA 3TIFA 3UWOA 3GPLA 1VECA 4DT1A 3TNFA 3R9XA 2AX4A 4PAQA 5IDVA 4NCKA 1VG9B 1R7RA 3QI2A 3EW9A 4DLXA 1LS6A 1Z6TA 1P61B 4HAXA 3B13B 2PX0A 4O0MA 4DSNA 1BOFA 2O8BB 2FWRA 3S1AA 3V9PA 3C7KA 1P9NA 1RE0A 2ZRPA 2NOAA 4LC0A 5AJZA 1X8KA 2R6GA 4JKIA 5EXSA 2HT1A 8OHMA 3IDQA 3GLHB 2QE7D 4Q4JB 1HE8B 3WBJA 2C9OA 3OFND 1KJYA 1HURA 4M2LA 4WXPA 2WZQA 521PA 1R2QA 2UZIR 3LXXA 3EA0A 2CNWA 2A2ZA 3QXHA 3TVDA 4B2LA 3U60B 4DWJA 4B33A 2JLQA 5KSPA 4ZCLA 2OM2A 4EPVA 3CONA 4C2TA 1KY3A 1XMJA 4OHZA 1FQJA 4CF7A 4NZYA 5HKKA 2QY9A 5JRZA 1ZINA 2D7CA 3TW4A 4LZZA 3PUVA 2WJHA 1XXHB 1ZNYA 4DDUA 1RFLA 3SC3A 4A82A 1CJKC 3GMTA 4PZYA 2P5SA 3ZYCA 3BFVA 1BMFA 1SVLA 2QP4A 2P6RA 2BC9A 4LBVA 2ZUCA 1AZSC 3GJ0A 2FEOA 1D8TA 4TQ9A 3KXIA 3WBKA 2OHFA 2YJTD 3AKEA 4Q19A 4F4CA 4CEHB 3NHBA 1Z6XA 4YDHB 3R8FA 3G5UA 1IXZA 1XU4A 1BKDR 1U0JA 3I72A 1UM8A 2BMJA 1Z83A 3HYRA 2G3YA 2OBMA 1W5TA 2OLJA 4JJZA 2FGJA 3TUZC 4EUNA 5L3RA 1R0WA 1CRPA 2WM9B 2GCNA 4C4PA 3EC2A 1NJGA 3I92A 3QKRA 3DEFA 2GCOB 1DG3A 3K09C 4CZ2A 4DZZA 1E98A 3EZ6A 3U3OA 4D82A 2CBZA 1RW4A 4OI1A 3ZDQA 2QENA 4M4SA 1NRJB 2HCJB 3I61A 1U8AA 5EE0A 2FSFA 1OH7A 4OI0A 4Q4HB 1E9FA 3HP1A 3EIHA 5E7IA 4MUBA 2LKCA 2N1BA 2PMKA 2A78A 1YRBA 1E2FA 5E7JA 1W36C 3NC1C 4A8JB 1SKYB 1W5SA 1WCV1 1BYIA 1ODFA 3T5GA 3RVBA 5FUYA 4RD2A 3ICQB 4EPWA 1NMXA 1NSTA 3AKYA 3BB1A 4EJSC 5KSOA 3LDAA 4PSVA 4QFMA 3ZZTA 1KSJA 2OCAA 2QRNA 1D2EA 4RD6A 4RD4A 1P60A 3CZPA 2Z4RA 4HUQA 3UMFA 1II8B 2IX3A 2AK3A 4LBZA 4C7OB 2JLUA 1TNDA 4IDQA 3Q9LA 2AR7A 2QAGB 1OB2A 1FPMA 3FFBA 4R98A 2Q21A 3F8TA 3QJYA 1TQ2A 3EZ7A 4O2LA 2I1QA 2XB2A 1ZUHA 4YMUA 1MO3A 1W4BA 3QBVA 2XOKD 4BFVA 2RB4A 4M9ZA 2F1HA 4C9BA 2JLZA 1Z0DA 4HLCA 3RS3A 3TR5A 2BVNA 4JBWA 4DDWA 5CLQA 4PPNA 1E9BA 4BUJA 4IOJA 1XD8A 4OK6A 3VKWA 3GLHA 2YWEA 2ZRGA 1CULC 4MYTA 3EWAA 3L43A 3WXMA 5DYGA 2ZSFA 5EE1A 3QXSA 4LCBA 3EZ2A 2IXEA 3AGQA 1Q22A 3AP1A 2BBSA 5L3VA 1SXJD 4QNRA 2XZOA 1J70A 3QG1A 1JBKA 1S2MA 3C16C 3RDPA 1ESMA 3H2YA 4NCNA 1E2JA 3UK6A 2GXQA 2WPDD 4QOSA 5G41A 2QE7A 2ZAMA 5UKDA 3LRPA 1NKSA 2IYZA 2DFLA 2GETA 3NBFA 4FI3C 3THXB 2F55A 3CF6R 1QHSA 2KWIA 3BXZA 3KKNA 3CW2A 4IW3B 5FOUA 3OHMA 3LXRA 3GLGA 1G3RA 1UPTA 1E6CA 1YQTA 4LV8B 4IOMA 5FUXA 4NP6A 1R8SA 1COWA 1HQCA 2GJ9A 5BQ5A 3ZD7A 3VR1A 3BH0A 3HDTA 4MYHA 4FXPA 1T8TA 4TTPA 1KMHA 3UMSA 4LGMA 1N5IA 3K9HA 4G5OA 1QHHB 1YZGA 2BJVA 3GFPA 3HJNA 4ARZA 4V02A 4B6FA 1ZJ6A 1FP6A 1OXSC 5C1BA 2ZYTX 2VSOA 1OXTA 4DJTA 1WE2A 4MRNA 3G0HA 4FMCF 3BFKA 3EPJA 4LOAA 1KK0A 1ZRHA 1E2HA 4PQRA 4RD3A 3WRYC 2F9LA 4ASUD 4DHEA 2CLSA 5AUPB 3AVTA 2P67A 5HPYB 1R5OA 4F38A 1ZD9A 3CLVA 3TQFA 5A4JA 1LFDB 4XVUA 1S4QA 2CCKA 3HU1A 5BYJA 421PA 4OQMA 4BLPA 4DSOA 4OYHA 3RSLA 3VFDA 2IS2A 2O8EA 4P31A 4NPHA 4D80A 5KOYA 4M8NE 3OIUA 4AY2A 4D25A 2C2HA 1ZCAA 2ZANA 4I81A 3QENA 4JL8A 3RRZA 3SR0A 1ZIPA 3HPRA 1OJLA 1Z07A 4GRAA 3U61B 1P7CA 4I1VA 5BYKA 4HAYA 3U7FB 4Q4HA 3IO3A 1XEFA 4RCZA 5BWMA 5JWRA 2O8FA 3HU3A 1NIJA 3TH5A 1JALA 1F3OA 4B43A 4QKQA 1M6NA 5DI3A 1KI1A 3QY0A 4A8JA 3T06B 2FN4A 1U2RA 4O25A 4NYJQ 2YV5A 3ETLA 1XMVA 4TQUS 3RS7A 1TAGA 2Q3HA 3OZXA 4A4DA 4BFSA 4HAWA 1XPOA 3QSYA 5JCZA 2WMNB 3O8RA 4MUAA 1NF3A 4NMMA 4FN5A 1XTQA 1II8A 1KO4A 2UKDA 1SVSA 1CS4C 3THWA 3KB2A 3AVWA 1V43A 1EFHA 2C77A 1CP2A 1HTWA 4XTCS 5FPKA 3CR7A 1AJEA 3C5CA 4C3ZA 2Q9CA 2FV8A 2XZPA 3PUXA 3EX7C 2FSGA 2PZFA 2ZQ5A 3LAWA 4TYQA 1AK2A 1DAGA 1KNQA 2XNDD 4UNNA 5KPJA 2VBCA 2XZLA 3B78A 4DVGA 3LLUA 2PEZA 3Q8XB 3T12A 4GMXA 4NTZA 3RWOA 3SJBA 3QKUA 4TL8A 5CYPA 3RC8A 3QVVA 2DFNA 2XOKA 1S8FA 2VF8A 1EFUA 3VR2A 3ZVLA 4B6EA 5J47A 5JEDA 2IC5A 1CR4A 3CPEA 4GMDA 2W6ID 2NZJA 2Q6TA 4DDTA 3CRQA 1NBME 1S1CA 2W6JA 4V03A 1UDWA 1YZTA 3KUDA 4TN1A 4DIEA 3U4QB 1G7SA 2FPLA 2BBWA 2HLDD 4RFSB 3QUSA 1GIAA 3CRW1 4D4MA 2X19A 3GQBA 3THXA 1S96A 2W58A 3NG1A 1SKYE 1T91A 3ND8A 3IPYA 2FGKA 4UNSA 4R2HA 4E07A 1ZM7A 1ETUA 4URUR 4GI7A 5C18A 4LY6A 3LW7A 2QTFA 2WPDA 2FZ4A 3Q72A 3I8SA 1EX7A 1T8UA 4R2IA 4L9SA 3TSWA 2V4ZA 3QEOA 5DI9A 1AZTA 3SYNA 3M0EA 4YLGA 1ZCBA 4G01B 2QMUA 5EXPA 3AGPA 1N6IA 3CB4A 3T1OA 1UF9A 1YR9A 5FR1A 3OEHD 4GSYA 1M34E 1PUIA 2REXB 4HATA 1QZXA 3GFOA 2Z5FA 2WWYA 2BV3A 4QBIA 5FOVA 1MRSA 3LQQA 3ADKA 3CRRA 1XTKA 3ZZUA 3NIBA 3IBGA 4TMWA 4G1UC 2OUKA 4URZR 1U9IA 1KI2A 4G5RA 1CR0A 5EP2A 1PLKA 1YR7A 4I99A 2VP4A 3HYTA 2HJGA 2RGBA 1OPXA 4UJ5A 2FZLA 4NKRA 3NVAA 5FBRB 4LBWA 2GF0A 3OESA 4M9XA 3WMEA 4ASUA 2J3EA 1DVRA 2FE4A 1TADA 3DVLA 1DE0A 1L4YA 5JI3E 5H70A 2GEDA 4YXWA 2G0NA 3A8TA 4EPRA 1BH2A 2WJGA 3ADBA 1AGRA 4NL4H 1YR6A 2DCUA 3AQ4A 1YZQA 3RAPR 2V54A 2KB0A 2FH5B 1CJVC 2QNRA 1J8YF 4A8JC 5DISB 5BN5A 4FMCB 1JXMA 2ZRHA 4B76A 2WTUA 1VKJA 1DAMA 4W9MC 1XCPA 2VSFA 4AYTA 1N6HA 2O8DB 1TMKA 2ECKA 5JCPA 4Q1EA 4F7WA 5EQTA 3ZIAA 1OIVA 1FX0B 3X1DA 4DB4A 3B1VA 4C30A 2JJ1D 1KSGA 2ZUBA 5M04A 1VHLA 1LF0A 2QAGC 4JL6A 1OF1A 2EFDB 4HAVA 4NYJR 4OK5A 4CT4B 3CIOA 4Z1MD 2A5FA 3RRMA 1OFUX 4BZXA 3ADCA 4RZUA 3RLFA 1CEEA 3LVRE 3SHFA 1M8PA 1DOAA 4FMDF 4TZ6A 1YHNA 2F1IA 4ESHA 1GOTA 4LHYA 1LB1B 3UPUA 2AN9A 3CPJB 4Q9HA 1QG2A 2DYKA 2B8TA 1TEVA 4PC3A 3CNLA 4Q21A 1KK1A 1ZVQA 1I4DD 2EFGA 3M4YA 2GXUA 2GJKA 2H92A 3AVOA 1OXXK 3NBXX 4HB4A 4JKYA 3QXJA 4PANA 4ERNA 1G8GA 2XNDA 1D9XA 2V9PA 5HZKA 2GTPA 2CL6X 3U4QA 1NVXQ 1TUEA 2WIBA 4TWZA 2G6BA 1OXVA 4IRUB 4Q4AB 1W36D 1Z8FA 3SS8A 3GP8A 1N0VC 5B2ZA 1Q21A 3KQHA 3AVVA 4CW7A 5KSYA 3K0EA 5HE9A 4EQ6B 1Z3IX 1R4AA 1I4TD 2ZS7A 4F92B 1GG2A 2MSEB 3AP2A 1F60A 4E22A 2HLDA 2H57A 1GKYA 1KJZA 1ESNA 1G16A 4MRPA 1XZPA 2O52A 2OLKA 2F6RA 4AYWA 2B21A 3K53A 1O3YA 4ACAA 5KNDA 3ZVRA 1ZBDA 1Z6GA 1OIXA 2Q3MA 4JLOA 1CKEA 5J4VA 1P2TA 2YOFA 3B9QA 2OZEA 3GJ5A 4V0MA 3LBIA 3E2IA 2A30A 2IHYA 1GKUB 1F48A 1PUJA 3PQCA 4WOPA 4CT5A 2VTKA 4QM7A 4JVLA 3TAUA 4NYIQ 1N5JA 1N5LA 1K8RA 3RWMB 4NBSA 3I5XA 4M1OA 5KYKA 5AJVB 1GSIA 2WWXA 2DPXA 5CM9C 2IEZA 5EE9A 2Z83A 1EWQA 3AF3A 5FOSA 3OEHA 2X1VA 2FSIA 4LJYA 4G0NA 3TSOA 1Y63A 3JVUA 4TTRA 5AUOB 5L8VA 4HSEA 1Q1QA 2GAAA 3Q3JB 4NU0A 5DYIA 5DNYB 1ZD1A 4PTLA 2FNAA 3LNCA 2QP9X 4Q66C 4I4LA 4W5JA 3AVYA 5GJWC 2GKSA 1VYUA 4LC1A 5FBWB 4DCSA 4QNMA 3W5JA 2AHOA 3FKSD 1E2DA 2B92A 1GNPA 1KSFX 1D2NA 1GRQA 1IHUA 1Z0IA 2BCGY 1Z29A 2ZE5A 4JVSB 3QKSB 4E09A 2H1LA 2ZI3A 1ZNZA 5TY0A 3DPUA 4DSUA 1IY0A 1R0ZA 5HKKD 3AVUA 2GILA 4HEJA 2ZROA 1WXQA 1I2DA 1YZKA 2LCFA 2PH1A 3L82B 2ORVA 5JJKA 2BOVA 2QQEA 4UXIA 4C0LA 1PLLA 4HYYA 5AJWA 2OCPA 1T3LA 1W49A 4BGDA 2FPMA 4PFSA 3TQCA 2I4IA 1BYUA 4M1MA 1P3JA 3R7WA 3B82A 3UWKA 3W8NA 3NH6A 3SYLA 3TMKA 2WOOA 5CYOA 5KDLA 3SN6A 1N0UA 4OHYA 4HB3A 4PHTA 1JQJC 3U5ZB 3KTAB 4LJ9A 3V4RA 1XX6A 4PC6A 3DMDA 4Z1MA 3THYB 4CEIA 3FVQA 4KFRA 2ZRAA 3IBYA 2H17A 3FMPB 4QGAA 1KI6A 4LSGA 2HYDA 1RRPA 4KITB 2IS1A 4BQSA 3UXMA 1XWIA 1VCMA 2J46A 2HF8A 4CYMA 1GKIA 2OSBA 1DTSA 3TE6A 3CRVA 2JJ2A 1N6OA 4B3BA 4B48A 4B75A 2JLRA 4NCIA 1TF2A 3FHTA 1KZGB 4JYCA 2WOJA 1E9RA 3ONWA 2YVUA 3K09A 4A2PA 2F1RA 3C15C 1U0HC 3LV8A 3L0PA 4ZIRB 2BEJA 1XJ0A 1X86B 3P27A 4GFDA 4Q03A 1RVDA 1CLUA 4A0RA 2XX3A 4EQ6A 1L7VC 1P9RA 4LHZA 2FSHA 4A6XA 1J8MF 4FMDB 3W6PA 1NI3A 2CVHA 2IXGA 3RC3A 4AYXA 1JAIA 2MMGA 2WV9A 5B64A 1JR6A 3EC1A 3MWKA 5CK4A 4DLZA 4WZBE 2NZ8A 2ZJOA 5GADl 2XTZA 4CEJB 1E0AA 2EWVA 1OFIA 4IVRA 4EJSA 1P9WA 5IHPA 2PEYA 4PPQA 4D0NA 1ZP6A 2H5EA 3B7GA 5E3HA 1XEXB 3EASA 2UVQA 3A58B 2XGJA 2F9MA 4NHOA 2VP9A 4B3DA 3LLMA 5TMPA 1DAIA 1FQKA 1IN8A 1XEWY 1SKQA 6Q21A 1KJWA 3RSOA 1VYTA 3VNVA 3PUYA 1PLJA 4AWXA 4LX0A 5JFGA 3V00A 4LHWA 4P4TA 4Z51A 2ZUDA 5IF9A 2OG2A 3BRWD 4PC2A 4TLAA 5FOWA 2ZYVX 2WWGA 4QHSA 1NJFA 2KI5A 1IBRA 1SGWA 2X8AA 2CHQA 1SZPA 4RVCA 3UKDA 2XTNA 2PT7A 3QF7A 5CB8A 3JZAA 4IOLA 1PV4A 4HZIA 3CX8A 1CJUC 4M1TA 2A5GA 1CR1A 3LQRA 4NYIR 4Q1CA 5ELXA 3QEJA 4II7A 3NKVA 1XD2B 2QG6A 3U6KA 1GTVA 3W3ZB 1T4GA 2GJSA 5LB4A 2ZRKA 3K9NA 4P33A 3EPHA 1MABA 3WNCA 3FFAA 4X8OA 2WKQA 1FMJA 3TAHA 1WF3A 3QKSA 3FKQA 2XJ9A 1HUQA 4V0OA 1OKKD 2K5UA 1E94E 2ZEJA 1E2QA 3FHCB 3GJ6A 2EWWA 1COWD 2AFIE 4U00A 3FKSA 1P6XA 2J87A 3REGA 2QBYB 1XPRA 4LHVA 1N6NA 3PITA 1G17A 2ZJ8A 3GJ3A 2KBEA 3W8RA 2I3BA 4JLNA 4KSCA 4GT1A 1G21E 1TQDA 3C5HA 1QVAA 4UNQA 2TMKA 2NO7A 1K5DA 3AF2A 1WDTA 1X3SA 3BOSA 2FOLA 2VHJA 4FINA 5FL7A 2WVJA 4KO8A 4JBYA 4D81A 4DSTA 1C4OA 2ZU6A 3K70B 2JLVA 4L8GA 2CDNA 4J0QA 1KO8A 4HAZA 2EYUA 4JYBA 2ZI9A 4HB2A 4URYR 3RS4A 1TU3A 3AM1A 5DSZA 2AXPA 3QF4A 3THYA 2V3CC 2XAUA 1Q1BA 5FL3A 2HV8A 3IKJA 2GZAA 2BEKA 2YC4C 4GPTA 4XWOA 3BC1A 4TSFA 5H1YA 1SHZA 4BFYA 4MITA 1G18A 2HT6A 3FMFA 1Z47A 4I1OA 2C9CA 3RYTC 3ZZ0A 1YZNA 2J0QA 1XD9A 3WNDA 1H65A 5DO9A 3GLFE 4ZIRA 1GNQA 1DBSA 2PT5A 4IVQA 3SBDA 4HAUA 4B35A 1MO5A 1E1QD 5FTLA 2CJWA 3VR3A 3WP0A 1T6NA 621PA 1JJVA 1W0JA 2D06A 2GVZC 4NONA 2BIFA 3OIWA 4HZUA 2ATVA 2ERXA 3VX4A 3AB3A 5E95A 3ZVMA 4TMVA 1R5NA 2DFKB 1BS1A 2QORA 3DOFA 1XMSA 3A37A 4JZKA 3CWQA 5G53C 1XEXA 3MRSA 2QP3A 3P20A 4X8LA 3NDBB 3D31A 2IWRA 3R8CA 1LW7A 2CK3D 4HDQB 1E4VA 3T35A 4LJ5A 4HDOB 4M1SA 5K8LA 4TYWA 2ZE7A 1F2UB 1F5NA 1N6KA 4PQFA 1KK2A 4N0EA 3WP1B 1ZM9A 5CITA 2FFBA 2L0XA 3KKQA 1Q57A 1CF4A 4TYPA 1MO6A 3BB4A 2O8BA 3T61A 1EFRD 3MSXA 4P0TA 3L2OB 1X8JA 3VNUA 1XMIA 2B7CA 2EW1A 4WBSA 3CNOA 1A7JA 4AKEA 4F4IA 3RRYA 2DB3A 2RGGA 5HTKA 1SVWA 2GEVA 3GCGA 2NG1A 5IK2D 2W6JD 4MRVA 3NTUA 1ZUNB 4RJLA 1Q1EA 1XPUA 3N70A 1FUUA 1HQYE 2F7SA 4ACBA 4Q4JA 4GDFA 4XIGS 4JSTA 3CX7A 2MMCA 3CUEF 2VHTA 3FTQA 3QBTA 2VEDA 5JRJA 1CJMA 1XCGB 3AF4A 1ZM4A 2CLCX 1IXSB 3QNUA 3SBEA 1G8HA 3VHXA 1US8B 1W4CA 1O87A 4ZI2A 1HE1C 4X8HA 4JLVA 1NVVQ 3NH9A 1JQLB 3VHLB 1NMYA 2PZGA 2JLXA 3VKGA 4KU4A 3QKTA 3DOEA 1U8ZA 2QTHA 4TYNA 1D2MA 4TZ0A 1OKKA 4KODA 4PHFA 1CJTC 1JR3D 1Z6AA 4MGKR 4IXMA 3DO6A 1XXHA 3OEED 4JVMA 4PXAA 3R9IA 3CF0A 2WJJA 1JXOA 4UNPA 3TVTA 1NP6A 1QHGA 3NEJA 2BMDA 1R5BA 1W44A 2V7QD 3WYFA 1EGAA 1E69A 2R2AA 1WMSA 4GZLA 2ZSBA 4EPXA 1IAQA 1L2TA 1VIAA 1N6LA 2AKAB 4KBFA 5CJ2A 5LB2A 4R71A 1UKVY 4UXHA 1IN7A 5HR5A 4BFUA 5FOXA 5CK5A 5GJCA 5L3QB 4LV6A 4CEHA 5TARA 1P72A 1N25A 4AK9A 5C46F 3SI7A 1RJ9B 4AKGA 1DS6A 5G3YA 4A92A 2MSDB 3J81k 3PVSA 5DGXA 2BBOA 3OE7A 3IIKA 4IDNA 5KNBA 2JJ8A 1K5GA 4PHGA 4DCNA 1VG8A 2KE5A 4A6PA 2EFCB 4YXWD 3LD9A 4A2QA 2AL7A 2WBLC 1B23P 2OEPA 5DN6A 4C0AC 2OAQ1 2GCOA 5KTYA 3NXSA 2FEMA 5F9FA 4B73A 4Q1AA 5LBIA 2GXAA 1XTSA 2XXAB 4Z8YA 2W00A 3LH5A 3LX8A 4XVQA 1T0HB 3TW8B 4BEBA 5KO2A 4CVNA 2B6HA 4D6PA 3BS4A 4LI0A 1RC8A 2GBLA 1GILA 3IO5A 3PFIA 3QPWA 4BEJA 4JS0A 1Q3HA 4Q1DA 4MA4A 3ZIAD 5GVSA 1E2LA 4JLJA 1E1QA 3AF1A 3LO5A 4POAA 2C96A 5G3ZA 5L3SB 3SOPA 2C8VA 5JBQA 4YMTA 4LPSA 3UG7A 3Q5EA 3W90A 4K8OA 3T1QA 4D4JA 4DBLC 3DZ8A 2Z6VA 1MV5A 5FUVA 1E79D 1GL9B 3SJZA 3ADDA 3B1WA 1VCIA 1MRNA 2XTMA 2ZJAA 2P2LA 2IUSA 5JMTA 4I1SA 4C7OA 5EE3A 4AG6A 1EESA 2J1LA 2QAGA 2J0SA 3MMPA 2VLIA 2OFWA 2CLDX 2CK3A 2DWPA 2VF7A 4TLDA 2ZS8A 2CHGA 5A0FA 3K9GA 3WNBA 4DLVA 1PZNA 1GNRA 4MGIR 3F5FA 1G5PA 2X77A 2ZREA 1H8ED 4RKFA 4BRUA 4Q7JB 1II0A 4ZDJA 3VU9B 2DR3A 4KLZA 3KXLA 4MKIA 2P3SA 3WMGA 2OV2A 5GJBA 5KHOC 2N46A 4UJ3A 4EAQA 5DHFA 1EFRA 1KZ7B 2RGEA 1WQ1R 3CZQA 1PVOA 4B44A 2FDCA 1S1MA 1N3BA 1A1VA 4H9GA 1FNNA 1T5LA 4KBGA 3BFXA 3GFTA 2IYVA 1AQUA 1J2JA 1US8A 2QPOA 3MJRA 3R20A 5IK2A 4BFZA 5J4KA 4ABYA 4B47A 2IYTA 4Q9LA 2FFAA 1KAGA 4IXNA 1KI7A 2F3RA 3GLIB 1UAAA 2J7PA 3JZMA 2WICA 4Z54A 3X1ZA 1P2UA 2YYZA 1Q44A 5FTJA 2A5DA 4HDCA 4A0GA 3EPKA 2IYLD 3EAQA 4Q9JA 3QPVA 4KSBA 2F43B 1WP9A 2X2EA 3RANA 3SDZA 5H8WA 1XZQA 2PJZA 1Y3AA 5IT5A 4OJQA 2KJQA 4QHTA 5SZJA 5J40A 2Z0MA 4YC7A 2EFEB 1G4UR 2YKGA 3M6AA 1NVVR 3TR0A 3AV0B 2RCNA 1QHHA 3L0IB 4JLMA 4ESVA 3H1TA 1JR3A 1KGDA 4LYFA 2VPPA 4OQLA 2Z43A 4URWR 3UMRA 2E87A 5C2JB 3KQLA 3K70C 5LD2B 3A4NA 5FTNA 3GEEA 3OEEA 2A5YB 2H18A 4Q00A 5L3QA 2R9VA 3T1TA 1OSNA 5P21A 2BJWA 1H8HD 2AWOA 5KPDA 1U81A 2V7QA 5HCIA 3SHWA 2D74A 3EXAA 1X8LA 4W5HA 2ZYUX 1XFAA 2WWHA 1Z0KA 4EPTA 4TLCA 2IYRA 3C4JA 4N3NA 4LJ7A 3ZS8A 4ZV4A 4AIIA 3SJAA 2QPAA 2WIAA 3P26A 3ZH9B 2FFHA 3Q7QA 5EUQB 2D3WA 3E1SA 2XXAA 4U02A 3IQWA 3SFVA 4PC1A 3B9PA 2D62A 3PIRA 1UKYA 1DARA 3BBPA 2CL7X 2WKRA 2J0UB 1FUKA 4FCVA 1XP8A 2ZJYA 1T5IA 1Z63A 2GBLC 4JJKA 3NBYC 1GUAA 2VSXA 3NWJA 3PEUA 4ZDWA 5C4GB 4CRWB 5L3SA 1P5ZB 2V1UA 1SVOA 3QE0A 4TYYA 1MH1A 2H8KA 1Q12A 3SEAA 1YU9A 1E0JA 4GOKA 3I1FA 1N6PA 1G7CA 1M2OB 4RZXA 4E5UA 3SFZA 2WJIA 2ZRJA 5K8TA 1MOZA 1NIPA 2VP0A 3FWYA 5FUWA 1Z06A 5HE8A 4V0NA 3KKMA 1KSHA 4IDHA 3F3YA 2WMOB 1SXJE 3DMNA 3I4LA 3QOFA 4MGYR 2FX3A 4ZDIA 2G0TA 2CL0X 2DFTA 2WJVA 3UG6A 1CXZA 1Z0FA 1E79A 1FTNA 2RH5A 5C4MA 3VU9A 2OT3B 5CIQA 4V0LA 5J4LA 1QG4A 3U44A 4EPYA 1P2VA 2JJ2D 1OIWA 1MKYA 5FI1B 4I1UA 2VHUA 1FNMA 3K0FB 4B3FX 1KYIA 1U94A 3AUYA 1W4RA 4OQXA 1KDRA 2ZI5A 1H8EA 4MKFA 1A5TA 2GNOA 5D3MB 2H7VA 3H0KA 4LDJA 2RGCA 4BFTA 2OAP1 2QGNA 1WA5A 3G82C 4BRWA 3ZS9A 2ASEA 2GZHA 2ZVQX 3KUCA 1P4SA 2J5XA 1FMLA 1Q3TA 3FPAA 3QXXA 2OCYC 4RFSA 4D4LA 3ZGXA 1AS0A 3TUJC 4AURA 3CWZA 4QHYA 3KFVA 2YOGA 3GEIA 4QBFA 3THOA 4B3XA 4IHQA 3AVXA 2FPKA 4BLSA 3WRXC 2G77B 2REOA 4XD7A 4MDFA 2YINC 2BBTA 2XEXA 3CO5A 3CRMA 3D8BA 3ZQ6A 3TBKA 4MQBA 2WKPA 1GRNA 1QHNA 5AUQA 4XTRA 1AGPA 3DKPA 1E4YA 1FFHA 2J45A 3BORA 4RFVA 4JSYA 1W2GA 3L8YA 1RRCA 2QMEA 1AA9A 5G40A 2XJ4A 4QGHA 2YOHA 3W5IA 4PAOA 4RCYA 4DRZA 4DB2A 5FBLB 2QZ4A 3R9WA 2OBLA 4F4JA 4M9SA 2BMFA 1E0KA 3SU8A 1S3SA 2WWIA 2XITA 4IJMA 1R8QA 1QF9A 4Q7LA 3JVVA 2ODWA 5AUNB 2QMHA 4KAXA 3KJGA 1NL3A 5FOTA 1MR3F 1UADA 3OF5A 1J99A 3FE2A 1ZAKA 4G5GA 5FI0B 3MJHA 4D0GA 2IS6A 4DLUA 2EVWX 3PEWA 3MAAC 1H8HA 2CMKA 4NCJA 4UXJA 3SQWA 3MLEA 1E9DA 4B74A 5HZHA 1CIPA 5FPTA 1KDOA 2ZETA 4LJ8A 3CM0A 4RD1A 1OLOA 2XNSA 4QJ4A 4OHWA 3EZFA 3KQNA 2ZRFA 3K9LA 1CRQA 1VCNA 2NO9A 2WSSD 2XSZA 2RAPA 2A9KA 1U90A 4BWYA 4MRRA 1WB9A 2ZYWX 4NDZA 3GLIE 3GLFB 1G291 2IK8A 3IILA 4BZQA 2BHRA 5B57C 4IOKA 4QGFA 5DHAA 2A7QA 3VKHA 1WRBA 3FOZA 4G5QA 4LUCA 1ZIOA 1VPLA 1GAJA 1QHIA 4PX9A 2W2XA 2C04A 2ZRDA 3B2EA 4D2IA 5JWHA 2O8DA 3V4FA 4ZDKA 2QA5A 1LS1A 4W5WA 4KI0A 1FX0A 2QEQA 5FL7D 4LYJA 4XSHA 2QT0A 4UKDA 3KQUA 3B1YA 2BMEA 4Q1FA 4AKHA 5CJPA 3KFXA 2ZSAA 2V1XA 1KTVA 121PA 2F1JA 2VRWA 1N6RA 2HXSA 1L8QA 4PO8A 5JZVA 1QRAA 3MCAA 4C0HA 2ODEA 2XB4A 1KHTA 4TSFD 4URXR 2CE2X 4IDOA 2O5VA 1FTSA 4H1UA 4KYUA 1E2KA 1B0UA 1G7RA 4HB0A 3IQXA 2ZPTX 2ANBA 3N2IA 4AC9A 1NG1A 2Z4SA 1G4AE 2NMVA 4YMSA 1UEIA 5D3MA 5SZIA 1NSFA 4OK3A 3NC0C 4Y0AA 4WXRA 1ZW6A 1Z08A 2R62A 4WAUA 3W34A 5FPHA 3U7GA 3L0OA 1W0JD 3U7EB 3AH8A 2ZE6A 1PJRA 1RRGA 4Q4AA 1NN0A 4HI0E 4MKHA 3QVUA 2FU5C 1W7AA 2IA5A 2GRJA 3B1XA 1X1RA 2GESA 3BGWA 2BKUA 4LJAA 4N0DA 2G1KA 3K8YA 3KKPA 1ZNWA 1DAFA 3KL4A 3MG9A 4TMZA 4Q9IA 5ANRB 5EZ6B 1KI3A 2V6IA 3CX6A 4D4KA 4PO9A 4ZKDA 1KNXA 2GAOA 2GCPA 4UQOA 4YONB 2JASA 4AG5A 1G5TA 1MT0A 4DUGD 5LD2C 3MD0A 3HWSA 4EDHA 2RHDA 1JJ7A 5JS8A 1OHHA 4K46A 4D26A 4Q48A 3SYKA 5D3QA 2PBRA 3BB3A 1HEIA 4OKSA 2OE2A 1ZYUA 3BERA 4A0FA 1T3HA 1KO7A 1Q1ZA 3MFYA 4M1WA 1QDEA 1E0SA 3O8BA 2VYFA 3RABA 2QTVB 1QBKC 4F93B 2B8WA 3LX5A 2IF2A 3NEYA 1A2BA 2CCJA 3UATA 2GJ8A 3ZJYA 1E1RD 2VHCA 2CXXA 3DDCA 4XWKA 5IRCD 1ZUIA 2CCGA 2R6CA 3VX3A 4HUQB 2WAXA 4P4UA 4D0LB 2JLSA 3EWSA 3FHOA 3GJ8A 3VR4A 1G1MA 1U0LA 1JEDA 4JLDA 4NYMQ 1AS3A 2CHVA 3GLFA 2AD5A 4L16A 5J4YA 4DCUA 2QN6A 1DPFA 3U3JA 3GEHA 4MH0R 5CDFA 1U8YA 1G3UA 2HDNB 1S0UA 4L5BA 2LWIA 3O8DA 2JA1A 3K0CA 1Q0UA 1EG7A 2WSSA 3DZDA 4O3MA 2DBYA 3WYGA 3CH5A 1G7TA 3ASZA 4MYCA 3TUIC 4X8MA 4LBYA 1G41A 1KK3A 1R10A 3X1YA 3B1ZA 1V5WA 3U3MA 2WHXA 2KBFA 1E2MA 4LJ6A 5E4FA 5K8IA 1RPZA 1GL7A 4RSGA 1W48A 1YVDA 4LWZA 1YKSA 3K70D 4H1VA 3K0AB 1NNEA 1E2GA 5GVRA 1G9XA 1DADA 2NTYC 2OXCA 4C0KA 2ZI7A 3B5JA 3RHFA 3KJHA 3A1VA 1CBUA 3A36A 3MWJA 3SE0A 5KUTA 1GDDA 1N2CE 3A4LA 1WBDA 2ODBA 3IHLA 2QGZA 3KTAA 3OE7D 4O2RA 3VQTA 1XB2A 1R6BX 3GJ7A 3FMOB 4DLTA 1P62B 4PQYA 1E9EA 5JLJA 1FW6A 3BH7A 4FWIB 2IUTA 3UIEA 4P3YA 5CIWA 5FPSA 2FJUA 4ZI3A 3GLGB 5DN6D 4Q01A 2GWHA 4G5SA 2ZRCA 2QROA 2ERYA 3HR8A 3U6BA 1XJQA 3REFA 3RRNA 4TL7A 1NBMD 3AVQA 2WJYA 2ZRMA 3KXKA 1TX4B 1KMHB 1T3SA 1UEJA 3LFUA 2OILA 2PLRA 4QG7A 2YWGA 1E9CA 2V6JA 4JIMA 4ITRC 5FH9A 3DL0A 4JT4A 4ARZB 3T34A 2JLWA 2O8CB 4B71A 1N5KA 3OIYA 2PZEA 2OFXA 2P65A 1D9ZA 4Q7KA 1N0WA 4MGZR 2YZ2A 1SHKA 4IKEA 1S9HA 1CU1A 2DHRA 3B60A 4GOXA 4PSAA 4TQAA 4WA7A 3BE4A 3ZD6A 1LF5A 5KNCA 1TPZA 3WHKA 4ZO4A 4CEJA 821PA 2FG5A 4B3CA 1I4LD 3AKCA 1YR8A 2BKEA 4RZ3A 3RS5A 2NO0A 1LVGA 1KMQA 1X1SA 2W83A 3ZQJA 2P5TB 2J7KA 4DEYA 3GJ4A 4OBEA 1EXMA 4TTQA 4PZLA 4A36A 4KFSA 2H16A 1VG0B 3EIQA 2O8EB 1ANKA 4TT3D 5F2EA 4OHVA 1YE8A 5JWOA 2O0KA 2GF9A 1OFHA 5LPNA 3FGNA 1R0XA 1Z28A 1IXRC 3VMFA 4TMXA 2ZRNA 1TQ4A 2O8FB 2ORWA 5HCNA 2R65A 3D3QA 2IT1A 4PO1A 4E03A 3M1IA 1TU4A 1OE0A 2ANCA 1RKBA 2J41A 2OCBA 3LBNA 1XNJA 5DI3B 3T15A 5TXGA 2HXYA 4DUGA 2ZRBA 2RGNC 3T1VA 4WVFA 4YMWA 4LV5B 4KFTA 3WMFA 3SQXA 5JHHB 1F2TB 4OQFA 1GM5A 1FL9A 1IN4A 1E9AA 2C95A 3H4MA 3A1SA 1XD2A 3KKOA 3L0SA 2QRZA 2RHMA 3PR1A 4XVRA 3THWB 4MDEA 3NHAA 1AM4D 2J7PD 5FBQB 1G19A 2VIIA 1RYFA 1KKLA 1E1RA 5EP4A 5EJEA 4RZ2A 2D2FA 2ONKA 1SVKA 5DIFA 2SHKA 4IDPA 4DC9A 4PAMA 4DCTA 2QBYA 4LK2A 1IN6A 3K0CC 4XOIA 4C2UA 1D6JA 1G64A 4NYMR 1HT1E 2Q9AA 3E5HA
chains in the Genus database with same CATH superfamily
4Q24A 3D3JA 1DQSA 4DC0A 1TL7C 1TKAA 2CJFA 5JECA 3FBTA 1PFUA 2IPAB 1RXIA 4D6YA 1S9DA 1UBGA 4Z9FA 3EUEA 2WTNA 1XZBA 1QNLA 4WQMA 3L6DA 4RMHA 3KLOA 2IUUA 3DQQA 1MTOA 1GNTA 1OC2A 4JQZA 5MN4A 1JEYA 1FBNA 3OFNA 4A1FA 4FIDA 1W1WA 1V39A 4G86A 4RVNA 2FYTA 3B2QA 3RBVA 4EEZA 5KYUA 2G36A 3KZNA 3P2YA 4C07A 4DA7A 2D7DA 4TM7A 4D9KA 1UANA 3NS7A 2V0NA 1HLDA 1QK3A 4FFPA 1XA0A 3HN2A 4NFYA 4OA5A 4D41A 3V4VB 1RIFA 1IY9A 4YT8A 4AI6A 1L6RA 4O3MA 2AUMA 3GN1A 4ZQHA 4EUKA 1UZAA 1YKGA 2CWDA 4QFBA 5L4LA 4LRUA 4NPAA 1I1OA 3DSRA 1J42A 3DV0A 2X9NA 2NO6A 4IJ6A 2Z09A 4CR6A 4GMGA 3W9UA 1P4JA 1MC4A 3L4EA 5F3RA 2BCJQ 2FJ0A 2FQQA 3G85A 4XIJA 2NXCA 2Q5CA 2IZ6A 3BDVA 3AO0B 1Q2UA 3E9NA 4RK6A 4XE5A 4RTNA 3PUWA 1TF7A 2D4HA 5FI3A 1N34B 3E1KA 2JIZD 5DTEA 3DUFB 5HA5A 4FCTA 2CN1A 4H3KB 1V3VA 1HMPA 4XSGA 1SOWA 4QECA 3UANA 3W7VA 2D2EA 3FROA 3VNAA 2AYYA 2X9LA 1B2RA 1GSOA 1DBVO 3W0LB 3OPQA 4HDNB 1NHWA 3ZR4B 5C37A 4JOQA 5CMLA 1IG0A 2IW3A 4RIHA 3TOSA 4LDRA 1L5HB 2NUPB 3LA6A 2A4MA 5THKA 5ESRA 1EVLA 2HSDA 3IT1A 3VV2A 2CEAA 4BKMA 2I03A 1KHHA 4M0UA 1II9A 3B3QA 4WESB 4PYIA 3HM2A 2JCSA 1LPPA 2P9JA 4ZCQA 2XUJA 3CNQS 1FFAA 3BMCB 4XFKA 1GGNA 4ZOAA 4EIWA 5FRDA 4CTMA 5FPYA 1NXVA 2G1JA 1AIPA 3O7MA 1OYWA 3MTEA 4KJZA 1C4WA 1SOUA 3LJKA 5EP1A 1W0KD 5COBA 3ZW8A 3DFZA 1LPSA 1I5EA 3ZV7A 4A6DA 5BV0A 5JJLA 2PLWA 1BIFA 2IUEA 2H7CA 2VDKB 1M72A 3OF3A 4PXSA 3VPFA 5K05A 3VR5A 2QN7A 1AKEA 1TTQB 4KTTE 4S35A 1MO4A 2Q1XA 5CGZA 2NZ2A 221PA 2RSLA 4TT3A 3TLBA 2NP6A 1ZNXA 5ALXA 1EGVB 2KMLA 4PPFA 2P40A 1UKZA 1S02A 1YO6A 2P0YA 1JW9B 2YV3A 2YIDA 3JWEA 3NIFB 4Q4LA 1XXHE 5EMJA 4I3GA 4B3GA 3VNUA 4AZ3B 3TFOA 1FUIA 1PFVA 2H0AA 1LSUA 2M98A 2VO1A 4FZ5A 5IEJA 5IMSA 1E7RA 4JD5A 4K6KA 5E6SA 4X1OA 1A8QA 2NU9A 1ZUD1 1LSOA 4EYKA 1AGXA 1MVOA 2I2WA 1VG1A 4LNHA 4PBRA 4OXNA 3O4VA 4RH1A 2I9KA 5JDIA 4M9UA 2OA0A 3SQDA 1K4KA 4JLWA 1BGVA 2AD1A 2IU3A 3AF0A 1KFKB 3DFIA 4RADA 4ZCIA 4YMHA 2P6NA 4QBKA 3T3GA 2Y93A 3FFXA 4I9FA 5JCOA 4ISBA 2IXTA 4HGQA 1D2RA 4XD7D 1TO6A 3HACA 1RLOA 1Z22A 3EHEA 2JLYA 3VO9A 2C3PA 4TTTS 4RTQA 1OB5A 1R6VA 3TTYA 4BVJA 1ENPA 1ICEA 2TS1A 1WXGA 2BFDB 3H6GA 5H3LA 2DQKA 5L95A 3U37A 2Y1FA 1XWFA 3OX2A 3V7FA 4NBUA 1YWGO 1HY3A 3K6SA 1IOZA 1HOTA 1KY5A 2I7TA 2Y1LA 4GG1A 5IBCA 3EA5A 3HMQA 4PGHA 2FMKA 4NQRA 2WW8A 4RMGA 5JO0A 4N18A 1JIXA 1UJ5A 1DTWB 4FZRA 4L95C 3O47A 3V1NA 3ZXIA 3PLAE 3VGJA 4PSCA 2BGUA 2KSQA 3A6ZA 3K05A 2J0VA 3UMBA 1ZLYA 4EY7A 3DJFA 3I5YA 1YA6A 3UYKA 4DMRA 3I62A 2XB8A 5H68A 4YP1A 1JSCA 2BEUB 2Q1SA 2RHHA 1ZK1A 3EPPA 3I6ZA 5JAQA 2W0MA 4EG8A 5LOVB 3R5XA 3GJXC 5B2EA 2OGWA 5J4HA 1KTIA 2BDTA 2DPMA 4H3HB 5L6LB 4D43A 3IA2A 3IVMA 3O8CA 3H5VA 4YRIA 4G8JA 2PVSA 2Z04A 3AX6A 3LECA 4RYDA 4X1YA 4AF7A 5LDDC 4FWTA 5EIEA 1E96A 4BV3A 3I32A 5BN1A 5K0ZA 2ZPUA 1DKLA 3BL8A 4N0MA 4PNEA 3EG5A 4FX5A 5DGHA 4JDUA 3W2FA 4FHDA 3G89A 5CVTA 1DG9A 3PEVA 4TX1A 3ROGA 4PBSA 1G5IA 1ZHOA 3EGVA 1LCIA 3K1ZA 4II2A 1P7VA 5LJLA 2QU8A 3AJAA 3UV6A 2AQKA 1V1MA 4M22A 3TDMA 1ISRA 1FOEB 1T0JB 2C99A 3HABA 3GEMA 5HJ2A 4AUNA 4YAKA 3OCVA 4FSHA 1WZCA 2IBMA 1XTJA 2OO5A 4BX2A 3LUKA 4X6LA 4J3NA 2C4NA 3ETNA 2X5KO 3A28A 1TLTA 2XA9A 2JATA 4C4SA 3TL3A 2NPIA 1ORDA 2IF0A 3H5OA 4Y1EA 1YB2A 3DLPX 1RE1A 4B32A 2QPTA 1EDEA 2FA9A 1NY5A 1YR1A 5FI5A 4DDVA 4P4SB 3F2VA 3TNDA 3TFQA 3AIKA 3CF2A 4EAAA 4MUHA 2WVGA 1BS2A 1DGQA 1NN1A 2HZBA 2M1ZA 2ZI4A 4IIGA 1KKMA 4IMPA 4A9AA 3OOEA 3SM9A 3AU8A 4MS3A 4WOCA 4YBRA 5G0VA 4OHKA 3PXGA 3WMRA 3ZYZA 4AMBA 2WQ7A 1J9EA 1KJQA 4DWWA 1KO5A 2WF7A 5CDUA 4FKBA 1C8BA 4NMWA 4QL3A 5AVJA 4CG0A 2DMRA 3NJ8A 3SZRA 1XJ5A 3D6MA 4GYYA 3RTDA 3F5DA 3SIWA 2HYIC 4ND3A 2YWHA 2H4ZA 1D1QA 3X1WA 1HE4A 2HM7A 5LIRA 2I6FA 3T0GA 3ICEA 1V2GA 4E7PA 2FR8A 2VJCA 4XWTA 5DFAA 4DLSA 2FFQA 5HZMA 3ZUGA 1UOEA 1DO2A 3EEYA 1IJEA 1NUUA 3WYDA 3PQ5A 1PG2A 2G5CA 1RYHA 3QEMB 4YALA 2PCJA 2PH5A 2FEWB 1T3TA 4KQ6A 1GWNA 1J9GA 5JSZA 4ZVPA 4JGIA 5JO9A 2ZB7A 2EZ4A 1TAQA 3N0XA 4FK8A 5E9AA 2D2IA 4C2BA 2HIHA 4GBJA 4UCWA 4DL9A 4I1RA 2IYUA 3U3KA 2WPNA 2X8BA 4MS1A 5GONF 4ARIA 4OSEA 3VNBA 4BVEA 5BUZA 3U62A 3RRXA 3OAAA 5IFKA 2O1EA 1BE1A 2W42A 3CKKA 1Z56C 1AGNA 1Q11A 3LFHA 5I45A 3E53A 4I5EA 3PCXA 2XCLA 2XIJA 2DETA 4B6GA 3HXOA 4GZMA 2Q3FA 1O94C 2OBNA 3GZNB 2HBZA 4IDBA 3P0JA 1F9EA 1GCOA 4QDTA 1XO1A 1UPXA 2IOQA 3QIAA 2L69A 4Q18A 3GUYA 3GNSA 3UZUA 3WGMA 4PLHA 4PX2A 2WU3A 1GFIA 3SR3A 5F7JA 2QD2A 2X8JA 4GNKA 3NT2A 4PSKA 5KU1A 5KQPA 2DWQA 5I8ZA 3VYUB 1J09A 4A0HA 1TM5E 2UU9B 2QRPA 3VAZA 1CNFA 5DGDA 1A9XA 5CFOA 4KXYA 5BW8A 5BVGA 4CM8B 3IVGA 2NZXA 1N57A 1U99A 3FR8A 1A04A 1PL6A 4E5SA 3HBFA 2IHJA 1O2DA 1ZM2A 2E1RA 3OT5A 4PLGA 4WLFA 4EY3A 1E60A 1PWHA 2W6IA 5C5EA 1ONNA 1MB0A 2BYTA 2AN5A 4BCBA 1AKYA 1G0OA 1SIBE 1SXJC 1Z9BA 2WZDA 3LX6A 5FAKA 1N2CB 3EXG2 4HLUA 4U7JA 3LTEA 1L9XA 1RAIA 3SKXA 1EXDA 1K3UB 3PNBA 1YL5A 2RGAA 3A6LA 1EZ4A 3P32A 3UC5A 5H59A 3LI2A 4RM2A 3B6EA 5IPFA 4G97A 3VPBA 1C8KA 4FFSA 4G0XA 1D4FA 3WGHA 5ALEA 1D1TA 1TECE 4KO3S 3VU3A 1GU1A 2ZIAA 4OQ4A 4R0NA 2Y67A 3MOSA 3M6UA 1CTQA 3RASA 2OHIA 5TF4A 3V1LA 3H8JA 1S8OA 4V38A 4NABA 1CZLA 2RBEA 3M2TA 1M8GA 1R6AA 1W85A 4R1UA 1HT2E 1NVUQ 3HNOA 4BZPA 4DNPA 2AKEA 1N9GA 1BRMA 3C4QA 4DT1B 3OZAA 1RMQA 1T2EA 1U2SA 1HMYA 4ZA2A 3A4MA 5F1KA 2O3JA 1V6SA 2LDXA 2IXFA 4K9PA 1OH8A 1QP7A 4OAQA 2E4YA 1EJ2A 1KJJA 4B87A 2DGDA 2Y99A 4TWIA 4AJPA 3VC3A 2HDWA 2JCGA 1F51E 1M6WA 2XT0A 3FYUC 3O4JA 2PX3A 2XUAA 2FE1A 1JKMA 1PGPA 3AFIA 4XJXA 3SHVA 3GJTA 3JAKA 3GZ4A 3ON5A 1JLLB 4B81A 2P68A 1JXAA 3JD0A 4JI4B 4TRJA 5ITWA 3K5WA 1NE2A 3ZW9A 1OW3B 3QA9A 3U44A 2JEOA 4Z8XA 4IEEA 2D1FA 2CNWD 4C0XA 4A15A 2SKCA 1EBUA 3UCEA 3IEPA 2PL3A 1P7WA 3OCJA 3I73A 5DCLA 1K97A 1ISMA 1E77A 3ESXA 4BMPB 2ZBRA 3KDSE 5A03A 4OHRA 3NO4A 2X0IA 1MMFB 3FPJA 1Q20A 4P35A 5F98A 1XDBA 1MB3A 3MELA 3TK1A 5B1SA 3SK0A 3FOCA 1NU6A 2DLDA 3G2NA 5HKLA 4N5NA 1MW9X 2W0SA 3ORYA 3E27A 4UARA 4BOYA 1ZMBA 3E58A 3M6WA 3I8XA 3I30X 5JDCC 2GYUA 3OKCA 4ZT2A 4CN9A 3DPIA 4UTPA 1DJQA 2ONJA 4G0VA 3K2QA 3K0FA 2BMAA 2JGJA 2X58A 2JK1A 2ZAGA 3OOYA 2HTFA 1V1RB 3CRZA 4Z9BA 1JT9A 2QX8A 3BK7A 3P4XA 5LM3A 4NCHA 2UUPA 4G2NA 3HG7A 2GEUA 2J4DA 3A04A 3MIZA 5A5GA 1X77A 1W2HA 2GXSA 1NUAA 2VH5R 1SKMA 2B6NA 1I7NA 4KV9A 3B5EA 3MTAA 1OXUA 2IGTA 4JFAA 3OM1A 5CT4A 4XGRA 3VR6A 4EZIA 2VWPA 4NZOA 1VKNA 3TEMA 4EFNA 3JRXA 3SF0A 5IHXA 5KNDH 2A3RA 4EI7A 1E1YA 3VDQA 2V98A 2I6XA 3DKVA 1E3DA 4RFLA 5AI8A 4WUVA 4BE4A 2C2OA 1A9RA 3G2HA 1C30B 4UUNA 3TIIA 2YTZA 3ZE7A 2ZIXB 4B0OA 3C98A 2AMVA 3LSTA 1GGEA 3O3NB 2AFIA 3AR3A 4JP8A 1CY1A 1ZU4A 4R2MA 3K1YA 1Z2AA 4WLVA 3ZH2A 4P32A 4NAHA 4PLPA 3D2CA 5AK0A 1IZZA 5KYXA 1U1FA 2O1SA 2ZSDA 5AOBA 2DT5A 1J90A 1G8YA 4M1QA 3QPUA 1JB9A 2BGNA 2W37A 4ZZ2A 1GRRA 1XKTA 1SVNA 2FF7A 1OLXB 2DSNA 5CTJA 3QKRB 1TIBA 1TQ6A 3KZ1E 5JCXA 1KC3A 3LBHA 1UMCB 4IFBA 1E5XA 2P6UA 1K7CA 2G83A 3L07A 2ZXFA 2IRWA 1GAWA 5DBGA 5GONB 5B58C 5JNUA 1OWOA 3OBBA 4Z4CA 3ZD6A 1YRAA 4IHAA 3VPCA 1XQWA 4DBVO 4LZOA 1NRIA 3L8GA 3LF1A 2AXNA 3I0ZA 3N2EA 4QBHA 3IAXA 4M8LA 1EM8A 3B85A 1JFTA 1XYVA 3WYNA 5HM8A 4Y6PA 1JPVA 1TD1A 4NG4A 1C2TA 3HI4A 4RK0A 4NATA 3WKEA 4PZAA 3T3NA 5DOZA 1C0KA 3Q2KA 2OHOA 5KBYA 3AM3A 4ZVKA 1BCRA 2XI4A 3HWRA 1IPFA 3PJEA 4JWKA 5KSZA 1WZEA 3JAWA 1EUZA 1KZ6A 2DJIA 2IHNA 4PR0A 4XIFA 2QW1A 3I2GA 3I6MA 4BJ5A 2FTKE 3VU0A 4AT1A 3MVEA 3HS3A 1LZLA 2X41A 2ZBGA 3BCRA 3TNJA 4PAQA 3FSGA 2B69A 1E6EA 1R7RA 1VG9B 3ESBA 3QI2A 2IH4A 1H3NA 1EWTA 1C7EA 3WGGA 4FYXA 3FTCA 1BDJA 5IULC 1UWLA 1Q95A 1XZIA 3AUSA 2XWBF 3I2YX 2CZGA 3G2KA 5ALDA 3N2GB 1LNSA 3M83A 4LC0A 5AJZA 3ONFA 1A7UA 2QTMA 3MTJA 2Q4RA 3UMGA 1HEYA 4R2LA 4NXNB 5BSMA 4TT8A 4Z53A 1CJBA 4J75A 1WW8A 3GLHB 1EVYA 3W79A 4JR2A 2QRVB 3OEYA 1UM9B 2ZDHA 4OSOA 5J1TB 3WBJA 3VMMA 3OFND 1KJYA 4JSRA 3R3SA 4WZAB 4EDFA 1ECBA 2FPIA 3INTA 1AN9A 1Q50A 1O0CA 4MQLA 1E1CB 2C82A 1A27A 2TMGA 4AJ4A 5AD1A 2WFZA 4F5DA 3BK1A 2YMQA 3QXHA 4B2LA 2MINA 3FI0A 1QORA 5BRNA 4ZAZA 1EAYA 2OQVA 5IT0A 3NEPX 3ZHQA 3ZDZB 2OHJA 5KSPA 2XMPA 2GCIA 2IY9A 3HLTA 3IULA 2ZB4A 4AY4A 3ZWVA 4X45A 1KY3A 5B6JA 4L8YA 2VJQA 2H4XA 2XVMA 4YUAA 3L7OA 1FQJA 4QXOA 4UPDA 4ENVA 1IHDA 4G24A 1LLDA 3L5OA 1L7OA 1P33A 1QG6A 4S12A 1SOAA 2D7CA 4NV3A 5IZCC 2PQ0A 1F0KA 4MW7A 2I62A 4TS3A 1QIDA 3EUFA 4PZYA 3AM4A 3VHRA 3ZYCA 4REOA 4YT5A 3BFVA 2HV9A 1JFFB 3PR2B 3Q15C 1AKTA 4JWTA 4KN9S 1LDBA 1UMBA 4BYGA 3R23A 3NPAA 1AHIA 1BDMA 3UT0A 1JMKC 3QLVA 1DXYA 1J22A 4D3SA 1CEYA 2YJTD 3ND6A 4LRQA 1J00A 3B1KA 3ZDAA 4CM7A 2JW5A 4CEHB 1VJ5A 3NHBA 1Z26A 3G1TA 3C3CA 4J16A 3UAWA 5A5EA 4PNZA 3ABZA 1BKDR 3CLUC 3T7IA 1D2HA 4Z7NB 3PGVA 4R1NA 3EQ2A 2WYHA 1I7PA 3BWBA 4DIMA 1DC5A 2YVQA 3CCCA 4H7DA 1JR4A 5D5HA 2H1SA 1C9JA 1GUFA 4RSMA 5L3RA 4EUNA 3AXTA 2WM9B 2GCNA 2B1JA 1DAOA 3EC2A 2ZT7A 1M5UA 4BN5A 3KAPA 3DEFA 2G63A 4GL4A 4PRZA 4R0VA 3DD1A 4AY3A 4CZ2A 2SICE 1M6EX 3C6YA 4CMKA 2C0PA 3DMTA 3DVAB 3IVCA 3EZ6A 3F5QA 1NLUA 2VVTA 3F6YA 3PLRA 3STVA 3OH8A 4BO2A 2QENA 5M2QA 4YY3B 1YZVA 4DCJA 4YP9A 4DUGD 1EWVA 4EYGA 4MYRA 1RYYA 1PZHA 2WTEA 2Y6VA 1T4CA 5BPHA 3EIHA 3D3WB 1YS9A 2PSHA 4LWQA 4LZWA 4AX4A 3R0VA 1MD9A 1E2FA 4JJ7A 1CQIB 1W36C 3NC1C 4A8JB 1SKYB 3WB2A 4N8SA 3KV3O 1ODFA 3KWJA 4L07A 4M7WA 3RVBA 3T5GA 3R0JA 3ICQB 4EPWA 3O7WA 1NPYA 2QTVA 3R77A 4EJSC 3A05A 3MJDA 2CC2A 4UUQA 3IKTA 2AFHA 3OLCX 3BXOA 4OYYA 4C7VA 4RD6A 4LK3A 3O3MB 1RZUA 1SNYA 2CNBA 2J08A 1II8B 4UOEA 1Q6YA 2AK3A 2VHVA 3KYCA 1P0PA 4I2NA 4LIPD 4MO2A 2IX3A 1HPLA 3DC2A 5ITSA 2X86A 4IDQA 1KP9A 5CAEB 3I1JA 4RKRA 1QRDA 1LD3A 3D8NA 5DJ5A 2C7QA 4GZ3A 2W6MA 4MUGA 3QJYA 4O2LA 4UD6A 5AHRA 1V95A 1CFJA 1M1UA 1JNXX 2I1QA 2YZMA 1ZUHA 3TZEA 4DNXA 3WMWA 4DQKA 4YMUA 4JENA 4ZN6A 2R2GA 5G1NA 4EG1A 4U7WA 5JAIA 1JLHA 5IDWA 1PR0A 1J1ZA 2NSYA 1F4PA 4QLAA 1FXWA 3B3AA 3IEKA 3T9DA 4JBWA 3I01M 2FZGA 4PPNA 3GPDG 4BUJA 3V8PA 4N4AA 3LWBA 4OK6A 3H1GA 4LRYA 1DKMA 3GCWA 4PRYA 1XTTA 2XHEA 1AF7A 1KPIA 4RTOA 4A8PA 4AUMA 2L18A 2Q41A 3SOZA 4Q3AA 1TZCA 1YCDA 1IUPA 4LCBA 3EZ2A 4BP1A 3AB8A 4CF3A 5L3VA 4N7BA 4Q1VA 3RH0A 1J70A 3C16C 1S2MA 5D51S 2JJMA 1ESMA 2C3OA 3JSAA 4NCNA 2H07A 3UK6A 2R7AA 4WN9A 1SBNE 4Z9AA 2WPDD 3RSGA 4JGGA 1H1TA 4EF5A 4X9XA 2ZAMA 3R3VA 1AC5A 3OF2A 1S5PA 2IYZA 3K1AB 3QWIA 2GETA 4TTIA 2X9QA 1PN3A 1W5FA 5TSDA 1Z4QA 5T64A 1QHSA 1IBLB 1T2NA 2BI4A 4F8YA 1RBQA 4RUKA 1A8PA 3FOBA 3OQPA 2ZJ1A 5FOUA 1U2TA 3CC8A 1UKAA 1G3RA 1UPTA 4OJYA 3MMNA 1JIVA 3ZD7A 1GNLA 2PJDA 2AUTA 1X80B 2AN3A 3QFTA 3BH0A 4TTSA 1O8BA 1JDVA 1TQHA 4TTPA 3NBAA 3V7WA 4E4YA 3IA7A 2D13A 3K9HA 5AW9A 1VL5A 3WZMA 2B37A 2JI7A 1YOVB 1O03A 4C88A 4B6FA 2ABWA 4BQPA 1NWHA 2CL5A 5A4DA 2X42A 4N9QA 2XMQA 3KVOA 5T6MA 2AIRA 4KR2A 2XGMA 1OXTA 1MVNA 2ID7A 2DHDA 4MRNA 2B9EA 1J8FA 2P6OA 1KQGA 1K2VN 5U4XA 2GYVA 5AIBA 1PJ2A 1SELA 4V3CA 4CIBA 2Y1GA 5IU6A 1N3IA 1ZRHA 2CLKB 4RD3A 5JXJA 2QW8A 1L7XA 1NNUA 2F9LA 3FAZA 4GP9A 4ASUD 2AG0A 4DHEA 3AVTA 1TCAA 2NPOA 3E7PA 2JD1A 1RQLA 4CPDA 5HPYB 4F38A 4HX9A 4UBJA 3EVCA 3JQ7A 3OFKA 3ZUPA 1PJQA 4JEUA 4L50A 3HU1A 4XB6B 2O2JA 3A2NA 1CUJA 4OQMA 1SCDA 1CK4A 4Q16A 1SD1A 2O8EA 1UDBA 4NPHA 4P31A 4QSHA 4BMZA 1EUCA 1JHRA 2XVZA 3DXXA 3M9XA 3O9MA 4RXTA 5KOYA 4I81A 1KEEA 4UNIA 1M8KA 2VEOA 3G8BA 3HPRA 3U61B 2ZKIA 2WYVA 1DP4A 2GM3A 1ZH2A 5BV7A 1PD0A 4KNWA 5A3SA 4HN4B 2W2PA 4HAYA 5CX1B 5DNVA 3SZ3A 5BWMA 2X0EA 3ESAA 5AQ1A 3EISA 1GA4A 1HDIA 5CX1A 4D8WA 4P58A 4YUXA 4RTRA 4MPDA 4H35A 1Y4DE 3C3PA 3QY0A 1IUOA 4FS3A 4O6VA 4YMIA 2RCYA 4LXIA 1SHTX 1X92A 2JRLA 2PHZA 3FVVA 4CU5A 3GRYA 4BJ3A 3PPXA 4ONEA 4RVUA 4YRKA 2G28A 4RHCA 3PHGA 1NF3A 4M46A 3EEQA 3FKJA 4FN5A 2P2CA 3HSSA 1RU3A 4Z4HA 5FNZA 5JSHA 1DT5A 8ADHA 1BD4A 3A6GA 4ZYZA 1WZ2A 4GR4A 3Q9NA 1M1YB 5H82A 1EFHA 2C77A 3ENKA 4JC4A 1CP2A 4PE5B 5LZ8A 4A8TA 3CR7A 1HDCA 1NI5A 3N6XA 4PX3A 5BVHB 5IN4A 5KYYA 3MGKA 2I91A 1I5RA 3RUDA 3QWAA 4TYQA 2CXNA 1ULBA 1AK2A 1KNQA 1XVAA 2FRDC 2GMWA 2YN4A 3DQPA 3ETHA 4MR7A 4IWXA 3OQIB 4JUIA 4MCAA 5BXYA 2CLMB 1WZUA 1A2OA 2GN4A 1I9GA 3ABIA 3DEJA 3OZWA 4NTZA 4PQEA 4WXMA 3QKUA 4XUEA 3SJBA 2EJCA 1E7WA 1VYHA 1N2SA 2DFNA 2ORED 5J47A 3PXDA 5DWQA 2BCEA 4GMDA 2W6ID 2WIDA 3WWZA 5KNBH 2HADA 3HZHA 5I9MA 4DDTA 2QLBA 1RXCA 4XDYA 3C3KA 4V03A 2I4LA 5AW1A 1NUSA 3T3PB 4HQKA 5KTSA 1OOEA 2BEWA 1GIAA 3KUUA 4PS0A 2FOXA 4DN6A 5EHQA 3THXA 3S44A 1RR6A 1S96A 4H17A 1P2BA 3IJPA 1T91A 3N6RA 1G9TA 2WJAA 4OBWA 4UNSA 5HBGA 3P19A 1X94A 1I14A 1QOPB 1QIJA 1XZKA 2KM1A 2Z2JA 5C18A 5KWEA 4OFXA 3L7CA 3UCFA 1GSHA 3LW7A 1QTIA 1U0BB 4EX6A 4M60A 1BHJA 4AL4A 4MIEA 4R2IA 3R3UA 1EGHA 4IHJF 3NMUF 2JFUA 4MV4A 5E38A 1C0IA 5CNMA 5H9VA 3L4KA 1YL6A 3NP9A 2BPOA 1LW6E 2VDMB 1KRHA 4G56A 3H5LA 3IAHA 4M38A 4ZC1A 3A70A 2VRBA 4JLUA 3VVBA 2MYNA 2RGRA 3NRJA 2CYCA 2VJDA 4LYGA 5A1JA 4FGWA 3I3OA 3RVLA 3U1VA 3R5TA 4R1SA 3WV4A 3N28A 3GFOA 5K2MA 3ZXXA 3ELWA 3FH0A 5MF6A 3PQ2A 5GZ3A 3ZNNA 5AIAA 1DXQA 4CL0A 1D0SA 4HDNA 4DTIA 2WJZB 3CRRA 1RQNA 3IYLW 1U9IA 3DOUA 3NONA 5K99A 1QQ7A 3R4VA 2JAWA 5JD3A 1YR7A 1SWVA 3FZYA 4ZZIA 2FVYA 2HJGA 1ULAA 1OPXA 4EKNB 5IKEA 2C9MA 1JFVA 1Y3FE 3HDQA 2EQ5A 4JA0A 3NM5A 3JX9A 1I5OA 2ZVDA 3VPDA 1N2XA 1APBA 5I01A 3K9FC 1GKLA 1GG5A 3WMEA 2J3EA 1DVRA 2ACVA 3BMCA 3MQ2A 2XRZA 1TADA 4JJAA 3DBLB 3SFTA 2XD9A 4BMDA 1DE0A 5JI3E 2QTNA 1M1NA 2FXVA 1KAQA 2G0NA 3TNLA 2RGYA 3RFVA 2D0IA 3ULKA 4JGBA 2QDXA 4CQMD 3ADBA 4DR3B 1JHVA 3IXMA 3LC7O 1I6WA 2OV6A 1VBKA 4P2GA 1G42A 1W6UA 4HV4A 2V54A 3FRHA 5GZ6A 4YLEA 1R16A 2QVYX 1NXTA 4XGNA 4QQKA 1QKKA 3IELA 3KEQA 4RKYA 3ZDBA 4DA6A 3G9XA 2V59A 5BN5A 4WXHA 1PWEA 2D5BA 2ZRHA 1XHLA 1SBQA 5FA8A 1EAMA 4YAUA 3DTVA 1L4LA 4CV3A 3DCJA 2O8DB 1K7FB 1TMKA 5BSRA 4MTCA 5JCPA 1VPTA 4Q1EA 4RSRA 3VR6D 1U1CA 5AM4A 2Y1KA 2EP5A 4FB4A 4DB4A 4FQ8A 4M76B 3B52X 2A0UA 4WUTA 1KSGA 3U7RA 2CLLB 1VHLA 1XELA 4LRSB 3IUMA 3CW9A 1OF1A 1PFYA 4CT4B 5KO2A 5F5XA 1YA8A 3OCCA 5TQ2B 1OFUX 3KZXA 5H3CA 2ZYDA 3RLFA 3W2IA 1UBJS 4TZ6A 3IUEA 2CZQA 1JN0A 2EHJA 2F1IA 1GR0A 1JIUA 1GOTA 2HF7A 4G84A 4F3CA 2BFDA 2WJ6A 1A7AA 5I7HA 5DNCA 1L4EA 2R8YA 1LB1B 4JQCA 2AN9A 1LI7A 2LBPA 4Q9HA 2DYKA 4FYVA 2JCBA 1QQ6A 3UAGA 1A95A 4BMSA 1K0UA 3H18A 2GPSA 3LYLA 2OXIA 4JK3A 4INJA 3LDFA 4LE2A 3U17A 1BNCA 4DLKA 4UHDA 1WVMA 2EFGA 4B85A 1DC3A 2VHEA 3E9EA 2BFPA 4W5TA 3ETDA 3N5KA 1DTWA 3EIFA 2NU6A 4KVFA 1D9XA 2H59A 2Z5GA 2V9PA 5HZKA 4F3NA 1PR1A 1PDWA 2PAFA 2CL6X 5CT9A 3PDIA 1NVXQ 1QIHA 2WIBA 1V5FA 2C1ZA 2G6BA 1OXVA 4LYYA 4PLCA 4PYRA 1GDTA 2O54A 3UMCA 2I78A 3AFMA 2YMLA 1CWUA 2BEUA 4XFJA 3SS8A 3V4SA 1ZAYA 1F8XA 2PMWB 2R85A 5LOVA 5K3OA 3AVVA 2UVPB 4CW7A 1Z6QA 5KSYA 1MC5A 3H05A 5BNZA 1FVFA 4GW3A 3ZKWA 5HE9A 5EHIA 1FS4A 1R4AA 4CQLA 1GG2A 4KQEA 4M0DA 1F60A 2TRSB 4E22A 2H57A 1O54A 3WBFA 4UDOA 2GLTA 4P86A 4PLWA 1OI4A 2O52A 4XWKA 4D3YA 4D0RA 4MR8B 3V46A 5JATA 4ACAA 1A1VA 1FK8A 3NNDA 3DXFA 5DCYA 1Z6GA 3ZVRA 5K5EA 1ORWA 4DR5B 3BK2A 1IIBA 4JJ6A 1P2TA 1R0SA 2YOFA 2OZEA 4MKZA 3E2IA 3TL6A 4TKVB 1JZQA 1MXHA 2JI9A 3FGOA 3PQCA 4PLTA 1PUJA 3LDUA 2RC5A 4NU6A 4QM7A 2LTAA 3OIGA 3CUVA 4JVLA 3E9QA 2P9HA 3IV6A 3RWMB 2NW6A 4R3NA 1ACMA 4QEKA 4E4RA 4UHKA 4PX5A 4QYIB 2YXDA 2DQYA 1J5EB 4L0DA 1AKUA 2R5WA 5J43A 2CDCA 2H9AA 4O3FA 5EE9A 4M9CA 5FOSA 3OEHA 4N39A 4GPD1 3W4JA 1PFWA 2ADOA 4BWGA 3FNHA 3QLUA 2UVDA 4NJMB 5L8VA 3IEMA 4OP1A 5MHTA 5FBHA 5DYIA 1Q1QA 1IATA 3ZU5A 1GUBA 2I4RA 1SUCA 1T1SA 2FNAA 2Y6UA 3BSWA 1MFZA 3LP5A 4JY7A 4NBTA 4OU4A 3P9SA 3BSSA 4REMA 1T0PA 2J9FB 3HGMA 3AVYA 3JS5A 1NASA 4IHJB 4ZVVA 4BIMA 4DCSA 1YS6A 1ZMRA 3B7WA 1RWXA 3I8OA 3KR1A 3W5JA 1U3FA 4XA8A 1POXA 1VE5A 1W4ZA 3K6KA 4RLFA 1QHFA 3TNYA 3K8QA 3V4LA 4ZMRA 1DHTA 3DC7A 5IJ0B 1KC1A 1Z0IA 2BCGY 2HQBA 4IUYA 5D85A 5GGXA 4YPVA 3H11A 4JVSB 5DLPA 2H1LA 4E09A 5T7BA 1NDUA 5TY0A 1IEWA 4DSUA 1R0ZA 1OUMA 2RARA 5GY7A 3S70A 3AVUA 4RPKA 1QGUB 4N7MA 4PN7A 5C1PA 2YIVX 4ZAFA 1WXQA 2E49A 1I2DA 2ZBPA 1YB6A 1ZFNA 3UAVA 1MLDA 3QEMA 2ORVA 2QQEA 4UXIA 5FEMA 4CODB 3TTSA 3D81A 4C0LA 3ED5A 1PLLA 5KNLA 4DDKA 2OCPA 3SXUB 4K9SA 1T3LA 4R4JA 3JYNA 1W49A 4IYJA 2FPMA 1HDXA 3HRIA 4M88A 4RESA 4JI5B 4CI9A 3F7TA 3UJPA 1Y6QA 4LTNA 4M1MA 1ZXLA 1UXOA 3ZD8A 2B98A 2YRWA 3B82A 3W8NA 2GNAA 1U7XA 5KSWB 1WSAA 3O9VA 4HRXA 1MH9A 2WOOA 2G06A 3SN6A 3PPVA 4EYQA 2DQZA 3SX2A 4B3TB 1R8XA 2YW2A 4WZZA 1QAOA 4X20A 4YT4A 3KTAB 3V4RA 2RGWA 3NTXA 1XX6A 3QOXA 1SO8A 1PJTA 3DMDA 3JR3A 4GX2A 3VI4B 2CXUA 1V8PA 2R6R1 1OAOA 3NORA 1FYWA 3FVQA 4A16A 3ZHRA 4LSGA 2IS1A 1TM4E 3LQ1A 2HBQA 1ZKDA 1B6RA 3P9NA 4L5JA 2J46A 4RQTA 3FCAA 5HBRA 3UXMA 1U65A 4A5SA 1QIIA 3FPEA 1P45A 1N4DA 2VPYA 3QBDA 5K0GA 2JJ2A 4B48A 1BQEA 3W5DA 1PIWA 3LL4A 1KZGB 1Z0ZA 3QVGB 5BT9A 2YY6A 3ZHXA 1QGED 2A0FA 2GCGA 2WOJA 4JYCA 3K09A 3CLTC 5E4JA 4NMLA 3RIHA 5DM60 1GD1O 1BS9A 2C4WA 2OYRA 1U0HC 1W35A 1YXMA 2P6PA 3LV8A 4OHMA 1CX9B 3TZ6A 2JH9A 4BQEA 2W4MA 2YWBA 4QOGA 3HA2A 1GNVA 3CUSA 1X86B 4GFDA 3RSZA 2B3DA 3QLTA 5TR9A 2XX3A 5CUQA 1L7VC 1P9RA 3IBSA 4WN3A 3UK1A 1N2CA 1Y8CA 2NTJA 4MPPA 2WQ6A 3RC3A 2CVHA 3LT0A 2WWTA 4AYXA 1VZ2A 3MBIA 5B64A 2XNKA 3ZI7A 4HL6A 3DEAA 4HVTA 2B1RA 2XRFA 4WZBE 1Z2PX 5GADl 1TJ3A 3STXA 2EWVA 3EAGA 1THZA 2FMFA 3JQFA 2O4CA 1V3QE 2YQ5A 5CT8A 4ZVUA 4HN2A 5IHPA 1NQ5A 4PAWA 4YASA 4GNRA 3ZE0B 5G1PA 4DSAA 2CXSA 3HL4A 3E48A 2X6QA 2XGJA 2C58A 3FCCA 1GL3A 1JG2A 2AB0A 2NV2B 1DKUA 1N2HA 3HVKA 3F6SA 5TMPA 1K92A 3LP8A 3LQ4A 1K0FA 4G1EB 1F06A 3TQHA 3UH1A 4GRDA 6Q21A 1C81A 3RSOA 4Q3NA 2X8LA 2E6UX 2YJ4A 2BLNA 1NOKA 3LE8A 5GWXA 5HIJA 4CMIB 1U7PA 1SCUB 2DFPA 5AI9A 4AWXA 5K3EA 3HY4A 3RVQA 5JFGA 4LHWA 4GPAA 4P4TA 5ARDA 4Z51A 5IF9A 1ORTA 3V2UA 4MKXA 4LQDA 1RS0A 4UEWA 3TZQA 1E5DA 2X8AA 2EDAA 1AUPA 2ATEA 4RVCA 1E3IA 2W11A 3DA8A 1TCUA 3UQYS 1FF9A 1XNQB 3JZAA 1PFGA 4IOLA 4ZGGA 2PZKA 3JVEA 1CJUC 2R1UA 3FPSA 3LQRA 1P19A 1L5VA 1U7UA 2IKQA 3CKMA 5EESA 3RREA 5J2UF 3ZVKA 1CUFA 5TGDA 4MAAA 3WWDA 4ZK6A 1ZVVA 3X43A 2RHBA 1WDWB 3G1UA 1GTVA 1XA3A 3B70A 3U6KA 2G07A 1T4GA 5LB4A 1IXYA 1XTZA 3K9NA 2WFLB 4CFYA 4E30A 4KKXB 2WKQA 1FMJA 4D4GA 3RODA 4RA6A 2M2IA 1HUQA 2XJ9A 4V0OA 5J5VA 1E94E 3ILYA 2ZEJA 3VHXB 5A4FS 2PMBA 3GGSA 4J94A 2EWWA 4LC9A 3FPLA 4XVHA 2Z9BA 2R25B 2EEZA 3EOZA 2VOEA 3FKSA 3KKKA 3REGA 4LMRA 2UYCA 1XPRA 4K03A 1TT5B 4LHVA 3BJRA 1GY8A 2MIIA 4YJHB 2BDUA 4WNIA 1JP7A 1SBTA 2GHQA