2HNBA

Solution structure of a bacterial holo-flavodoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mioC
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 42
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnbA00
3W78A 3N3AC 1GG5A 3TEMA 3S2YA 5TGZA 3NHYA 1FVXA 1D04A 4QODA 1AKWA 1J9ZA 2R97A 1C7FA 2QX4A 1OBVA 2X2PA 5LJLA 3UXHA 3GAMA 2Z98A 1CZNA 4YAWA 1XYVA 4FX2A 1QHEA 3FX2A 1J8QA 1FTGA 1RCFA 4YQEA 2MTBA 1H66A 5F4BA 1D4AA 1CZKA 4GQIA 2XOEA 3P0RA 4DY4A 4HS4A 3L9WA 4GR9A 2MWMA 2Z9CA 4R81A 3GFRA 4Y9UA 2OHHA 1RTTA 1E5DA 5LBTA 4D02A 5EA2A 1FUEA 1F4PA 5NULA 1SQSA 1YOBA 3NFRA 2V5VA 5ULLA 1YCHA 1H69A 3NHUA 5LBUA 1AKUA 3N39C 4HEQA 4LA4A 1J9GA 3W79A 1FLDA 3L9XA 4YALA 3QFCA 3ESXA 1C7EA 2M6SA 2HNBA 4J8PA 3FVWA 3KAQA 3SVLA 2BZSA 4QOEA 4C76A 3KLBA 4NULA 3OX2A 1JA0A 3U7RA 1OBOA 2Z9BA 1AKTA 4QOIA 3JSXA 3RPEA 3F6SA 1RLIA 3HR4A 3F2VA 5FA6A 1AHNA 5A4KA 3TE7A 1DX9A 4ZVNA 4YAUA 3EDOA 4YAOA 4ZVMA 4N9QA 1FLNA 2Q9UA 2Z9DA 5FUQA 2FX2A 1NNI1 2FZ5A 5F12A 1QRDA 1AKRA 3B6MA 4QOGA 4ESEA 4S24A 4BMPB 3LCMA 4YAFA 1J9EA 3ES9A 2XODA 1OFVA 3NHWA 4M0CA 5LMCA 2QWXA 5NLLA 4QOJA 3OJXA 5BUCA 5LJIA 3NHKA 1FLAA 4NLLA 1D03A 3FJOA 2AMJA 3QFRA 2OHIA 2A5LA 1ZWKA 1YRHA 1AMOA 3B6IA 3N3BC 3OWXA 3NLLA 4ZVLA 3OX3A 3NHPA 1TIKA 1FLVA 4C14A 4F8YA 2RG1A 1AG9A 4FGKA 3HLYA 1WSWA 2V5UA 5F51A 1JA1A 3R6WA 1B1CA 3OVMA 4PTYA 3B6JA 4C0WA 5JROA 4ZVKA 1XYYA 2BN4A 1YKGA 2QMYA 2W5UA 4LAFA 4PTZA 2R96A 1CZUA 1CZLA 3NHJA 1YCFA 1CZOA 1ZX1A 2MT9A 2BF4A 4BMOB 1AKVA 2OHJA 4DILA 5LLDA 1QBGA 1I1OA 3GFSA 3EYWA 1AKQA 1T5BA 3F90A 4LTNA 1XI2A 1AZLA 2QX9A 3NHSA 3OJWA 4FGLA 5LVAA 3QE2A 4GI5A 3O2NA 4OXXA 1X77A 2FVXA 2BPOA 1SG0A 1DXQA 2M6RA 2QX8A 2FLVA 1CZRA 3B6KA 2HNAA 5FX2A 2ZKIA 1WSBA 2QMZA 1TLLA 3K1YA 1KBOA 1T0IA 2QR2A 4XDGA 4XDHA 4DIKA 1YDGA 1KBQA 5EAIA 2KQUA 4FGJA 3GFQA 4H2DA 3K20A 3D7NA 3LT5A 3HA2A 4N65A 4C0XA 4Y9RA 3FNIA 4QOFA 1BVYF 4N82A 3TZBA 5EMNA 2FCRA 4ICIA 3NHFA 6NULA 2B3DA 2Q62A 2F1OA 4LTDA 1ZWLA 4U7FA 2WC1A 2QX6A 4LTMA 2FDXA 2D5IA 3W7AA 5B3LA 3F6RA 1YCGA 1FX1A 3W77A 2FAXA 2FZVA 5B3KA 2V9CA 1DXOA 3KEGA 3OWHA 3U7IA 2MOKA 4U7GA 2ARKA 4U7HA 3ESYA 3NHLA 3G5MA 4PU0A 4CETA 2OYSA 3ZHOA 3KAPA 4Y7CA 4CF6A 3FW1A 2FOXA 3OX1A 1VMEA 1V4BA 1RLJA 4QOHA 2BMVA 1CZHA 2X2OA 4H6PA 2KLBA 1QR2A 2N1MA 2GSWA 3ESZA 2HPVA 3NHRA 3O73A 3UXEA 1BU5A 1XT6A
chains in the Genus database with same CATH superfamily
4GZ3A 1CLUA 1KVSA 3Q3CA 1PG2A 3M5DA 1Z7BA 4MQEB 3VC2A 1MT0A 3DYBA 1MO4A 1BE1A 3MXOA 2CNWD 4FT2A 1PU2A 1NI4B 2OCAA 1ZXXA 4R0NA 4B9EA 5JC1A 2P9YA 2QZ4A 1KA9H 1FVXA 4TZ6A 1EVYA 3OT1B 4DJFC 4LF9B 2WYWA 3AZPA 1OX5A 1MLDA 1N0VC 3JD1A 1F9EA 4YRLA 4MKFA 1UBOS 1T0PA 4GBMA 1US8B 1NXXA 5K2OA 4KFTA 1CXZA 1QFSA 1XHLA 5TF4A 1OH7A 4PYRA 2ZSDA 4ZDJA 2FETA 3BHIA 1JLSA 2ZRGA 2J7KA 1FMCA 1KS9A 3E3LA 4I6JA 3TTTA 1W9MA 2ACVA 3L77A 3WNBA 4P3YA 3I4CA 3EZ9A 3TR6A 4RJJA 3PHGA 4FLFA 1QCCA 2H1IA 4JYCA 1JE1A 3I73A 4QRIA 2FJPA 1U8CB 1Z74A 1ESDA 3OCZA 5ALSA 5K51A 5ES3A 1JZSA 3FBWA 2NW6A 4J3NA 3M6WA 4K2AA 3PQ5A 3EZGA 1DO8A 1JLMA 3IB6A 3RS5A 4C0HA 1KY3A 2R85A 1NSTA 4MHOA 3DGFC 1LH0A 1GPLA 2I4TA 4JLJA 2Q0XA 3T15A 2F6RA 2YTZA 1LDEA 1VXOA 3ET4A 3LUCA 4OJQA 3SZ3A 1XMQB 3Q85A 1Y33E 5C1IA 1KQPA 1RI3A 4PFQA 1ADYA 3WSTA 2F8MA 4YY3B 1G8KA 2FHSA 1JJFA 2Z4RA 3C6QA 1F0KA 1GNTA 2RIPA 5TT0A 3GJZA 3LYLA 2Q3HA 2J48A 3TM5A 2RHJA 3SKXA 1J23A 3G9QA 3ZS9A 5JD3A 4QRHA 1YIDA 4EJ6A 1Z5NA 2G1KA 2Y76A 3HM9A 2FVYA 2ZDGA 5JSHA 3L8EA 3MVEA 1JAZA 2EBHX 4L50A 1WCV1 4GAEA 4NJMA 4A6DA 1EFPA 3TZKA 5BSTA 4L0QA 4RLSA 3E1KA 1R0KA 4B76A 1VDZA 3FYTA 3IUSA 4TX1A 4EVQA 1HYGA 1T8UA 5E0KB 3P27A 4FMDB 5TS3A 4QDOA 2Z3VA 2YC2C 2O59A 2ZRIA 4LRSB 3B9BA 2R5WA 3IE0A 4Q1AA 2X0IA 2UU9B 4U2KA 5TMBA 3HKBA 1ECCA 2DQSA 3HDVA 5NULA 4P22A 5H0IA 1SKUA 4X1OA 5FTLA 3DBRA 3IO5A 2DR2A 2EGHA 3LBHA 1UPCA 4FEYA 4UNSA 1EJ0A 2G7ZA 3LW8A 1I7DA 2NNWB 4L4ZA 4CQLB 3I2YX 4DA9A 4XUCA 3V9PA 4LE1A 2NUBA 1XZ8A 3NT4A 3QP9A 2HO4A 2Q1UA 2R65A 4XM1A 4CUJA 3AHEA 1YVEI 2QN2A 4DLZA 4EQZA 2DJ5A 1J9GA 1Q0UA 1ZI6A 2YV3A 4BB5A 3I4FA 4JDPA 3C70A 3RYHB 1Y1PA 3HC7A 5JAQA 1JDUA 3KQQA 3DM5A 4C4YA 4QTTB 1IY8A 1ECLA 3T0FA 2G08A 3GPLA 4QFBA 3M3PA 4LOHA 1WU8A 3X1MA 1ECBA 2WJPA 1MABA 4EMTA 1BVRA 1ZNYA 1R8XA 4P4SA 3FWKA 3I23A 1HGXA 1OX4A 1FNCA 3E8MA 3TLXA 4A0SA 4D9FA 1E2DA 4YMUA 2BFNA 4BNVA 1L5HB 1FC0A 4KNVA 2CT8A 4O4HB 1XDBA 4M8NE 3G13A 5EIBD 2I6UA 4K8RB 2BDEA 4ZYTA 3K0CC 3CINA 4YJGB 3ZHRA 4NI5A 1M10A 1E1KA 3ACBA 1X0XA 1LX7A 2G1JA 1T2EA 4L9WA 2Y1GA 4MI3A 3WP0A 3VR2D 2BMEA 2FEPA 1QIHA 3GELA 3WK5A 1OA1A 1HQDA 2C96A 2J1LA 1NLZA 1OXTA 2WHRA 1GGJA 2HMUA 3W3AA 3KLBA 1W8DA 4NULA 4CR8A 1U8TA 1E79D 2GN1A 3G02A 4G23A 3EASA 1HI9A 4G2NA 4X6UA 1J1UA 3MWLA 2ATIA 4Q7MB 4TV9B 3KPJA 3PL1A 5CDTA 3SS8A 1Y1TA 1MAAA 3IJ5A 4ZA2A 1MOZA 3GLSA 4J03A 4MVJD 3NASA 4D3SA 4DGSA 4NZZA 1JFFA 1ULHA 1UZLA 3VH1A 2WAMA 2JIPA 2ZYUX 3HR4A 4KIWA 1P81A 3DA8A 1K0FA 1MAVA 5TQ2A 2EBUA 4J1TA 4IF6A 3SHTA 1NM5C 4QBTA 3CSDA 4JSYA 2A9VA 2P67A 3PHIA 3HL0A 3LQFA 4BEJA 3I2FA 4RKQA 4CIAA 1ZUIA 4YAOA 3I1FA 3FPFA 2QM0A 2ZITA 2HNKA 2B9VA 2H31A 3GRUA 3TZHA 2JW5A 3FYSA 1L7EA 2A0XA 2X86A 5GAJA 1E5XA 4CF4A 3HRKA 3BK7A 5DXAA 5IARA 4EY3A 4BKQA 2FX2A 2XIQA 4B3GA 2BFAA 3A11A 5EP2A 4ZU1X 2BHLA 3QEBZ 3WMWA 1DG9A 3G5TA 2F4VB 4RVSA 3UUFA 1PK7A 2XGMA 5EJMA 1E2GA 1F20A 1JQ5A 1UBGA 4AP5A 1HORA 2PUFA 1H5QA 1MC5A 1P62B 3BKXA 3P0EA 2C4NA 4CEIB 1OROA 3QJ5A 5CIWA 4BXOB 2YV1A 4HKTA 4HH1A 4XE5A 1QZUA 1MD9A 4YCCA 5FLYA 3R1IA 4UUPA 4YAFA 5F23A 4TN5A 2BTQB 1S8FA 2QG9A 4UNIA 2HLDA 5EJ6A 4YAIA 2WD8A 3ZLVA 1ACLA 3JQAD 4UREA 4AFNA 3L8CA 3UENA 1NNEA 4EEKA 1PV4A 1UKZA 4IIEA 3E3MA 3PDCA 1S8NA 1KEKA 3ZU5A 2IEBA 5I5EA 4TWRA 1V1MA 3L0PA 4TLDA 2PVPA 1JUDA 4DANA 3SS7X 1HFKA 5HUQA 2PM8A 1IHXA 3FTQA 1IBSA 4M1KA 3SG0A 2ZB7A 1CFJA 1XWWA 3JX9A 3NBFA 4PZEA 5C8YB 1E2IA 2Q5EA 4UEQA 1JE0A 2ECPA 2IZZA 3EPPA 2WYOA 3RIYA 3FMIA 3L41A 1ZA2A 2A0KA 1CTQA 1FXUA 1RM5A 1BAPA 1ULSA 2A2ZA 3LFHA 1DJOA 3PGKA 3L18A 4O29A 3FUXA 3U7QA 4YUXA 2Q7DA 1G5PA 1RWNA 2YS7A 3MSXA 2AJTA 3Q12A 3T9BA 3OQVA 4QUEA 1Q7CA 4EGJA 3UJ9A 2I22A 5DULA 5A9RA 1XEFA 4ENSA 2FWPA 2AMJA 3EAGA 3QFRA 2DX7A 4WRRA 4UUOA 4XPIB 4GPIB 2MCFA 1JR2A 2JIQA 2YXLA 1GCIA 5AVWA 3AI1A 3T3MB 3CZRA 4GX5A 1QOZA 4MPJA 4PYQA 3UHFA 2QW8A 3DJYA 3LV8A 1MW8X 4M38A 1CUZA 5F5LA 4A0FA 2PQMA 3EQ9A 3KKMA 1J20A 2VJKA 3OKAA 1DC5A 4CMEA 4BPBA 1J2UA 1Z68A 3AEYA 2YVAA 2C9BA 4MVJE 1X7WA 3PZBA 3V55A 5CX1A 3IYLW 3PFKA 4ER7A 1CVRA 1XJ5A 4YK7A 2XMQA 4G0XA 3NDBB 3TSYA 2HQOA 1L7QA 4IGIA 4YIHA 2ZYSA 4R2MA 4E6EA 5MN5A 2DPXA 3G82C 1BWSA 3KHTA 4WAUA 4B17A 3DULA 4MLCA 4DLSA 2VT7A 5GIPE 3T9EA 5ALXA 2CL7X 3GLRA 4Y1FA 2EAUA 5JARA 4CIVA 5BV2P 2XXAA 1KERA 3BHJA 4X0EA 5FNVA 4XWOA 4OLJA 4EIWA 1JH9A 2GK4A 1U63A 1TD9A 3BOSA 1ZVMA 3BA1A 3OVMA 4BVEA 4J07A 3HWSA 1V5EA 1DQRA 1K5PA 3P9CA 1OLUA 2VAWA 3DQPA 5EIBC 1GTJ1 1S96A 4H4CA 1E2QA 4MVJG 4ZN6A 4WY5A 3THXA 4RX1A 2HDHA 4TN1A 2VYVA 4FSXA 3HCFA 1CRPA 1T91A 3K4PA 1T1SA 3TIXB 4YRIA 4V1CA 1MFPA 4UTRA 3UK6A 4D4MA 4B5KA 1RE1A 2CHQA 2IQ5A 3IP5A 5JLAA 3RYCB 4KLRA 4FQ5A 4C0JA 4AZWA 2W70A 1HETA 1DWQA 1D09A 2RFLA 2VDVE 1Q0ZA 3FLBA 3IUYA 3L8DA 1V48A 2BBOA 1SVMA 4ZV9A 4AF8A 3W2IA 2QL5A 2FFHA 3F7TA 5LLDA 3M9LA 3DHEA 2RJNA 3OFSA 1Z25A 3DL0A 4JGBA 5LQCA 2IXGA 2IXEA 1PK8A 1XTIA 3O83A 1N2ZA 3T1NA 1AZWA 1Z0KA 5DP1A 1KEEA 3B7GA 2B4RO 4I9NA 1U0FA 2X5KO 4HH3C 4LSMA 4PLHA 4PZAA 1VCOA 1SU7A 2C8LA 2EQAA 4YRCA 1U7OA 3L4JA 1R0LA 1FQKA 1LVGA 1NYLA 3A0RB 4NENA 3ENVA 1NMXA 2BBTA 4Z0NA 3KYCB 2I3ZA 2H1RA 1H9BA 1XQ6A 2VHQA 3BRCA 2ZZKA 3LYUA 2HEGA 2H1VA 2I4RA 2JGDA 2ZVDA 1GD1O 3E18A 3KXPA 4HX5A 1BN6A 3V7FA 2VDWB 3GPDG 4TKUA 1KI4A 4HRXA 3BB4A 4I50B 4PS1A 5FUXA 1NR5A 1PP4A 1Z29A 5FNVF 1T3LA 2VEDA 4IDPA 1L5SA 1XN1A 3RBVA 2V7VA 4PRLA 1NFRA 2A7XA 4Z0TA 3MJDA 3UWDA 3K1YA 3WWDA 4ZCQA 2PNJA 4A16A 3DPUA 1M8FA 3HH8A 4PR3A 5FOVA 1CQPA 1WD7A 3PQ2A 4U1RA 5KQMA 2AKYA 1FVFA 4CDGA 4M0FA 4PZLA 4Q3DA 5JXWA 2JDID 2ZJBA 4GM0A 1EESA 3ZXXA 1F9AA 2EHDA 1Q14A 2CXXA 3WMRA 3ZHVA 4CKCA 2J0SA 3K6RA 4MGEA 3NIBA 4HL6A 2O2XA 4P1ZA 3MTDA 1R0RE 2Q5HA 3R5XA 1JVBA 5H5JA 5BVHB 1EFRA 2NO1A 4X61A 4OQEA 4TMFA 3U0VA 2VWPA 3I01M 2QDKA 3T7RA 3B8HA 3KSMA 1JEDA 3EXFB 3G0DA 1AM4D 1I5OA 3ZHZA 5HIAA 5I9NA 5B1DA 4KODA 5A2GA 2E49A 4JVMA 3DOOA 4EUKA 3HCWA 4JK3A 4R1TA 5DYYA 5EL0A 2LRHA 4IRUB 4CM8B 1W2HA 4IRXA 2YBEA 5H3HA 1DEOA 2BDTA 4FHFA 5JAUA 1XG5A 3I09A 3CURA 3ZNNA 4CZ2A 3B6ZA 4L76A 2CNOA 1Z0JA 3ZDYB 1LUAA 1QFXA 2G9VA 3IBCA 5JCXA 2DTDA 3S2EA 1WLSA 2JA2A 4OMCA 1A9OA 1QK5A 2YWCA 3AI3A 1Y8RA 5JS6A 5CLQA 4OCZA 2AHRA 1G8FA 4KN5A 5AXBA 3GVHA 4WL0A 4NU5A 2XMCA 1NBMA 1CUYA 3QU2A 4QYXA 4V3CA 3MCTA 3MYRA 4DG9A 5KSZA 1U6JA 3E0QA 1JDSA 3NBKA 3ZWAA 3IAM1 5FT9A 1OHHD 4OU4A 4CI0B 1JMVA 2R8BA 3WYAA 2I7VA 2IX9A 1KI6A 2VBGA 2CFSA 3ONWA 4INAA 2VPIA 4OQLA 3HYTA 5A3RA 4HWGA 4C0SA 1U0HC 4TT8A 2JBAA 3QFTA 5EZQA 3C6BA 1JF8A 3N8NA 1T4CA 1KVRA 3OQBA 4XI9A 1G5IA 5GM1A 2C94A 4G5XA 2XVXA 5I9SA 3UYKA 2DEUA 4HPJB 4B6OA 4G0QA 1XJWA 4ZQFA 3CA8A 1TW2A 2XKJE 3BILA 3EWIA 4NPHA 1WCIB 2B0JA 2RGXA 3GG2A 3P9XA 4YRPA 5KWVA 4ZI7A 4UNPA 2ZXFA 3GEPA 3C3KA 2JKVA 4XFKA 1UK8A 4KE7A 1U7PA 1IZ8A 4B4UA 1UXGA 3O1JC 3RRYA 3FI0A 2VAVA 5ALHA 4B4VA 1KRHA 1O5IA 1BVHA 2C0QA 1IPFA 4BO5A 5IXJA 3D3WB 4GOMD 1F2TA 4CV3A 1M2WA 5ADUS 2PR2A 4UBJA 1YD7A 2LCIA 1JFSA 5A0TA 4U6SA 1JTFA 2Z04A 4K46A 5GPBA 3W77A 3WYCA 2GPYA 1ZONA 2J8ZA 4JGIA 3WP1B 3OETA 4FUTA 4FYVA 4KZPA 4UZFA 2CXHA 3X1JA 2I87A 4BVAA 3WQSB 1N2JA 1CDOA 2W6PA 2GFIA 3GN1A 2IOYA 2WIFA 1KDRA 1IUPA 3NI2A 4DAOA 2IP2A 3LT4A 1TRKA 1BD4A 1AOXA 2J3MA 3MG9A 5DMXA 4G67A 4QD3A 1CUBA 1TO6A 2ARKA 2W6ID 1YQWA 1C1HA 4PG8A 2ZXEA 2FQXA 1TQ2A 1XZHA 4GSKA 4YRSA 5JNWA 1T8SA 4GKBA 4QFMA 1EGAA 1OW3B 2A7QA 2FN9A 5JI3E 2ET6A 4COOA 2GETA 1DTEA 2E4UA 4X62B 1KFEB 2P2DA 1K6IA 1VIDA 4OQFA 3AJ8A 1KORA 1NW9B 2O14A 5GJCA 2NU8A 2ECFA 2D6FA 1YS6A 1A88A 1VIVA 1A04A 3OOWA 1TZJA 4L0MA 3AF1A 3TL2A 4F7WA 2I03A 3JASA 3QXCA 2GN8A 4ZI7F 5DBHX 1Y34E 2IPLA 4CPDA 5CW2A 2QYHA 5J63A 4ARAA 2ZUTA 5FI5A 3DC7A 3HN2A 3U37A 3LS2A 3ZG6A 4EQ6B 2BMWA 1QC5B 3MWYW 2HJ9A 3EEIA 1GKLA 1QK3A 1I4TD 2NLOA 2QN9A 3F9RA 4UU8A 1Z6GA 2GBLC 4I3FA 1YOVB 1S7GA 2BUAA 2HSDA 2P2YA 3BXHA 3JVEA 4GWLA 2GKGA 4QTUB 5J9FA 3W6PA 4RDCA 2COKA 4UVIA 2ANBA 3WGKA 4WEOA 4AJLA 3D7RA 4J3JA 4OI4A 1DRUA 1Z6AA 4LY3A 4JXKA 3FSGA 1J4AA 2V9ZA 1YQGA 1CD5A 3AKDA 4JSTA 3MF4A 1GPH1 4QGSA 4FC6A 1NQ5A 2A9QA 4UQOA 3G0GA 4MQLA 1IE3A 3PT9A 5JVDA 4FFRA 1QP8A 3BC1A 4JI1B 3STXA 1UR5A 4C78A 2JLWA 1M6VA 1EBUA 2YJNA 3A9SA 3IQXA 3NHYA 3FDIA 2NTYC 4KFSA 4UD2A 1YXMA 3ICVA 1AS0A 4RXTA 4RZUA 3ZK8A 1HRDA 2AZMA 3ROZA 1FW8A 3RVPA 4ALMA 1S2OA 3N2KB 4DCGA 1C7FA 2XE6A 2VJYA 4QEKA 4QQKA 3M1IA 3OE1A 5EI5A 5LXTB 5TS2A 1Q1QA 3S68A 1LPNA 4FX2A 3KJQA 5GZ6A 3IC5A 4MW6A 4IS2A 3C4JA 1D07A 3K70D 1L7NA 5ECDA 3LK7A 3AEUA 5U4XA 2W6OA 4KRYA 1Y48E 3UMGA 4FVTA 1E94E 4KLCA 1WMFA 2FKAA 4RHFA 4RVOA 2ON6A 4LYFA 4YQEA 3RTCA 4BWYA 2G88A 1C1DA 4N0PA 3HZRA 3WYFA 3MTBA 4UJ3A 1GQRA 2ZU0C 4EA9A 1DWOA 3AETA 3R3VA 1TYDE 3GLHA 4CCYB 3K6SB 1QP0A 4CV2A 5FQOA 2RCYA 3CSSA 3IO3A 4R2KA 3HXTA 4YP5A 4A0QA 1MAWA 4QVIA 1XU9A 2IIPA 5EN4A 1ISFA 3FHCB 1XZAA 1TGYA 4B4OA 1EVIA 3DO8A 4D4IA 1ZJZA 4GSLA 4N7BA 3ZBTA 1FP4B 3GVIA 3FPBA 1VE9A 5ALIA 4E11A 2OLKA 3AFNA 5CGZA 4M87A 1PDVA 3PXUA 3N0RA 2IPMA 2IF0A 1IJKA 4NZNA 5JVDF 2ZWPA 4RH1A 2VC2B 5DCUA 4DPKA 1U7WA 2XWSA 3MW8A 1AX9A 3L93A 5G02A 3VKWA 3FNBA 1I51A 2J6IA 3D8SA 2FPIA 2GRUA 4OHZA 3G2JA 3QMWA 1DU4A 5LYYA 3VSBA 1U0GA 2WMOB 4CU5A 4R40A 4CKZA 2P9CA 3PNLA 5LIRA 5SICE 3V1MA 4KQKA 3QFHA 4UHFA 7MHTA 1GZ5A 3OM0A 5GZ1A 4BO4A 1G291 2G0AA 2XJ9A 4B48A 4K03A 1XKTA 3BMNA 4F86A 2CLSA 5E1OA 5HTOA 4JUIA 4IGKA 3WO0A 5FTMA 2VYCA 3LOUA 1UXOA 2HF8A 3VAYA 4I1PA 3HDHA 1AUQA 1IJBA 1QOPB 2I6QA 3AEXA 1HMPA 1F60A 1COWA 2NZVG 2YINC 5CX4A 4F6RA 5JATA 2IHBA 1Q57A 4MPRA 1GLGA 2VBCA 4UQPA 3C98A 5LC1A 2IUSA 1II0A 2YW9A 2RGYA 3UFXB 5IT5A 1E4YA 1J2JA 2ZOSA 3AP2A 3PIRA 1Z22A 4L0CA 1N3LA 3RCBA 3U2QA 5IT4A 4QNRA 1NVBA 1HDCA 1Y89A 1TQ4A 3OP1A 1UXKA 1QRRA 5AKKA 3CF0A 4X20B 1PG5A 1EDBA 3VQTA 1P2UA 3BE5A 1RYMA 5K3EA 1F1JA 4RJKA 5EKTA 3SKVA 5DYWA 2CVOA 2HWKA 4RMIA 4TTRA 4XCXA 1LRLA 3VR1A 1WV1A 3KQNA 2IHYA 2NTVA 4DWWA 4LFAB 1CDEA 4HO1X 4QUHA 2ZSBA 4Q4JB 3SE7A 2QPLA 2TMDA 3VVCA 4MMZB 1JLLA 2WYIA 1KOLA 5DNUA 5AO9A 5AUQA 1JSCA 1KH3A 2GAAA 3ENQA 5JMTA 2I5PO 1T3GA 2IPNA 5IFLA 4J8PA 5AK6A 1TTQB 3HUUA 5TSDA 1TTHA 3W5AA 2PMBA 4H1TA 1KDPA 5L7TA 2YHIA 1GGKA 1OFGA 2QTVB 1CHNA 1YRWA 3FLEA 1C3LA 1EX9A 2YNMD 1IY1A 2AZDA 2A0UA 1JHPA 4AUMA 4F3CA 3VTZA 1E8NA 3FPEA 3A2LA 3EBPA 1C8LA 3ICOA 5L53A 2B8WA 1KI1A 4MS4B 1UINA 1SKMA 4YRJA 1XU7A 2WJHA 2P30A 2IS4A 2Q6IA 3GBVA 3M1YA 4FD2A 4PZYA 3UKOA 2V59A 2FW7A 4UU0A 5DHUA 4F2DA 5KUTA 3VX3A 4HB0A 2FPKA 3FZNA 3HKDB 1E1RD 2H51A 2ZWMA 3BJEA 1RAHA 1DAOA 1U28A 1Y8CA 3PQ8A 4ID3A 4MUXA 4ND7A 3LDGA 5FB3A 4GFDA 1M2HA 4X1IA 4EUFA 3AOEA 1PEAA 5IEBA 3K9WA 2XYVA 1BVUA 1G3IA 3FFXA 3E8SA 3LI2A 4H0NA 4K3VA 3H9BA 4HUQB 2FMKA 3B3FA 2WF6A 3VHXB 3DSRA 2CFIA 2VRBA 2ZRBA 2FSUA 1ZKMA 4DHWA 3Q41A 5ICEA 2FUG6 1Z15A 3GT4A 3AB3A 3K70C 1IEXA 1QPZA 3CB4A 5JWRA 3K8QA 3ROPA 4Q24A 4M1MA 3VNQA 3AY0A 4HZIA 2F00A 2NV6A 1EFVB 3I72A 5H16A 3HB5X 3C5WP 4X54A 3S29A 4ZEVA 3F74A 3QFSA 2NN3C 1O4VA 3C7CB 1SZDA 2IHJA 3KOZA 4JMLA 5KAPA 3VZCA 3HJTA 3P52A 4G0UA 4HB2A 3ND5A 3LYHA 4MINA 1NUAA 1DKNA 4Q1CA 1FRZA 5KYUB 1TQDA 3HXQA 4K5QA 3L6CA 3I6MA 5DGIA 2HQRA 2B8NA 3OHPA 4RTMA 1JSZA 3H42B 4IUCS 4DMHA 4F2WA 1A9YA 1VSUA 2C54A 7REQB 1YQEA 1Z8DA 4MVJH 2HM7A 3IEUA 3IV9A 2DBZA 1EE9A 3FROA 1OUMA 2HSEA 2L0XA 5JFGA 3I2IA 2J4DA 3LHDA 4KXVA 3FZEA 1GAJA 2OD9A 5JYDA 1ZBQA 2O7SA 5K09A 2Q0QA 4RACA 5KKCA 1D6SA 3ESAA 4QU9A 1GRCA 4URZR 5LJIA 1VGRA 3HI6A 3P0FA 4WQMA 3VPXA 3S3TA 1JHUA 1U9JA 3BWVA 2JGKA 5JSKA 1PJ8A 3WKAA 1SUDA 5BV7A 4W5NA 3E82A 3H4TA 4ZOLB 1OZ0A 1ZJYA 1VL8A 4WBNB 2O8BA 4BVKA 4MAAA 2WZDA 1HLDA 1V8ZA 2I66A 2V7GA 3AZQA 3HB0A 4GKVA 2CYAA 2IYSA 1LPPA 3PKJA 3D6HA 5F9MA 2DHRA 4BNIA 2R48A 3GAAA 1NT4A 1UFQA 3D1JA 2C9YA 2FSIA 3A1NA 1RJGA 3SC6A 3CPJB 4LY9A 1K8XB 2HA5A 1MOQA 4EX7A 2QYTA 1CDZA 3TQRA 3MLBA 5JDCC 3VH4A 4IHKA 2BFCB 1Z4LA 2X6RA 3ZV7A 2VATA 3L8MA 2XCQA 1M34E 3M82A 1VBMA 2QTFA 5DBGA 3CWQA 3OMLA 3ZJYA 3W6NA 2XMDA 5EHQA 4C7KA 4JI0B 3FMVA 1WXHA 4R8VA 1CQJB 1Z06A 4WUVA 1XAJA 3AUKA 3ENZA 1G20E 4ARBA 3RVSA 3OZGA 3OD1A 2H1SA 4S1VA 3RHZA 2VCEA 1D6MA 3L6DA 2JFBA 5HEKA 3DP7A 1Z2NX 2DM6A 3WIOA 2FB9A 4B45A 5AICA 2EWMA 3MEQA 5IXSA 2XZLA 1XB2A 1YQQA 2A88A 4LXGA 4XQEA 2GF9A 1Q44A 4UMDA 3VO9A 3U7HB 1E0KA 1QIGA 1SBQA 1X1SA 1Z5PA 2PT7A 3JATB 5HZGA 2QMYA 3ZNQA 5BW5A 3PD0A 4GDMA 4IS3A 3WIUA 3LDHA 3HVUA 4QGGA 5CLIA 5FOUA 3ZNOA 2IEZA 2QVZX 5FA8A 5GVRA 4YGYA 5LP6C 1VHDA 3DNMA 3L05A 4II7A 4K40A 5IJWA 1X6VA 2N75A 5KMGB 4QJ5A 3KTOA 1XNGA 2YICA 3BWBA 2C7OA 2YNMC 4E2YA 1JR6A 3KT3A 3TIFA 1R8YA 2P8SA 3TUJC 3H5VA 1DKMA 1NN3A 3OQ6A 4Q12A 4BAGA 4GOKA 4B7XA 4JBXA 1WUIS 5IM5A 5DGHA 4ZMBA 2HZBA 2IJGX 2EKQA 5JY1A 3F90A 3JARA 1DBIA 1LW6E 2ORWA 1WXFA 2IQIA 5K4AA 2Q21A 2WUWE 2WWVD 1EPUA 3RKRA 2B3TA 2O0KA 1QO0D 4IUDS 4BBJA 1QIEA 3PNVA 2MU1A 3OUUA 3GLGA 2ZANA 5JDIC 5AXDA 1P7PA 2OGWA 4FI3C 4OXXA 4W7IA 3QKIA 3WKEA 2P68A 3CHYA 4FMCB 2A5JA 1UMDA 2QTGA 3D81A 3P71T 1PL8A 2NZ8A 3B48A 2DUMA 4LISA 2P77A 3WL4A 4J0FA 3QSGA 3TPCA 4PCUA 4WCFC 3FWYA 3OMXA 3R0ZA 5DM1A 4ZICA 5I6DA 4OQYA 4DQLA 1AGPA 4RD0A 4IUBS 3VOAA 3EFOB 2OAQ1 4KNYA 2OG1A 1DEHA 1HOXA 2VK1A 3FWZA 4FTWA 4EZBA 1I0IA 2PGAA 5J4LA 3ELBA 4QUJA 1R10A 4M1SA 1G1AA 2PU7A 2VCYA 3GK3A 1PAUA 4UVGA 4TT3A 2VQSA 5FL7D 4BV2A 2PQ6A 4GZ5A 3RS0A 5KTMA 3MJTA 5H4GA 3AM4A 4O4JA 1JKJA 2JIDA 5EYPB 1XPJA 3R8FA 2V65A 1X14A 5LA6A 1KYTA 3N2GA 5J2UB 3RVMA 4BUCA 3U9LA 2IDJA 1VMIA 1DDIA 4IDDA 1W9HA 4TTJA 4EO9A 3RHFA 1YA6A 4D57A 2OBNA 2GCIA 2XGSA 5B7QA 3U4AA 2WJAA 3GCZA 5JAZA 1ORRA 1X7ZB 3CF4A 4EKGA 1SZCA 4NAVA 1SC3A 3UPTA 5BSEA 6Q21A 2H0AA 4GF5A 4QBHA 3B5JA 4PIVA 4UXJA 4LVOA 2JFPA 3V6LA 5KC9A 2LV8A 3UM9A 1J06A 2AVNA 1PWYE 3L1UA 1BMFD 4P86A 5A4JA 1MZPA 4LBYA 1EFTA 4YRQA 4MULA 3AIOA 3COWA 1JIXA 1RD4A 3PWSA 2IUEA 5D6NA 4MQEA 3EG5A 1C7RA 3E22B 4NU6A 4OVKA 2BI4A 2R5NA 3D7NA 3KB1A 1NI4A 4EA8A 2QW1A 4B44A 2Q3LA 2HUNA 4M1OA 4WJLA 4O4LB 3OT1A 3RLFA 2FF5A 2NTEA 1IBLB 1E3EA 1V9SA 4XB2A 1US8A 3H1AA 1YS9A 1JLHA 2PPVA 2QR5A 4TKVB 4U2EA 3WZLA 1F6DA 4LRTB 1H1TA 3BTVA 3KKEA 1V2HE 4B34A 2WT4A 4OO3A 1DIHA 2WOOA 1MUUA 3I52A 4JXJA 1N6OA 1R8SA 3WLKX 2CLEB 2QMUA 3G1TA 3K0SA 2C9DA 5FBQB 1XMOB 4YJHB 4QASA 4OATA 1B0PA 1IRIA 1H0SA 1TK2A 3DWGA 4O4JF 5KWEA 1RAGA 1ZW6A 2HUPA 2J3DA 4RZ3A 5LA6F 3ZWVA 4Y0NA 4C89A 2X0JA 1DDOA 3KSBC 2PGLA 4EF5A 5KYVA 2ORVA 1UODA 2OBYA 5THKA 5MFPA 3ECSA 2XY4A 3BCHA 3U31A 4GT1A 3MGAA 5BSHA 2CZCA 4U7FA 4XGRA 3NKVA 1OE0A 3H1EA 4Z54A 1Z0DA 1P4HA 3JAWB 4DLTA 4TPKA 2D2XA 3ZLBA 3BJZA 3GH1A 1QMPA 2CN1A 1V6CA 3CCBA 4DIUA 3A1CA 3IIMA 1EUCB 1QHFA 4QUKA 3W7AA 4BNKA 4MUFA 4EVIA 3NUGA 3K9BA 1I3OA 2MHCA 4WHMA 4OB7A 1W0KA 3LWNA 2D5CA 4CIBA 1CNMA 4IIUA 3VSAA 3DAHA 4YMTA 3KB2A 3Q0TA 4UM7A 1BEEA 1CK4A 3O94A 3ZY3A 3EK2A 2A9FA 1BD3A 1ZI8A 4NCBA 5HGXA 3VDNB 1C9NA 1GTZA 3O03A 3F2IA 4GMDA 3ZW7A 5DBEX 1CNEA 4P0TA 2ZQYA 2NSYA 4DDHA 4RY2A 3U39A 4F2HA 5IABA 4OK6A 1QYVA 2FEMA 1DO2A 2P9JA 4NE2A 2M1XA 1LDGA 1ISJA 3ILSA 3G0OA 3L7LA 5DK4A 2VT3A 5LUAA 3W5DA 2XEXA 4D5GA 1H65A 3OTWA 2C95A 2G5PA 4F8EA 4ZYWA 4R3WA 3BDAA 1QFZA 4R5HA 2JCBA 5BURA 5FOSA 4M0KA 2FPOA 3I0MA 3UHPA 4DXDA 4C6RA 5FTNA 5B3JA 1X8KA 3BIWA 1S2IA 2CLCX 4CQLA 2ACWA 5AKEA 3R7LA 1OAAA 3I6ZA 2WUEA 3KXDA 3HR8A 1OX6A 2Y0EA 2ZEJA 3FLMA 4I1IA 3V8BA 3FH0A 3K5IA 3C15C 2UVDA 5CXXA 1DP4A 4RH0A 5CBKA 1H2FA 2PZLA 3RYHA 4BX2A 4UQLA 3VHRA 4GZMA 2QM8A 5EJ4A 4FNMA 4UHDA 1IOVA 2H16A 2HV9A 2RSLA 3HJCA 5JY6A 3BL8A 4C2AA 2FCAA 2PLAA 2J6CA 3EGDB 4IDHA 5CLJA 3J81k 1USUA 3STYA 4G1EB 1GFIA 1G3RA 3FCEA 3KQYA 4LNUB 3RC1A 4HQLA 3H5LA 3QH4A 4LHEA 1L5HA 3F3SA 3PQEA 3FCAA 4I9UA 4O4HA 5FV4A 3CG4A 3KTFA 2YQ5A 5D01A 3O2SB 4YJGA 3DTNA 3RODA 3HJNA 2A4MA 1EINA 4AUKA 1XT6A 3O3OB 4YUWA 3PIDA 4TS3A 1JIUA 4JC4A 3UAOA 3RYIB 4HS9A 1KS2A 4FMDF 4KAFA 5K8TA 4FDLA 4B6RA 4AKTA 3UMSA 2X6TA 4QJ4A 4G4GA 3GMSA 3C7DB 1AGXA 1V43A 3EXHC 1C80A 4D1YA 3DOHA 1KPIA 4LUCA 4ENRA 3OBIA 3AM3A 4EARA 4TV9A 4UOZA 1P5RA 2PLNA 5A3SA 2IE8A 2FPUA 1OTXA 1OBVA 1P60A 2QX4A 3JQGB 5JCJA 3OJ0A 3EB9A 2HY7A 3FYHA 2Y1OA 1FTGA 2RB4A 3DD5A 1H2BA 1ZM3A 2Y2VA 3R9IA 1I5EA 3M6XA 4U9HS 2PX0A 1F8FA 3LHFA 3OI7A 3DZCA 4C4XA 1ZMOA 3A6KA 2QU7A 4IEEA 5DTEA 4TZ0A 4HN2A 1GV0A 1W5SA 3H4IA 4G5RA 5A06A 4DYDA 3VU8A 3EN0A 4TQAA 2VWGA 5B2ZA 2BD0A 4M1YA 1JHXA 3STVA 4RMHA 4RYLA 4UM9B 3KNZA 1CY7A 4ZPJA 4D4LA 3VKGA 4OIMA 3STTA 3AJDA 4CG3A 4UARA 4QUAA 4ARSA 1ILEA 4D26A 1R7RA 1XKXA 1GTRA 5IT9A 3K8YA 3E9QA 4O4HF 1O7JA 1HYHA 4DABA 5G3YA 1JU3A 2J9FB 4EHIA 1KAOA 2ID8A 4ZCRA 1T36B 3W7BA 4YFVA 1P8AA 3V6MA 2IYZA 2PIDA 3WE7A 3GUZA 3WLAA 1EE1A 3A4IA 1NBHA 1QVZA 3ICWA 4C07A 2OMKA 3HCOA 4EG4A 3I3SR 2X5NA 3G2QA 1HZZC 2GPWA 5DTQA 4ZALA 1P7YA 3CVVA 1PR3A 3IEPA 4CEIA 1P9OA 4BXOA 2SKDA 3PHBE 4FFOA 4N12A 3WFJA 2RK6A 4JKIA 3GFRA 1ZH6A 2OHHA 1DS6A 1XCPA 1Z4KA 2BTQA 3V2GA 3KZKA 3FHLA 4TV9F 4MYHA 1H5NA 2J5RA 4E2ZA 5DO9A 2VQEB 1P29A 2OV8A 3EHEA 5AKHA 4F2GA 5LBTA 4ABTA 2WFAA 4G5OA 3IEVA 1QRAA 3WNCA 1POWA 4QEZA 2QE7D 5C8YA 3PDWA 2LIPA 2P5YA 5JJCA 1XRNA 5DSXA 4ETIA 4JLWA 1ZZEA 1L4BA 4HLCA 4ONEA 1Z38A 2CVHA 4RPLA 4G1BA 2NACA 2OUKA 1XZLA 2JKYA 2WSMA 1XA0A 1W48A 2PJDA 3UCXA 2JVKA 2XNKA 3IXMA 1FNBA 4LOJA 2EJCA 1FRNA 1ZRSA 1M2KA 4R8LA 3Q8LA 3EE6A 4XPIA 4B6SA 5AD1A 5CA1F 2NVOA 4FFDA 4I1OA 5DB4A 1PV2A 2AWOA 3H5NA 3KXLA 3S2IA 4EFNA 1T2AA 3CBGA 2CCJA 3LWDA 5F73A 1MH1A 2PMEA 4BX3A 3HXKA 4D8WA 3HR7A 2ZAIA 3C7KA 3LX8A 4LCBA 3PC4A 4WESB 3TGWA 3UT0A 4LN1A 3W5BA 2YY5A 1W36B 1YUNA 1EX7A 1N2GA 4X8MA 2AG6A 4L27A 1C7EA 4M7RA 3EGCA 3TDKA 3QF7A 4D74A 4OOFA 1PZNA 1ZD8A 2RHGB 1Y9AA 1Z36A 2NNLD 5DYNA 5DLPA 3SJCA 3U5TA 2QTLA 2O8EB 1A2QA 1M75A 1YQUA 1ZHFA 3AR9A 4S0XA 4H1VA 5LN1A 4BO9A 1C3VA 3QOFA 4ZJZA 1JI3A 2NT3A 4MWDA 2P5UA 4P8RA 5DISB 4AP6A 2WAAA 4J9UE 5I3CA 2QRGA 4FFMA 2CDNA 2NG1A 3PSAA 4Y6QA 1YZTA 3PR1A 2NTNA 3CKKA 4LRYA 3HNPA 2C92A 2ID9A 3DUFB 4Y6PA 3OX2A 3RABA 2QMHA 2G9ZA 1ZJJA 1PBTA 1MORA 1QUFA 4X95A 5C8YF 3DLTA 3O31A 4UC0A 1OXMA 1W44A 5EWMB 3DMRA 3EVBA 4G0MA 5AK5A 5FUVA 1V35A 3KJNA 2Y05A 3COYA 1A2OA 4JOSA 1YQXA 2W4IA 3PRHA 4YV2A 3UG7A 4H1HA 4REQB 1QJ4A 5EHXA 3N59A 1Q7EA 4WFKA 2ZYIA 3THWB 3CX6A 1GILA 2VA9A 5I3ZA 2ASVA 2L19A 1A9ZA 1E2PA 4YMLA 2DPMA 1P1KA 3EVCA 4WT7A 1L4HA 1JXMA 4N5MA 5IW8A 4E46A 4WJZA 5JSUA 3RYCA 3R9WA 2V45A 1HQYE 1PJ3A 1QCYA 3H05A 3IQZA 1OYOA 4KBFA 3E3AA 4PO1A 4YEDA 2ECOA 2DFLA 2VUSA 1Y6GA 2GTIA 3SGLA 4GI2A 2QZ9A 1HDIA 4LG1A 3OZ7A 2GWRA 3CVOA 1QE3A 1YMVA 2HHJA 4N7RA 1CUJA 2ORYA 4NYMQ 3H19A 3IPYA 1Y1LA 1VOTA 1Z5VA 1QYWA 2F17A 5FTWA 2FN8A 5HZMA 3CLVA 5LL6P 2CBZA 2V6GA 1ZKDA 4OMUA 3DMYA 1PVVA 5A04A 1KAHA 4KAAA 2B4AA 2Q1YA 2C5AA 2WA2A 2O8CB 4AKHA 3KYCA 3HYRA 1T3HA 2CSUA 3PGVA 5ERXA 4QM6A 4OP2A 2J0EA 3DC2A 4P3KA 3TVYA 4DWJA 1Z0UA 5JD6A 2Q4RA 2PN1A 3UJNA 2HC9A 2VDWA 1U5BB 4EWLA 1RHRA 2NUTB 3QLTA 2AWNA 4I50A 1KU0A 1P80A 2O2YA 4CGZA 1TQHA 2KI5A 1U04A 4E5NA 3IBGA 3LWZA 4FDVA 1GUDA 3GEDA 4Q9AA 2FW6A 2IDKA 4I1SA 5EZ6B 4G5GA 4DLPA 4EG0A 3J7AC 1CG6A 2QK4A 2EX0A 1N5LA 4CKYA 1EU1A 3LCVB 3QUSA 1XZIA 4W7HA 1SOMA 4EHDA 4CGYA 1HY3A 1W96A 4M8KA 3CW9A 2X0NA 3NM4A 4O2BB 1L7MA 2ODPA 3WWYA 1UBKS 3MCUA 4JCCA 4RJTA 2GZHA 2Q3EA 3NG1A 4MIEA 5BVHA 2XZOA 4CCSA 2V97A 1X1AA 4JLOA 4J0JA 2GF2A 1BXRB 4UUBA 3ROEA 1SD2A 3VKUA 3ZDZB 4E7PA 2C7QA 1N78A 1FW6A 2QL7A 1CPYA 3EXFA 1EDZA 4OREX 3G8AA 1TKBA 4ER5A 1M6WA 3EFEA 4J0GA 4DC0A 1PJAA 1JJ7A 1R6XA 4Q7KA 4RZ2A 2PV0A 2ZBPA 1U7XA 3PUIA 2WRZA 4E51A 1KPHA 1QPBA 2ZYRA 4MV8A 4QQRA 2BHTA 4CL8A 4CM8A 2M9MA 4ZOQI 4GOOD 1J8DA 2AG5A 2YASA 1SU6A 3IESA 4OLFA 3CVYA 5LMNB 3PR2B 4WLNA 2PQ2A 4C2BA 1RYDA 4BP8A 3EBOA 3JYPA 4UHEA 4ZOCA 4X9XA 1PYOA 3G5AA 9LDTA 3TG8A 4NZ9A 3NETA 3AP1A 1M0TA 2EW8A 2PV7A 2CFOA 3KBBA 4I50F 4MA4A 4RNCA 4LF6B 4K9KA 2C1XA 3E1SA 4GI1A 4AM8A 3EUEA 2ODTX 2R8RA 4NAUA 4UAVA 2QJFA 3RTEA 4Y98A 3UICA 1QB8A 2AFVA 4LDAA 2X2FA 5FHRA 3RIHA 5D5PA 3VR4A 3HL4A 4K28A 1E0JA 3RUDA 1Z39A 1UBHS 2CVZA 2L42A 3NHAA 1KP9A 1SO8A 4TKZA 4M1EA 2FDCA 4F38A 2C20A 4GYYA 3IDAA 3AKEA 5AW4A 4H77A 3LSYA 4LWOA 5G0WA 3CGGA 1QE5A 2JVIA 3HWRA 1AHPA 4FYWA 1N77A 1JKIA 3EEBA 2GTHA 4JI5B 2F3QA 4MZDA 1OJLA 3WXBA 1W4CA 5ALQA 5KNBA 1PO7A 1YFZA 2G8NA 3GUCA 2Z5GA 3WLLA 5GJVC 3Q2IA 2BN4A 3IBYA 4YRRA 4HWRA 1WCIA 4O4IB 2R6ZA 4JZYA 2HLDD 3LIIA 3ZCQA 4XVUA 1JT9A 1CZUA 2OL4A 5CVCA 1CZLA 1QVAA 4LSZA 4AJ4A 421PA 2Y0CA 3ANYB 3CXUA 4I08A 3U62A 5KTTA 2MT9A 1G38A 4X63A 4QXPA 4BMOB 4OJYA 3B2EA 3D3WA 2OHJA 3PUHA 3UAXA 3RC8A 2YYAA 4AWAA 4R8RA 5IC5A 3BXGA 3HYNA 1MHPA 1ULBA 1JL3A 2VDUE 3GFSA 4MUEA 4Q1FA 4MB0A 4LXXA 3LZ6A 1T5BA 4Q19A 2FSSA 3AVOA 4X60A 3TFOA 1EYZA 1ZD9A 2IXDA 3JYHA 1JIVA 2PZ8A 3MAGA 4FFVA 4S12A 1N8KA 5I5GA 3G79A 4HNTA 1P1HA 1VZ3A 2SKEA 2F64A 3HLTA 1K7YA 3QWFA 5FPTA 3KVOA 2PWPA 1JAXA 2J5KA 4PN3A 1VBNA 5AW6A 4MKIA 2I2CA 1Z2OX 2D74A 4PQFA 2BVNA 1SG0A 1QV7A 2N46A 2GZ1A 2VOJA 4V0OA 1R66A 1E6KA 1GFWA 2WMDA 2VT2A 2QXUA 4RSMA 1FPQA 3O8QB 3TTVA 1NZJA 2FGKA 5KKNB 1LNSA 3MPOA 1WSBA 1TLLA 1V39A 4M88A 3VNUA 3NC0C 2C04A 1T0IA 3TL3A 3GY0A 1IHYA 2C5FA 4RPHA 5B58C 4KPEC 1R9MA 3OHMA 3OIGA 3NVAA 1XTKA 4DV6B 2WV7A 5BQFA 1P9NA 1T3SA 3ADDA 1E2MA 5DWQA 3PEUA 4NZYA 5JTTA 2BEJA 1RQPA 3B36A 4YI3A 3I2JA 5CG1A 4EQ6A 2AJ8A 4BMVA 1QC5A 3FOFC 1JWLA 2XVMA 2P4SA 2GD0A 4KW7A 4W5WA 2IU6A 2JCYA 1YOVA 4U2FA 4HT3B 2KHZA 2QG6A 4P7GA 5DHFA 3OPMA 1JFLA 1XV5A 2HRQA 4PPFA 3AQIA 5T57A 3AHIA 1G6KA 1WDMA 2EFDB 2W83A 3LT1A 3OO1A 4HBZA 1FQJA 4P5DA 4R7TA 1P5ZB 1M8PA 1V8FA 4DLRA 2NU6B 3A04A 5ENDA 5EG5A 5ADVA 1DHRA 2VYVD 3ZY2A 2O20A 3FPHA 3K16A 1I3NA 4U8HA 2CDRA 2XTZA 3VZPA 2WTNA 5EQTA 1U1FA 3E0XA 5KVAA 3N86A 2PO7A 5F1OA 1M1UA 2WVJA 3IVXA 3N2KA 4MTCA 2FRVA 1MJHA 3TLZA 2G72A 3D59A 1GU0A 1EQ2A 2H1FA 4DMCA 2BGJA 3MIZA 1P9WA 2H4ZA 2O2ZA 3UJ6A 2K2WA 5BR7A 5LXTA 3JVDA 3QU5A 2VJLA 4CT4B 4OJTA 2P9TA 1NI3A 4DQKA 1NYRA 3D6VA 5COAA 3AESB 5HOQA 4IP0A 4I5GA 3IALA 3MQ4A 1U11A 2RGUA 2XQFA 3G7NA 1FFHA 2C2KA 2AOUB 4KAXA 5IC6A 3CPHA 4H7FA 2NM0A 3QIAA 1YJBA 3B89A 1HT1E 1ZUWA 2BKLA 1TCAA 4NZPA 4F1JA 2Z95A 4KYIB 4DSTA 3QOXA 4G37A 4OLBA 3VAZA 3ROMA 1ESNA 1TMOA 4CCYA 4X93A 1UWLA 3K6SA 3NIWA 3ORFA 4Q6WA 2BEKA 1E3DA 4FU0A 4JZKA 4DA8A 2YWJA 4MAFA 5AK3A 3SQDA 3WISA 2XE7A 1RZRA 2PGJA 3LRXA 1FP4A 2QGNA 3CYFA 3LBNA 3N7TA 3NKFA 1FUUA 4QXRA 5EMJA 2EZ8A 3R3XA 4CVNA 3QPDA 1U3GA 4NF2A 2AQHA 1VKRA 4LE2A 3A3NA 4K6KA 3UA3A 5G53C 4ER6A 4MQ4A 1QH0A 3HDYA 4G9GA 3RS7A 1MVNA 4MUBA 4EUSA 1L7AA 1EFRD 4NARA 1LCIA 1L9KA 3WGTA 1OGJA 1RYZA 4JJGA 3LMKA 1DXOA 2O0LA 1NMEA 4IM7A 3RWBA 1ZR2A 1ZAYA 1SIUA 5LXTF 3QU7A 1G55A 1N1GA 1A2KC 2ECQA 2XB9A 2WDZA 4BP1A 1P39A 5C8DA 1S0UA 2BP7B 2PT6A 4P53A 4AUEA 1ODLA 2WP8J 2ESRA 2ZK7A 2GBCA 4CR6A 2F55A 3QK7A 3PVCA 1I24A 1P1FA 1OFUA 4RZXA 2BHNA 4V0QA 5CK4A 1LS1A 4MW5A 4DDMA 4R7GA 1Q2XA 1UDAA 1VXRA 2R4TA 3W6UA 1TYCA 3PFNA 2KM1A 2XQKA 3EEQA 1NJ8A 1XP8A 2JJYA 2M98A 2MIIA 1J0AA 2QTCA 3EY4A 3IEXA 4TSRA 3SIWA 1XPRA 2R2GA 3ADCA 5CVEA 2P40A 3UFXA 1DE0A 3SFTA 3DP9A 3TZ6A 3UQZA 1K9VF 1UBTS 4CKXA 2VPZA 3NTLA 5AVTA 2FFQA 1NBMD 5DNEA 3ZK9A 3ZLUA 1KY2A 4IZ6A 4C06A 3KPVA 4ZI7B 2IH2A 4RS4A 4PAOA 4X20A 5AJHA 1BHJA 3RS4A 2HZ7A 4HQKA 5G0SA 3OBBA 1A7UA 3HEBA 2JGIA 5FOTA 2QAGB 2EZUA 1A8QA 2ODNA 2HRBA 3RKSA 2J67A 2DHCA 2N1MA 3JXEA 4V0NA 3ORQA 4D4KA 4PYMA 2ZLBA 1LLDA 4Q4JA 2UUAB 4WGFA 4CMEC 2AR9A 2DPYA 1R4NB 2RB5A 3O3CA 1LX6A 2A9RA 1W88B 2PS9A 1KMNA 4JUAA 4RV4A 3A10A 1Q1BA 2QLBA 1Y9JA 3IAS1 2G9UA 4AN0A 5I4BA 4BVFA 3OE4A 1AB5A 3H5TA 4QPCA 4PHTA 1C7QA 1XMJA 2OEPA 4FBGA 4YJFB 1GG5A 1DRJA 1T9BA 1TT5B 3HKEB 1H85A 4O2AB 3JTEA 1XVIA 2OBXA 2QTVA 1P61B 5D1NA 5D51S 5DOVA 1Q2UA 3PHJA 4L22A 5EEHA 1JIQA 2XD9A 2G9RA 3HU1A 3S99A 3W1EA 3BT7A 1J9ZA 1KHTA 4Y6LA 4F9FA 3CNLA 5IASA 2F1JA 3AVXA 3LU1A 3W8FA 1T5DX 4QDKA 3OQOA 1YB4A 1YRAA 2C7BA 2DUWA 4MS4A 2Z98A 4JVNA 5CMLA 4EX6A 2CD9A 2ZRCA 3L6RA 4I5FA 4IVRA 5JMOA 1FFSA 2TS1A 3OZTA 4MUIA 1A9PA 4BNFA 5JI2E 4DNQA 3PPIA 1LVHA 1V71A 2VSYA 3EIHA 3U16A 1OPRA 4DLUA 3S5JA 3HKDA 2YN2A 2LVBA 3RU9A 1R1DA 1ISHA 2CB9A 2ZTHA 3P2JA 2MTBA 4WY8A 4EKNB 3PLNA 1MC1A 4ZU6X 4RVNA 3VC7A 4R0VA 1RFGE 1NQTA 5ETJA 3T5TA 3P9NA 4PEVA 5TPZA 1UJ6A 4YV1A 1JB9A 1MU0A 2OVFA 2AXNA 5GONB 3WKCA 3N2ZB 4QXOA 3VHXA 1JEEA 2P9HA 5M3BA 3N2EA 3L1KA 3PJEA 1ULUA 1N25A 1VGQA 3MCWA 4HAWA 4D8XA 3FDXA 2ZYWX 4IDEA 3JZMA 4NOKA 3F8TA 3QNUA 1UXHA 4G1FA 3V5NA 3L9WA 3D43A 1VMKA 1QP7A 1EQUA 5ER6A 2ZRLA 3COPA 1RAFA 3LT2A 1QGDA 3VAAA 1EFVA 4DQUA 2LXNA 4HDKB 3AFHA 3RAJA 5P8WA 2YOGA 2MSCB 4BU0A 2P11A 1EHCA 5KJFA 2FPGB 1SCUB 2LWIA 3ZQKA 2ZBRA 5BMVB 1JHZA 5AUOB 4PPYA 5AW7A 3GFPA 5AJWA 3HCRA 2PTGA 2RI6A 5KYUA 3S2FA 3L79A 3QVVA 3HADA 3KV3O 1BH6A 2GBIA 1PZXA 1NBME 5BPHA 1KO4A 1E5DA 4TXJA 3G7UA 4XRGA 3T3OA 4XD2A 3HVIA 4XSVA 2NZYA 2X9LA 2VP3A 3ED1A 3VPCA 3ZZNA 4E3WA 8LDHA 1E9EA 2AS0A 2QUIA 2R6CA 3FSGD 4KDEA 4YLGA 1HFEL 2CNDA 3RQSA 3HSKA 4B2YA 2RBEA 3CH5A 3QJYA 3RAGA 1NUHA 4GMFA 4NBKA 3ZX5A 2PRJA 4UEJA 5JRDS 5J1SB 3N70A 5DHQA 3RJZA 3VR5A 4BIMA 1U2QA 4ZKDA 2UZ3A 5DNWA 1DZ3A 5IF3A 2H2DA 1CUCA 1OXSC 2P75A 1V5IA 2NADA 4RGBA 1N2EA 3C3YA 4P54A 3HXOA 2B8JA 3DE1X 3DXZA 1G8GA 4ABYA 4L15A 4Y6GB 3QVWA 5CUQA 4ZOLA 4UASA 2PSDA 2V74B 2ONJA 3WB0A 1OXKB 3IA7A 4WBNA 4FYIA 4BE4A 1ICEA 1DO0A 3G89A 3PD1A 5BO5A 3OU7A 3TVTA 3TMAA 4ZT2A 2I55A 2FX3A 2MR6A 3ZHQA 4KI7A 1ZHOA 1JTVA 4MR7B 2VJNA 4J7UA 2GPJA 1BKYA 3MAAC 1XJ0A 2L2QA 2ZJ0A 4FMPA 5CH8A 5DNDA 2OQRA 3ADOA 3SJAA 1R37A 4YCNA 1LNQA 1KFBB 2FZEA 1D1SA 1TAGA 2LP4Y 4W1PA 2BFCA 1PNTA 4WXMA 2IOFA 4KWIA 3FFWA 1IZ7A 2YWBA 3KQVA 4AZ3B 5JNTA 1ISMA 4OKIA 4ZVSA 4P33A 5DX1A 3RVBA 2UYQA 2Z1NA 2QXTA 1CQJA 3CZCA 4J0IA 5IP5A 1A5AB 1ZN8A 1JWBB 3MGGA 1UAGA 1Y6RA 3BMOB 5JFTA 1YV9A 1YK0A 2Z9BA 5SYMA 3IHLA 2XCOA 2X3YA 4P6VF 2B4YA 3FTNA 2JF0A 2F43B 1GYQA 1PWXA 1V2GA 2CXSA 4M4SA 1HM5A 1U9CA 5EUQB 3U9TA 2BT4A 3AKCA 1UH5A 3GDWA 4JXZA 2Z83A 3JATA 3E2PA 4RANA 1JR4A 3S7ZA 2ZUFA 3PUKA 5EJGA 3A7DA 2QVCA 1CJTC 1GHTA 2VRWA 1X0VA 4QAQA 4ZOLF 2R7LA 2BEVB 4A26A 1YC2A 1GPUA 4WBNF 1EVJA 5KMGA 1W4LA 2J87A 4KXFB 1O8BA 4YP9A 2Y68A 5TJHA 4KQ1A 1FDRA 4PBSA 1T4DA 4NG4A 5D6OA 2ZBGA 4XIIA 2I7TA 4DTCA 4MRSA 5ESXA 4JIGA 2ATXA 4RENA 5EUMA 2O0MA 2IP1A 1MFZA 4F45A 5IM4A 1K6JA 1COWD 1ZGZA 4B85A 4QM7A 3BGWA 3KDPA 4RV5A 1TADA 1A5SB 1T24A 4PC2A 1TC2A 4QE3A 5JEEA 4RF5A 2XDYA 4TL7A 4ZEXA 1SC9A 3A4VA 2VAXA 3NP9A 4JLPA 4O4LA 1FRQA 1QYXA 2FZKA 5BSUA 3OCJA 3HCDA 4D0LB 1EDDA 3DM9B 2D7DA 1A4RA 4QLAA 3YASA 3QTLA 4K6GA 2MSKA 5B6PA 2P4QA 4MEJA 3SAJA 3EJWA 1XR3A 2Q6VA 5E8RA 3VGPA 3BMCB 1G7TA 3CVJA 2IYFA 3EFOA 3SQMA 3PTLA 1ZQ1A 5EXEA 4FNGA 3G8CA 4B80A 3G5UA 4KYVA 5KWIA 3OM1A 1W5TA 2V1UA 2FZGA 3HK2A 5C52B 3MK31 2I9KA 2UYOA 4DA4A 4LV5B 2RHMA 2M32A 1U2PA 4WPGA 4KDFA 1NMQA 3SKYA 3I53A 1FTYA 5DH9A 5EYPA 5HP4A 1B2LA 4JP1A 2QOEA 3EIEA 5E2AA 1P2SA 1QQ5A 3WMXA 2PUWA 4TSFA 1L8XA 5J2UA 3VPAA 4BDSA 4YMIA 4TL8A 1ADJA 3DE0X 1X87A 3SXUA 1NPYA 4NZMA 2C58A 4ZAYA 5G40A 4Q5IA 3UHAA 2R8EA 3KWFA 4K6CA 4WK0B 1X7ZA 1ZH4A 4GS5A 1COZA 2BCJQ 1K7XB 1N92A 1XMIA 5T41A 3P9ZA 3FRHA 2BFEB 3M4JA 5HIIA 1EK5A 1NBAA 4FE3A 4R05A 3V80A 2GEVA 1M67A 5IM4F 1D0VA 3IXLA 4UE3S 2OHXA 2FXVA 3IUPA 2HK6A 3IDQA 3MJEA 5DVZA 1CVLA 4CUZA 4EENA 3DBLA 4NBSA 2CJPA 4K9DA 3W04A 1DQYA 1C4XA 4GMGA 4XWGA 1ZCAA 3WOHA 2P35A 1MB9A 1F4VA 2X41A 3E22A 1D0IA 3KU1A 3ME5A 4CMIB 1PKEA 2WV9A 4FMCF 4O4LF 4ZODA 1GAEO 1K8QA 3PKIA 3UWOA 1MHTA 4CEHB 1XEAA 5CEFA 1XZNA 3PE3A 4WE3A 3HTXA 1YHNA 3TSZA 1G16A 1UJ5A 1AQIA 1EEHA 4TKVA 1Q6ZA 2DH6A 4AUNA 5CVVA 3L0ZA 2PCJA 1T10A 2ZCVA 4NU0A 3IRVA 1CE8B 4PXSA 3RIMA 4F8YA 4PZDA 1WEHA 4ESOA 5IDWA 3SP1A 1UBCA 3A14A 4YJ3B 3RWOA 3DKVA 3GRVA 3LUKA 4JJIA 4X41A 2BUCA 3ESBA 1V4VA 1QNLA 2WHYA 4M21A 1XVUA 1NDQA 2X9GA 1CR6A 1J56A 5KNCD 1JZTA 2HSWA 1HYBA 3DNFA 3F4BA 1WABA 4IXDA 5JCOA 3ZWOA 2MSEB 5J2UF 2XMSA 3WS7A 5E3HA 3DB1A 4IOMA 4YRKA 2QD2A 2CEAA 4O2RA 3HVHA 4INZA 3DG9A 1L4MA 2ZULA 1DRWA 3I61A 1XZCA 4WZZA 5DM70 1F0PA 4B74A 5DLDA 2ALJA 4CLDA 1EJBA 1Z0IA 2WR8A 3ONDA 2DAPA 2Q5OA 1K5HA 3JAWA 3PYMA 3NVMB 1MENA 1VA4A 1VJ5A 3NOXA 1U2GA 3VFDA 1TEVA 3C39A 3RG8A 2I4OA 2C3UA 1V8PA 1EUCA 1IWBB 2P4HX 3KKOA 1I2CA 3P9RA 5H83A 2GHRA 5LU8A 1B7GO 1ZX1A 3E8XA 3FJYA 4BECA 1ADCA 2QVBA 4TWAA 4G56A 3OO0A 1ETUA 4DCTA 4B6FA 3KHKA 1Z3IX 3OH8A 2EARA 5JQGB 3HWX1 2QUHA 4RESA 1AKQA 2GN6A 3QBJA 2P1RA 4KR0A 1L4KA 2OPBA 3WQRA 5C1BA 4R8KA 1S4MA 1TM2A 1F12A 1JHAA 1GZVA 1ZNQO 2YFQA 3UK1A 2H2AA 2NXNA 3NS7A 4G5FA 5DASA 4N47A 2ZPUA 4GC9A 4WMLA 3WRYA 1T9ZA 1FMLA 1JR3A 1JBQA 4L4SA 5MFZA 1S6YA 5J47A 3NANA 3IIIA 4KACA 3T9CA 2BBSA 4DWOA 2PUGA 3SNHA 1L5WA 2O2CA 1LA2A 2P0AA 4RCYA 4EG7A 1XD8A 2OY0A 1AKEA 1H8HA 2HCRA 1XGKA 4UM8B 3NOOA 2J6BA 1DBRA 2EKDA 3GOHA 3PXGA 1CZRA 2AUMA 3B6KA 3P2IA 3M6VA 3D3KA 3OPYB 5J4KA 3S81A 2GD1O 4YLEA 4ZMSA 3DEYX 2IYOA 2O2DA 2OV4A 3PNKA 1IMOA 3SOPA 3STUA 1ONSA 2C84A 3DCIA 3IL2A 2ZI9A 4IOJA 4XDGA 1P33A 3GRCA 3ZZ1A 4DEYA 1F0NA 1U80A 2GJ8A 1VPEA 4PICA 5E9WA 4NVRA 3H9EO 4FYHA 4BQNA 1QHYA 4UBKA 4IO0A 3QYAA 4BFSA 4KR7A 1DV1A 1GY8A 2A5FA 2WHQA 3EGDA 2Q4DA 1I6MA 1OA0A 3ENKA 3TLKA 3QPWA 3OZUA 1E1DA 4U4AA 5HJ7A 1Y3DE 5AVQA 1FFXB 4LNUA 1E1MA 2O7NA 5CFQA 3IH5A 5ECWA 4NDAA 1U31A 3C8UA 3LOQA 1JMYA 5E7IA 2PAAA 4ALIA 1N3YA 4MDFA 1JIIA 1BDIA 4LF7B 1NWHA 1E7YA 4KVAA 4IKOA 2PBFA 4HDQB 2ZRKA 3UJBA 5DDIP 1TYAE 4NEQA 5IUNC 2F62A 3RYIA 4YLYA 4RELA 1ZIPA 3OQIB 3AI2A 4II2A 4R1NA 2WILA 3LT5A 2ZIWB 3GBPA 3HBLA 3ZHBA 1IXKA 1UM8A 2XGGA 1UP7A 4G85A 4WW0A 1HE1C 2PLWA 2I8AA 2O3JA 3LY5A 4GRAA 4QDJA 4MVJI 2HPAA 3JQGA 3ZY6A 2LGJA 4C2UA 4LZNA 2ZG6A 1QHSA 1DJLA 4RIIA 4CUKA 4F5YA 3LBAA 3LLVA 3CZAA 3R0IA 1C4OA 1K9SA 1SAYA 1UDBA 4RTQA 1QQBA 2IUYA 1MP0A 1VL6A 2CXNA 1JALA 2ZT5A 1HE3A 4X97A 4PX5A 3K0EA 3D0OA 4P32A 1U8ZA 2CUKA 2ZSKA 4QYIB 1U28C 4Q03A 5FOQA 4PO9A 2JFGA 2F4NA 2VPPA 1I6KA 4E22A 2FK8A 3LTNC 2DR3A 4PYNA 3AOEC 4N6GA 1FS6A 2CK3A 1WS6A 4QVKA 2ROQA 3EXG1 4RPJA 4ZC8A 5HJ5A 2WC1A 3J7TA 2QX6A 3WAKA 3NIFB 4B7ZA 2B1RA 1Z12A 2CGEA 1UJNA 2PX2A 3EXAA 2J9FA 4AYXA 3AR3A 1T36A 1OFTA 1E0DA 4PSDA 3K2QA 3O4RA 4MA5A 5CD9A 1RMQA 1I7NA 4OQNA 5EKSA 4TT3D 3ZDFA 4FILA 3K9NA 3GP5A 5KVQA 2FPRA 1S3GA 1VCHA 1WUTA 3C3PA 4JITA 5JCZA 5EJIA 3WJ7A 2PANA 4TQUS 1XRJA 2OAGA 3TFQA 4ETNA 2W11A 1R3DA 3LRPA 5I7UA 3GFOA 1E66A 4ARCA 1Y0BA 5ALZA 1HT0A 2V7XA 3RVOA 1GAXA 2OO7A 2RARA 4AZ0B 2HKIA 1BKDR 1CX9B 4UHJA 2A6PA 1SG9A 4YB8A 2Y6UA 4XJSA 3AFGA 3OPNA 4D43A 3A3OA 2GAJA 4DL9A 1ARZA 4YCJA 2FA9A 2GH1A 3U48A 4XXHA 1HT3A 1OKKD 3LP8A 1IQRA 2PD6A 3EIQA 4KTVE 2AYYA 4WK6A 5DF1A 1FSFA 1A95A 1K0UA 1FQOA 3CR8A 4XR9A 1L1FA 1EVLA 1MJGA 4HVCA 4BV9A 2E37A 3LA6A 1Q0QA 4CG1A 5BW8A 2O2GA 2EZ4A 3R41A 5C3MA 3COZA 1B1AA 2HCJB 3PQDA 3X2EA 4IDCA 2V8BA 4Y7CA 1LZLA 5C0OE 1QDEA 4RIEA 4Y2TA 5KSYA 3MBKA 3IAAA 2WZCA 2OFFA 3LVRE 5DM60 5ALJA 1TEZA 2ILTA 4AN4A 1O0CA 1GPNA 2TMGA 3PC8A 5FPHA 1N2CE 4F71A 5B12A 3UTCA 2A58A 4QDZA 1KTVA 3RSHA 4ZZ2A 1Z0ZA 3NT5A 4NFYA 4WA7A 5I9TA 4BN0A 1ZI9A 4P92A 1E59A 1KI9A 1TMKA 3BERA 4ZRDA 2HDNB 4WESA 4D9JA 5J4HA 4G01B 2FUG1 4KVFA 4LGYA 4H7EA 1MRZA 4DARA 1UPBA 3DOUA 3JYLA 1ZOSA 3PX3A 3CNOA 4RF2A 2OECA 3U3DA 1RQGA 4EL5A 5CIQA 3IP6A 1SCQA 2HXYA 2O8EA 2WVGA 2ZIFA 1OGYA 2IF2A 2JCXA 3LXXA 3FF1A 2I2FA 1BC5A 4O5OA 1PZGA 3OSZA 4GBGA 4YTEA 4CL2A 2VLBA 5F64A 3QGMA 3C3CA 3GLGE 2VDOB 4ZOBA 2JGNA 4CNQA 1U99A 3BHNA 1KI8A 2OXFA 5DIFA 2C7GA 2I3DA 3VYUB 4JH0A 3GCDA 5KQSA 3DUFA 2IHTA 3NEPX 3WNQA 3GXOA 3I83A 3RTDA 4D3ZA 1W0KD 3R0QA 4E4TA 4AJ1A 5EWMA 4L16A 3RD5A 4A23A 3H3XA 1KOFA 4DUGA 2AMFA 3PPYA 4E21A 1XTRA 5LJLA 4MRVA 4X24A 5HMMA 2W4MA 3CNHA 1RP7A 1SUIA 3CB2A 3FX2A 4RDXA 3GXBA 3UBMA 4LHWA 3RNLA 1T15A 4JKOA 4REQA 2EV9A 2YR0A 3GUHA 2BL4A 4HRVA 2ZCJA 2RHBA 1DCFA 1USKA 4WLVA 1OILA 1E3JA 1SUCA 1YTUA 3U1TA 2EQ5A 4ASUA 3GD5A 2NVWA 1ZIOA 1QVVA 2G9NA 1WCWA 1ZMTA 1ZJWA 3LC2O 4C7MA 1LTKA 4Q66C 5CTJA 1H66A 1HLPA 1PJZA 2FH5B 3K72B 1PYGA 5KTKA 10MHA 4J2TA 4HN9A 1KJJA 2RGGA 1M34B 1YI0A 2ILVA 4ZT7A 1ECGA 1KETA 3IPCA 3P0RA 1Z4IA 4YUAA 5A4IS 2QRUA 4WN9B 3OOSA 3DB2A 2JASA 4MTLA 4MLPA 3ZHUA 2HWYA 1G20B 1GITA 2OM2A 3AB8A 2QMOA 3VKFA 3EPJA 3VI4B 3ZBPA 3CF2A 2JCGA 2O8CA 3FKJA 3F73A 2BSAA 2ZJ7A 4PYLA 3TB4A 3GFBA 2A1TS 3TJMA 1G5RA 3BGSA 3BVPA 1NVTA 3DOIA 4IJWA 4Q9IA 1H93A 4B0PA 4DMUB 4A8HA 1TMGE 1U5BA 1GEEA 2NUTA 4QJ3A 1TCBA 4XA8A 2W6CX 5EPUA 2R7KA 2PSHA 3I3OA 3NV9A 3V7UA 4DADA 1SUWA 2AI3A 1HURA 2ZRMA 1HTTA 1CIVA 3JQQA 1SD5A 1W5FA 4I55B 1RVV1 4DM7A 3PEWA 1VM6A 1XSEA 2H9IA 3M8KA 4Y3UA 1XF1A 3ZCUA 4Q05A 5HGJA 4BTVA 4MZXA 4US2R 1D5CA 3LLUA 2H17A 1SKYE 1NU6A 1T3ZA 4B8ZA 1PLKA 4O2BA 2QV0A 4PIMA 4LFBB 3NP7A 1XDSA 2R11A 4D42A 4DR3B 1Z4NA 3CG0A 2WNSA 3FG9A 2I29A 3FLAA 4XM2A 2RE8A 2J0QA 4KXQA 1FTNA 3CW8X 5EWJB 2ZU6A 5FHQA 1BXRA 2QZZA 4FGWA 1KY5A 4LXHA 3WSWA 2V6FA 2ZTVA 2EOAA 1X1QA 4J0QA 1JW9B 3NO4A 2ZWVA 1FSPA 4HWOA 2A33A 3LFTA 3DZHA 3N39C 3BBPA 1MT3A 1MX3A 3DZJA 4RMNA 1KC1A 1XN4A 2HHCA 3F8SA 2WFMA 1NU8A 1DAFA 4L9AA 2RHLA 5JCJD 1HLGA 3V1UA 1BW9B 3UK0A 2M1ZA 1ZSNA 4HZUB 3THRA 1PI3A 1XMXA 5H3CA 3KJGA 2Y27A 3C1AA 2H1CA 4PONA 1MJ5A 3TEFA 3EA0A 3UHJA 1JAYA 2JFQA 1QHXA 4L07A 4C43A 4DJAA 5B37A 1VDMA 2PYDA 2WWWA 3QI2A 3VBCA 1V95A 4NICA 3P19A 1C81A 2ZJ3A 3SZLA 1XEXB 3IVCA 5DYIA 2FG6C 1M72A 3T3NA 2C8VA 3ELUA 4H9GA 2J85A 4RK1A 2QTRA 5IAKA 1WZEA 1K7FB 3GJTA 2IYYA 4KO2S 1U0SY 4BKUA 1AK2A 2B92A 1D2AA 2LDBA 3PI6A 3GDHA 2BFDB 3MWKA 1XA3A 2GAIA 4CEJB 2WK1A 3LXRA 2G06A 4KQEA 2FP4B 4DCSA 2V0GA 3ZY4A 3CSUA 1Q3KA 4RFSB 2GM5A 2F2TA 2Y1CA 2PEYA 3MLAA 5ED0A 4O2BF 2VP2A 1JFRA 4OP3A 5BRJA 1Z5WA 1JHVA 4FLMA 4U7JA 4ZJUA 4MWZA 4PZZA 3IODA 2PMDA 4QC2A 4CQNA 2YMLA 5KVCA 1YAHA 3D8BA 3CKYA 3LUHA 3C6KA 3W8RA 3ANXA 4EDHA 2DOKA 5HTKA 1WDTA 3EVTA 5FBKA 3S2UA 4BLPA 4D0RA 3OMWA 5A62A 5AKLA 2Q9CA 2PZBA 4P4UA 1CR0A 2DECA 3KSDO 4O4IA 1LRJA 1ID8A 5A4KA 1PRYA 5KJ1A 1TYBE 2J4CA 3CCCA 2QP4A 4EZIA 4AJKA 1I2DA 3D4BA 3Q7SA 1BCSB 3BQMB 1HDGO 1V3QE 1L2TA 3KCQA 2B37A 1I5RA 3HVKA 1GUFA 1NYTA 3TJZA 1B93A 1GKIA 2Z58A 1PNRA 1S2MA 5ANRB 1NYQA 4GLOA 4HC4A 5AYVA 4NCKA 2GHTA 4TVBA 5BUSA 4ER0A 2XNSA 1NNI1 2XUOA 4AXXA 2GRJA 1E3TA 4WSOA 2OPHA 1OIXA 2JIZA 3DHWC 3SDZA 4OEHA 5LR6A 4NCJA 4N8DA 3DMDA 3OPYI 2AKEA 3FB4A 4XJTA 3WL8A 1DC7A 2BSXA 5HXAA 3T5GA 3B6MA 1G66A 3QELB 4KQ6A 4OHRA 1GGNA 2ZBQA 4YIKA 5CAEB 8MHTA 1I4LD 3WYDA 1THZA 2KS6A 1N9GB 3GGOA 3V4PB 1NXPA 2HD4A 3D8RA 4LDNA 3A6HA 4BFYA 2OG2A 3WTCA 2RH5A 1IRXA 3F4LA 3GRKA 3O8QA 3O4JA 4R31A 2D1FA 2IVZA 3OLYA 4MYUA 1CDDA 1GPMA 4Z49A 5B3JC 5TLSA 1WE2A 5BR8B 2P3LA 1F1BA 1II9A 3WWOA 4URFA 3V4FA 4MLZA 2C2MA 2AD1A 5IJZA 2C7PA 2JIOA 3BMQB 5GJBA 4O4IF 5AHRA 1L5LA 5DN6A 5T4EA 2QTNA 1GCGA 2HYIC 4G36A 1KYZA 2ATCA 2DWUA 4BTLA 1OVGA 4KFRA 3NB0A 5DBOA 4EF6A 2PE5A 4XWKA 3S1LA 3QY9A 4P34A 1J2TA 2P2GA 3EVAA 3HNOA 4E94A 1W581 3S4YA 4X85A 1G0NA 1GR1A 4RULA 3JAKB 4KWCA 3T6KA 3JQ7B 1NJFA 4Q02A 4JP5A 1RXEA 3D7KA 4EZEA 5IRCD 5ECYA 2I67A 5GWXA 4FZ5A 1W5EA 2NU6A 3CIOA 4EUNA 4O3MA 1YRHA 1CS4C 2EHJA 2RGAA 3OIVA 2BKXA 2POCA 3C1OA 1AT1A 1R18A 3PC7A 3RAPR 4TWIA 1KEWA 1QYCA 3OZIA 1ZRNA 3T5CA 4CDMA 3LL4A 2P6MA 2I62A 4UM5A 1ZA1A 5F1YA 1A3CA 4BMNA 1I0LA 1QF9A 2CF5A 5E2BA 1YR7A 2JGEA 3NHPA 3ANMA 3VI3B 1KMCA 4G65A 1L9XA 3OLWA 1E69A 4UNQA 2DHEA 2HRDA 4AMUA 2ZS8A 1VLQA 1VRCA 2C8KA 1MQ8B 4QTYA 1DQPA 2WB4A 2CLDX 3A2MA 5TQJA 5HM6A 1VIAA 1ZMXA 2ZJAA 2XB8A 4NNJA 6AT1A 2FKNA 2EYUA 1Y7PA 1E4OA 2I1VB 3AESA 3NYWA 2QORA 3Q3EA 4HK4A 4B7AA 1Y3BE 2H9AA 2Z6UA 4INPA 1A7AA 2AOUA 2OXEA 3R74A 3F5SA 5A7GA 3L6EA 4KGVA 1OT3A 1O4WA 1N1DA 1RAAA 5KVSA 3HY6A 2WJ4A 2BSQA 5JSYA 2BEUB 4IX1A 1LDBA 1RS0A 4FCVA 1T9KA 4BFUA 2W6NA 2W0MA 5AVUA 2CZQA 1E6CA 2GHQA 3LVFO 2WU8A 3ABSB 3T06B 3DMTA 2D2IA 3L84A 4DUYB 4TQGA 1LSUA 3O75A 4MIKA 2O2JA 1SVUA 5HFAA 1AN9A 1Z47A 5CDGA 4CIXA 1JI0A 1ZXBA 4HOYA 3CX8A 4RSRA 3WGNA 2YMPA 1WZCA 1M2JA 2P0YA 1DRKA 4QGFA 4AG5A 3R77A 2EIXA 2C77A 2HLNA 1OLXB 2FN3A 3KVRA 4EA7A 5JOQA 2AV6A 5L45A 2I91A 5FI3A 2RHHA 4NJOA 1CUVA 4RXUA 4UFNA 1SOWA 1SVSA 1E9RA 2Q49A 4KC0A 4RIFA 2FQQA 3DMHA 3M6LA 2HDWA 2PLFA 4MMXB 5J5CA 3H2HA 3TAUA 5ILQA 3O91A 3W2TA 4GX0A 3ZVMA 1N6KA 1TVKB 3OFJA 4U7TB 5HCIA 2IWRA 4XCQA 1YJQA 5E38A 5F3DA 3B1VA 2BP7A 2EDAA 5ED4A 1TB4A 2G77B 3MWEB 1P7WA 4TQ9A 1E2BA 2ZJ8A 4P35A 1X3LA 2P91A 2N47A 4H27A 2F9FA 2PGOA 3FUWA 4F21A 1ZH8A 5KNCH 5D85A 1MTOA 2XADA 2KBEA 3QVXA 2O5CA 4R1UA 5I7FA 3BFXA 4LRQA 3HZHA 1T6ZA 2JFFA 4PRZA 4ZYUA 3OJLA 2UXCB 1N2OA 4WOBA 3Q3IA 3VNRA 2DKNA 1BS2A 1VTKA 1YDGA 3ZHCA 5BN5B 2GEKA 4O1IA 3RVKA 1GTVA 1LDMA 2J59A 4I8IA 3H9JA 3WG9A 2VUHB 2JLRA 2QZSA 3PHCA 3VR4D 3IIJA 2XV1A 1A8HA 2GPTA 2QAGA 3CLTD 2J9YB 2VZ0A 2IOQA 2BJVA 4R1SA 5E7QA 5DYGA 2JJ2A 5EIHA 4M37A 5G1NA 9ABPA 4K9RA 4PC6A 1QHNA 2D0DA 1E2NA 2VQ6A 5J40A 4LXQA 3V00A 1R6VA 3V7NA 1R4NA 2CUTA 4N0QA 1CVIA 2C4VA 2P2ZA 4V0RA 3JD2A 3SEZA 5HQ3B 1X7HA 1W88A 3A25A 1EFAA 3MTAA 1JU4A 4NR0A 2WP0A 1SC4A 3CLUC 1I2AA 2F1KA 1UQRA 1T1EA 3T61A 4X71A 1O9GA 4UVHA 4R83A 1I9GA 4YJFA 1UWKA 2GASA 1XZPA 1TT5A 2PK3A 3HKEA 4O2AA 3V2HA 4B6PA 2ZPAA 2JLSA 4U2BA 3PA8A 3GGSA 2ATVA 3KLOA 3OIUA 3B12A 2JHCA 2XA1A 2NUAB 2Q5LA 4M9RA 4N82A 5EE1A 3TZEA 2GOYA 3V1NA 3ZTWA 1SD1A 5CB6A 1DHTA 1ZGJA 4GOXA 4YP6A 4KHPB 4HMPA 3ZHYA 3RS9A 2RMKA 4JBWA 2M6KA 2OORA 4ILEA 3MNFA 1E79A 3TSOA 3A05A 4TUYB 3O8RA 4PLFA 5LZ9A 5KTOA 4JYPA 3RVJA 3MN1A 1RYYA 1KSFX 6NULA 2QDXA 1VL5A 1E58A 4TZKA 1HR0B 3KJZA 2ZJ2A 4IFTA 3HKCB 3ZD7A 2NSLA 6PFKA 1B76A 3NTUA 1IXSB 5T3UA 3RBXA 1PLJA 1RZVA 1L5QA 2REXB 2X1LA 4WINA 2PKCA 1MEEA 1R5BA 1ZJ4A 2C9ZA 2EFCB 3E7WA 1PVDA 2A35A 2A78A 1NXSA 1PV1A 2PS3A 3F5DA 3LL7A 2YXBA 3NYRA 3PEEA 4JASB 2W00A 2FE1A 4KIJA 4QGHA 3K8OE 1YZLA 1YJAA 3CR3C 1CB0A 1N4DA 2CJXA 1KPGA 2PR7A 5GONA 1ND6A 3AIMA 3OIDA 4HAUA 1R0SA 1P6XA 4BASA 3ENWA 4UCQA 3QJGA 3PFGA 2AXPA 2AQKA 1MPTA 1H6DA 3ASZA 1N2XA 3NRJA 1H2EA 4M0LA 4FN4A 2MYNA 1QGUB 4UUMA 4HDKA 2VSOA 3D4IA 3C3DA 2H48A 1W4RA 3KWLA 3OZAA 4O2AF 5A1TA 3C6ZA 2XUJA 1AV6A 4TLEA 3P9PA 2PUEA 2GK6A 2FPGA 4KQJA 1Z62A 3VU0A 5F21A 1PS8A 1SCUA 2AE2A 5BMVA 4Z0PA 1Z33A 5GGXA 2PZAA 3REFA 5B3KA 3UBTA 2QEQA 2JK1A 3P4XA 4GZLA 3IAXA 4EHLA 2JJQA 1U3DA 3BZUA 2RBGA 3HNRA 2Z6QA 1I1NA 1D0SA 2E82A 5IANA 1WXEA 5KAMA 4FS3A 2X58A 1M0EA 4KTTE 2R86A 1G9TA 1J42A 3ZLTA 3DXXA 4MLDA 2Y2UA 3HB1A 1QDUA 4LKOA 1SCKA 1DPGA 1KO8A 2ZIZA 2D54A 4ND3A 4NH4A 4Y2JA 2Y1DA 3QYPA 3BXOA 4QDXA 4Q9KA 4EKDA 3P1JA 1CEQA 3DEFA 4MVJF 3EIXA 2GEFA 1N5IA 3N0VA 4LMPA 1TPZA 1PGPA 1JILA 4KXXA 1PTKA 2JAUA 3FGZA 4JJ4A 1MX1A 5ILGA 1QIJA 3HN7A 4G5QA 4CF6A 2E4YA 4ZO7A 1VBFA 4MV1A 2HT1A 3A4MA 1SA0B 1ATZA 2IRWA 1EGQA 4J91A 5GONF 5IDQA 1JFTA 5K6AC 5AQEA 2WQ7A 4G4JA 2QW0X 1Z6ZA 2IGTA 1C8VB 4A2PA 4DQXA 1RQ7A 4JOCA 1Y4SA 2DPGA 1ZZGA 4XIJA 1BX1A 2GN0A 1Z7YA 2VLIA 4MR7A 1L5KA 2WF5A 5DN9A 5F1KA 3WGIA 1UFRA 3VJRA 4TMZA 1NIPA 2QM3A 4LHYA 2YRFA