1DAEA

Dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
219
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daeA00
3ZD7A 5KSZA 1D5CA 1XWIA 4XTRA 4BFXA 1II8B 3ICEA 1P60A 4ACBA 1U8ZA 3GJ3A 1Z47A 4R7ZA 1P73A 2ZPTX 3I61A 2C04A 2OILA 5H1YA 1JQJC 1YU9A 2WWIA 1DARA 1OFIA 2B8TA 3M0EA 4LYAA 4QC2A 3R9IA 1KI1A 1WCV1 3BXZA 2GJ9A 2CLDX 4UNSA 4I1OA 3V9PA 2J45A 4KVGA 4Q4HB 1FUKA 5CK5A 2O8BA 1OFTA 2IYRA 621PA 1I2DA 1RPZA 4WBSA 2L0XA 4LJ4A 3IEUA 3S1AA 3WBKA 3VAAA 1B23P 1XPUA 1E98A 5CB8A 2N42A 3C14C 1SVWA 4DLVA 2ZXUA 4JLKA 3P32A 4C7OB 2V7QD 1D9ZA 4YMVA 1ODFA 3G0HA 3AV0B 3HWSA 1FX0A 2QSYA 2QAGA 2RGBA 3K8YA 4KV9A 1V5WA 3HYTA 1R7RA 1XEWX 1Z2AA 2QRNA 1KKMA 1GDDA 4DCNA 3P20A 4M9XA 4AD8A 2JLWA 3QF4A 2W6JA 4B2LA 1YZQA 1QZXA 4ZDKA 3CRQA 5GVSA 2XEXA 3THWA 3AKYA 1UJ2A 3CNOA 3I1FA 2WZQA 3PG5A 1NLFA 4C0HA 4PHTA 1XBTA 5JSZB 1OFHA 3GQBA 1OXXK 3TSZA 1Z63A 3IHLA 4CRWB 1ZM2A 1LW7A 1TL7C 1N6LA 1CR4A 2FFBA 1ZD9A 5FTJA 5KDDA 4B76A 1J90A 4Q7KA 4XTCS 4L5BA 2CHGA 3W3ZB 3RNLA 4F38A 2O8FB 5EE0A 4DLXA 5AUOB 4IHQA 1UADA 2J59A 1N5JA 4M9QA 2Z5FA 3BB4A 4AURA 1T0HB 2BIFA 4NCNA 1OIXA 3A1TA 4FCTA 3SJCA 3VMFA 3PJRA 4D82A 1AQUA 1UKEA 4MITA 5LDDC 1E2DA 1E99A 2FDCA 1T8TA 3K0FA 5C18A 1W49A 2ANBA 1QHYA 3PCRB 5EXTA 2ZYWX 2VF8A 3FKSA 3W34A 4HAVA 3TLXA 1GVNB 1YZGA 5JJIA 3I5YA 3C4JA 4M8NE 1M74A 2J7KA 1EX7A 1Y63A 1Q22A 4I1SA 5FOTA 2ZI6A 1HQYE 2ZITA 3VFDA 3BH0A 2ONKA 4E5UA 2VSFA 2I1VB 4MRRA 1ZUHA 2OSBA 5JRJA 3MJHA 1OV4A 1KKLA 4L8GA 1O3YA 3VHLB 4EAQA 3MWLA 5HKKA 2CEAA 4Q9IA 3RSLA 1ZM4A 2QORA 4YMUA 1AQYA 4C0AC 1IBRA 1S4QA 1HH4A 4HZUA 3U7EB 3KXKA 2ZS9A 4Q19A 4XWKA 4EFLA 1Q1ZA 3O8CA 3EASA 2W00A 4OK6A 1NRJB 2OLKA 1KAOA 2G1JA 1OH6A 1KI2A 2QI9C 1E9CA 5EE5B 2HT6A 5EP1A 1N6OA 3DEFA 1P9NA 4A9AA 1E2IA 4TQAA 3DVLA 1GM5A 2OFWA 1BH2A 2QL6A 3A36A 3IKJA 4PQYA 1II0A 3B1WA 3TAUA 2XNSA 4CW7A 4BLTA 2AK2A 1AZSC 1Z6GA 2OEPA 3MCAA 1JXOA 4XIGS 3WNCA 2XXAA 5JHHB 1ZUIA 4OI1A 3X1ZA 4KVAA 4QG7A 4ON9A 1UKVY 2QPTA 4A2QA 5AJWA 2ZE5A 5LPNA 4M9ZA 4CGZA 2DY1A 4TLEA 3IBYA 3QKUA 4JLNA 1KDOA 5JEDA 1NKSA 2AWOA 5BYJA 4M2LA 1T6NA 4JT4A 4JZKA 3PUZA 1IXZA 3IUYA 5TY0A 4V0LA 2GXQA 1XTSA 5TARA 1X1SA 2R8RA 2C96A 5CK4A 2YV5A 4PPGA 1NSFA 3TE6A 3HP1A 4ZCLA 1GKUB 3WRYC 2W6JD 3AF0A 1W5SA 2XSZA 4DDUA 2QE7D 3RWOA 3NWJA 4PXAA 3BORA 3PEVA 4LC1A 1O87A 4JT2A 4CEIB 1TUEA 4HB2A 1S0UA 4E22A 1E2PA 4ASUD 4QFMA 1A1VA 2HV8A 2FF7A 2IYZA 3CNNA 3F0TA 1LS6A 4QNRA 5JCPA 1UAAA 3SBEA 4GBMA 3ZS9A 5BWMA 1GITA 2GVZC 4C7OA 3WYAA 1BO6A 2Q9BA 4TQUS 3SJBA 4W5WA 2R6AA 3QKSB 5CDFA 3V4RA 3K9LA 2ZREA 4QGHA 1SVSA 2RGNA 4W5JA 1IY1A 2MSCB 3QKRB 1VG0B 1AN0A 3IO3A 4DBLC 4D4LA 1UBGA 4OQLA 3GLFE 2BVNA 3DHWC 4PPQA 3BFKA 1E1RD 3W90A 1UKYA 4NTZA 2R6CA 2ZI7A 1QF9A 1QHHB 1VCNA 2WKPA 1KSFX 2OAQ1 5JSZA 3FFBA 3FKQA 1G64A 4BZPA 2OCPA 1G6OA 1W2HA 1KI7A 1N6IA 2H1LA 3IO5A 3RANA 3KB1A 4JLJA 3FKSD 1G291 2ZI9A 3L2OB 4F4IA 3SQXA 3WY9A 1II9A 2HEIA 2JEOA 2JAQA 3MWKA 3QVUA 2F1RA 2PEYA 1KMHB 1XMSA 3N5CA 2O8FA 5AR1A 4A4DA 2KI5A 1RYFA 2BDTA 4PQRA 4Q1FA 4C9BA 4ZI2A 1NVVR 1G17A 2LCFA 2AWNA 4IEIA 2XTMA 1XD8A 4I1UA 3UXMA 4QBFA 1E0AA 2B7BA 3KB2A 5HKKD 3LXRA 3Q5EA 4DEXA 3A58B 4A8JB 2VLIA 1P62B 1R5NA 3EG5A 1W4RA 3BGWA 4GZLA 4E09A 2YKGA 1XB2A 1Z3IX 3SYLA 3L0PA 3B9QA 4BGDA 3AVTA 1K6MA 1CIPA 3RDPA 1FP6A 2EWVA 3C7KA 4TSFD 4ZPXA 3ICQB 2YVUA 1LF0A 4B3XA 3CNLA 4YMSA 3VU9B 4OQNA 3TJZA 1XTRA 3GJ4A 2AD5A 5HE9A 4OQMA 3REGA 3CH4B 3T5GA 2BMEA 1ZC4A 4AYTA 3A1WA 3RS3A 1ANKA 4K8OA 5B58C 3I72A 4DLZA 1W2GA 3B85A 5TMPA 2BCJQ 1IJFA 2D74A 4QKQA 1COWA 4L9SA 3R7WB 3CX7A 1F2TB 1KSGA 2KE5A 4R2HA 4RD2A 2XZLA 4ZI3A 2P6RA 3G5UA 2ZUDA 2CL0X 3CZPA 4UNQA 1IN4A 3FPAA 3W5JA 3GLIE 3IPXA 2H7VA 5KDLA 2ONJA 4G01B 3CPHA 2NMVA 1OHHD 2VRWA 4IJMA 1LTQA 2YC4C 4D81A 4JLMA 3NHBA 4IOJA 4HUTA 2P0EA 2A5JA 2O8DB 1AGPA 1CEEA 3DPUA 1JPJA 3NG1A 2VBCA 4A0FA 2P6NA 2J5XA 1XXHE 1E94E 2XSZD 5FBLB 4JIMA 2R6GA 3JZMA 4ILEA 1YZKA 4YXWD 1MRNA 4US0R 2HF8A 2NO9A 2RKOA 1E4YA 3GJ6A 1N5KA 5F98A 2PCJA 1RRFA 3TIFA 2YOGA 2ZAOA 1Q1QA 2R44A 2ODEA 4OHVA 2CK3D 2YNMA 1CLUA 2IXEA 2LWIA 4KFSA 4KLZA 2ODNA 4II7A 1F60A 4QGAA 1G7CA 3KKQA 2FGJA 4JSYA 4MH0R 5ELXA 3VNVA 3I4LA 4HUQB 4OI4A 1IQPA 3QPVA 3GFOA 1P2UA 2PL3A 4QNMA 1TTTA 3DZ8A 2NZ8A 4IXMA 5HTKA 3ZZ0A 2EYUA 2HJGA 4KSBA 1D2NA 2BJWA 1I4DD 1VG9B 2A5DA 4MYCA 4TLCA 1G19A 2AHOA 1SXJA 3GJ7A 4Q1CA 4IOMA 3BC1A 3U4QA 5F9HA 1E9AA 2AK3A 4DSUA 4GOJA 2FSIA 2QMUA 1P61B 3V00A 3QKRA 3OFND 2QM7A 4D4JA 4DSTA 3ZVRA 4EPRA 2OXRA 3AVWA 1HY3A 1KK2A 3LV8A 2RHDA 2ZQ5A 2D7CA 1VHTA 5C2JB 1H8HA 1QHHA 3GCGA 3BAFA 3SYKA 5HCIA 2QQEA 1PJRA 1E2JA 2AN9A 3U44B 2FSGA 1R0XA 2QAGC 3TSOA 2JATA 1A7JA 5BW8A 4TN1A 3RC3A 2GZDA 3KX2A 3TR5A 3QEOA 4RY2A 2VPPA 4B3GA 3SJAA 4EPWA 2VP4A 1F3OA 1XEXB 1NP6A 2X19A 4IVQA 5BN5A 3AB3A 3EAQA 1D8TA 3SS8A 4GRAA 4CEHA 3AVXA 1KMHA 3CBQA 2IL1A 4V0MA 1NMZA 4M4SA 3SZRA 1I4TD 1LFDB 4PX9A 4AG5A 5FL7A 4LSGA 1E2EA 3WMEA 2XJ4A 1YRAA 1G16A 2JLXA 4DWJA 2YHSA 1Z8FA 4JL8A 2VP5A 1BMFA 4L9WA 1ZCAA 1COWD 1T3HA 3O8BA 4QRHA 5DE3A 4F91B 3IDQA 1U94A 8OHMA 5G40A 2IX3A 4CEJB 4J0QA 2IHYA 4URWR 3VU9A 2VHCA 1R5OA 5BQ5A 3KFVA 4WOPA 2NPFA 1NMXA 2DBYA 1P72A 4KYIB 3L82B 2VHQA 1KI6A 2D7DA 2P65A 1IAQA 2J46A 2QT1A 5DNYB 2QBYB 1F6BA 4YQFA 3QXCA 2DFNA 1SQ5A 2GEVA 3ASYA 3IHWA 3LD9A 1Z0FA 4DLTA 6Q21A 4DVGA 1OH8A 2A5GA 3UMFA 4V02A 1EFTA 3R7WA 2HUPA 4DCTA 1F2TA 1HA3A 2ZJ5A 4JBYA 4B71A 2ZJBA 5JWHA 2RGAA 2JDID 3THYA 1WDTA 1IY2A 2J0QA 4QJ5A 3V4FA 4POAA 1DTSA 2WJGA 2ZE7A 3K0SA 2ZRJA 1AS2A 4KBGA 1S3GA 4MYUA 5K8TA 4AI6A 3BIFA 3GLIB 1IN6A 5SZIA 5KTYA 1C1YA 4GMDA 2Z6VA 1ZW6A 3BB1A 2O8DA 2G9NA 1W4BA 4KCGA 1QHSA 3CH5A 1W36B 3O8DA 1KO1A 4DB4A 1FTSA 1OE0A 4WXRA 1ELOA 1XRJA 1SVIA 5KDOA 1N5IA 2RGEA 4UNNA 5EE3A 1GP2A 2CJWB 3UATA 3QF7A 3DM9B 2OZEA 4BE7B 4LHYA 1XXHB 2FGKA 2OXCA 2VHUA 4FMDF 4EKDA 1C4OA 4M1SA 3CRVA 5EP2A 2VP2A 2WSMA 2QA5A 4HEJA 5BN4A 2J0VA 3AGPA 3Q72A 2JIZA 2ZRLA 3AUXA 5FR1A 3NDBB 1ZRHA 4KBFA 4LBYA 3B5JA 1SXJD 4K46A 1U0HC 1KO8A 1Q20A 1XJ0A 3OIUA 4OJQA 1SKQA 5EE9A 3QXXA 4IDNA 2WAYA 2R62A 3B7GA 3UG6A 2F1JA 3L0OA 4HUQA 1E9EA 3CWQA 1H8HD 4LJ9A 3E1SA 2F7SA 2LKCA 4M1WA 4TTQA 3TMKA 4C0KA 4PPNA 5ANRB 1VG1A 4M21A 2OBMA 5A4JA 4IDQA 2I1QA 2GDJA 2ZYTX 3H0KA 5HZHA 5AUNB 1DOAA 2ZRGA 1XCMA 4YC7A 4HYYA 2F6RA 2WV9A 3IGFA 1RW4A 1T9HA 2OUKA 2UVQA 2ZSEA 4NL4H 1G20E 2IUSA 3JVVA 1LF5A 2I4IA 5DISB 3QVVA 5FI0B 3PEYA 3NH9A 1E9SA 1NJFA 1Z6AA 1KDTA 1YJ5A 2CVFA 4D26A 2QP3A 2H57A 1OIWA 5FL7D 3EW9A 2D2FA 2W2VA 5DI3A 5FTLA 1LS1A 1N5LA 5HZKA 4URZR 1OJLA 2PEZA 4H9GA 1BMFD 3P27A 2KBEA 2CMKA 4BZXA 2ZI5A 3RVBA 2RGNC 1R0ZA 2FEOA 4ERNA 5G3ZA 1E2LA 1XEXA 3CLVA 2O5VA 2GNOA 4NDZA 4AWXA 2IEYA 3T1TA 1KJZA 4Q4LA 2WWHA 2ZANA 5CIWA 1EWRA 3IIMA 2GEUA 4MUBA 4YLGA 3M6AA 2JLUA 1W48A 4US1R 4NYMQ 2ZRIA 4RSGA 1W46A 2IS1A 3UMRA 4Y0VA 3QPUA 2N1BA 1W1WA 5KSYA 1DAHA 2XGJA 3WMFA 4CDGA 4BFSA 3LNCA 3RS5A 1OIVA 3AQ4A 3BH6A 3BERA 3CPJB 4M0LA 2FZ4A 3EARA 2C5LA 4RZ2A 4TTPA 5EJEA 1M7HA 1HE1C 2ZR0A 3NC1C 3CR7A 2FFHA 4CEJA 3LO5A 2PJZA 1KSHA 2QPAA 3LBHA 3THOA 2W0MA 2V3CC 4JBXA 3ADBA 3EWSA 4OHXA 2H17A 1EFHA 1VDZA 3CF6R 2PT5A 2WWWA 4KODA 5DH9A 3FGNA 1P2SA 1ZM9A 4W9MC 1ZINA 1S96A 1R0WA 3DMNA 2ZR7A 2G3YA 4D80A 4P4TA 1EGAA 2QY9A 4X8LA 2WPDA 2OCAA 1ZU4A 3WP0A 2VSOA 4PAQA 3QENA 3U5ZB 2BCGY 3AVUA 1VPLA 1JJVA 3AF3A 3DZDA 3Q7PA 1GL7A 4DDTA 3IBGA 1M34E 4D0GA 4LBVA 5C1BA 1Q57A 3EPLA 2JIZD 5F3WB 1KJWA 2B6HA 4ESHA 1Z06A 4HZUB 2F9MA 1E0JA 2RCNA 4MKHA 1RVDA 1RZ3A 2GESA 3O47A 3VHXA 2QPOA 3CRW1 4TZ0A 1L4YA 4LWZA 2G0TA 2JA1A 4ZCMA 3EIQA 1XTIA 1DEKA 2CJWA 1CRQA 3LY5A 5IHPA 3H86A 1K8RA 3W6PA 1P9RA 4FCWA 2A78A 4JLPA 2ZTSA 3PFIA 2CLSA 2EFEB 3NEYA 2ZS8A 3F8TA 4D4MA 1XD9A 1NIPA 1XEFA 3I8XA 1ZD1A 3OF5A 1IN8A 1Z0JA 4K81B 4MQBA 2FV8A 1EG7A 4URYR 1NY6A 3WMGA 4RFSB 3KUCA 3BD9A 4LJ7A 1OYWA 3CX6A 1MABB 1S8FA 3K1JA 4S35A 4AK9A 4P4SB 5FPSA 4W7SA 2WVJA 4XSHA 4M1OA 4QM7A 4Q7MB 4XVRA 4D4KA 4NU0A 2CLCX 4G3XA 4JVLA 1L8QA 4OHZA 4GOXA 2NPIA 4QOSA 3MJRA 4PZYA 5E95A 1EFRA 5JJKA 5AUQA 1KO4A 2AL7A 4B43A 3AH8A 3TH5A 4DLRA 3ADCA 4Q7JB 1CJUC 5C4MA 3KQKA 4LC0A 4C0SA 4URVR 3CX8A 2GHIA 5EUMA 2FSHA 4DJTA 1XP8A 2YJTD 2ZI3A 1CTQA 4FMDB 1ZM7A 821PA 4DB2A 4C30A 1XTKA 1J7KA 5J4LA 1KI8A 4LYHA 521PA 1DAEA 3EZFA 4R71A 5CLLA 4Q00A 4IXNA 1SXJE 1ZM3A 3O8RA 1P9WA 2V8OA 1ESMA 1HQCA 4LPSA 4LY6A 4TL6A 1G18A 5DGXA 1OT3A 1UEJA 3W8RA 1T8UA 5JZVA 4G5RA 3UMSA 2QBYA 5HE8A 4BLSA 5CJ2A 2BKEA 2OBLA 3NBYC 2IWHA 1EWQA 2HDNB 3MUFA 5K8IA 4D25A 2QE7A 4MA4A 1X8KA 1JR3E 3ZJYA 4EPYA 2KBFA 5JBQA 4ASUA 2R6DA 4H1VA 2FE4A 2WJHA 4HDQB 1JJ7A 4BRUA 3OAAA 4JLOA 4M1YA 3CW2A 2ZSAA 1HT2E 3BH7A 3GP8A 1OXSC 2ERXA 1P2TA 4GP7A 3R9WA 3K0CA 3PEWA 4OI2A 4JVMA 3Q85A 1DAGA 3NTUA 5KSOA 4JMPA 4QJ3A 4NZYA 4V0ME 1JR6A 2WJVA 1KJYA 4MRVA 2AFHE 4ZO4A 3WHKA 4PAMA 3OIYA 4MKGA 2WPDD 2F1HA 421PA 4Q7LA 1E1RA 4DIDA 1WB9A 2W83A 3ZLJA 4MDEA 4WZ6A 3UWOA 4JLVA 4Z8YA 2ZJZA 2DFKB 3G82C 1DO2A 3U3OA 5FTKA 1F48A 1N25A 3RS2A 4C2UA 4EFMA 2A7QA 2C9YA 2X2FA 1X86B 3CZQA 1P2VA 1UKZA 1Z07A 1W4AA 3FHCB 4KI0A 4RD4A 3QXJA 1N6HA 4AKIA 5F2EA 2YWEA 1RE0A 3KZ1E 4A8JC 4PO9A 4CT5A 3HR8A 1Y3AA 1W36D 2IS6A 3PXGA 4RZXA 3B6EA 3VR1A 1KNQA 4AY2A 3ZH9B 1YR8A 2ZSFA 4UNRA 2UZ3A 4NYIR 4DC9A 3KUDA 3KJEA 1XX6A 1T5IA 2CCKA 2PZFA 4GI7A 1LY1A 1S9DA 3EXAA 2HJVA 3VR6A 2O8CB 4BQSA 1X3SA 2QZ4A 2WWYA 1QG2A 1NL3A 3AEZA 3NBXX 5JRZA 4RCYA 1GAJA 1ZJ6A 4ZV4A 4M1KA 4QBIA 1CKEA 2QMOA 3LRPA 4QHSA 2CNWD 4TSFA 3CWZA 3W8NA 2IYYA 1KZ7B 4QL3A 2IS4A 1XZQA 1ZIPA 5FBVB 3A37A 3GJXC 1B0UA 1FPMA 1UEIA 1KY2A 2C8VA 2Z4SA 4PSKA 1WBDA 1TQ2A 1JXMA 1ZAKA 4KFRA 1EFRD 1S3SA 4XH9B 2RGXA 1T3LA 1ZBDA 4Q1DA 1CU1A 1TX4B 1EFUA 1N3BA 4RFSA 5IK2A 1ETUA 3B2EA 2E87A 5TVKA 4KFUA 4R9UC 5FOSA 2GETA 1MABA 4EFNA 2Q3MA 4P4SA 1G3QA 4JLAA 5DIFA 5A5GA 2CDNA 2GF9A 2IW3A 2BBTA 3BWDD 1OHHA 4LHWA 4A15A 4TYNA 1OSNA 3KJGA 2ORIA 3NKVA 4LJ5A 4TL9A 1G8PA 2NO0A 1G4AE 5HR5A 4DT1B 4KYUA 2Y8EA 3GMTA 4XWOA 2HCJB 3LX8A 4C0BA 3KTAA 1P3JA 2EFGA 4GMXA 4KJZA 4PSVA 4A1FA 4AG6A 5AUPB 3MWJA 2REBA 4HB3A 2BEKA 4YXWA 4X8HA 2QTVB 3C41J 2OV2A 2ZSDA 5FOXA 2G6BA 5AJZA 3AVPA 1LVGA 3GJ0A 3OAAD 3P1JA 5DN6A 3FMOB 5GJVC 3ZS8A 5J4YA 2VQSA 3SEAA 1TQ6A 5JLJA 2Z43A 3PITA 1GWNA 3U4QB 1SXJB 1U9IA 1VIAA 2CK3A 4HATA 4TYWA 1QDEA 4LV8B 3AF2A 4BECA 2IA5A 1KMQA 1RRGA 4R2IA 3U7FB 3PUWA 3DKPA 1OXUA 1UBCA 4BLOA 2W58A 1PVOA 4F4CA 2KSQA 4DLUA 2OCBA 4FXPA 2GAOA 2CHVA 1JEEA 3RRMA 1ZNZA 3QE0A 3REFA 4LHXA 1N0UA 2IUTA 3DOEA 5KSPA 4B75A 1Z83A 2GJ8A 5JI2E 3KQLA 2IXGA 1FNMA 3LQQA 1KYIA 1W47A 3OFNA 5A0FA 4CEHB 1LNZA 3SNHA 3TSWA 3SQWA 2FFQA 2IYXA 3TKLA 3CR8A 3OE7D 3K09A 2GBLA 5BN3A 3K53A 1AKYA 3LWNA 3QBVA 4AKGA 4NE2A 5LB4A 1TU3A 4JLDA 4P4UA 4PSAA 2J7PA 4LV5B 3AF4A 4QJ4A 4HAYA 2A30A 2MMCA 2JJ2A 2R65A 4P0TA 2G77B 1CJVC 1AKEA 1NVUQ 1OKKA 5CJPA 2C9OA 4A92A 1MT0A 1YZNA 4MYTA 3OEHD 4PO8A 5CM9C 2RH5A 4LX0A 4R98A 1NIJA 3FMFA 4O2RA 1GOTA 1OB5A 1Z08A 4HAZA 4HLUA 5SZJA 3SJZA 1KI6B 4ZIRA 3KQUA 1WMSA 3SOPA 2O8CA 2PT7A 1X6VA 2XB2A 3F5FA 1NLZA 3CONA 3JVUA 4YMTA 2V1XA 3EIHA 2QMHA 5EZ5A 1GTVA 4UXJA 3A1SA 4V0OA 5IK2D 1PLJA 4EQ6B 3THYB 3DOFA 3UIEA 1NG1A 2Z4RA 1IXSB 1HUQA 4Q9LA 3EWAA 1CR1A 1E4VA 1VCOA 4Q9HA 4EPTA 4CIDA 2JASA 2ZAMA 5KPDA 3LW8A 1X1RA 5D3MA 4C0LA 2BMJA 1CULC 3T06B 4BFYA 3W9YA 3NIBA 1VYUA 1Q3HA 4IFBA 4MYHA 3Q3JB 4LRWA 1X8LA 2ZRFA 3RSOA 1N2CE 1GSIA 2CCGA 2PH1A 4JLBA 4DLYA 3T1VA 1L4UA 1L2TA 1W36C 2JDIA 1G41A 3A4NA 4TMWA 1N6RA 2FPKA 4NHOA 4ACAA 4WA7A 1G8GA 1QHNA 4ARZA 4WXPA 1TUIA 4C2TA 5DN6D 4G5GA 1E2GA 3W6OA 3C5HA 3VR2A 1JALA 2AX4A 1IM2A 3U3KA 4JJZA 4X8OA 4I1VA 3H1TA 4Q02A 3KQNA 2YOHA 3CF0A 3HU3A 3FYHA 4FCVA 4LYFA 4DT1A 1XCGB 4F4JA 3FOZA 1CR0A 2EW1A 2QG6A 2ZSBA 3CUEF 2XTNA 3GLHE 2GJAA 3RRZA 1MO5A 2ZJOA 5FOVA 3UK6A 1KAGA 2IK8A 2NGRA 1XJQA 4FINA 4G1UC 5K8UA 4UQOA 3LFUA 2ZRNA 3BE4A 1OYYA 3TK1A 2JLSA 4N1AA 5SZHB 1VHLA 2P5TB 1XPOA 1R5BA 3TRFA 5KNDA 3KKNA 4GPTA 4PHHA 5FUWA 2C78A 1E2KA 4P31A 2HXYA 4EIWA 4UNPA 4DCSA 1N0VC 1T91A 5FBWB 2PX3A 4S2EA 3THXA 2BBWA 1RRCA 4IW3B 1Z2CA 3TBKA 2XJ9A 3EIEA 1TAGA 4KXFB 1CJKC 4NYJQ 4YDSA 1JR3A 4DCVA 3U7HB 1ZD8A 2VHTA 5DI3B 1E9RA 5H70A 1G9XA 2JLQA 4OYHA 4RKFA 1U81A 2J7PD 3U6KA 4ZCIA 4IVRA 3QXHA 3RS4A 3T35A 2QP4A 3VR5A 3VNUA 3HU1A 4RKEA 2JJ2D 3EZ2A 4LGMA 2BEJA 4PZLA 3K70B 1OKKD 3PENA 1D6JA 2XZPA 4RD0A 1BIFA 1JAHA 2WKRA 4KHZA 3R8CA 4B73A 2IEZA 2QAJA 1FFHA 3F3YA 2V6IA 2F3TA 3LBNA 2CE2X 3VX3A 1L7VC 1OFUX 3BJIC 3U2QA 1Q1EA 4H1UA 3QNUA 5CITA 1HURA 4LHVA 3TQFA 1Z0DA 3CKLA 3AP1A 2PZEA 4BZQA 5GJBA 3CRMA 4M1TA 1ZMXA 2C2HA 3SI7A 5SZKB 1MRSA 2W6IA 2VA8A 4P33A 4UKDA 4FMBB 2JLRA 4B35A 2EYQA 1XU4A 5JHGB 2KJQA 1E9BA 4JVNA 2GJKA 1NBMA 2EVWX 3VTKA 1KZGB 2AKYA 2O0HA 2O0KA 4Y0AA 3E2IA 5DYGA 1Z29A 4A2WA 4ZDJA 4QGFA 4A82A 2F55A 4PC3A 2H16A 2H8KA 3QG5A 1VMAA 3L0IB 4O25A 2XNDD 4DSOA 1YE8A 4TMKA 4WZBE 3SHFA 1PLKA 3U60B 1FZQA 1GZSA 4EQ6A 1OXVA 1KDPA 2Q3FA 4EJSB 1XZPA 2IXFA 2ORVA 1IY0A 1E1QA 1KY3A 2ZJ2A 3N70A 2YWFA 4HB0A 4LHZA 4EPVA 4OK5A 4WVFA 3U3RA 4ZKEA 4RD1A 4TMZA 5IDVA 1YKSA 4B32A 4DLSA 1WF3A 3MG9A 2GA8A 1GIAA 1GRNA 1I2MA 3OZXA 5L3VA 1KO5A 2FZLA 1DAIA 1CJMA 1KNXA 2D06A 2XITA 1E2FA 3GFTA 4JS0A 4IDPA 4XSGA 4LUCA 2ZJ8A 3L8ZA 1W0KA 3A8TA 2QENA 4IEEA 1DAKA 3RRYA 3ZVNA 3H84A 3TGPA 4QHYA 3NXSA 1OW3B 2UZIR 3X2SA 1VCMA 4EDHA 3QPWA 2A2ZA 1E9DA 4V03A 3VR3A 2RGGA 3ZQ6A 1D2MA 2FG5A 2WMOB 4C0JA 4IDOA 5CIQA 1Z6TA 3OIWA 1RFLA 1NG9A 4LJYA 4DSNA 5BYKA 2Z83A 3ETLA 1XF9A 4L4UA 3WP1B 2V1UA 1G5PA 1GG2A 3WNDA 3I8SA 1XD2A 3SBDA 1HYQA 4QXAA 1W7AA 5E3HA 4EPXA 1W4CA 2H92A 4Q4AA 5P21A 1EX6A 3GLHB 2GZHA 1JR3D 3X1DA 2CCJA 1S2MA 1EFCA 3T5DA 2ZETA 3GEIA 4FWIB 2GK6A 2BOVA 2H5EA 1GNPA 1YR7A 2HYDA 4DZZA 1TMKA 3VKWA 1AZTA 3R8FA 2XAUA 2GAAA 5G41A 3BS4A 4TT3A 5IT5A 4IDHA 3CM0A 2HF9A 3QG1A 5BXQC 3QBTA 4LPKA 2DYKA 4TL7A 5DLQC 4G0NA 1KSJA 1WBBA 4GOKA 3KQHA 1IOZA 5GADl 1X8JA 5DI9A 2IYUA 1PZNA 1Z5ZA 1Q1BA 3I3SR 1M7BA 2BMFA 1KIMA 4NCKA 1SULA 2ZM5A 4IKEA 2RGCA 1G3IA 2D3WA 2F9LA 2OBNA 1ZCBA 3GJ5A 1QHGA 221PA 1EK0A 2IYSA 4MRSA 1M7GA 2VP6A 1U9IC 1G7SA 1JB1A 2O0JA 1S1CA 3RS7A 4B3FX 1UDWA 2W6ID 1CR2A 2Q0HA 4Q9KA 4OI0A 2ZRBA 5C46F 5B64A 4KAXA 3AKDA 1NKTA 5FBRB 1FL9A 1NBMD 4DDVA 3FMPB 4BASA 1AS0A 5E4FA 1LV7A 4L16A 2V4ZA 3GJ8A 3J81k 5H68A 1KK1A 3GFPA 5J47A 4LJ6A 4TMXA 1E79A 3QSYA 3K9NA 4HDCA 1ZP6A 3VQTA 4ZKDA 3IILA 1XMIA 4RZ3A 4HB4A 1E0KA 1E1QD 2P2LA 1Z22A 3LH5A 2NO1A 4P32A 1N6PA 3VR4A 1ZNXA 1XFAA 2V54A 2EQBA 2GBLC 4GP6A 3Q9LA 4UXIA 4ZDWA 2PBRA 2EFDB 3E70C 3JZAA 2IYQA 3MFYA 4URUR 5JMTA 2BWJA 3D31A 3AVOA 2OFOA 1FTNA 3HR7A 3KL4A 1Q12A 1Z28A 4LOAA 4FD2A 1DELA 3QOFA 2IUUA 3MAAC 4CYMA 1NNEA 4MRNA 1SHZA 3LBIA 1ONBA 1W0KD 1YHNA 3GEHA 5AWFC 3TUJC 2HYIC 4LZZA 2GXAA 4EJSA 5J4KA 1VYTA 1DBSA 4HLDA 3RC8A 4L15A 2UKDA 1PUJA 4Z54A 3P4YA 1SVMA 1AS3A 1N6KA 5HCNA 3TNFA 2SHKA 3R9XA 5B57C 3FHOA 2YC2C 1VIYA 5L3SA 3B60A 2O52A 1C9KA 1XDBA 5GVRA 2R2AA 1KO7A 1NVVQ 4ESVA 2QP9X 1NLYA 4XOIA 4GL2A 1DG3A 2ODWA 4KO8A 1J2JA 1XJCA 1KK0A 1JECA 1YRBA 4MUAA 4QGGA 4Z8XA 3TVTA 3ZIAD 1T3SA 4U7DA 2QTFA 3KKOA 2GRJA 2AFIE 1UPTA 4Q9JA 1MO6A 5FUVA 1YZTA 4OQFA 2Q9CA 4OJKA 4DDWA 4LCBA 3B13B 1E2HA 4JBWA 3H2YA 5FOWA 5L3RA 1E2NA 1DPFA 4QHTA 4AYWA 4B6EA 2DB3A 4TT3D 2TMKA 4WW0A 3T61A 3TW4A 2CNWA 4HDOB 4N3NA 3DL0A 3X1YA 2IBMA 1PUIA 2IYLD 3L8YA 4Q21A 2KB0A 4YMWA 4D6PA 4O0MA 4HLQB 4HAUA 1OF1A 4PHFA 5AJVB 2WKQA 3GLHA 2IC5A 2J0UA 5J4VA 2WJYA 1GFIA 2HLDD 2ZUCA 1UBFA 3WYGA 4AYXA 3NC0C 2IYWA 4BFTA 2ZJAA 4LI0A 3P4XA 3AVQA 1TQ4A 5EUQB 5DYIA 1TF7A 2GKSA 4FW9A 1KI4A 3KTAB 4BPBA 2AXNA 3RHFA 1G21E 5EZ6B 1G4UR 5M04A 3K70D 4FMCB 3TR0A 3I62A 5JS8A 1XTQA 3NBZC 2YWHA 2ZVQX 1Q21A 2NO7A 1E96A 2MSDB 3B9PA 4MKFA 1ZUNB 3Q5DA 5CB6A 1NI3A 3NDPA 2IHBA 4KLNA 1SVOA 5JWOA 2GF0A 2YZ2A 3AF1A 4AC9A 4PPFA 1A2KC 1PV4A 1R4AA 4AIIA 4HLCA 3N2EA 2ZRKA 1SXJC 2ZYVX 2DWPA 3WBJA 1E79D 2Q9AA 3B8HA 3ECCA 4XVUA 5J4HA 3ND8A 3AVYA 4PFSA 5E7MA 1FQJA 5B2ZA 3FE2A 2FJUA 3B1ZA 1P75A 1J8MF 5CYOA 1BOFA 1G7TA 4M9SA 1NVXQ 4QM6A 3B1VA 3EA0A 1GNRA 3FMIA 3KKPA 4MKIA 1G3RA 2KWIA 2WJIA 2OE2A 2ZROA 3QKTA 4DCUA 1YQTA 1E2MA 5LD2B 2ZRMA 721PA 3GLGE 3MWYW 5FTNA 3QIAA 1G3UA 5J40A 4DRZA 2ZE6A 3PR1A 4URXR 2GZAA 2VL7A 1NSTA 3IQXA 1AA9A 2D2EA 4U5XA 4DXAA 4D2IA 1GL6A 3LVRE 5TV2A 2DPXA 4KSCA 4TLAA 3IQWA 3A6PC 4D0LB 3M4YA 4LJ8A 4NKRA 2FMXA 4HAWA 2HT1A 4B3DA 4BLRA 2NOAA 2FPMA 3SE0A 2ZE8A 1NBME 3M1IA 5E7JA 1TQDA 5KUTA 4WIAA 3C16C 4B47A 2FOLA 2FN4A 1E0SA 2WIAA 3OE7A 1OH7A 4UJ5A 2BBSA 4ZIRB 3LLMA 3I73A 4GNKA 2VH5R 1J99A 2ORWA 4RD6A 5JI3E 2RAPA 5DO9A 5TXGA 4Q01A 4Z1MD 3CIOA 2BM0A 1E9FA 2A5YB 1RC8A 4HAXA 2GVDC 3IPYA 4NP6A 2G1KA 3H4MA 3PUVA 1UBEA 3CO5A 2QUZA 2NTYC 3B78A 3KXLA 2OHFA 3OEHA 5FI1B 4TQ9A 2ZU0C 4OL0A 4PC2A 4AKHA 2OG2A 3K0EA 4OQXA 5D3MB 1CJTC 4F7WA 5B30A 4MGYR 4MRPA 1U0LA 5G53C 5JEEA 1ZIOA 3PUXA 4PQFA 3FVQA 1J8YF 5EXPA 1BS1A 3QEJA 2YOFA 5HPYB 1RJ9B 3AVVA 2FFAA 1XTJA 4HI0E 3ADDA 2C98A 5CYPA 2O8EB 3A1VA 3A1UA 4JKIA 1YZUA 4DUGA 3W6NA 1SKYE 2J3EA 2WIBA 4I4LA 2ZRDA 4NMMA 2DWOA 3BFVA 4TTRA 4ARZB 3ASZA 2FU5C 2ASEA 2ZUBA 4JL5A 2HXSA 1WE2A 1G6HA 4FN5A 1G7RA 4PC7A 5E7IA 1QRAA 3RWMB 1G8HA 3IIJA 5UKDA 3B1YA 1NY5A 4AKEA 1CS4C 2REXB 4OHWA 5KPJA 2J87A 2XX3A 1KI9A 2WAXA 3LW7A 3RYTC 1A4RA 2FX3A 4GSYA 1U90A 2BM1A 2BBOA 2ECKA 2X8AA 3LXXA 2LKDA 1II8A 3T12A 1E6CA 1NMYA 4RZUA 4GZMA 2ZI4A 3WXMA 3ONWA 1JNYA 2ERYA 1M6NA 1QHXA 5GJWC 2I3BA 3ZYCA 1Z6YA 2RHMA 2QGZA 3BFXA 1D2EA 2ATVA 1NN3A 2QNRA 4Q4HA 4B2PA 2W0SA 4OKSA 2CHQA 2IT1A 3ZZUA 4MDFA 1GL9B 1QG4A 4P3YA 2R6FA 5EP3A 4NYMR 1XPRA 4Q4JB 3THXB 2AXPA 1H8EA 2P5SA 2Q21A 1CXZA 1P7CA 2ZJYA 2ZVPX 3LVQE 4OK3A 3RABA 5AK0A 2ODBA 3KJHA 3ND9A 4N0EA 4LDJA 5JFGA 3I5XA 1TPZA 1JBKA 2CBZA 1U8YA 5KOYA 1UDXA 2FEMA 4PTLA 2AKAB 1RRPA 3GPLA 4B48A 2GTPA 4A36A 2PCLA 3BK7A 1G8FA 2OFXA 3PIRA 2QEQA 2N46A 2GK7A 3DKVA 3B82A 3LDAA 4TMTA 1WQ1R 4M53A 1EXMA 2QM8A 2BHRA 1OLOA 2IYTA 3KJIA 3K70C 2B21A 4Z51A 1Z6XA 2BKUA 4LV6A 4GT1A 2B92A 3AGQA 2QSZA 2DCUA 2ZR9A 4UJ3A 3MSXA 4D0NA 2CXXA 1CP2A 1Q3TA 3RLFA 4TYPA 121PA 3GLGB 2NO6A 1MO3A 1JAIA 2VO1A 2DHRA 5KHOC 4E03A 4BWYA 1W0JA 2WWGA 1FW6A 4ITRC 4M22A 3SYNA 4UXHA 3DMDA 2REOA 2GCNA 4IOKA 4DIEA 4GDFA 4DHEA 2FWRA 2FA9A 3PEUA 2G83A 2J0SA 3HYRA 5F9FA 3MRSA 3C5CA 1SVKA 1XMJA 2ZRHA 1R8QA 3NHAA 3K9GA 4KITB 1ZNWA 2Z0MA 5DSZA 5TDHA 2BC9A 4BFWA 2X77A 1E3MA 4JYBA 1FUUA 3P26A 3L43A 5KNBA 1NJGA 4B74A 3PQCA 3WHLA 3CF2A 1TEXA 2XB4A 1MKYA 3MMPA 1E2QA 1F5NA 4I81A 4RCZA 1BKDR 4DUGD 3GD7A 2ANCA 4HSEA 1TADA 1WA5A 4CVNA 4DKXA 5C4GB 4NCHA 4YONB 1U2RA 5FPKA 1YZLA 1HTWA 4EJSC 1J70A 3WNBA 4CT4B 1CRPA 1HT1E 1R10A 3EC2A 2B7CA 2WM9B 3PUYA 2EFHB 1N6NA 2XNDA 4MGIR 2FPLA 1RJ9A 3D7MA 2ZRAA 4KU4A 4TYQA 5IRCD 2VYFA 3OHMA 2GXUA 1R2QA 3NEJA 4LBWA 4O2LA 3WRXC 2O8EA 4IFEA 2JLZA 5IF9A 5L8VA 2A9KA 3QJYA 4U02A 1R6BX 2ZYUX 4A0GA 4PANA 4FIDA 4MGKR 1GRQA 1SKYB 2VF7A 3LQRA 2MMGA 3UPUA 3T1OA 2X1VA 1V43A 3QXSA 4RFVA 2D4HA 1A5TA 1U0JA 1GNQA 2FH5B 4NH0A 2W2TA 1DVRA 2G0NA 4XVQA 3ZDQA 4BEJA 1XD2B 4BFUA 1VG8A 1H8ED 2GEDA 2EWWA 4Q4AB 2RGDA 4G5OA 4JSTA 3B1XA 3TAHA 2RB4A 2GCOB 4MGZR 1AIPA 1AM4D 1WP9A 1RKBA 1T5LA 5FPYA 2JJ8A 4F93B 3GEEA 1GKYA 1RIFA 2CE7A 5D3QA 5EXXA 3HPQA 5LB2A 4B34A 2A3RA 5FFMA 5KNCA 1ESNA 3L0SA 1LB1B 2MSEB 2V9PA 1NVWQ 2WTUA 2QRZA 2XOKA 5DHFA 4LYJA 5FUXA 3EPKA 3FWYA 2OT3B 1D9XA 2DWQA 4W5HA 2IWRA 1VTKA 4TYYA 4Q4JA 3NVAA 5DHAA 5KU1A 4US2R 1FNNA 4CEIA 3ZVLA 2HCBA 1TF5A 3N2IA 3HDTA 3PV0A 4G5SA 1F2UB 1SZPA 2OO7A 4EUNA 1M1YE 5KYKA 1IJEA 3FFAA 3IIKA 1CBUA 3BRWD 1ZYUA 2FSFA 4B44A 1WXQA 2CL7X 2VP9A 3TVDA 3Q7QA 3FDIA 3UKDA 1DAMA 1QHIA 5EP4A 3TW8B 3QI2A 1IHUA 1W0JD 3C15C 3CRRA 3QKSA 3TUZC 2ZIAA 1TU4A 2G88A 4HZIA 2VEDA 3U6BA 2WICA 4QBGB 2P67A 4PO1A 3FHTA 3UANA 1VECA 2PMKA 4WZAE 5JS7A 2VSXA 2FNAA 4M1MA 1XMVA 2QTHA 3ZZTA 1FP7A 3U61B 3GLFB 1XCPA 4Q48A 1G8YA 3EC1A 1T0JB 1KTVA 1UF9A 4KFTA 2W2XA 3U3JA 4A0HA 1NF3A 2F3RA 4B33A 3GLGA 3LX5A 4A2PA 3K0CC 3K0AB 4PAOA 4G5QA 4V0NA 1AGRA 3T1QA 1JQLB 3SFVA 2QN6A 4A6PA 2GCPA 3AP2A 5AJYA 2JJ1A 3C8UA 1DO0A 4I99A 1P6XA 5H8WA 3BOSA 5G3YA 4B6FA 2F1IA 2IYVA 1KK3A 2V55B 4C4PA 1DADA 4PR0A 1Z0KA 3X1WA 4N0DA 5FL3A 2ZEJA 3PVSA 4CZ2A 2WWFA 4IOLA 4V0KA 3KDSE 2C9CA 2JCSA 1SHKA 3MGCA 3LLUA 4A8JA 4JJKA 4BEBA 4DEYA 1TEVA 4F92B 1US8B 3ZGXA 3HPRA 1A82A 2DR3A 3DO6A 1FOEB 5FH9A 2WWXA 2E9SA 2B8WA 1U8AA 3WYFA 1G1MA 1G5RA 4ABYA 1IN5A 3QQ5A 5JCZA 4DLWA 4TLDA 2BMDA 1SGWA 2RMKA 3A4LA 1K5GA 2QROA 4BUJA 4Q66C 5L3SB 1QVAA 1GRRA 3SHWA 1OB2A 3ZD6A 1GKIA 3EPJA 1H65A 1JPNA 2OESA 4CF7A 1YR6A 4WAUA 5L3QB 1K5DA 2JLYA 3OEEA 2XTZA 1DE0A 1UM8A 2E1RA 2PLRA 2J41A 4Q1EA 3EZ7A 2C77A 3EZ9A 4Q1AA 1DS6A 2AD1A 3T15A 2PX0A 4Q47A 4FMCF 1IONA 4O3MA 2VTKA 4XD7A 4JYCA 4BLQA 2J1LA 2DFLA 3UG7A 1IN7A 1Q0UA 2QU8A 3A4MA 4Q5IA 4BFZA 2J9RA 2XOKD 4NYIQ 1ZNYA 3KKMA 1N0WA 3EX7C 2IF0A 5FPTA 4A0RA 3MLEA 1MOZA 1E32A 3AP3A 2XZOA 3LAWA 3ZIAA 2WSSA 1M8PA 1P4SA 2GWHA 5AJXA 2ZRPA 1M2OB 1U99A 2AR7A 2YWGA 1TNDA 3RRNA 3SC3A 5KO2A 1MO4A 2GCOA 2J0UB 2F43B 2YINC 3EA5A 2D62A 3SFZA 3KFXA 3RS0A 1BYUA 2WOOA 1U98A 3I32A 1HV8A 2GXSA 2NIPA 3Q8XB 2VIIA 1AJEA 1MH1A 4C3ZA 1NN5A 3AKEA 1W5TA 3CB4A 2NQ2C 3CPEA 2WJJA 1CF4A 3SDZA 1RYHA 1R0YA 2VHJA 3D8BA 3VKGA 4IRUB 2Q6TA 3HJNA 4B3CA 1F2UA 1OXTA 1JEDA 1Z0IA 2BJVA 2R9VA 1GUAA 2JLVA 2HLDA 2O8BB 3OIVA 3BBPA 4NONA 3D3QA 3NH6A 3LA6A 1FMJA 1W44A 4Q1BA 4TWZA 3X1XA 3S1AB 2WOJA 1HEIA 2C03A 2WHXA 5JWRA 2JJ1D 2YYZA 2IF2A 5FTMA 4LBZA 1YR9A 3VKHA 1VYVA 1JI0A 3EZ6A 2IS2A 2P3SA 2QMEA 4JKYA 4TZ6A 4NBSA 1XNJA 1YVDA 2OAP1 2OCYC 4PC1A 5CDFE 1NN1A 3BB3A 2K5UA 3GLFA 1FX0B 2QAGB 3IEVA 4B2IA 1G3MA 4LK2A 4TL8A 3UWKA 2PZGA 3U44A 1P5ZB 3ZVMA 3QF4B 2GILA 3OESA 5GJCA 3K0AA 3THWB 3ADKA 4RD3A 2QT0A 1IXRC 2P6UA 2WMNB 1Z0AA 1QVRA 2C99A 2C95A 1DAFA 5TB5A 1S1MA 4BFVA 1TF2A 4RVCA 1KOFA 1KI3A 1DG1G 2OLJA 2V7QA 5LD2C 1GILA 4QBHA 3K09C 3DM5A 3VX4A 1QBKC 3U7GA 1AK2A 1T4GA 4U00A 3AKCA 2QQ0A 2PJRA 2ZS7A 3FTQA 2A5FA 2DFTA 4OHYA 4ZDIA 3OEED 3SN6A 3ZQJA 5FUYA 1MR3F 1US8A 1R8SA 1HE8B 1PLLA 4BRWA 1I4LD 2ZU6A 4JVSB 4C0QC 1BYIA 2NZJA 4NCIA 3AM1A 1ZC3A 2X2EA 3FB4A 2ATXA 3DDCA 3W3AA 1UFQA 4Q18A 3MD0A 5FPHA 3K0FB 1S9HA 5FR2A 4RJLA 4TLBA 4XD7D 3QUSA 4PHGA 4HLUC 5CLQA 1MV5A 2CL6X 2NG1A 4Q03A 3K9HA 1OPXA 3KXIA 3HU2A 3QY0A 5L3QA 1EESA 4PZZA 1OH5A 5K8LA 5LBIA 2PMDA 3I92A 4A6XA 2WSSD 1ZVQA 3AUYA 1A2BA 3RAPR 3U3MA 1VCIA 2GJSA 5EE1A 4GFDA 4X8MA 3R20A 1FMLA 1KHTA 1WRBA 5FBQB 5FOUA 2OM2A 2BV3A 2JGNA 2CVHA 2Q3HA 2VP0A 4XJXA 1FQKA 2PLFA 1G5TA 4B3BA 5EXSA 1KDRA 3TQCA 3GLIA 4LJAA 2WBLC 4FWTA 4Z1MA 3TUIC 1Q44A 3E5HA 3NBFA 4TMVA 3W5IA 1SVLA 2QGNA 2EFCB 5JJLA 2V6JA 4IVPA 3SR0A 2H18A 5J5CA 1KGDA 4NPHA 4E07A 5JECA 3SU8A 2EU8A 1ZU5A 5CM8B 4OBEA 4PC6A 1XXHA 3T34A 1NN0A 4NCJA 4BLPA 2F43A 5EQTA 3D6TB 2XXAB 1VKJA 1E69A 4XWAA 3EPHA 4JL6A 2ZRCA 4YDHB 1XEWY 4NYJR 4FI3C
chains in the Genus database with same CATH superfamily
1S5PA 4IP0A 1CY4A 3NDIA 4K9OA 2D7JA 1J21A 5IAGA 3RVLA 2G04A 2LGJA 3HGMA 1L5MA 1Z47A 4ICIA 5K8JB 3I61A 3RW9A 4YLYA 1JQJC 2JCBA 4X71A 2B8TA 5HQTA 2YWBA 3U39A 2R00C 9GPBA 4K6GA 1AUQA 4FGJA 3TIGA 3W8EA 4UNSA 4I1OA 4FHGA 1KC1A 4MVJD 4PLVA 2C1XA 5CK5A 2GLXA 3GZNB 1M1YA 2O2YA 2PJDA 4DF3A 1OUMA 2G9UA 4TRMA 1I2DA 1F06A 1QGAA 2GPSA 2LV8A 4AB1A 2V0CA 1BFUA 2CC2A 4CMJA 2I8CA 4LJ4A 1XPUA 3O8OA 1Y8CA 1E98A 2R79A 2HX1A 2QUHA 2W2QA 3TCXB 1Z6ZA 3HVJA 1L5FA 2N42A 1SVWA 1SXPA 2ZXUA 5DJ5A 4JLKA 2ESRA 3P32A 3P2IA 2HJ9A 3T3HA 4C7OB 2H8GA 1XZHA 3HWSA 1FX0A 4KV9A 4Y7CA 4BZZA 3K9FC 1JEYA 1DJOA 1V5WA 1CUXA 1R7RA 2SCUA 3HVUA 3WIEA 3QGMA 1HLDA 2J3IA 3CN9A 4DCNA 4M9XA 2JLWA 3JQQA 4B2LA 1CFZA 5BR4A 3ZKWA 2XEXA 4LWQA 1XO1A 5AI5A 3AKYA 2VOEA 3I1FA 2W42A 1K7CA 4ZVRA 4BJ6A 2OLEA 1CY0A 2NT3A 2DQYA 4MV8A 1YVUA 3DOHA 2Q9UA 4PHTA 3SFTA 1FJGB 4RH3A 3OOJA 3M2PA 5CPFA 4G97A 1SMKA 4H7HA 2WM8A 3W3AD 3TSZA 4ERXA 3ZHUA 1Z63A 4PYIA 1C0EA 1HG1A 1JWBB 4L85A 2GGSA 3OFVA 1E3WB 2J32A 2FFBA 2GD0A 5KDDA 1E6MA 3RCBA 5CT6A 2E4XA 3MK31 1J90A 4D8VA 5A7GA 3ZCUA 4FYIA 3RTBA 1JQ3A 3ZV4A 4R3UC 2D5AA 2Q4RA 1ZESA 3RNLA 3C3KA 2B2CA 3HKEB 3MCTA 2QI9F 1N5RA 3GX1A 1WV0A 4ID3A 1QQTA 2NZVG 3H5WA 3QITA 1T0HB 3TRJA 4N54A 3GK3A 5JD4A 1PL7A 2X0KA 4F6LA 1UKEA 3AI3A 3E82A 2XCTB 1T8TA 2BHTA 3I0ZA 4R05A 4MAFA 4WKOA 5C18A 5DM2A 2KLBA 1W49A 2D1QA 3HCWA 1GG9A 1FP2A 3PCRB 4OTZA 1GU7A 5EXTA 3ZBQA 5JAOA 2PVPA 1UEXC 3TLXA 2XNHA 1GVNB 5EJ4A 5JJIA 4E1AA 5HKBA 4M8NE 3DEKA 1M74A 3TSCA 1Y63A 5CVCA 2X2PA 3GLVA 1XZIA 4LTNA 4MPTA 1BGWA 3BH0A 3HJBA 2VSFA 2I1VB 3AR6A 4D3ZA 4FB4A 1EJ2A 4TXHA 2JVIA 3TLAA 3OUUA 2C07A 1VOTA 1NQUA 4PTZA 1O3YA 3VHLB 3NJRA 3WIOA 3DBHB 5K4GA 4LDZA 4EAQA 1XZGA 3VYSB 2OQIA 2QR5A 1TYBE 1ZM4A 2BZGA 3EQZA 3FJYA 3TECE 1UANA 3VR5H 1IBRA 1S4QA 4BE9A 2HY7A 2PPVA 3R3WA 3OOEA 3KR0A 5BT9A 5JQGF 2ZS9A 5T4FA 3PT5A 2CKDA 2G28A 3CTMA 4K6OA 1NMQA 4OK6A 1THMA 3TAXA 4DJJA 3U16A 3VOBA 1KI2A 2QN9A 4WK0B 3OCJA 3RAPR 3FPKA 4M38A 4E94A 4ARUA 1FFAA 4YI3A 1ZOOA 2B4TO 1BH2A 1GGKA 4BCDA 2NU7A 5EIFA 5EWJA 4CW7A 1R6UA 2WZBA 4WUTA 4BLTA 2R1VB 4FBGA 5AQ1A 4UHFA 3H97A 1JJBA 4XIGS 4OSOA 5AM3A 2XQIA 4G4SO 3X1ZA 1I51A 1RQGA 1SZCA 3P5BA 3E7DA 3LYUA 3IQIX 1EPUA 5EEGA 3RVSA 3PA8A 1O9HA 5NULA 4GMGA 1WDLA 4CGYA 1CP3A 4JXKA 4F12A 3V55A 5LPNA 3AT1A 3FGZA 4ESOA 2Q8QA 2ZT6A 3AJ8A 5J59A 5K0LA 5BYJA 3KVRA 1BX3A 4M2LA 3RYHA 4RACA 3I01M 4UU8A 1T6NA 5CEJA 4JZKA 4IX1A 3IUYA 3ZU4A 2MTBA 1FSGA 2IGBA 1OI2A 1MAHA 3C0KA 1ONNA 2PXHA 4JUFA 3VH3A 3MMXA 4GE0A 4FSXA 4H77A 2DE0X 4IFIA 5HUQA 4YGXB 4C2BA 1XNGA 4UTZA 1NSFA 1CQJB 1XDWA 3O92A 4HQFA 3T9AA 4ZCLA 4G0VA 1P1CA 4FS3A 3WRYC 3IKTA 3SZOA 4RH0A 4J1SA 1W5SA 2I9PA 4DDUA 3LPDA 3N05A 3NWJA 1B0PA 3K5PA 3D2CA 4KQCA 2JBWA 2H1CA 3ZEIA 4CEIB 1TFRA 3IS3A 3LDHA 3N53A 3PNMA 3FZYA 2AJLI 2BM8A 4GBMA 4MQ6A 4OUDB 3ZS9A 1LPNA 3ZDYB 1OVGA 3IFSA 2JK1A 4CCYB 2Z6UA 3TLCA 2HKIA 2Q9BA 3ZLUA 4BP9A 3LQFA 1EH5A 4G5FA 2ZREA 4MNTA 1WKVA 2EF1A 4QGHA 4W5JA 3BJEA 3FDJA 5FQNA 1E5VA 3IO3A 3R40A 4Q3LA 2HCRA 3SG0A 2HLPA 2HLHA 3PGXA 1A50B 4J0DA 4P81A 4U7FA 5I3CA 2DRIA 2Y1CA 4PPQA 3ZE9A 1UKYA 4HWOA 2R6CA 3KB8A 4FCCA 4LI3X 1FE8A 4ZT7A 3R7BA 2XVYA 1QF9A 1XHFA 3E03A 1VCNA 4XXHA 3TIXB 5KEIA 1ZJWA 4U9IS 1G64A 1TC2A 2OCPA 3Q3IA 1U2DC 4FFVA 5CH3A 4EGSA 3DNMA 5K3DA 3R1IA 1LPPA 2H1LA 3L0DA 3MTEA 3ZXXA 1X9GA 2NVUA 3DE7X 1NU6A 3CINA 4BUCA 4L02A 2QVZX 3L2OB 2C0CA 4F4IA 5K5EA 1Y8ZA 4EFKA 4XDYA 5K51A 3ZUGA 4E12A 2PEYA 4U3JA 1UQTA 3N5CA 3PFGA 2O8FA 1ADCA 5CA1F 2KI5A 2YXEA 3NHMA 4PQRA 4C9BA 1CX9B 1O6CA 1NVVR 3HBMA 3TFOA 2LCFA 4IEIA 2GFIA 4DNFA 4QBFA 1IHYA 3Q3HA 4RK1A 1F8GA 3SX0A 2E89A 4O6VA 4A8JB 2AN1A 2W98A 1R5NA 1PV1A 4FEAA 1W4RA 3BGWA 2O2CA 1H0HA 3IRVA 4UTXA 4ZVPA 5KVSA 3JXEA 1EU1A 1FP1D 3L0PA 4R8KA 1RI4A 4BGDA 3AVTA 1DTWA 1TK2A 1L7OA 4I1IA 3RIHA 4D8XA 1FP6A 2EWVA 3GGCA 4RM3A 1YQWA 3E8MA 3M82A 4F6RB 3SX2A 1IUOA 2FWJA 2HHCA 5HBGA 2H4ZA 3EFHA 1LF0A 3HCPA 4RQBA 4JI8B 5IAEA 3VU9B 1L7RA 4HX2A 2FWMX 3KE8A 3VGJA 3NANA 3BL6A 2PUVA 3HNRA 5HE9A 4YMLA 1VB3A 1RI3A 4TS1A 2C83A 1Z5PA 1ZC4A 1U2GC 2V7XA 4LXUA 4AQ7A 3MQFA 3LA8A 4YALA 2BTQB 3W2EA 2OC4A 4IIGA 4M9RA 2HRCA 3ZGOA 4XLZA 1U7ZA 2GSDA 1XDUA 2WSBA 3MRXA 2VDNB 2JBAA 1KSGA 2KE5A 2XZLA 4RD2A 1BXZA 2OK7A 3WB2A 1OBFO 3PXUA 1A76A 2ORYA 2VK4A 2PUFA 3CZPA 1ESDA 3FPAA 3W5JA 4RV9A 5ITVA 4YCAA 2X86A 2Q3DA 2H7VA 3PNBA 4PSCA 4UBKA 3QPDA 2YZ7A 1BDBA 3H5NA 4I5FA 4IHJF 4KDCA 5EMKA 1MTZA 2RGWA 3CPHA 2VRWA 3DFMA 4C0XA 1GZ3A 2YC4C 2D5IA 3FWPA 4JLMA 4EMSA 2NYRA 2PZ8A 5C8YA 4HUTA 1NXVA 2AF3C 1JLLA 1YCDA 3HCAA 2O8DB 1CEEA 3HJGA 1YK0A 4RGVA 5EERA 1GSOA 1R6DA 2O06A 3OCWA 1UJ4A 4BVHA 2D13A 2J5XA 2X8WA 1XXHE 1E94E 2X41A 3LT2A 3P9RA 3B52X 3DZBA 4JIMA 3WLMA 1TKCA 3IT2A 4DRXA 3ZQKA 5HNKA 1NFRA 1ZKMA 1QGYA 3VR4H 1Q5PA 5IWAB 1Q17A 1K86A 4C08A 5HZGA 2XF8A 4US0R 3WRWA 1GUYA 1XLVA 4B4UA 3GJ6A 3LBFA 3HI4A 3ASVA 3DBLB 4BVFA 1K63A 1TGYA 2G9ZA 2CZQA 3AU9A 4G24A 4F0JA 2O5EA 2WILA 4R9NA 1BFDA 1CIJA 3O31A 2IYOA 1Q1QA 1AUOA 2C2WA 4V3BA 4OHVA 3SZ3A 1CLUA 1VFNA 4KLZA 2H2FA 3TN7A 4F3RA 3K71B 1EK2A 4OQEA 2HWWA 3JSXA 1V25A 1RPAA 3KR9A 3JRNA 4P93A 4QGAA 4Y6PA 4BO0A 1G7CA 3KKQA 5K0CA 2PFGA 1VGVA 4MH0R 2GBCA 4RDIA 5BRAA 2FMIA 1POXA 4HUQB 4ZV9A 4DBVO 5CH5A 4WCFB 1UBNA 3LP8A 3GFOA 1Y7TA 5GONF 3T7DA 2EJVA 2ZUFA 3QOWA 2V5UA 4QNMA 4R7TA 3U9SA 2C7PA 3DZ8A 5HTKA 1R9NA 1WABA 4D3YA 2EYUA 1KXJA 2COUA 4KSBA 4P6VF 3T54A 1O03A 4L8WB 2DFDA 3U4QA 1G19A 2AHOA 1IJBA 4GEKA 4Q1CA 5EVCA 3V3TA 5KX5B 5F9HA 4IDCA 1NVGA 2FSIA 1NBHA 5EMMA 1V6SA 3ZCPA 4X9XA 4D4JA 5HVNA 4DSTA 4WOCA 1HTTA 1NDHA 2V9ZA 3I1JA 1VPVA 3TEFA 4GI5A 2JGLA 3KRTA 1CUHA 3LV8A 2ZQ5A 3ZKAA 1LK5A 4URFA 3OQ6A 2YIDA 1YVPA 1QHHA 3K1YA 4OHCA 4DV5B 1PHRA 3R3UA 5FWXB 2CUTA 3AOEA 1DI0A 3U44B 3ZI4A 3TSOA 3GY0A 4H7JA 1A7JA 2Q2NA 4PWYA 1JHUA 3DLPX 2J6HA 1UP6A 1FDIA 4G2TA 5LP6B 1P7ZA 5IP5A 1FYFA 4EPWA 1F3OA 3OLQA 4OXXA 5KYTA 1QU3A 4I8DA 1L9KA 2FWAA 1D8TA 2FG7C 2VDMB 4GRAA 4R5MA 5DYTA 2EFJA 5I7RA 5KKNB 4YJ3F 1DLIA 4HPWA 1QYIA 3SZRA 1HPLA 1G59A 3R7LA 1MQ9A 1J09A 4PX9A 3ZXIA 3O8LA 4LSGA 3I9KA 3THSA 4AJ1A 4O63O 1ZONA 3QA3E 4OPMA 3H5RA 2XNCA 1QONA 3WE7A 3DPIA 3AJEA 1Q92A 2ZUWA 5AW0A 2C4KA 4K88A 1H0RA 3M34A 1R4MB 4DWJA 1PE0A 2YHSA 5L7WA 1CZOA 4AY5A 5B7NA 5IJWA 2VP5A 1YA8A 4BKUA 4RTLA 5DBFA 1T3HA 1D1PA 1Y8QB 3WWDA 1QNLA 2NVWA 1U94A 4JJIA 5ERYA 3TLBA 1W5FA 1Q0RA 1PZMA 1Y4UA 4J0QA 1MHTA 2CEKA 4URWR 5FFFA 3OEYA 4YRQA 4EDFA 4IL5A 5BQ5A 2VTBB 1UQUA 3BHNA 3AR5A 3N6XA 5B1DA 5ALQA 4X6LA 1KI6A 1S7CA 4FQ5A 4UVHA 1DXYA 2P65A 1QQBA 2P90A 2J3DA 1I3KA 1PK8A 1VA5A 3QI7A 4EJMA 1MEOA 2K6GA 3F4KA 3QXCA 5MN5A 2DFNA 3U5TA 3T99A 1UWVA 2P0AA 4HR7A 4KO3S 3ZK9A 4DVGA 6Q21A 2Y0PA 1XELA 2I67A 3Q10A 1OROA 3KBBA 1RI1A 3LGSA 5KYYA 1ADJA 2JDID 3EPRA 1H3FA 1QH8A 3I1YA 1Y6RA 3AIIA 1IY2A 3RNOA 1ZZEA 5KREA 5J2TA 1M0EA 3HSYA 3FPCA 1DTSA 4M9UA 1ZQ9A 1F6DA 3K0SA 4YRIA 1Z15A 2I8LA 3SLKA 3I6MA 4D97A 1FYEA 4MRMB 3KJFA 4OKIA 2X5OA 3PIIA 5KTYA 1C1YA 3OZVA 2E55A 3PPVA 4GMDA 4ND8A 4C3UA 3BB1A 2XRFA 3AUTA 3EVZA 4Q3CA 3K15A 4GMFA 4BMCA 1ISPA 4F60A 2AOUA 3WGYA 1FTSA 2VA9A 5BW4A 5KDOA 3U4CA 1EBBA 1SVIA 4B5LA 3EZXA 4JR2A 4CL0A 2CJWB 2VBIA 3FIJA 3H1AA 5AKJA 1UPCA 3A2NA 3FNHA 4J0IA 1Y42X 2XE6A 1KJQA 2GS9A 2GT1A 1VLQA 4P0PB 4UMEA 3CZ5A 5LCXA 2Q8PA 1EWKA 5IVDA 3TDNA 3UTCA 2WSMA 1VLJA 2GWRA 2P11A 1NPDA 2Q3JA 4FSDA 4RAOA 4ZAWA 3AGPA 5TIIA 3ACDA 3AUXA 5KNDD 1BHJA 4BO4A 5T7BA 3NDBB 4KXMA 5ADVA 3K94A 5KB3A 1GADO 2PKCA 1JRLA 3DE5X 3PLRA 4NNOA 4R54A 1U0HC 4NY1A 1DC4A 2H1SA 3RHTA 2LIVA 4K6MA 4EECA 1DRJA 1FMCA 1XJ0A 5T8KA 2MSWA 2E4WA 3F9IA 4D96A 3G2IA 1VMEA 1QGZA 2ZFUA 3LWDA 2LPMA 3UG6A 3L0OA 1E9EA 2W2OA 2PSSA 1HYGA 4U63A 4OMCA 5DCUA 4C4XA 4DG8A 1USVA 4FUQA 4EEZA 3E1SA 3FDXA 2F7SA 2P1DA 2R6HA 3HGQA 4LZOA 4TTQA 3OZRA 1T24A 3P9ZA 4HG2A 5ANRB 1FVHA 1U1DA 1LEHA 1MN6A 4P0QB 5A4JA 2I1QA 3G2PA 2GDJA 4D9EA 1M83A 5AUNB 5DU2A 1ZJJA 5CG2A 1XCMA 2JFHA 4YC7A 1QWOA 5ALGA 2F6RA 2NUPA 3KLPX 1PJ4A 3LF2A 1CDZA 2NO4A 1NWHA 2UVQA 4QYXA 2IH2A 1W59A 3JVVA 3HA3A 1RKUA 1JQDA 2LDBA 5DISB 4D6XA 1FFGA 1PCXA 1NJFA 1ZRNA 2X58A 4RLFA 3QU7A 3UMMA 4P35A 2LXNA 4IMPA 5JY1A 3C6MA 2H57A 1OIWA 4NBRA 1KQ3A 3P2MA 5G4LA 3WYNA 2HRDA 1Y4DE 4MB6A 3OA2A 5DI3A 5K0ZA 5HZKA 2EEPA 3RVDA 1OYOA 1OJLA 3PX3A 4UHCA 3GUYA 3CLUD 1GA1A 1TCCA 5ERXA 5CDUA 3NYWA 2RBGA 2C7OA 1O7JA 3IA7A 4BU0A 3L7AA 3AEQB 5E6SB 3EH2A 4DQ0A 2CNDA 1DQYA 1B6SA 1J25A 4WLUA 4KREA 1W85B 3UO8B 4MWDA 1KJZA 4Q4LA 3F7NA 1Z34A 2ZANA 2ZSIA 3CZ4A 5CIWA 2H07A 2YWXA 4HAOA 3IVCA 3M6AA 2QZSA 2RBKA 4P54A 4YDQA 5L4NA 4HH3C 2H1IA 4F4DA 1W46A 4IHKA 1J2EA 4EB3A 3UMRA 4Y0VA 4UZEA 3QPUA 4EABA 1PS8A 1J0BA 1W1WA 1O0BA 1K6IA 1NXTA 1WKCA 2XGJA 3WMFA 4EGQA 4G8DA 4RF3A 1ODCA 4XYMA 3QYFA 3ICPA 1RWWA 3LNCA 3L7JA 3RS5A 4HDMA 3L4KA 2ACKA 2RC6A 1Z7YA 1TUBB 2EKBA 2C5LA 4RZ2A 4BQQA 2IOFA 2ZR0A 1PJ3A 5F9MA 3SMVA 3A4IA 5F4BA 1GPKA 2PJZA 3WK8A 1KSHA 2QPAA 3AETB 1I3NA 4JBXA 2B2XA 5BNZA 3ADBA 4PCUA 4Y6RA 2PMWB 4IIDA 1BCSB 1G4HA 2P1ZA 2RJ3A 3KCQA 4WK4B 2GM5A 3FGNA 4M87A 3VBCA 5JFOA 4JI6B 1P2SA 1SXQA 4AY4A 1BQEA 5JCJD 2FMFA 1V1RA 1AKUA 4D80A 2WQ7A 1G8SA 2PLNA 2DPHA 2QY9A 2WPDA 2X4LA 4ESEA 2F48A 3ET5A 4PAQA 3AM3A 2QLJA 5CDGA 3QENA 3U5ZB 3AVUA 3A6HA 4OYYA 3A9UA 4M49A 1JJVA 2WHPA 3AF3A 1M2KA 3F7MA 1B42A 3Q7PA 4JYPA 3M1YA 4BRSA 4EARA 4ETWA 3IBGA 2G1AA 2IUYA 2YH2A 4LBVA 5C1BA 2ZSUA 2ICAA 3RJ9A 4UBMA 1Z73A 1UBHS 3IL2A 5F3WB 5KTTA 2F3SA 2EZUA 3H11B 4U7GA 1N5DA 1M5UA 3GFBA 5DRYA 1E0JA 1E5XA 2AJDA 2QW1A 3MHTA 2IP4A 2OWEA 1OWOA 4MKHA 4LQ4A 3AJRA 1IM5A 3JD0A 2VKQA 1BHO1 3O47A 4TZ0A 1TM4E 3MF4A 3R9XA 3KT0A 4LWZA 1SBZA 3LC7O 3EIQA 4KSYA 4ZCMA 2I4TA 2R87A 3LQ2A 1N2CA 1BH6A 2WR8A 3D4PA 3OI7A 2FI1A 2RHJA 3BREA 3T6KA 3V2GA 1FJ2A 4FCWA 4LRQA 2A78A 1RYZA 3KSDO 4JLPA 4OGFA 1PX2A 5DOZA 1FXWF 2Y2VA 4ZCTA 2YS6A 4FOLA 2HQRA 1NIPA 1SU6A 1XEFA 1N75A 1ZD1A 4BMSA 3W5DA 3B6KA 3K30A 5KKCA 3SR4A 4YRCA 5FEMA 1EG7A 4IIJA 2H5JA 4Y2TA 1ITZA 1MIOA 3BWEA 1DQRA 4RFSB 5JAHA 1Y3BE 4GM0A 1XJWA 2JFBA 1P4RA 2QTBA 1R6VA 1L7BA 4GPEA 1MABB 4M6WB 4C6HA 5DYNA 3K1JA 4PBRA 4YJGB 3F4BA 1EIWA 1YR3A 1A04A 1X0VA 2Q1TA 4QD3A 4XSHA 4WKNA 5A6SB 4M1OA 1NOIA 3UXHA 1Y8AA 4Q7MB 2HFJA 3V8RA 3GUHA 3QHQA 1GRVA 1GGNA 2Q6VA 2P30A 3C7TA 2CLCX 3LBYA 3PI6A 4MPJA 1ZWLA 1O94C 3RUEA 2NPIA 3IQFA 1XL0A 3RADC 4BS9A 5CX1A 3MJRA 1CUVA 1Z3CA 1LZLA 1EFRA 4PZYA 4EYEA 1Y6FA 2Y1FA 4YIHA 1KO4A 2AL7A 1L5KA 1FSFA 1IQUA 4DLRA 4DMGA 4Q7JB 2PBZA 3KOMA 4QZVA 2BUCA 4MUFA 5AHKA 3CX8A 3ENVA 3QE3A 2FSHA 4P4NA 5E8RA 3D6NB 1KOGA 1S3IA 4DJTA 1E3QA 5E6RB 5B58T 4CLEA 4FMDB 1ZM7A 5B2EA 4DB2A 4JP2A 5IHXA 1DRKA 3BTOA 3KYCA 4QFCA 2G40A 1D03A 1KJ8A 1DMSA 3EZFA 4ZTZB 4TKVB 3ZK8A 1YIDA 1SXJE 1Y98A 4I46A 4KWTA 4WY5A 4FLEA 1P9WA 4LY6A 4TL6A 2BEVB 1W0CA 1M73E 3A04A 3UT5A 3UXYA 3EUWA 4J6FA 1T8UA 3TL6A 5JZVA 4G5RA 2F59A 2EW2A 2HFKA 2Z6AA 2BKEA 3R8XA 4RTKA 3MUFA 5CLIA 4WRRA 2QE7A 2XTAA 4QXRA 2FAXA 5HTOA 4C4RA 5TT1A 2NQTA 3H6GA 1X42A 5C35A 1KMNA 2R6DA 3AW9A 4G4SP 4KMOA 4NFHA 4YAOA 3BT7A 2R6R1 3NHLA 1WUJS 5HS6A 4YXFA 3PX7A 1JJ7A 4BRUA 3OAAA 5ILQA 4M1YA 3CW2A 1ONPA 3C87A 3E7XA 1RMTA 3DKIA 3FVVA 5BVGA 3GP8A 1COZA 3O2SB 4XW2A 3DMGA 3IKLA 3N7AA 1EB9A 3PEWA 2HPZA 5EC8A 5KSOA 3DC7A 3A2KA 5F1PA 4LRXA 3JWIA 2O1XA 3REQB 3DP9A 4P82A 4YBZA 3N6VA 4V0ME 2W2PA 1JR6A 2WJVA 4MRVA 2IY9A 3NTVA 2F62A 2WPDD 1GZHB 3QEBZ 2H2AA 4WZ6A 2QQ5A 3D2BA 2OP0A 3A6GA 5BN3B 4JFAA 4JLVA 3G82C 3QU5A 4WNCA 1CVRA 4HVLA 1R9JA 1N25A 3ORQA 1RXSA 4EFMA 4I1PA 3ZBTA 1P2VA 2VS1A 3FHCB 1OTHA 1KR2A 3BWVA 4JUIA 4O0LA 3WJ2A 3E22A 5E6UB 5BO5A 4Q24A 2Y1EA 4UD2A 2C5BA 3J7AC 4UBNA 3DFZA 5ALEA 3GRCA 1Y3AA 4N3CA 3B6EA 1PR4A 1QC5A 3DF7A 4R2JA 4IXTA 4NJMB 4REQB 5CFNA 5IHPA 2CXTA 4AY2A 1BXGA 4UNRA 2YUIA 3KTOA 4LZPA 5EZSA 4NYIR 4A27A 1V4NA 1XTZA 2Z58A 5C5IA 2C5SA 4N39A 5A3VA 4D9CA 4YRPA 3VR6A 3TSAA 4BQSA 4RAQA 1I36A 1D04A 2DSNA 4EA7A 1OAKA 4HP8A 1H2YA 1IOVA 1ZL2A 3NBXX 5JRZA 3IR7A 2XW6A 4RQTA 4EG5A 4B7CA 1GAJA 3ZW9A 3RSCA 4AKTA 3FI9A 3LRPA 2QMOA 2WHQA 5I4CA 3OMWA 1CUYA 2RGUA 2YN2A 4QHSA 4M55A 3N6RA 4NFSA 4E5YA 2IYYA 1E1LA 4KO2S 4QL3A 5CT5A 1NZFA 4CM1A 4JV5B 2IS4A 1M2GA 4ZEOA 4V1CI 1EP1B 3JQBA 2HIAA 3NOOA 4JJ8A 2P78A 4R9RA 1LU9A 5D2CA 2IHKA 5JSFA 1GNVA 4COOA 5LQUA 4EY8A 1FPMA 1FSSA 4LZLA 2NX2A 3IT0A 5EJ2A 1OAOA 3ZPXA 3P9NA 1Q0SA 4PSKA 2C0QA 3LG2A 3KQOA 2XMDA 1H22A 2AE2A 5E9AA 4YS6A 2AZ4A 2BUAA 1EFRD 1S3SA 3JU3A 5IH3A 4X3OA 1T3LA 2BGNA 1CEQA 4M1ZA 3WL3A 4Y6LA 1RHUA 1TX4B 2UZ1A 4L9RA 2W93A 3B2EA 4TKVA 2BFPA 1OH8A 2WG0A 2GN0A 2JGAA 3IHKA 1I4WA 3DLIA 4R9UC 4WKPA 1R50A 2JIQA 1VL8A 2Q3MA 3JD4A 3JVIA 3GG2A 3O75A 4LRUA 3JQPA 3L6BA 4JLAA 1K8QA 4E5DA 4Q16A 1N2HA 5A5GA 5L6MB 2GF9A 1YS7A 1XOIA 2ZCVA 2BBTA 3CXUA 3FOWA 1OHHA 2O50A 4LHWA 3UBMA 5I7HA 1SBNE 4Q15A 1DC8A 1DFIA 3N76A 4RABA 4L5YA 3C7CB 5KYXA 4PU0A 2CHFA 5FNVB 3WO1A 4UDYX 1L5GB 4GI2A 4NJOA 3D8TA 4DT1B 1JYEA 2Y8EA 4F96A 2MSLA 3WAKA 1Y1SA 3S1SA 3A70A 4NAVA 2PVSA 4WOJA 3RTCA 3LVFO 4AG6A 4Y2VA 4YRDA 5AVXA 3FSJX 1VZ3A 2GEKA 4HB3A 3G2HA 5KWJA 3BSSA 4YXWA 5AOCA 4X8HA 3QELA 1WD5A 2YCBA 4MP8A 5FOXA 3OAAD 1G20A 2QG4A 3H2HA 3P1JA 5DN6A 3D8NA 3B1KA 3P8ZA 2V96A 3SEAA 4Z7JA 4DZRA 3HFSA 1EAYA 4EKIA 2PKEA 4KKXB 4RMHA 4O4LA 1GWNA 1YZHA 5D5HA 3T4XA 3FHLA 4DCMA 4E2FA 1QRUA 2WWVD 2D1TA 5D01A 1VIAA 3A14A 5B6IA 3I1IA 1Q2UA 1V41E 2E5WA 2PKRA 3SHOA 2OQRA 1KMQA 2AF4C 2YMMA 1RYNA 3NDRA 1TM7E 4R2IA 3NBQA 2I62A 2WKWA 2OZVA 3TCKA 1KEPA 2Q50A 3U7FB 3SKYA 3B5EA 3DKPA 1LA2A 1PGQA 2IELA 3ESZA 3LSTA 5L6LB 1PVOA 4Y1RA 4RKRA 5TJ9A 2OCBA 3LNTA 3PGMA 4JGBA 5G02A 2VAXA 3WLPA 4FM9A 1HWYA 3RRMA 3VYRB 5GZ6A 1ZNZA 4KPUB 3REFA 2GPTA 3QUCA 1N0UA 3GD5A 3GC6A 5KSPA 2GJ8A 4IJWA 3VPAA 4AZ3A 2QNBA 4BWFB 5JI2E 4JOCA 4V2UA 4TV9B 3EY4A 1NM5C 3IA2A 1J6UA 1P81A 1M6YA 1QOQB 1FU4A 3PCTA 4OHBA 1KYIA 3S2YA 2VWQA 1DOHA 4ZRDA 5BN5B 5BORA 5K0EA 4FR5A 5HDQA 3SNHA 3AV3A 1WAMA 1VIDA 2D4AA 2FFQA 2RHWA 3HB5X 3TKLA 3UHJA 4Z2AA 2UYGA 3I8OA 3S5UA 2UUAB 3K09A 1L3IA 2GBLA 2XMCA 2YY7A 5I9SA 1G2QA 1AKYA 1YJBA 3NUQA 1DKNA 3VR6D 1RCUA 3WQSB 4P4UA 1RZUA 5FEUA 2J7PA 3FX2A 4D44A 1WXDA 1P1RA 5EXDA 1AMOA 1WETA 1JYSA 2MMCA 2Z98A 2VNHA 3I0MA 5BVHB 1BROA 1GPBA 2PFSA 3KKLA 1CJVC 1JZSA 1SURA 2XGSA 2PBFA 4A92A 1Y3DE 3K4QA 4WTOA 2PRKA 2KS6A 2VPWA 5CM9C 1Z4JA 2RH5A 1H42A 1P7YA 2QYOA 1NIJA 1OZGA 3FMFA 3GDWA 4LX0A 4OP3A 1YDHA 1FDUA 1Z08A 4MB2A 4TLLB 2P9CA 3WFIA 4G0UA 4G56A 1WMSA 4L6IA 4RK5A 2ARKA 4LOKA 1X6VA 5EYPA 3OP4A 2HJWA 3BIXA 1Z56C 1C4WA 1RJWA 3JVUA 4J8PA 3KU4A 2AYYA 4OL9A 3V1UA 4EG7A 3DOUA 5EZ5A 3ORFA 3NHKA 2OV6A 1T5BA 2VEOA 4ZCPA 2ZUVA 4CL2A 3THYB 3DOFA 3ESAA 5E1DA 1HUQA 4M60A 3PA6A 4Z3OA 3RAGA 4KHPB 2H2HA 4G0PA 3UICA 3MTIA 3BEDA 3V7NA 1EUYA 4I50A 2IYAA 2ZZNA 1EHYA 4IGFA 1BE8A 4Q9HA 3L1IA 4MV5A 4CIDA 2JASA 1GGHA 2ZAMA 3LW8A 2ERCA 4Z0NA 5TQ2A 3SSNA 4XUDA 5D3MA 3R7AA 4YCLA 1A9XA 1LWNA 4QYIA 3T06B 1H2XA 3HCFA 3ZWNA 1R3UA 3S7ZA 1UM9B 4K8RB 3P97A 3R5KA 3Q3JB 5ALHA 1INLA 2ZRFA 4NESA 1JSZA 3OE4A 1B3RA 1VP9A 5CDSA 3CNQS 3L8HA 3IPAA 5K3CA 2PH1A 3NTXA 3T1VA 1L2TA 1N92A 3K9WA 5CX4A 1W36C 1BEEA 1E7QA 3DD5A 1BVYF 4FOTA 2R7AA 2O8NA 4N3GA 5DN6D 1SKMA 1E2GA 1YVEI 3UJCA 3FTFA 2OAEA 3C5HA 2GTIA 1LLQA 4EG8A 4FZJA 2I2WA 2FPRA 4X8OA 5BQOA 1QK5A 1R4NA 5DGDA 1YDMA 3H1TA 4AX4A 1U2TA 4QXOA 3EW7A 3IJRA 1ZVJA 1JA0A 4MWCA 3UWMA 1IY9A 1J2RA 1GTZA 4LYFA 3W79A 5KYNA 2QS9A 3T1NA 1NBOA 1KKUA 2EW1A 2Q49A 3KJXA 3RRZA 1QTQA 2GJAA 2HBRA 1MO5A 4FFPA 4H7FA 5AXBA 4JXZA 2IK8A 3H5OA 2Q07A 1RWQA 2DMRA 4TKUA 3F49S 3OT1B 4UQOA 4S05A 4QOJA 4JJ6A 4BNDB 1VPEA 3QLEA 3S2FA 1G21A 2HA5A 5SZHB 1AKMA 1L4MA 4AP6A 2UUCB 2P2DA 4XCQA 5HEKA 3KKNA 1G5FA 2XVAA 3CEHA 1X1QA 3C6BA 4BRZA 3QYAA 3CUWA 4KRFA 1SVUA 1LRJA 4L50A 2DHDA 4EIWA 2RKBA 5IVKA 1N0VC 3OKCA 3WV4A 4F3CA 1K4MA 2PX3A 2VTEA 3GCDA 5CFMA 3A1FA 1AH2A 1PBNA 4UUMA 2X0RA 3MPOA 1KEKA 5F52A 3GDOA 2Q4DA 2PWAA 2XJ9A 4J43A 3B70A 4JIGA 1TAGA 3TBKA 4E1BA 3TDMA 4MJXA 1NBIA 3D7RA 1XCOA 2Y27A 1YS2X 2GR9A 3FUCA 1JLSA 4WV3A 2DF8A 1G9XA 2JZCA 2WFMA 1Q14A 4FE4A 2JW5A 4O4IA 5JNRA 3LTNC 1U81A 1QAQA 1ECCA 2J7PD 3T7IA 3I5XA 4LE0A 1UINA 4P7GA 1P4AA 4IVRA 2NP6A 1E3SA 1WB6A 4S24A 5KYWA 3BRQA 2F1KA 4JJAA 4RKEA 4R1TA 3DOOA 4LQDA 2KX7A 4LGMA 1LQTA 5AVUA 4ZI7B 5K20A 4K0RA 1D6JA 2XZPA 4HSGA 1DJNA 4UEKA 1JP7A 2WKRA 3OPYI 2ET6A 4DR5B 2IEZA 3SC2A 3RG8A 4A0QA 1I5OA 3LBNA 3V8EA 5IYZB 1L7VC 1U0SY 3U2QA 5IAOA 3QNUA 2VKTA 4JODA 3BMOA 4P7FA 5DSTA 3UKOA 3WLHA 5CITA 2BYTA 4DPLA 1PSDA 3GRVA 1E1CA 3CKLA 3GJZA 4IDEA 5AM0A 1NLUA 3U37A 2UYCA 5LOVA 4ZYTA 3MINA 3U80A 1DDOA 1XRPA 2JCYA 4RIHA 5AM1A 3RAFC 2IPOA 3DP7A 2Z3VA 3KQYA 1ZMXA 4IRMA 1K7EB 1PNTA 4IWNA 1XA0A 2WMYA 1KYXA 3SI7A 4B9EA 5EMNA 2W6IA 3QMPA 4XPIA 3DE0X 2VA8A 2CNNA 3JASB 2VPZA 3E2MA 3FETA 4P33A 1AMNA 4B6GA 3LBAA 1A4IA 4CDMA 2QLMA 2H5IA 3FFXA 3H05A 4AJLA 2O2JA 2FKNA 1LKZA 3A4YA 4CHTA 4OHFA 2SNIE 1TTHA 3HXPA 2QRJA 1KZGB 4BV2A 5AFSA 2JIMA 2O0KA 2XI4A 4A82A 2F55A 2H16A 2H8KA 4BWVA 3QG5A 2GLTA 2A57A 2B0CA 4AJ4A 3QUTA 5HKLA 2MINB 2ODPA 4PSDA 2NNLD 4WZBE 3JCZA 1A2OA 3EAGA 5JQWA 3MJSA 1J1IA 2EF0A 3LOUA 2R6ZA 1TOAA 5BV7A 1OXVA 1ZPDA 1AUXA 3V1YA 1UBTS 2WUVA 3AEKA 1YWGO 3GVPA 2PY6A 3I58A 3N70A 3MWEB 2YWFA 2VTVA 4HB0A 3S2SA 4QATA 1H4QA 1E2BA 1PUXA 4ZO7A 3EK2A 4DLNA 3IUJA 4OXQA 3R9XB 4PRZA 4UUNA 5BY2A 2Y0BA 3FR7A 1RI2A 5LJIA 4YRNA 1IWPB 2R86A 2PG3A 4DLSA 1BN7A 2O2HA 3G59A 1QE0A 1PGPA 4EO7A 1I2MA 3OZXA 4FFNA 2W8BA 1KO5A 5AIAA 1NVAA 5AJUA 1DAIA 2VSQA 5LYJA 1PYGA 1CSEE 1T6YA 4LKRA 3E5NA 3ZHTA 1A77A 1LJLA 3BWYA 2NU8A 3SF8A 4L74A 1EQAA 1W29A 3FVTA 2QENA 4IY1A 3E4DA 1ZMTA 1IEXA 2ZDHA 4O5AA 3RRYA 3JQAD 4CMEC 3ZVNA 3U4GA 4HDNB 1E6WA 2F8SA 4BV3A 2R8XA 3SK0A 4XFKA 4EDHA 3QPWA 3RUHA 3VR3A 4FYVA 1U6JA 1PT8A 1VKRA 1Q77A 2X3FA 3N2NA 1Z6TA 1B8PA 3G0OA 2VG8A 2JRLA 1I7PA 4CM9D 3OY2A 3G02A 2ATEA 3WP1B 5JZSA 2D5CA 3SBDA 3PGVA 4DS3A 3SIRA 3GJSA 4GOOD 4ZI7F 2FRDA 1YFLA 1FSZA 3LHIA 2VVTA 4JZYA 1MBZA 2J9GA 1T5TA 4FGKA 3X1DA 1S2MA 4AMGA 4QTZA 4ZZIA 2W6NA 4LCEA 3BD7A 4NBTA 5ABPA 2HQ1A 2ZUUA 4OJYA 2GK6A 3KUXA 4ZA2A 1X7ZB 4QECA 2H5EA 1GNPA