3FNQA

Crystal structure of schistosoma purine nucleoside phosphorylase in complex with hypoxanthine
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
280
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 94
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fnqA00
3LA8A 5EPUA 4BN0A 4NS1A 4EARA 4L5AA 5CYGA 1OTYA 4DAEA 3UT6A 3GB9A 3ONVA 3UAYA 4OY3A 1PK9A 4DAOA 5F7XA 1JE1A 2ISCA 1I80A 1VFNA 1A9SA 4DA0A 4BMYA 1V4NA 4L6IA 1ODIA 1VMKA 2AC7A 1C3XA 1OU4A 1A69A 3ODGA 1SJ9A 1PKEA 3T94A 4LDNA 1TCUA 1RT9A 1ZL2A 1TGVA 1B8NA 1T8WA 1V2HE 1Z38A 5F78A 3FNQA 3QPBA 1VHWA 4TS9A 3FB1A 3NM4A 4YNBA 3UAXA 3D1VA 2A0YA 4PNPA 1JE0A 4TXHA 5F77A 1V3QE 1U1FA 4F2PA 5EUBA 2BSXA 1RXCA 4D8VA 4MCIA 5CXSA 1OTXA 1LV8A 1PWYE 1PK7A 5B7QA 3MB8A 3PHBE 1Y6QA 4NY1A 3O4VA 5K1ZA 1U1CA 2QPLA 1ODLA 1RXSA 3DPSA 1B8OA 3SCZA 1Z5OA 1ULBA 3OOHA 1JP7A 4MCHA 4DA8A 3GGSA 4D8YA 2AI2A 1NW4A 1QE5A 4F2WA 1RR6A 4QARA 2QTTA 4GKAA 2HN9A 1YRYE 3K8QA 4G89A 4PR3A 3KUKA 1Y1SA 3LGSA 1ECPA 5I3CA 1K3FA 3F8WA 4WKNA 2I8AA 1V41E 2HWUA 4L5YA 1ULAA 5IFKA 4OEHA 3P0FA 5CCEA 1T8SA 1Z37A 3O6VA 5EFOA 4JOSA 1PR6A 5CCDA 3NM6B 2OC4A 3OF3A 2P4SA 2HRDA 4L0MA 4LNAA 4DARA 5FAKA 1JDVA 1A9OA 1RYZA 2A8YA 2HSWA 5B7PA 2AI3A 3OZBA 3EUFA 3OZCA 3C74A 5F73A 4TTJA 1A9PA 3PHCA 4YO8A 1OVGA 3ENZA 5B7NA 1T8YA 3OOEA 2Q7OE 4D9HA 3KVRA 3FWPA 3TL6A 4P54A 1JPVA 2PGAA 4KN5A 1TD1A 3IEXA 4TXMA 1PR2A 2A0WA 1PBNA 3OZDA 1PR0A 1PR1A 1T0UA 1RXUA 5F76A 4OF4A 1SD1A 5F7ZA 1TGYA 4M3NA 4TXNA 1CG6A 3EMVA 3OPVA 1JDSA 1A9QA 1Y6RA 4F3CA 1YR3A 1YQQA 4DA7A 4WKCA 5IU6A 1Z33A 4D98A 4BMXA 1XE3A 1VHJA 3EUEA 4R2XA 1LX7A 4F3KA 4LKRA 1Y1QA 2IQ5A 3PNPA 1WTAA 3PNSA 3NM5A 1V45E 3UAZA 4NSNA 5ETJA 4G41A 4RJ2A 1JYSA 5DK6A 3KU4A 3P0EA 4M7WA 3K8OE 4LZWA 1Z39A 2QTGA 3E9RA 5F7OA 1ODJA 4QFBA 4QATA 2GUWA 4TTIA 1OUMA 4MARA 3BSFA 1RFGE 5KB3A 1FXUA 2B94A 4WKBA 1N3IA 2AI1A 1G2OA 3BGSA 3DP9A 4X24A 3DJFA 1PW7A 1SD2A 4OGLA 4DABA 1YBFA 3E0QA 4LNHA 4DA6A 1Z36A 4DANA 5JPCA 5B7GA 2QSUA 2ON6A 3OZEA 1K9SA 4R2WA 2I4TA 2XRFA 3EEIA 4TTAA 4TYMA 5CYFA 1NC3A 3KHSA 3FUCA 4QEZA 1U1DA 4IP0A 4JWTA 4WKOA 2OC9A 4YJKA 1ODKA 1Y1TA 1Q1GA 1Z5NA 3UAWA 1Z5PA 3BJEA 1SQ6A 1RCTE 4GLJA 5CXQA 4R31A 1YQUA 1PR5A 1T8RA 4K6OA 4I2VA 2A0XA 4BMZA 3KVVA 3DF9A 3LBAA 1Y1RA 4QAQA 4JP5A 2OECA 4UC0A 3OCCA 1LVUA 3MMSA 4G8JA 1A9RA 4H1TA 1JDTA 4EB8A 4QASA 1RXYA 1NC1A 1K27A 1JDZA 4OGKA 4ECEA 1RSZA 1M73E 1CB0A 4F1WA 1U1EA 1TCVA 4U2KA 3FAZA 3FOWA 2RJ3A 3DDOA 1PF7E 3IOMA 4GLFA 1PR4A 1OV6A 4TXLA 3KVYA 3E9ZA 1JDUA 3NBQA 4OJTA 4WKPA 3U40A 4M1EA 4D8XA 1A9TA 4L5CA 4E1VA 5F7JA 1ZOSA 4TS3A 5C80A 4YMLA 1Z34A 2H8GA 1V48A 2QDKA 1U1GA 3BL6A 3INYA 3UAVA 2OXFA 1Z35A 4FFSA 4GMHA 4TXJA
chains in the Genus database with same CATH superfamily
1QR2A 4CQMA 5IM4F 5KYUA 1IDOA 2IYRA 3U39A 3G23A 5CR9A 6NULA 1O9GA 2VRCA 4P92A 3IUMA 3UT5B 2O06A 5FUQA 1WHTA 2FP3A 4DADA 5A0TA 4GZLA 1ACJA 1IOZA 2MJLA 3ICCA 2AN5A 5JC1A 1G2IA 1FL9A 3KC2A 4D9BA 1IZZA 1SVMA 1XZMA 1ZI9A 4BWVA 1UFOA 2I76A 2ZYHA 2ISCA 3ETJA 3ITKA 3M34A 4LJ5A 1I80A 5DJ5A 4CR7A 1EFKA 1VE9A 1JKJA 1O77A 5A7HA 3TQCA 1JSXA 1R3DA 1ZIXA 2JLWA 1IHOA 1MO5A 1FRFS 2JHAA 2R1TA 3W04A 2V7QA 3AG5A 3T9EA 4OVKA 3A3NA 1CX9B 4I1PA 1W2WB 1FNDA 1BEUB 3UHJA 3V9AA 2ZWIA 3ZNOA 4ZEVA 1VP3A 3C7AA 1NZDA 3LT2A 3FWZA 9MHTA 3OPQA 1YMVA 4DA9A 2IDJA 1M7BA 1YS1X 2VP4A 4JYBA 1OU4A 2AQ8A 4R2LA 5CH3A 3T5TA 3WDLA 4OB6A 3ZDDA 2VJMA 2XGOA 1A4IA 3G9XA 4JI1B 2XTNA 4BO8A 3BGIA 3HJGA 5AVSA 1A5TA 1ZCBA 1RT9A 5D01A 4PN7A 1CUDA 4LF4B 2NP6A 2IRWA 3TZQA 3F9CA 2L17A 4QFCA 4LF8B 3GZ4A 2WPDD 1U8YA 5CP8A 1I5EA 3RRJA 3SKVA 1VSTA 4BUZA 4PN3A 5GONF 5JPDA 4PYJA 4HAVA 4YAEA 1VHWA 3WNDA 2ZYRA 2K4MA 5BW6B 3KWJA 4A8HA 1U0JA 4MVJG 1YR2A 3SLGA 1OC4A 2PBFA 3C16C 1OLXA 2QX6A 3RVQA 1E98A 1LBTA 2R8EA 3I1FA 4HXEB 1P33A 3RSCA 4DLAA 1VLJA 3DLIA 3L6RA 4MS4B 3QVMA 4LXUA 1CJUC 1Y6ZA 3GUYA 1N2IA 2C20A 3BWBA 4MRNA 2GSWA 3RNLA 1EH5A 3OEED 2IUUA 1GZ4A 1WRBA 1F8UA 4O4LA 5EWMB 2JS7A 3ZWOA 1UDCA 2PXCA 1GXSA 3NBKA 3ZY2A 4OHXA 4ZVOA 2J30A 1IOLA 3HEAA 1J24A 4LF5B 1IY8A 1YC5A 1U8XX 3UF0A 1P75A 3QE9Y 3LUJA 1H3EA 1LPPA 4G01B 2MWMA 1S9DA 4LPSA 2VVTA 4QTTB 5GONB 3ZYZA 1UL1X 3T5CA 1YCGA 2X9VA 2Z09A 1EFRD 3TOXA 4EFNA 2B4RO 3A3OA 4RIFA 3WDKA 5CLJA 2A3RA 3FNBA 1YS2X 2O0HA 1I8TA 3W6PA 2Y0CA 4GU5A 1Y8QA 5F21A 1PUIA 4Q93A 2ZI7A 1FJHA 3TINA 4AMZA 2XD4A 4UAGA 4PXSA 2MMGA 4HVCA 3SYMA 1ONNA 4DUGD 1Y3IA 1DO8A 2EW8A 3E9CA 1MDBA 3PHBE 3NHKA 2OOSA 4LJ9A 4PLWA 1CUHA 2CD7A 4LJ4A 4M9RA 5FUWA 3ZR4B 5KQMA 3T41A 2A33A 1AIPA 1V8PA 2VYND 4FDLA 5DP1A 1BGXT 3HFGA 3G89A 4HGNA 4ZVNA 3CNLA 3DG9A 5JPIA 3AGQA 4AUEA 3PHGA 1ITZA 1DBWA 1Z6QA 5ELMA 1BKSB 5DGIA 4ZQEA 2WJIA 3DPSA 4E1AA 4E2XA 1UBJS 4BVAA 4EY3A 1VE5A 2G76A 1EE2A 1JKIA 3O84A 1YKGA 5EIOA 5FWNA 2AEFA 2F1HA 4GI7A 1NQWA 3BAFA 4QUGA 1ZIDA 3D8HA 1QHHB 4XOUA 2VPYA 3DOUA 3VKFA 2WHPB 1VL6A 1IPFA 2JJ1D 5DNUA 1G63A 2RAUA 4BRSA 4JKOA 3KXDA 2UUBB 5BV0A 2CHEA 1JFVA 2FUNB 4FJ0A 5BOSA 2XB6A 2YIDA 1KH2A 3B20A 3BCSA 4FHDA 4K88A 4BO5A 4X1KB 3ZHOA 1PX0A 1E2HA 1RADA 4FLEA 3SZOA 4AJHA 1KAQA 3PUVA 1IE3A 4Y9RA 3QE3A 5SZIA 1C9NA 2BTQB 4Y98A 3ZDFA 1Z0AA 2OORA 2XDYA 3KT6A 4CVNA 3WOVA 5TIIA 2J67A 3ZXXA 4RMNA 1NOKA 1B4DA 2C7RA 2CCGA 2ET6A 4ACBA 4MOWA 5LU8A 1W96A 3RFVA 3K92A 1R0YA 2AZDA 4OJNA 1FFHA 2NWQA 1N9ZA 3BG5A 3G88A 1QB7A 2WZBA 5D3ZA 5TQ0A 4UQLA 5TT0A 4F45A 1Y1PA 3OLYA 1L5KA 2HLDA 5A4IS 3DKRA 1WHTB 5DLDA 3SYKA 2PA0A 2VBCA 3M6AA 5C4GB 1FDSA 3C97A 1G8HA 4M0KA 3UK2A 4EG1A 4UMVA 4YRQA 3L82B 3H87A 3VDNB 3C0KA 3I9V6 1Z37A 1NUPA 5BMOA 2C4MA 1YVUA 1P0MA 1USKA 4CKZA 4S1TA 2HO4A 2F3QA 4NR0A 5E7IA 1H9BA 4HPJB 5FOUA 3EXEB 5IM5A 1N0WA 3H1TA 5JAOA 2QL5A 2HQBA 1XYYA 2YWFA 3IIJA 4FNGA 1Z2AA 2EJTA 3SSOA 3K2EA 2QU8A 1IJFA 2R8XA 1S2IA 2BKEA 3X1WA 2W6MA 4ANFA 3CF4A 4CM6A 3AUYA 3DKVA 2C94A 3FMVA 3FYHA 4JNKA 4L5BA 4PCAA 3RT1A 3W5JA 1D2NA 1NVXQ 2PMBA 4HEA1 1NTRA 4G63A 3C74A 1G3UA 2YHAA 3DFFA 2B7CA 1TW2A 4M38A 2RKOA 3F90A 2CL6X 4Q4HB 4QUEA 4W8OA 5E1OA 2FRDA 3ORFA 5FR2A 2G1UA 4TMKA 4BNJA 3DQZA 3EVNA 4J6FA 1AKNA 1OVGA 3O7WA 3V4FA 3PRJA 4LXHA 2OCYC 3GIWA 2JVJA 1WW8A 4LTDA 4HQFA 1PJ3A 4X0EA 3OCZA 4NZPA 1GRQA 1TUBB 2VK4A 1D3AA 3O21A 4H0FA 4Q48A 2Y1DA 2OZPA 1H2EA 2FKNA 1B74A 1F60A 3D4BA 3MELA 3MIIA 4GEGA 5TJHA 4AJNA 3KXIA 3HSSA 1P0CA 5JYBA 3I34X 3Q2KA 1MB9A 1K06A 5EESA 3FWPA 4OREX 4HDMB 4PFKA 3UWOA 3ZBQA 2PUCA 1OLXB 4OQXA 1E3JA 4P54A 2I6QA 5DIFA 1RYHA 2PGAA 3QU2A 4AULA 4EHJA 1XL1A 1Q0QA 1AUOA 4JJ4A 1N2CE 1XTZA 2YW2A 1NVGA 4HN2A 4PTZA 2DBQA 3DLHA 3OMLA 2ENWA 2I4RA 3TW8B 5BQXA 2NUBA 3X1YA 2ZVQX 4PSDA 4DQKA 4EMSA 1PR0A 2G40A 3GVIA 5K0NA 3W1WA 1X7ZA 4Y6LA 1P18A 2DT8A 3FNFA 1JHQA 3V5NA 3MUNA 3KKOA 1BDIA 1ZEMA 3RODA 3RS2A 4WZ6A 1W52X 3GFSA 1PWHA 4DLRA 1IN6A 2IHVA 2QRVB 3CEAA 3FN4A 5YASA 4DPMA 1Q44A 3QTBA 4FYKA 2QG4A 4XCVA 4UU0A 1YZLA 4DIKA 3PLAE 1YS6A 5LNK6 3N2IA 4RE5A 3FPBA 3DUWA 1ZC4A 4K26A 1U2GA 1ZN9A 3LHIA 3LT4A 3FOAA 4IINA 4DCJA 3H0KA 2DBYA 1DHTA 1Y6RA 4GNKA 3FDJA 4ZQIA 1YIDA 3F78A 2V74B 2QTFA 2R00A 3GGOA 3O4GA 3QZUA 4GP7A 2B3DA 1TO6A 4NENA 4R0MA 3NBAA 4JSRA 2FFRA 4HDCA 2DXIA 5KVAA 4NPHA 2CY0A 5JW6A 1D2EA 3CXRA 3EXHB 3SLKA 1G9SA 4H2DA 2E89A 4HJRA 1T24A 2M6SA 4BLPA 1RLUA 4BUCA 4ZI7A 3W3AD 3EZYA 2GJSA 3HC7A 3TRFA 3O90A 1QSGA 4KG7A 3E35A 2WLSA 3PSHA 1LTHR 4MHOA 1T1SA 3PNSA 5BYBA 1L5HA 1WPRA 1ECBA 3ZTYA 2HMVA 4EO9A 1QP4A 3T7AA 5K3FA 1JIJA 1MQSA 2FXIA 4X00A 1FDRA 2MT9A 4G41A 2OSBA 4LZAA 3SC4A 3WKAA 3P9CA 2QXYA 4EEXA 1NNUA 2Y9MB 3IHTA 2EQBA 3OCJA 4PG5A 1COZA 4BVJA 5MDHA 2XVYA 3O0DA 4NULA 1M7HA 3QLUC 1IEQA 2HTEA 2JIBA 1B0AA 4KN6A 3BFXA 4NFLA 1JW9B 4CJXA 1J1IA 4DJAA 3D3QA 4AQ7A 3ECSA 5DT2A 1AKRA 1Y7TA 2P3OA 3ESDA 5LUBA 1MAWA 2GBGA 3ESXA 2J3JA 3I1IA 3GY0A 4KQMA 1UCFA 4DSUA 4JI4B 4U8HA 2ZYUX 4PC3A 1R0BA 2Q9AA 3PWSA 2J3DA 2QAGA 4C78A 1YVPA 4FMBB 2CLDX 2XVXA 4ENTA 4QFBA 2UXBB 3A11A 3JYOA 1ZQ9A 2QD2A 4MGYR 1J7KA 4MI6A 3VR4H 3QU4A 1GAWA 3ROGA 1D2RA 1J49A 4PPGA 3QVJA 1AX9A 5KB3A 1AH2A 2MSDB 2RGDA 1FXUA 1L4NA 2VHQA 2DFLA 3PWZA 4XJVA 4IWNA 2I6GA 3JCZA 3E22B 3MWGA 5ERGB 3B7GA 4XIYA 4X3PA 3RUIA 4B6OA 1Q17A 4CM4A 1QHSA 5A7GA 1UDXA 2J9ZB 2A7XA 2PQMA 4JNCA 3TPCA 3TSAA 4DNPA 3CXUA 1F4PA 3PTZA 2FEXA 3IUBA 3FMFA 3RHZA 5KQSA 1Z25A 1X1QA 3D5QA 4EFDA 5JJ5A 1F17A 4F56A 2PUBA 3SEZA 4BJ3A 4BTEA 4DA6A 4CQJA 3RVOA 5HGXA 1UANA 3P97A 1O96A 2NSHA 4B3DA 1GZVA 4I8XA 4COOA 5JOQA 1MBZA 3BMQB 1WZEA 4M1WA 2H65A 4EKDA 1P6UA 3EEIA 4TYMA 3FW1A 3EXIA 1VJRA 1CUVA 5FBRB 5LJIA 3OOJA 1GQRA 4TS4A 2JFNA 5KJ6A 4IY1A 5KYKA 2WZDA 3P9NA 1RZUA 3LGXA 5BN4A 4XQEA 3UJNA 3DMDA 4HLDA 1E1QA 5CFMA 2VN8A 2ASVA 1N5DA 1Y81A 3I72A 4TKUA 4IP0A 3GNSA 4I66A 1SXJB 4JEHA 1GPH1 4KRXA 4EA7A 2UXDB 5HUQA 3EDCA 2QVXX 2I54A 1R15A 1UADA 1VYVA 2WSIA 3KCQA 2WWHA 3NBFA 4LOIA 2DULA 3ZK7A 5LR6A 3CZMA 3E9EA 3ECAA 1SKYE 5AQEA 4EYOA 3GUZA 2PU7A 4Y2QA 3ZIAA 1WMDA 4GKBA 1S8FA 1T4DA 4F96A 1CY7A 4XGQA 1GSHA 3IP5A 5AW8A 4CLRA 1GZ7A 4D82A 3HNOA 3FWYA 3IMCA 1X7ZB 1GPJA 1OFIA 3GRRA 3MRTA 4BVGA 1U3CA 4EL0A 1YNOA 1RCTE 2VHYA 5B3AA 4QREA 2JJ2D 4KQ2A 4IDEA 5E0KB 1M8GA 3TS1A 3OPYB 3FKJA 4HTFA 4ER6A 4IG4A 3A3PA 2ST1A 2VBIA 2WJZB 1P7WA 2D0PB 2UVDA 3HDJA 4W82A 3QW4B 1D6NA 1CBUA 1ULZA 4R83A 2XUHA 3U3MA 4AZ0A 4JCOA 4ZJYA 3MPUA 3W6OA 1EI9A 2YJGA 1P7ZA 1L5MA 3HYTA 4OPMA 2AG8A 4PLGA 4PLHA 5JWHA 4ON9A 5J1TB 5JANA 5ENDA 2P9TA 5DTEA 4TQGA 1KMIY 2QLBA 3IELA 3MS4A 3OD1A 1ABFA 5ELLA 5EMMA 2R9VA 1OKKD 1LVUA 2P68A 3O74A 4PQGA 2YZNA 4XB6B 1ADGA 1SD5A 3IVXA 1ZD5A 4ISBA 4JOQA 3Q7RA 4RETA 3VU3A 4MUKA 1BVRA 1JIXA 2AYXA 1T1RA 2O3QA 3K0BA 4ZHQA 5JC8A 2J6BA 1NSFA 4KPGA 5DXJA 4PX2A 4BNKA 5LD2B 5CLLA 2WQ6A 4C4AA 2GLUA 2ZYSA 3KV3O 3R8FA 3CZCA 4L4YA 1F0KA 2CL0X 2J46A 5D7BA 1HKHA 4QLAA 1O57A 1WP4A 4C2BA 2GLTA 1WXFA 3DCYA 2CXOA 3O1HB 3LCUA 3MAJA 4L7QA 5CH8A 1F6DA 1A0OA 4GX5A 3JY6A 4UNSA 5AUPB 4GYJA 3RV4A 1B0ZA 1BN6A 1XZIA 3DOHA 3IP7A 1GLGA 3G6WA 2Y1GA 3A4MA 1GM5A 5DM2A 4DBZA 5JYEA 1Q7EA 3V4LA 4QGHA 4LJYA 1PF7E 1XF9A 3C98A 5SY6A 2XZPA 2ZRPA 4YDSA 3SAJA 2OE2A 5DHRA 1BFDA 4BRZA 1XX6A 1NTOA 1DAIA 2ZIVB 4JFRA 2XB9A 4Q6BA 2FCAA 3PFCA 4E3WA 4RTLA 1I14A 1Y4DE 3ZWBA 4WUTA 5JCZA 3OU6A 5C8YA 3GBSA 2JW5A 2Q3FA 3NNSA 4GUAA 2OYSA 4X60A 3KHKA 5AJTA 2IGBA 2VHZA 2QZPA 3QIVA 3VHXB 3ELWA 3QG5A 2YYAA 3U81A 3T3NA 4JELA 2VDOB 4N9WA 4PCLA 3R41A 2ZBUA 4GPD1 3EQ9A 1M5TA 3M83A 4E6PA 1M6NA 2XCTB 1YDWA 3ENNA 1P7CA 3Q9NA 4G09A 4CHTA 5KSZA 3CY6A 2FPOA 2C1XA 2HHLA 2ATCA 3MGBA 4O5OA 3V3TA 5EJ4A 2BGWA 1R9NA 2I2BA 3CKKA 5HVNA 1IXRC 3R9XA 5JJKA 2VHTA 3NWJA 1E59A 1FVOA 1P5RA 2H8GA 3UJBA 2RHBA 4GW3A 2JCBA 4CM4B 1TZCA 1C3VA 4MQLA 4AIIA 3OZAA 5C8DA 5DBFA 5CA0F 2O8BA 4YR7A 1U1GA 4DMRA 4IDDA 5CBPA 3A7EA 1THMA 3PGLA 4RJIA 1OGIA 1Y80A 4WY2A 1SUDA 3N5CA 3GMDA 4GLLA 4NS1A 1FZTA 1E5DA 4PWYA 4P0QB 2FE4A 3LCJA 2XIQA 2DB3A 4F9EA 3ZLTA 3Q7SA 3ZG6A 3B6JA 4PIPA 5I9MA 3QOWA 5MN4A 3JWJA 2BM0A 2KS6A 2GSDA 3RF7A 3SK0A 1YQGA 1BX0A 1P60A 1PK9A 1RAAA 1IN7A 1BS2A 2VT7A 1NNI1 1TA9A 2BIFA 4JEUA 2EHDA 4B6SA 3THWB 4L07A 4R1TA 4R6XA 2WTAA 3TAHA 2C8VA 2CHGA 1A9SA 4KQHA 4BLRA 5CA0B 1FW6A 2XJ4A 1RLJA 1EDEA 1GDHA 2FFJA 2HSEA 4PBTA 5T41A 5JDCA 1UAGA 2Q7DA 4KWEA 2QKYA 4YDRA 3WHLA 4KAAA 4WVFA 3EDQA 2QVLA 1P1KA 2KBEA 5AKXA 1CUIA 3U9TA 2RI0A 4RWEA 2JGEA 3MXTA 5K01A 2LWIA 1PJAA 5T4EA 1R8QA 2XA1A 1J0EA 1XEXA 3JQ6A 4H16A 4URYR 4XEUA 3SQOA 1WBJB 3BIOA 5CH5A 2VCHA 4BEWA 4Y3UA 4CLRB 2IIVA 1E2UA 2O2CA 2PRZA 2VQ6A 3DNPA 5KOHA 3AVTA 1KRWA 4LDNA 4MRVA 2I03A 2QRQA 1BU5A 4F5WA 5BVHA 3L8YA 3LCRA 1IIRA 4Z0TA 4M7OA 3DVRX 1FX0A 5EKDA 4ZJZA 1ZNZA 2PJUA 5DI9A 5BR1A 1GQOA 3TZBA 1P62B 2I6UA 2UV8A 3INGA 5CB8A 2DHCA 4AZ0B 4P84A 4RJJA 3HI6A 3TMAA 2IDZA 5K2MA 3EQ7A 4RABA 3UAXA 4C0SA 1JNXX 4UCQA 2EGHA 1PT8A 4JB8A 3TAXA 3HRKA 1I2BA 3GVXA 2GWRA 4WZZA 5EIBC 1QTQA 3WWZA 4DPLA 3I2IA 4OXNA 4FFBB 2VT6A 2FPIA 2FPSA 3H6HA 4YFVA 5G4LA 1T0IA 3EY4A 1X7XA 2H7CA 3CO5A 4EPTA 1BCSA 2W6IA 2A59A 2SHKA 1MXFA 1V9LA 2ZAYA 4JODA 3MCAA 4MROA 3KWMA 3L7JA 2W4QA 5BWNA 3ZLUA 2GPBA 1WUJS 3FYUC 2O7RA 2P79A 1F5SA 3OEWA 1SCBA 1JVSA 3WRVA 1R0SA 1GITA 1RRMA 3KJHA 2PXHA 4XLZA 1SG0A 2EBUA 3IO3A 4W1QA 2IYYA 4NJMA 1UKZA 1WZ2A 2VP9A 4TLAA 3OLCX 5FPTA 1PFWA 3PXCX 5I5EA 1KIMA 1PWYE 3QKUA 4M88A 1MW9X 5LCXA 3KKPA 1F3LA 4TLCA 3REFA 3G1UA 2XUJA 4QOJA 1SVUA 1ZXXA 1SBTA 2ZE5A 3AF2A 3K1ZA 3R7BA 3UKOA 4K5QA 3D31A 5BXQC 1PFQA 3N2NA 2BHNA 5G2OA 2IEBA 4ZVTA 2X0IA 5K8JB 1K86A 2F64A 4C14A 1JWAB 1ZCAA 2H4FA 3FTPA 3ITDA 4B34A 3WGUA 4YV0A 3QBEA 3F6EX 1R12A 3N8NA 3ZI0A 4DZTA 2X1HA 1U1CA 1A4RA 1UT6A 3G1TA 4PF1A 3KX2A 5KSPA 5KC9A 2GN0A 1UIRA 1XEFA 1GILA 2VZ8A 1ZC3A 2OK7A 3IDQA 4QNMA 4UNQA 1GTRA 2D0DA 1D03A 5BNFA 1SQFA 2VP2A 1KEKA 2ZRIA 4BE7B 1RRGA 3MSXA 3H2IA 4GPIB 4BFWA 2GK6A 4O4JF 2XA9A 1KP9A 2OHGA 5LBIA 1U5BA 3CCFA 1DCMA 3PJFA 4ARVA 2VYQA 4YAOA 4RFSA 1YDFA 3JQ9A 1M2KA 2F90A 4BU1A 1KVQA 1E69A 3RRFA 5H81A 5FFFA 4RZHA 3DEZA 3W5UA 3ZQUA 1RR6A 5K0LA 2XD9A 2WUGA 1CDZA 4TSRA 1NJ8A 3T9FA 2DFVA 4Y2HA 2ES4A 2IHJA 4QQNA 3WOHA 4IQGA 4GKAA 3UUFA 2HXSA 2VK2A 3KUKA 1Y1SA 3PDHA 4Q12A 1T6NA 3O9ZA 5IAOA 4O2AA 3ZY6A 2R5WA 2LXNA 4U39A 5DN6D 3FPJA 1J07A 2Z3ZA 4O4JB 5H3CA 1U90A 2C5SA 3UAGA 3KOOA 3T3IA 1VC2A 1YAJA 3IVMA 3WAJA 1U7OA 2HWUA 2I2AA 1SWVA 3ROZA 2C7OA 3VDQA 4FZRA 1K63A 2X1LA 1QIEA 3QTTA 4ZU6X 4TTQA 2UXCB 4LEIA 1XQ9A 2ZXEA 1UXGA 5HOQA 1Y9ZA 2VJQA 3G8DA 2B4TO 5DB4A 3K1AB 3WLNA 2AOTA 1UEJA 4OFWA 3TL2A 3OAAD 4EA8A 1ZSVA 3QU9A 5GY7A 5K9ZA 1QU2A 5LQRA 4LGCA 3IV7A 4E21A 3K72B 1DAEA 3S2UA 4MA0A 4RDXA 2PBLA 4QA9A 3R0XA 5BMVA 1XA0A 4PC6A 4LNAA 3O47A 4PY2A 4RMGA 1ODSA 2R2GA 2V6FA 5CVCA 4PFSA 1ZRSA 3V1MA 5IKEA 3Q3HA 2QL9A 4CIYA 4EIWA 1IM5A 4ZQHA 3LCCA 1IN5A 1ZX1A 3U3XA 1RKXA 3PR3A 4YGXB 1JKFA 4A36A 1YZKA 2H5LA 3DLCA 5D1HA 5EMHA 1VJ1A 4WCFA 1A9PA 2A9KA 1E60A 5AJWA 4Q7EA 3T4UA 4HB0A 2C78A 3IS3A 4YRNA 4AF8A 1OLOA 1TQ4A 1I9GA 4I1VA 2AFVA 8ADHA 5KOHB 4M7PA 4GR9A 4RTOA 4L72A 3L79A 3M0EA 3V2HA 4C2TA 3F5DA 1G8JA 5LWHA 2ADMA 1HYBA 2JIZD 3TWOA 4RQUA 1WXDA 2DR3A 1Q1BA 1FX0B 4OAOA 2VXYA 1AQUA 5B2EA 5TGDA 5IULC 3OHMA 4JA0A 2JANA 3B2QA 4TLBA 2HR1A 3QA3E 3GZJA 4AK9A 1T15A 4JEIA 3W7VA 2ZUCA 3JTEA 1M8PA 4UDOA 3HO1A 1XMJA 3HCPA 1B2LA 4OP2A 2FSUA 1TTPB 5HFAA 1I94B 3K70B 3PX3A 2FPPB 3CVXA 2R6R1 1Q83A 4I2NA 5FI1B 5HW0A 5C7OO 3ECCA 3LPDA 2J5XA 2H63A 3BFJA 2F00A 4XD7D 1C7IA 2C59A 3KCNA 1CNFA 3A9TA 4IL5A 4RO0A 1E79D 1GDDA 2NAPA 5KAPA 1EFPA 3DB1A 5K6AA 1AS2A 1XRMA 2ZWOA 3OBBA 3GFGA 3WICA 2HQ1A 3QELA 1QYXA 4K1LA 3D4OA 3V1YA 2VHWA 1ZM2A 4QXQA 3PJDA 2I3ZA 2AQHA 1S1MA 5DHFA 3GRAA 3GA5A 3PDIA 2XNJA 5LZ5A 1R1DA 2VHXA 5TMPA 2OHOA 3AR8A 3U4DA 2ZTHA 2J6HA 3QMWA 1NXWA 3O2SB 4FBLA 3ER9A 5HF9A 2B82A 1TUGA 1QDEA 3ZNPA 4LYHA 2NOAA 1CHDA 1XMIA 5JG7A 4R3UC 3B2EA 2IEYA 3T5GA 2WYOA 5AVXA 1EEXB 4ZYZA 2JGKA 4ZTBA 1N6LA 3WSVA 5DNCA 1RPTA 3ENWA 3NHZA 4HQ0A 1OR8A 3O82A 5EVCA 3ZE2B 2H7XA 2QK4A 4TKVB 5JQGF 2XKBA 3PGVA 3RIXA 1KEWA 1EX6A 3AXSA 3HLTA 3I6QA 4HWPA 3VYVA 1HDOA 1IATA 3CIFA 1ENYA 2BEVB 3QH4A 4ZFNA 2OPHA 1YFZA 4LKRA 4NBWA 1U2SA 4F4CA 1QH1A 1V1JA 3OPNA 2EFCB 3TM5A 3MQFA 4MZXA 5ALQA 1RJGA 2GJKA 1DADA 1WUHS 1LXCA 2WRZA 1VSBA 1U5BB 3HGMA 1GNPA 3U4MA 1L5GB 1ZH4A 4NSNA 3NOOA 2AL7A 2O0MA 4DNXA 1JLLA 3WIDA 4CBVA 1H2HA 4RJ2A 5JQGB 4KO4S 1UBUS 3GLIB 2UYGA 3KLBA 3C1AA 1YT5A 4A6DA 3NKFA 3Q4GA 4PIMA 1C8BA 5AXCA 4ATNA 2KB0A 2QAIA 2PO5A 2ZWPA 3GLUA 1XWWA 3K09C 3HXOA 1QTRA 1Y7HA 4DR5B 4KPYA 5J9FA 1E8NA 2BFWA 2FZWA 2VF8A 1UWLA 4IV0A 4LBZA 5TXGA 1EXVA 1FUYB 1P1BA 3HVIA 4MYSA 2ROQA 5GOTA 2BONA 3E9RA 4UTZA 5FADA 3ZVRA 4TMTA 1A95A 3LY5A 3QPCA 3ZHVA 1KY3A 1CHNA 3I5MA 4QYTA 2CJPA 2J6IA 3HKBA 3SQLA 4QG7A 3C5HA 4IDOA 1RABA 3QVVA 5HM8A 5GJVC 1DBRA 3L18A 4KV7A 3EGXA 4HY3A 4OSEA 3F6RA 4F9TA 3GH3A 1KQ3A 3ZVMA 3DJYA 4X54A 1ISJA 1P2VA 4TM7A 2OKCA 1W581 4XVRA 2M9MA 4FX5A 1U0GA 1YMQA 4AKHA 4K05A 1VKNA 3PI6A 3VJKA 4BLUA 4BCBA 3RAEC 5KINB 2I4NA 3U5TA 1Z07A 3MD9A 3DR5A 2JGDB 1WE2A 3OWXA 4BNIA 1KDZA 5AUNB 1OXVA 2YZ7A 3X0DA 1XRNA 2W2XA 2XNDD 3AILA 3ORSA 3BK1A 3DE1X 2J4CA 5LB4A 3HZRA 1RHQA 4IHQA 3VU8A 1HYQA 1DOZA 2XHZA 4UDNA 4GX1A 1T9BA 1KSGA 2NSJA 3I1JA 4PS0A 4QBFA 5AXDA 5CEFA 2QM8A 2GILA 3FBGA 2B7LA 3KQUA 1OXBB 4JJKA 5B3JA 3QYJA 4ND8A 3O8RA 3EQZA 2II6A 1OA0A 2OP0A 1XXLA 4UARA 2Q6KA 4GMKA 5TT1A 1I4OA 4MR9B 3TW4A 1BEEA 1XMSA 2IKSA 2VBFA 3D8NA 4OI2A 2WTEA 4GAEA 4RKQA 4ZCRA 4GZ3A 2PDAA 1HLPA 2WHQA 5AVQA 4CQMD 2ZYAA 3R1IA 5IKOA 4P53A 4AQYB 3PR2B 4ZVKA 2VP5A 3MJTA 4JQOA 1KQFA 2H1FA 3GJQA 1FS4A 1KZ1A 1WNFA 5GTDA 2ISQA 4Q3LA 4W9RA 4MGKR 4WOJA 1KS9A 5T8KC 3NJ8A 3F97A 2PUGA 4R1PA 1NLYA 2YRXA 4UFPA 1OT5A 3W5VA 1CRZA 1E1RA 3LPCA 1XJCA 3KWLA 3F3MA 1L7OA 4DCPA 1OREA 3EOBI 5AKHA 1C4OA 4O3MA 2Q5HA 5JD6A 2Y9PB 4ZAWA 1YZVA 5FJJA 4L16A 5JNVA 1X8LA 4DV3B 2FQYA 3VMMA 2JGMA 1F3OA 4YJKA 1E2JA 4EYEA 3H2YA 3DAHA 1Q0HA 1ZD3A 2R7KA 5LN1A 1CUGA 4KGDA 2F43B 1L4BA 3S6JA 1IY0A 2X77A 2PL9A 4RKEA 4UHHA 2NNLD 3EVTA 2ZZMA 3DBOB 3DEYX 3F3YA 2VQSA 3QX7A 5ERYA 3AVUA 3VPCA 4ZEXA 3TZCA 1S7CA 2C8KA 4LSWA 4F7WA 1HH4A 1KY4A 4RNCA 1PHRA 5EWLB 1GQQA 1TQ6A 4MRRA 1UH5A 2Q6TA 1R5JA 2YRWA 4I50A 1RJ9A 1HDIA 1TKAA 1FBTA 4XI9A 2ZJ8A 3QYPA 5DN9A 2AGVA 3JALA 3Q15C 4GOMD 5CMLA 3U2QA 4ALJA 1U0FA 1ZZGA 4WY5A 2Q2WA 1GRVA 3ANXA 3G7SA 3LWBA 5AJUA 3C6BA 4ZOEA 3PITA 2I78A 4UC0A 4Y6GB 3PQ3A 1LZLA 5KQGA 2O57A 4CF5A 3KJXA 4FI3F 1JBQA 2QTVA 1BOFA 2P77A 5U1PA 1EK0A 3WSTA 4CQLB 2EJUA 4FZVA 5K4GA 4C2UA 1Y63A 1DJQA 4GT1A 3KJEA 2ESRA 4PPYA 2FK7A 2DTXA 3IVRA 3WDMA 1Q12A 3TTXA 3C70A 4CIXA 1QH1B 1GOTA 1QVZA 1XDBA 1PL0A 2F62A 2EGGA 2IOFA 3KVNA 4RW0A 1GUDA 1GL6A 4BO2A 5IDXA 5KWSA 1QO0A 4ZTUB 3I01A 3NV7A 2VRWA 2H1VA 2IPXA 4DRXA 2H4ZA 2R6CA 1U81A 4QYXA 1FOEB 2AE1A 1K3TA 4OH1A 1AGPA 4JHXA 3FRJA 2PS3A 4L0CA 3KDAA 2AUTA 2ZWMA 4JQZA 1EZZA 3PQ2A 3D7SA 5BV8A 5AVUA 221PA 4Z7JA 4YI5A 4KR6A 3SHFA 2XT0A 4L0DA 1YI8A 2HNAA 1DNPA 1NM5C 3F5QA 2DQKA 2P0YA 4FE7A 5EOVA 3TKYA 4ZIRA 2AE2A 2D4HA 4ESOA 1E4EB 1DIBA 1JQDA 1NAIA 1P7YA 1CEQA 2GZ1A 4IBOA 2PJZA 1FYWA 1LPSA 3E9ZA 3GRZA 2WF9A 4MLDA 2F1IA 1NMSA 5FPYA 4ZEWA 1HE1C 3REQA 3RSZA 2R8BA 3EFBA 2PRIA 2JRCA 3EW9A 1XTTA 1P31A 3JPWA 3NVDA 4DCMA 2PH5A 1V6AA 4FQ8A 3JASB 1PFKA 2XLCA 3DYVA 3EZGA 1NP7A 3SY8A 3GLHA 4MLPA 1CUFA 4WMLA 4NX2A 2ZRKA 3GG9A 3TD2A 4URUR 5GJWC 2J45A 4D81A 3B9PA 4II7A 5I9TA 2XUZA 3KYDB 1X77A 2CMFA 3U16A 2FSFA 4LHVA 4UW9A 2VF4X 4RIHA 1DQPA 2YDYA 3N39C 4WN9B 5C1BA 5IDQA 4BO4A 3ZI7A 4YRMA 4Z49A 2XCIA 3M6FA 2GO7A 3CR3C 3PFGA 2H06A 4KMOA 4LCEA 3PHJA 1UBEA 3TD9A 1NUSA 1YHNA 3HE3A 3ZDXB 5F5XA 1OAOA 4TXJA 2JNWA 1Z06A 1E3SA 3GRCA 4CI0B 4E14A 1V6CA 1BQEA 3PNBA 4ND8B 4NU8X 2FX5A 2Y4OA 2JI6A 4P31A 3J81k 2R60A 5EG5A 4J1SA 3T1YB 2VF7A 1Z4OA 4FGWA 1E9CA 3ZH9B 3JRWA 4RGYA 4ZXFA 1GZHB 5LP6C 3GB9A 4HNVA 1TMOA 4DLZA 1GGNA 3DCIA 2FNAA 2PIAA 3VRHA 4C1NA 1HNZB 1L5ZA 1WB5A 4FGJA 3R8CA 4BGEA 1D4FA 3D6AA 4JSYA 1LDNA 2XQVA 4GRAA 5CM9C 3L6EA 3I52A 3RRNA 4HDAA 2VZEA 3WBJA 1DC3A 3R3XA 2PX5A 3FGZA 4XVHA 3CEHA 3TM4A 5JUWA 2EL9A 2HLDD 2SCUA 1QPBA 2H59A 3SHOA 4IS3A 2J8ZA 3AHFA 3HWRA 3KD2A 3TLXA 2BSAA 1PS8A 5GZ3A 3ZGZA 1OXSC 1PCXA 2I3BA 3HJRA 3QLUA 2RK3A 2OILA 1J1ZA 1N1GA 4O5AA 4I50F 2IFTA 2VPQA 1GNSA 4C7XA 4Q9IA 2CNWA 3GDWA 2EJWA 2NZYA 3SR3A 1QVRA 1W29A 4G1VA 4N6NA 4QGAA 4QOEA 1VI2A 4QUIA 4MKRA 3VYTB 1Y42X 3FPFA 3FBWA 3KD3A 4LCJA 4UDYX 3AR9A 5LZ9A 2R6GA 1CRQA 1DC6A 3IJPA 1HC7A 3MPOA 3T7RA 3UXHA 4QLBA 5A5GA 2YVQA 4D1YA 1QLJA 4KQKA 4UCFA 3G0BA 4DIEA 3GMIA 3ET4A 4EJ2A 4R7ZA 2CYBA 5DLQC 3SJUA 4D6XA 1YGYA 5F78A 2XT9A 1IM8A 3IJRA 4RLFA 4BO7A 4UM8B 5BWLA 5ICGA 5J2TA 4NEGA 2YXPX 3I92A 5AM1A 4IQ4A 3PKJA 4M49A 4OFZA 2JAUA 1ENOA 4I50B 1E8DA 1RJ9B 2QSYA 3LRPA 2B98A 4HOYA 3DLPX 3G49A 4W6ZA 4B76A 3GLFE 1RBMA 2ZB4A 3EPJA 2CE7A 2H16A 1XCOA 3K9BA 3OF2A 3P94A 4S1PA 5LYYA 4F3NA 3WO0A 5ICMA 4L6AA 1AQYA 1SB8A 3I53A 1Q11A 3EF3A 1BW9B 4R8KA 3TKLA 4Q1AA 1DEKA 4TXHA 3HCOA 3IVGA 1K88A 1U04A 1KF0A 2R44A 2IUEA 1OWMA 3A1NA 4C3OB 2HK9A 4B83A 2QTVB 1FTYA 3LDHA 3VR5H 4Q82A 3HVUA 1J21A 3K0AA 3LBFA 3NTLA 1QV6A 3TNJA 4PG8A 5M34A 5HTKA 4PRYA 4B3SB 2P9CA 2FN3A 1EEHA 5DBOA 4EI7A 1XPOA 4RGQA 1SRQA 3HV2A 3QVKA 5KTRA 4KRYA 1IBKB 5MFPA 4PYOA 1MQ9A 1LNSA 4QWMA 4R69A 4PINA 2QM0A 3DPIA 3R5SA 4JZYA 1VCNA 4UEKA 3FLBA 3EGVA 3RAPR 3ZDQA 3FLMA 3KEOA 1QVVA 2ZT7A 3U19A 5I4KA 4HAUA 2BKUA 1TT7A 4HQRA 3OHPA 4B79A 3X2SA 3KT3A 1UMCA 3R40A 4FR2A 3ADDA 5EZ6B 1FRQA 4M83A 4L85A 2JHGA 4JH0A 4PO8A 4NYMQ 1Y6QA 3AV0B 3VR6H 4ZIRB 4N0QA 2XUPA 3SFVA 4Q7MB 5K1ZA 4WFQA 5GV8A 2RGNC 3V8RA 4YAKA 2XE4A 3QSYA 4C0BA 2I99A 3AVVA 3EVEA 3BJZA 3ZGVA 4XM0A 1P9LA 2B78A 2ZRHA 3CKYA 4C3ZA 3B1WA 3DD1A 1MJGA 5C35A 4IJKA 4G1EB 4LUCA 4Y9DA 3GEBA 1URPA 3RYIB 4QT4A 5EIEA 2WUFA 3NCHA 3IT1A 3D7RA 1YZFA 4OOEA 4P86A 1KYZA 1AKYA 2OXIA 1XALA 3TUIC 1JALA 3BREA 3ZHBA 1P73A 2ANCA 4MYHA 3WB9A 5ED4A 4QOHA 2AN9A 4MXDA 1KNXA 3J81A 1BRTA 3AEXA 3O4RA 5L4NA 1KETA 3KV1A 3DZGA 4YALA 2HPVA 2GYUA 2XF2A 1AO3A 3C7TA 5L3SB 4E07A 3I5YA 1TVKA 1DTWB 1L7VC 2O3JA 1KO5A 4HEQA 1T2CA 3BWDD 3Q72A 3A1EA 4PLVA 1EVQA 4UQOA 1US8A 1DSSG 1NVKA 1KDTA 1Z0UA 3VR4A 2OCIA 1VLVA 4P7FA 3IEUA 5HUHA 1DKUA 1AG9A 1DFGA 1M72A 1QO9A 2RGWA 1DDGA 1T43A 1L5OA 3D2BA 1QZ3A 4OFXA 5L6MB 1ULAA 5JNWA 2JIMA 3E5MA 1O0SA 4QJ4A 1P5JA 3IURA 2QV7A 1YSCA 2FMFA 4CEJB 1RE1A 3WHPA 4CL0A 1B15A 1RVDA 3GXBA 3EZ6A 3HVJA 3LGAA 4EPYA 3RYHB 3CLRC 2IE8A 2X41A 4ZCLA 3RRZA 5JASA 5J47A 4MAFA 4JLSA 3ETGA 2IZ0A 1ACMA 4FSXA 1XU9A 4MRAA 1FVXA 3B7PA 1EFVB 1KDYA 4AUNA 1FCJA 4J0FA 4Z4CA 1NY5A 3FCXA 5JT1A 3SQNA 3LLMA 2IELA 5EJ5A 1N57A 3IMEA 3O4HA 4B3XA 1CZNA 3JQAB 1RW4A 2ZPUA 2H1LA 3A2LA 3GVHA 4UKDA 5D7NA 2C4NA 5A3VA 5HX7A 3STHA 5K8UA 3T1QA 3IP9A 2F7SA 2V8BA 1OLUB 2ZEJA 1YS9A 2X9QA 4MMZB 2FVYA 4IGAA 4A92A 4FFVA 2YQ5A 3LMKA 3TQHA 5JRDS 1AXEA 2GZ3A 4YMSA 2RI6A 2HDOA 4MAMA 1G7SA 1J39A 2IXTA 1GT91 3HTXA 1AKMA 1MGOA 3S2IA 1G20B 2O3TA 3MAGA 4XYGA 4FYWA 5EE9A 1RI4A 1VIDA 5CM2Z 1RHMA 1E6UA 2BCJQ 2KMLA 1JEAA 2PLAA 4IDBA 1VE7A 4U7PB 4ND7A 3PHIA 1S8NA 2O6LA 3KQYA 4OQYA 2E1RA 3ND6A 4ZOLB 4HH3C 1CUYA 5DIZA 1P5ZB 4KI7A 4HS4A 4OHUA 4OJMX 4LRYA 1DCFA 2WHXA 1YRQA 3BZWA 3TMYA 1Z5GA 3HSYA 4ZV7A 3ZCRA 3HDGA 2MDTA 3IQXA 1FYVA 5L51A 5IWAB 4NV1A 3GJ4A 1PR2A 1T35A 2A0WA 3AY7A 2AZMA 4RK1A 4CLEA 1S8AA 5F1PA 4J07A 1SWWA 1R0RE 3P9SA 2TMDA 2BZ0A 2VCEA 3RTAA 2GEDA 1E1QD 1GN8A 5ECGC 5T57A 3ZYCA 4D42A 2ZK7A 1EP1B 3H2KA 2AOVA 5IW8A 1G2PA 3RJZA 1N8SA 4W5JA 5AVWA 5IZ4A 2F8SA 4GL4A 2GK7A 3UB3A 4A0HA 5IBQA 5KYTA 2B9VA 2P6OA 2QM7A 2EG5A 1JHAA 2IYFA 3MMNA 3ZIAD 3M9WA 5CT9A 4UAJA 1T9ZA 4YA6A 4LZLA 4F6CA 5ICEA 3O0TA 2X14A 1JG7A 1NLZA 4DYDA 2UUCB 5ITZB 3R44A 2ZTMA 2ONYA 2Y27A 1O87A 3RRXA 3NDBB 1IEVA 4GZ6A 4ZAZA 2ICAA 3C3PA 3HKEB 1X3SA 2HF9A 2NACA 2SICE 1RLMA 2V4MA 2UYYA 3ADOA 5CX1B 4E51A 3A32A 2J9FA 4RELA 1K68A 2YMMA 2E7ZA 4E4YA 2X2FA 1I4WA 2EEPA 1VSQA 4M4SA 4Z4FA 1N9KA 1XVAA 1F5NA 1H0KA 4EYSA 2FF5A 1LDYA 4BMSA 3PXUA 5E1DA 1MVLA 1J2RA 1G17A 1PSZA 4DGSA 3O3MB 4TMYA 3CLSC 3CPJB 1L2TA 1RMQA 2AS0A 1L3BA 1NF3A 3ZOZA 4RV9A 2WUVA 1WUIS 1RBQA 1Z6TA 2CLFB 3ZWKA 4CIDA 3ELBA 1K7SN 2O2YA 2PH7A 1V45E 3I37X 3OI7A 3U7QA 1JPJA 3MWEB 5DTMA 4R1QA 1XYVA 2NP7A 3L7KA 4RCVA 3AINA 3AFOA 4JOBA 3ZWYA 2JFFA 1GKYA 1ZRHA 3CC8A 3QF4A 2PBRA 3V48A 4BOYA 2E6KA 3L0CA 3LQQA 3D1JA 3U0BA 3TIXB 5KDOA 1H3FA 1EM8A 2Y0EA 3G2QA 1V0JA 3U4GA 5G0TA 5T3YA 5JSUA 3WP1B 2FDXA 3G2IA 2G72A 5MN6A 2V6JA 3D6FA 4O0LA 5DLPA 2R4UA 5EUMA 3MYYA 3I9FA 5CB4F 4FYHA 4EHAA 3VV2A 2FJ0A 1DE0A 1UC5B 2HRBA 1BWSA 4LMBA 1PD0A 4LVCA 3AFMA 2PSEA 3CRQA 2OO7A 3EYAA 5L7WA 3BN3A 4I19A 3SZMA 1LLUA 2RE8A 5K4AA 1NXSA 1I3OA 1HLDA 2I7DA 2J5BA 5DNEA 5HFJA 3RC9A 5KJCA 1CNMA 1D6JA 1V16A 2G0AA 3RIYA 3S68A 4JI3B 4C7BA 2B94A 3F2IA 3FKSD 1Q7RA 4RDHA 5C4MA 5AOCA 3SDSA 3CBQA 3THRA 1W1UA 2OAEA 4WINA 3VYRB 3TGLA 4Q3BA 4LF6B 1E2PA 2AC4A 4JJEA 1SCNE 4Q24A 2UAGA 1WU8A 1YR7A 4H7HA 4F0JA 4E2FA 5CB4B 1E9SA 1UUFA 4DVGA 721PA 5IYZA 1EG7A 3EZXA 3GLIE 3TCXB 3WWOA 4F9FA 3LK7A 5ARBA 3ZQ4A 2Z5GA 1TZMA 4LG1A 1TUIA 1TXGA 3HCFA 1YDEA 4HEJA 4H4DA 4PLYA 3KB1A 2VL7A 2HU8A 2VF5X 4JBGA 3J80A 4FZ3A 3AVQA 4RY9A 4EY5A 3HCCA 3ED1A 2WM8A 5BN5B 4JUDX 2WZQA 3I0MA 4A9AA 4EVIA 2VC2B 4EX7A 3MJDA 4NBTA 2REOA 3FVVA 2GDZA 4H31A 4GM1A 1HLFA 3ZC3A 2P6NA 2GJ9A 3Q7TA 2EBFX 2OCPA 4L4UA 4RH0A 3TOZA 1VB3A 3C8HA 2ZJ7A 1FPMA 2C3UA 5EUQB 4EF4A 1PEAA 4DSZA 3M5DA 3ONNA 1CULC 2O9JA 1RHUA 5BWBA 3ASYA 2HJ9A 1QGYA 2W00A 3TVTA 1WDMA 4MYDA 4AG6A 3UJDA 4CF6A 3HR8A 5JLAA 1P2UA 5L53A 4GR5A 2CT8A 3I12A 2JGNA 5K8TA 3BB4A 1R4MA 1GSOA 3TCKA 2ZREA 2Z83A 4IJUA 2EX1A 2WWWA 2JJYA 1BWRA 2XDQA 4QNRA 3DE0X 2FMKA 4XE5A 1N6PA 3U3JA 2BPOA 3SFTA 1CQZA 2OG1A 2YC4C 2XNCA 4HDOB 2BJHA 4PAQA 5G1PA 5JWRA 2QLMA 3FF4A 4N8EA 3RVRA 1Q1GA 1K0FA 4AZ3A 1NG1A 2CMGA 1PLKA 5B1EA 5KYYB 3CSDA 4HZGA 4R31A 3F6PA 1PR5A 1T8RA 3QFCA 3BA1A 3PNMA 4YV1A 1QH8B 1NR1A 1WUYA 2WMDA 4D3SA 3HO8A 1DPGA 3WB0A 4YAGA 4HI0E 1ZK2A 4OX9B 3PUXA 1EWTA 2PUWA 3BSYA 3CURA 3FM9A 4PYKA 3PNVA 3RI3A 4QBTA 4RENA 3PQ6A 4M9ZA 5CA1A 4E22A 4R2MA 2AOUB 3F6YA 3KKEA 4R05A 4RZ2A 3IXMA 2Z2IA 2SNIE 4U6QA 5SV2A 3MGKA 4C5AA 3AV3A 3DO8A 2ZCVA 4PSKA 3FCAA 3VV3A 3RT9A 4NDNE 2DPMA 5L40A 1VRVA 3THXA 2Y77A 4QTUB 3JR7A 3ID6C 4MRPA 3MS7A 2FG5A 1SU7A 1EFLA 3C7CB 4IOJA 1VG1A 4J4HA 5CX4A 3PB3A 2CBGA 1S3FA 3OUUA 1UZAA 4FGUA 1N2SA 2HF7A 2P7IA 1NI4A 2V5VA 3P20A 4QASA 3SQMA 3WO1A 4C43A 3K70D 2C04A 4LHSA 2OFOA 1TKRA 1NBHA 2QTZA 3EFOA 5IAJA 5K09A 1JI0A 4AQDA 2BHSA 2W6ID 4GE0A 1TM5E 4Z4IA 1QMGA 3WLOA 2VH5R 4DJEC 1IYZA 1N7IA 3CTMA 1RFLA 1ID1A 3LPNA 3OM0A 3X3HA 1PGNA 3K96A 3B2NA 4WOBA 3T34A 3WXBA 2GCGA 2V6BA 2CEKA 1AKVA 2YWJA 2CC2A 2NO0A 4U2KA 5HF8A 3MCTA 2XNSA 4JGBA 1U9ZA 4EJSC 1RKUA 3KOMA 3QF4B 2WUDA 2Z9DA 2YNMD 4NTZA 3A9SA 3WGJA 4EJ0A 3B6KA 5G53C 1JH8A 5AHXA 4K6KA 5H5JA 4BQFA 2WT9A 4LQDA 2C8LA 5P8WA 4D0NA 2CF5A 5KX5A 2I2WA 4O2LA 2UYQA 3AT1A 3C39A 4B6GA 1V4BA 1G6Q1 5JXHA 2WE7A 1RWXA 4A2CA 1DAOA 1MX3A 3E81A 3FYUB 4L8WB 4WKPA 1YKSA 5HJ5A 1F6BA 1F8YA 1Q1QA 4NCNA 4R5HA 3S1AB 1GA6A 2CHVA 5G1OA 3C85A 4N41A 3BGOS 2XGJA 2Q1XA 5GWXA 1XFDA 3RVBA 3JWHA 1MRNA 1RI5A 2JEYA 1YCHA 3KKNA 4JBNA 4OKSA 4MJLA 5KUTA 4GNRA 5FR1A 1SUSA 1P4RA 3WGGA 1E6LA 3TTVA 2EF0A 5K3EA 1WX1A 2H3HA 1U2EA 3JVIA 5CDUA 1D2MA 2QDKA 2EIXA 1YQXA 4IQFA 5JVDA 3OY7A 1N7GA 4YT8A 3MRSA 1ECFA 4FEGA 4BN5A 1L4KA 1XBTA 2WA1A 4HXGA 4BVHA 3ANYB 3RRMA 2YWCA 3DHVA 4AIRA 2Q3MA 1VJCA 4Q3NA 3QUSA 4RIGA 4EHLA 1L1EA 1PGQA 3HJCA 3M3PA 4CKWB 1VRCA 3BAZA 3DC2A 4JBWA 1VLLA 2UYCA 5IJWA 2AKEA 1QV7A 3MFYA 3C41J 2VATA 4OY3A 4RHYA 4DAOA 3C24A 1UBLS 3UXEA 3T7EA 3OY2A 2XVMA 5I8ZA 4X6UA 1GPDG 2AJCA 1KOLA 3S8YA 2PFKA 4JI6B 2B7BA 2WSLA 1CJCA 2N1BA 5FWXB 3L5KA 4LRXA 3HNPA 4DNOA 2WIFA 4BKUA 1Z2EA 4ETNA 1BVUA 2NU7B 1PS0A 4GMGA 2JAQA 2IY9A 3U7HB 1MC4A 4RF5A 4CETA 1QCYA 1ETHA 1R4MB 1UJCA 1Z56C 3K09A 4BFYA 1T4BA 2YASA 3MXOA 5J2UA 4JLMA 3Q41A 4NKRA 4QPPA 1LNZA 3EGDA 3UKDA 1KZGB 3B5IA 1CD5A 3AHHA 4MZDA 4AY2A 4GM0A 1LW6E 3CGGA 1I0LA 3PENA 1M6EX 4AO7A 2ZJ1A 4Z8XA 5TB5A 4CCAA 1DB3A 1N0VC 4ZU1X 1WZIA 1Y9EA 4HX5A 1QRSA 1TCUA 2WU3A 3CT4A 4FX2A 5E6SB 4AZ3B 3AI2A 1UK9A 4FMDF 2GTHA 3UJ8A 3BX1A 3NHUA 4HDKB 4L0QA 3HCWA 4ZVUA 4ROTA 2W58A 1JQKA 1TRKA 2JJMA 2RONA 3DMGA 4BV8A 2VOEA 2W43A 3H1AA 4V0RA 2R62A 3ORQA 1ZESA 4DMCA 8AT1A 4P7JA 1KPGA 3N2ZB 4RHCA 1UBGA 2AZTA 5DDIP 2IVFA 2VZ0A 4U6SA 2YJTD 4R68A 1R88A 3G5UA 2QUKA 4CMGA 2CXRA 2P3LA 2C5AA 3KBBA 3PPIA 4ISCA 3A6EA 3Q5EA 3RR2A 4B3FX 1FMTA 1FXWA 3QBVA 3TO5A 2EEZA 3AI3A 3L1HA 4Z6KA 5K5EA 1V3QE 3QE0A 3B53X 2ZRJA 4FMDB 2XY4A 1RWQA 4JYMA 3WK9A 1DJPA 4PM4A 3R7WA 4ZZIA 1EUZA 4JL5A 4PO9A 1BWQA 1HEYA 3K1TA 4B5LA 1DKLA 2CDNA 3VPAA 2XUGA 3B36A 3TG2A 3OM9A 3M82A 5AJVB 1LUAA 3RBAA 3UGQA 4DKXA 2KQUA 2ZTVA 3R5FA 1KXZA 1P3DA 3H4IA 2QU7A 3QOXA 3OQ1A 4Q47A 1QC5B 3UHFA 1XJ0A 1U4NA 4NCHA 1WZCA 3AHEA 1K98A 3QMPA 1W0JA 1ZWLA 1KAEA 4WNAA 4O63O 2B4AA 1KEZA 4F91B 4C4TA 2GPYA 4RTJA 1VBNA 4Q3KA 4RL4A 4TVOA 1FFBA 2OAP1 4Q4AB 4J1QA 2IZZA 2EVWX 2ZP1A 4MHSA 3UJPA 2WG2A 2JAHA 1A8IA 5JY6A 1WMSA 1CUCA 2UVPB 3EXG2 1DAPA 2WF6A 1MC1A 3E6AA 3IO5A 3O8OB 3U7GA 5HMMA 3TR5A 1Q0TA 1B8OA 3B6IA 1IXYA 2Z5LA 3OECA 2A78A 1UWCA 1HGXA 2PXAA 3HA5A 4H1HA 3TR6A 4Z4EA 5JVDF 3NIBA 1O95C 1YE3A 3B1ZA 1KE1A 3IP3A 3LJKA 1Y8AA 1KWKA 4D0GA 2Y99A 3VJRA 5ALSA 1W1IA 3BORA 1H22A 1Z4IA 1Z8HA 2OXRA 4ZQGA 4M0DA 3RSQA 4U4AA 1BNCA 3SGLA 1RRCA 2HMWA 4KR7A 1LF0A 3G8BA 1QRAA 1IG0A 1OPRA 5C1IA 1U0LA 2O2HA 5K51A 1K8XB 1JA0A 3NO4A 3NTXA 1NF9A 1XMVA 4FMCF 1JAXA 1M6YA 5B1SA 3ZDEA 4V03A 4EDFA 1YJ8A 2BH9A 4D46A 3DMFA 1GEGA 4XDGA 2UZAA 4X92A 1QG2A 3QBJA 1FEZA 4DB4A 2QPOA 3V1UA 1E64A 3WL5A 2H1HA 3FD8A 4ZPXA 1O0BA 3DE7X 3HLYA 1JG1A 1KARA 1F9AA 1VE6A 3DEIA 3SZGA 2X9NA 3W2FA 5EQDA 2W11A 3KYIB 3AW9A 1D2CA 3EWNA 5DGDA 2C4VA 3LA6A 3LYAA 3TNLA 2Q07A 4JVSB 5H82A 3UOAB 2E21A 3RREA 4B3JA 4ER5A 2LPMA 4Q16A 2XYRA 1T6ZA 4FMCB 4K8OA 5L7YA 4G0MA 1UK8A 3Q2IA 4G1CA 4J3FA 4IZ6A 3P71T 3HPRA 1Y9DA 2HRDA 2WLTA 3PJEA 5FD8A 2RHJA 1I3MA 2G7MC 3ASUA 3I9NA 4R41A 3SJZA 3K1JA 2JL1A 3WWDA 1ZY2A 1SXJE 2VPXA 4OMDA 4ZDKA 3L0BA 2ZKIA 2J7PA 2QR5A 3A4VA 2O3UA 4K40A 5C51B 4P98A 3L6DA 4Y2TA 3FTCA 2BBSA 3AWDA 3GEGA 1S3SA 3BDIA 3FCYA 1WDTA 3OLWA 4ZWNA 2DM6A 4NK4A 3DMTC 3T3DA 2WR8A 1U9IA 1EDBA 1W35A 2GEKA 3BULA 3WMRA 1Y6GA 2YWEA 3QYFA 3PHCA 3RB8A 1O94C 1JHUA 4TM8A 3QWBA 4Z86A 2D1RA 3TF5A 1X1BA 1XLUA 1OAAA 2Z5FA 2R97A 4RTRA 4X1IB 1KO4A 4JKYA 1T8YA 4YCMA 4PFQA 1V43A 5A4FS 4UTOA 4J7AA 2ZSIA 4MUJA 3S1LA 1L5QA 3ERCA 2QX7A 4CTOA 1KYQA 2Z30A 1E5LA 1HRKA 3C4VA 3NAGA 3VOSA 4ED9A 4YXWA 4IFEA 3CX7A 4CF4A 5AVZA 1BA3A 3K6KA 3UMMA 4BVFA 3D8BA 2WDPA 4HEHA 1XZFA 4HVLA 3KOYA 4TMXA 5AXBA 3GUCA 1L5YA 3HP4A 3ANSA 3L84A 4IDPA 4GBMA 1GV1A 4S1OA 2O7QA 2Y1WA 1XEAA 1EFTA 3J7TA 3OQ6A 5ALOA 4KKVA 2R0QC 1UKAA 3H2ZA 3HJFA 1MMFB 2W2TA 3IB6A 3UUGA 3MQ4A 5JE8A 1EWKA 5HHTA 2H2FA 4X3CA 3I28A 3R7WB 1ENZA 1XPJA 3WZMA 4CU2A 5E0OA 2FB9A 3RFXA 3L77A 3AL0C 2VTBA 4GPAA 1XDUA 1YKFA 1H1TA 4ZZ3A 4MQBA 1E1RD 1HDYA 2CFCA 1Z29A 4QU5A 5JCJA 2QVCA 3UKJA 1L3IA 2DMRA 2LBPA 2X3YA 4ZK2A 4B4DA 1DBPA 2ODNA 4INAA 3VOBA 3COSA 1WBBA 4J76A 1VFPA 2XADA 1KK2A 2BDUA 2GZAA 1XB2A 4MEJA 2BR5A 3ESAA 4X63A 4MAAA 2FSVC 3UB2A 4BMOB 1R8YA 2WVHA 5FPSA 4YXFA 1ZCFA 2G5TA 4E5VA 5J58A 3FX2A 3SR4A 4DA7A 4RVFA 1KGSA 4BIMA 3LDAA 1ZKMA 2ONKA 4EVSA 5FV4A 3NYIA 1T3ZA 3CS3A 4MRMA 1ILWA 1DC8A 2AXNA 5JAUA 2NO7A 4RD4A 4X95A 1HM5A 3L8FA 2PT9A 2ZQ5A 4U7HA 5BRNA 3LC7O 3P0HA 4N82A 3W4KA 4RPJA 2M6LA 5C0OE 1E6MA 1DIGA 3PNPA 2A0KA 3H9QA 5JD3A 4AJ4A 1MKYA 5JAIA 4PGHA 1JEJA 1JIIA 3S2GA 3UAOA 1XZAA 3RC3A 4HMOA 1E5QA 3ENKA 2BLNA 4ZT3A 3EZLA 5ETJA 2ZRQA 2E85A 4XAQA 4C0AC 5KKCA 4L9WA 3PPVA 2QNRA 3GJ5A 3O1IC 3OT4A 4O2BA 3VSCA 3LE8A 1EUCA 3NH9A 3ZDZB 2ZYTX 3DS8A 4ND6A 1MHTA 1W76A 2ZS7A 5FOSA 2DGDA 1YDHA 2QN1A 1N5IA 2AW3A 5ISMA 3MT9A 3BRCA 3HVHA 2OD9A 3GJ7A 3MS2A 2X7JA 2GCOA 2NAFA 3JQPA 4QDJA 5LBUA 4L9AA 2X1VA 5TRTA 2IX3A 2ZIEA 3A9WA 4F8YA 2OO3A 4BQPA 2IYPA 2P0EA 2DPYA 2R8RA 4PNZA 4D9EA 3E2PA 1WW3A 2XMZA 1JB9A 4LZWA 1TF5A 1NPYA 2W6JA 5FKJA 2P3QA 2ZJ5A 1TLTA 1SIBE 5JCOC 1YRBA 4OUDA 3OIVA 2O7NA 3UJ9A 4DGQA 5EIXA 1DWOA 1ODJA 4AJOA 3GA7A 2A5JA 4OLHA 5FT9A 4ABYA 2IZ7A 4C03A 1OASA 3RYFA 3IBCA 1XQVA 4DW8A 1RHKA 1WMEA 3OTWA 3TQQA 3W77A 2G36A 4L75A 4BMDA 1JVNA 1U0TA 3GWGA 3JD1A 4Q1BA 4B43A 3W8FA 2CFSA 4OMFG 3I5UA 7MHTA 3HXQA 4MVJA 1A5BB 3FZNA 4D4IA 5JYCA 1QZZA 2ZVJA 5A3JA 2C3YA 1N3IA 2ZM5A 3PEEA 3EIUA 1JDBC 2PM8A 1MZVA 1IMOA 1PL7A 2MU1A 3A9CA 4XLLA 5I51A 8ATCA 4BQIA 3SC2A 4ML3A 3M33A 2GAAA 4XYEA 1NURA 1P6XA 4H7KA 3Q3VA 4EI9A 4UBLA 2ODWA 1W2HA 3NB0A 2I3AA 2W71A 1JQAA 3EVBA 1UJ5A 2RGNA 3X1KA 1S5PA 3WLEA 5KDDA 3NV9A 2HK6A 2IPOA 1PSDA 1A96A 1OA1A 4RHUA 2H54A 4NS4A 4QUBA 1ULTA 1T5DX 1C9KA 5IASA 3DHEA 1RYBA 2TSYB 5D3KA 1YJQA 4AO6A 5C9ZA 3LOPA 4LE1A 2BFBB 4OXYA 4W99A 4GWKA 2OBLA 2N42A 1ZK3A 3E05A 5AK0A 5B4TA 1WXWA 1B8PA 3IHWA 3PNYA 4TKMA 5CITA 1K2WA 4J03A 2C0PA 1UR5A 1CR1A 1MNQA 3MLEA 2QP3A 3NBMA 3OOWA 4QGFA 2ZCJA 5LP6F 1G9XA 3VPDA 3W4IA 4E15A 3OETA 1Q5PA 1BKDR 4TV8A 3WRXA 2LNDA 3V1NA 1TJNA 4A1OA 4J29A 4NH0A 3TZEA 4QXOA 2W2LA 4PZDA 4UBJA 4F2DA 1GZ5A 5EKSA 1YVRA 3E8XA 2APJA 2W2KB 5AJYA 1PZFA 1LLQA 1LDEA 5EXPA 4XIGS 3F9IA 3VVMA 3P0IA 3GJ6A 4N8SA 3F5SA 1SBYA 4RGVA 4JI5B 3MTIA 4FS8A 2IHNA 1LQUA 2YINC 2X4LA 3B8EA 4XYBA 2HXGA 3KZNA 1F2UB 1PYGA 4IHAA 1QHNA 4J16C 4MUGA 4ZHSA 2DLNA 5LP6B 4BQQA 3ZQ6A 1Z2OX 2WT8A 1R00A 1H42A 4M99A 1A77A 3U1BA 3TLEA 3KSBC 4YAJA 5E1BA 5B58T 2A0XA 3WLKX 3HGTA 4OUKX 3F5MA 5T67A 4DMMA 3PF9A 2HLPA 5B5SA 2FYTA 5HP4A 5I7WA 1MVNA 1E0JA 3F46A 1VYHA 1SEVA 1KIAA 3H8SA 4JLBA 4ONEA 4OK3A 4DCNA 4O2BF 3F4LA 2GF2A 2IPNA 3L4JA 2PRKA 1X19A 3GBPA 3O2JA 4JXJA 3R7DA 1BS9A 4GSKA 3RUPA 3PJRA 1OX6A 1HL3A 1DXYA 1XQXA 2WU4A 3B9QA 1EAYA 1T2FA 4EUKA 1RXYA 4NE9A 3EPKA 2OCGA 3ZGLA 2DX7A 3PSAA 1RM3A 4V0NA 3SC6A 3VI3B 5B1DA 3AUTA 5L3VA 2BGKA 3AR4A 4EVRA 2XXAA 4YBRA 3DZFA 2Q5CA 5A4AA 2C7PA 1X7WA 3UWPA 3G0CA 1FDVA 3QQPA 3ZE6A 5EHIA 1G6HA 4LY6A 3WLSA 3L7NA 1CVLA 3TZKA 1XVTA 1A9XB 1CF9A 1H6CA 1P3JA 4ZKDA 5JI3E 3U44B 1NG9A 4U2GA 2RJ3A 1U0BB 5DBEX 1EUCB 3AETB 1PGPA 2G4CA 3B9RA 2OGSA 4QHTA 3DZCA 4RXUA 1X1DA 3DDOA 4KACA 4KDEA 4K81B 3UENA 4JC0A 4BFZA 4F4FA 2ANBA 1TI7A 4KMMA 3C1OA 6GPBA 1Z83A 4HLCA 1XZCA 4JT9A 1BHSA 4B4OA 2O8CA 1OI4A 5FXMA 4DLVA 4KDCA 5KU1A 5E1MA 4AS1A 3BUSA 5IT0A 2QJRA 2TS1A 3OJCA 2PGNA 4NATA 3QVOA 1W44A 5EE3A 2YHIB 1SCKA 4L1KA 4QPJC 3NP7A 1ZN7A 4FZJA 1O2DA 3G59A 4X41A 1ARZA 1Y98A 1KWGA 1DQSA 2Q5OA 3A6KA 3BDAA 3JW8A 4PONA 4N3CA 3WISA 3CIOA 1JQJC 3KUDA 1YJBA 3MNFA 2GN4A 2NZ2A 2XZOA 1C30B 1S9HA 5FBZA 2FAXA 3UHPA 2NO5A 2VH2A 2Q3LA 3X1DA 4O4IA 2IWHA 1BE6A 2ODBA 1TTTA 1Z34A 4AWXA 1K6IA 1W6UA 4AJ1A 2FZVA 4M1MA 2E1PA 4KO3S 2H7VA 1E61A 2YWGA 4DMFA 4P80A 2RHHA 5HDBB 3I04A 3RS4A 3LO8A 1JZTA 2JFYA 4BO9A 4IILA 3ZNQA 1QFJA 4OI0A 4JITA 4OHWA 1CIVA 4E6EA 4M1KA 1DT5A 3ZCUA 2FPRA 1NAHA 3NNNA 3QOFA 4E5PA 1BIFA 3NWOA 5FTMA 4A4DA 5ALGA 2EL7A 3UT6A 4PC7A 2AWOA 2P75A 4HD8A 3QVSA 3RYTC 3UAYA 3UHAA 1TK3A 1JSRA 3JQBC 3AR3A 4MKGA 3VR4D 3P96A 1A71A 1TYAE 1VFNA 1IK4A 3PVZA 1MV5A 4HGRA 4DIDA 1DBVO 3IIMA 4G2NA 2BFDB 5BWOA 1NVUQ 1BD4A 3AFNA 3IB3A 2JD2A 1RLOA 3ZU5A 4DR3B 5DMXA 4D56A 1W85B 3L43A 5ERXA 1UMBA 8GPBA 5CNIA 1W4LA 1ODIA 1R74A 2YWDA 4JBXA 1J0DA 4AP5A 4AY3A 3ONDA 3QX3A 5F12A 3BIJA 1RAGA 3GJ8A 1G5TA 3T0IA 4M9XA 3VZCA 3RSLA 2EZ8A 1SUWA 4C0JA 2Q3DA 3NXSA 4LYFA 2GEJA 2VDVE 2JH3A 3CW2A 5EZ5A 3GD5A 4AWAA 4WZAB 3RYCA 4FFPA 1T10A 2WSSA 2J41A 3Q87B 2LUOA 2OZLA 1T8WA 4PYQA 1E92A 2VYVA 1NW9B 2WF5A 3JATA 3MJCA 4B6QA 4D7AA 4ENVA 3IIEA 3DTVA 1I32A 2WYWA 1W48A 3AR5A 5HF5A 1E3WA 1UZLA 4ZREA 2EX4A 4YNBA 2BGLA 5J5CA 3CW9A 3QEMA 3VPGA 3ME5A 4WNIA 2NO4A 2P4QA 1IH8A 2VSFA 1WDWB 3NTOA 2QF7A 2BBTA 1W5AA 1FDIA 1H4TA 3BK2A 1KU6A 3CH6A 5TGZA 2PMEA 3T1TA 1QS0B 5DLYA 3ZZ1A 4MP6A 4AY6A 1LK7A 2C82A 2RHMA 3AF1A 1KPIA 1XN1A 2QHXA 2CLCX 5CW1A 4ILKA 5E3JA 5DE3A 1FNSA 5HS6A 3W5BA 5EP2A 1ZFNA 4OHZA 4XFJA 1OLSB 1WHSB 4FBMA 3FLEA 1IPHA 4A0GA 4K7JA 2CXTA 2ZW9A 3DLAA 3PXBA 3R5JA 4XPIA 4DEXA 2K7FA 5AW3A 4BZPA 4YT2A 2ORYA 2AF4C 2EJBA 3ZJVA 3SMVA 4ZGWA 1JHRA 1ZGAA 2V6GA 3RSGA 4S2EA 1SVOA 1X7WB 1NV8A 3TYXA 1WD7A 1N1MA 2BBOA 2ZI4A 5AW6A 1Z75A 2ZSBA 2PV7A 1N2CA 4NOLA 2ZIXB 4OXXA 4MUFA 2QN8A 1P4AA 3DZBA 4M22A 3F2VA 5CM8B 2GCPA 5AH0A 1ADFA 4KYVA 1JR4A 1HT2E 3CF6R 3CU5A 3EEYA 4AUMA 1FFAA 1PJSA 2A0UA 2COUA 4OKIA 2W4MA 3E15A 2VUTA 4NZYA 5I3ZA 3GUHA 1UZUA 3QWHA 5F52A 2IWRA 1XNGA 1IRIA 1SHKA 4A82A 5ES4B 2O8EA 3QX9A 1LF5A 4D9MA 4QVKA 1T13A 2BP7B 1UPCA 1DG9A 2VI5A 4QQKA 5FBHA 1HDXA 2QM3A 4LW8A 1EFHA 1JILA 4LX0A 4F5YA 3QKRA 1NXPA 1Z0FA 4M8NE 4OO3A 3VSDA 1RACA 3SLRA 2HF8A 3F7MA 2ARKA 4EKYA 4KQ9A 4PGGA 4MK4A 2UZ4A 4JR0A 1Y8ZA 1UAYA 3GFVA 4MCHA 1R4AA 1VYTA 4KX5A 4O8ZA 4JROA 1FNBA 4QAJA 4YCNA 4CF7A 1ZDMA 3SM3A 3TLAA 1L8QA 4AY5A 1L8XA 5CRIA 1U8CB 4HFJA 3K6JA 1AQIA 4YJFB 5JZMA 2VDPB 2I8LA 2VP3A 4YAFA 4XJTA 3USZA 1T36B 1QQ5A 4H7JA 3UJHA 2QX4A 2GASA 3BIWA 2QIOA 2CB0A 3ZN2A 2ZXUA 3A6PC 3L41A 3T7CA 3KXLA 1TMYA 2QZ9A 4B75A 1DZ3A 1FTSA 2VNAA 3G02A 4GOND 5I3CA 2YL2A 1ZU5A 1K3FA 1HO3A 4N12A 3D8SA 3PXEA 5J43A 4Y30A 1NMXA 3OTQA 4KP7A 4ENQA 1QTIA 1V41E 2WHRA 4YJ2A 4DR2B 2FDCA 2V59A 1PKXA 2AG0A 2Y0BA 3M6MD 4TOIA 4M0PA 3RASA 1NP3A 1YL7A 4NBNA 1J2TA 3C87A 4AVYA 5EKUA 3EVAA 4FE3A 4MR7B 3JU3A 1VL0A 4KK4A 5EIBD 2FW7A 2FPMA 2ATXA 3VO9A 4UD6A 1NONA 4XWTA 3HZHA 1NW7A 3HYLA 2RIRA 4DDMA 2WDZA 3WLMA 5KHLB 3K4PA 4DDHA 5JALA 3EVCA 1WXQA 4U5QA 3RWBA 1SBHA 4RADA 2X7HA 1P39A 1XTPA 4JLDA 1NZJA 3OF3A 1DWPA 2YYZA 2G1PA 4DARA 1RCFA 3CSUA 1EP9A 4KUGA 5EJAA 1H4VB 1KYWA 4UOQA 5KYVA 4ZT2A 3VTAA 3IR6A 4EJSA 1DEOA 4CL2A 4FILA 2A8YA 3A0RB 2V98A 3AVWA 1MO3A 2H9YA 3DNFA 5B7PA 2QS9A 4OB8A 2ZB8A 4IOMA 4CR8A 2L0XA 2WKRA 1GUBA 3OVMA 2Z95A 2IUSA 4KHPB 5H0IA 4Q66C 3EBLA 1JT9A 3D3KA 3OCXA 3PXDA 4PHFA 1X9GA 2RHTA 3FGNA 2QQGA 4HN4B 4ZO6A 4UVDA 5AWFC 2KI5A 1HZZC 2D2IA 3LBIA 4ENSA 4ZALA 5JIBA 5KVCA 4HNUA 2WBLC 2YWBA 3RIMA 1I36A 5BRAA 4QEKA 4V38A 1BC5A 1UM9B 3ZEAA 121PA 5JEDA 1TAHA 2YHSA 5LMNB 3T5AA 3JATB 1QLWA 2YIVX 1PT7A 2PVPA 4IDQA 5FDFA 2M1XA 4HRYA 4D9HA 2B8TA 1FFDA 3REGA 4Z4GA 1QCCA 2WU8A 2VDJA 4HFMA 4KXYA 1ZMTA 2OCDA 2C0QA 2Q5IA 4YQEA 4LHWA 1GR1A 1IUKA 2KW5A 3B60A 3VUFA 4E5KA 2D62A 1HTBA 1M7GA 3QLEA 3MINB 4HZUA 4YJGB 3I4FA 5IKXA 1BJTA 1XZHA 4X62B 4XQCA 3QITA 3LTNC 2HDWA 4G0VA 1N36B 3AJAA 2KYRA 1PBNA 3NBXX 1C3LA 4DIBA 5CG1A 2BZ1A 4CL8A 1YFLA 2BGGA 2AK3A 1VE3A 2XWSA 2ZIGA 3IQHX 3EPLA 4JHLA 3R0JA 4Z51A 1T0UA 1JV2B 3BWCA 3EIWA 4LJAA 2IOHA 2PX2A 4DY6A 1JG4A 4D9IA 1N2EA 2WFZA 1FP6A 4BNFA 2IYNA 4P81A 4C07A 4F38A 3DO6A 1U7TA 6REQB 5HKLA 3GLGB 1J7JA 2V7EA 2HRCA 4M3NA 1GL9B 4TXNA 1RBZA 4C6TB 1OJ7A 1L9KA 4RTMA 1L7RA 1OXMA 1TO1E 5HKAA 1AC5A 1U0SY 4UBMA 3OPVA 1A9QA 3N75A 2V7GA 1AHPA 4M9CA 4HT3B 2X76A 4IGEA 1S01A 4RYLA 4K9PA 4WKCA 4KFCA 5GJBA 1DS6A 2FEAA 5BQOA 4FQ7A 3ENVA 3H3JA 4NFHA 1G8YA 5IBRA 4CM8B 2HT1A 2WW8A 4X44A 2F1KA 4QOFA 2GKGA 1LX7A 1OYWA 2PGLA 2D06A 1P0FA 2FMXA 2QNBA 3LVQE 2FPGB 1T26A 2E3JA 5CXUA 4U0KA 3QLVC 4V0QA 3WY9A 2HIHA 5NULA 2DUMA 1CY6A 2HSJA 3UK1A 3BBPA 5DISB 2ZUWA 4BCCA 2WY2D 1JJBA 1P17A 1S1CA 1MOPA 4M6WA 4NNJA 3ROKA 3UAZA 1G55A 2XWBF 2ZDQA 4D92A 4TN1A 1AKUA 3AF5A 2RC6A 4J4BA 4G5HA 1WD5A 2PPLA 1TPYA 4KE8A 3HCEA 4LRWA 3D8UA 3IBTA 4B3GA 3FSEA 3K0CC 4US0R 4DILA 3W8RA 3A4TA 4G07A 3QA9A 1GAXA 4BB0A 5IJ0B 3ZDBA 2G0TA 2YJ6A 3VVCA 3ZS8A 5REQA 2PGIA 2Z2ZA 3LW8A 3VKWA 3ZU3A 1XXHB 1HG0A 3MJEA 2QRLA 3I58A 4LX8A 421PA 2X6RA 2ZBVA 1KQPA 1ADBA 3THSA 5G0SA 2WKWA 4RTKA 4V39A 1XK6A 3K0FB 4R7TA 5K3AA 3TLBA 3T9AA 4R8RA 2FPWA 1PTJC 3QNMA 5JXWA 1VG8A 3O94A 2OYCA 1M5UA 4ZYLA 1XVVA 5B7QA 4FJ2A 4EGCB 2ZSFA 4QODA 4J2HA 2VJLA 1Y6FA 1AUQA 3BSFA 1IN8A 5EMLA 4Q7QA 2F1OA 3N53A 3NOVA 5JBIA 4KGVA 1HSZA 3VVLA 4JI8B 1Z7EA 1JLSA 3R9IA 3ZNNA 4IX9A 3GLTA 1EM6A 1G2OA 3HG7A 5CT5A 3D8TA 3K2BA 3EAQA 3MM4A 1WUTA 1YMUA 4EO7A 2H17A 1SXPA 2JBAA 3RS8A 4R9UC 1YS4A 3AVYA 4EJSB 3ABRB 5EJ6A 2XUFA 4AMGA 4RKWA 4L8LA 1E6WA 3LG2A 2QPTA 1R5BA 4GGOA 4LJRA 4YUZA 4LGYA 3BFPA 1MX5A 2JAXA 3BD8A 3IBSA 1EK5A 3CFYA 2C42A 3H7IA 1U0NA 4ITVA 4LNHA 1SUEA 3ZBTA 4DPKA 1N77A 5JPCA 1CYEA 2CXNA 1E20A 3OG9A 1NR5A 2ZBEA 3QXSA 5AT1A 2FUG1 1NJ2A 4UHKA 4F6RB 4KJZA 4ZYTA 4OP1A 1H8HD 5AVKA 2JGFA 2NVOA 4PIVA 5CFNA 3H9JA 2B5WA 1NC3A 3LC0A 1RWKA 3BXPA 4YAWA 3ZV7A 1KC3A 1YZHA 4QJ3A 1U28C 3H8JA 5AOBA 5BN3A 1IIBA 3K53A 4DLUA 5CYPA 1E9DA 1KYYA 4AN4A 4WBNA 3PC3A 2WTBA 4I5DA 4MWOA 1XD2A 4KQCA 1ISMA 3MOIA 4XWGA 3VR2D 1FYFA 4P22A 3HYRA 1ZGGA 4II3A 3HKCB 1RIIA 4V02A 4XX0A 3TE6A 1GAEO 1C0PA 3N8HA 4BECA 4Z1OA 1E32A 3SXJA 1BHO1 5EJFA 5KQPA 1SELA 4EZBA 3ESBA 4OQDA 1HTTA 1N25A 3NAQA 4JENA 5IF9A 1IMJA 3B3QA 3AO0B 4JEMA 1XZNA 5IH3A 3UZUA 3EOAI 2W9XA 4EGJA 4LF9B 1YS7A 2YZGA 3D2LA 4E4TA 2J09A 1Z15A 2IOFK 3L3BA 2IIBA 4IIUA 5LXTA 1LQTA 2CJXA 3OKPA 3RSOA 4UXHA 1QCDA 3SVLA 4ZC8A 3E27A 4LOHA 2YZ2A 3ZWDA 1V6SA 3ER8A 2J0QA 2HD4A 3UBTA 1ZOPA 2X8WA 3N2GB 2RK4A 4KN9S 3UK0A 1LFDB 1SKYB 1ZHHA 4RA9B 1YRWA 3KFLA 1FFXA 3OFND 4QPDA 4RD2A 1MN6A 2OECA 3P45A 3T1VA 1FDTA 4YJHB 1RQPA 4TTPA 2V0NA 4I55F 2Q8QA 4KQWA 2Q0XA 4PEVA 3P9RA 2IVZA 4U2CA 3C3AA 4E88A 4F4UA 1MDFA 2YUTA 2G06A 2GBLC 4H1TA 1AB6A 2HRRA 3DMTA 2YFKA 2AJDA 2BEWB 3IA7A 1ANKA 1APBA 4KIUA 1NC1A 2GYVA 4ZVLA 1QFMA 2F6RA 4PQYA 5ARCA 3Q88A 5ALRA 4G4GA 3A37A 3BCRA 1N3BA 4NFSA 5D00A 3DDWA 3KBOA 2V4UA 4W4TA 5HR5A 2IUYA 3K16A 2J3HA 2Q8NA 4R01A 2DH5A 3AOGA 4TVSA 2C7GA 2C5EA 3RAJA 3FZYA 2O7SA 4QKQA 2M2IA 4I55B 3PFIA 4MO9A 3HA3A 4NZZA 3RSHA 2V8OA 2VF2A 4Y1FA 3Q9LA 4XZ3A 4DM4A 4JQYA 1J2UA 3FTFA 2AQIA 3TOCA 2A30A 2ZUVA 3PC8A 4B46A 2HHHB 1J4AA 2BMVA 2YYSA 4WXHA 2GD1O 2FP4A 2JFOA 3NHSA 3BL8A 4Q7LA 5HDQA 4N7JA 4I4TA 1W0JD 4F60A 2PMCA 2C7VA 4OD0A 1GYRA 2G6TA 4KV9A 1F2DA 4OJTA 4HXFB 1PX2A 2OSVA 1K08A 2V03A 2WIAA 2ZITA 4EGFA 2X5OA 2XCQA 3DE4X 1ENPA 3VR3A 4R8VA 4MLZA 4DREA 3UV3A 2QZ4A 3HXMA 2AWNA 1MABA 1HY3A 2D5AA 4DZRA 4EUSA 3HACA 4PGFA 4UBKA 1ICIA 1RS0A 4HPXB 5HILA 4P5DA 1DIHA 4TWAA 1KS2A 2GM5A 1Q2XA 3C45A 5FOTA 3ZGOA 3QVXA 5C80A 1EVIA 2XWPA 2V7PA 2OM6A 1QYDA 4RVGA