1DAEA

Dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
219
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanism of an ATP-dependent carboxylase, dethiobiotin synthetase, based on crystallographic studies of complexes with substrates and a reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 71
structure length 219
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1daeA00
4RY2A 2A3RA 4F4JA 4FMDF 4URUR 5KPJA 4NYJR 1M6NA 3K70C 3QPWA 1A5TA 1G7CA 2OBNA 5LB2A 1S8FA 4NYMQ 1UKZA 2OFWA 3RSLA 2IYQA 4IDQA 1MO5A 3BB4A 3PUZA 1CRPA 1NN5A 1PZNA 5KSYA 2O0JA 1D8TA 3DVLA 3B6EA 3BRWD 4MKFA 1E4VA 1E2GA 4R71A 1H8HA 1RRPA 3CH5A 4BFWA 3DM9B 4DLTA 4JKYA 1LW7A 2BKEA 1KO8A 1MV5A 1OH8A 4M1WA 2WJHA 1R0ZA 1QHXA 2O8FA 3BFVA 4TTRA 2CBZA 1NVVR 3SHWA 3LQQA 3KTAA 2WAYA 3P4XA 4FW9A 1NLFA 3EC1A 2FZLA 1OKKA 3CX7A 3MJHA 1KY3A 2QG6A 4D4JA 1G8PA 3F3YA 721PA 5M04A 5CDFE 2XAUA 3VKGA 2FGJA 1RRGA 3VR6A 1AKEA 1FP6A 2SHKA 4EFNA 2GILA 2QBYB 2HJVA 4NYIR 2JDID 1KI1A 4B3XA 1QDEA 2HYIC 1KKLA 4A15A 4XVRA 2QT0A 3G0HA 2G6BA 1E1RA 1RYHA 3RWMB 1HT2E 3KXIA 4QGFA 4TYPA 4A8JC 2IK8A 1XRJA 3AKYA 4C0SA 4HUTA 4EAQA 4PO8A 2AHOA 4TYQA 3PUVA 3HU3A 2WVJA 3R8CA 1P73A 3WXMA 1VG1A 3WNDA 3Q7PA 3F5FA 4KXFB 5BXQC 3MFYA 3AF1A 3SFVA 5AJZA 4GPTA 2GZHA 5JWRA 4NMMA 4PPNA 3N70A 3MD0A 1NLZA 1ONBA 3QKSB 3SJCA 1XD9A 3K9NA 4C3ZA 2CHQA 1R6BX 3D3QA 4WBSA 4CDGA 2AFHE 1ESNA 1JR3D 4BFXA 1QHIA 2ODWA 2XB4A 4S35A 5DISB 5C4GB 5LD2C 1R5OA 3O47A 3LQRA 5EXTA 2AN9A 3MJRA 2IYSA 2NO9A 3GEEA 1AKYA 5CJ2A 4B47A 3B82A 3EPHA 1XMIA 4URWR 1G6OA 4LCBA 1ZMXA 3GLGB 4ZDKA 4B73A 4HAVA 1Z5ZA 2VHQA 4M9QA 3W8NA 1D9XA 2QP3A 4TLAA 4YLGA 4V0ME 1KNQA 2VA8A 2G77B 2AFIE 4PHTA 4NP6A 5L3RA 2ZQ5A 2I3BA 2HV8A 1Z6TA 3U5ZB 3RS3A 3G5UA 1OSNA 4OBEA 2HDNB 1A2BA 3CH4B 1O87A 4IFEA 4X8HA 4ZDIA 4GMDA 3LW8A 2VHJA 2NOAA 1TAGA 4UKDA 5L8VA 1P9RA 3O8CA 1XTQA 1W1WA 5HTKA 1CS4C 3FHTA 3EZ6A 1N5LA 1M34E 4OHWA 4BLSA 1YZUA 4LBYA 4G01B 2Q3FA 1W46A 2PLRA 2WKRA 1NVXQ 1WXQA 2QA5A 2VP4A 4G5QA 3U44B 1SXJE 3OEED 4KVAA 4PTLA 2CLCX 3QF4A 2EFHB 2Z43A 4KAXA 1E2NA 4NCHA 1GP2A 3U3RA 1NSTA 4LHZA 1KDOA 3KFVA 4AC9A 2GZDA 1U0HC 2YOFA 1G3RA 3U7GA 1AQYA 1XX6A 2Z6VA 4MUAA 3DO6A 5B64A 1FQJA 2VYFA 4Q1FA 1E2QA 2OILA 2OZEA 4AYWA 1DG3A 2QQEA 4PPQA 2ZJYA 1ZUNB 2GJAA 4GP6A 1Y63A 4NKRA 5A0FA 4ABYA 2FPLA 1WB9A 1YR7A 2AD1A 4POAA 4DLRA 3D6TB 5CK5A 2PZGA 3TLXA 4Q4JA 4KVGA 2IC5A 1T3LA 4KHZA 4KLNA 4W5HA 2FN4A 3NBZC 1II0A 2IUSA 1U8AA 3CONA 1A2KC 4IDHA 4M2LA 2F55A 1T0JB 3AVTA 2GA8A 2PL3A 3ZYCA 4QJ3A 4DCNA 1GG2A 4GDFA 4JIMA 3I73A 1XXHE 1BOFA 4TMTA 3THYB 1ZNWA 1XEXB 1IN4A 2XJ4A 3ADDA 1AZSC 2BCJQ 2OO7A 2ZJZA 1GNQA 3DM5A 4L15A 3QSYA 3ZQJA 1QHSA 4FCWA 4DT1B 1CP2A 4YXWD 3L0PA 4D26A 4B48A 2EYUA 4US2R 1LS6A 3FGNA 2VHCA 1XJ0A 2DR3A 5EE5B 2ZS9A 4CEIB 1P2VA 3GJ8A 1I4DD 5F2EA 4NYMR 4EJSB 2YKGA 4JLJA 4PZZA 1MH1A 4QGGA 2PMDA 4US0R 3W3ZB 1KKMA 3QUSA 1IXZA 2J0VA 3RNLA 2O8EB 3RRZA 2CVFA 2QL6A 2RGEA 2W6JD 4C30A 2FE4A 4Z1MA 2G9NA 3WHKA 4IXMA 3ZS8A 2XNSA 4OI4A 1T5IA 3EPLA 4NU0A 4A6XA 4V02A 3SYLA 2ZROA 1MABA 4DDTA 4I1UA 2FX3A 2GWHA 5TXGA 1E94E 1E2EA 2AKAB 3LLUA 3VR3A 4LGMA 4W9MC 4Q4HA 4G0NA 1ZC4A 3CWQA 1G5RA 4B3FX 3QXHA 2NTYC 3H4MA 1HQYE 3LDAA 5CLQA 1XZPA 1XPUA 2O8BB 3K8YA 1Z06A 1G3MA 1RIFA 2AKYA 3C15C 3U61B 5CYPA 4JJZA 1B23P 5AUQA 3VNVA 2WWHA 3KZ1E 1GNPA 1W4BA 4C2TA 3C14C 4BZPA 1BH2A 2D7DA 3MWLA 1EFHA 2F1IA 1KGDA 1NJFA 3DZ8A 4QHYA 2IYXA 3IO5A 1E9CA 1OF1A 5KDLA 3EX7C 5EE0A 2GCOA 3H86A 3IPXA 1KOFA 1H8HD 4V0OA 4TWZA 2BBWA 4DLVA 5HZKA 1R8SA 2JCSA 2R6GA 1G64A 2GVZC 4D6PA 2IYWA 4WVFA 2A5YB 4C0JA 2JLZA 4M9ZA 1BS1A 4RD6A 4HAUA 1L4UA 1OKKD 3OIWA 1GSIA 2UKDA 3W34A 1CJUC 4RFSA 3ZJYA 4MUBA 3UWKA 4OQXA 4Q1CA 1O3YA 4F38A 1ZU5A 4FMCF 2B6HA 3BH7A 1KK3A 3X1XA 4OHYA 2XTMA 2PMKA 3IIMA 1I2DA 2WV9A 3UIEA 3WMGA 4JMPA 4A6PA 1XU4A 1OFIA 3GLHB 1QHNA 1E1RD 3K9HA 5JLJA 2A5JA 3GJ7A 4MYCA 4HZIA 2B8WA 2IWRA 4C9BA 2QU8A 1GAJA 3TQCA 1SKQA 1FZQA 1ZM3A 3VR5A 4XTCS 1GRRA 2IHYA 3SBEA 4OK5A 1W44A 3AEZA 4EQ6A 3W5IA 1S4QA 2Z83A 3TSZA 4QM6A 4TSFA 3PQCA 2ZJ5A 2H18A 2L0XA 1QVRA 2XNDA 4JLBA 4N0EA 4P4SA 1IAQA 3NKVA 4LV6A 3KQHA 4Q01A 3SZRA 2CE7A 5FPKA 2O0HA 5JS8A 4HATA 1NN3A 4RD0A 1J99A 1Q1QA 2I4IA 1HE1C 1E2DA 1TEXA 1NKSA 3BC1A 1AK2A 2JLRA 4X8OA 1R0YA 3SDZA 5G41A 1XJCA 3QY0A 1EXMA 2GF9A 3CRMA 1X8JA 2WWIA 3LXRA 4AD8A 1AN0A 4I81A 3SQXA 2BM1A 4ITRC 4XWAA 5L3SB 1J2JA 3WNCA 1JEDA 1E2KA 4DWJA 1PUIA 1Z0FA 4LWZA 1PVOA 3K9GA 3QKSA 4C0QC 1VYTA 2J0UA 4C4PA 4DB4A 1RYFA 2W6IA 5DI3B 2B21A 2BKUA 2WIAA 3CWZA 3CIOA 3LBIA 5A4JA 1VHLA 2QM8A 3GD7A 4PXAA 3RRMA 2GCNA 4BFZA 1J7KA 5EE9A 3KB2A 1X3SA 1SULA 4UNRA 5B58C 5HZHA 3A6PC 1NMXA 2IL1A 2VP2A 1FL9A 3VHXA 4A4DA 2V8OA 2J1LA 3GLIA 4XVUA 1NSFA 1Q0UA 3U2QA 1VG9B 4MRVA 2I1VB 4LDJA 3R8FA 3Q72A 4JLMA 4IKEA 3KKNA 4LY6A 1SQ5A 3ICQB 1KI4A 2CCKA 5HKKD 4HAXA 3GLGA 3NC0C 2OUKA 1ZNYA 3QBTA 2WSSA 1VMAA 2QPOA 4P33A 2FEMA 4JL6A 1IN7A 3LVQE 2ZRGA 1S96A 4BPBA 1W7AA 1U8YA 3TAUA 3K0AA 3EC2A 1TQ6A 4M1TA 1T3HA 2YC4C 2ZS8A 3FWYA 2ZRDA 2H57A 2ZVPX 1B0UA 2DHRA 1JR3E 2WJGA 2ZYTX 5EP2A 1Q12A 3K0CA 4C2UA 1ZRHA 3DOFA 4MGZR 5J4HA 2JJ1A 3QG1A 4HLUA 1GWNA 2WKQA 2QI9C 4DCTA 1RRCA 4HUQA 1VG0B 4GI7A 5CM9C 3DZDA 2R62A 3PV0A 2O8CB 1HURA 3ZIAA 3CF0A 4BUJA 2IS2A 1KZGB 2WKPA 5E7MA 2JLUA 1G19A 3CLVA 3OAAA 4LPSA 1TF7A 2A5FA 2V7QA 4B71A 4B43A 1SHKA 3TR5A 3W9YA 1YR6A 4IRUB 1S9DA 3IEVA 3RRNA 3EPKA 1G7TA 3SR0A 3QVUA 1TU3A 2GK7A 2J9RA 2J3EA 1W0KA 3UATA 1H65A 4ESVA 4ZIRA 3I4LA 5DN6A 1T8UA 1GL6A 3SFZA 2W83A 4OJKA 4B35A 1SVMA 4IOLA 2GBLA 5GVRA 1CXZA 1P72A 1EWQA 4ZO4A 1ANKA 4DLWA 1NG9A 2D7CA 3DKVA 3CPJB 4PC2A 2NIPA 3TW4A 3TUJC 2AXNA 2EFCB 1N6NA 1U0JA 1GL9B 2EFGA 3CPHA 4NYJQ 1PLKA 5P21A 2J59A 5AJVB 3TVTA 4BLQA 2LCFA 3NIBA 3B2EA 2CLDX 2B92A 4QXAA 1KY2A 5F9FA 2J41A 4Z1MD 1Z2CA 2FJUA 4R9UC 5IRCD 1HUQA 2ZE8A 5TV2A 4BLRA 2BOVA 2OXCA 3ASZA 4XSHA 5CJPA 4Q1EA 1Z6GA 4DT1A 1E98A 4TTPA 2GRJA 3S1AB 1DS6A 3VHLB 5KTYA 3W5JA 3K0CC 4W5WA 2WSMA 4NZYA 2ZVQX 1X8KA 4HLUC 2ZUCA 3W90A 5G3ZA 2QGNA 3QEJA 1XD2A 2B7CA 2WZQA 3PFIA 5FI0B 2GXSA 2V4ZA 2NGRA 5FPHA 5BYJA 5FR1A 4UNSA 1NVUQ 3A1SA 1P62B 2ANBA 4HZUB 4CYMA 4E03A 2D74A 2IBMA 4UXHA 2GJ8A 2Z0MA 3P4YA 3C7KA 1KI3A 4EPTA 5GJCA 2VEDA 3CX6A 1C9KA 2QP4A 1US8A 4HLQB 2UVQA 2C9CA 4NCJA 3BBPA 1OT3A 5JHGB 1KO4A 1ZUIA 4TTQA 5JJKA 1KDTA 1XTIA 2QMEA 2ZI7A 2NO7A 2GBLC 4JLPA 2OHFA 4LHXA 4RKEA 2AL7A 4FD2A 4B6EA 5FBLB 3V4FA 2XB2A 3IEUA 1AA9A 2VP9A 2H5EA 4MGKR 5G3YA 4LC1A 1AS0A 2DFNA 2D4HA 4TN1A 2F3RA 2CNWA 3N5CA 1BMFD 1G3QA 2FOLA 1Z08A 4YMUA 4GL2A 3CX8A 3THWB 4HB2A 1Z3IX 3T34A 1TMKA 4Q9IA 1W4CA 4DDVA 2EVWX 3JZMA 3CO5A 1LF5A 1SVOA 3AVPA 1CR2A 2DWPA 3E1SA 1OHHA 4JT2A 3SNHA 1ZM9A 3LXXA 5K8UA 3AVYA 4E07A 2JLVA 1YQTA 4XD7A 1G8HA 1IM2A 4GZMA 2GZAA 5FOVA 2F9MA 4TSFD 4G5GA 3I72A 2XNDD 5BN4A 3PEYA 1CIPA 1AM4D 3FOZA 3PR1A 4XWOA 5JCPA 1UDXA 2KI5A 5J4KA 3KJEA 4LRWA 1OE0A 3PXGA 3R9WA 2ZUBA 4O0MA 1FFHA 1TF2A 1A7JA 4MGIR 1HQCA 1CR4A 4Q7JB 3MAAC 3DHWC 3ZVMA 1TUIA 2DY1A 3P27A 3QKTA 1U90A 4FI3C 1MRNA 1XJQA 3L8ZA 4WAUA 1VG8A 1F3OA 3UG6A 4ARZB 4EPRA 3EA0A 2EW1A 2W2TA 4P0TA 3WYAA 2YJTD 1GZSA 3U4QB 3NG1A 2DFLA 1IONA 5HE8A 5C1BA 4AG5A 5JRJA 3R7WB 1FTSA 2NZ8A 4BLOA 3B7GA 4JLDA 2XGJA 3KDSE 2ZE7A 5FBWB 3T1OA 2XXAB 4O3MA 1VTKA 2N1BA 3FKQA 2XOKA 3CNLA 2QTVB 2W6ID 4KFRA 1UBEA 1AIPA 1ZYUA 2GDJA 4CT5A 3W8RA 3LVRE 3KX2A 4DCSA 1Q44A 1KO7A 4PFSA 5H1YA 5J4YA 4KBGA 1UF9A 3CPEA 3PEUA 4DCVA 1VDZA 1WQ1R 1P7CA 3SYKA 4DRZA 4XTRA 4BASA 3SEAA 4F4IA 5FOSA 1EK0A 4PHHA 1Z0DA 2YV5A 1Z28A 3LBHA 3J81k 3EWSA 2ZE6A 1CU1A 5FUVA 5AUNB 1SXJB 1NLYA 1KMHA 2ANCA 2PZFA 4L8GA 4Q5IA 5TB5A 5L3SA 4KLZA 3W6NA 4OI0A 4G3XA 1E2LA 2IUTA 2QAJA 3QEOA 1D5CA 4A0HA 3K0EA 4BWYA 3FFBA 3MCAA 1N5KA 1NKTA 2WSSD 2EFEB 3CRRA 3TW8B 5BN5A 1FMLA 1TPZA 2BEKA 2ORVA 4QJ5A 5KDDA 1G16A 1R5NA 3EASA 521PA 1UBFA 4LJ8A 4XWKA 4B74A 2AR7A 3DMDA 4OHXA 4BLPA 3C41J 4BQSA 4CRWB 1MR3F 4YMSA 3OF5A 1U81A 4P32A 2QPAA 3SI7A 5H68A 2ZR7A 4PQYA 1GL7A 2A9KA 4MKGA 2ERYA 3AGPA 3LY5A 4QL3A 3WP1B 2F1HA 3BE4A 5FOWA 2VP5A 1XMVA 5JWOA 2Q9BA 4B2LA 2QE7D 3OAAD 4IW3B 2V7QD 1ZVQA 1XTRA 3CF6R 1GRNA 2XTNA 4NH0A 1XXHB 4LK2A 4A2WA 1TF5A 3T35A 5LB4A 2ZYVX 3T61A 2RHDA 1DTSA 5EXXA 2IHBA 1W0KD 3CNOA 3HP1A 4LPKA 5HCNA 3GMTA 3QKRB 3U3JA 5DYGA 4GP7A 5DN6D 3IQXA 5JHHB 1G18A 2UZIR 3TJZA 1NL3A 2EWWA 5CM8B 3KUDA 3RSOA 4PC6A 3T06B 3DL0A 1C1YA 2MSEB 4FMBB 3BIFA 1K5GA 4OHVA 5DHFA 1KO5A 2GESA 3FVQA 1P75A 5C4MA 1R8QA 3DPUA 4E5UA 1WRBA 4XIGS 5F3WB 4Q1BA 1HY3A 1N0WA 1II9A 3OZXA 4OQNA 2G1JA 2WWFA 4R2HA 5B57C 1JR6A 2ZS7A 2OEPA 2P5TB 4M21A 4UJ5A 3TK1A 3KKMA 2CJWA 1I2MA 5AJYA 1N6LA 2J87A 3BFXA 4HLCA 4JT4A 3TNFA 4B6FA 1EFTA 3P1JA 3VQTA 5TMPA 3WYGA 3U6BA 2ZANA 2JIZA 2KBFA 3I8SA 5DHAA 1N6HA 2ZRKA 4DDWA 1OXTA 4YQFA 2QNRA 1N2CE 2EU8A 3IDQA 2GEDA 4OK3A 1U0LA 2DFKB 3MG9A 4CT4B 3BERA 3RS0A 4ZV4A 5KUTA 4MQBA 5EJEA 4DBLC 1XTKA 1ETUA 2CXXA 1NRJB 1NBMA 2ZR0A 1C4OA 2CL6X 2FU5C 3H0KA 1KMQA 1F5NA 3F8TA 3ND8A 1W0JA 3BXZA 5FUXA 1RZ3A 4Z54A 5J4LA 5EUMA 1PUJA 4PHGA 4PAMA 2WPDD 1ZINA 2P65A 3VR1A 1U2RA 3K0FB 5FFMA 2QEQA 5L3QB 1TUEA 4H9GA 3RYTC 2XJ9A 4O2RA 1PV4A 1IXRC 2BHRA 1YZQA 4HEJA 3BJIC 5L3VA 3BS4A 4Q9KA 1E69A 4D4MA 2IS4A 2REXB 1CBUA 4WZ6A 3GLFA 2OFXA 4B75A 1YZNA 5EP3A 3A36A 3GJ6A 2R65A 5GVSA 3I8XA 3A37A 4A0GA 1OFHA 4ON9A 4PANA 2DB3A 1JXOA 5JSZA 5IHPA 1ZM7A 2P6RA 2BC9A 4ACAA 4S2EA 2VF8A 4C7OB 3CRVA 2AXPA 4U7DA 1T6NA 4MA4A 2XX3A 4A82A 2XTZA 4HSEA 1N0VC 4RFVA 4XD7D 4ZPXA 2BMEA 3VFDA 3HR8A 1G17A 1GOTA 2MSCB 5JZVA 2WTUA 2K5UA 1AS3A 2ZAOA 2LKDA 2O8DB 3IO3A 2FFBA 5EP1A 4CW7A 3JVUA 4QJ4A 3QI2A 5FOTA 5TY0A 3TRFA 5KNBA 3THWA 3CR7A 3EZ9A 1FMJA 4UNNA 3SQWA 4A92A 1T9HA 1KO1A 2CLSA 2YINC 5KOYA 1KJWA 2YHSA 1G291 3AUYA 1ESMA 4H1VA 5EE3A 2RGBA 3L2OB 1TQ4A 4DCUA 4URXR 1OW3B 3WBJA 3EIEA 4BFUA 4L5BA 1CKEA 2OAQ1 3QXXA 4A1FA 2Q3HA 3K70D 4ZI3A 1JNYA 3E5HA 4OYHA 2MSDB 2VQSA 4AI6A 2FFQA 3IHLA 2GKSA 121PA 5AWFC 3WBKA 4XJXA 3M4YA 1WF3A 1JPNA 4D0LB 2F7SA 3RS5A 1OJLA 1ZBDA 2OT3B 1OIWA 3T1VA 1VKJA 3B9QA 3U3OA 1CR1A 2ZRLA 1S3GA 3QVVA 3UG7A 1NG1A 4BZQA 1VIAA 3QBVA 1JXMA 2F3TA 4RVCA 1E2PA 2F43B 1E0KA 1QHHB 1LB1B 2EQBA 5BW8A 1P4SA 2QAGB 5TDHA 2N46A 5JEDA 3Q85A 4TMVA 3VU9B 4CEJA 5DE3A 3G82C 1HEIA 4ARZA 2AWOA 1MT0A 4EPWA 4OI2A 4DXAA 1N0UA 3K9LA 1Q1BA 5EXSA 4MITA 4EIWA 3R7WA 1CJTC 1JJ7A 2GXQA 2XXAA 1IBRA 4LJ4A 3RVBA 4MRPA 1M7HA 2F6RA 2VL7A 1FNNA 3FHCB 2VRWA 3NDPA 2RGAA 2IT1A 1F2UB 2VO1A 2ZJBA 4MRNA 4AKGA 4RSGA 3N2IA 3L0OA 3VAAA 1II8B 2JLWA 3TVDA 1Z0JA 2BDTA 4Q7MB 1F6BA 4HLDA 1U94A 4K81B 5FR2A 4ESHA 4Q02A 2GCPA 1T91A 1Q1ZA 4CF7A 5KHOC 5GJWC 4JKIA 3TQFA 2X19A 4PO1A 4RZXA 2JATA 1LFDB 1SGWA 4Q7KA 3FTQA 2JLSA 2H7VA 1G3UA 1KSJA 3ZD6A 1GUAA 3OFNA 3PENA 1T0HB 4N3NA 1OIVA 4W7SA 4YMWA 2QY9A 2JA1A 1LNZA 3PUXA 3PITA 3TGPA 4G5RA 1DAFA 1OIXA 2GHIA 2I1QA 4NONA 4X8LA 3WYFA 2ZM5A 3GLIE 2VBCA 1XTSA 1UAAA 3CZPA 3LLMA 5FL7A 1ELOA 4URZR 4ZKEA 1W4AA 4M9SA 2R2AA 3VMFA 5HR5A 3LAWA 2AK2A 3NEJA 1OXVA 1E2IA 3MWJA 4D82A 1Z22A 5AJXA 2RKOA 3AKDA 2WICA 1UBGA 1YZTA 2BJWA 3R20A 2C99A 2YWFA 5FBRB 3BD9A 1D2NA 2CHGA 4FXPA 4A9AA 4ZCIA 3ADCA 2A7QA 1K5DA 3PJRA 1K6MA 3PIRA 1M2OB 4OHZA 3LV8A 4Q4AB 3NBXX 3SS8A 5FOXA 3T15A 2WWWA 5KSZA 3PCRB 1J70A 2G0TA 2ZREA 5IT5A 1IY2A 1NJGA 3UMSA 1W36C 2RH5A 4KJZA 4JVSB 1GIAA 1WBDA 1CJMA 2XZOA 2KBEA 4LBZA 4JL8A 4MGYR 2QBYA 1G3IA 1SVKA 5FTKA 1GDDA 5FTNA 4UJ3A 4IDNA 3E70C 3CF2A 3REGA 4D2IA 1YJ5A 3K0SA 1E0AA 1SVSA 4LJ7A 3BWDD 1T4GA 4LHYA 1XNJA 1IY1A 1FUKA 3A4LA 1L4YA 2REOA 1P6XA 1TADA 1UADA 4EUNA 3H1TA 3FPAA 4GZLA 3ASYA 3LBNA 1XP8A 4KCGA 4KI0A 1YZGA 2DBYA 4ZDJA 3HU2A 3A4MA 3A1UA 3CW2A 4LBVA 3LO5A 2RGCA 4LUCA 1NBMD 1HA3A 2CK3A 1EGAA 4MKHA 1TTTA 3AVWA 3L82B 5LPNA 4R7ZA 1FOEB 1KI8A 1EX7A 1P61B 1TNDA 3T5GA 1IN6A 2PJRA 5GADl 4PZLA 1Q20A 3OE7A 4V0KA 3AVXA 1KAOA 4OQMA 3B13B 2IYZA 1E9EA 4PHFA 5IK2A 4AYXA 4P31A 1DE0A 3T1TA 2QM7A 2CCJA 2HCBA 3GJ0A 2CE2X 2JLQA 5E3HA 5E7JA 1QHYA 4FWTA 2ATXA 1GVNB 1S2MA 4P3YA 5KDOA 2XSZA 2P2LA 3D31A 3I92A 5BYKA 2OE2A 2FDCA 1JPJA 2QSYA 1HTWA 2JLYA 2WM9B 4CEHB 3TMKA 4B3DA 2PLFA 3KJHA 5J5CA 3OESA 2GJSA 2ZI3A 3B60A 1T3SA 3CRQA 3GFOA 1E3MA 5JMTA 4A8JB 4LJ9A 4FN5A 5F98A 3UMRA 2DYKA 3HJNA 3K0FA 3CUEF 3EPJA 1E79A 1X1SA 1FQKA 1HV8A 1OV4A 2W2XA 5C18A 4MDFA 5KYKA 1KI7A 4ZDWA 4GMXA 1JAIA 1F60A 1LY1A 4D4LA 2V54A 2C2HA 1N3BA 1NIJA 4TYNA 3RS4A 1D2MA 1G1MA 3U44A 1DAKA 4AG6A 2PH1A 4JLKA 5FTJA 5E95A 4IEEA 4O2LA 4QNMA 2ERXA 2J7KA 3MWYW 2NZJA 3QNUA 3KFXA 4I99A 4A2PA 2A2ZA 5LD2B 4RD2A 2GK6A 5KO2A 4C7OA 3U7FB 3LX8A 1DAGA 2TMKA 1G6HA 3HYRA 4WZBE 5G53C 4FMDB 3ZD7A 3THXB 3KTAB 1VCIA 2RAPA 2ZSFA 3RLFA 2BM0A 2A5DA 2FFAA 3I32A 3LH5A 4DLSA 1JEEA 2VHTA 2ZJ2A 3L0SA 3AF2A 4B34A 2QQ0A 1S1CA 5JECA 3WNBA 1TU4A 1G8YA 4W5JA 4QBHA 1XB2A 4FCVA 3AQ4A 3KQNA 1P3JA 4DLUA 1MO3A 2JEOA 2R6FA 3QF7A 5B2ZA 1E9AA 4WIAA 3TAHA 3GQBA 2W0MA 5FPYA 1KJYA 5AJWA 4JLOA 1W2GA 2G88A 5EZ5A 2CHVA 2ZRCA 1E2JA 4DB2A 2OLKA 3MGCA 2ZETA 3THYA 1XEXA 2IF0A 2NG1A 3TE6A 3NC1C 1QG4A 2JGNA 2P5SA 3B1YA 4GBMA 4TZ6A 3UPUA 2R6CA 2DWQA 421PA 1FW6A 1OFTA 4JSTA 3SJAA 4M9XA 1R0WA 2C5LA 2NMVA 1RW4A 2GXUA 2KWIA 3KB1A 5C46F 4BFSA 1XMJA 2JDIA 5SZIA 2GVDC 1UKVY 3GJ3A 4JJKA 3UKDA 1KI6B 4TQAA 2P3SA 4CEIA 2AWNA 1QHHA 2IW3A 2QPTA 3IBYA 1JQJC 2Q21A 2CL7X 2QAGA 1DEKA 3Q5DA 4IDPA 1N6IA 4E22A 2GAOA 3FB4A 3VU9A 4EJSA 2PX0A 2E1RA 2ZRPA 4HYYA 3AV0B 2OM2A 4TT3A 1Z83A 1L7VC 3TIFA 4DKXA 2O8EA 4IJMA 3CKLA 1G20E 1KI2A 5J40A 3EIQA 3M0EA 1BO6A 1DAHA 1T5LA 4LHWA 1ZW6A 4GFDA 4TYYA 1SZPA 1UJ2A 2P6UA 3WMEA 4QC2A 4PC7A 4WOPA 3TSOA 2C98A 2CDNA 2EFDB 4NDZA 1W49A 1G41A 1DAEA 3CNNA 4OL0A 3U3KA 3MRSA 1E1QA 1I4LD 1YZKA 4LJ6A 1KSGA 2O8BA 2VSOA 1CRQA 1Z29A 1Z6XA 4Q1DA 5CB8A 1F48A 2Z4SA 3NDBB 4DEXA 1UPTA 2D2EA 4KFSA 4TQUS 1XD8A 4DIEA 1JB1A 1J8MF 2ZSEA 3Q9LA 5GJVC 2B8TA 1AZTA 2ZYWX 3QXSA 1KYIA 1YZLA 2QP9X 1KSHA 1L8QA 2FSIA 2WJYA 4M22A 4AY2A 5FL7D 2KE5A 2ZUDA 1NY5A 2HF9A 2Q0HA 3C4JA 4RKFA 3NVAA 3VX3A 3W6PA 2HEIA 1E9BA 5CIWA 5AK0A 3RC3A 3QF4B 1XCGB 4M1YA 1LTQA 3LD9A 1E0JA 4QBGB 3A8TA 5FTMA 4ZKDA 3PG5A 1DO2A 1EFCA 1WDTA 3GJXC 3K53A 3PVSA 4EPVA 5DYIA 3B1XA 3OHMA 2C8VA 2FSGA 2QAGC 2CL0X 3NH6A 1EX6A 4EJSC 3THOA 4NCIA 1NNEA 2V6JA 8OHMA 3TR0A 1TX4B 4L9SA 1BYUA 1BIFA 2F1RA 1SVLA 1KIMA 3NTUA 1DAMA 4CZ2A 1W5TA 1UDWA 1JAHA 1W47A 1EG7A 1Z07A 2XITA 3A4NA 1K8RA 3GLHA 4ILEA 2FEOA 2H17A 1R5BA 1ZP6A 2C96A 3NH9A 2RHMA 1TQ2A 4HAYA 4F93B 2DFTA 2DPXA 4TMKA 1GM5A 4BGDA 3ADKA 4Q4AA 1RKBA 3HWSA 2JAQA 5BWMA 3KKOA 2H16A 3VX4A 4Z51A 4MKIA 3WRXC 2W00A 1JI0A 4G5OA 4G5SA 3QQ5A 1H8EA 2NO1A 1KK0A 2P0EA 3OE7D 2QTHA 2WOOA 5J4VA 1HYQA 5JJLA 2ZSDA 4IOJA 3R9IA 3QKUA 3QXJA 2G83A 1PLJA 2LKCA 4DLYA 3NEYA 1XFAA 4OQFA 2V1XA 3HPRA 2ZJ8A 3H84A 1I4TD 3GEHA 1YHNA 1XMSA 4QBFA 2F9LA 5JJIA 5EQTA 2BIFA 1OPXA 1E99A 1MABB 2V6IA 4URYR 5EUQB 5SZKB 4WW0A 4YMTA 1SVWA 1NMZA 3U6KA 3H2YA 1P9NA 4MH0R 4BE7B 4Q4HB 1M74A 4QNRA 4FWIB 3NWJA 2VHUA 4LBWA 4QFMA 2QGZA 5B30A 1V5WA 5DI3A 5JI2E 3I5XA 2BWJA 1IHUA 4LJYA 4AWXA 1Q3HA 3U3MA 5CIQA 5TVKA 1UBCA 2HYDA 2GTPA 1FNMA 2HXYA 2YWGA 3SU8A 3IIJA 3I5YA 1DO0A 1E79D 1RE0A 2C03A 3ZZTA 5DNYB 3GP8A 4YDSA 4I1VA 2H8KA 1OH7A 1OYYA 2J7PA 3A58B 2FF7A 2HF8A 4DJTA 3VKHA 4TL6A 1DOAA 1GRQA 2FZ4A 2QMUA 1TL7C 4F7WA 1Z0AA 2JJ1D 1ZIPA 2BVNA 1CJKC 4LC0A 1G8GA 3GCGA 1NBME 2GCOB 5D3QA 4F92B 2WIBA 2V55B 1NMYA 2YWEA 3K09A 1W5SA 1XEFA 2NPIA 2ONKA 3FDIA 4V03A 4Q9LA 3ZIAD 4YMVA 3RABA 1ZJ6A 2BEJA 5EZ6B 2OESA 1ZD8A 1WMSA 1U8ZA 2ZI4A 3A1VA 3QJYA 3I3SR 1T8TA 3HDTA 3SC3A 3GPLA 4BECA 1OB5A 4UQOA 4GT1A 4BZXA 1JECA 2ZTSA 4EPXA 5J47A 2VP0A 3GEIA 4NCKA 4RCZA 2QRNA 4RFSB 2CVHA 3EARA 2FA9A 5JEEA 2GF0A 4IOMA 2H92A 4RCYA 1A1VA 2QROA 2IS6A 4KYUA 4B3BA 2O8CA 3I61A 2ZRNA 3GLFE 2Z4RA 3QXCA 1CF4A 1A82A 2W2VA 4YONB 3O8BA 3B1ZA 4PAOA 2J45A 4JBWA 4BLTA 1NF3A 4F91B 2WWYA 2XZLA 3THXA 3FE2A 5CK4A 5JI3E 5K8TA 4L4UA 3UXMA 1M7GA 1RRFA 2W58A 4EQ6B 2HT6A 4CIDA 2ZRBA 4FMCB 5CYOA 1IN8A 1HH4A 4TLCA 3LW7A 1GKUB 4JLNA 4KO8A 4PC1A 3EG5A 2C77A 2VIIA 2REBA 4P4SB 2OAP1 1UM8A 2HT1A 4AKHA 1KK2A 2G0NA 1D2EA 1Z6AA 1SKYE 2GAAA 4KFTA 3ZVNA 1P2SA 4AIIA 3KKPA 4RZ2A 3AF3A 1ZCBA 4C0AC 2ECKA 2F1JA 3ZGXA 4Q19A 3K09C 3MLEA 6Q21A 4TT3D 2WOJA 1P2TA 5DLQC 2LWIA 3UWOA 2D62A 3A1TA 3DMNA 1XPOA 2PT5A 4RJLA 3HR7A 4FIDA 1VIYA 3AGQA 1N5JA 4LX0A 3S1AA 5K8LA 3V00A 4DC9A 4Q1AA 2WAXA 4AK9A 5LDDC 2IA5A 1Z47A 4JBYA 2PCJA 3ICEA 1R4AA 5HE9A 2RGNA 4IHQA 4IEIA 1KHTA 1IN5A 1KI6A 1OXXK 4IDOA 5E4FA 2J0UB 3AVUA 2BBOA 2OLJA 3T1QA 2IWHA 4TLBA 5GJBA 3Q7QA 4O25A 4PX9A 1E96A 1E1QD 1DELA 2C9OA 1UKYA 2WJVA 2ORWA 4K46A 3V9PA 3FHOA 1XZQA 1VHTA 1YVDA 1U99A 2YYZA 4XH9B 2PX3A 1Z8FA 2OBMA 3GLIB 4HZUA 1F2TB 3AKEA 5FOUA 5H70A 3SJBA 1COWA 2E9SA 1P2UA 2FWRA 4PSKA 2CNWD 3PUWA 2QMOA 1GKIA 4F4CA 3ADBA 3L0IB 1MO4A 1YE8A 4DUGD 3T12A 1Z0IA 5CITA 4JVNA 1AJEA 4U5XA 4U02A 4JLAA 1IY0A 4V0LA 1CTQA 1Q1EA 1W48A 2X8AA 3C16C 4B44A 3HPQA 3ONWA 3K0AB 1OHHD 3MSXA 1TEVA 1ZIOA 2OCBA 4TL9A 5CLLA 3EIHA 4X8MA 2GEUA 2Q3MA 2ZRHA 5H8WA 2OXRA 3QENA 3QG5A 2G3YA 5CDFA 1N25A 4KSCA 4JSYA 4LJ5A 1KDPA 3BB1A 1BYIA 4DLXA 5FBQB 1KDRA 4DSOA 1QHGA 5HKKA 1A4RA 2WHXA 2VPPA 4HUQB 1ZAKA 5CB6A 2HLDA 3X1ZA 2ATVA 2FG5A 3C5HA 4PSVA 4Z8YA 3SOPA 2Q6TA 3BH6A 1E32A 3QE0A 4ZCMA 2RGNC 2VF7A 2QUZA 2JLXA 2J0SA 3GFTA 5K8IA 3UK6A 4Q21A 4OK6A 1CEEA 1Q22A 1KSFX 3ND9A 1G4UR 2IXEA 3B9PA 1DPFA 1U9IA 3ZS9A 2QZ4A 2PZEA 2X1VA 3IQWA 4ZIRB 1E9FA 5BQ5A 2IX3A 2DWOA 4URVR 4DSUA 3PUYA 3KJIA 2RMKA 1Q21A 3O8RA 1H8ED 4MRSA 3KXLA 2AX4A 2HJGA 3TBKA 2IF2A 2ZRIA 4DEYA 3RC8A 2IXFA 3ZZUA 1J90A 4ASUA 2JJ8A 2XOKD 1IJEA 3DDCA 4M53A 5JS7A 4HDCA 2PEYA 4Q66C 4Q47A 2VTKA 3X2SA 1KTVA 1KJZA 4PQRA 5KU1A 4TQ9A 3RHFA 4DSTA 2G1KA 3GFPA 4QG7A 3KQKA 1MKYA 2W0SA 2YVUA 4JVMA 5JWHA 3VTKA 2ZU6A 1SHZA 1UFQA 3K1JA 5DSZA 3VKWA 3WRYC 2ZEJA 3U4QA 1Z0KA 4A0FA 4LHVA 3CZQA 3BH0A 2BMFA 3MMPA 3U7HB 3CM0A 4V0MA 2FMXA 4H1UA 2PT7A 1AGPA 1NVWQ 3T5DA 4AKIA 4DHEA 1NN0A 4A2QA 1IQPA 1ZM4A 4QBIA 2IUUA 3FYHA 2WWGA 3MUFA 2JJ2A 3NXSA 1E0SA 4J0QA 1XD2B 5EE1A 2Z5FA 1Q3TA 4Q9HA 1V43A 2D06A 1AQUA 4B2IA 2FV8A 5FL3A 4Q00A 5DI9A 4KBFA 4K8OA 2GJKA 1YR8A 4Z8XA 3RDPA 3VR2A 4B76A 2J7PD 2WJJA 4QM7A 1S3SA 3NBYC 4A36A 3GJ5A 1SXJA 3OIVA 4UXJA 1KK1A 2ONJA 4DZZA 4R98A 5D3MB 1X8LA 2E87A 3BFKA 1U9IC 1MO6A 4LOAA 1US8B 4LJAA 2WBLC 2XEXA 4BFTA 4EKDA 3FMFA 2CMKA 4IVRA 4II7A 4LI0A 1DBSA 4TL7A 2WWXA 4GSYA 1Z2AA 2R6AA 1S9HA 1VYVA 1G8FA 3IGFA 4LYAA 1S0UA 2ZI6A 3X1WA 1RC8A 2UZ3A 3A1WA 3I62A 4US1R 1DVRA 2VSXA 4PZYA 4QGAA 2OCYC 4IVPA 1XBTA 3JVVA 1VCMA 4MYUA 1NN1A 2R44A 4NL4H 1YKSA 4D4KA 4G1UC 3X1DA 2J5XA 5FPSA 3PEWA 1E2FA 3KKQA 1ZUHA 3OEHA 4XSGA 4QRHA 2ZRFA 1MRSA 1QBKC 4DVGA 3NHAA 1WP9A 4KV9A 1GNRA 5G40A 3TUZC 4UNQA 3GLGE 2YWHA 2N42A 4Q4LA 4DLZA 4OKSA 5LBIA 1XXHA 2VLIA 2RCNA 4GNKA 2GNOA 3D8BA 3DKPA 3HU1A 3PEVA 4I4LA 3AM1A 3LRPA 4KU4A 4MDEA 3WMFA 4QOSA 5FUWA 2FPMA 3QKRA 4GOXA 2A30A 1BMFA 3HYTA 4JBXA 1R2QA 5AR1A 3EA5A 5KSPA 1N6OA 4JS0A 221PA 2IYTA 3KL4A 1ZD1A 1E2MA 4U00A 2IYUA 2JASA 4KFUA 1SXJC 1FPMA 4D81A 2C9YA 4JVLA 4PO9A 2JIZD 4LSGA 2HUPA 1JJVA 2ZRAA 2FNAA 1XF9A 3BB3A 4LV8B 1ODFA 3EZ7A 5F9HA 3IHWA 3MWKA 4C0BA 1E9SA 3RS2A 3WHLA 4R2IA 1J8YF 5FPTA 4B3GA 3B1WA 5E7IA 1ZU4A 3K70B 1E2HA 4L16A 1OXUA 1Q57A 3FKSA 1EFRA 4ERNA 2OSBA 4AYTA 2KJQA 3ECCA 1XEWY 2OCAA 2Y8EA 4MYTA 3ZH9B 2Q9CA 1ZD9A 4LYFA 2XZPA 4XVQA 1DG1G 2ZIAA 3AH8A 4B2PA 2D3WA 1BKDR 2O5VA 3E2IA 4RZUA 2X77A 2RGGA 1W0JD 4NCNA 3KJGA 1FX0B 3SYNA 1P9WA 1XCMA 4RD1A 5FBVB 4GRAA 2IYVA 1E6CA 1U98A 2P6NA 621PA 4JYCA 2NO0A 3AF0A 4MYHA 3TH5A 3ZVRA 4AURA 2OFOA 2V1UA 3AP3A 1G7SA 1FP7A 1COWD 3KXKA 4M1OA 4QKQA 2BMJA 1DADA 1UKEA 4TMXA 4Q18A 3O8DA 4KODA 1KMHB 4M1SA 3RWOA 2O52A 5KPDA 4M4SA 2BBSA 1G4AE 5JCZA 3DEFA 4JL5A 1JBKA 4EFMA 4V0NA 3GJ4A 4ZI2A 4I1OA 4FINA 2BMDA 3B8HA 1D6JA 4KYIB 1VCOA 3BAFA 4M1KA 4YDHB 3IPYA 2IEYA 2VH5R 4OI1A 2YC2C 1AGRA 2PBRA 3SJZA 2WMNB 4CVNA 1RJ9B 2GETA 3B78A 4JZKA 2RGXA 5L3QA 3U60B 2D2FA 1F2TA 3FFAA 1ZNXA 3U7EB 1YU9A 4I1SA 1QZXA 4GOKA 2C04A 3AKCA 4HDOB 2BBTA 4D80A 1YRAA 3P20A 3EAQA 2HLDD 1DAIA 3L43A 4D0GA 4KSBA 5DIFA 3UMFA 3VR4A 3KQLA 2DCUA 1QVAA 2IYLD 1LVGA 1S1MA 4YC7A 1X1RA 3M6AA 1VECA 5KNDA 1NIPA 1E9DA 4AKEA 4C0HA 5JRZA 5ELXA 2MMGA 4TZ0A 3EZ2A 3QPVA 3UANA 1CR0A 3N2EA 2O8FB 2WJIA 3BGWA 4QHSA 2V9PA 5KNCA 1Y3AA 3P32A 4MRRA 3LNCA 1QG2A 4WZAE 3W3AA 4WXPA 1CULC 1N5IA 2O8DA 3QIAA 5JFGA 2X2FA 2RB4A 1EWRA 1PLLA 3SN6A 4BEJA 3REFA 1FUUA 2BJVA 3RS7A 2YNMA 4BFYA 4ASUD 1YR9A 3F0TA 2QE7A 4HAZA 5KSOA 1OFUX 1UEIA 4WXRA 1ZC3A 2ZSBA 4IOKA 4L9WA 2Q9AA 2FSFA 3IILA 4PAQA 1NP6A 2A78A 2PEZA 4NPHA 4Y0VA 2VP6A 1GKYA 4A0RA 2QSZA 3BK7A 3LFUA 2P67A 4LYHA 3FMOB 1WBBA 2GEVA 1OLOA 3B1VA 4IXNA 1HT1E 3BOSA 2ODNA 3QOFA 4Q48A 3RANA 1N6KA 1G5TA 1RVDA 3KQUA 3AUXA 4EDHA 2ZI9A 2OG2A 4QGHA 4JLVA 1R0XA 3TUIC 5AUPB 2NO6A 1WA5A 3M1IA 2CJWB 3LA6A 2CEAA 1G9XA 1SVIA 1GITA 2HXSA 4LYJA 3Q5EA 5IDVA 2ODEA 3CBQA 3WY9A 4TLEA 1CJVC 2ZYUX 2F43A 1NI3A 2JJ2D 2V3CC 2VSFA 1G5PA 4NE2A 3TKLA 3AVQA 4HI0E 3GLHE 4NHOA 4Q9JA 4BEBA 4IVQA 4TMZA 2NPFA 4RD3A 2ZJAA 4OJQA 4C0KA 2KB0A 4LV5B 1W36D 1AS2A 3L8YA 5FTLA 3WP0A 1SXJD 1IXSB 4FCTA 4PR0A 2X2EA 1Z63A 1FTNA 3SBDA 2IXGA 5SZHB 1E9RA 4PQFA 3ZLJA 1M7BA 3RRYA 4E09A 1N6PA 1G21E 1LS1A 4PPGA 4Q03A 1NVVQ 2H1LA 5C2JB 3ZZ0A 2CCGA 1WCV1 4QHTA 2OCPA 1VYUA 3ZQ6A 4D0NA 1F2UA 1KZ7B 4ACBA 1Z6YA 4DSNA 4TLDA 1HE8B 3OFND 2FSHA 2FH5B 1JR3A 1II8A 5EXPA 1OH6A 4NYIQ 5FI1B 1X86B 3AVVA 2ZAMA 4ZCLA 5D3MA 2WMOB 5TARA 4N1AA 4HDQB 1R7RA 1OXSC 4Y0AA 3X1YA 3GLFB 1GILA 3OEHD 4EFLA 3P26A 3OIUA 3EXAA 4M0LA 4N0DA 3I1FA 1IOZA 4TYWA 1KNXA 4PSAA 3AF4A 2WPDA 5JSZB 2YOHA 2GXAA 2FPKA 1LV7A 2QN6A 3ETLA 4CGZA 1P60A 1P5ZB 2QTFA 1RFLA 4RZ3A 5IF9A 3NHBA 4HB3A 4BRUA 2FGKA 4P4UA 2QMHA 3RAPR 3AP1A 2YZ2A 2ZPTX 2IYRA 2EYQA 2ZU0C 1SKYB 2R6DA 3BORA 4HAWA 4NBSA 1GTVA 1KI9A 3OEEA 3FMIA 2ORIA 2EWVA 821PA 3LX5A 2QRZA 5A5GA 4Q7LA 4Q4JB 3CR8A 5SZJA 3SE0A 3IBGA 1X6VA 3NBFA 2ZRMA 3VNUA 5UKDA 1QF9A 3SHFA 2ZITA 4JYBA 3Q3JB 3EWAA 5FUYA 4DIDA 2C78A 3FKSD 1EFRD 1XEWX 2ZJOA 5ANRB 4BFVA 2ZR9A 1DARA 3C5CA 1IJFA 4OQLA 3JZAA 2GJ9A 3CB4A 4TL8A 3Q8XB 5AUOB 1PJRA 2CK3D 4RD4A 1MOZA 2OV2A 4TMWA 2ZE5A 4IFBA 4PPFA 2ZI5A 2ASEA 4D25A 2B7BA 2ZSAA 2BCGY 3FMPB 5IK2D 1CLUA 2AK3A 3AB3A 3W6OA 4GOJA 2IS1A 1EESA 2R8RA 3DOEA 1M1YE 1N6RA 1ZCAA 2NQ2C 4PC3A 3LWNA 5FH9A 2A5GA 1XCPA 1ZM2A 2PJZA 4CEJB 1OB2A 4EPYA 3IIKA 1VPLA 2XSZD 2R9VA 4NTZA 4KITB 1E4YA 1TQDA 2AD5A 4B3CA 1NY6A 3KUCA 2ZXUA 1YRBA 4UXIA 1G7RA 5HCIA 4DDUA 4HB0A 4YXWA 2J0QA 5HPYB 3B5JA 1XDBA 5DGXA 1RPZA 1OYWA 4XOIA 1FX0A 1GFIA 1JQLB 4BRWA 5BN3A 2QT1A 2KSQA 2YOGA 2ODBA 3QPUA 3B85A 3ZVLA 3C8UA 4UNPA 1JALA 2IEZA 4WA7A 1QRAA 2RGDA 5EP4A 4DUGA 1EFUA 2QORA 3CRW1 4P4TA 5DO9A 2W6JA 1W36B 2MMCA 3EW9A 5DH9A 2C95A 1WE2A 3R9XA 1XTJA 1W2HA 3D7MA 3AP2A 3OIYA 2FFHA 1W4RA 3ZDQA 4CEHA 2J46A 1R10A 2OBLA 1KAGA 1VCNA 1XWIA 4B32A 1OH5A 2QENA 3AVOA 1M8PA 1L2TA 3IUYA 1ZNZA 2PCLA 2ZRJA 1UEJA 3IKJA 4A8JA 2IYYA 4M1MA 3V4RA 2HCJB 2BV3A 4C0LA 2O0KA 3EZFA 1XPRA 1RJ9A 4B33A 3TSWA 4LZZA 4M8NE 1LF0A 4HB4A 1D9ZA 5JBQA
chains in the Genus database with same CATH superfamily
4BNWA 3ZLTA 4FMDF 5IC6A 3DTVB 1U5BA 5DTJA 3BVPA 4CIXA 3FYUB 5EJ4A 1A5TA 2OBNA 4EKEA 4XR4A 5LB2A 1Y3IA 1UKZA 4KQJA 4QQKA 2IYQA 3TLMA 4DY4A 4TPKA 3VNBA 3BB4A 3PUZA 2W2PA 1CRPA 2XYVA 4ZOEA 1NN5A 1D1QA 5KSYA 5K0EA 5KYXA 4G9BA 2Z1DA 4FOSA 3B6EA 3ZIDA 3EIUA 4X63A 2P3LA 5EMMA 1DDOA 1H8HA 1RRPA 2FP4A 2VOEA 3DM9B 4FDMA 4GRIA 1OI4A 2H2GA 3D4BA 3ETGA 3GCWA 3ROZA 4GUAA 4PGGA 4RETA 1WWKA 3CR3C 3LSYA 1T4DA 4EGFA 2CBZA 1NVVR 4PLGA 3WFZA 4EJFA 3KTAA 1F6DA 2YR0A 1NLFA 1IBLB 2FZLA 3CX7A 2HO4A 3FCCA 3SYMA 5FV7A 4CV2A 1DQSA 4RTQA 2UU9B 3F3YA 4L4XA 4NATA 4YRNA 2CFCA 3U17A 3O1HB 3AL2A 3PLRA 4X93A 5EMNA 5CDFE 5FO0A 3TB6A 3VKGA 3VR6A 1FP6A 6LDHA 3TCXB 3KETA 3L06A 1A9OA 5IH3A 4DMLA 3UFBA 1ISIA 5IU6A 5L7TA 2I7VA 2JDID 1KI1A 4CR7A 4QUIA 2HYIC 3P5BA 1KKLA 3JQRA 1MG5A 1P91A 5EEGA 2QT0A 4PX2A 2G6BA 3RWMB 1RYHA 4YCBA 2NU8B 1XDSA 3D8UA 4YROA 1HT2E 1F8FA 5KS2A 5K9ZA 4TYPA 3RVQA 2IK8A 1N5DA 4YUZA 3TLAA 3JQGA 3OQ1A 3KLBA 2CLOB 2AHOA 4WK2B 3DUFA 3PUVA 1E5LA 5TJHA 2NZWA 4RTJA 2VUTA 3AC0A 2QN9A 3Q7PA 4NK4A 4RPLA 2RHGB 1RQPA 3F5FA 4PW0A 5BXQC 4U3JA 4Y1RB 3G7SA 3LPMA 4WJKB 2CLFB 2RHOA 4LRTB 2JZNA 1YDEA 2PQMA 3EEFA 4PPNA 2RK3A 3RREA 1ONBA 4ES6A 4BATA 1JNXX 3WAKA 3KE8A 1RXSA 3HDYA 4R54A 3P9XA 5KYWA 2Z8ZA 4XARA 4FYWA 1NMQA 3PEEA 1PQUA 3DT8A 5P8WA 4BFXA 1QHIA 4WLOA 3L9WA 2EBFX 3PZBA 1XWWA 4S35A 5C4GB 2VHZA 2ZVJA 1FSSA 5DWDA 2N75A 1SC1A 5EN4A 3UK2A 1ML3A 1T4MA 4MV7A 5TRTA 4F4DA 2IYSA 3WLAA 4DR4B 2FSSA 2ACVA 5E7QA 1NI5A 3OQBA 5AVRA 5BORA 1G6OA 1HZZC 1TVKB 1XRMA 4LCBA 2FK8A 1V0JA 4LRSB 2AS0A 1WMAA 4BB0A 4EHFA 5L4NA 3WA7A 2VHQA 2CLMB 3DW3X 4C7BA 1W59A 2QL7A 2E7ZA 1I6WA 3W8NA 1OXBB 1YMQA 1KNQA 3L6DA 1O5IA 4YLGA 5CFQA 1KH2A 2YMPA 3RQIA 2AFIE 2Z3ZA 4UCFA 4FDUA 3EAGA 2FXIA 3F3MA 4R5HA 4EHLA 1QOPB 4PNZA 4Z4HA 3ZJVA 4FFBA 1Z6TA 3UH1A 1JU3A 3IP6A 2HDNB 1C3VA 3VPHA 4DQ0A 2NUTA 3HO1A 3LW8A 1TUBA 5CH8A 1XTQA 3CNHA 3ETHA 4HX2A 4EG7A 3MJVA 3KLMX 2HIHA 5JO9A 3MS7A 4LBYA 4G01B 1VM6A 1W46A 3N75A 2A9FA 3U44B 2IRWA 2ZSHA 2B83A 1UDCA 1AVTA 1U0NA 5AW2A 4PTLA 3F74A 2OOSA 1FEZA 4LSWA 3WLSA 3ZW8A 2F8SA 3O1JC 4XIIA 3G2KA 4LHZA 4WLEA 1RQGA 2GZDA 4IV0A 2B69A 3H5TA 4GNRA 4L5YA 4UMFA 4EJ0A 3VDNB 1PK9A 2AMJA 1NQUA 1P0MA 4BRSA 3NYRA 5B64A 4A03A 1EA7A 2O8VA 4B4WA 3SQMA 1BDHA 4LISA 2M2IA 3E7WA 4L8WB 4F6CA 3C3BA 4A1OA 4QPJC 5HK8A 4W5RA 1ZUNB 4GP6A 2GM9A 1Y63A 4G0QA 5DN9A 4ABYA 4EITA 2YFYA 1PYOA 1U2DC 3HL4A 4QODA 1Y8RB 1ITZA 3S40A 3ABRB 1TZJA 4DLRA 2I76A 1ZVJA 3HDJA 3M3PA 4I5EA 4ZEMA 3EGXA 4HNAA 4Q4JA 1Q84A 3USES 4XJVA 1RTTA 4V0RA 2HCFA 2FWIA 2FFRA 3OSUA 3TNJA 4W5HA 1SCUB 2XQFA 1UZLA 4GKKB 1MC5A 3BRCA 5ULLA 1SEVA 4EFDA 4HH1A 4IDHA 1U8AA 4WTOA 1A2KC 4DE5A 1ECBA 1GD1O 2OHIA 4CIVA 4OA8A 1BHJA 3ZYCA 4GX0A 1GG2A 1QIJA 2P4SA 4C03A 2IH2A 4N5IX 3JVIA 4TMTA 1EHCA 3PHLA 4GEKA 3LUJA 4O4JB 5BWBA 1T1JA 2I7XA 1SIUA 2OO7A 2ZJZA 2Z2YA 4YXWD 3ER9A 1C30B 3FUWA 3BWEA 1V4NA 5A4IS 5CCBA 2A88A 1MPTA 4OF4A 3R7DA 3WIDA 2FK7A 2UXDB 3MJ4A 5BSTA 1DT5A 3PQ5A 2V58A 5EE5B 2ZS9A 4ZU3A 2PYDA 4OV6B 3KOXA 5FO1A 1JPVA 1YQXA 2H2FA 2NTJA 3JPWA 1IMJA 1QHEA 2Q50A 1C9MA 3L93A 4EJSB 3ZHUA 5KTTA 3PGJA 3QFRA 4US0R 2PMDA 5DT2A 4QVIA 2PMEA 2J0VA 5U1PA 3RNLA 3VYSB 1YS9A 5HKLA 1GVHA 3R7LA 4C30A 2FE4A 4XGRA 5IEBA 2G9NA 2JBWA 2GZ3A 4IXMA 4P5EA 3A3NA 3HI6A 2QIOA 4OI4A 3WHKA 4NU0A 3OOWA 3ZS8A 4ZVLA 4IWYA 4V02A 5K1ZA 2ZROA 1MABA 1LFAA 2HMUA 1ZVMA 4NG5A 4DDTA 3T95A 4F5ZA 1K7XB 1OY1A 1P9OA 2GWHA 1E2EA 2QUHA 3LLUA 4FKZA 1V3TA 4TKUA 4ZXFA 4ENPA 5F78A 4GR9A 3KZVA 1Q0HA 1QP7A 1U7OA 3NP9A 3UGJA 4JJIA 1IXKA 1OASA 4L9AA 4B3FX 3IODA 1LPSA 3B3FA 4B9AA 3N2KB 4DNQA 3K8YA 3PD0A 2XD9A 2AKYA 2Q5HA 3C15C 3P97A 4KMMA 4MVYA 3SX4A 3PZRA 3WRWA 5CYPA 1B23P 2PRZA 5C5CA 3DAOA 1CQIB 1GNPA 3ZCTA 3RBVA 3LY7A 2EL9A 3K05A 3ZX4A 1ZA2A 1PWXA 2BSXA 2YQ5A 3RASA 4CLRB 2BHSA 1NT4A 5J2UF 1EFHA 1NJFA 4KQIA 1WV1A 3JYNA 4I4TA 5DNUA 3IAXA 1YC5A 2A3NA 4HD8A 2YHUA 5EE0A 1OTYA 4ZEWA 3C6BA 5K99A 3HFSA 3NNDA 1TIKA 2DT8A 4V0OA 3V80A 3BSSA 4DLVA 4M7PA 3CTPA 4YUVA 2JCSA 2Q5LA 1G64A 1JYFA 2EQ5A 1EUZA 1LX7A 2Q3CA 2PFKA 3A6DA 2PWZA 2R48A 3ET4A 4Q3AA 1HMPA 3LC7O 2G9QA 3HA5A 2JLZA 1BS1A 3JVEA 4K05A 3AUFA 3DE1X 3JCZA 3M6XA 4OQDA 2IV2X 2PGNA 3OIWA 3FYUA 1OU4A 2YRFA 4RANA 4E33A 6PFKA 2HY7A 5BV7A 3SX0A 2P11A 3K30A 1MNAA 4I0WB 2P78A 2R1TB 3G2IA 2Y76A 1J5EB 1N2XA 4AG3A 3TO5A 4Z4CA 1RYNA 2FQYA 2XTMA 4NCXA 4EB6A 3RFTA 5JCXA 1ST2A 2EAUA 4LOJA 4BNZA 2WV9A 4XUEA 1JHQA 3NUZA 4JBNA 3UIEA 1EGHA 3H16A 1VKOA 1XU4A 1PD0A 3PQ4A 1QHNA 1WPXA 5HF5A 2LVBA 2WC1A 4LOKA 4OJMX 4WT7A 3W5BA 1E64A 2X41A 2X7JA 3C43A 3O94A 1Y5RA 2QSJA 5REQA 3OTQA 3OBBA 1BVUA 4E5PA 2IWRA 4ZI7A 2QU8A 1FXWF 3IBSA 3GDGA 3TQQA 4AJ2A 1FZQA 2ODQA 4XTCS 1T3GA 3SDBA 4B9EA 2O19A 2VNAA 1D07A 2HOQA 4OK5A 3RK0A 1PS0A 2AZMA 1KZ9A 4RIGA 1M5UA 2Z83A 1MX3A 3TSZA 1PGPA 3PQCA 3MINA 3N7AA 4UHFA 3HEMA 2J5BA 1NNSA 1G42A 2V7BA 3HCFA 4JLBA 4S05A 3RAFC 1MXFA 2B1RA 2J31A 1U2GA 1PGOA 1PX2A 2OK8A 4EBBA 2EHJA 4TVSA 1WHTA 5EKSA 5JS8A 4I7EA 2CMDA 4MUGA 1N75A 4GLLA 4LHSA 4EUKA 5HS4A 2I4IA 1A9PA 1ABFA 2JA2A 3FPEA 3K20A 3KP1A 3EVBA 5LA6F 4UEWA 1XQYA 2C7VA 5LC1A 1NKSA 1WCXA 3BC1A 4PNHA 4RS3A 5LZ9A 1M2VA 1AK2A 3RTCA 3UTDA 1JHRA 3S2GA 3SDZA 4EA7A 1W9MA 2B7LA 1R0LA 1NVBA 4JXKA 1A96A 3PUKA 2AVDA 4JP3A 4N0MA 3LXRA 5BUQA 2I66A 4EUSA 4AS1A 1YMVA 3OUTA 4CTOA 5CLHA 5L3SB 2PSHA 1W35A 4NJOA 4CLXA 4EVSA 5BV8A 1W93A 2XDWA 3D8SA 5JDCC 2WIDA 4CJXA 4DWJA 5DBGA 1RI1A 3EFOB 3I9V6 1Z5WA 5DXAA 3ABSB 2W6IA 3UYLA 3ZOZA 5BUCA 1ZXLA 2A1TR 3H1PA 2BKUA 2WIAA 1QGYA 2ISQA 5HFJA 5HWSA 2ZIWB 4E6EA 1F8UA 2CVPA 2GYYA 2GCNA 1XYVA 3NWBA 2QLMA 2YCLA 1KF0A 2XXBA 4DR1B 5B58C 2IL1A 1FL9A 4JJKA 3GLIA 1RYDA 1NSFA 2XMQA 3PXDA 3U2QA 3PQ7A 3QX9A 3RG2A 4BX2A 3I05A 5T41A 4JI7B 2J9GA 1TVKA 3E15A 2G4CA 3DBLA 1K68A 4N7JA 2CCKA 2V7WA 3UNXA 4YJHA 5HKKD 2J9YB 5D3KA 4BJ3A 4ARUA 4MMZB 5KSWB 2M6KA 4IDBA 1E5VA 2ZDQA 1TYEB 3IEKA 1HL3A 2QPOA 3ONFA 4JL6A 5CRIA 2Y1EA 5TSDA 2LDXA 2M6SA 2WEKA 4WASA 4XPIB 4KWCA 4YRCA 2IZ7A 2WZCA 3JU3A 1CLEA 3K0AA 4PZ9A 3PUIA 1JTVA 4MLPA 4Y9DA 4BNJA 2R8XA 1LUAA 2JCYA 4NBLA 1GU7A 2DBVO 4KNYA 4Z0NA 4MS3B 2ZVPX 4NENB 2QX7A 1B0UA 1CJBA 2ZYTX 3MRTA 4E31A 3H83A 3EHDA 4KQFA 1DJPA 3GJRA 3DOFA 3QPCA 5T64A 1YH3A 3QG1A 3TOCA 4S1TA 1JDTA 3IT2A 5CM9C 1RQLA 2OYRA 3KPUA 4AF7A 3ICPA 1V8PA 4IVNA 1GPNA 5C5IA 1KZGB 1KPHA 1AMUA 2P75A 3H65A 1G19A 3OAAA 3TZKA 4HWSA 4DJAA 3HCRA 5G0UA 2V7QA 4H7PA 4ITUA 4JITA 2MSWA 3SHOA 2ETVA 1RWQA 3A11A 3S4YA 1L5NA 3IKVA 3DXYA 2ZWPA 2YN2A 2HN9A 4HCJA 3O95A 4MUMA 4P22A 1GGJA 4H3VA 4QNNA 5CGZA 3GGPA 4B6PA 2J9RA 2UUAB 1RPJA 1W0KA 3UATA 3E82A 4ESVA 3ZW7A 3TDNA 4MMXB 2ATIA 2B4QA 5DN6A 5LQDA 3AM4A 2OHVA 4K40A 5LMNB 1YC2A 3O75A 1Y7IA 4OLJA 2BD0A 1SCQA 1WB5A 4IOLA 3BEOA 5BW6B 2GBLA 5GVRA 3T0GA 3WK5A 5KX5F 4ZO4A 2Y0PA 5IN5A 3RSQA 4DLWA 1EWQA 4Y2XA 5TMEA 2EARA 4PX3A 2EIXA 1H6DA 1PFUA 2ZTLA 3CPJB 3HKDB 5A03A 2EFGA 3EZLA 3HNOA 3IELA 2GN6A 1PLKA 4HVAA 4MPTA 4MV3A 4TXLA 3LWZA 3SQWA 1KZ1A 1TPYA 2ZJ3A 5AJVB 3QA3E 1NU6A 1PT7A 4BTVA 4C1BA 3VVLA 1JR2A 1IOWA 2QJTA 4Y2VA 5FEMA 3B2EA 4IYRA 4QXAA 3VR2D 5F9FA 2BRUC 3F5MA 3H7AA 2FJUA 4J07A 4KL8S 4R9UC 3ETEA 5TV2A 2BOVA 2OXCA 3ASZA 5EINA 1LWOA 1YCHA 3FF1A 1K4MA 1B14A 2P9TA 1DS6A 3VHLB 4HNSA 4UM5A 4DADA 3G8CA 4INZA 5KTYA 3V4LA 2GN1A 1URPA 1G4HA 1OI7A 3A3OA 1D5WA 3K0CC 4GICA 4UE3S 5F76A 4AB1A 5IT0A 4NZYA 5ILGA 4G4JA 4D8YA 4YV2A 1GUBA 2HA7A 2ZUCA 3QTBA 3RAJA 4AZWA 1XRLA 4XX1A 3I1YA 1RAGA 5FRDA 1KGSA 3IP7A 3RGWS 4HQ6A 2PKQO 4BGIA 1JHZA 2X5KO 5DCWA 5I4KA 1EZZA 4BTEA 3IJPA 1P62B 2QSUA 3M5DA 4HZUB 3PGMA 5EJIA 3EXG2 4KXNA 4ESOA 1Z0UA 2VS1A 4RL6A 3RRFA 3WBFA 2Z0MA 2Q4BA 1LI4A 1Y9JA 2DE0X 3WFIA 4EHJA 4IMIB 4HR7A 5GJCA 3O0TA 1T9KA 1ZKMA 1C9KA 2OXTA 1U1EA 1US8A 3LPCA 4HLQB 1UJNA 2C9CA 3NONA 4NCJA 3MF4A 4J0IA 3N3BC 3JRNA 4L50A 1KDTA 3ZV6A 5L7WA 1UBRS 5EWMB 4LHXA 3DBHB 3RV4A 4BIMA 2HL6A 4JCOA 2HMSA 4DLNA 1IEXA 5L51A 3N2KA 1KKUA 1V9SA 1FFGA 2QRPA 3HVKA 2ODTX 3FZEA 3WWDA 3QE9Y 2H5EA 4MGKR 1XYGA 2DFNA 3DQPA 3OTWA 3FJ1A 3G5TA 4ND6A 2D4HA 5DGDA 3GR6A 2B30A 1IDOA 3L9XA 4LHEA 3NT5A 3N5CA 1BMFD 3OX3A 5DTIA 1VGVA 2GD0A 3A1DA 4M76B 3NPMA 1XRQA 2AF4C 1G3QA 1ZQ1A 2MSNA 4N39A 4GL2A 4QIHA 2GN8A 1A4UA 3KRTA 1F5SA 3MLAA 1NPDA 4LMAA 1XTZA 1AKNA 1WBJB 4WX2B 3G79A 4CETA 2CXRA 4DFDA 3W2IA 3UHOA 2ID9A 3JZMA 3CO5A 5EY5B 3RVKA 1KBZA 1X7ZB 4XE5A 2DWPA 3GARA 5DB4A 4Q37A 4JT2A 3JS5A 1USWA 1ZM9A 2HRZA 3F46A 5C3MA 3TYXA 1YZFA 1YQTA 3KQVA 4P2GA 1IM2A 4B6OA 4LE1A 1ZJWA 1JDBB 3ED5A 3WJ7A 5I7RA 1QE0A 4OJNA 3K4PA 5HGJA 1P6QA 4TSFD 3I72A 5D1HA 4E2ZA 1PGJA 2XNDD 5IZ4A 4K0RA 3PGLA 4CKCA 1CIPA 1AM4D 3AUTA 3FOZA 3U19A 4KXYA 4CHGA 5CCEA 1YFZA 3BM5A 4R31A 1SK9A 1UDXA 3D8NA 3ZU4A 3IUPA 3FVRA 5K0TA 4MIEA 3GEPA 5T6BA 4HNRA 5TC4A 4YRZA 2NSLA 3EA4A 3LQYA 1M33A 3NWEA 1DJNA 3X2EA 4ZC8A 4MGIR 1XK7A 1CR4A 1QC5B 3JVDA 3QKIA 4E30A 4Z3OA 1B6TA 3DMTA 5HJ2A 2AMYA 5LYJA 4R2XA 3QKTA 1XJQA 4V0SA 3F73A 2ISCA 1RBYA 3HJUA 3L6OO 2EW1A 3WYAA 1TOAA 2GAIA 1P5RA 1YA8A 2H51A 2AMVA 2J3KA 2W6OA 3GOQA 3PHGA 3ENVA 1RPAA 3NG1A 4WXYB 4QOJA 5JRJA 1P45A 3PC2A 4BV9A 4PCVA 1FYWA 1W5BA 1Y0BA 3CLRD 1Y48E 2NZ8A 2UDPA 5FXMA 3VPXA 2FP3A 2ZE7A 1LKZA 5B4TA 1UXGA 4FQ5A 3V7FA 1D0IA 3F5QA 2H7YA 1WD7A 4KFRA 1UBEA 1QYRA 4LNUB 4CT5A 2ZPUA 3E9NA 3LVRE 1DX9A 3HFRA 4EKNB 2WNIA 4PFSA 5F23A 1OXMA 1R6VA 4KBGA 2XMZA 3EXEB 4PU0A 1ZZEA 5LP6F 4M83A 1WQ1R 3SYKA 3ZHZA 4MEBA 4DIMA 4X94A 5B2FA 4Z2YA 4A6DA 5FPQA 3FTNA 1UZMA 3IBFA 4EB8A 4TV8F 3JASA 2B9EA 3EWSA 4FYVA 2WYWA 5B12A 2DLDA 2VDMB 4CV1A 1NLYA 1KMHA 5AI8A 1W6UA 1SG9A 5HIJA 1EK6A 3AHCA 5L3SA 3DT6A 3FWPA 3W6NA 4OI0A 4G3XA 4TN5A 2C5BA 2QAJA 4YCLA 3K0EA 1FQOA 3FFBA 1KXZA 4KAAA 4YYZA 3RS9A 1P6UA 4MLDA 2CSXA 3LXMA 4U0KA 2DLCX 3CRRA 5KVAA 3OX1A 2AXQA 3ZXSA 1KYVA 4RF2A 1FMLA 3IQGX 4QJ5A 2OG1A 3HO8A 2I2WA 2TMGA 5FT9A 2IU4A 3QEBZ 2FMHA 4LCEA 4XWKA 4P80A 5T4BA 2WT9A 1A8PA 3QPDA 2GPTA 2J5KA 3CKKA 4OUDB 1FJHA 1Y98A 1P1IA 3H6HA 5HRUA 3ORQA 2H7CA 3OF5A 5FBZA 3FPHA 3UOAB 4P32A 4P4NA 4DQKA 4M89A 3SI7A 5H68A 2MU1A 3TW8B 1RBZA 2QD5A 4OAPA 3IAM1 2C9ZA 3QM1A 3WP1B 4BMNA 3BE4A 4GKJB 1QWSA 1U0TA 1T2DA 3GGGA 3ZWQA 4W9NA 5AI5A 5JWOA 4EJ6A 2V6MA 4UHHA 4BMDA 3CF6R 1AHHA 1DINA 3LS2A 5ALQA 3PYMA 2QN2A 3LWBA 3KPYA 4X54A 2Q3EA 1RWMA 1C50A 4RDCA 1C8VB 5E4YA 1DV2A 3BIOA 2YBEA 3C3XA 5JU6A 1DTSA 3KAPA 1B6RA 1QMGA 4MR9B 1PZGA 3N76A 4GP7A 3IQXA 3GA0A 2UZIR 4HX9A 5J2TA 1Q7RA 1KS2A 3UCFA 3FIUA 4S24A 3RSOA 3B6MA 2BGNA 2EHDA 4BVBA 1YDGA 3DBOB 1WUKS 1RP7A 3N59A 2EJBA 3BIFA 3KQOA 4OHVA 2HPZA 4MMYB 4UZFA 5GONB 3T3NA 5CHEA 2HRRA 1P75A 5C4MA 1LD3A 2NO5A 2H1CA 4IILA 4RSHA 3B52X 4E5UA 2HTEA 2JI7A 3DDHA 5ALYA 2HW8A 3H3FA 4K3VA 5I9LA 1VL8A 4NXNB 5F3WB 3KBBA 1W4LA 1IIRA 2IZOA 3G17A 3LYLA 1I1QB 2Y4NA 4RDHA 5EIBC 2WF5A 2OV8A 3H9JA 5GP1A 2WWFA 4R2HA 4YMLA 2D5IA 2ZS7A 2OEPA 4M21A 1YWGO 3ZWMA 2I33A 2CYBA 4UJ5A 1GTMA 3TK1A 1K9VF 3KKMA 1OT5A 1U65A 3Q3IA 4F6LA 5HZGA 1UQUA 2WYHA 4HLCA 5H5JA 2KLHA 2J09A 2Q3DA 4B31A 3BL6A 4B6FA 1Z68A 2R87A 1U8XX 3ZWWA 3U6BA 1V1RB 1YS2X 2ZANA 2JIZA 3K73O 3QU9A 2G5TA 4YWHA 2ZRKA 2X0DA 4H1WA 4YQFA 1DB3A 1YB5A 1X1TA 4DCMA 3B7PA 1N2CE 1I30A 4MEJA 1W5FA 3I2HA 2EU8A 1PNOA 3HBNA 3DHYA 1ISMA 5HOEA 2GEDA 4OK3A 4RCVA 2RSLA 1P8AA 3OX4A 2WWVD 1CE8B 3HXOA 1J25A 1PTJA 3A7EA 1XTKA 1ETUA 4HTAA 2PANA 4EG5A 2IOYA 3L07A 1NRJB 4B4OA 2FE1A 1C4OA 1VSUA 2CL6X 4QEDA 4RVHA 1QVVA 1KMQA 2VJPA 4KWHA 1XJWA 3HXTA 2MINB 1F5NA 3RT1A 1M54A 1P1FA 3KZNA 4CL8A 5HP4A 4C6HA 1L5FA 1T5HX 5J4LA 3HFGA 1YJBA 5EUMA 2QZSA 2WPNA 2FETA 2Q1UA 1QR6A 3F6BX 3FTDA 2FWAA 3HA3A 1QLWA 1T1GA 5EQDA 5IM5A 4KN5A 1K5PA 3NKLA 4ZVQA 2FG7C 4HAIA 1A4IA 4RLFA 1U2RA 3GDWA 3VR1A 1TEHA 1RE1A 3E9MA 1XTTA 1AG9A 1Y6RA 2QEQA 4RKRA 5FFMA 5L3QB 1I5RA 3VV3A 2VYNA 2YICA 1YK1A 4MVJH 1PV4A 3AUKA 2MT9A 3UXEA 1Q1NA 1ZICA 1ORVA 1V26A 4E4RA 4WBNF 1TVEA 2WHPB 3R0JA 4K5QA 3BS4A 4AMBA 2C31A 5AW0A 2Q29A 2M1ZA 5AM0A 5C31A 3ULKA 3WO1A 3GLFA 2Q7OE 4YV0A 1YZNA 3H3JA 5ES3A 4S04A 3BWVA 3KZKA 1DG9A 1PFGA 1W73A 3GJ6A 4K88A 3T9CA 1IVYA 1QYXA 2IYOA 4RESA 5GVSA 4LF9B 4PXYA 1UC5B 4A0GA 3IDAA 3EIXA 2A9JA 1BEUB 1CS0B 4PANA 2HHHB 1HYGA 4DIKA 2DB3A 3GG9A 3N8DA 3NOOA 4S2EA 4DPKA 2X86A 2ZQZA 3AR5A 3WLIA 3QNMA 5B1IA 1U0RA 1Q19A 2O2CA 4IRXA 5B7NA 1CZOA 4HSEA 4ZPXA 2BMEA 4CG3A 3KE9A 4EF4A 3C1OA 1Q77A 1KL7A 1AS3A 4ID3A 2ZAOA 1JDNA 3KR9A 3U3ZA 3R74A 4BMVA 1LX6A 5FOTA 3ZZNA 5KNBA 1GCGA 1BGWA 4U1RA 4JR0A 2RH8A 4A92A 4DCOA 4EP1A 3ZI7A 3H4IA 1KEWA 1UZAA 5A05A 1KJWA 1MTOA 3IJRA 4HH4A 4R16A 3AUYA 1ESMA 5EE3A 5A9SA 3G0DA 2QNBA 5GOZA 1A04A 1KBOA 4BN0A 1HYEA 3L8EA 1GGVA 3WBJA 4X44A 5CP8A 4D99A 4BFUA 1CKEA 2OAQ1 1TK3A 3PQEA 3RF7A 1N0HA 5IKEA 1IEVA 1IJKA 2BZ0A 4OYHA 3E5HA 4KRGA 2MSDB 2EJCA 4AQDA 1HMYA 1UCFA 2QTTA 3D3JA 4I6GA 4UVDA 5IFKA 4AI6A 1QORA 121PA 3BJZA 1T4BA 3D8TA 3HBAA 4Q7EA 1K1EA 3ZGZA 1U2EA 1ZIDA 4D0LB 4LRYA 2A1TS 3A2NA 3V6LA 5U4QA 1OJ7A 1HDOA 1NBAA 1VJ5A 3IH5A 3RFXA 2I67A 1HZJA 2I54A 2ZRLA 2F3PA 3GF4A 3NP7A 3QVVA 3RVSA 2BMVA 1IH8A 5H3LA 1HDZA 6NULA 1YE3A 4GWLA 4N5DA 1QHHB 1LB1B 3BREA 3IUSA 4R68A 1LBTA 3WIUA 2ZCJA 5TDHA 4E5VA 4TTIA 1WV0A 3BIJA 2G82A 3Q85A 4N3GA 5CBKA 4LF8B 1DOHA 1QPZA 2I2AA 2AI2A 1ABEA 2WZBA 1ECJA 4PSCA 2BKAA 3TJMA 2BI7A 5DLDA 1LTKA 2VXCA 3GT4A 3I6BA 4PCUA 3U31A 1I3KA 6AT1A 4DV2B 2ZVDA 1F17A 4MV0A 3MJEA 5BSFA 1XVIA 4EIWA 1O4WA 1I80A 3QVSA 5DM60 2C7OA 1MZVA 3LYAA 2B78A 4N3AA 2PKRA 3OJWA 3ELDA 2X3UA 4Z4QA 3RVBA 1ISFA 4LNUA 3HA2A 3Q8MA 2IOFA 4LZJA 4HWOA 1XZFA 2RGAA 3C97A 1SA0B 3DTYA 1R6TA 3NDPA 2GF2A 5F64A 3V8EA 5J58A 1C8LA 1KVSA 3PVZA 1R66A 3SWWA 2NSHA 3DOCA 4N0PA 3Q0IA 5EHIA 2V7XA 4K3UA 3GCZA 3JQAA 2B6NA 2ZOSA 4UPVA 5K45A 2FJ0A 3EEIA 5DBEX 1Q1ZA 3MJCA 4CF7A 3PWTA 3WR5A 5HK9A 4LY9A 2PKYX 1FFEA 1R6DA 4YQZA 2PRIA 5LOVB 4RABA 4AJJA 1HDRA 2NP7A 1J9ZA 4PYNA 4D02A 2JLSA 5E2AA 4MVCA 5DMXA 1FFAA 4X41A 2VJLA 4LE0A 1GUAA 2PGOA 1EAYA 1T0HB 1XNGA 4HYQA 3ZNOA 2IHNA 2VJKA 4OUDA 4W7SA 4GOMD 2IP4A 4D44A 2ORED 5K8VA 3TGPA 2XKAA 6ABPA 3DSRA 3RNOA 1DAFA 1EWVA 1OIXA 1QCDA 3WYFA 1HNZB 2KS6A 4ER6A 2ZM5A 2VBCA 1XTSA 1UT6A 3UC5A 1ZK4A 4MINA 1WULS 1SBIA 4ZKEA 3GHHA 3L79A 3SEZA 4M9SA 5HR5A 2AK2A 4MP6A 4D82A 1Z22A 1BRTA 4KMRA 4RPCA 2BJWA 4NBUA 1IVSA 4NY1A 3T7CA 3I09A 3TE7A 5FBRB 1ZLXA 3GAZA 1Y1QA 2CHGA 4U8HA 4AJEA 1IPHA 5BWLA 1OR8A 2A7QA 1CUGA 3MOSA 4PIPA 3KB8A 1NI4B 4M0PA 5FKJA 3UMJA 3PJRA 4OOFA 3N58A 4MRMB 1HTBA 4BRZA 4MR9A 5EI5A 1HXHA 4E5SA 2FLWA 3MVEA 4QLBA 3SS8A 1PWYE 2NU9A 2SKCA 2ZFUA 2QYSA 3TINA 2ZREA 4W5TA 4FR2A 1QYDA 3CQ9A 3S99A 3UMSA 1GIAA 3NYQA 4PX5A 1CJMA 3OZUA 4H4DA 1LVUA 1XC7A 1SVKA 2ZJ4A 3QLEA 5FTNA 3OZAA 4IDNA 3CF2A 4D2IA 1Z37A 1YJ5A 5CNMA 5F73A 5GONA 2AQHA 3OQIA 2AT1A 2QIPA 4Q9DA 2CL5A 4A0QA 3VU8A 1E0AA 1HE5A 1T4GA 2ZBGA 4JI3B 5BNTA 5I5GA 3EG9B 2PSEA 1E62A 1UADA 2LTAA 4EUNA 2HJ9A 4NJMB 3ASYA 4B09A 3H17A 3LBNA 5ICCA 1DUIA 2IYFA 1A8IA 1SD5A 1Q11A 2DBYA 4B46A 2H5IA 2PUDA 1KARA 3HU2A 3ILXA 1PK8A 1TJPB 1R0KA 3GJTA 3FAKA 3LO5A 2O1WA 1ODLA 2CK3A 3FCOA 3M9XA 4MKHA 5ALIA 4OKNA 1A9QA 5DNVA 1KRWA 1PYDA 3LX4A 4G85A 4ZAWA 2PV0A 2ZBEA 4YGYA 4C4YA 2HH9A 3EODA 3FVTA 3QVTA 1Q20A 3GU3A 1DXOA 5I01A 1KAOA 5AM5A 3B13B 5EKDA 4PHFA 1UJBA 4DCCA 4LAFA 1DE0A 5EPUA 3HUEA 1P33A 2FPPB 2I2FA 2X23A 5KAPA 3OP4A 2Y2VA 3DZCA 2ZG6A 1WXDA 2YZKA 4KUGA 4FWTA 1GVNB 2XUKA 3G2OA 5KDOA 4N9WA 1WDWB 4H77A 1KQGA 5ALXA 1CE8A 2PUVA 2AXEA 1SVNA 2GEKA 4IH4A 3NBUA 4X61A 2JLYA 3TIVA 2JGJA 2WM9B 4P0PB 4D43A 1J9GA 4DBZA 4RF4A 2HJRA 2O50A 2ZWIA 3VOTA 4U0JA 3D4IA 1NQVA 2MINA 3OMXA 2IV7A 4R2LA 1ZL0A 3OG9A 3TFQA 4E15A 2QWXA 2ZI3A 4MW4A 3CRQA 4W6QA 4IX1A 1ZR2A 3CISA 1E2BA 4EHNA 4LJ9A 1YDFA 1JG4A 5F98A 3FG9A 3QY9A 2JJYA 8ABPA 5JAZA 4C4AA 3WQSB 3H97A 4MYDA 5ELMA 5BWNA 3EPJA 4O4HF 2OCKA 1E79A 1X1SA 1BVHA 1EXVA 4RZSA 1WQ3A 4MW7A 1PHPA 3OUUA 3UWSA 4ZHQB 1EH5A 2WK1A 3C5VA 1VKHA 4LQCA 3ZXXA 4D4LA 1RM5A 4E7PA 4F8JA 2HJHA 2V54A 4BC1A 1M73E 1CEYA 5GTDA 1G1MA 3CXUA 4H7EA 1DAKA 4NAUA 5BNFA 3F4LA 4M7OA 1W581 5FTJA 2V7GA 4J7UA 4IEEA 5DTEA 1E3DA 3MWYW 1C9NA 4PZDA 1CS0A 4I99A 3TLKA 2HV9A 2L82A 4Y2UA 1THGA 5KTPA 1ZJYA 3U7FB 1YRQA 4J16A 1NTOA 3PNVA 1DAGA 1E3EA 2D4AA 2DUMA 3GWZA 4RSMA 1Y7TA 2CMFA 2C83A 4WZBE 4FMDB 5U9CA 3THXB 5H0IA 1T0BA 2FQ1A 3GJQA 4QOEA 1ZZGA 1JQKA 1QQ5A 1EM8B 2MWMA 3RLFA 2FFAA 1PWHA 4DLSA 5ESWA 5LJIA 3TSCA 4FSDA 4G26A 1JEEA 3CLTD 5HILA 4FONA 5F77A 3VPSA 2ZJ2A 3L0SA 3AF2A 2I4RA 4B34A 4L3VA 2NZXA 3FNIA 1G5HA 1G8YA 4IDGA 1KQOA 2P6OA 1YQ9A 2R6FA 5KJ6A 4PSUA 1SAYA 4QFDA 2XRYA 4RY8A 1VCHA 2NSYA 4K9DA 2LV8A 3Q0EA 4WFIA 5BQXA 3PL5A 4WLVA 2HUNA 1YJ8A 1I24A 2IDKA 3ENWA 3IALA 4H6PA 1WXEA 2ZRCA 2C3OA 3ACCA 1UFVA 2OLKA 3GAMA 3GRRA 3THYA 3H9UA 1OLSB 3MGAA 1HRKA 1UPAA 4G4SP 3FR7A 1MDFA 2NG1A 5G0WA 3W2GA 4DUYB 1LV8A 4GBMA 2GUWA 1MAVA 2RAUA 421PA 1OFTA 3TW0A 2Q7DA 5A4MS 4YRSA 4MCHA 4TZKA 3QOWA 4M9XA 5SY4A 4LTMA 4AMUA 2C5LA 4QATA 2KWIA 4O8ZA 1RS0A 3R8XA 2LIPA 2IUFA 5A2QA 2NVUB 5JRDS 3UKDA 1E6MA 4ISBA 3EVGA 3VNVA 2FPIB 4JEHA 1QHHA 2IW3A 2QPTA 1RQXA 3G1UA 3TKAA 4QYIB 3Q5DA 2CL7X 3LL7A 1JDJA 3NCTA 4OXKA 1N6IA 4G0UA 2GAOA 1F8GA 2AIRA 2H3EA 3RVNA 2ZRPA 2J3DA 1JA0A 1JKIA 2X2OA 4DQUA 2O8EA 1Z4OA 1Z83A 1L7VC 2Z30A 4ZAFA 1QDUA 4IJMA 1G20E 1KI2A 3A3PA 4IO0A 3M0EA 4MQUA 3T7KA 1R3UA 3QU5A 1T5LA 3B6ZA 1U8EA 2G4LA 2FDRA 4J76A 1C1XB 1ZW6A 4GFDA 3O8QA 4LQLA 5BOVA 2M32A 3ZDCA 3WMEA 1Y4UA 3ER6A 2OCXA 2BEVB 3BWBA 3BX1A 4H08A 4WOPA 5AHWA 3STXA 4NCAA 3EF1A 1RZRD 1QS0B 2EX0A 2WTEA 2WU8A 3SIXA 1W49A 4GLBA 1DAEA 4OL0A 1KETA 3U3KA 5M34A 2HA6A 1E1QA 1I4LD 5AHRA 2OKCA 1NVGA 5FX2A 5BY2A 2JRCA 2VSOA 2B2NA 1C9EA 3JAMA 2Z4SA 4DEXA 1J2YA 1UPTA 5JTTA 1J8MF 1U1CA 4PLPA 3VZDA 3WRXA 4RAQA 4DMGA 2B8TA 1JLLA 1ST3A 1Y4DE 3ZBPA 3JAWA 5JPDA 1KYIA 3QPAA 5HVNA 4R1QA 1YBVA 4AY2A 2ZUDA 3OJEA 1NY5A 3VX3A 4B79A 4M98A 4C7JA 1ZN8A 1I6MA 5CIWA 2GYUA 3D3KA 2YYYA 5LWHA 3QF4B 1NW5A 1Q7BA 1PS8A 2B8EA 1JIUA 1AKUA 3HRIA 4M1YA 5CVTA 4QBGB 5IDXA 1EIWA 3A8TA 4N7MA 1D6NA 4XZ3A 3IXLA 4LVOA 4HMOA 1DEXA 4FB5A 4ZKDA 3VR6H 2FZKA 1DO2A 2HKIA 4JUBA 4EATA 1JH9A 4KR7A 3GZNB 2FZCA 2GOYA 2Q2QA 1BJRE 3K53A