4F8EA

Crystal structure of human prs1 d52h mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
315
structure length
308
Chain Sequence
PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEHVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title A small disturbance, but a serious disease: the possible mechanism of D52H-mutant of human PRS1 that causes gout
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 308
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f8eA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f8eA02
1JLSA 1WD5A 4PAWA 1PZMA 1DKRA 1I14A 4RHTA 2AEEA 4RHYA 3H83A 3M3HA 1QK3A 5K51A 4JLSA 3GGJA 3G6WA 3EFHA 5KAPA 5E38A 1HMPA 3N2LA 3ACCA 1LH0A 2E55A 1G2PA 2JKYA 4KN6A 4P80A 4P82A 4QYIB 2H06A 1R3UA 1GPH1 5HKLA 2PS1A 1U9YA 4M0PA 1CJBA 2H07A 5BSKA 2P1ZA 1AO0A 4F8EA 5BQPA 1A3CA 2VFAA 4RACA 4X44A 1QCCA 1XTVA 3LRTA 4P84A 1BZYA 4M0UA 5KAMA 5ESXA 1A96A 4P81A 4RHXA 1Z7GA 2IGBA 3QW4B 1UFRA 1OROA 4M0KA 1YFZA 1A4XA 1UPUA 1DBRA 4X45A 1XZNA 5IPFA 4RANA 4MB6A 3KB8A 4LZAA 1DQPA 2JKZA 1QK4A 2HCRA 1I13A 1NULA 1QB7A 1QB8A 4JITA 3HVUA 5JSQA 4TWBA 3DEZA 5ESWA 4RADA 3GEPA 3S5JA 5JV5A 4RAQA 2FXVA 1W30A 1OPRA 1I5EA 3ACDA 4LYYA 1FSGA 1P18A 4WN3A 1A97A 1BD4A 1MZVA 1IBSA 1ZN7A 1Y0BA 4ZFNA 1G2QA 2JBHA 1L1QA 5IAOA 1ECCA 1VSTA 1STOA 4Z1OA 1QCDA 4P83A 1ECJA 4OHCA 4RAOA 4LYGA 4PFQA 3OZGA 2PRZA 4P3KA 5EUCA 3MJDA 1DKUA 4FYMA 3GGCA 4QRIA 4RV4A 4RABA 4WMLA 3MBIA 1L1RA 1BD3A 1I0IA 3DAHA 1ECFA 1OREA 2C4KA 3LPNA 1V9SA 1JLRA 1G9TA 1ZN8A 1UPFA 1DQNA 1TC2A 4QYIA 1QK5A 1P4AA 1O5OA 3OZFA 1XTUA 4RQAA 2GEBA 5HIAA 2YZKA 1I0LA 4LZOA 1D6NA 1G9SA 1ECBA 3DMPA 1J7JA 4RQBA 4IJQA 1XZ8A 1XTTA 2WNSA 1ECGA 1GRVA 4S2UA 1ZN9A 3ACBA 3NAGA 2JI4A 1O57A 4P86A 1A98A 1U9ZA 4RHUA 5BRNA 5BQOA 1HGXA 1A95A 2DY0A 3O7MA 1VDMA 1NONA 2EHJA 4LZNA 2H08A 2XBUA 3OHPA 1P19A 1VCHA 1TC1A 2PRYA 1P17A
chains in the Genus database with same CATH superfamily
1II8B 2YTZA 3LCRA 1R9NA 2AX3A 2Z30A 4B4UA 1V8FA 3FYUB 1B3RA 4C5BA 3H65A 1GKKA 2HJHA 4QTTB 3TCXB 1UEJA 1C30A 4GM4A 4RM3A 4N01A 1BKYA 1WVIA 1H23A 1MO6A 2PFSA 4MUXA 1TVCA 5B1IA 1X7YA 3PXXA 1T4DA 2C04A 3FTNA 3OIUA 3GFOA 2QQFA 1KPIA 4UM7A 4TMFA 3WLAA 4DLYA 5JH7F 3P94A 4K5QA 4M1EA 1TAGA 1D2NA 3QEBZ 3H8WA 2I1VB 4DA8A 2QLNA 5EE0A 3IUQA 1XMQB 1ZUWA 4IUDS 2X23A 4QASA 1S5PA 1RKXA 1TZCA 2PGLA 4P38A 4MULA 3HO6A 4Z4GA 4QQ8A 4EG6A 1YFLA 1S8OA 1Z7GA 3HWSA 3QWFA 2FFHA 1JFTA 4YJ3F 2I6FA 3L0YA 4FUTA 4NJMB 1Z82A 3MJVA 3AG5A 4MR9B 4RTSA 2B0CA 3AT1A 5J2UB 4IZHA 2YZ2A 3GBSA 3F5DA 3HWX1 3LK7A 1XRSB 2GASA 5B7QA 2ZIXA 4KQCA 1ODFA 2XDYA 2OV1A 1J42A 2BJWA 1M3SA 4KSBA 3DEZA 3PA6A 1UXIA 2HOQA 3QVSA 4KW7A 3EIUA 4PRZA 5ERGB 2JD2A 4OBWA 5TPWB 4MROA 1MN6A 2H5EA 3JWGA 4R7ZA 1C7JA 4MQEB 1LLCA 3ICOA 1R8JA 4KYVA 2ALJA 4PR3A 1RQLA 4G24A 2C92A 4HZUA 4NCJA 5EIOA 2B61A 1NBME 1ODKA 5JHGB 3VV3A 1G2QA 2H17A 3EWNA 1G4HA 4MUFA 5BYJA 4YRAA 4MS3B 4NBSA 3WC4A 4K9PA 4O4LB 3VAYA 4Q0MA 1E4EB 1MOSA 2FKAA 2HL6A 3ZX5A 2FUEA 2PANA 4OHZA 5M2QA 4JYMA 4IOKA 3VV2A 1VFNA 1M1YE 3DFUA 3MQ2A 3PXUA 4KAAA 2C1EA 4ILEA 3ZJTA 2GCEA 3L02A 2JHPA 1YUMA 1BE0A 3EFEA 2Y0BA 1Y4DE 1OZGA 2VF4X 1SCNE 3OD1A 1B0UA 3RK1A 5CX1B 2XNSA 4JFRA 2JFFA 5J4KA 1T0IA 4Q7MB 2G4VA 2PUBA 5D51S 1Z36A 1OWLA 1G8FA 2UZ0A 1MT3A 1WLYA 5DMHA 1D1SA 4NMHA 1S0UA 2GD0A 4XWAA 3V9PA 1JHOA 3FLBA 4U0KA 1LSUA 1PTJC 2HA6A 3BWYA 5FA8A 4DLVA 5D3ZA 1V43A 2E89A 1NSFA 5C5EA 3ZLUA 3BIXA 4JT8A 2XW6A 5JUWA 2O2SA 3DV0B 1ZISA 5G1OA 1ZONA 1ZCZA 3NONA 4MJLA 1EVQA 4FKMA 2BH9A 4N65A 1ESZA 4PFSA 4RZUA 4WY5A 1TKAA 2WMYA 3RYHB 1MQSA 1BGXT 1VYTA 4JXJA 4NYMR 3VQTA 2NXNA 4MYTA 4KI7A 1PDVA 1CU1A 1HFKA 3LLCA 1G8YA 1XZBA 3LBFA 1X7ZB 1BOFA 2Q3HA 4Q3DA 4EKIA 3FWKA 2H1RA 3UT6A 1FLVA 1TT5B 1DKRA 2QMZA 1I32A 3DG9A 4MZXA 3WGLA 1N3IA 3WHKA 1JR4A 4J7CA 4D74A 1U1DA 3C41J 3IQFA 5SV2A 2YBDA 2PUAA 4BXOB 2HHJA 3B85A 2GZMA 2Q4DA 4LCEA 1MAWA 2UZ1A 3DOOA 1FRQA 5CD1A 4AO7A 5L45A 5FP0A 3B9BA 3O0DA 1SPBS 3GLVA 1VMIA 3SKYA 1UWKA 4EB0A 5GINE 4HWOA 4I8XA 1G3IA 3EOAI 4V1CI 5IAEA 1KNQA 3G1WA 3GZNA 2J67A 4Q4AA 5CLJA 4R1LA 3HJCA 5ECDA 3RDPA 2ZUVA 3BJEA 3PF8A 4TRMA 4J4BA 3RAPR 4ARUA 1WTAA 4OHWA 4XUGB 3K2BA 1JSZA 4PEVA 3TSZA 3VH1A 3I3OA 2BSAA 3ANMA 3K94A 2H1WA 1KIAA 1HSOA 1NJSA 2NYRA 2O4CA 2ZAIA 2CJWA 2JIOA 3IP7A 3K5WA 3JPYA 3DTVB 4L0CA 4M0CA 4MHSA 5AKJA 3TNJA 4D2IA 1UPUA 1OA0A 4DCNA 3RFTA 1L8XA 4BIIA 1RXEA 4PO8A 4CIXA 1C3LA 1ZNYA 1DAMA 1MPTA 1EQUA 2ZRJA 1FFGA 4S1NA 2ECPA 2WKRA 1H2YA 5D5HA 5JASA 1NULA 4K86A 3BD7A 4UAJA 3EK2A 1E66A 4A9AA 1JH9A 2ZYWX 2WFZA 4G89A 2P91A 2QQEA 3VU8A 2BKUA 1BN6A 2H1FA 4N3GA 1V95A 5AUOB 1HYQA 1SIUA 2UYQA 3UB2A 3A6PC 2XHEA 4Q48A 2CHGA 1JIJA 4G8JA 4YRGA 2VSYA 1GNTA 4J49A 2EQAA 4X7RA 4JASB 4O0MA 4LCJA 1U28A 2X0DA 1Z7WA 3I8XA 2ZSEA 1GR1A 4MK4A 2ZUFA 1Y8AA 3IAS1 2X4DA 5C1IA 1RWXA 2W6PA 1J23A 2VJOA 3KJQA 3O4GA 4YPFA 1FTSA 4NDZA 4P36A 4W5NA 3WNQA 3OECA 3LM8A 4BO2A 1O77A 1KAGA 4PICA 3ELDA 4Z8XA 2JASA 3BRWD 3PVSA 4AK9A 2OHIA 3DC7A 1JVSA 3I6IA 3VDNB 4Z49A 1C0EA 3H4TA 3M6MD 3I04M 2PQMA 4NAHA 3R3UA 2JJ2A 1Y6ZA 2HRCA 3H8SA 2Q3CA 3PZBA 1RIFA 1FP7A 1N7GA 2Z5GA 5ALXA 2ZRHA 1I4DD 2WLTA 5ECGC 2E37A 3D6AA 2UV8A 3VSCA 1K98A 4PINA 1CXZA 2MSLA 2W9XA 3G9ZA 3UBMA 1ZITA 3CVYA 3G3EA 4LECA 4XH9B 1UBHS 4WZ6A 1T9CA 3T7SA 2GARA 1MB2A 4RFSA 3TTYA 1DSSG 1FDWA 5LNK6 2F48A 1RKVA 2BFEB 1ZM4A 4MMXB 2QX7A 5KYXB 2FW7A 1V11A 4N12A 1TMYA 1ECGA 1EGMB 4IIFA 1ZD1A 2IUEA 4DSNA 5IHXA 3RIYA 1HE5A 2NSLA 5HPYB 2B94A 5BR7A 1MT0A 3WA6A 4KQGA 1E2HA 3ROGA 2JATA 1UBUS 1FDOA 1WHSA 1RP7A 5BXQC 4IFEA 1XZQA 2V3VA 1VCOA 4LNHA 2XD4A 2HPVA 2WF5A 3IBSA 3VPAA 2ANCA 3FTFA 3BTUA 1SQGA 2VJKA 4EF6A 1WABA 3K2QA 5CLIA 1ZU4A 4B87A 2FR1A 3SICE 2JA2A 1Y34E 1XLTC 1QGYA 3PUHA 3QVLA 4EQ6B 5CEJA 2Q9CA 3PHJA 5CB8A 5KDDA 1YBVA 2ECKA 5K6AA 1W0KD 4L5YA 2I33A 4MWOA 5ITZA 4Y7DA 3OPYB 3TLBA 4A2PA 3N2LA 1ELOA 2CDBA 3MERA 1M1UA 3F78A 1IXYA 4XZ3A 3GXBA 2A14A 4HDKA 4A16A 3I53A 4ZO8A 3G7UA 3ZD6A 4LCBA 2NU7A 1AKVA 3MBKA 1GTMA 4CLHA 3ORRA 4KXUA 3D6JA 1D2CA 3OIVA 2C2HA 2X4GA 1XCOA 1O2DA 1WDKA 3Q7TA 4RVHA 1JHMA 4M6WA 2NUTA 3UB4A 4B34A 5LMUB 4F3YA 5FPHA 1NW9B 1GT6A 1KJ9A 1LTHR 1TI7A 3PPVA 3RYCB 1OUMA 5AOBA 5DNAA 1SFRA 3MTEA 1EM6A 1IY2A 4C0XA 4EHNA 4KO4S 1T5SA 1TXGA 1NDQA 3DZFA 4QJ3A 1F1JA 4JT2A 2J46A 4K6HA 3UYKA 3N39C 4WXRA 2OCIA 3TKAA 4TTTS 1C8BA 3RRXA 1YVPA 2PV0A 3RAJA 4D8UA 5CFOA 4FYIA 4I1YA 4ENUA 3CRQA 3WO1A 2HDOA 4EZEA 4CEJB 2IYWA 4MVJI 2WK1A 1GZHB 4TLMB 4XLLA 1L7XA 1KPHA 1XX6A 3LYLA 1S3IA 4IEEA 4Y2PA 1Q0LA 1TO2E 1H9AA 1BMTA 1H6DA 1N8SA 3G7SA 5EMJA 5L3SA 5H80A 4UNPA 3ZTYA 1YO6A 1L1FA 4RPHA 1JJ7A 3R7DA 4F0JA 2IZ5A 3A6JA 1EUDB 4NCNA 4BQOA 5DI3A 4QOGA 1P1KA 2WTAA 4LVUA 4PPFA 1JEYB 1U2DA 2D06A 1EHCA 2DF8A 2QR5A 4F91B 1QCDA 2B4YA 4KACA 2X22A 2ZIGA 1A9RA 1JWAB 1IJFA 4E46A 1XQ6A 4PTYA 5AKIA 2PO5A 4B73A 5TPZD 5KOHA 5JADA 3LIIA 5ERXA 2DFPA 1GUAA 5FI5A 3ELBA 4ZO9A 1T5LA 1ZCJA 2P0EA 4WXEA 4AIRA 3UJHA 5FPKA 2CKDA 4MRSA 5C81A 4MQFA 4D9BA 2CUKA 4UBNA 4DPLA 4W5TA 2C2XA 4GYJA 2QTTA 4JP5A 1ORTA 1V39A 4DJJA 4RH1A 4WHMA 2J3EA 1ML4A 4IXWA 3KO8A 3G6KA 2Z57A 4DB2A 3KFVA 1M7BA 4A0RA 5FPQA 2J3KA 4M2LA 1SJ9A 4ZXPA 1A9XA 2NYVA 4F4UA 1OY1A 1U65A 2H9YA 1LBSA 5HCIA 2AE1A 3ZD8A 1CR1A 4CKWB 5UKDA 1YBFA 2HRZA 3EQ2A 3PG5A 2YVLA 4G5OA 3CZCA 5E9AA 4D41A 4D0NA 5A9SB 3O8OA 5JNWA 2O20A 3EYWA 3PL1A 2Q3LA 3SSNA 4DKJA 5JC8A 1DIHA 4G0QA 2QQ0A 4AO8A 4A2CA 1XA0A 3FG9A 5GJVC 2NTJA 1IZ0A 2EKZA 1M6NA 2C1ZA 2QF7A 3IKJA 3M83A 4CNQA 5D00A 3DMTC 5BN4B 4BBAA 4Q7QA 1NVUQ 2WU3A 1XTPA 2RGGA 3C14C 3IT2A 3EDQA 3NWPA 5A04A 1DB3A 4L0DA 4ROTA 1UM8A 4R2LA 5FOUA 3N6RA 1X6VA 5BYKA 5F2NA 4AWXA 1KF0A 3P9ZA 2GBFA 4E2XA 1E7MA 2HQBA 3BJZA 4H59A 4HS9A 4RZ2A 1EP9A 4RKYA 1IUPA 1C9MA 1E89A 1XD2B 2DM6A 2QPLA 3HUDA 1FDTA 4HTFB 4WOCA 2PT9A 2C7GA 3SHQA 1CVIA 3VJKA 8OHMA 1VC2A 1N9ZA 4Z7QB 1RJ9A 1VSBA 3L43A 4RW0A 4OCZA 5HFNA 1NBWB 3WTBA 3SX4A 5FBKA 3QHPA 4RE5A 5FWDA 1T10A 1ZM9A 5TVGA 1PQPA 3D2LA 1WQ4A 4J43A 4CM8B 4DBZA 2GGSA 2VF2A 4KFCA 1V5EA 2PK3A 4PGFA 4M1ZA 1CTQA 1RLMA 4J2TA 2F1HA 2I2FA 1A5TA 2VYVA 3FFWA 4RQUA 1CYEA 3QKRB 1YB4A 1VPDA 1NHGA 2IHVA 3D3KA 1M2NA 2P67A 3JQPA 4YRDA 3M3PA 1SVWA 1OCEA 2OCKA 4BNUA 2ACWA 3I8SA 1R5BA 3QNUA 4CT4B 1UDWA 1X94A 1GQOA 3FSGD 2FA9A 1DJOA 1YE5A 4B79A 4PZEA 4G2TA 1T0BA 2DB3A 1UXJA 3HDGA 1IK6A 1D4ZA 1LB1B 2I62A 4OEHA 3I01A 3U39A 4UNSA 1TPYA 4KE8A 3NC4A 2BGJA 1I7QB 2X3UA 4NHEA 4KV9A 1X3SA 4ALLA 2K2WA 1JU3A 1Q5PA 4N39A 3ESZA 5J3JA 3R20A 4BQEA 4XB1A 4ASUD 3HCPA 1GA6A 4HAXA 4NZPA 4C6SA 2BHSA 3CGWA 4M0FA 2AJTA 2M98A 1XCGB 3Q9UA 4BNMA 1O0SA 4B3IA 3AVOA 2UZ4A 4Y1FA 4AJLA 2YXDA 4HDRA 4X6XA 2FR8C 5TGZA 3B60A 1MC4A 1N1EA 4OY3A 4CQMA 4DB4A 2JZCA 1RP1A 3BDVA 5AW8A 1ADBA 2WZQA 3H2ZA 2JD0A 3NVDA 1G21E 3N7UA 3WIVA 1V9LA 4LG1A 1G5FA 2ZETA 4EIWA 2P2LA 3EVEA 1NVXQ 2WHQA 4E2FA 4MQ5A 1LVGA 2EW1A 5JQWA 1H3EA 4V1CA 3EGCA 4TV8F 1KOGA 3VDQA 3JAWA 4ZEOA 3QWBA 5FBQB 3AK4A 4MKRA 5BNIA 4BASA 3I9V1 4QQKA 1MVLA 2CL7X 2Q49A 1T1RA 4BUJA 1NZDA 1RC0A 1R8QA 3MCTA 4IHKA 1L4EA 2HTFA 2OGTA 2LDBA 4R2JA 4Y1EA 5F1OA 3VH3A 5IX8A 2XITA 1L5WA 4GDMA 4YWJA 3JQBA 3WGIA 3F5SA 1Y5RA 4OXNA 3TEMA 3VU9A 1TKCA 4ZGBA 2W71A 2HA5A 1S2IA 2I2AA 4DRXB 5I4KA 4C7OA 1Q0PA 3WMRA 1MFPA 1AKWA 2PT7A 5DWQA 1TEVA 5CFQA 5HJEA 1VMKA 2FPMA 1UQTA 2FFQA 2XCUA 3MFQA 1XFAA 2RAPA 1Y3BE 3DBLA 4HDOB 4KTVE 1PL0A 3EMVA 2V7QD 4AG6A 3WYGA 4OU5A 4DJFC 4F2HA 4UASA 2GETA 2XKAA 1P4SA 4Q9DA 2W00A 1X38A 2C07A 2GPSA 1P91A 1W35A 4UEKA 5GGXA 3CC8A 5KQMA 3DAOA 4XUEA 2ZZKA 1ZM7A 5EKDA 1K66A 3KUDA 3TTSA 2AS0A 2WSSD 3FZEA 3KYJB 3Q15C 1GD1O 2BGUA 4M87A 2P6MA 4QYMA 3RS2A 1C3JA 3ZZTA 4F3CA 1E8DA 3TX2A 1K8YB 3WE7A 5K51A 3T5MA 1SU7A 3TDNA 2QRKA 5E2AA 4XRRA 4QREA 4RGBA 3IUPA 5FLKA 1LH0A 4KXQA 1SU8A 1PQWA 3BULA 4QYIB 1CUCA 4WOKA 4E5MA 1CS0B 4ENPA 1KP9A 3C2QA 4KXVA 3CG0A 1Z5ZA 4QXOA 2PSSA 5B3JC 2FJ0A 3A0RB 3RU2A 4AI6A 1RE0A 2WAOA 3DNPA 1DCFA 1XTVA 4DLAA 4MMYB 2LR0A 3R5KA 1DKMA 3ZU6A 4UVGA 2NZVG 5A5DA 5ALLA 4DCOA 2I1QA 1EJBA 4HRAA 4J91A 4PX2A 4Y2YA 5DCLA 5EZYA 3OX4A 3OTIA 1GHTA 4TMKA 4IWNA 1OKKD 5C34B 4KGZA 2O19A 2PEZA 3BCSA 1CZHA 3VNAA 4HP8A 3LRPA 4BQRA 3IKTA 4HMOA 1J2UA 2XUPA 3LOQA 5DOVA 5IPFA 4AM8A 1M2VB 1NVFA 5F3RA 2V6FA 1N3LA 4P35A 4TLAA 4ARZA 3FCXA 2OXCA 2DBZA 4BZZA 3AR6A 1ZU5A 4JITA 4I55B 3HVUA 1UUFA 3ETJA 4PBRA 2RC5A 1ZOSA 1ZOOA 4K40A 1JIQA 2AC7A 4PLCA 3B3JA 4RA9A 1XK7A 3HDJA 3JQAA 5KQPA 3PKJA 1Y37A 1LPPA 2AOTB 4RTMA 2OQ2A 3EPHA 1ZICA 1N2SA 1Z73A 5G53C 1NU8A 4CIVA 5CA0B 1SBHA 2ESRA 3FOBA 4YRJA 2W2KA 2JCSA 3K0CC 3QEOA 1JSRA 1Q11A 2Q41A 3DKIA 3IX7A 4RIFA 5DDIP 4P7JA 3KP1A 3WY9A 2W0MA 3SJBA 3BFVA 1AKUA 4RAOA 5AICA 4KNYA 5J43A 4F9EA 3S3TA 4R5MA 2OC4A 3EX7C 2GWHA 3WGZA 4FJ2A 1P81A 1WTCA 3BYZA 3LQQA 2YKGA 1RWWA 5A5VA 4DLWA 4UBJA 3DTVD 1L5KA 3ZCUA 2ZUWA 5K0LA 2AFHE 2DQYA 4L85A 4NE9A 5SYNA 2PUWA 2WJZB 2RHOA 3IH5A 3WNDA 4DIDA 4EUKA 1B0PA 2XMZA 4PZUA 3GCGA 3E03A 4INAA 4MNTA 1EBUA 3U81A 2YUTA 1RXCA 3INRA 1QM5A 4Q3AA 5CLQA 3AV3A 3LKZA 9LDTA 2C61A 3UBTA 2V0GA 2COUA 3PLAE 3BE4A 4NCXA 1YDFA 3AIIA 2RGEA 4H7HA 5HMMA 1FP4B 3OJ0A 3T7JA 4Y0NA 4WASA 4YP1A 5I6DA 5IKEA 3BB4A 2V7GA 3SHTA 3R5FA 2KE5A 2GZSA 3ZVLA 4RO0A 1CQJB 1SQ5A 5HMLA 2FN8A 4Z9YA 5IARA 3QKWA 3N8GA 4MVJA 4RJKA 1BDMA 3IR7A 5LZ2A 2CB9A 4RDIA 1Q0QA 2X0KA 2A3NA 3BREA 4LYFA 2GA9A 5K8IA 3KKZA 4CM1A 4I4TB 4BLVA 1O9GA 4G9BA 4A0FA 1US8B 5FNVA 1TZKA 2DPHA 3A4TA 3R09A 2DQ4A 4REOA 4OQQA 1O9HA 1ATIA 5ICFA 2CCGA 2TMYA 3FPBA 5DCYA 3L7KA 4QTXA 2IBTA 4NHOA 1KJNA 2Q1XA 4IX1A 2OHFA 1E5LA 1NATA 1U1EA 3N3AC 2OM2A 1RYNA 5JWRA 1J70A 1Z83A 4DNXA 2EBFX 2DCUA 1QPZA 5FADA 1XXHE 1FDRA 3AJAA 1TX4B 2XY4A 3TZLA 4DOMA 4MI3A 3TW8A 2INGX 3NNSA 1TPZA 2XOKA 5FYDA 3T15A 2XCSB 4Z86A 2OO5C 3SS7X 3DUFA 4J9UE 2VRCA 1TVKA 1E94E 2F3QA 3EGXB 1E3JA 1Y8QA 2HWXA 4XXHA 2GJ4A 3JTMA 1L5VA 2DHRA 4LE0A 4ZVSA 3W06A 3ZKWA 1XZGA 2ZJFA 3GQVA 1ULUA 4KMSA 2BONA 1MF7A 2QZ9A 3W2EA 1N75A 4PZ0A 4XM2A 3TW0A 2ZRIA 3LIPA 2XNDA 4IX9A 3UAYA 4YAGA 4HAOA 1G17A 1HT2E 3HG7A 2IGBA 5H3LA 1DUIA 5P21A 2X6QA 3GFQA 3OTQA 4NFYA 4ZI2A 3MD0A 1AG9A 3ZLVA 2VPQA 3BTVA 4KK4A 3PJFA 1A5BB 3B53X 2WG0A 4PS0A 1DIOB 1JALA 1RWVA 3UK2A 5AVZA 4EI2A 1F5SA 4R69A 3JQCA 4NPAA 1J56A 2R5WA 1C3VA 1I3OA 2IXFA 2ZVJA 3B3QA 1V45E 4R1TA 5AJTA 4P92A 4DXAA 1CUFA 1NLYA 3ET4A 1HURA 2FPPA 2VK2A 2GI4A 3PFCA 5D3QA 5HFAA 1CULC 3UK7A 2QLTA 3A04A 2IIBA 4E4RA 2WC1A 3DAYA 2HLDA 2B1IA 4EI8A 3W3ZB 4ZT6A 3VNQA 3ADCA 4AY6A 2NM0A 1HNWB 4N7JA 4P08A 4YRBA 4ZI7A 1VSTA 3LPLA 3PNBA 3GN2A 5JLJA 4C4YA 4KLCA 2HQRA 3UAVA 4TYNA 3D6UA 1ECJA 2PUDA 1H2HA 1YMQA 3EVBA 4B7AA 4LYGA 5HZMA 1H2ZA 4DMRA 4IQ0A 5B7PA 4LTDA 4URXR 3FCYA 1JIXA 1Q0HA 4NJEB 2OCLA 4UPEA 4H1UA 4XDGA 2VKTA 3TR0A 2I8AA 3RUDA 5D84A 3FF1A 4HXEB 3FPAA 4TS3A 1M6WA 4WESB 1QYCA 5AK0A 5EXEA 1DT5A 1F2DA 4D9IA 5KTNA 1OLXA 1R64A 2VSQA 3OY7A 4TQUS 5BSMA 3AUSA 3EVFA 3RRNA 3UANA 4DUGA 2Y6VA 3NM4A 4KO1S 4KU4A 4YLEA 1H6BA 3GUZA 4K9NA 4M46A 2O8DA 5BQ3A 2GTPA 2XCTB 4FEAA 3Q0TA 3KFLA 2COEA 3A1DA 3VGPA 2C7VA 2G5CA 3Q85A 1E1KA 3PIRA 1E0AA 3P9PA 2P9ZA 1XWWA 2X3FA 4MR7B 1ZI6A 4JI1B 5IAGA 3V8QA 1JDTA 5HQJA 2I4IA 4TLLB 1G7SA 2QJTA 1CQZA 4RY8A 5FWYA 5T57A 1UQRA 2GD6A 4BLPA 1PFQA 5IUNC 1KJYA 2VTBA 2UXBB 5E6SA 4XARA 2WDPA 5DHAA 3R75A 3GVIA 5BNTA 1RJGA 3AEKB 3TCNA 1U90A 3D2BA 5AR1A 5F73A 3TD6A 2Q5EA 3EFOA 4IVRA 4XB6B 5JH7A 4BP3A 1ZR2A 4O2RA 3HYCA 1GNVA 3B1KA 4W9NA 5DEIA 1KEUA 1OC4A 2AR9A 5LDHA 4L4RA 4L4ZA 4OUKX 1MW8X 4REQA 1ZPDA 4H7JA 3QWAA 4L15A 2FETA 4HEJA 4S1PA 4ZWNA 4OFBA 3RIXA 3VZQA 1ZJZA 4MLZA 1FX1A 3C8UA 1A4IA 4CQLA 3W5VA 1TUBB 1N5DA 1YONA 2I7XA 2R6JA 3NV7A 4KJXA 1PWHA 1S8FA 5F7ZA 3DYVA 4KAJA 4YJ3A 3GZTB 5J9FA 1EK5A 5FOSA 4FFOA 3GNTA 2ENWA 3H9JA 5EIAA 3PTLA 4J0EA 3S55A 4FX5A 3KUKA 1EFDN 2A30A 4GLLA 1OQAA 2H1HA 3N8HA 4J1TC 1PSZA 2FSSA 2QR3A 4QRHA 1FRNA 4UE2A 3SIPA 4HDNA 4R98A 1FFDA 2RGAA 2GPNA 4H0CA 1P80A 2BBSA 3AUXA 2DLDA 4QLAA 4LPKA 3P32A 2BGKA 4YWHA 5T4BA 1A96A 4OGWA 3T3HA 1R3DA 3VU3A 3IKVA 3B6ZA 5EE1A 1KK1A 4HVLA 4D7AA 2VCYA 4MLPA 2CKMA 1MRZA 1OIWA 1WY5A 2F3SA 3EW7A 4M1WA 4KGVA 5HIIA 3M5WA 3UJ8A 3ZE0B 3VXKA 1QYXA 3ILXA 3OHMA 4J0KA 3EIHA 4D96A 1K7YA 1Y80A 5AW6A 4TSFD 4EGFA 1KK0A 4C0LA 2UVPA 2IHYA 4LJYA 4C6TB 3KVOA 4GBED 4BJ3A 1PEKE 4KGXA 4DA7A 4EK9A 4YEDA 3ZGYA 2MHCA 2Y1FA 3M4YA 1SZDA 4LEIA 1EWYA 5B5SA 1ZK2A 2GLUA 1A2BA 2NZUG 2DWQA 2BI8A 2LVBA 4MYSA 1N0HA 2JJ1D 4F56A 5HW0A 4CDMA 4EQZA 5IASA 1MZVA 1QHYA 4KIFA 5DBHX 1EX9A 5CURA 1Z2EA 3WRYA 4BMNA 2ZRCA 5DN6D 1D8TA 3KU1A 4OH1A 1JI3A 2WTEA 1M76A 2XF8A 1R9JA 3CE9A 4Z3OA 1IQUA 5EXDA 3UA3A 4KDRA 3E84A 4I5DA 4L02A 5IC5A 1JJAA 5EJ8A 2HK7A 2I3BA 4WCFA 4UUPA 1LVHA 2JGNA 4YACA 3AU8A 1E0DA 1PR4A 1PUJA 1LPOA 2G1AA 3H19A 4LRUA 3IXLA 3BK1A 1WMFA 3E9RA 4KRFA 4DDHA 1KMCA 1U02A 3EG9A 1TC2A 4JZKA 1S96A 3HNPA 2DH5A 4KZKA 1GG9A 2E4XA 5LWHA 3JD2A 4NIMA 3FETA 1FCJA 2O3UA 1R0WA 2PGDA 1M8JA 3B5EA 3UHFA 4EGAA 4OI2A 3D0OA 1UBEA 4BGDA 4DIBA 2GR9A 2YRXA 1GPLA 4ESHA 2F1RA 2EEZA 2IHTA 3V7WA 1RYHA 4EEXA 3MTIA 4Q4JB 4R9UC 1FSPA 4QFBA 5AD1A 3G5LA 3I2YX 4MKHA 2O3SA 1V4BA 3KIPA 3OZVA 2XRZA 4DG5A 1E3EA 4JMPA 2Q4BA 3H2GA 2H4ZA 5DIZA 4X62B 1NUUA 4EBBA 3TRIA 4D81A 3DPUA 2PQ6A 4INOA 4QO7A 3ZV7A 1YQTA 4AKSA 1IHYA 2QBYB 2QVLA 4PY2A 4CKEA 5BSVA 3U13A 1NQTA 3L8DA 1DJLA 1G8SA 1B00A 1O4WA 2D62A 3KU4A 2JFWA 1KI6B 2PRYA 4GLJA 2R11A 4XJTA 3U4GA 3V9AA 3A2NA 4J4HA 5IUKC 5BYAA 2O1WA 2MOKA 2ZBRA 3F1KA 4JVOA 4Z4FA 3EY9A 2QV7A 1OZFA 3QFRA 3T0IA 2W6MA 1AT1A 1CZUA 3HXOA 1QHSA 5CHYA 3PPXA 4ER5A 3PQ2A 1F7UA 1R88A 1DADA 2A2ZA 3UMFA 3MA0A 5IVHA 3DHEA 1GP2A 1KTVA 1VI2A 1A4RA 1MJGM 1NN3A 3EZ2A 5EZ6B 2XWQA 3KCNA 5CB4F 1QJ4A 3VKUA 5CVJA 2PL9A 2JARA 2J7KA 1G2IA 1IRXA 2D5BA 1W2HA 1ZRSA 1AKNA 3M4XA 3GIWA 1P0QA 4JR0A 4Z3DA 1B7GO 1D6JA 2ZIEA 4EG7A 3BMNB 2VBIA 5K6TA 4U7DA 3C6MA 4D98A 4YXWD 3A14A 2IHZA 1A72A 3GA5A 1G20A 4OO3A 3TVTA 2QI9F 5L3QB 4AXBA 1SBCA 3TD9A 2IF0A 3GAMA 4AKTA 3RTCA 3BXHA 4LBZA 4WNIA 5CU7A 4I1PA 4ZXFA 4L95C 2H5IA 3H2HA 1O7JA 5IJAA 3MUEA 5LLSA 3CLSD 3RSOA 2GK7A 3GLIA 5KI6A 1Z4PX 4ZO6A 5ALGA 4QYTA 4H6VA 4I6GA 1MEJA 1Z4MA 3T9DA 1X87A 1MCZA 3E7DA 5JANA 1K7SN 5KKNB 1O0BA 1EVZA 4M88A 5DGDA 4BX9A 4HUTA 2WILA 1WNTA 3KRTA 4LZJA 1YHYA 3CH5A 4DV7B 5DCWA 1NP3A 1FX0A 1YC5A 1FNBA 1GL3A 3AOGA 3L1UA 4HLUA 2VP9A 1JF8A 3WXMA 1BTOA 3HJGA 3ZWDA 3WIOA 3PICA 4R2HA 3HCCA 1PZNA 2IOYA 4JLBA 1GAJA 4P83A 3U7QA 1Q1NA 5CP8A 4A0GA 3L8FA 2J0UB 1MMFB 1WXEA 2G07A 3JQ6A 4BFTA 4EM6A 3GJ4A 2OM6A 5DX1A 2AB0A 1YE3A 4KX3A 4UHEA 5EE3A 3RSCA 4B17A 3UT5B 4G0MA 4EG5A 2OBLA 4GEGA 1O96B 3HNOA 3T7DA 3ETCA 4JLOA 3BDAA 1YKSA 2XKJE 4Q02A 5FHQA 4OHRA 3K53A 1M6VA 1WP9A 1PS0A 5ITWA 5HF9A 1U1IA 1C1HA 4RL4A 4ETWA 2JW5A 4MYCA 2PYZA 4TTSA 1T2AA 4DBLC 2YOHA 5U9CA 2EAUA 3PIDA 4Q82A 4XIFA 1V5IA 4ZCRA 4DV0B 1V1RB 1QG0A 2E49A 3RSFA 1ZK0A 3FNFA 4HDQB 2ADFA 3U7JA 5JY1A 1JN0A 1YL6A 1CLEA 1DHRA 2OAEA 1CZLA 4Z7OB 4A7PA 4YTEA 3KKOA 1NVGA 1B43A 3R7SA 1P77A 3G85A 3WLJA 4ROSA 4PVDA 3PFWO 1XD8A 4BB6A 4WZZA 5CDUA 3SXPA 2AYYA 1QRUA 1HLPA 3NETA 1X7WA 4LRTB 3EC7A 3AM3A 1L8OA 5EIEA 1PT9A 4J1QA 2ACEA 2IU6A 2HXSA 3L49A 3R6DA 4IQ4A 1FQWA 3FWNA 4AZ3A 2W43A 1A95A 1K2VN 4MUEA 3T4EA 5C8YF 3DVAA 4G1EB 1IN4A 3I9NA 3T0FA 1YAHA 1SD2A 5DHRA 1YZHA 5LC1A 1FOEB 2CNNA 3MQ4A 1VXRA 4BKMA 3N0TA 2QSUA 3M3HA 2EFCB 4MIOA 2Q7OE 1DFGA 2QD5A 2X2PA 4HAZA 2G17A 4KDFA 2PT5A 1XAJA 4V3CA 3V6MA 3QEKA 1BO6A 2FG7C 3WNBA 1GOTA 1RQRA 3T7RA 4G25A 2P9YA 3HBJA 4BO7A 2JKYA 3CY6A 1N3YA 4QQRA 2OECA 3OSZA 5ALSA 4JUDX 4G41A 1GGHA 4MWCA 4PPQA 4QT4A 3FCOA 2O0HA 1GFIA 1YR1A 3AERB 5CNKA 1UJ4A 5C3MA 2VHTA 3IIEA 4WNYA 3IB3A 2P62A 2ZI5A 3UK1A 1C7RA 1EQ2A 4JBYA 3G5TA 4Z0TA 1BW9A 5KYWA 4KREA 4BN5A 3MRVA 1T0UA 2G8LA 2ISSD 1L4BA 2RHGB 3DOCA 2A1TR 3KPJA 5K03A 1Q2UA 3P45A 3PX7A 2JLYA 1GU0A 3QW4B 5AK3A 3N9IA 3CUSA 5G4KA 3PT5A 1QOPB 3DNFA 4UMVA 1TQ6A 4FNGA 3FKSD 2I9PA 3VX3A 5A3QA 1C3OA 1NT2A 4Y6QA 5JBNA 2NX2A 2X5JO 4RMHA 3NHRA 3CLTC 2O6HA 1GSHA 2PZGA 5IJZA 3L7DA 5TQ2B 5IAAA 4RENA 3RWMB 4D0RA 3R0VA 3EEBA 3VOAA 1W4AA 1VL6A 3BQNB 3CZ9A 3OAAA 1X80B 3IEMA 3S1AA 1YI0A 2NIPA 2AI2A 1UF9A 2ZYHA 1UOQA 3DOFA 4G5XA 4OHUA 3NVAA 5CYFA 4X8HA 3S29A 2H92A 2WTMA 3M6VA 1BD4A 1BXKA 4BMCA 1YB7A 3WFIA 3BE5A 1YDHA 1YS2X 1TIBA 2Z04A 4WGGA 2DUWA 2JGFA 2P5SA 4DM7A 2ZOSA 3KK0A 2A0XA 4IO0A 2H4WA 2ZR0A 1UKZA 4O0LA 1AZLA 2W58A 3L79A 2O2GA 2TRSB 4CM4B 2FSGA 3M70A 5EJ6A 1KBOA 2B1JA 2DUJA 2Z09A 4TT3D 2FFJA 1K9VF 5CVCA 3LC7O 1AA9A 2HSDA 4RSMA 1VLZA 1KGDA 1ZD9A 2A88A 3BMCA 1FF9A 1FW8A 3MT0A 1KQNA 2DR0A 1XDZA 1V3QE 3HYSA 4ZCMA 3QXXA 3KAQA 1DEKA 2JFUA 2FSVC 3G02A 1KAEA 3NAQA 3DT8A 4N5DA 5DNDA 1PI3A 3HDYA 2Y76A 3BIWA 3JQEA 2NQ8A 1GGJA 1U7DA 2XUFA 4Q1CA 3T4XA 5CXSA 1U2RA 3O73A 1JE1A 3GCZA 3ZE9A 1EXDA 3IMEA 1REQA 1XQXA 4W1SA 3PX2A 1S2OA 4R8SA 4BNIA 2WTNA 4B6RA 3ZVNA 1BCRB 4Q18A 4C30A 3FAKA 4O4HB 5EVJA 1U11A 2BBOA 1NXXA 1XZ8A 3BWCA 3CSUA 4JT9A 3QKSB 5IABA 1BHQ1 2WYHA 4YCDA 4BBJA 4M1KA 3ZDYB 2P30A 3HA5A 3OTGA 4M22A 4F96A 5AWFC 2Y1DA 2J3MA 3H0CA 3TJMA 2HQSA 3AB3A 4HPXB 4JKIA 1UPBA 2JAXA 3PEUA 3MG9A 4X61A 1DWOA 1NR7A 1J9GA 1WEHA 1PJQA 2GF9A 3CZMA 3JARB 3ZXIA 5D5PA 2QW8A 5JBQA 1I4EB 5D5QA 3Q8KA 2IOFA 1YMVA 2V74B 5AVJA 1O54A 2AZMA 3O3MB 3X1YA 4EOGA 3INYA 5K0TA 4YECA 3F73A 4KVZA 3T1NA 5CUQA 3GBVA 4RHYA 4D9NA 3UHPA 4U4AA 1GYRA 1S2DA 3I4FA 4Z4EA 5E38A 4IXNA 4BHTA 3DF7A 4K9OA 5IJWA 1XU4A 1FQKA 3P9RA 3TR5A 4DDUA 1SWVA 5HNKA 2K7ZA 3Q3VA 4HNQA 2JFPA 4F6RA 1VKHA 4GM1A 3DP9A 5KO2A 3UCEA 2R48A 4M1TA 3AL2A 3WNCA 4DWWA 2NACA 5J4YA 3OF3A 4BMYA 3AGPA 5BN5A 5BY2A 3DL7A 4ZK2A 1Z4OA 1WMDA 2NXWA 1KP2A 2G82A 4S0ZA 3LGXA 2QAGA 2A9PA 2ERXA 3R6WA 4PAQA 3IDQA 4G81A 3AZQA 4Q1FA 2Z56A 3OQ6A 2R1TB 4JGBA 4ZYWA 5EGSA 4LYEA 4ZMRA 5IJXA 3IIIA 5AHRA 4PYQA 2CE7A 3IP1A 3TSWA 4C01A 4C4TA 1GVNB 2F1JA 4AD8A 1R8XA 1YKFA 5EJGA 5AM2A 1A4XA 2EJCA 3IBYA 1NF3A 3L9XA 1EFCA 1ZXLA 5ENVA 3K09C 4FMCB 4MB6A 5CAEB 2CXTA 3CVWA 2R1ZA 1PVOA 4ESOA 1NPTO 2NXCA 3Q10A 2AUMA 4KQ1A 3ZIAA 4KVAA 4BAZA 4IL5A 4DZZA 3ENVA 1EFPA 2EJUA 4MGZR 2HK6A 2Z98A 1P2FA 4AFNA 2DBYA 4Q6BA 1SNYA 1EK2A 1QUFA 4TV8A 4EZBA 5CBPA 5MN4A 4IJWA 4ANFA 2O48X 2P65A 5C51B 2VA8A 2VL7A 3N58A 3MHPA 3GJXC 3GPDG 2RSLA 3MCVA 4XQEA 2E48A 1HDGO 3TN7A 2GRUA 3NBQA 3OTWA 4IFBA 1DI0A 3GO4A 4PX3A 3B7WA 3PDCA 3CE6A 1CQIB 3CIFA 3JYPA 3O8DA 1VLJA 3QJYA 4IS2A 2JG3A 2PVPA 3HR7A 5DLEA 3DLHA 3F8TA 1Z12A 3NBZC 1C0PA 2ZJ4A 2F8LA 5GVRA 3TJRA 3EC2A 4NP6A 4RA6A 2B7CA 3JD1A 5AHWA 1FNCA 2ATXA 3RU7A 4CN9A 3RAFC 1HZZA 4J0IA 3VOSA 2VQ3A 1BEZA 3G1UA 2RGYA 5JW6A 1FP2A 2HY7A 4WI1A 1ECFA 2C8KA 1C80A 2OGSA 3HBMA 5DISB 2XWPA 5TR9A 4BZXA 5GADl 4A27A 2XLCA 1H2EA 2EERA 2O7NA 4P98A 3WL6A 3B1FA 4BATA 2PUFA 1U0NA 4DR4B 3CISA 3IBFA 1AN0A 1YA6A 2NXJA 2D1TA 4MLDA 2OZPA 5TV2A 5EINA 1VYVA 4ESVA 3ZWNA 2FZ5A 3QVTA 5JOQA 1Z3IX 1KKLA 4GOLD 4ZAZA 2HKIA 2O2EA 1HQCA 2O4UX 3DZIA 1Y5NA 3HDHA 4O2BB 4CETA 5IUJC 3PNVA 1NRWA 3U3KA 4C3OB 1XZAA 4KNWA 2VDKB 3FPEA 4EHLA 2JCXA 4OM8A 4ITVA 1CUYA 3A25A 4KPUA 5JRJA 2B21A 3G5MA 4Y2TA 5TNXA 1PYOA 4FYHA 3UUEA 5JZMA 4FR5A 4WKNA 1MX9A 2ZE6A 5JAUA 4CF3A 2NYAA 4Q24A 3CEJA 4M0LA 1AMOA 1VCIA 2L82A 1A76A 2FVYA 3A4VA 2AFIB 2VNAA 2CJPA 4EPVA 1KIMA 2BFBA 2MYNA 4UBKA 4CCWA 3D0KA 1PZMA 1U80A 3CLVA 2W7TA 4Q1EA 4ZRMA 5WRFA 1OB5A 2RHMA 1W0KA 3RARA 1CVRA 1HL7A 2DH6A 4IIXA 2FRDC 4J3JA 5KAPA 2FG5A 2I6GA 3OA2A 5KNDD 2CNOA 2HIHA 2B35A 4NOLA 1Y4UA 4EA8A 4FLFA 1RIIA 3MXOA 1GRRA 4DZTA 4KN6A 2VDMB 5B58T 3SVLA 4ZZIA 1G7TA 2EKDA 3D6MA 4EF5A 2RC6A 3EE6A 3OMLA 1YQ9A 3HCRA 5JPIA 4GWLA 3RUEA 2WG1A 4E09A 1UJ2A 2GBLC 4EP1A 1PU2A 4EGCB 2C5LA 1NZFA 2B2CA 1S3FA 1TD9A 3KPUA 3Q5DA 2QR2A 2ZIFA 5JXJA 2YFKA 2GPJA 1Y3CE 4DARA 3EDCA 1UBNA 2H2WA 1EVKA 4Y6LA 4AJ2A 1TM3E 3DKRA 2VNHA 1WB5A 3D64A 3QKUA 5AKLA 3OZTA 4EDHA 3AETA 2C4HA 2FY8A 4GPD1 4QU9A 1SQ0A 5E1BA 1NW8A 1RHMA 4R9VA 4TTIA 3TZCA 5AJZA 2DTXA 1HRKA 2R68A 4DAEA 1EFVA 4TROA 1VKZA 4RYLA 1NNI1 3F6CA 4NU5A 2RGNC 1D0VA 3LHKA 4LZAA 3D2AA 2EFGA 3BJMA 4KH0A 2XOEA 1O95A 1KQPA 5DXAA 3G2MA 1WHTA 1IAVA 3WGVA 1WLSA 4PQRA 4CF6A 3WZ2A 4DLLA 3CVVA 5T64A 1XWFA 2BZ1A 2JVIA 3KTOA 3O4JA 4K3VA 1BN7A 1JHAA 4RADA 2DHDA 1ADJA 1SUBA 3A6LA 3LPMA 4P3YA 4LHZA 3NM5A 3ZDRA 4EMTA 3C87A 1NR5A 3WISA 4EUEA 3LVFO 4KSYA 4F7WA 2HSGA 3TOXA 3LSTA 1MO5A 5C1DA 3JASA 2RIRA 4RK7A 1OFIA 1Y1TA 3E3OA 4Z53A 2F1KA 1J1IA 1HEYA 4RMNA 2EJVA 2VXCA 3LPDA 3D4OA 5EI5A 1JYSA 1E7RA 1MXFA 4KPGA 3RANA 3VOTA 4PZDA 1EJ2A 3CA8A 1Q1BA 1E2LA 2P69A 1ZL0A 4HNAB 4RM2A 3HJUA 3W5IA 3ZJUA 1SCBA 3H2SA 1A4UA 1YNOA 5LOVF 4QAJA 3K70B 3RVRA 3RVNA 1QH8B 2DYKA 4MYDA 5CK4A 1AUXA 5IJ9A 2I91A 2XYRA 3OCJA 3AESB 3LECA 3C39A 2EQ5A 4H18A 4QUEA 5IDWA 1QOZA 1T29A 1ZP6A 4X8OA 3CZAA 3HU2A 3NHBA 4AJKA 4ALIA 4EGQA 4PIPA 4RIIA 1FFSA 4WXPA 4RTNA 3V4RA 4ZAVA 4Y2XA 2C4KA 2GH1A 1E5VA 3JALA 2Y1EA 4BTEA 5JSKA 4YN3A 2ZYSA 5M5BA 2WYVA 4OI1A 3TIXB 2VEOA 1SOUA 4CMBA 1E1MA 4KUEA 3NDBB 3OP4A 1U3VA 1IK4A 2CLOB 1I3LA 1SCIA 5HIAA 4OTZA 1PFWA 3JZFA 4B48A 3JZAA 4FSXA 5KJ6A 1J00A 4DV1B 4P0TA 5EVCA 4P3OA 1ENPA 1PV4A 4WZAA 4US2R 4YJGB 3TMKA 4WD3A 1J2YA 1SC1A 1KWKA 4CMCA 4NL4H 4Q4CA 4I5FA 3RVOA 3RT7A 3RFCA 2WJYA 3QE3A 1WS6A 4UM5A 4WEQA 3B70A 3DD1A 5JDCC 4TLCA 4A2WA 1IWBB 3OPYI 5I8WA 1JKJB 2YHBA 3GN1A 3NG1A 3UGTA 4DSOA 2O57A 4PG7A 4JYZA 3F71A 3PIIA 2C4VA 2O59A 5F2EA 4IDFA 4KP7A 4B6GA 3OU7A 4G5FA 3ZLTA 1Z28A 2B92A 1L9KA 1XDWA 3F5FA 3TS1A 1ZD5A 2JIZD 2QD4A 1EDDA 4C0HA 4NDNE 1DAIA 2DECA 3ZHZA 1AHPA 3O8RA 1TCVA 2OLKA 5KPJA 4OSEA 4R3WA 2IYPA 4XX0B 3RC9A 3FTDA 1G2PA 1XLWA 2CD9A 3H2JA 4FKBA 5KJEA 2W2LD 4N5NA 2X0JA 3I72A 4KO3S 1O87A 1WZUA 1YRLA 4DV2B 2E1RA 1ESEA 5KU1A 3TBHA 4CL0A 1HRDA 4E6PA 3UJ6A 1A9ZA 4U7TB 1IQRA 3UJ9A 3ZQ4A 1S9HA 4TKUB 5EERA 1KYTA 1F2UA 2H59A 2I2WA 3KZMA 4GG1A 3NOQA 4MICA 4B8WA 1NVKA 1D09A 3RVSA 1K7FB 1O94C 2VDVE 2W6NA 3KQPA 3FSGA 2OGWA 2B4AA 1FLNA 2Q7DA 2HTEA 2XT0A 2EP8A 1IZYA 3PHGA 3SX2A 3WHIA 4M7OA 2O2YA 1OYYA 3CMMA 2ZCUA 2FUNB 4X8MA 3ZX4A 4KXXA 2R4TA 3MM4A 4INPA 3PITA 4TWZA 1JTVA 4R05A 5TMPA 2G4CA 4DUPA 2AX4A 2PXHA 3JWPA 3QPUA 3T1HB 1FMJA 3DZBA 2VZEA 1PZGA 4GYKA 2Z9DA 5EHQA 4ASUA 1P1FA 4D9CA 1SAYA 1CP3A 1PR5A 2FXVA 3K9GA 3K4PA 4MW2A 4AN0A 5JSUA 1Q2XA 1EFRA 1S1CA 2D2IA 2DWPA 4I4LA 4MHOA 3OFSA 2W70A 3UT0A 4AXXA 4PX5A 3ZI0A 4EUSA 1TAUA 1JX6A 3BA1A 1V8DA 3BF7A 2NU8A 3RYFB 3W3AA 4C0AC 4CCAA 2VK1A 5GIPE 4RJLA 3OSUA 4O2AB 1L4LA 2BLLA 3E7XA 1T6YA 2IHJA 2DFTA 4FFBA 2BGWA 4FVTA 4C7VA 4GKVA 3NWEA 4URVR 1F4PA 3C8ZA 4GLFA 4BVEA 1AS3A 1EI9A 4HFNA 4D8WA 2IHNA 3BHNA 5FWXB 2IYSA 1NBIA 1EUYA 1PG5A 1RHJA 2ENUA 2HPHA 2XUQA 4LFCB 4ZCTA 4L6AA 1DTWB 2WTBA 4GX2A 1ZO8A 3VNBA 2OORA 3EH1A 1P0IA 4I1UA 2HHCA 1VB5A 4J76A 4L0MA 4X3PA 3VR2D 5KX5B 3L4KA 3O0TA 4ZVMA 4BV8A 1FVOA 5BRAA 1NYRA 4TVKA 1RVDA 2OKCA 1E9VA 4YT5A 4OX9B 1D7AA 3UAXA 4M7RA 5JROA 2R84A 5AVOA 4G1FA 2FI1A 5JS1A 3FMFA 2P6UA 5AW5A 5ADHA 1EE2A 1KEWA 1D5WA 3HKBB 3GVCA 1CUWA 1JQJC 1DKQA 4JCCA 2P3OA 4PS1A 3RS9A 5ENDA 3LUKA 1YS4A 2A9OA 2D1YA 2NV6A 1RLIA 2Y9MB 3IAUA 5DYIA 3WBBA 4BNDB 3SEAA 1XHFA 5B2EA 3RRBA 3HGTA 5GOZA 4L73A 3AUKA 3H1GA 3DOEA 1L7EA 2QUIA 1ACMA 4S04A 1YL7A 2HGZA 3NTQA 4X7MA 3AHDA 4E51A 2IOHA 1RAIA 5LL6P 4C1BA 1JDUA 2PVCA 1FYXA 1C2TA 1D0SA 1WPRA 1XZNA 3N87A 3O82A 3OPNA 2WSSA 5TF4A 5KTMA 2IWHA 3MJHA 4IJ6A 2HXGA 4FHZA 1M72A 4MRAA 4CIWA 4TQAA 5L95A 3N8IA 3WQRA 4B3GA 4MRMB 3DT6A 3KEFA 3GAAA 4P2GA 3OKFA 3H0KA 2IU0A 1SHKA 3HY3A 3T7AA 3HU5A 5J4VA 4GECA 1GY8A 3FCAA 1ZD2P 1VJTA 5G41A 5CW2A 3DC2A 3DMHA 3MAJA 1K88A 4M21A 3VKHA 4D42A 1LTQA 1MB0A 4KQIA 3WV4A 2YWEA 4DLBA 1X1CA 1JH8A 1BEEA 5BSKA 4GPZA 2PUGA 4PLYA 5EY5B 2PS9A 4LTNA 3R3JA 4HB0A 5DX0A 2G04A 1YHZA 2C0CA 1GGMA 2WU0A 5IDYA 2BZGA 3KEMA 5HF6A 1WUJS 5HTKA 3LNCA 1IBCA 4EECA 3OBBA 4UXJA 2P9GA 2IZOA 1GXSB 4BNJA 1VLHA 3KVNA 5K2OA 4ZOQI 4XFKA 3DLAA 4P31A 2CVZA 3A31A 4W7HA 1FFXB 1Q74A 3IAXA 1PEDA 3QFFA 4LGCA 3V2GA 5E4TA 2J9FA 3TPZA 5I4BA 1UL1X 5EKTA 3BGIA 1O5TA 4EW6A 4PQFA 1Y81A 1Y5LA 1GG2A 3QXHA 2A0FA 5FQOA 3O4VA 4N9WA 4Z4CA 1JEQA 5D6NA 3WV5A 2QUKA 5LBUA 1E6EA 2E5WA 2J4CA 1XZIA 1YCDA 3CIOA 2EKQA 5ESWA 4K7JA 3H13A 4JWKA 2ZJ8A 3HUFA 5JMPA 3ICPA 3V1MA 5H8WA 4MPJA 2XGGA 1NTRA 4O2LA 3AKYA 1YOVB 2O7QA 3GGPA 1P7VA 3LZDA 2OBMA 4GO1A 5EMHA 2ZXUA 3EFBA 2JFHA 4ZVKA 3SFZA 5B7GA 5H16A 5BVHB 2B8EA 3AQ4A 4J0GA 3LWNA 3E1SA 4PYKA 2XXAB 2GWRA 1AKQA 4R31A 1J0DA 2BY4A 3EA4A 5DXJA 2YWGA 4DNFA 5K0FA 1Y9DA 1UDBA 5FORA 4ZC8A 4F72A 3PGMA 1XAHA 1GFSA 1LPBB 2VUSA 3TLJA 3VNVA 4X20A 5C1BA 2RK3A 3QBEA 2PZLA 2NZ2A 2AN5A 4DADA 2AJCA 4YCCA 2FCAA 4P8RA 4D3DA 3H86A 4MJ3A 3THWA 4PGHA 4QWWA 2QW1A 3MPOA 1KE1A 1GYPA 3OU2A 1VE6A 5FF9A 4MWEA 4XJVA 4NE7A 4V0ME 5AVUA 1VTKA 4UHDA 4PHTA 4DWVA 4JIMA 4PHFA 2PQ0A 3DM5A 4I19A 3ADBA 1QQ6A 2Q5LA 3B2QA 4M99A 3UXEA 3ZVRA 3FJOA 2J9ZB 1AKMA 3C8HA 1G4AE 5JCXA 2CFOA 3PQ8A 2H2FA 2QSZA 1XTTA 1ZS9A 2R6AA 3NWOA 4L5IA 4QX6A 5BV2P 4DR3B 4HHEA 4IYJA 2KX7A 2ZDQA 3FNHA 1Y8RB 4JD5A 4PGMA 4IS3A 2AF4C 5E3HA 4J2HA 4U2CA 5H82A 1CUAA 1W88A 2AN4A 1KVQA 4HXFB 1CJMA 1HGXA 2JAWA 3RHSA 5E6RB 2WJ3A 1KBQA 2GSWA 2IDZA 2MSKA 2R6GA 1A9QA 4Q7LA 3CRMA 4RDHA 3W34A 5CB4A 2VLBA 4I50B 4DJEC 2VDNB 1IYZA 1HE8B 2HRDA 4KDEA 5CVDA 1ZGZA 1AHHA 1A04A 4QNMA 2OSBA 1FL9A 3M2PA 1GU1A 1PAUA 3B8HA 3RF6A 4C4RA 4EKEA 5AM4A 4YRTA 4ZHQF 5LJLA 1J1UA 1YBHA 3FB4A 2W90A 3MN1A 4PWYA 1JAYA 1L7PA 3B36A 4I4CA 3ZTWA 1V6SA 2X0EA 5JSZB 2BVNA 2PT6A 1Q21A 4XIYA 4UZFA 1T3TA 4I7EA 2ODPA 5C7YA 3JAKB 3R4VA 4GI7A 1N9GB 3FGOA 1RWBA 3QVUA 5IKOA 2BM1A 1ZH0A 2WWRA 2BV3A 2CCJA 4GM0A 5K0SA 2D0PB 3JWHA 4DMLA 3GLGA 3EEFA 4NZMA 1AB6A 1W85B 5AFSA 1TUEA 5I7VA 2REXB 2Z4SA 1OFUA 2IYTA 4RXMA 3VM6A 5LDGA 4BO6A 5LP6B 1UKVY 3T7CA 3L4SO 4KYUA 4W5JA 3HADA 5FUXA 4IXTA 4RGQA 2F8SA 3S8EA 4LMPA 4W99A 1I1OA 2O3TA 4RHXA 3A32A 4N7RA 3VA7A 3BIFA 2PCLA 1TEZA 3FCEA 2BUBA 4UE6A 1Y42X 1U0SY 5GGYA 1KFCB 1IM5A 1PGNA 3KB8A 4H6XA 1RI3A 3THSA 1SC4A 3EDOA 4LX0A 3F6SA 1E0SA 2I6UA 1JB1A 2G5TA 2H4YA 2XTJA 2F64A 4LQLA 2XYHA 2QRNA 3STUA 3L4JA 4HH1A 1XMOB 2WD8A 1XEWY 5AP9A 2NO9A 4FBGA 4TZ0A 4JP1A 2QIOA 3O3CA 4AZVA 5JV5A 4TXNA 3SF8B 4YT4A 3WQSB 3R7AA 4WY2A 1SGWA 4G0PA 5IZCC 1EB9A 3ISJA 3QHAA 2C94A 4TM7A 3WADA 1NLUA 1DIRA 3RPEA 5FA5A 4N0DA 4W4TA 4UULA 5EE5B 3T5AA 1NDHA 1IE3A 2F3PA 3EZ9A 4WACA 4ZGWA 3I9MA 2P6OA 1ECCA 2NV0A 4LJAA 4XDZA 4ETNA 2VDWA 1NVAA 2SKCA 3D2CA 4LXHA 4NARA 3DDSA 2H2DA 4CU5A 3KOYA 4ZARA 2PJZA 1FSSA 4H27A 4IIEA 2NP6A 5JI3E 3CPSA 3NDJA 2J33A 3MBIA 4I6JA 5KEIA 3I23A 3M9LA 1GPWB 2VXBA 3R6GA 4LV8B 4MV8A 3RASA 7REQB 1ABBA 3NBMA 1JHPA 1K0UA 1SUIA 5F4BA 4EVQA 1MBZA 3TSCA 3C15C 2PN1A 3IO5A 2R1UA 2OZLB 2TS1A 4HNHA 3A4YA 3CN7A 3NDRA 5JVDB 3EAQA 3ZH2A 5D01A 5C8YA 1HX7A 2QVXX 1NRXA 3NYQA 1Z6QA 2V0CA 3JYLA 4E08A 1XQ1A 4FXPA 3L1KA 3V32A 2VC2B 3DL4A 3UHJA 2GEBA 2LUOA 1CEXA 1P9LA 3EUFA 5GZ3A 1ECBA 1PG0A 1RXUA 1ISHA 1Z68A 3HU1A 3OX1A 5FTWA 2RI0A 2Y92A 1U81A 1GSIA 4NX2A 3T1TA 2NAFA 3EEIA 3L82B 3DJFA 3HJRA 3OTHA 5K3FA 4B2YA 1X13A 4KDCA 4RUKA 1U9ZA 1OWPA 4HK4A 5COAA 5FH9A 2YHIA 1PNRA 4JBWA 1C4WA 1Q44A 4MS1A 4S1WA 2D8AA 2Z5LA 5ALDA 1HLFA 1HNXB 2C5BA 1PTJA 4IQGA 2PMKA 3K70D 4ZO4A 3QOXA 4KNVA 4YS6A 1VKRA 2O3JA 5ALUA 4B1FA 2DJ5A 2VF8A 3PNSA 3EA0A 4IIBA 4ZOCA 1ZI8A 4MVCA 3AFHA 2FUCA 3QLJA 2Q6KA 3K0AA 2A94A 3VC2A 1GM5A 3QELB 5AKYA 5EFOA 2BR4A 4HL6A 1JG4A 1Z56C 4QGAA 3THOA 4MWTA 4L5AA 3TSYA 1TCCA 2AOVA 1RBYA 2VJMA 3D3WB 4BNGA 2O8EA 3EWAA 5K5EA 5K6RA 1PGQA 5KU7A 2NNLD 5IKXA 3EMKA 4B6QA 1JSXA 3I1JA 4FT2A 2V7VA 2Q3JA 5EJ9A 5KCZA 4A8JC 3RYIB 3G89A 2XQIA 3IOEA 1TF2A 3DE5X 3FZQA 1RAGA 2RAFA 2W83A 5AVQA 3ZE8A 3AUUA 4FP9A 1QAMA 1F3OA 1RTTA 5SYAA 1IPEA 4YV7A 4D46A 3AWDA 3T41A 2ZSAA 3IA2A 3MWGA 1F8YA 2Q2OA 2C4WA 2IPOA 2YV2A 1SBNE 2XD9A 3DDNA 3PJDA 4L5CA 4XLZA 3UJCA 3ZD9A 3HLTA 4CN8A 5C52B 1CY7A 3NPMA 4CGYA 5DYGA 2G9QA 3U4QB 1C7QA 2OCPA 2I3ZA 1AZTA 3MS2A 3CEAA 4JOSA 2YXLA 1Q12A 1OBVA 3ABRB 2VQFB 4XSGA 1BXGA 1MAAA 1TQ8A 1YK0A 2XTZA 4PQYA 4ZVOA 5T4HA 3UGKA 2FPXA 4AT1A 1XC7A 3PCRB 3SOPA 3FMOB 4TSFA 5LZ9A 3Q2OA 1B76A 3BGDA 4TS4A 3DKVA 1QU2A 2IY8A 2VSXA 5BQXA 3ZCQA 3UOWA 5KPDA 2PL5A 1I2ZA 3BBLA 4R9NA 2WZBA 1KMHB 1G0OA 1RHUA 2VSNA 2ZPTX 2DFLA 2OCAA 3V5NA 2YMMA 3P2EA 3MOIA 5DHFA 3V4FA 4D6PA 2O9JA 4DMFA 1ZN7A 5FDFA 3G2QA 2O1EA 2E4VA 2R2AA 4RVUA 2WF8A 3OLYA 1E98A 1UMCA 3AUYA 2P3QA 2JIDA 3OT4A 1U7TA 2JGEA 4JA2A 2AW3A 3T0GA 1P74A 3CBGA 1KZ6A 1ZJ4A 1LQ2A 1QIHA 1ES9A 5EWLB 3LK6A 4W5RA 3IQDB 1NAHA 1DNPA 3DO8A 4NCHA 4XCXA 5LYYA 1F8FA 4DCUA 1M6EX 1W8IA 1DEAA 5DNWA 3K6KA 1SR8A 4PAMA 4QBFA 4ZAWA 4JNKA 4QDJA 4P54A 5JR3A 1NY6A 2YS6A 5CFLA 1WJGA 1BOOA 4M7WA 4EHDA 3EUAA 1U4SA 1F2VA 5C1PA 1U2ZA 1QAQA 5BSEA 3BEOA 3OZFA 4UMFA 4JBLA 2N46A 5C8XA 2AL7A 4JJ8A 2R0QC 2Z6UA 3GT7A 3CR3C 3RIGA 2PQ2A 3K9CA 1T8UA 3T7IA 3UFXB 1FNSA 4KFSA 4NEQA 5DT2A 4AS1A 3ACBA 1R0SA 2A4MA 1NBEA 2YOFA 4YREA 4B3JA 1JFFB 2WT4A 4BX3A 4EI9A 3GJZA 5A62A 3AB7A 3SMQA 4RNCA 1C1XA 2NO0A 5JALA 1JDVA 1JHQA 3H18A 1X1SA 1Z33A 3DCIA 1VDMA 3F7TA 5DHPA 4DXDA 2ATVA 4HWSA 1QG2A 1SVLA 2H08A 2ORED 2QYOA 4XWOA 2PX6A 721PA 3PZRA 3KSDO 1O8CA 4CLOA 1YHNA 4ENVA 2JGDB 1P1HA 1E7SA 5DW0A 2RHWA 3FZNA 2FP3A 4EY7A 4UPDA 3QUTA 4DR2B 5AJUA 1LPSA 1VHQA 1G3MA 3OCUA 4MA0A 2YJ6A 3LRXA 4QYWA 5LA6F 3ZCPA 2F55A 3CUWA 4JP8A 4JH0A 3PDIB 3ETEA 3UOAB 2GJKA 4RK6A 3WRVA 1NMEA 4HMPA 4BMVA 3WLTA 4Q3NA 1LZLA 2EG9A 2L2QA 2YRWA 2Z9BA 2XSZD 3A1TA 4GU5A 1DG1G 1EKXA 1PJLA 1SCAA 2NZWA 5ALTA 1H9CA 2YV4A 3SVTA 1NQ5A 3ONNA 2XE6A 3EC1A 1T2EA 3Q98A 1P9WA 1T4CA 2DFVA 5BO5A 4EF4A 4D9HA 3GYGA 1H6AA 3AVUA 1DBWA 2FW6A 2ZRMA 3IV7A 4EH1A 1ND5A 3F6YA 4IKOA 1K8QA 5AXDA 5AW0A 4NEHB 3D4BA 2E5LB 4IJMA 2M2IA 5JMOA 4YXWA 1ZYUA 2C9ZA 3P2JA 1JDPA 2H4HA 4K2HA 4V0KA 1UFRA 4TSRA 1RYDA 2EYUA 5L6MB 5K8TA 2JCYA 1AU9A 2WD7A 1AV6A 5I9SA 1ICIA 3FPHA 1T9KA 1C81A 3L0IB 1TJPB 1L7BA 1ZUIA 4PG4A 1M73E 5GM2A 1IB0A 4PCLA 1K3UB 1LBEA 1YE8A 3C7TA 4GGPA 2PNJA 1DJMA 4BECA 1F3LA 1GTL1 1YQXA 3HFJA 4R6WA 1C30B 3L7YA 4QE3A 5GTDA 1QZUA 2AQIA 2QLBA 5BQ5A 4HOYA 1BMFA 3A11A 1TK2A 4HQOA 1X7YB 3R6LA 5B6JA 3TQFA 1D07A 3NJRA 3SLRA 1QO9A 1UOEA 5IT4A 2AFIE 1Y6FA 1BROA 1Q84A 2LP4Y 4ZAGA 3O84A 4F4HA 1CUGA 3DDOA 4QULA 3I9OA 1BJKA 1KP3A 1DO0A 1UR5A 2YN2A 4MP6A 1Q0UA 4L6IA 4U0JA 3H87A 1QAOA 5DPMA 3EVDA 2VJDA 4TYPA 2BMEA 2EKLA 2R87A 3LBHA 2BKAA 4UREA 4F3RA 5EHZA 2NMVA 4C21A 4HAUA 1XDUA 4QICA 5CM8B 4DLXA 1SBQA 2QE6A 1Q1QA 5DP2A 5K6AC 2GN4A 5IBCA 5F3DA 1V37A 2DWCA 2ET6A 2HJWA 2FE1A 4LJ8A 3BE6A 4MR8A 1U94A 4HQLA 4DJTA 1ZK4A 3FGZA 4EKNB 3I01M 4GPIB 3WDKA 5F3WB 1E2BA 4KL8S 1EXMA 2JS7A 1J8YF 2JI9A 2ZTUA 3ZYZA 2YWXA 4QC2A 2H0AA 2AGVA 4RTKA 3MMNA 4QBTA 1E63A 3ZY5A 1NOKA 3NH6A 3PL5A 1AGNA 2ZIXB 2WWTA 1CUXA 2XE8A 5HKBA 2GOYA 4NICA 4URFA 3V8VA 1CW2B 4R84A 4FHFA 1COWD 4AUNA 2IXBA 1AGRA 1JDNA 1NGSA 1YD7A 3A1NA 3QFHA 4GRIA 4M1OA 1KEKA 4OBEA 4NABA 2X1LA 2NG1A 4DGSA 3HYRA 4KMOA 3KAJA 4OP2A 4HZUB 5L3ZA 3R5JA 2Y8EA 4OQZA 1N5MA 1EFHA 1SCJA 4F3NA 3N07A 3EZ7A 1LDNA 3M81A 1Z26A 3FDXA 4Q9HA 1DO2A 3DKPA 3GFPA 2QP4A 4JT4A 4IUBS 3AG6A 4KAFA 2ZYVX 3G9UA 1HA3A 1H8HD 3ZJ4A 1J20A 2C9OA 3A9UA 3KQYA 1A1SA 5ED4A 2XWBF 3G9XA 4R2MA 1A82A 3ECSA 1T0PA 1QK3A 1UPCA 3F47A 5TQJA 4BV3A 1A7UA 3C1UA 2HSJA 2QROA 3UN1A 1CY1A 3EUWA 5DBEX 3U80A 1TJ3A 1KEZA 3BH0A 3OZRA 3CB4A 1JYFA 5K4HA 1BS1A 3QU4A 2NP7A 1OZAA 3ZEAA 3BMQA 1U2DC 1ZOPA 2V6JA 2GSDA 1YZYA 1NVDA 1PVDA 3C70A 4LAFA 3TRJA 3RROA 3FIUA 3TLGA 1AQIA 4B09A 2CFTA 2YVQA 5JNVA 3WL3A 2BYTA 2VRBA 3K0BA 4KX5A 3NRCA 1UZNA 2ZTVA 3GHYA 4GR4A 1RJFA 1TZ2A 1J4AA 1R37A 3S8MA 1WA5A 5E4YA 5IT9A 4URYR 4BAGA 4ND8A 2J4FA 2D4HA 1MQ8B 2Z2XA 2VP4A 3MWKA 1VBFA 4LSZA 3DW3X 1GZ3A 3UMBA 4V38A 2OXRA 1P3JA 2VNIA 3OUUA 1G63A 1KYYA 2FEWB 2Z5FA 5H4HA 5B58C 3L1JA 5B30A 5ICCA 1MDFA 3SMVA 2CYAA 5LOVA 5BPFA 5DYNA 1ZMOA 1QB7A 1J09A 1O94D 3B82A 3WDSA 2PJDA 3VHRA 2O0MA 1ISSA 1WB6A 2KQUA 3RSGA 4R3NA 3SZOA 1HH4A 1J8VA 1T3GA 1OSNA 3EF0A 3NLLA 2C5HA 3VR0A 1XDSA 3WBKA 2JFVA 4RPKA 1Z0DA 2OTCA 3VU9B 2UZ1B 3EMDA 2XYVA 4PIMA 1DE0A 4FOSA 4RV5A 1AV7A 2QLLA 1OZHA 3TQHA 1R5JA 3WK6A 4BUZA 4BFCA 3KSUA 2O2DA 4BQPA 3MTBA 1QQ7A 1Z88A 1YH3A 3GZNB 3KTAB 1SVSA 3QF4A 4Q4AB 2B8WA 1B2RA 5IAOA 2RE8A 4CQNA 5CYOA 5BOSA 3L84A 2CNWD 1E79D 2YS7A 4LOKA 1RLOA 1XUOA 1KOLA 4UUOA 3QUQA 4OBXA 4D25A 4YA6A 2EIXA 3STYA 1M8PA 2VBCA 4RV4A 4RS3A 3DCJA 2G71A 2FR8A 3GZ4A 4M86A 2DGDA 1NMSA 4JIGA 5HA5A 1YTUA 2CJWB 2XNJA 3C3AA 2EG5A 4UU7A 4CT5A 2OYRA 3KL4A 4N0MA 1Y3DE 4DCMA 3E7PA 4ZCPA 4D8VA 1KO8A 3UA4A 1DDIA 2L69A 4K9MA 4OQEA 2VOEA 1N33B 2JLWA 1D1TA 1J8DA 3IPAA 3PDWA 2XVMA 3D02A 1CIPA 1C9NA 1JNXX 2O07A 3TH5A 3WYNA 3X1KA 4B45A 3DMRA 4NENA 2HYDA 1JDZA 2ZCVA 4DV6B 1WDLA 5K3AA 3USCS 3OI7A 1GL9B 2PRSA 4BYGA 4YV2A 3I37X 1TB4A 1B42A 3PWTA 4XEHA 3UTCA 1F0NA 1QUEA 4FCCA 4BOYA 5K3BA 4GMXA 3KJHA 5IK2A 3PF9A 3LF2A 1CY6A 1L1EA 2XUOA 2OAQ1 3EEYA 3ZHCA 1SVUA 3F4BA 4U6NA 4I9GA 5KWVA 3KEGA 5LMNB 3CB2A 1OV4A 5ALMA 4ARIA 2GUWA 4P0PB 4V2UA 1ATZA 3HY4A 2RH8A 3UUGA 2WF6A 2O7SA 4RESA 5FI3A 3E2MA 1JSCA 1LU9A 1BHSA 1QHFA 1UP7A 3DA8A 2GPWA 4LY9A 4N54A 3D6NB 3AVXA 2A33A 4UTVA 4UUAA 1DTSA 1GL7A 2PBZA 4CKBA 4A8TA 3H1AA 1OPXA 4RK0A 5JTUA 5EQDA 3L7NA 3EIEA 3QPCA 4JA0A 3AI2A 4MGIR 5HZGA 1KR5A 2QPOA 1BWPA 3OCYA 3Q3JB 4LXGA 4MRNA 1DDOA 4EHBA 1EFUA 2PRIA 3LT4A 4OHXA 1RE1A 4EG1A 2ID9A 2OC9A 3SLKA 1VLMA 4WN9B 5JAPA 4UTPA 4RFSB 2YXNA 4Z0PA 4D4MA 1G8KA 2VFAA 3KVVA 5E0OA 2B1RA 1Q50A 3SNHA 5AUPB 2XMRA 2ODWA 1V11B 3Q1KA 1U7OA 3MWEA 1ABEA 3OQVA 3DQQA 4U2KA 4WBSA 5E6UA 4YMTA 3TEFA 1TZBA 2V4UA 3SDSA 4MVJM 4G84A 2XA2A 3LLUA 3V3KA 4MKXA 1WHSB 3KOMA 3LDFA 4J03A 1JXMA 5JU6A 1C0IA 4AP6A 1UJMA 4R40A 5B3JA 2QAJA 4NPCA 1Z5UA 1O3YA 1XJ5A 1XQVA 3NWBA 4PRYA 4YRLA 3JQBC 4EKDA 2FF7A 1QK4A 1A9TA 1E3TA 1MABA 5BVGA 1YQQA 5KSPA 4DN6A 1IL0A 3HQ4O 3LUAA 4EJ0A 2P9QA 3TXXA 3BMOA 2PPVA 5ICMA 3KSAC 1RPNA 2V54A 2B8NA 1N25A 4NTZA 1T8YA 3BRSA 1OU4A 2A5JA 4JJKA 1AC5A 2WFAA 4Q39A 1DAEA 3O6VA 1TJNA 2I1LA 5ITZB 4DA6A 4H17A 3BFJA 2YW2A 1DZIA 4KBYA 5DLPA 4XOIA 3KZXA 1Z3CA 2FSPA 1E7QA 4GIBA 4HEQA 4HDKB 5C0OE 3MRXA 4BGEA 2IZ6A 5BMOA 7MHTA 2NU7B 3TZKA 2GAIA 3N2IA 4FILA 4P3XA 4PO9A 4ETIA 4MV9A 1B4DA 5G2OA 2NUTB 5JQGF 2XF2A 1KDVA 4M6WB 1LRKA 3GT3A 4G5SA 3ZGLA 4EW1A 1ORDA 2ZUCA 3DHWC 4CL2A 2D0IA 1LZKA 1HOXA 3O90A 4ZT5A 3WOHA 1NYLA 3CRNA 3GGCA 4FT4A 1NSTA 2ZJOA 1YDMA 3K0CA 1CX9B 3OZXA 3AKZA 3RS7A 2HO4A 4MHTA 3AVQA 5CB6A 1TE2A 2H7XA 3DDHA 4MQBA 1WP4A 5ESRA 1ZINA 3WAKA 3ZYCA 1L5OA 4Z4HA 3IHTA 2J6BA 3HVJA 4KQXA 3A9VA 5KOIA 4NBLA 3W3AH 3ZC3A 3RH0A 2FX3A 2PUVA 5CBKA 1XKXA 2BN4A 3BT7A 5L3SB 5EGNA 2WSLA 3I45A 4QOEA 3VOBA 2P2NA 4M1YA 2QN2A 3CS3A 1IC6A 5C7IO 3NHWA 1G55A 1M1NA 4D9GA 5GAJA 1C9JA 2CVQA 4Q4LA 4A15A 2TMKA 4CKCA 4ZU1X 1C7EA 2I2BA 2ZWAA 1WB9A 4J1NA 1ULTA 2FWNA 3FR7A 5KC9A 1WW2A 1XB2A 2ABWA 2JIPA 3A3PA 3GA7A 4LRWA 2WYOA 4DIFA 2GN0A 2ZUEA 4NS4A 5LQMA 5HM6A 2NUAA 3BA6A 4D82A 5I9NA 5KNDA 4MQFB 2YH2A 4TMYA 4C7XA 3VZDA 5AJYA 1W94A 1U2QA 1NV8A 2R8RA 1U3DA 1FVXA 3PNKA 4IGIA 5BSUA 1Z2PX 1MGPA 1HT3A 2I87A 4NULA 1EFLA 5BSWA 3R9KA 2JGIA 2NO4A 4B3RB 2QU7A 2NO1A 5ECWA 5LLTA 1S8AA 3GWZA 2A92A 3H5TA 1A9XB 3IXQA 5D87A 3LT1A 3IQEA 3OUTA 4MQ6A 1HPLA 3TNFA 4BLTA 3N0RA 4NYIQ 2HHHB 1KFKB 3WLKX 5F23A 3T38A 3UMMA 2C7PA 5JJIA 2MDTA 4GP9A 1O5IA 3AF3A 5TDHA 4CTMA 3O8OB 4ZN6A 5KMGA 4B8ZA 2YY5A 2XQVA 1ZNZA 1KAQA 3QVOA 1RACA 3H7IA 4GZ5A 2ZJ7A 1L5MA 2QK4A 1RXSA 1I2BA 3TCKA 1P6QA 1QZZA 3ZLBA 3SD7A 3E22A 4QFMA 1NU6A 4EEKA 1GDHA 1TYDE 2CLCX 2OO5A 1E2NA 4UNQA 2FMUA 2OD9A 2MSCB 2YINC 4MV5A 3MT8A 4KFUA 2CMGA 4FTWA 1NI5A 1AKYA 3I9KA 3VX4A 3KUCA 3M6XA 3ABQB 3Q5GA 5HX7A 2FMFA 4QGBA 1ESDA 1GADO 2PYIA 3QMWA 4X0EA 2JDID 4MWGA 1M7HA 2GXSA 2C9MA 2OA0A 3GNLA 2FJPA 5BV1A 4R0NA 2C8JA 4L07A 2X6TA 2ZAGA 2NZXA 3VR6D 2F59A 1RJ9B 2AZ4A 4CTJA 4V3BA 4OYRA 3X1XA 3B51X 4QTYA 1OXVA 2H1LA 2OHGA 5FAXA 1NUTA 5K3SA 5T8KC 3SAJA 3OJOA 3PQ4A 4ECAA 2RHBA 1QCYA 1FYEA 1N78A 3K0FA 3LBIA 1NASA 1HEUA 1I0ZA 4QVIA 1M0EA 2XOXA 1OAOA 2CLSA 2YYSA 1J9ZA 2ROQA 3IUMA 3M8KA 4GP7A 3P2YA 3MK31 1UODA 2ZROA 3UENA 5HIKA 3SJ7A 5J1SB 2ZJBA 3OFVA 2R62A 2FSUA 3RGGA 3M5PA 1Z25A 3NQ41 4BVKA 4CDNA 3NEPX 4CEIA 5KOJA 4BO4A 2DPGA 2C5EA 4D9KA 3QI2A 3MAGA 5L9AA 1LI7A 3ZR4B 4JI7B 1JLRA 4UHHA 3UG6A 1RC8A 1OF1A 1J39A 3C3DA 2P68A 4X97A 4D3ZA 1FFEA 1CDEA 1QK5A 1XQ9A 1CQXA 3GMIA 1OLOA 2E9SA 3O47A 3ZNNA 4EYSA 4AURA 3G7NA 1T1SA 1SZJG 2XJ4A 5CNMA 1T1JA 4Q9AA 3HSKA 4HTAA 1I10A 1RWKA 1IB6A 4GKKB 5KSZA 3ECAA 2BUAA 4J7UA 3WL8A 4WK4B 3ZVMA 2DBQA 4ZHQA 4DV3B 1ZN9A 2J1LA 2TECE 3FCUB 2ZWVA 4NNJA 3E53A 1XTQA 4HDRB 4C14A 3NHMA 3LXUX 1S6YA 1SXIA 5ALFA 4KUHA 2M1XA 1H94A 1DARA 1TGYA 4CQMB 3LUBA 1ULSA 4RY2A 2F4VB 1QV6A 2V9PA 3GCDA 2C2MA 1YZVA 3B2NA 3GFRA 1R0CA 4UEOA 2CUNA 2C54A 5AT1A 2BEJA 3FI9A 2HEGA 3AOEC 2JIZA 3L01A 4V1CB 2X5KO 4YJFA 1EDZA 5FBVB 4QU5A 4TL9A 1DAOA 5AI4A 5TVKA 3S0JA 3JAWB 5DM2A 3ASVA 1EP3B 2BMWA 3CG4A 4LHYA 5EIWA 2CXPA 2ZPAA 4OK3A 3OOHA 4YH1A 1K7EB 4BLRA 4YR9A 3ENQA 4R2XA 1W75A 5ALIA 5B4UA 3ZBQA 1DT3A 1QIJA 1Z4IA 2V5VA 2J59A 3PD0A 1QH9A 2R8PA 3MYYA 2BGGA 2Z3VA 3GLKA 2JFXA 1EFKA 1E6WA 2KBEA 2XHZA 4FDVA 4I9HA 2WMOB 3DL2A 1I7PA 1GPAA 1YRWA 3H2IA 4C7OB 5AI6A 3UZUA 5CDFA 2IF2A 4PYIA 4UW9A 5I7EA 5HFJA 2CY0A 3O94A 2PMEA 4EI7A 1HDXA 1X8XA 2WMNB 4GSKA 3DBLB 4RLHA 1RRMA 1YCGA 3Q72A 1Z5GA 5CM9C 3WGGA 3QVJA 2IUYA 2XBMA 3ZNQA 2V5AA 1OROA 4N1AA 3LVRE 4Y0AA 1J2TA 2BM0A 1QGOA 3ITKA 3VUFA 3ANSA 4J0FA 1W49A 3ED1A 5H3HA 3VRHA 2W93A 4J1TA 2G40A 1NUAA 1L5YA 1NVTA 4MYRA 2ATEA 2E3JA 1NJ1A 1Z17A 4I66A 3MWDA 1E1QA 3O8QA 4IY1A 2IU4A 1JE0A 4FW8A 3KQVA 3R77A 5JYEA 3PFFA 4RDXA 1R0KA 1ZNXA 3B3FA 4CTNA 4Q34A 1PFVA 3QFSA 5CYPA 4W6ZA 4FPXA 1Z74A 2VPYA 1SG9A 2D7JA 3FVWA 4IWXA 4JQOA 1C8KA 2GVDC 2ZLBA 3IILA 1AQYA 1CWUA 5KYKA 4B6EA 5FUWA 2ZUUA 5HCNA 4LF7B 1SXPA 3LT5A 2Y1XA 1RPJA 1WULS 3RUFA 5BURA 5DE3A 3DYIA 4W9NC 4EYEA 4R1PA 6Q21A 1SEPA 2X13A 1NE7A 2Y1CA 2L17A 1PR6A 1UJBA 1XZJA 2BC9A 2R6HA 4WX2B 4DYDA 5EZYB 3R3WA 3CTMA 1WXFA 4ZVLA 3BXFA 1DMSA 3RS0A 4XWKA 4A2QA 4QUJA 4NXNB 3G0OA 3GOHA 3DTNA 4GI3A 4HNTA 1NW4A 5G3ZA 2CNLA 1JPVA 5AW1A 1IHPA 3JCZA 1V5GA 4YDQA 2JVJA 4IUYA 5EWMA 3WGJA 5B55A 3ISVA 3A4MA 2DSTA 3F0TA 4ARZB 3EXAA 2N0SA 3MIZA 4S0XA 3E5MA 1X80A 4OLHA 4ZDIA 1OVGA 4J8PA 4HNVA 1FS6A 2CHVA 2IHBA 4RA9B 5DRYA 1B1CA 5HK9A 2HBRA 2P4EA 3JQAB 3R5XA 4DLKA 1BYUA 1SHLA 1MC5A 3WLFA 3C3MA 1JHRA 1NM5C 2VJYA 1LS1A 1QIEA 4X95A 5FX2A 2BM9A 2IPMA 4RMIA 4WOPA 1JV2B 1EVIA 4W63A 1U5BA 4OFZA 1RWMA 2Q07A 4MQMA 5CNIA 5BQOA 2D0OB 2W2KB 2ZIAA 1NRIA 5I5EA 3IQZA 2BDUA 1YQWA 3LP6A 2EZ8A 4ZI3A 2QTAA 3EVAA 4BP8A 3LLVA 3T95A 1D1QA 2CJXA 1JA1A 4XPIA 4RZQA 3OOWA 4ZZ3A 2YX1A 4YP6A 4EJ2A 2VPZA 5CIYA 4GOKA 4J0CA 5DBFA 4IFTA 2Q6LA 3SY8A 2UUBB 4DLZA 1YZ3A 3UJ7A 1QIGA 2MIIA 3S5UA 3N05A 5MDHA 4GW3A 1F5NA 1S9DA 2GEJA 5IAKA 2JFBA 2IDKA 2DPMA 2VPTA 2UZAA 2DULA 2JI7A 3KUUA 5EIBC 3H6HA 1XRMA 1IJBA 2ZE8A 4DSTA 3FYSA 3LLSA 3ZWCA 4RKRA 2FZLA 2HA0A 3NVMB 4FD2A 3RWBA 1Y4AE 2UYOA 3EQ6A 3O3OB 4H0NA 2GFIA 2J9RA 4TZKA 3ET5A 5HF5A 3ZI4A 4J3NA 1DKPA 4NPHA 1EZZA 2GA8A 2FPOA 1JEJA 3VAZA 4L51A 3VO8A 5H83A 1RZUA 1GCGA 2ZQYA 1UK6A 3DFKA 2DUMA 4EYQA 3W5BA 1YK1A 2NNWB 3HCFA 3KCQA 3MZ0A 4MKFA 2HMUA 1BFKA 4UCXA 4ZAFA 3NAMA 3FUUA 1YASA 1QLWA 4FB4A 2BHTA 1HFEL 2I65A 4M0KA 4I4NA 3PE3A 4DMGA 2H4FA 3RD5A 2GHQA 1RLUA 1BRMA 5FNVB 4NQRA 1WEKA 3WLHA 5CG2A 4GMFA 2YZMA 2XH8A 5LBIA 4EG0A 4ECEA 4WLOA 1M6YA 3HJ