3FNQA

Crystal structure of schistosoma purine nucleoside phosphorylase in complex with hypoxanthine
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
280
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 94
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fnqA00
2XRFA 1V41E 1OUMA 4DA8A 1PR6A 2PGAA 4D8XA 1A9OA 1YBFA 4TS3A 4MARA 4DABA 2HRDA 1VHWA 4D8VA 4F2WA 1JE1A 5F7ZA 1YQUA 1RXUA 1YQQA 4JWTA 3LGSA 4JP5A 2HSWA 4EARA 1LX7A 5K1ZA 3KHSA 5FAKA 3UAYA 5CXQA 3DP9A 4YNBA 4DANA 3NM6B 3BSFA 3UAWA 1VMKA 4JOSA 1ULBA 1LVUA 4L5AA 4D9HA 3OOHA 2QDKA 4BN0A 1YRYE 3QPBA 1RYZA 3T94A 1TD1A 1RSZA 2HN9A 1PR4A 4TXNA 1NW4A 4M3NA 5F73A 1A9SA 3PNSA 4M7WA 1ODLA 1JPVA 4KN5A 4QASA 1B8NA 5CYGA 1JDVA 5CCEA 3K8QA 1Y6RA 3E9ZA 2AC7A 5IU6A 4PR3A 2A8YA 4L6IA 4F3CA 4F3KA 1V3QE 3LA8A 3MMSA 1Y1TA 1U1CA 5B7GA 3OF3A 4FFSA 2AI3A 2IQ5A 1G2OA 2OXFA 3UAZA 4NS1A 2A0XA 1RT9A 1RFGE 4QAQA 1JDZA 1ZL2A 3TL6A 1K27A 5F7XA 1Z36A 3DDOA 4DAOA 1K3FA 4BMYA 1ECPA 1A9RA 3EMVA 4TTJA 3NBQA 1TCVA 5F7OA 1T8SA 1RXYA 5F7JA 3IOMA 1CB0A 4OGLA 1FXUA 2OC9A 3ENZA 1C3XA 3KU4A 4U2KA 1ZOSA 2I4TA 1VHJA 1TGVA 3INYA 4QFBA 4P54A 1V4NA 1Z34A 4L5YA 4BMXA 4WKCA 4WKNA 3UT6A 4LDNA 4D98A 3GGSA 4TS9A 4TXLA 3U40A 1PWYE 1JDUA 5CXSA 1TGYA 3MB8A 3OOEA 1Y1SA 5F76A 1YR3A 1JDTA 4ECEA 3K8OE 3DPSA 3KVVA 3FWPA 3BGSA 5CYFA 1Z35A 1Z5PA 3UAXA 1RR6A 1U1EA 1U1GA 3OCCA 3C74A 5F78A 4TTAA 1OU4A 1B8OA 1T8RA 1Y6QA 1Q1GA 1PK7A 4L5CA 4OF4A 1T8WA 4R31A 1RCTE 4OEHA 3DJFA 3FOWA 5ETJA 1T0UA 1Y1RA 3BL6A 5EUBA 4G89A 4X24A 1ODKA 4QEZA 1PR2A 4DAEA 1PW7A 5B7QA 1VFNA 1PR0A 4H1TA 1PR5A 2QSUA 1PF7E 4LKRA 1NC3A 3PHCA 4EB8A 4BMZA 2AI2A 4G41A 2BSXA 1Y1QA 3KVRA 4GMHA 1OV6A 4TXJA 4IP0A 3OZEA 3EUEA 3FUCA 1U1FA 4GLJA 2ISCA 3O6VA 4I2VA 4QATA 1SQ6A 2OC4A 3OPVA 4LNHA 3NM5A 3O4VA 5EPUA 3ONVA 1Z5NA 5B7NA 2Q7OE 4R2WA 4GLFA 3KUKA 1OTXA 1M73E 4L0MA 4OY3A 5B7PA 3PHBE 4K6OA 4R2XA 1ULAA 3IEXA 3UAVA 2OECA 2P4SA 1A9QA 3KVYA 4YMLA 1T8YA 2HWUA 1OTYA 1V2HE 1V45E 2A0YA 4DARA 4LZWA 2B94A 4NSNA 3E9RA 1PK9A 4F2PA 2QPLA 4MCHA 3SCZA 1PBNA 1NC1A 5C80A 1ODJA 4M1EA 4WKBA 3P0EA 4TYMA 2QTTA 1N3IA 2QTGA 1LV8A 1WTAA 4TXMA 3FNQA 3EUFA 1V48A 1XE3A 1SD2A 2AI1A 1QE5A 3DF9A 2A0WA 1PKEA 3NM4A 2ON6A 4DA7A 4NY1A 4DA6A 4YJKA 3FAZA 3ODGA 3OZCA 3EEIA 4MCIA 4WKPA 1JP7A 4RJ2A 4UC0A 5KB3A 3OZBA 1TCUA 1JDSA 1I80A 4TTIA 4LNAA 3FB1A 4OGKA 1JYSA 1A69A 1CG6A 4TXHA 5I3CA 1JE0A 1RXCA 1OVGA 4WKOA 1RXSA 1Z39A 3LBAA 1Z38A 3GB9A 1ODIA 4OJTA 1A9TA 5DK6A 1A9PA 3PNPA 3F8WA 4GKAA 1SJ9A 1Z37A 4PNPA 1Z5OA 1U1DA 4DA0A 3E0QA 4E1VA 4F1WA 1PR1A 1SD1A 1Z33A 5JPCA 3OZDA 5IFKA 5EFOA 4G8JA 2I8AA 4D8YA 5F77A 2RJ3A 1K9SA 3P0FA 2GUWA 3D1VA 5CCDA 4QARA 2H8GA 3BJEA 4YO8A
chains in the Genus database with same CATH superfamily
4URXR 3PC8A 2IYWA 4AZ0B 1DU4A 3ICWA 4RVHA 3IXMA 2CSUA 2VS1A 2GKSA 5GONA 4ZQGA 3WIBA 1PFVA 2HCJB 1J09A 1W93A 1RWWA 3IGFA 4Q9JA 2J07A 3DT6A 4D8XA 3VISA 3LLVA 4JP8A 2AFHB 4X60A 5LA6A 2VT6A 1BE6A 1KRWA 2HRDA 1QMGA 5K0SA 1KFEB 2AXNA 5K8LA 1JIIA 5KYTA 3QVOA 3RPEA 1DKUA 2XRMA 4M9SA 2DQYA 4MXDA 4AQDA 3LHIA 1HE8B 4C3ZA 1IG0A 5HK8A 4C0QC 2FMFA 3D4NA 4GGPA 3FKSD 3SJCA 4R0NA 3TSWA 1HBJA 2YYYA 4XPIB 3DKRA 1E9RA 3K05A 3R23A 3GDFA 1NYQA 1MC1A 3EPLA 2FPLA 1C7RA 3ZE8A 1J90A 2Q41A 2YV2A 3ZW9A 1KGSA 3CURA 5F5XA 1UUFA 5KQMA 3RT9A 2C61A 3PYLA 1NE7A 1TMOA 2KLHA 3I04M 3A3OA 3MERA 5C52B 1AQYA 3IQXA 4EFLA 1RWBA 3DEYX 3WNCA 1IZYA 3AT1A 1CQIA 3HADA 4P7KA 3UAWA 3WLJA 3AFOA 2IEAA 5AHXA 1HNNA 4L5AA 3LXUX 1YFKA 2YUTA 1BRMA 3OLYA 1P0PA 1UPTA 1KJ8A 4PLPA 3COWA 3LBHA 3EC1A 4TUYA 5B3KA 3EEBA 4QVGA 2QVGA 4RSHA 5TEWA 3G0IA 3ZLTA 3R20A 4MDHA 1PZGA 4A82A 1N5KA 4ACBA 2Z4SA 2IYUA 1EVKA 3B3GA 3PRJA 1C50A 4H3VA 2AEEA 1L5GB 5BURA 2J3KA 2AUNA 3KG2A 4R1OA 4R6WA 2QW8A 3W3AH 1P7VA 1W85A 1UFRA 3GCDA 3C3XA 4KFSA 2FPSA 2NP6A 1XDSA 1IPHA 3EWIA 4L4ZA 3F7TA 2HN9A 4QFCA 1SQGA 5LMUB 1U04A 1TT5A 3C1AA 4AWAA 5A1TA 2E1PA 4C6HA 3CX6A 4AO7A 1C4OA 3ROEA 3R0IA 2D8AA 4RLSA 4ENPA 2BFWA 2CNBA 4TZTA 2J08A 4MLDA 4Q4AB 4RPCA 4RHEA 4U2GA 2RKOA 1JJAA 3FNHA 4LF6B 2JARA 5F2KA 1SUEA 1Y3IA 4M1KA 4PGGA 1BN6A 4EAAA 3DL4A 1YZKA 2DHCA 1XTVA 3FZYA 5DN9A 1WV1A 4F3KA 3DAOA 3IEUA 3L7MA 3RT1A 5B64A 3RR2A 4D0RA 4WLUA 1VP9A 2ZUUA 1NP6A 1COWD 4HMPA 3H2HA 1Z7YA 4Y6LA 3V46A 3EIWA 3P9QA 1XNRB 2OTCA 1XVVA 3WVNA 3GJ8A 5JO9A 1CRPA 1FTYA 2OXEA 4X62B 1AKMA 3F5DA 4MUEA 4UUAA 1IJEA 4CLDA 2E4XA 4QXOA 2HJHA 1X0XA 1Y1TA 2WF5A 3AHEA 4P4LA 1JLMA 1V3TA 4OD0A 4G86A 4Q1CA 4R8MA 1XZGA 4D3XA 1QYCA 3AKZA 2OUKA 3GBPA 2WSBA 4HDSB 3GLVA 3OKAA 2A1TS 4QUAA 4QSHA 5F2NA 3GGDA 3JARB 1PUIA 3MCWA 2N0SA 1WKBA 1PLKA 3TAXA 3UC5A 2FN9A 5IT4A 1JG7A 5A5FA 5ITZB 4KXYA 2OMKA 3BDAA 1R0WA 4ER0A 4E15A 4YIHA 4NYMQ 1IWPB 2BPOA 1AHHA 3W04A 2EG9A 2B6NA 1RLTA 3CLUC 3MAJA 4P36A 3R7AA 5ALTA 5EE3A 3N1UA 1LCIA 5BSGA 3K5HA 2R44A 3RVNA 1C4KA 2POQX 1QIHA 4PLTA 1H3FA 2J9RA 2WPDD 1YGYA 3NEJA 4LTDA 2GN8A 2IE8A 4BZQA 1QV6A 3ROQA 1OGJA 1NVAA 2OG1A 5TLSA 3U4QA 4TWRA 1YL5A 3AETB 1GZSA 3VKWA 4ZYYA 5JH7F 3ZOZA 1CVLA 1RD4A 1SVUA 3ZWKA 1XLUA 1IPEA 3C6KA 5TPZA 3VOAA 1WCXA 4YAOA 2ODEA 4NK4A 4G4IA 3H8JA 2YWEA 4CPDA 5BWCA 2XMCA 1NX6A 1OC2A 3OX3A 4X85A 4G85A 4JQZA 4HJXA 2GVDC 4Q9NA 4ITVA 2IOHA 4PBRA 1NX9A 3GEEA 3HP4A 5EVCA 4B6QA 3AYXB 1CDOA 4N8EA 4W9NC 4NFHA 1O5TA 5GVSA 5JANA 3IOMA 2GD1O 3E2IA 4B3SB 1YCFA 3N0TA 5AK5A 3JYQA 4LYYA 1X86B 3R7NA 2ET6A 1YFJA 3QW2A 2HU2A 3TR5A 1ZSVA 3TR0A 4F97A 1XZMA 4FILA 1O2DA 3KB6A 5IXSA 4B17A 1O0BA 3UXEA 4LRWA 5BV2P 3RS4A 4S05A 2X9LA 4REOA 3A4LA 4PBSA 2Z9CA 1R12A 4B0PA 4BFCA 121PA 3UXHA 2CL5A 2Y1LA 1LBSA 2GAJA 3BIFA 5CH8A 3EISA 1QZUA 4DC9A 3FTEA 3BFVA 5E6UA 1O89A 1Y4DE 1XR3A 1ZK1A 2OXIA 4Q4HA 1RKBA 3BD9A 1M2NA 3LVRE 5GONB 2PU7A 1OJLA 3ANYB 3DOFA 1BA3A 1PBTA 3MTGA 4GHWA 4JUBA 1CZNA 4NJMA 3B6EA 3ORYA 5CDYA 3BJRA 4IIFA 4YLEA 5HKKD 3CLTD 1T25A 4F45A 3WJ1A 3MRVA 1JFFA 5LA6B 3BTSA 3A36A 3HNOA 2GOYA 2BL4A 1SVOA 4TWZA 3KAKA 1Z4QA 4KVGA 1A7JA 1DBIA 3DZCA 4IUYA 1SVKA 1H22A 3NHRA 4UZEA 3DBIA 5C37A 3RU9A 3N2IA 4FYHA 3SHFA 4QDJA 3AIKA 4X63A 1KXZA 5EERA 5IF9A 3SJZA 1U7UA 5BVHA 3EY4A 5DTJA 2IXEA 3DMYA 3T4PA 2HHLA 1AGRA 1FQJA 4MH0R 4NMLA 1QYDA 4A1OA 4C5BA 1E58A 1WB9A 5F3WB 1FLDA 2WIFA 2PVPA 3RFVA 4RDCA 1VXOA 3A4YA 5U4XA 4IGIA 5JZ9A 5FCDA 5FNVF 1J8YF 1WULS 1PJ2A 2I7XA 4BKPA 2G88A 2Z08A 3ENNA 3S29A 2FR8A 4AICA 1M0TA 3CTPA 3X44A 4Z4QA 5KC9A 1UZMA 3FAKA 5JAIA 4GGMX 3HMKA 4PZLA 1XQ6A 2ADMA 5EG5A 1DXHA 1GPWB 3EGVA 4BO0A 4G1UC 1ISHA 3JQ9A 4PG4A 1RR6A 1U1EA 4UU7A 1CQIB 2G70A 2IS6A 1DFGA 3N2NA 2FNAA 3R3JA 4X95A 1AS3A 5EEHA 3H2SA 4TRMA 4AY3A 1MJGM 2VZLA 3U3DA 2I22A 4DCMA 2ZBDA 1TAGA 4C0HA 4M89A 2XB2A 3VSDA 3TLMA 3HCBA 3QUSA 1R8SA 3BMXA 3P9XA 3A31A 1YE8A 4OEHA 3AEKA 2AS0A 3NJ8A 1Q0HA 3E1SA 4JU8A 5ILOA 5C4MA 3N5KA 3WKBA 4A2WA 4JXKA 4PAWA 2HRCA 1Z56C 3PXXA 4P0PB 1TRKA 3KOMA 1JLRA 3M5CA 1GPDG 4HMOA 3ZDYB 2PMWB 3E82A 1PJ8A 4K9DA 4QEZA 3E61A 5FBQB 1TT5B 3L1UA 3U3KA 1KARA 1XK7A 5TXGA 4ES6A 3IO5A 3O8LA 1B8UA 2PL5A 4OSEA 1RKQA 1KDVA 1YRAA 1J56A 5HNKA 3Q7RA 4KITB 1GG8A 1Q83A 1MVNA 3S1SA 4KFTA 1TCCA 1KU0A 4E08A 4DMFA 1TM3E 4EB8A 4ZAYA 4YUXA 2WWTA 2OENG 3FSRA 3PGXA 3NC0C 5AUQA 3TRIA 4YAUA 4B3GA 5HPYB 3WBJA 1YC2A 4ZZ2A 2J9ZB 3DAYA 4NPCA 4H60A 1NF9A 1I0ZA 2QU7A 4TMYA 5LOVA 5JWHA 1NAIA 2XUJA 4Z1MA 3SP1A 4XVRA 4HBZA 3DR3A 2NACA 1SXQA 1M6VA 3WICA 4PYJA 3ROZA 1RS0A 4BWYA 4WZ6A 1G5FA 3WG9A 1WCWA 2O48X 5IHXA 3FYUA 5FA8A 2O06A 1XZIA 4ZYTA 1NBME 3DEZA 4L4SA 3PFWO 2PT6A 2CHVA 1Q84A 1NU6A 1UXKA 3EGXA 2XVZA 3ENQA 3O6VA 3U80A 2II6A 2VK1A 1PT9A 2L18A 3QLUA 1C29B 1A7UA 1VKRA 3ZV7A 2EDAA 4JC4A 3VRHA 4LNHA 5T6BA 4YCNA 1FVXA 1U9CA 2AN4A 1NSFA 3HA7A 1IZ7A 5C8YF 1E8MA 4MYHA 3KUCA 1O77A 5BR7A 2R8EA 5EPUA 1M2VA 4O33A 2PA0A 4IEEA 5LWHA 1S2IA 5CDUA 1X1EA 5JAHA 3SXUA 1ZR2A 3EULA 1U6IA 3CUUA 2ZZKA 1YQGA 4I4NA 2PNFA 2Q5EA 4GRAA 5BSUA 1KVQA 2IVFA 3RVMA 1I2CA 4AT1A 1JH9A 3ME5A 4S24A 3AF3A 8OHMA 3RUHA 4JXZA 3OHSX 5JARA 1E2LA 1VMDA 2PH7A 1RLJA 3DWFA 2XI4A 3FVVA 2CW5A 3INNA 4MV1A 4PGHA 3RASA 3E4CA 5HJ7A 2GO7A 3BH6A 4ND2A 5BV7A 1KYWA 1JR2A 1SC1A 1ZK2A 1TO1E 3SBDA 2P4SA 1RYYA 4GZMA 4YMLA 1T2DA 1PJZA 4B44A 3ZQ6A 4IVQA 3BX1A 3WLLA 5I01A 1KRHA 2GM9A 2V3VA 2ZXFA 1JN0A 1XP5A 3LGXA 4L7QA 1RLOA 1KQ3A 2QMEA 2V5AA 3GW8A 5KHAA 5IZ4A 3PNYA 4OP1A 3NX4A 2DTEA 3ZWXA 3KS9A 1L5NA 1EWQA 3O3OB 4QNRA 1N2HA 2CC2A 4G1VA 3NR2A 2PGJA 4IJMA 3ZWPA 3RE1A 5ITWA 3WIOA 2W6JA 4JLSA 3AX6A 2C8VA 3R9XA 5HSGA 1OREA 3UW3A 3KQOA 2UUBB 3G2NA 2H92A 1K4MA 3BWBA 1QGAA 4JQYA 4LZWA 4UHEA 5JMOA 4J0DA 4Y9TA 3OUZA 1B23P 1N6LA 5F5LA 5F76A 3IAM1 4ARZA 3N39C 2I4MA 5E6UB 2WHXA 1UMDA 2I2DA 3WHKA 2GK3A 5GZ3A 2H85A 2QZ4A 4Q4HB 4LY6A 3WO0A 3AF6A 2WZDA 1R2QA 2D13A 2DX7A 3P9ZA 3K2QA 2FP3A 4RX1A 5T4EA 3TW6A 3RC3A 3L3BA 4HWRA 3ZJ4A 1DADA 1XD8A 4NJMB 5EA2A 1SKYB 4J75A 2O8DA 5IBRA 5JYCA 3KOWA 2C2OA 2IXBA 4V0RA 2RHOA 4EI7A 4JEIA 1P9WA 4ZOQI 3AHDA 3SMQA 1SD2A 2IKSA 2CDBA 4UKDA 4DIOA 1XIVA 5D51S 2XDQB 4FYKA 1VB3A 4KQMA 1PWXA 1XKQA 3ANXA 1KSGA 4HADA 4JLBA 4E22A 1RCFA 3LFHA 1PKEA 5DSXA 1E2DA 2W2LA 3RABA 2FEMA 3UMYA 1CQJA 4H0NA 1XZFA 3L93A 2NXNA 4ER5A 5DTRA 2PN1A 4Z9FA 1ZU4A 4B6GA 3FAZA 1IY0A 4NV0A 4PTLA 4GRIA 1GZ4A 3OZCA 4W7SA 5DXFA 2DHQA 2ZI4A 3OLXA 4KSYA 1J97A 4P3NA 4Q7KA 5EESA 3W7BA 4BQNA 4LSGA 4LC9A 4XGNA 2CK3A 3L8ZA 4NBVA 1ZBDA 2C9CA 4QICA 1CR0A 4Y1EA 4OHVA 4PYQA 3RSHA 3T9EA 3WOHA 3A11A 4N5LA 5I8PA 3KT3A 3WDKA 4FMCB 3ECAA 1CR2A 1CYDA 1GYQA 2FP4A 5ULLA 1CG6A 5KQRA 2QYSA 1FBTA 1YA8A 4KKVA 2SHKA 3AEKB 3T7RA 1W19A 1JEYB 2R66A 3NASA 5CX4A 1Q3TA 4ALLA 4QTZA 1OWMA 2P3SA 4XH9B 3UK1A 3WR5A 2LTAA 1JKFA 1S02A 2H63A 2R62A 3A6JA 2F64A 1XVAA 3GB9A 1BDJA 1JF8A 2XKJE 1EBBA 1PJCA 3N9IA 1BYUA 4KMOA 1GQYA 4XR9A 2NQ2C 1I6LA 1BDBA 2G72A 3FD8A 4TZ6A 1DJQA 4CM1A 1GYPA 2HBYA 2RIRA 4G5GA 3PDIA 2HZBA 4GKAA 5ESXA 1E4YA 4RIHA 4GG1A 2YWHA 3F6RA 4YRAA 3GARA 3GY0A 5DNCA 5KYWA 2VPYA 1Z37A 1POXA 3SZUA 3RAPR 1C3LA 2DAPA 2C03A 4OVKA 3W77A 4QXPA 4H1HA 1R4NA 2QAJA 1MA0A 4EHDA 4QU9A 4LN1A 1I1OA 1ZOLA 4O8CA 4E1VA 4XB6B 4EHKA 3GLIA 2DR2A 1KF0A 4BB9A 4Y0VA 5CH3A 2DG2A 4CEIA 1DC6A 2COEA 1QFZA 4CG3A 4RK1A 4HDOB 1I7NA 1S7GA 3TCKA 1QX3A 2FX5A 4JL8A 1VL6A 3K9FC 1LGYA 1QWSA 3CLTC 3IOEA 5LOVB 1E66A 5HF6A 1KGDA 1DFHA 5ARCA 4GL4A 1G5RA 5M04A 4HCJA 5JWRA 1M6VB 3TI9A 2LZ0A 1DI0A 2AK2A 5E6RA 3CC8A 3L7BA 4YRZA 5EKUA 1VDMA 2HLDA 4URVR 1T3SA 4PVCA 5K8JB 3A9CA 3GP3A 3F6EX 5ICEA 3U7FB 3IUYA 3MGKA 1WXGA 3PWKA 3UPTA 3ZGVA 3EGXB 3R3SA 3UCFA 1PQUA 4BNNA 4RQTA 4OLBA 4ZCLA 4H0FA 2YJZA 4DA8A 2WU8A 5C8ZA 1SQ5A 1IH8A 1ZGHA 1S3GA 2H1VA 2ONKA 3DMPA 3RVPA 4EUNA 1PNOA 3FTFA 3OZSA 1NUUA 5U4QA 3ZVKA 2ORVA 3UBMA 4E1AA 1A9OA 1DQSA 3IKLA 1M2VB 1LPSA 1XMQB 3KQMA 5FLXA 1GZ5A 3GRYA 5K2MA 4QD3A 2WTEA 3OEYA 1L3IA 3AHJA 4NATA 1XJ0A 4OU5A 4TLBA 1SXJA 4YAWA 3ZNPA 5JCZA 1H6CA 5F7ZA 2XYRA 2ZRNA 4FIZA 1T3ZA 2GKGA 2JI7A 1T3HA 2W2VA 2WYVA 4Q82A 4I3HA 3U13A 4B2YA 1OOEA 2G9RA 2JFPA 1EU1A 1YR2A 1YQQA 3DAFA 3FZNA 3F7NA 4CM8A 5AIBA 3WQQA 5BYAA 1DIOB 1W1UA 4H7DA 4LZAA 4KR7A 1XROA 1D2RA 1DC7A 1KFKB 3AERA 3W1EA 3WJ7A 4D02A 3UEOA 1N8TA 2QQ5A 3FGOA 2QJOA 5K1ZA 3OZXA 4R01A 1WF6A 2WT8A 5IT0A 3JQPA 3WIVA 4O4JF 4DQXA 4AECA 1OLSB 1ELOA 2QN7A 4M7PA 2Y77A 1NP7A 2YC4C 4A0QA 3ZCSA 3TI7A 2F1IA 4TM7A 2DXIA 2DTXA 5BV8A 2FW0A 3FLBA 2H4WA 3AOGA 1Y4AE 3PQCA 4NCAA 4R84A 2FZWA 4P22A 5JSYA 2WF9A 2Z3WA 4EG7A 4EFNA 2JFHA 4BTLA 3H7AA 4AUKA 4YDRA 3B60A 3B1WA 3TQIA 2AJBA 5KDOA 1LTKA 4UXJA 2ZT7A 4GLBA 4R0VA 4CLOA 1EM6A 4HNUA 5K9ZA 2CV0A 1BD3A 2E5FA 3O91A 3RFTA 4R9UC 1ZM4A 2ECFA 3Q8MA 4KQGA 4ARZB 2Q3LA 5AW4A 3HVKA 2VJCA 1UMDB 3O2NA 3UG7A 2DOKA 1LU9A 3DFZA 3UMBA 1QDUA 2AR7A 1MAHA 1YFZA 5JNLA 2OFPA 1USVA 3NHBA 4KQEA 4FDLA 4ZYVA 1SUSA 2AZXA 1G8AA 4RTNA 4BL5A 5A6SA 2ESRA 4IIDA 2FK8A 4KYTA 2E85A 2QD1A 4DM7A 4HWSA 2O8DB 2Q6LA 4DVJA 4M9CA 1VXRA 2YZNA 3CUEF 5E0OA 1TLFA 3QBEA 3AB7A 1IHDA 2PKYX 3FTPA 1GKUB 4UHFA 5AXAA 5LL6P 1B8VA 5CFLA 3WDMA 2I2CA 4R68A 2BF7A 1ISSA 2FWNA 3MPUA 3HKDA 4KAXA 5BNZA 5BPFA 5ITSA 3RF7A 1EQAA 1SQ0A 1XA3A 2FOIA 4F3CA 1BROA 4NCKA 1IXKA 5ALGA 4D0LB 1WPQA 2SKEA 2F8SA 1CQJB 1P73A 3HHPA 3D3EA 4I1IA 4EH1A 4D9GA 1SZPA 3GBVA 1H9BA 4V38A 1UMBA 1K63A 1JSCA 3HI4A 4FJ2A 1B6TA 1GDTA 5KJ6A 4TYWA 3ZK8A 2C5FA 1G38A 2PLFA 3C5WP 4ND7A 3SFZA 3TVTA 3WK4A 3ZH9B 3SF0A 5C1DA 4MTLA 5B57C 5LP6F 4F96A 4NS1A 1AZLA 5ENVA 2HMWA 2LBPA 4RM2A 3LLUA 4ZZ3A 2RGCA 1T6NA 3K9QO 1Q7EA 3DTTA 1I13A 1I9GA 4LDPA 4RTJA 4Y6GB 4NZNA 4IOJA 4AKTA 3WGNA 1A97A 1RLIA 3EFOA 4ZDJA 2FP4B 2NOAA 3C7CB 3OD5A 2C20A 4N5IX 2FKNA 1LTHR 1IK6A 3K09A 4PIVA 2BONA 1QP7A 3OJWA 4TTPA 1S2MA 4JNKA 1B1AA 4BP9A 2H4JA 2CL0X 4IGAA 4X9XA 1ZSNA 3B1JA 1X94A 4RLHA 1TEZA 1J06A 4AJHA 3WKEA 2IDKA 2NVUB 3DV0A 5GGYA 2W6IA 1H2RS 2Z43A 3BMNA 3KR9A 3ITEA 3WB0A 3ANTA 2HPZA 3SS7X 2P91A 1FS4A 1ZRSA 4X71A 4HDQB 1ULTA 1VZ3A 2TMKA 1JSXA 3BREA 3PDIB 5CLQA 4YV1A 9ABPA 2QMQA 2C83A 4CMIA 5KYWB 2PKRA 3OTHA 4YMHA 1KBOA 3D6FA 1QG2A 3DBRA 4O2BA 4DMGA 1R4NB 1HYEA 3K8YA 2VDQB 1T2UA 1T43A 1ZUHA 1IRIA 3M4NA 3GLIB 3AY0A 4AQ7A 3AHFA 4OHBA 3MTBA 4A03A 1T5OA 1SIUA 1TCBA 4JODA 1YZTA 2A2ZA 1N2OA 5HP4A 4CEIB 3CH5A 1AO3A 2ECPA 4E3WA 3BCUA 4B6OA 1FXUA 4P33A 4W1RA 2JAQA 1Z88A 4K8OA 1RAIA 2QTMA 2YRFA 3WKDA 1VPWA 1NVEA 3U4MA 3AIMA 5E6RB 2F55A 3AY3A 2W5UA 1IJFA 4ZU1X 5KVAA 3HLYA 3NTUA 3SJ7A 1QKKA 3TOVA 5A4JA 3Q9NA 3VU0A 4GPAA 3LLCA 2Z57A 2I8CA 5FTNA 4DCJA 3GGCA 5CG2A 3N0RA 5HX7A 1BMFD 1LF5A 2V3CC 4H08A 5JDCC 4EYEA 2KPOA 1JQAA 2IYTA 5TQVA 3OU7A 4IDHA 3UYKA 4N48A 2GZRA 4YJHA 1RWNA 4ALNA 2WT4A 4Y9UA 4TL9A 4QJIA 2IRWA 3NATA 3P32A 3VR3D 4ZI3A 4A6PA 5CM8B 2YFQA 4BGUA 5IDXA 3MJFA 1VHQA 4I8DA 3R6DA 1T3GA 1R0CA 2P9HA 4MP3A 1M8FA 2FK7A 1ECCA 2ODTX 3H6HA 4MGKR 4JUIA 3TMYA 1M2FA 4GMXA 4KLCA 2ZJ7A 3TOSA 4B6JA 2CL6X 3OLWA 4CM8B 2VJAA 2ZQYA 1PFQA 1GGMA 2YINC 1JDUA 1IOWA 4Q1BA 4TPKA 1KY3A 5FWDA 5JD4A 5LDDC 4BEVA 2ZSKA 3PHIA 1WW2A 4QFMA 4HUTA 5JI3E 1LFDB 1E62A 1VFPA 3N8KA 1SKQA 1NBEA 2QTCA 3P4YA 1NATA 2HJSA 3AERB 3QU9A 3Q2OA 4JCCA 2IU4A 4Y1GA 1ICEA 1NN5A 4C6SA 3DPSA 1F3LA 4MAFA 1CRQA 3EBPA 4NENA 3OZTA 2VTVA 1J00A 1ULSA 4EY3A 4D9EA 3SC2A 2I76A 3ZW8A 4Q3EA 3F6CA 2YXBA 4EVRA 1F0YA 1QG4A 1UJBA 3CZ5A 4IDOA 2XWBF 3OCCA 2B4QA 4HLDA 4K9SA 1GTSA 2VYQA 1I3KA 3U1VA 1MFPA 4UJ3A 4B5KA 4EQ6A 4I1PA 3A9TA 4E2YA 3FIUA 4R1SA 5I8WA 1EM8A 1O94C 2XSZD 3CLRD 4FN5A 4YP5A 1KY4A 3T95A 4LKOA 1Q1GA 2W42A 5ADVA 4BC0A 2FZLA 3IO3A 2YZGA 1DRKA 1JNYA 2AHRA 1QOPB 1S0UA 1TZBA 1H0RA 3DLCA 3MQFA 1HK7A 3D7SA 1DG3A 5F64A 5G0TA 1OJ7A 2FUCA 4B6RA 2IJGX 2D2XA 4BFWA 5EFZA 3UQZA 4MS4A 4IH9A 4YRDA 1NF8A 3T6KA 4D9NA 3OE7A 4HLQB 3ZEAA 1KOGA 5AP9A 4AF6A 1EWKA 1M0EA 4N76A 4WNCA 2RGDA 2QW0X 3EWAA 3T1VA 2YN4A 621PA 3H5VA 4EL5A 3VO1A 4FEEA 5HE8A 5C18A 4V1CB 3W4JA 2BGGA 4LC0A 4K9QA 4Q48A 3DPUA 4CMGA 1WBJB 2ZDHA 2ZS7A 2ZE5A 3VFDA 3AB8A 4AJOA 4BP1A 4FDAA 2AZTA 3UGKA 3CX7A 4Q9HA 4C6TA 5LUAA 3AEUA 5HIAA 2HXSA 5M7EA 2FSFA 2M1ZA 4UOQA 1BW9A 2VHZA 3COPA 3LX8A 1I7PA 2BMDA 4NYJQ 1EWVA 1WZUA 4BO6A 5IRCD 4ILKA 3ZXSA 3A06A 1KPHA 3AKEA 3HKDB 2VQ3A 1PLJA 2AJDA 1DKPA 3LLMA 3ROTA 3SOPA 1DQRA 3U7EB 4W82A 1UANA 1NRXA 3I73A 4L08A 1E1QA 1U3UA 3V7FA 1YACA 1PR3A 2WWGA 3F3KA 1EI9A 4LDQA 3SEZA 1Y1QA 2WB2A 4Q0MA 4OQQA 1JMVA 2C5LA 1UMBB 4B3IA 3KVRA 1K68A 1UJCA 1KBQA 2ATVA 1KAGA 2F3RA 2ZTSA 4V2UA 3L7IA 3E1KA 4XA8A 1G42A 4TL6A 4WCDA 2J48A 3AY7A 3C87A 4V0ME 1IOLA 3AF5A 5ECGC 3S2SA 3FUCA 1KVUA 1NXWA 2OZPA 2VAPA 3DTYA 4G5OA 5JSKA 5E38A 4O0LA 4JV5B 3UYLA 5EE1A 3OJLA 1Z2CA 3S0JA 3W9SA 3F97A 3WZMA 4DV6B 1XCBA 3GGJA 4KUEA 4MW6A 2EZUA 2J3QA 2X42A 3PG5A 5ICCA 5K6AA 5FHRA 1EA5A 4LE1A 4RH0A 2WIBA 1Z0FA 2QGFA 3EFOB 3QJYA 3ZQKA 2Y8EA 4E03A 1C1YA 2NXCA 1AMUA 5B37A 2JGJA 1XTPA 4Q00A 2W6OA 4U8HA 3EFHA 4INJA 3PXAA 3N2ZB 2QRQA 4WESA 1RU3A 4BVAA 2R6JA 2DFKB 3MHTA 4CKYA 3Q7EA 4EBBA 1E99A 3E18A 1IUNA 3DV0B 3BKXA 1GQOA 3BMNB 3I3SR 3TVDA 4L27A 3A6PC 4KIFA 2Q7OE 1Z07A 3Q0IA 3RFXA 4GLFA 3PICA 3SJUA 5FOQA 1OTXA 1OX6A 4UHJA 1MGOA 5CB4A 2OZLA 1GVHA 4RD3A 1BN7A 5BQFA 1I2AA 1JZQA 3PEYA 2IY8A 2ZT5A 3UENA 4ZPXA 4GBMA 4CMIB 2G4CA 2WKWA 3A1SA 4G0MA 3PLNA 5FFFA 2WNHA 3IEXA 4X6UA 1A95A 5JJCA 3DBRB 2IUUA 4IRMA 1KYZA 3ACDA 4O2BB 3OM9A 3WO1A 5JMTA 4FDVA 4JVOA 5BNTA 3RSFA 5HS4A 4MRNA 3HSYA 3NETA 3TO5A 4JDPA 2IX9A 4M1WA 3A4MA 2VP4A 2QTBA 4B6FA 1U3VA 4DNPA 4NZ9A 1DBRA 4PCUA 1NKVA 1CZOA 5P21A 1MFZA 1ULZA 2FPWA 5CLJA 4S3MA 4NBWA 5TJHA 4PG7A 3U0BA 5CEJA 1E1MA 3OUUA 3QPWA 1T6ZA 3MGBA 1VZ2A 1XDWA 1M1NB 3E9RA 3FFAA 4WEQA 4NAUA 1SCAA 2WOJA 1DRUA 5CFPA 1JQJC 1ND6A 2XTJA 2XE4A 2ZPUA 4MWBA 5FX2A 5IAOA 1JEAA 1L7XA 5KX5F 1TU0A 2Q1SA 1GCOA 2E55A 4JITA 2VP2A 1KH3A 2QTTA 1LW6E 2OV1A 4YJHB 1L5KA 1WTAA 1D2CA 4LZOA 3PGVA 4LEIA 2OGSA 4LZLA 2OORC 4PO8A 1N77A 1P7YA 1D6NA 4XEHA 5DTMA 1KQPA 4UXIA 1DXYA 1YJ8A 2DP4E 3U19A 5LU8A 1LB1B 3ZDRA 2QTVA 1F60A 3NRJA 3PF8A 2F6RA 3N6VA 4DWWA 1PSWA 1X38A 3Q2KA 1NJGA 1VIYA 1G5HA 4R0MA 3DZDA 4GXQA 3QW4B 4QUJA 5HFNA 2J7PD 3NBXX 5KINB 2J0QA 5DMHA 3OZWA 1QE5A 4LF8B 4F85A 1E3EA 3WK5A 1F7UA 2A0WA 3MOGA 2IUFA 2ON6A 4IJVA 3P0IA 3GG9A 5JEEA 4MW2A 2B2XA 5G1NA 4XLZA 4HWKA 2J3HA 3G7SA 4IXWA 4P3OA 1P1BA 4S1WA 4WRRA 5TGZA 8ABPA 4NENB 1H4TA 4HVTA 4D9CA 3K71B 4GP7A 5HQTA 3SC2B 3HE3A 1NR7A 1O3YA 3DLHA 2D2VA 1P62B 3ZBPA 4JKIA 2AIRA 1NXQA 2YRWA 4D3FA 3F49S 3AP1A 3VR2A 3KCQA 3NJRA 2W48A 5FWYB 1M2KA 2BGRA 4EQ6B 1Y9ZA 1PEAA 3EPJA 1EM8B 1S7CA 4I0WB 2CJYA 1JYSA 1XHFA 3UH0A 1KETA 1ZK4A 1ZH8A 2OO5C 3K0HA 3HGTA 4Q4LA 2FJ0A 4G8DA 4EEZA 3SVTA 2FN8A 3UJHA 3C8HA 1KWGA 1ZEJA 2O2SA 3GJ4A 1QTRA 2WA1A 4M22A 4QTTB 4FONA 2ZIXA 4MS4B 6PFKA 4DR4B 4EHNA 5C5DA 3C3JA 4B31A 2XBUA 2IY9A 4D4KA 3CXUA 1KQGA 1XAGA 3DW1X 3F8WA 4IDDA 4QOSA 5TSDA 1NONA 3OE5A 2I6SA 4ZOAA 5IANA 1L5RA 3FKQA 3UUGA 3FNGA 3ANNA 1SVIA 3CRZA 3M6AA 3DDCA 5AK3A 3ZWOA 4CM9D 3RVRA 4C89A 1JV2B 2DJ5A 3AEUB 3MJHA 1E1NA 3FCYA 1R5OA 4X54A 3TF5A 2ZCJA 4OX9Y 1JL3A 1FSSA 4JHLA 4COOA 1CUEA 4IJUA 5E4FA 1ZMTA 1DBWA 2GNOA 3B1ZA 2C2GA 3R6LA 2QUJA 2AJLI 4EMBA 2NZJA 2X41A 5T4HA 3EHEA 4D46A 3U5ZB 3DKPA 4HEQA 1OPXA 5FBRB 3WLSA 1DTWA 2C00A 4EUHA 1FTSA 3OFND 3V7WA 3OFSA 2Z6VA 4PANA 1L4UA 2FUG1 2CLEB 3DEIA 4YEDA 5AESA 1TW2A 1T2VA 2GUWA 3C3DA 4EG6A 2QLJA 3E9CA 4J3JA 2JJYA 3F2VA 4RCYA 3VKVA 3BQNB 3GRVA 4D6YA 2JK1A 3COYA 5ESDA 4BNJA 2FGKA 2G1PA 3OBBA 4DTIA 5DEIA 1CS4C 4QT0A 2UUCB 1EFRA 1U81A 1PR6A 2Y1WA 2I6GA 2WZBA 5A04A 1SUBA 1BWRA 1NDQA 1RYFA 2Q4EA 2D06A 3H1BA 1J5XA 4L1KA 4L4RA 3FX2A 4GPD1 4BFTA 2DH5A 4B75A 2OCAA 3R5KA 2P90A 5TS2A 3BL5A 4G9GA 3D9QX 2PXAA 4WESB 5LYJA 2IW1A 4F2WA 3R5JA 5EWMA 4WOJA 4HH0A 1SXHA 2IC5A 5EHIA 1JLHA 2JEOA 4A2QA 5FOUA 1JE1A 1XO1A 2JIRA 4KU4A 2X8AA 1XMPA 3UWKA 4E7PA 4EW3A 1SK8A 4KFCA 1ESEA 3HWX1 4R5MA 1JU4A 3T35A 2JFBA 5CB4B 2OZLB 3KQTA 2QUZA 4UAGA 1JEDA 3KQVA 1D0SA 4XYGA 3W5JA 4F4CA 4JP5A 1OF1A 3DL0A 1K8RA 1WOMA 3QEKA 2I1LA 4LGCA 5IC6A 3VJMA 1LX7A 2O7VA 2JDID 2JL1A 1HDCA 2ZBUA 3MWDA 5SZIA 1AE1A 4C7XA 3U61B 2VZ9A 1RAHA 3CBQA 4C2AA 1VSQA 5C4GB 2F1HA 1VG8A 3IP7A 2VHTA 3NM6B 1P2TA 3BSFA 4IDAA 3TLEA 4C03A 2MYPA 5HZMA 1F20A 2BKLA 1T5HX 2ETVA 2GN0A 2PKEA 4JC0A 4X5OA 3CZMA 1FS6A 2EX1A 4NMWA 3VPGA 3V8PA 5BR8B 1XNHA 2IPXA 4BN0A 2R11A 4FVTA 4B71A 3ZXXA 4BJ3A 1Z2PX 4OHMA 1MPTA 4E09A 2Y1CA 1YB7A 1X2EA 3GLFB 2R6R1 3VZSA 3QF7A 4D7AA 1IU9A 1NBAA 2JJ1D 3OPYA 4FEYA 4XCVA 4TZ0A 1E6MA 2CXTA 1GRQA 2CBGA 3PQ4A 2MOKA 4RACA 5TJ9A 2ZJ0A 3THYB 5JWOA 2FDXA 4HJRA 3FGZA 3TRJA 4E13A 1Y82A 3NXKA 4YCBA 1JKXA 1ATZA 4TS1A 1FPMA 3HJGA 1Q7CA 3HB1A 2J9GA 3CVJA 4R1UA 5HA5A 3WMEA 4YUAA 4CETA 3CR8A 1PNRA 1TM7E 2C9YA 2PK3A 5FPQA 2DVMA 4BS9A 5B55A 1AK2A 1OFUX 1JA1A 2HSZA 2QTVB 2B99A 2FX2A 2XNHA 4ZOCA 4X66B 3TE7A 2XMBA 1GG2A 2FLWA 3ZWBA 3MTEA 2J6CA 2ISQA 4DV1B 2QM0A 3B6MA 1Z17A 1NVBA 3T61A 4D9FA 4ASUD 3ZE6A 4TWBA 2YQ4A 3LVFO 1LFAA 1YONA 2Q1UA 5CDHA 5MGNA 2PX5A 1KO4A 1K7CA 1X3LA 3K0CA 3U0VA 2EFDB 4LK3A 5MF6A 4YCJA 1Q2XA 1HORA 2YYSA 2LGJA 2XZTA 3O4JA 5IEJA 4UM7A 4AMVA 4DLRA 3MMSA 4PYMA 2BYTA 2BGUA 1QRTA 5IS2A 3T4UA 3NCHA 4MKZA 2W9XA 3RIXA 2J3LA 3CUVA 4PCLA 3WWZA 2MWMA 2HRZA 4JBNA 4NV3A 1NYTA 2Q5JA 4ZD6A 4MHTA 4IPTA 4Q1DA 1QYXA 2AI3A 2IP1A 3VAAA 2F3UA 3FVWA 2B92A 3KXDA 1YF3A 1HDOA 1YIDA 4A0GA 3DEAA 2NZYA 1DAMA 2BRUC 2P0AA 4LF9B 1FJHA 2PGLA 1MVLA 3FPKA 3K5PA 2ATEA 2Q1WA 5LZ9A 3ZCVA 1YAJA 4GKBA 1S5PA 2IDZA 2J4CA 4QBTA 4UMFA 4OJNA 1RMQA 2QA5A 5C3MA 4RTPA 2D00A 4QNNA 1ZL2A 5BYJA 3S55A 4CQNA 3KKOA 2BGWA 4QQ8A 4YS6A 3RCBA 3S99A 5E95A 3M6IA 4OG2A 1K27A 2YJ5A 4FCTA 1KEVA 1Q0SA 1RTKA 2ZREA 4L8YA 4QOHA 1XVUA 4RYLA 1E9AA 2HRBA 2FR0A 3ECCA 3FJOA 3MOSA 4JDUA 1FTGA 2QW1A 2E0IA 3O4FA 3VC1A 3TXAA 4ARIA 1TZMA 3CZ4A 3QTBA 2PGNA 3K0KA 2RB4A 4N9QA 1ZI6A 2VHXA 4KP7A 1XRMA 4MWDA 2YIDA 3G8YA 3GHHA 2YV3A 3L6EA 3DTVA 3LUKA 4HRVA 5DHUA 2I62A 3JZFA 4ABTA 1TDJA 2Y0EA 3MHPA 5GVRA 1H9AA 3L0IB 1E0AA 3MQ4A 3VYUB 5ITVA 2YWGA 1JYFA 5HCUA 2CLCX 2QN3A 1G0NA 4KPUB 3DQPA 3ZY3A 4BQEA 2Z0MA 5EZQA 4CI9A 3CRW1 3MSXA 4UEKA 4LBVA 5FPKA 4NZMA 5T41A 2QRUA 3AR4A 4FNGA 3I9V1 4K3UA 3TVYA 1IZ9A 3PFHA 4O5AA 3JAMA 3HN7A 1D1QA 1FFDA 4YUZA 4QGSA 1I36A 4OK3A 3E7XA 2O2XA 1JSRA 2WJPA 3N0XA 4Q4JA 5CW1A 3KJFA 4B7AA 1NM5C 2DLNA 1EFVA 3PQ2A 4NJEA 3W2GA 2WB4A 3QXXA 3VYVA 1SU8A 1V4NA 4LX0A 4MVJH 3H2YA 3KPYA 4FLEA 1B0ZA 1RQNA 1X1SA 2JASA 2O20A 2WUEA 4DDVA 1C9YA 1OI4A 5EMHA 5DU2A 3T5TA 1XTIA 1ZJJA 1IBLB 3C4VA 2BZGA 1Z34A 1Y1LA 1U2GC 2GCPA 2G25A 3IOCA 5DNEA 4BMXA 4C0LA 4F5YA 3KQHA 1E32A 4IMJB 1PZNA 1ZW1A 2OKCA 2RAUA 1FDWA 2BT4A 3E0XA 2WSSA 4W6ZA 5GIOE 5AW3A 5LYJB 3O0DA 3PE4A 4I1SA 1JBKA 3PNMA 5EWMB 3SK0A 4F84A 4QXQA 1P0FA 3EWNA 5CURA 4U7GA 3WXBA 3CIFA 5L7YA 5FL7D 3NALA 3U56A 4RTKA 5GJBA 4XYLA 4JVLA 1V8PA 3OUTA 3DXYA 3T3OA 1E96A 3AG5A 4UPVA 1G17A 1FVOA 1PZMA 2ADOA 1TA0A 2PL1A 3CE9A 3LT1A 1XN4A 4QYSA 5D8DA 4EPXA 1WF3A 2ZU0C 1TJ4A 3UV7A 3I5MA 1N5RA 2FSUA 3QJ5A 2C2WA 2C3MA 2VWQA 4HSGA 4WJZA 1T9CA 3W5UA 2AOWA 3W4KA 4EELA 4FFRA 1Y1PA 2XCSB 3I8XA 3KQYA 3K5WA 5KQPA 3MWDB 3QEMA 5L3VA 2H2WA 1WNTA 1GAWA 4JZYA 2P75A 3I2KA 5IW8A 5K4GA 2IS2A 2K7ZA 3EC2A 3E3MA 3OEWA 1ADYA 1RAEA 2L42A 4IZOA 4FHEA 4PSCA 2ACVA 4ESOA 2JFGA 2VH5R 4M8SA 1NRJB 4QECA 3RYIA 3FDFA 3VBCA 4RZHA 4KXMA 2ZTUA 4XQEA 2X15A 4RUKA 4YV7A 4N3AA 5EJEA 4QXMA 1LQ2A 1MOSA 5BXYA 2AJCA 5BUSA 4QBFA 2I6UA 3LPLA 4S1OA 4XX1A 1GEEA 1FA9A 1L4BA 3N7TA 3KUUA 4CCYA 4HTFB 4Q7QA 4QM6A 2C5AA 1JAHA 2Y68A 5L9AA 1BVRA 2QYOA 1KA9H 2GKOA 3T15A 1XC7A 3GPCA 4E2FA 3G0GA 4MS1A 2BHRA 2PRYA 1LK5A 3H9QA 3PUYA 2Q3CA 4MUXA 4Q03A 3EZ6A 3ZHUA 5AMXA 2DJIA 2DGDA 3QBTA 4IAOA 4II7A 1KY5A 3E3OA 1PR5A 4LRQA 4NNOA 4UTXA 4I81A 3HYCA 2ZSJA 4TSFA 1NBMA 5AWFC 3A6KA 4CDMA 3P2EA 4H6VA 3X1JA 4CT0A 4BAUA 1WUJS 2P6PA 3IODA 4Y7DA 4YFYA 5IJ9A 4GX1A 3ADPA 4HEA6 3FYCA 2ORIA 2IUTA 5EZ5A 5J5CA 4TLEA 2PE5A 1XQWA 3AI2A 2W2NA 3L06A 1Z15A 3LDUA 3NHSA 1K06A 1J24A 3DDWA 3GUCA 4MAMA 1AQUA 4TYPA 1QTIA 4U6NA 4DNQA 3HLKA 4EF5A 2PZBA 4RC9A 4FSDA 3BORA 2ZJAA 3NDJA 4BNGA 5C9ZA 3JALA 1O0SA 2JVKA 3FFBA 2H52A 1ODTC 1W6RA 1X8KA 4RFLA 8MHTA 2WOOA 2FUEA 2YICA 3DDSA 1G9TA 1GZUA 1IXRC 2IHUA 1UXGA 4GGOA 1Y89A 1HFEL 2QP4A 2FLVA 3EQ2A 3KV3O 1JFLA 4ENWA 4WQMA 1GUYA 1H8HA 1FDSA 1I7LA 3ANMA 3D4OA 1W36D 1TIBA 4AYXA 3UMGA 4KI7A 4PV7A 5FIUA 1J1ZA 1E5QA 3VZQA 1HO3A 2OXCA 4UNNA 3TSCA 3R44A 5TF0A 1ZD4A 4B48A 2N46A 4YY3B 2HYDA 3JYPA 3HS3A 5TNXA 4Y2XA 3QQ5A 3HPQA 3ORFA 4TVBA 2HGSA 3LW8A 1QHYA 2MYUA 4R2WA 4GWLA 1ZUWA 3BQ9A 1RXIA 3QF4A 2H3HA 4E1BA 1CJCA 4MVJD 2PUHA 1P5ZB 5C46F 4M7RA 1ODSA 3T99A 4L0MA 3CZQA 1RI3A 1OHHD 2E4YA 3PHBE 3WP0A 5TPWB 1AXGA 1YV9A 4YC7A 5K0CA 3IDOA 1JDBC 4V0OA 5GINE 1XRLA 2HTFA 3FMVA 3GAZA 2Y1XA 2DFVA 1E0DA 2OZVA 4HBGA 3DTVB 4KAAA 2YVKA 3A6DA 4LI0A 2D2EA 1L5OA 2ZITA 1DBVO 3D8HA 4LXUA 4B3XA 3BGWA 1Q6ZA 3HVHA 4Q9IA 3PC8C 5B58T 2Q3FA 1QC5A 3CF2A 3JZMA 2EKPA 2R8XA 4NPHA 4WZBE 1W1WA 1AHPA 2X3FA 1DIRA 2QRGA 4H18A 3H2ZA 4IFTA 5CCBA 3FCOA 1I30A 3G1WA 1FSZA 3GNTA 1JFRA 1PK8A 4Z1MD 1CUGA 1TZCA 2N9UA 1J2JA 2Z04A 3HXPA 3OF2A 4IGEA 4AYWA 4CJXA 1VBFA 3DEJA 4PHTA 4L0QA 1FL9A 2XYPA 2NT4A 3C6ZA 2R60A 2Y71A 4Q4JB 1CV2A 1EFVB 4Y2JA 2W6ZA 4CDNA 5BP7A 4RZ2A 4S1VA 5C80A 1GARA 1SHKA 1U0LA 4EX7A 2ILTA 5J5AA 3WB1A 2HM7A 1F17A 1GJRA 3L7LA 4E32A 3GFTA 3ER9A 1V11A 1ZM7A 3NHJA 2JD1A 1N3IA 2HMVA 4INAA 1TFRA 3C16C 1XELA 1Z4PX 3FNQA 3EW7A 1Y7IA 3PCTA 2XHZA 3GLSA 4UUQA 4DTCA 4FW8A 5IXJA 2B25A 2OV8A 2O6LA 4FQ5A 1NQUA 3CEAA 3E9YA 3RVDA 4DA4A 3ZGZA 2O1XA 2PR7A 1PEYA 1UBHS 4MX8A 4RY0A 4YRNA 5JNUA 2R47A 1CRWG 1XTZA 3HV0A 4CTNA 2QG6A 2NO0A 3RJMA 3RC8A 3A4TA 3MS7A 2QTNA 2IYQA 3DNMA 4RZQA 1Z7EA 1S2GA 4GW3A 4J16A 4L8VA 4LHYA 1VMAA 1P75A 3S68A 2FTKE 2EZTA 1ZONA 4DA7A 1UZLA 3ZXIA 4UFPA 1Q7GA 1VL8A 2O3SA 2P65A 4YJDA 4JJZA 1QV9A 3SYLA 3CR3C 3QEMB 4ZOEA 3ZCUA 5LMCA 1SCDA 2PGOA 1LZLA 2MJLA 4BCCA 4PBTA 1G6KA 3LKZA 1Q11A 3O83A 3OIFA 1L3CA 2ODQA 4LXHA 4FC6A 4PN3A 4BFUA 2O7RA 1IN5A 2Y9PB 4AP6A 4I1VA 4Z4HA 3N2KA 1I80A 4DV3B 5E7MA 2XMQA 1GADO 4L57A 3ACBA 4HDCA 3OZ7A 1TPYA 4MQMA 1P1IA 4FE3A 5DP1A 1AUQA 2Y0PA 1S3IA 4BQPA 4QQKA 3PL1A 4F71A 1GRNA 4NX2A 4RF3A 4F8JA 5EJ7A 5K8IA 1GQRA 5D3KA 4CCYB 5FO0A 5TIIA 4B8WA 1GKKA 3NUGA 4PQRA 2X4IA 3DT9A 2ZE8A 3FRHA 2B8JA 3WL7A 4ZOBA 1RYNA 2FFBA 3E8XA 4LCBA 5L95A 1HR0B 2E21A 2CMGA 1CTQA 2R1TA 3CUKA 3LQ4A 2I29A 1EQ2A 4CIAA 2VEOA 1UBJS 2PX8A 4PLGA 3BAZA 5FPYA 4UU1A 1MV5A 1XBTA 3DMTA 5C8XA 4QO7A 3ZW7A 4O3MA 5JJBA 3ILSA 2OAP1 1Y5RA 2XIJA 5KTPA 4G56A 2RGUA 3NT2A 3SYTA 3B9QA 4O29A 4D9IA 2YIJA 2ZB4A 3MJ4A 4HV4A 1FJGB 1KJWA 1LKZA 1M6NA 1Z2OX 2FQ1A 3HGQA 3AV0B 3KOUA 2OQ2A 3GFRA 5IJ9B 4DQLA 2D0IA 5FF9A 1TOAA 5L53A 1PR1A 1XTUA 2QTZA 1EZ4A 3PC4A 4BX9A 1I33A 1CR1A 1OIXA 1T9GS 4J0KA 3A04A 3JXEA 1LSOA 4R05A 3OZDA 3QUCA 4WN3A 5IH7A 4C7MA 5T67A 1EH5A 1GG5A 1QKJA 4ZXFA 5JJLA 4MVJP 4GVPA 3WBFA 3W8RA 4P53A 1FDVA 1XLVA 4OHZA 3UB3A 4DQUA 1VA4A 3I01A 1QVRA 2VBCA 3ND5A 3WWCA 3TLCA 1VYVA 5DOZA 2RH5A 2VNKA 4DRZA 2XKKA 2GCGA 2AKAB 5DX1A 4OFZA 2Y27A 4XYMA 2OL4A 3JYOA 5B1IA 4ML3A 4YRJA 1ZCZA 3WLIA 3B5EA 3LA6A 1K7FB 1NXPA 3IQEA 3L46A 3V4SA 4S1TA 3U60B 1N32B 3GAMA 3RIGA 4XR4A 1QIEA 2ZAMA 1WIWA 5CD1A 1LWNA 1T35A 1JFVA 3ZE0B 1VYUA 4KLZA 5K4HA 1P61B 1IOVA 3OM0A 2BFBA 5FV7A 2CFCA 4EW6A 4TOIA 1UBOS 3SU8A 3OLZA 4BO3A 3N70A 3DR5A 1IN7A 4NQRA 3K70B 4B3RB 1HE1C 4KI0A 2CNOA 3BD8A 3V7YA 1ZSYA 2COKA 4H3KB 4R16A 3ZJTA 4P35A 2H4XA 4DPLA 3IEVA 1P7WA 1YZLA 4I5GA 4P5EA 3DDHA 3MS4A 3RRJA 4D4LA 1Q6YA 3QF4B 4OGWA 1RWQA 2FMTA 4MJ3A 4BO5A 3VAYA 3OC6A 5KAPA 1II0A 4J4TA 2IEYA 2GYWA 3RSLA 3ZCTA 2I7CA 3FZQA 4P6VF 1DQYA 4KQCA 5FPHA 3G8AA 1H2EA 3QJGA 3C41J 1D4AA 3NYIA 5FV4A 3BJIC 5G1PA 2QM3A 4MUKA 1WVGA 4JSTA 3RYTC 2V5UA 1TM1E 4YCSA 4D74A 1V9SA 2X86A 4MOWA 4B43A 4XZ3A 2JFUA 1QOQB 5A4KA 2K87A 4M1YA 3H17A 4G4JA 4ZC8A 4WXHA 3VTKA 1LVUA 3ERCA 1ADGA 2IXFA 1IZ0A 2I3BA 2R9VA 2YFYA 3PFNA 4TVKA 4HYYA 1QG6A 3A4IA 4H31A 3ESDA 5DYWA 4AQYB 1UBCA 2O2JA 3IQFA 4RTOA 3HCAA 1Z4KA 1Z6QA 2DT8A 2ZSHA 3GVHA 1KMQA 7GPBA 5EUQB 3EVFA 5HG0A 1IXZA 3D6MA 1AC5A 2YXNA 4R8LA 4WD3A 1CU1A 3VC7A 4GVXA 4EKNB 4C2BA 3PVCA 2BDTA 1E6CA 1NLMA 2V3WA 3A7EA 1ESZA 3CPJB 3O2JA 4I1OA 2X13A 3LC0A 4CBVA 1I4LD 2Q8QA 2IH2A 1ETHA 1TD1A 1X14A 2V55B 3VZDA 5BSMA 4EMSA 1O58A 4DZRA 3GF4A 1V11B 3UWSA 1TQ4A 3SYNA 3VO9A 3ZLUA 3KZXA 4OMFG 4CL3A 3SSAA 4HVLA 1NVXQ 1D1PA 4CV0A 2WV7A 5BSHA 1QFSA 3U7GA 2JJQA 2BEJA 3HXMA 2BJWA 2R7MA 2WG1A 3JQ9C 4FS8A 1GQFA 1VSVA 1WY7A 4JLMA 5JH7A 1U2ZA 2G9VA 3B48A 4KHZA 4O2AF 4XW2A 5IJZA 4HL6A 3VKFA 5KDLA 2HD4A 2KYRA 4ZCTA 4EJ2A 1N36B 3S8YA 2VRWA 1W36C 4PR3A 4PZEA 2Y66A 3BFPA 2EFCB 2JGRA 2P6OA 3U7HB 1TNDA 1OPRA 1U28A 4AX4A 3CVUA 2IYZA 2FRDA 1MT0A 1PEDA 4BV3A 1PT8A 2IOYA 2BFDA 2UVPA 3B2EA 3EAQA 4IKEA 4BRZA 4CKCA 1K8QA 1TTQB 1EXDA 4I5IA 4BQFA 1X70A 1T24A 3GOHA 3R4VA 1BKSB 5NLLA 2FVYA 4WNYA 2BCGY 2ZKLA 3MFYA 3VR5A 3KKKA 5AJUA 3LUBA 2DWPA 2X6TA 1HMPA 2A0XA 4AJKA 4B0OA 2XB9A 3UOAB 2QVBA 2RJOA 3QVKA 1AV7A 2CF5A 1K3TA 3ZE2B 4PEVA 1ZNWA 1GAEO 3A37A 4Q1AA 4RM3A 3TZKA 5DDIP 4ZAGA 1JR4A 2X22A 3VGPA 4Y9RA 1MP0A 3RAJA 4FKZA 4FOSA 1EDDA 2C9OA 2ZAIA 4EATA 2Z6AA 3ZBTA 2HA4A 3KM0A 5F52A 1L7MA 1N5OX 5T8KA 2Z5LA 2NYRA 1B14A 1RWKA 1Z36A 3G59A 1X2BA 1KJJA 1CUFA 3X1XA 4BMSA 3RODA 1DQNA 2PUVA 5IJXA 3CPHA 3UNXA 3ZV4A 3MOIA 3EMVA 1LLCA 1Z75A 2UZ1A 2ZRHA 3GFQA 1G8JA 1JIUA 4YLGA 2HFJA 2OYRA 3REQA 2IYLD 4KDRA 4BVBA 2WQ6A 3FYUC 4L8WB 5I6DA 1JKIA 3D5EA 3AR8A 1E64A 4E30A 4F60A 3HBFA 1G7CA 2F8MA 1QE0A 4JIGA 4JI5B 1PG2A 2QQFA 2YZ7A 5A1JA 5IPFA 4E94A 1P5JA 4D5EA 2PUDA 2FW7A 4Q6WA 1E98A 3QLUC 3ND7A 4U00A 5FNVA 4DM3A 1CB0A 2G3YA 1WW3A 4OGLA 4RIGA 5J23A 5FLKA 3OQIA 2GAAA 1ZRHA 2R85A 1UBUS 3E3AA 2ZBFA 1WG8A 1X13A 2BF4A 5KSOA 3SR4A 2ATIA 1EUZA 3Q3JB 4C0BA 4UULA 3L1HA 3TYXA 1G8GA 3X1ZA 2I4TA 1LV7A 3LY7A 1W9MA 3OA2A 4LYFA 4L76A 4WUVA 3H0CA 4US1R 1D07A 3DZHA 3K9CA 2PANA 4KYVA 4UHDA 1SUCA 2OPHA 5LPNA 3QEBZ 1XZBA 1XCMA 4UUOA 3O4GA 5KNCA 3O4IA 1RBZA 1SHZA 3UN1A 1VLHA 3WWDA 3U7QA 2OGWA 16PKA 4NCNA 1PDWA 4KCGA 2I67A 1FOEB 3LUPA 3O26A 2CYCA 2BFBB 4G0UA 4R2KA 1Y8AA 3LDHA 3NV7A 3OH8A 4RABA 2MYTA 2ZIVB 4AO8A 4EL0A 4WDRA 4BFLA 4QJ4A 1TMGE 2YWJA 3N6XA 5LMZA 1GAQA 3C5HA 4MVYA 3QEAZ 1TM4E 3P9CA 4N03A 5JFTA 3LG2A 5F9FA 3NHYA 1YGPA 4IJQA 4TQ9A 2XYQA 5CVEA 1F4VA 2FW1A 2NSLA 4OH7A 5G4KA 1T5TA 3RU2A 4NVRA 3BWEA 2XNJA 1G9SA 2A9PA 3SFVA 3LUFA 2B4YA 4EPYA 2B4RO 1PJQA 3KXKA 1ZR4A 1Q17A 1Z5PA 3NT4A 2L17A 3QU4A 3U31A 1TQ2A 2VBFA 3W7AA 1UEXC 3ELDA 3QNUA 1H65A 4RA9A 1C0IA 1R7RA 3ABRB 2GMWA 1A77A 1YC5A 4U7PB 4AAYA 3RHTA 2UYGA 3C24A 5C7IO 4ZJPA 1VQ1A 4NYIR 3LW7A 2F59A 5A05A 3TFWA 4NCJA 4TVOA 5FO1A 2ZJ8A 2JLUA 1OWOA 4CKZA 3SQNA 2P40A 4ZIRA 2ZYSA 1L5YA 2W2QA 2Y6UA 2NU7A 1Y6FA 1QGOA 3IHKA 3TM5A 5D3ZA 5HDQA 1EUDA 3L92A 3UUWA 2DWOA 1Z63A 1EWRA 3EA5A 3R3HA 2V4MA 3PNKA 1BRTA 1JDJA 2C3UA 1ZOIA 2VDPB 3PTZA 4XUGB 1AQJA 4YP6A 3NHMA 3I6QA 4N0DA 4RY2A 2Z2KA 4M2LA 3UMRA 4MUHA 1GG9A 5C8YA 4FHCA 1W35A 3IE2A 3ZY6A 1E0JA 4GDFA 1MABA 1WY5A 1XEAA 2WKSA 2Z8ZA 3BRWA 2IOFA 3PUZA 3QQPA 3U4GA 4YJ2F 3EVTA 3KVOA 4D9JA 2VLIA 4V0MA 2JBAA 3H99A 4RNCA 2Q0SA 4EKEA 1HDYA 1X7WB 1OU0A 3GLGE 2B21A 3D4IA 1YFLA 4ZEVA 3GMIA 2IEDA 3A2LA 2YMLA 4LKRA 4F4DA 5JH7B 1GTMA 1M2HA 1MEEA 1SEVA 1XQYA 4U7TB 2PYIA 3TX6A 1NJSA 1Q3HA 2BEWB 4L9SA 4RXUA 1GGFA 3T7TA 1Z08A 1GLVA 2J5RA 2XUFA 1W34A 4AWXA 2AI2A 4Z7OB 8ATCA 4KFUA 5AVXA 3OT5A 3DDZX 4MEAA 2BSXA 3H1AA 1X77A 5EWJA 1ABBA 5E7IA 4YACA 3IV6A 1JHQA 1JEEA 5F4BA 2NPFA 2PMDA 3UV3A 2BBSA 1CY7A 2P2CA 4CKCB 2OAQ1 1BYIA 2XNDD 2ZSUA 4CDRA 4H7HA 4HDNA 4D80A 4ZMSA 5JADA 4DY4A 2EKLA 2EP8A 1PJTA 3H86A 1QIGA 1D7AA 4NXNB 3RJ5A 1DIBA 1IDOA 3CKMA 4EI8A 5I9TA 4MICA 3I6YA 5TVKA 1USKA 4E2XA 1PV4A 2FF5A 3HJRA 2GK4A 3PENA 2D7CA 4YPOA 4J49A 1HSOA 1WV0A 2O7NA 3HBMA 3JQAD 1FP1D 3NOOA 5A5DA 4YCLA 3D2BA 3EF0A 2BSAA 4FZ3A 1CJTC 3K8ZA 3QY9A 2X23A 2CE2X 3ZZ1A 1RBYA 3CQ9A 1TIKA 1E2GA 4U3JA 2QRLA 1ZJ5A 1OZAA 3AF4A 3DPIA 2GVNA 3NONA 4NEGA 5AJXA 1XPOA 3NBZC 3QVGA 3KFXA 1TEVA 2JKVA 3AVPA 1M2OA 3T3PB 4DY6A 3EDCA 5JPIA 4I5EA 2HJVA 4KH0A 1YDMA 4C4RA 3RK4A 2UZ1B 1VGVA 2QM7A 2QI9F 1DJNA 2XVXA 3D7MA 4MVXA 3REQB 3BG5A 3P8ZA 1NMZA 3PUHA 1UK9A 2XKBA 3PWTA 3Q6IA 5FUXA 3ZY2A 3PQ7A 4B35A 4UCFA 1OB2A 1Z2DA 2VJDA 2ROQA 3PQDA 3DFUA 3F5QA 3G7NA 1QTQA 5THQA 4F2GA 1QUFA 1Z6TA 2OZEA 2I66A 2GCIA 4UE3S 4AN4A 2LE0A 4NAVA 4RWEA 5ENZA 3TAHA 4Y1RA 4IIGA 4LXQA 1LPOA 1E5TA 4D6PA 3FM9A 4ZT2A 4HGQA 1ODCA 1R6UA 3BD7A 1CVIA 3KQSA 4IICA 2Z5VA 4OQPA 4MQEA 3ZC3A 2EJBA 1TC1A 1NASA 3T3GA 1KMCA 1R27A 4EJMA 4WT7A 3JRWA 3OJ0A 4ARAA 1V45E 1SXJC 1ZI8A 2RAFA 1MC8A 3MCAA 4WFKA 3VPFA 4DARA 5LD2B 1YZUA 2BDUA 3NWOA 5BSTA 3H2BA 3A1DA 3LYAA 4Y2PA 2P6UA 2FZKA 1RFLA 1A72A 4Q3DA 1JZSA 2B30A 5LZ8A 2HHCA 2P2YA 3FNRA 5HDBB 4B33A 4KGZA 5BWMA 2CL7X 3U7QB 1K5HA 2VXBA 4XFKA 1JR3D 4YBZA 4EJ0A 2IY7A 2JC3A 2XBLA 3MUFA 3CH4B 4JCOA 4MV9A 4U2DA 4AROA 4EW1A 1FU4A 1KXJA 1KVRA 4J0IA 5L4NA 3OIWA 5DH9A 1JHXA 5FYQA 1QQ6A 1XXLA 3RKSA 3LWBA 5JPDA 2HK9A 2UYCA 3V2IA 3DF7A 1V48A 2OHFA 2NYAA 2A58A 4NOLA 4OA8A 4X6XA 1G6OA 5DF1A 5BN5A 1GGEA 1UAYA 4ME6A 1SB9A 5DHAA 3W9YA 4V1CI 3PUVA 1YS2X 3TSYA 4A6DA 5DI3B 4B5LA 3IA7A 1NVVR 3VOBA 2QNIA 1T3TA 5G4KB 2JRLA 3ED5A 5KMGB 3ZJVA 1BCSB 2G1JA 1FZQA 2NW6A 1C0KA 3HDQA 4HSEA 1SQSA 4IGFA 3ZWNA 5JQGF 1DEAA 1F8GA 3DVQX 3GG2A 3L1KA 3CRQA 1PEKE 3LV8A 4WL0A 5EEGA 5GOZA 3FB4A 1YT5A 1OXSC 2OSBA 3T1QA 1K2VN 2O07A 4EWLA 4X20A 1AVTA 3QVMA 2QV7A 4R83A 3WAGA 4G67A 5JALA 2OZKA 5C1IA 3VZRA 2E6UX 1UBGA 1KEWA 1EGQA 2K6GA 2ZSIA 3PI7A 4RA9B 2R0QC 3L9XA 4E5SA 4J9VA 4JQCA 2IZZA 1IE3A 4AF8A 6YASA 5LWQA 3FB1A 4FC7A 4Y7CA 1ILEA 1F9EA 4HZGA 5JUWA 2D5CA 3JQ7A 1ZVMA 2ZIUB 5SZJA 4M8IA 4ZIRB 4HN9A 3DBHA 2DPGA 2NU7B 2PRJA 3H9BA 4F3YA 2JEYA 4BNIA 4A4DA 2W6CX 1EUDB 1YB5A 1YR1A 1KAEA 3JAWB 2JAWA 3LBAA 4RU1A 1Z38A 4YHHB 2HJRA 3G2LA 2ORYA 4NCBA 4KREA 4C0WA 4Z4FA 1QZTA 5MDHA 1RWPA 4GOOD 4IDFA 4OBWA 4BNTA 5C8YB 2RH8A 4M0LA 3PNPA 3SIWA 3UJCA 1MABB 1BJTA 3ZZNA 2L69A 1PJAA 1C4XA 4HGRA 3N8NA 4JOCA 1XEXA 2JBAB 3E6AA 3D8TA 1XHLA 3I1FA 3MLBA 4FE7A 2JG3A 1BDMA 4BVHA 4FCWA 2YJGA 1EEXB 4GKKB 2JI8A 4RTLA 3SJAA 3JD0A 4GBGA 1BHO1 4HH4A 3OLCX 1ZQ1A 4Z0PA 2X4LA 3RU3A 4YCAA 3D2LA 2ZM6B 3RUIA 4ZI5A 1GZ3A 3JR7A 2P9TA 1E1DA 1I3CA 5JMPA 4B2PA 4HB0A 3BL8A 3FTDA 2XMRA 3MPOA 4F9TA 2QSZA 1RHJA 3MINA 4KODA 3I01M 1KNXA 4HH1A 5DHPA 3K09C 2X8LA 4HAZA 3OEHD 4JLKA 5B3JA 3WFIA 4O4JA 2BZ1A 3FH0A 2Z9BA 4G8JA 5EWJB 3TOXA 2GO1A 1ECFA 3NHAA 3LQKA 5KOIA 3T5DA 2P8JA 1DMSA 5JQWA 3P52A 3LZDA 2I3AA 2JJ2A 2JPDA 4LHSA 3WGTA 3M6XA 2QBYA 3NHPA 4HDNB 2OO3A 1Q1BA 2DLCX 1N6HA 2NSDA 1JB9A 3NEYA 1PZXA 4DIDA 4GNKA 3ELWA 5ALHA 5EQTA 1TUIA 1A2OA 2QAIA 3ZV3A 2VUUA 3AW8A 5FLYA 4P34A 5H3LA 1OUMA 3PNQA 3C5VA 4OFWA 2BEUA 4BFZA 3FROA 1BCRA 5BUQA 2RHRA 5EJ5A 4WK2B 1YVEI 2VDKB 3RLFA 2QHXA 5DX0A 1IEVA 3JVUA 4DABA 5AOVA 1EUQA 1RC0A 2B82A 3ITDA 1FPQA 3KLNA 2DBVO 3DE0X 4IW3B 5FKJA 3UICA 5JBNA 3HJAA 2YZ2A 3CUTA 3KJIA 1QONA 3QVGB 5FUBA 3SEQA 4FI3F 1AV6A 2GDJA 3FHOA 1M2OB 3RIEA 4F91B 1GU7A 5CVTA 1YR9A 4KACA 4Z5XA 2HQRA 2NTNA 1I94B 2F43A 4RSMA 2F3TA 3TWOA 1VIDA 3VVCA 5ALSA 1JILA 1ENYA 3QHQA 4GBED 4KDCA 5L3RA 3RHZA 4CLRB 5KWVA 4QYXA 3BS4A 3EVEA 4FGJA 1YCGA 3U3MA 3Q2IA 5IDWA 3KRTA 1JQEA 3IUNA 4FW9A 4OHPA 4IJ5A 1UBEA 3EODA 1E7YA 2HLHA 4FFMA 2O0MA 3VHQA 1UBNA 4DANA 4DZZA 1CHDA 4OL9A 1NUQA 4MEJA 4ZC1A 4Y1RB 2X0EA 4ERNA 3SSNA 4X64B 3UHAA 1R1DA 3TIIA 2V8BA 2B5VA 3H9CA 5JZSA 1X92A 1DBQA 4MQEB 2CB9A 2MT9A 2OD9A 4CIBA 4POAA 1UH5A 1LK0A 3KEOA 1VJCA 5LP6A 1B41A 2PPLA 3EG9B 1UOOA 4RHUA 4MUAA 4R7TA 4RMHA 1P91A 2YMPA 5DHFA 3SQLA 1WZNA 1RHQA 2NO5A 3NRBA 1ZKDA 4CR8A 3IDQA 1VJ5A 1ONOA 3MJVA 1DZ3A 2I7VA 4YAFA 2EYUA 3WHLA 2QXYA 4G24A 1RYZA 1VLVA 4C43A 1FMJA 5DCYA 1N8KA 3P9SA 3JWIA 4K1LA 2AN1A 2PYZA 5UKDA 1NW4A 1HTTA 3QHAA 4KAFA 3I9LA 3OQPA 4Y0NA 2HF8A 2QTRA 3H5OA 3I12A 5CIQA 5ES4B 2VTBA 4OB7A 3A27A 4Y3UA 1PL8A 3TW8A 1OH6A 2OHOA 3BXFA 2D54A 4OJKA 2CDRA 3PC2A 3UAGA 3FPGA 2H54A 4GWKA 4ND8A 1IVNA 3RG8A 5BN5B 3ZQUA 2OBNA 1KEEA 4LJLA 4OHXA 4G23A 2ZG6A 4ZDWA 3EPPA 5A4DA 3G17A 3UKOA 4L07A 2RGGA 3KJXA 4L75A 4M1OA 4KSBA 3RNOA 4TMFA 4LSZA 4U5QA 3WADA 3CNBA 1L1FA 1SU7A 1I4OA 3AI3A 4W9RA 1D2HA 1ZAKA 5IN4A 3NFYA 3QX3A 3A9VA 1RJFA 2G5PA 2NXWA 2P0YA 3UANA 3O8DA 2I4NA 5ICGA 4QUHA 1VE1A 5EHZA 3PDUA 5J1SB 2AFRA 3OF5A 1PQWA 2XXJA 4BTEA 4DSAA 2CVHA 1E7SA 2P41A 5C8DA 4PZYA 1NW3A 1W4BA 4A15A 2DECA 3LK6A 2A92A 3ESBA 3I1JA 4CU2A 4BNYA 1OLUA 1RM3A 1MAWA 3V7NA 3IIKA 4KR3A 4B7CA 5U1PA 4D0GA 1LC3A 1ZN9A 4YRBA 4Q16A 4YUVA 3R3VA 3IVGA 4RV5A 3JQ7B 5JXGA 3I2GA 4Q47A 4QDKA 2OLKA 3OPMA 2J3MA 5CFNA 3I3OA 1M72A 3DBHB 5HUHA 1FIUA 2VAMA 1NQAO 1N2SA 3I62A 3VU3A 4RE5A 4P58A 2QRNA 1RJEA 5JV5A 3GZ4A 1P0MA 3SQMA 2AG1A 4B3FX 3PR2B 3IPRA 1N0IA 2I6FA 3OZIA 4DAOA 3SQWA 3KKZA 1Q92A 3GEDA 3NIDB 3PJGA 3FVQA 1S3SA 3PU6A 2E4AA 2YFHA 3OZRA 1GZHB 1M2WA 4HD8A 5H68A 1Y34E 1MAVA 2Q3HA 3ZHOA 4RHCA 1XEXB 4JLOA 1WXQA 3FOZA 2IOFK 2NU9A 1ULHA 1O95A 1VJTA 2EOAA 3M34A 3O03A 4JLJA 5KCMA 5JR3A 4LJYA 1YOVA 1SU6A 3BXEA 5ESWA 2XNKA 5GGXA 1NRIA 1VCIA 3PF9A 1RXYA 3PPWA 4MDYA 4HNTA 4XB1A 3FUVA 4Z8YA 1L5WA 3D8BA 1VKOA 3K94A 4YRSA 4HLUC 2IYPA 2WVAA 2YBEA 1XRRA 3S7ZA 3VH4A 4MVJF 5FWNA 3MINB 3ORHA 1G3QA 3TH5A 1A1SA 1QB7A 3TUJC 1K66A 3MUNA 3QFCA 4EHIA 4O4JB 4PSUA 4ZMBA 2YKGA 2V7XA 2OC9A 3ELYA 2DKOA 3ENZA 4LDJA 1C3XA 1BWPA 1W29A 3G88A 3MVEA 4TYNA 1TPZA 1OH8A 1T5LA 1VLQA 2JFZA 3WHPA 3ZCQA 3MMPA 4S2EA 3H8WA 3TQQA 2DPLA 2QBYB 4ZT4A 4DR6B 1W4CA 3OPNA 2YVLA 5C3UA 4R8KA 1P5FA 1T9KA 5KWJA 2D1SA 2WU4A 3KYBA 4JVSB 4RF5A 4P54A 5KYXA 5JXHA 4OMUA 1W2GA 2R6HA 4GXRA 2VHYA 4Z4EA 3W6UA 3LF1A 2IXDA 3EXFB 3E05A 4HXYA 2BEUB 3G2QA 5JRZA 1GPBA 3GEMA 2B83A 1NOIA 1E7MA 4AMYA 3DP7A 3QBVA 4R71A 1L3BA 1P81A 1RI4A 4LJ4A 2YNMA 5LR6A 3OM1A 3CF4G 3JR3A 1Q12A 2XCUA 5AICA 1GIAA 5DYIA 5EJ2A 3KOZA 3PGKA 2R5FA 2WQ7A 2WSLA 1P3Y1 2C7OA 4YMUA 5FT9A 4U39A 1AHNA 2X6QA 5IK2D 3UMFA 3TLAA 4BMOB 3IP9A 3B6JA 2EJVA 5A5EA 4AURA 5IHPA 2BH2A 1GGKA 1Z5GA 2J45A 2Z56A 5DSZA 2F43B 1E9DA 1U0EA 2N1BA 1MC5A 2I9KA 1Z0KA 1H2XA 1OX4B 4E7OA 3SN6A 3K8OE 2OO7A 1LD3A 1AJEA 1WMEA 3AEZA 2ZJFA 2QR2A 2Q45A 3QKTA 2JH3A 3FR7A 3TNLA 4G0QA 4W5WA 4BVJA 1T0JB 2G7MC 2MR5A 1RXVA 3WBBA 1GQQA 4TKVA 1QFYA 3NB0A 3GRAA 3PQ6A 4IJ6A 1MTOA 3KZNA 1E9CA 2WT9A 1MOQA 2HBZA 1P5RA 2GPYA 3ZVLA 5E7JA 2CYAA 2RHLA 4E5MA 1WKVA 2D2FA 2FH5B 3T7CA 3GPBA 1EG2A 3HA3A 3SD7A 5KNDA 2CKDA 3ZJ5A 1UCFA 2QE7D 4WXPA 5LP6B 3RS7A 3QX8A 2FXVA 3EUWA 2A1UA 3GT7A 5DBHX 1Y8ZA 5HUJA 1I3NA 5JD6A 2D1FA 4NG4A 3GLRA 2PUCA 2DQSA 2CLKB 4N8DA 3ZGXA 3R41A 4REMA 4XFJA 1AU9A 1P1RA 4X1YA 4BLUA 1XNQB 1U7WA 3DFFA 4LVNA 4YRLA 1XF9A 4RD6A 5HR5A 3D2AA 5AM5A 3G7UA 1T5IA 1CJBA 2P30A 3AM5A 3JATA 4RAQA 4ZO7A 3QG1A 3V3KA 3KWFA 2QX9A 1SBZA 5CNJA 1CK4A 3CW2A 1MR3F 3H04A 3EK2A 1ZIDA 4B4VA 5BN4B 2PL9A 5CLFA 2VTBB 1P18A 4JGGA 3ND6A 5DNUA 3FZGA 3GEIA 4IQFA 4ABYA 3RC7A 1GOTA 2C88A 3H0EA 1KEEB 3O92A 3T3MB 3MK31 4ZT5A 1OZGA 5TMBA 2C1EA 1CFJA 1PFYA 2PEYA 3W06A 3IJPA 1GPJA 1JHDA 1KR5A 1X7XA 3AL2A 4G5FA 1YKSA 3PLAE 4BMZA 1GR1A 2WFMA 5FEMA 5JEDA 2Y99A 3TSZA 4HS4A 1YO6A 2CHFA 2FWAA 5LB4A 3FDJA 4TTVA 4EYQA 5CIYA 3I5YA 1VSUA 3PQFA 4H0CA 2PLAA 3ETLA 2PZAA 2HU8A 3FKSA 4Z86A 4BBJA 4MYSA 4BOYA 3CF4A 2I1QA 2XYHA 3P9PA 2IH4A 2Z2YA 3EF1A 4G63A 1UOPA 4XARA 3AM1A 1D6MA 2XF2A 4QUIA 1I4EB 1KKLA 1GL6A 1OLUB 3D7KA 4MB2A 4O4IF 2GNPA 3E03A 4UM9B 3C98A 4J0EA 1Q1AA 1G7TA 4FZRA 5GZ6A 2EWVA 3WSVA 1FRNA 5FL3A 4CV2A 1Y3FE 2VNAA 4QPDA 4JB3A 4XX0A 4HR7A 5ALMA 4R54A 4WBXC 1OTHA 1I8TA 2JGAA 3FFXA 4FD3A 5KX5A 4ZYUA 3ZHYA 3OOSA 1YBHA 4LVUA 3U44A 3D6UA 4WZBA 5IBCA 2LVBA 1D04A 2XUZA 1NXXA 2UZAA 1SKBA 3MWYW 1ZIYA 2O23A 3EZ9A 4G0PA 3UUEA 2P1DA 3DVSX 5K0ZA 3PEFA 3AIIA 2NO6A 2QQGA 4XTCS 4UBMA 3HC7A 2UXBB 2J1LA 4PC6A 4G5QA 1S8FA 1WUHS 1YR8A 4ZOLF 4JJ4A 2HRRA 3AR6A 2NU6A 2J0VA 3LBYA 1H2ZA 4O59O 2GM3A 4L0DA 5JXIA 3EFEA 4QL3A 3NKVA 1ZD5A 3HFSA 1LVGA 3L0YA 1LNQA 1QZZA 4Y2GA 1L5HA 1UJ5A 4AJNA 2GF9A 1YOVB 1KPGA 4H35A 3L6UA 3TINA 1MH1A 4NTZA 2PUTA 4MV6A 2IYVA 5AJZA 1EVQA 3U4DA 1NUPA 1EJ0A 3IVMA 1B0AA 3BZWA 2Y6VA 5DE3A 3OA0A 1M9NA 2HK7A 3JVDA 3WBKA 3IL2A 2YVUA 4JWKA 4UCQA 5HKBA 1P0QA 2I2BA 3BKWA 1PS8A 1JDPA 3BIWA 3ENVA 1JHVA 1OWNA 2W8ZA 3J7AC 5IULC 1YR7A 5DT2A 1PFGA 3SBEA 1HC7A 2VA8A 4ZEWA 4I9NA 5IVIA 3ZWAA 3BB3A 1FUUA 3OMWA 3NDIA 2C31A 1H3NA 1KY2A 3PLRA 3V80A 5B4UA 4AFNA 3DZKA 2VJYA 1GT6A 1RBMA 4KSCA 4PZ0A 3I8SA 1AA9A 1EJBA 1NOKA 3OX1A 1ISMA 1JVBA 2QL9A 1KEUA 2AFVA 1Q14A 2G63A 2QPLA 3CNOA 4N7BA 4R1PA 4KR9A 1COWA 1PFWA 5DGXA 4MKFA 2ZBRA 4JJEA 3GXBA 4ZHQA 1A8SA 5KYXB 2IW3A 1E89A 3CNNA 3QKRA 1JQ3A 2QSJA 4PZ9A 2J31A 3L0CA 3LLSA 3NWBA 3F5SA 2IP2A 2FEKA 3A3PA 3BWVA 4L2IA 4WNAA 2Y1OA 2VDOB 3E53A 4S1PA 4I1YA 2QLFA 1BE8A 3UOWA 3O8OA 3GRKA 1JB1A 2B5WA 2DYKA 3NI2A 1A8IA 3OQHA 3NTQA 3MLEA 2EW2A 1QH9A 1K6JA 3U7RA 2PXCA 4I55F 3IQGX 1YTUA 2NO4A 3DE6X 4UMEA 4YREA 3UB2A 3PX3A 4DDTA 1BDHA 3M2TA 4WIAA 1HLPA 1L6IA 3SG0A 4ADSG 1FW6A 1T1RA 1O6ZA 3GVPA 3WDSA 4EABA 5IP5A 1QUEA 2PWPA 3REGA 2EXXA 3OZFA 2H11A 1T6YA 5FTKA 2JHCA 1XL0A 4A2CA 2JIQA 4RDXA 2CDCA 2DHDA 1VGQA 2JLSA 2WPDA 4YRQA 2GS9A 4HEJA 3AI7A 5EMNA 2OFXA 4F2DA 1UK7A 4WW0A 3AXSA 2XGJA 4O08A 4PPYA 1UQTA 3PD1A 4PC1A 6AT1A 3MJRA 3LT2A 4NOKA 4KXWA 4ND3A 1AUXA 3TTUA 4DV2B 3R8FA 1RZ3A 3KUDA 1C9EA 1N0WA 3ILYA 3NAQA 4FDUA 5JE8A 3OCJA 1H2BA 4HDMA 1EDZA 3GNSA 2P9QA 2MINA 2RBGA 1SPBS 4MUNA 4TKVB 3R6GA 4TTSA 4EA6A 3LNTA 1MEJA 3BSWA 4OK5A 1LPMA 3NBKA 4MWGA 5SV2A 1EFCA 4TTIA 6NULA 5ECYA 4LNAA 1S3FA 2NYVA 3TN7A 2GA8A 5KWSA 4CNQA 1E3WA 1Z68A 3VM6A 3FPFA 4K87A 1B15A 1A69A 4HAVA 2WAAA 2WM9B 3GV0A 4JT4A 1Y3BE 5CGZA 4DYVA 3RYCB 2IX3A 2IYNA 4OXNA 5JRDS 5E6SA 2R8OA 2A0KA 1OVGA 1VE5A 3AUFA 1ZIPA 5IYZF 3W79A 1B8PA 5J4YA 2YHAA 2QLTA 4YT8A 4DGSA 1I2BA 2BM1A 4TT8A 1YUBA 1TI7A 5H4HA 5THKA 1KDTA 5LM3A 2NZUG 3DCNA 3P2MA 1VCHA 1STOA 4AZWA 5IC4A 3EOAI 3X1DA 4KIWA 1QIMA 4W5JA 1NG9A 3ELUA 3IBCA 3FWNA 4WZZA 2ID9A 3ZDXB 3C7AA 2GN2A 1ZGBA 4Z2YA 3DZGA 1A98A 2BM0A 1FFAA 1I2MA 2OV2A 2HWYA 1R5NA 4CMKA 1V35A 2CXQA 3EASA 5HKKA 4TYYA 4HDKA 4UNQA 3KQNA 3QXHA 4NICA 2EWWA 4ITRC 2ZUVA 2FPGA 1AH2A 3N2LA 1S2DA 5EJ8A 1Z25A 2XUQA 3E7DA 4CI0B