2HNBA

Solution structure of a bacterial holo-flavodoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Protein mioC
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnbA00
2HNBA 5LJLA 4H6PA 2V5UA 4YAUA 4QOEA 3GFQA 2XODA 3NHLA 5LVAA 2Z9BA 4LTNA 1AZLA 2GSWA 3NHSA 5F51A 5LLDA 2N1MA 1YCGA 3L9XA 1CZNA 1KBOA 2QX8A 2Q9UA 3TEMA 5F12A 3GFRA 5EAIA 1XT6A 1XYYA 4FGKA 4ZVNA 3U7RA 4QOHA 2BMVA 2MOKA 3O2NA 4QOIA 4DY4A 2QMYA 1C7EA 5LBUA 3NHJA 2ZKIA 2R96A 5LBTA 3GAMA 2HPVA 3S2YA 2AMJA 2W5UA 1TLLA 2Z98A 4N9QA 2FZVA 3NHFA 1CZRA 2FAXA 4ZVLA 3NHKA 4Y9UA 3ZHOA 1DXQA 1JA0A 4C0XA 4C76A 3K1YA 1AHNA 4FGJA 4YAWA 1YKGA 5A4KA 3EYWA 4U7FA 1FUEA 1BVYF 2B3DA 2BPOA 4C14A 3SVLA 3W7AA 5NLLA 5FX2A 3B6IA 3LT5A 2FVXA 1FLVA 3FX2A 3K20A 3W77A 3OWHA 1FVXA 1H69A 3FJOA 4LTMA 5LJIA 2XOEA 1J9GA 2F1OA 2MWMA 4DIKA 4QOGA 3QFRA 1ZWKA 4HEQA 3ESYA 4YAFA 3B6JA 1I1OA 5F4BA 3R6WA 2FLVA 4BMPB 3NHWA 4S24A 1B1CA 2WC1A 3NHPA 3KAPA 1J9ZA 2QX9A 2OYSA 1J9EA 5EMNA 1RLIA 3EDOA 3OJXA 4XDGA 1D04A 4OXXA 1X77A 3JSXA 2FZ5A 3HLYA 3ESZA 5NULA 2A5LA 1JA1A 4LTDA 4LAFA 2RG1A 2MT9A 1RLJA 3KLBA 1AKVA 1AKQA 5ULLA 1GG5A 3OVMA 2QWXA 3ES9A 5LMCA 3OWXA 4YAOA 4U7HA 2OHHA 3FNIA 3NHRA 2FOXA 1YCHA 1AKUA 4NULA 3W78A 3HA2A 2BN4A 2X2OA 4ZVMA 1SG0A 2FCRA 4PU0A 3FW1A 1D03A 1KBQA 4FGLA 3NHYA 4QOJA 4NLLA 3RPEA 1OBOA 1CZKA 3U7IA 1RTTA 1QBGA 1F4PA 3GFSA 4M0CA 3F90A 4R81A 3OJWA 1DXOA 3L9WA 3LCMA 4DILA 4F8YA 4QODA 2QX4A 2KQUA 2V5VA 1ZWLA 4ICIA 1AKTA 3N3BC 5JROA 1AKWA 5EA2A 6NULA 1YDGA 3NFRA 4H2DA 4D02A 1T0IA 1CZOA 1NNI1 3B6MA 2OHIA 1SQSA 1FLAA 5TGZA 1YOBA 2MTBA 2QMZA 1FLDA 4HS4A 1CZUA 3ESXA 1WSWA 1AKRA 3NLLA 3OX1A 3F6RA 2BZSA 1QHEA 4U7GA 1FTGA 4Y9RA 4GQIA 3QE2A 4PTYA 3UXEA 4Y7CA 1AG9A 1J8QA 1RCFA 1AMOA 3NHUA 1BU5A 3O73A 1QRDA 3QFCA 2Z9DA 4XDHA 3TZBA 5B3LA 2QX6A 3KEGA 1H66A 4FX2A 4ZVKA 1DX9A 3FVWA 3HR4A 1E5DA 5FA6A 4YALA 1OFVA 3KAQA 1V4BA 4YQEA 1T5BA 2BF4A 3W79A 4GI5A 3F6SA 2X2PA 2FDXA 3OX3A 2ARKA 3F2VA 3B6KA 5FUQA 3G5MA 1YCFA 2Z9CA 2OHJA 3TE7A 3UXHA 2Q62A 1VMEA 5BUCA 1D4AA 5B3KA 4N65A 2D5IA 3N3AC 2HNAA 3OX2A 3D7NA 4BMOB 1C7FA 4CF6A 1FLNA 4CETA 1XYVA 1QR2A 4GR9A 1WSBA 2M6SA 2V9CA 2QR2A 2R97A 4ESEA 1ZX1A 4QOFA 2M6RA 1FX1A 1YRHA 2KLBA 1CZLA 4J8PA 3P0RA 1CZHA 1XI2A 1OBVA 4C0WA 4LA4A 4PTZA 2FX2A 1TIKA 3N39C 4N82A
chains in the Genus database with same CATH superfamily
3K0SA 2HT1A 5INTA 3KX2A 3QHAA 1W0CA 4MIKA 1LQ2A 2TYSB 2O8BA 3BSYA 3U4QA 4UUOA 1ZGBA 1KQ3A 2ZSEA 2F9LA 3M6VA 1LX6A 4KUHA 4UNQA 4V0OA 5D2CA 4EHNA 5C9ZA 3EFOB 4OJMX 4Z9YA 2O9JA 3NHLA 4UAGA 3R9KA 2RK3A 3ZDDA 4IG9A 4PBTA 4TXHA 3OUTA 1Z47A 1AZLA 1ACJA 3GA0A 1M0TA 3SICE 3VAYA 3W5IA 2C0CA 4TM7A 5BSFA 4N0EA 1V6CA 3AUYA 4PO1A 3IV6A 4G0ZA 4O4LB 3G1UA 1ZIOA 4FX5A 4F11A 3SPXA 4ZKDA 2Z8XA 6LDHA 2VP3A 5K3FA 2P2DA 2P9BA 4Y2RA 1DAFA 4TYYA 1A4RA 5J58A 3ZQJA 4GWLA 1N4AA 4PYRA 2XNDA 4EY6A 3GXOA 2ZRQA 3H2JA 3I83A 2JC3A 4RA6B 2H48A 3QI7A 4QUJA 1L5MA 1FYEA 1Q7TA 4QDXA 2FB9A 1GY8A 2EJWA 3DH0A 3RJZA 5A3RA 3O90A 1NLYA 1P2DA 1FYVA 2IP4A 2XE8A 3GRAA 3LXXA 2HD4A 1FP6A 5K3BA 1DHRA 2VNKA 3ZNNA 3FMFA 3MG9A 3EPHA 1G6HA 2EGHA 1IN1A 2PYZA 4P7KA 1C30B 2C5LA 3KB2A 2AX3A 2EFGA 5CMLA 4YBZA 5FUBA 3WK8A 3Q7EA 4FW9A 2Q3EA 4X95A 5JQWA 5JSUA 2VK1A 1DADA 1W2GA 1NUHA 2QW8A 2CL5A 2Q4EA 1GARA 2ZWOA 2YNMD 3M9XA 3QBEA 2N1BA 1IQ0A 3EPKA 1FFHA 4IG4A 2MOKA 3TYXA 1N92A 2M6LA 3T9EA 1UZLA 1O57A 3ZX4A 2D13A 2GZ1A 2C20A 4UHJA 4IPTA 3RC9A 3RVNA 4BQRA 5I8WA 5KTYA 1IBMB 1X9HA 3EFOA 2H1RA 5BYKA 3OZUA 3IAFA 5KYXB 1NBHA 2CVZA 4J0JA 4BCDA 2Q8PA 2II6A 3K3PA 1OZAA 3O8RA 3FYUB 1HKUA 2YC4C 2YN0A 3DWEX 4JASB 3JALB 4MPPA 2VHTA 3C3YA 3ZDAA 2H4FA 1TLLA 2O2IA 2B5OA 4DJFC 1JHYA 1W85A 5FTNA 4FC7A 1TEXA 3CNHA 1GILA 3LHDA 4PCLA 2ORIA 5EWMA 1O4WA 3N6XA 3P2KA 4NHOA 2HV8A 2DSNA 2PR7A 3B2EA 4XGRA 4Y9UA 2FNAA 3SQNA 1PJZA 3A11A 1FSPA 4Q9JA 4RA6A 4IDDA 4QJBA 4EGQA 1BWSA 4I50A 1G7RA 4JI0B 1SVKA 2VZLA 2QF7A 5CJ2A 4NAHA 1NL3A 5TDHA 3UUFA 3V32A 1T6BY 2CCJA 3RM3A 2G0TA 1YKGA 3H04A 2ZRHA 1POXA 1AMNA 1RJWA 3VYUB 5L7WA 2HPHA 2R8EA 3PDJA 4R7TA 8AT1A 2PZLA 3AXSA 4U7FA 5LYJF 2A4KA 1PSWA 1ZG3A 1BRMA 3KR9A 2EKQA 4BZZA 3CVJA 3HHPA 1L7MA 2RJOA 3VVBA 4G9EA 2CNWD 4ABYA 3IEXA 1MC1A 1NE7A 4U2FA 4OJNA 4U5XA 2GMWA 5KOIA 1ILEA 1NVAA 5ESDA 4K9KA 3VO9A 1X6VA 1Y37A 1U5BB 4GM0A 5JXWA 4MX8A 3T3IA 4BP3A 4EMTA 2IE8A 1ORWA 1JMVA 2IU4A 1RWQA 2IWHA 4E21A 3GK3A 3BHMA 1CJMA 5K3SA 5A5VA 2G25A 3I5UA 7ADHA 1RYFA 3SQMA 3T5CA 3OKFA 1AB6A 3NDJA 4FT2A 4F21A 5IXYA 4F0JA 4GXQA 1MB4A 4NEQA 3FYUA 1RQXA 4HDSA 5BN4A 1T5IA 3JALA 1SC1A 3VPGA 4KQCA 3COPA 3I9NA 3MIZA 1SBCA 3M81A 3VBEA 4RANA 3AJDA 4MPTA 3W77A 3WGNA 3ZLBA 2PUAA 3CISA 2JHGA 3ZWOA 3TSCA 5G1PA 1JJFA 2NG1A 1NZJA 1EWKA 4ENSA 5C5CA 4DV1B 1ZH2A 3IP5A 4TMZA 3UJHA 1T8SA 2XEDA 3TOXA 1EX7A 4BO3A 5KVCA 4Y6RA 3V8MA 1G0NA 5BYJA 2F3QA 2QY9A 3H4TA 5AK0A 1HMPA 3M6MD 3S8YA 5CVJA 4WFQA 4JN6B 2NO5A 2Q49A 2FEAA 1RNLA 2FMKA 1R9NA 1A2OA 4QBIA 4JJ7A 4WKCA 3V1TC 1VZ3A 2QDKA 4BQQA 4E4RA 1KTIA 1WMDA 1TVKB 3QFRA 3WLQA 4JYAB 1JQDA 4RTMA 1CQXA 3OTWA 2BF7A 2HEIA 1AF7A 3BF7A 3GLHB 5BOVA 1EFPB 1SVOA 1XJQA 4Q6WA 1S2MA 3KTAA 4JP3A 4X1OA 5D1HA 4MS3B 2X41A 3OZGA 3WQRA 4CF3A 1GPDG 1UODA 1U3UA 2QYTA 3DFMA 2HTEA 3N7AA 5HIMA 1I3NA 2A8YA 3HDHA 1UOOA 4KVZA 1U5BA 5CFRA 1UMCA 4XASA 3NGMA 3IAUA 1M1UA 2X0FA 4OJKA 2JH8A 2VPIA 4NJOA 1WDKA 5FFNA 1WVGA 1UIRA 2NYAA 1C0PA 1H2AS 2AE2A 2Z95A 3C1TA 1OJ7A 1ZJ4A 2EX4A 3IPAA 5CRIA 4HGZA 2FPXA 5K2MA 3M82A 1ZCBA 2JJ2A 4O6VA 4AROA 1O0BA 2D5LA 5F1PA 2R5WA 2GBFA 4EMSA 3AIMA 4KN5A 2Q2WA 4EF5A 3FJYA 1WNTA 3H1FA 5KDDA 1J9EA 4UE3S 1XR3A 1A5BB 4URYR 1N6HA 3FNHA 4BVBA 4DLPA 5KJCA 3VPXA 4KSYA 3A58B 3NHBA 5KWEA 1DC5A 1LCIA 2E1PA 3CR7A 1VI2A 4JLJA 4BNDB 4D8TA 3UT5B 5HE8A 2O0HA 2FZ5A 1P7VA 4RZHA 1R4AA 1GZ7A 1TQ4A 5E6UB 3E7WA 4BEBA 3QQPA 1MR3F 3GW8A 1WG8A 3X1MA 2OKGA 2Q0HA 3CW8X 3GVIA 4IIYA 1FP1D 3CR3C 3D1VA 1RU3A 1XROA 4R1QA 4Q7JB 3ZU5A 3R75A 1DC4A 2XVZA 1QTIA 4FBMA 2W2NA 2AEFA 1KVRA 3L7JA 2OOKA 2A5LA 3GLHA 4V2IA 1EFPA 4DL9A 4BKMA 3VDRA 1EYZA 4JBIA 1KO5A 3LPAA 1O03A 1PNOA 4KQMA 2ZT6A 3INNA 4EEXA 4PFKA 4K0KB 4MVJP 3P52A 1V3TA 2RI0A 1KGSA 2XH8A 2MT9A 1K3UB 2WJ6A 1FXSA 2N42A 1GZ4A 4H9GA 5DNWA 2VO1A 5FT9A 3ULKA 3S1SA 2HW8A 1ZVVA 1O95D 2G4LA 3SX2A 1Y1QA 5CXXA 4DYDA 1ZJ6A 4B46A 1DOHA 4ODIA 4B71A 4HSGA 4J16C 4RDXA 4RS4A 1TMGE 4MVJH 5BYBA 1UCFA 4FLMA 3WK6A 1N1DA 2AYYA 4D57A 4FHCA 4ECEA 2RSLA 1KYYA 2WSIA 1E94E 4LDRA 3CH5A 3QOYA 1RD4A 3B70A 2OPBA 1K5DA 2XKKA 2LCQA 1TNDA 4QJIA 5HNKA 3EPJA 2YUTA 2JEYA 1E0JA 1OAOA 4U1RA 1JPJA 1Y42X 3JARA 1WW8A 5AP9A 1QB7A 1BOFA 1XAGA 2H0AA 3LBNA 4JXJA 4BGEA 2P79A 4BNDA 1E7RA 3KPWA 2OZPA 3GNQA 1IQUA 3KSDO 3OH8A 2O2HA 4G8DA 4J1TC 4KH1A 5FWXB 3KLOA 4Y1GA 5FHRA 1ZH6A 3PUIA 1YBFA 2QUBA 3KSBC 2F8SA 3GWZA 3ADPA 3PA6A 3NBKA 3U7EB 5L53A 2AJDA 1QYIA 2GBLA 3H6HA 3OCJA 2X58A 2CLFB 1O6GA 1MOZA 3D81A 4WXRA 1E3TA 5EIBD 4TKMA 1RFLA 1H8ED 2ZI6A 2Y4NA 1PVOA 1MCZA 3S70A 1VE9A 1XCMA 3LC1O 5AMXA 5FBKA 1I3MA 4B3SB 3E27A 3GAAA 3K8YA 4NE7A 3NR2A 3OC6A 1UXIA 5F3RA 3PEVA 5ALSA 3W5BA 4ZYZA 1M2KA 2GRUA 1FY2A 4G41A 5DTJA 3VX4A 4ERXA 4QU5A 1GFIA 2CDRA 3GFSA 3EQ2A 3H13A 3O8OB 3L79A 3UMRA 5I47A 2HWYA 3TG2A 1KI4A 2X3FA 1FFAA 4LHVA 5HIAA 5I3CA 5JS1A 1R0ZA 4QTTB 2QN3A 3FN4A 3PVZA 1AMUA 4R1MA 4RZIA 4BO6A 2ZUEA 3RR2A 3EJ6A 4D8VA 4W99A 4AKSA 2OCXA 3DQQA 2QTLA 3H8VA 1I7PA 2QX4A 3UKOA 3VZSA 9LDTA 3FOEC 4AKGA 3FDZB 4K87A 2NTJA 2VCHA 3C7KA 4O63O 4UOQA 3ZV3A 1BS2A 3ZQ6A 4TROA 4F2HA 1QYXA 5J5VA 2ILTA 4XLTA 3TD2A 3JCZA 3OIVA 3T99A 1VCHA 3IUPA 4G1BA 2D54A 4FWBA 3IQIX 5EZ6B 3V1YA 4XVCA 4MQLA 4YJ3F 1P4AA 4RY9A 4MVCA 3AHCA 4GE0A 4NCJA 4DA0A 4JLUA 2GYYA 1YDGA 3AF5A 1GD1O 2PKWA 4JL8A 1OXSC 3L7AA 1ND6A 3SLRA 1VLMA 3TLEA 1Y80A 1RLUA 4XWKA 5AW3A 3RT1A 1GUFA 2BCJQ 2WFMA 1ZRHA 2OHIA 3CRQA 3QW2A 2XF8A 2REQB 2XYGA 4HBZA 4KQ6A 3UGTA 4YRSA 2K6GA 2G9UA 1NMSA 1Y63A 3GLFB 3LYAA 1FFYA 3HPRA 2NTYC 2AN1A 3ACBA 3N2GB 4ND1A 4NQRA 3P9KA 3ORRA 1JQLB 1RC1A 3WRVA 3RIXA 5U9CA 4XM2A 3T8YA 3WGGA 4I55F 4OMCA 5E4YA 5GJVC 4QTYA 1WBBA 2OV4A 2GEFA 2AQ8A 1G16A 1LDBA 2VH2A 1WCIB 2ATIA 2GHRA 3A26A 3O8OA 4K46A 4CF6A 4M55A 1XD9A 4HJRA 1IJEA 1DUVG 5JHGB 2IYTA 4KGVA 4WCFC 3KXKA 3I9OA 4RQAA 2BZSA 1UT6A 4UHHA 4AMVA 4B0PA 4DA7A 3DGFC 3MS7A 1FB5A 3CPEA 4DIBA 3RWOA 1Z4IA 5KKAA 2JIZA 3C15C 4BNXA 3UXEA 2P2CA 4AC9A 1M1ZA 2R1VB 1US8A 5JY6A 1YE8A 3D6MA 3DNFA 1C7JA 2GUGA 1RQGA 2R1ZA 3AUUA 3PPVA 5CYOA 1JV2B 2EWMA 1MNAA 3RBAA 5BSUA 3E1GA 1YAHA 3AQ4A 2BC9A 1I24A 2RAFA 4DJEC 3L43A 2ZRFA 2ZI4A 5AHRA 1K6JA 1G64A 1T4DA 2EZUA 3I04A 4FFOA 4X7BA 3WMWA 3PQ2A 4QSMA 4RORA 4CLXA 5AW0A 1IWOA 3ZWXA 3P2OA 1AJEA 1YRAA 4QNMA 3OTOB 3G5LA 3A0RB 3GCWA 1XNJA 3VO2A 1R8YA 4HN9A 3WG9A 1XTVA 1QG6A 1PK9A 3KK0A 3VR3A 2IBTA 3F9CA 5JJLA 3AMVA 2ZAYA 2VQFB 1VHDA 5T8KA 3JYHA 2DWUA 2QTWB 3ROTA 1U2EA 1IUNA 2FQQA 1KKUA 1Z0ZA 3OQVA 2V7PA 1GAJA 3BULA 4G01B 4MW5A 4OG2A 1TD9A 1QDLB 4OOEA 2EFDB 1N4DA 2AG8A 4AJIA 4IIVA 4BX8A 1Q6ZA 1WCIA 4HGNA 1C9EA 5AI6A 3JTEA 2PFSA 2EV9A 5HE9A 4GM1A 1GKIA 1T36B 2DM6A 1RAEA 4MULA 4F2PA 3CLTD 1W6RA 3F3KA 1TYBE 2ZJ7A 3C7TA 5B7NA 3FWNA 2DKNA 1Y9JA 2E5WA 2GEJA 3WMFA 3L4JA 1DTWA 4EY7A 2NO4A 1I4DD 2E89A 2NSDA 2Z2IA 2GJ8A 3CEPB 3G2PA 2Y68A 4YT4A 2Q62A 1W8DA 2I33A 1J0BA 2D7CA 3TQRA 1V8DA 1X2BA 4N65A 1Z82A 3BHJA 4NX2A 5DNAA 2QNRA 3GJSA 1NRJB 1K27A 2FLWA 3C3EA 5DTMA 3KP1A 5YASA 4LI0A 3NPAA 3QYPA 1MO6A 1KAHA 1NVKA 2CVPA 4PSVA 1PJ2A 2E6UX 4BVHA 3EQ7A 2ZB8A 5FHQA 2R7LA 5ESWA 3L07A 3OM8A 4UOZA 3EIHA 4HGYA 4B6OA 4F60A 2AW3A 3JTMA 4HGQA 4C22A 1L4LA 4YX9A 4QOFA 1UINA 3QMVA 1JR3E 2NXCA 1U90A 5IXSA 4KQIA 3U1TA 1ONNA 1HX7A 1E61A 1VGVA 4KDCA 1QPGA 1SUPA 3UJ3X 4WKNA 1KAMA 2XTNA 5DNEA 4LUCA 1K9SA 2GESA 5HZMA 2AHRA 3BFVA 1TZMA 4ZU1X 3WTCA 3SSMA 1ENOA 1OBVA 2GCOB 2PGXA 2YWHA 4GX1A 4MICA 4PSCA 1JN0A 4YWJA 1ACLA 1QP8A 3E7PA 2EWVA 2VUTA 1I2AA 3FKJA 1SUCA 4IV8A 2BGUA 3UEOA 3WZ2A 3UMJA 3H5TA 4AAYA 2XXBA 2VI5A 4UQPA 3U61B 1O6FA 4JHXA 2FN7A 5AJZA 2ZYGA 5L3QA 3UOWA 2C0PA 5AUNB 1PR5A 4LF6B 3GNLA 1DG9A 2Q5CA 1SBYA 3PC2A 2IBMA 2BDUA 4KFSA 1BEEA 4NBTA 3M70A 4RELA 3GFQA 1SQGA 3NKFA 8MHTA 1ETUA 3LWZA 4HB0A 4EPTA 1WB4A 1NR5A 1TT5B 1T8RA 3ADOA 3KQTA 3KV3O 1M66A 2P4QA 2FZEA 4J76A 4XYMA 4Q3OA 4INZA 4D8YA 5HUQA 4KEAA 3GJ6A 2AD5A 4G0XA 3M8KA 4HQKA 2PS0A 4UC0A 1CQJB 1Y6ZA 1P1CA 3HB1A 1N9ZA 4ZEOA 1JXMA 1LSUA 1VL8A 4IHJF 1RYHA 4RQUA 1XK7A 5JSFA 2FUEA 4Y2JA 5ALOA 1P9LA 4DJJA 1UQTA 3SCZA 3GI1A 1KJYA 4Q21A 3DKRA 2VF4X 4TZKA 3OZAA 1OH5A 3LAWA 2QMHA 4GQAA 9GPBA 4ZAWA 1U0BB 2AQIA 2YZ7A 2E0IA 4FUTA 3QNWA 4MWGA 4OQYA 4RF3A 5GM2A 1FMTA 3E8XA 4GOKA 4A0GA 4CIVA 4CEJA 5A4IS 5C7LO 1F7VA 5IVHA 3EIXA 1IJFA 1OX4A 4Y2PA 5HQJA 4HB2A 4GT1A 2R9VA 1XEAA 1WXDA 2XTAA 4TRNA 1RPAA 1PNRA 1NR7A 3OUZA 1OH6A 2ORVA 5TPZA 4GICA 2Z57A 4ZQIA 1F0NA 3UUWA 1X8XA 3QUSA 4LMAA 1GPH1 4DZZA 1M2EA 1RC0A 3CX6A 4C4AA 3L4KA 1MIOA 1QJCA 2ZTUA 3LW7A 1RSZA 3O4GA 4HRYA 4TQAA 3AB8A 3NT2A 3NOXA 3PV0A 1JDTA 3R0ZA 4IDFA 3MUEA 2OPHA 4IYRA 2WLTA 4KMSA 3SQOA 3WLJA 5CB4F 3W6UA 1R4MB 3QUTA 5L4SA 3HJAA 1IN6A 1QGED 4IVPA 2CB0A 4M89A 5LBTA 4PGHA 2VP5A 3C3KA 1T9BA 4N7BA 5EXPA 1BEZA 1E2BA 3UW1A 4RCZA 3HXQA 1MRSA 1BH6A 2I22A 3ST7A 4JVMA 1WX1A 3JQFC 3FROA 2XGJA 1CQJA 3KYCB 5K6AC 5KEIA 4HLDA 2FZVA 2LR0A 1V48A 2RONA 3G0GA 4IH1A 3IRVA 1LW7A 3MJRA 4O02B 4N7RA 4PVDA 3EXHC 4OO3A 2B8JA 1PN3A 1RHUA 2BUCA 1ORDA 4FTWA 3THRA 3JYOA 2WTUA 1PLLA 2JKVA 3E9ZA 2HWXA 5AFSA 3N2EA 3HDVA 1L4GA 4QYMA 4C7MA 4FD2A 2ZE7A 1EWQA 2FXIA 4RKYA 2V7EA 2VSXA 2PXHA 1ZJYA 1RYYA 1C4KA 4YV1A 3SEZA 1KP3A 2OWDA 1MDFA 4Z51A 1Y81A 2CUNA 4TYPA 2Y1GA 3GELA 3HKEB 1KZ4A 1Q1GA 4DEXA 4KXQA 3ZDFA 1KFEB 1EP3B 1N2SA 2CW5A 1M2JA 4RV9A 2VL7A 5KNCA 4LXXA 3W0LB 2H63A 1H22A 3DCIA 3MILA 4RMHA 1THMA 4QREA 4DCTA 4YUYA 1BH2A 4M8LA 3TOSA 1I4LD 2J0EA 4B17A 1GGHA 4M8KA 2BHSA 2Y9PB 3H2HA 4NG4A 5BW6B 2O2YA 5JVDF 4ZYYA 3IYLW 5B1YA 3P20A 4R83A 5HFNA 2GRAA 3M1IA 1OYYA 1R4MA 2IUEA 1VYHA 2J5XA 1ZI6A 4TLCA 3DMPA 4I81A 3DEZA 4WADA 5IC4A 3C87A 3CX4A 3EASA 4KO2S 3DL7A 1XHEA 1EP1B 3DV0A 4WOCA 2XE6A 2FQYA 4MEBA 4FN5A 4XQCA 2GEUA 2OY0A 3I2IA 3SHFA 4I4TF 4D9KA 1RRPA 4E3ZA 1CRQA 1IHOA 2JAHA 3JQCA 3IDAA 4Q6BA 2A7XA 1A3CA 1V16B 4S0ZA 2HLDD 2IKSA 4Q39A 4NV1A 4CTMA 1LBIA 1N5JA 3F0TA 1RS0A 3O6VA 4G09A 4L57A 5DOVA 3WRYA 1AD2A 1T6NA 2X9GA 5AHWA 4DIUA 1WPGA 1BMDA 1CUBA 1PG5A 4R1OA 3V97A 5FWYB 3SZGA 2VOJA 3H2KA 2YNMC 1QWOA 3B6EA 4ISCA 2FP3A 3BEDA 4JOCA 5EXTA 1CNEA 3I30X 4HDQB 3OEED 4D79A 3T5AA 3B78A 3DHNA 3HKEA 3EOZA 4P7JA 5FWNA 1CUGA 1QG4A 3STYA 3DP7A 4HH1A 4BB0A 3GDWA 4REOA 1GPYA 1J1ZA 1Q0RA 2YKGA 1NVTA 5KOHA 5FPYA 1LTQA 2WSSD 1UC4B 2G0AA 4D4IA 1CKEA 1QTRA 1A5ZA 1E4YA 2C8LA 2MSKA 3GPCA 4J0CA 1Q3TA 3LLCA 1VMKA 4RF2A 3TLZA 2C2HA 2YXPX 1UDAA 3SR0A 2ZIZA 3QLVA 4UAVA 1L5FA 2FPOA 1R5BA 2QYHA 2WUEA 3BTOA 3GT3A 3SYMA 4K28A 1KZ7B 2UZIR 5AW5A 5AKIA 4BFZA 3A3PA 2C7RA 1LFDB 3A1DA 1DBSA 1CF2O 2B6HA 5B4UA 2VHWA 2IYSA 4YT2A 3K0EA 1UBMS 3I2FA 2H5JA 1P0FA 3OM9A 5K8LA 2HUNA 3ZHUA 5LKRA 4O4LF 1XXLA 1Y1SA 1U8FO 4EG7A 1N8SA 1GU7A 3RIMA 3RS7A 3C98A 1EHIA 3WYNA 2OM6A 3KUUA 1R5NA 3GG9A 2C2YA 1MOPA 1XKLA 2I7CA 2Y71A 3KM0A 4J6FA 4JI6B 4BE7B 4LGVA 1ZOOA 5GTDA 3F73A 4UBOA 1AN9A 1V16A 3R4CA 3TWOA 4OHPA 2OILA 3VI3B 4HLNA 4IKEA 2HRCA 1P4SA 1OBCA 2J48A 2N0SA 2VWGA 3GRYA 3ILSA 4KLRA 3VC7A 4CHTA 2FEOA 5B2ZA 1ISMA 3S99A 2PCLA 5IX8A 4OXXA 4HO1X 3WBFA 1F2UB 1NXQA 2GK6A 2X7HA 4LOAA 1QQ7A 3TI7A 1PNQA 4AP9A 2IYYA 3QTTA 5FWYA 3DTVD 1JDBB 3OZ7A 3TXAA 3WMGA 5BUZA 3GUYA 4TWBA 3BH7A 3QKUA 3E3LA 1ZN2A 3N6VA 4X62B 2VJCA 3S0JA 1S2NA 3AB3A 5H68A 1M6NA 2OUKA 4LRWA 4R4JA 5AUOB 2P8JA 4TV9B 4C0KA 3ZVMA 4DLSA 2ACEA 3TRKA 1B6SA 2F1KA 4ND8B 4JJ8A 3IIMA 4HEA6 5I7EA 1XZDA 2DPYA 2ZUCA 3JV7A 1PS0A 3HXLA 1UKCA 3OE5A 4IV5A 1L5WA 3UG7A 2KLHA 4X64B 2OO7A 4B40A 5KJ6A 4BLRA 4YRGA 4Y0VA 5LU8A 3BDAA 5JWHA 3TTXA 2ZSDA 5KYWB 1JKMA 3NPMA 1GG5A 2IW3A 4J4BA 3ZHZA 4N40A 1XCJA 3O47A 4LYEA 1M2OA 2SKEA 2NO9A 5E9AA 4G0YA 2H5IA 3TAHA 2GF0A 1S3GA 1P73A 2DUWA 2QKYA 2QUIA 3DXYA 3MMPA 4FDLA 3T9AA 3FTPA 2I55A 3HA7A 5FAKA 1JHRA 1M83A 1X7XB 2ZBDA 3D3EA 4J0KA 4LYHA 1ZPDA 1BMQA 1TYAE 3HFSA 5KTPA 1FYDA 3NM6B 3FCXA 1JMYA 1OC4A 1P5ZB 1DELA 2YWGA 2WU3A 4EHFA 3NHRA 2VTBB 4PFJA 4P4LA 1Y8QB 4I5GA 3U3RA 4R8LA 3KALA 5LDDC 1P62B 4HAXA 4OI2A 2WIGA 4YB8A 3W78A 4CEIA 2ATVA 3QPBA 1KO4A 2V3WA 3HDJA 1T9GR 3HXKA 4MRMB 3T5TA 2I4IA 1SG0A 3C1OA 4OHBA 2IQ5A 2YJZA 4ZOEA 4ALJA 4PU0A 2G36A 1V5GA 1FJGB 5A9RA 2B35A 4ER7A 1Q74A 2EDCA 1M2HA 2PX8A 3L7LA 1H8HD 1UMKA 4X20A 1NJ8A 2DBYA 4FK8A 3ZUPA 2X6TA 4JR1A 4ZZ1A 3HQ4O 5JCJD 2H0RA 3RD5A 3KYJB 4FNOA 5KHOC 1RTTA 4TV9A 5DK6A 4B5KA 4WLFA 3UK2A 5CUQA 3I6QA 2P0AA 3LNTA 3PCTA 2ZROA 3OZSA 5BSRA 2X0NA 5EJGA 5DEIA 4UCWA 1MABB 2E48A 1P5RA 2GM3A 2R62A 1UR5A 2ZRIA 2H7CA 3BL8A 3R5KA 2ZBPA 1PWEA 3JY6A 3FJ1A 3GUVA 4HNGA 5EJFA 4TRMA 5BN3B 2B4YA 5ALTA 4TTJA 2JGFA 3HYRA 1COWA 1V0JA 1KS9A 2B8NA 2NV6A 4JIMA 4K7JA 3VR1A 4JIGA 3DE6X 4X8LA 4XQGA 4F8YA 5K2OA 1B93A 4LYGA 1ZO8A 2P6MA 4BFXA 4D3ZA 1S9DA 4Q15A 3ZE7A 1N7GA 2JARA 1RWWA 4ICIA 3VDXA 3NWEA 2ZYAA 1H65A 2OAP1 5AHOA 5TT1A 1ULSA 3A9SA 5CT9A 4C6TB 3GGCA 1Y1TA 2HBRA 2XUPA 3NDBB 2A84A 3R8XA 4MRMA 1J2TA 2GZRA 1E3SA 4RKRA 3DE5X 2WJGA 3R20A 5DSXA 3N2IA 4MHTA 4AKHA 4MOWA 4IFTA 2IU0A 3EDCA 3KOWA 4GLBA 2AZXA 2W0MA 2IKQA 3Q3VA 4H1UA 4LV5B 2CXNA 1O95C 1XZMA 2Z83A 3DZHA 2GXAA 1W34A 4ES6A 2QVGA 3EDYA 3B6MA 5CLQA 2ONKA 4RVGA 1FFWA 4N5IX 4QLAA 4TL7A 3E5RA 3R7WA 4Q05A 1AM4D 8ABPA 4EJ6A 4G4IA 5K3OA 2PIDA 5TGZA 1GDHA 2YJGA 4HR7A 1H05A 4YLYA 1DXYA 4TN1A 1MABA 4A2CA 2QROA 5K6TA 3JAMA 2C3OA 3CRRA 4B2YA 5KVVA 4EZBA 1L7OA 1QK3A 3LDFA 3ELYA 3W9YA 2IPLA 2OO5C 3R6GA 4URUR 3JVUA 3PRJA 5F77A 4UU8A 2JF0A 2RC6A 3J81k 4G1UC 2I4RA 1S1CA 1LWNA 4NNPA 4RTNA 3AJAA 4A23A 3OKCA 2WZDA 3PNVA 4I1PA 2AD1A 2QLFA 4UVIA 5KTMA 2PUBA 4KR6A 5KQLA 2ZJ3A 4HQLA 3WRXC 1Z13A 1I6KA 1XO1A 1GPLA 1TGVA 3I73A 3IE0A 1ZIPA 4RVDA 1RKXA 5I51A 4W5QA 3LYLA 1SKYB 1W88A 2CEKA 4MLZA 4JFAA 1PJAA 3O73A 4C6TA 2R8XA 2CXUA 4MYTA 2X15A 3GZ4A 5EMKA 4F4CA 5K8IA 2HL6A 2XYRA 1TLFA 3FUTA 5KTSA 1Q3KA 2EHJA 5CAEA 2IZOA 1ZRSA 3PD0A 3ELUA 2CFOA 2LXNA 5ECGC 1VXRA 5CEEA 4DM7A 1WUKS 4PZEA 1Z28A 2C82A 3FVWA 1HRKA 4LPKA 4W9NA 4XSVA 4UOEA 2F8LA 3DCNA 4MW9A 2J08A 5CG2A 4D0GA 4CIAA 2QE7D 2V9ZA 5A3QA 1TMOA 3K1AB 3WRWA 1FBNA 2CXOA 3E6AA 3T35A 4C6HA 7ABPA 3AI3A 3IAM6 1BO6A 4P0PB 3I6ZA 1EP2B 4IW3B 1L4YA 1VYUA 1ZGGA 3GP3A 3JQ7B 1NBIA 1AQNA 4DRXA 2CE7A 1V4BA 3W4JA 4ARZA 1CUIA 4AVYA 4DDVA 3BB3A 1R0RE 3RUDA 3W79A 5AJUA 4NKRA 5LBIA 2ATEA 2JRCA 2PUJA 2VUIB 2Q0QA 3HEBA 4XTRA 4UW9A 3UNXA 3WOHA 1S2DA 2GILA 2RG7A 2I5PO 4DN6A 1VSVA 2RHHA 1RAAA 3RS8A 4OK3A 5HIKA 1SZCA 4UEOA 5KU7A 4L6CA 3E9RA 1MA0A 4I66A 1DKRA 1VFNA 3EHEA 2OENG 1FVHA 4J75A 3UB3A 4JP8A 2UVPB 4AJKA 1ISSA 1E69A 1O96A 3BIXA 1KK2A 3KEOA 1UBSB 4AX8A 1M2FA 1SHLA 4UFNA 3H83A 1NWHA 1D6MA 2YJ4A 4UZSA 5ALFA 3JAKB 4FDAA 1JAHA 4M9ZA 3V7NA 1D4AA 3U7JA 3ZNQA 3OX2A 1EFRD 5B7PA 1BWQA 1HF3A 1C41A 2WA2A 3WXBA 1HE5A 5I7FA 4JT4A 2KJQA 3HY6A 5JH7B 1A82A 2HMWA 2AFVA 3CUUA 3UK0A 1X7DA 1FSSA 1UKVY 3W7BA 1YB6A 3NHAA 2O0JA 3GMTA 1G63A 4HEA1 4KX5A 4P7FA 1TQ8A 4F45A 1NNEA 1YTUA 3I5XA 1U2DC 3GFFA 2EHDA 2V6IA 1GDDA 3DE3X 3SEQA 5JSYA 1UBUS 4BTEA 4ESEA 1ZX1A 2ERYA 4ENUA 2HQOA 3K1AA 2HGZA 5ALWA 4EHAA 3BBPA 2M6RA 1FX1A 2CXHA 2ZTVA 4FIDA 4RTKA 3R3XA 2I6UA 3EZ6A 3G9XA 1IZ8A 3M5CA 1UZAA 3ZIAD 4WFIA 4PWYA 5K3AA 1SXGA 2FEXA 2O6HA 3NUQA 3L8CA 3QJGA 4IGKA 2P65A 1EAYA 5AIAA 5D6NA 3IDQA 4MR7A 4QVIA 1BMFD 1UDWA 1OYWA 4RHUA 1FDIA 1WXHA 2CFTA 3IKMB 2QTAA 2UYQA 5EE9A 4BN5A 1SD2A 4JI5B 3KWLA 3I9JA 4K9PA 3TIXB 3HYNA 4HRAA 1XAIA 1XZAA 1FQOA 2UVPA 3E0XA 5A4DA 1RI3A 1N6IA 4S1WA 4U9HS 4BASA 5A2GA 5LJLA 2UZAA 4GOXA 2PQ2A 3FVQA 2ZSBA 4MLDA 2J45A 4Y0NA 2FDCA 1EK1A 3JAKA 1RRVA 2XA1A 2XUAA 3KWFA 3NMUF 3CRW1 3AESB 3GP5A 2E4XA 3KOUA 4GXRA 4IDCA 2I1QA 3P96A 4PE5B 3LC0A 3OOEA 3L6CA 3RABA 3WIOA 5JAZA 1HNZB 4S12A 5LIPA 2XYPA 4C0AC 5F51A 4AU1A 5LZ7A 5BR8B 3C3PA 1T91A 2Q4DA 1H4VB 3CZRA 3R5TA 3TIIA 1V4VA 2WAXA 3K09C 4L85A 4Y1RB 4BUCA 4BGDA 4ZAXA 4YMHA 4ZVSA 4Q37A 4Q02A 3ZBUA 1HOXA 3A6EA 3RTDA 4EA8A 3IOEA 5EHIA 5GONB 1UIMA 5IVKA 2IXAA 1NQXA 4DCMA 2AF4C 3LL4A 1J49A 3CLTC 2QHXA 1YBVA 3F4BA 3UJ7A 3IOBA 3ZEAA 1JQKA 3NJRA 2XGOA 4Q9HA 1BOOA 1MEEA 4IDPA 4Q0MA 2FW9A 4LOLA 3FGOA 1WCXA 1BJKA 1NUAA 1SKQA 4RAOA 1QV6A 1KFKB 1AQ6A 1Z6TA 2PX4A 1RAHA 3QX7A 4JCCA 4KI7A 4DDHA 4A0RA 4B4UA 5K03A 1XRQA 3CONA 4QQ8A 4NZOA 3KZMA 1T2DA 1KPIA 3C97A 3PNPA 2IUTA 2QN1A 2YN2A 5SYNA 4AWAA 2G06A 1D1SA 4COOA 2OESA 5AI9A 2GETA 3E3NA 4C4PA 1II9A 5FTMA 3V8PA 3E48A 3L0CA 1ATIA 3MAJA 1VMAA 3PC6A 3DW3X 3S2GA 3PVSA 4E11A 1RM4A 1TZ2A 2OE2A 4TYQA 4RFVA 5KYUB 3W6NA 2P2GA 1QORA 2FX5A 3C8HA 4FCVA 2PK3A 3LS2A 2IP2A 4JEUA 4FQ8A 3Q7RA 3NVAA 5I9LA 2Y6VA 2EGUA 1MAVA 1PF7E 1QK4A 2XKJE 3D0RA 2QMYA 4UDOA 4RLQA 3AESA 1Y3BE 1NI5A 1LPBB 2BD0A 1X8KA 3JQBA 3KSRA 3NGXA 3PC8A 2C8VA 3GAMA 3R3SA 5B58T 5HWSA 3JWPA 2Q8NA 3QG1A 3EZXA 4F7DA 4AJHA 3IA7A 4JEMA 4LQDA 2ZPTX 1WS6A 3DNMA 4A0QA 4Y1RA 2PRYA 4EA7A 5HTKA 2J32A 2OOSA 1AUPA 4GR4A 3DCYA 4II7A 3M3DA 2FWJA 4ZD6A 2ZB7A 5FP0A 1A50B 3UAWA 3ILYA 5TQVA 3RUHA 3Q2KA 3WKAA 2H7YA 3DNPA 1DIRA 2HMYB 4V0ME 2FAXA 2IT1A 5TQJA 3E9QA 1KRWA 2BFDB 3K0CC 3REGA 1DRWA 3I4LA 4JZYA 1XA0A 1DXQA 4D9BA 4ZIRA 3GJ7A 1S3SA 2W8BB 2VYNA 3SXJA 4QTUB 3CBGA 4RJTA 4E14A 4P54A 4FZRA 1E4VA 3U60B 4TV8A 3AF3A 1XX6A 3HUDA 3OPMA 4KQXA 5A4KA 2V4ZA 1G0OA 4O4JB 2ID8A 1WXWA 1R10A 5FUVA 1Q7GA 4PZZA 1VPDA 4RJLA 1IRXA 1O77A 1FMFA 3DHVA 3EQ9A 3HVHA 3WAKA 3CEMA 1V7QA 2GD2A 2L19A 4G8BA 2NXWA 2H1VA 3PQDA 2LRHA 2QU7A 2QTZA 2XB9A 4KGZA 3X1DA 3B9QA 2R48A 4Z4GA 1D4OA 3GRCA 3U4IA 4PW0A 5A0FA 2ZCJA 2K5UA 3C6KA 5CTAA 3AVQA 1NQOA 3QBDA 3QOWA 1KDYA 5JY1A 4B81A 3I92A 3ZHXA 3KETA 3IAM1 5H4GA 1OLOA 2GF2A 1E66A 1T2UA 1U0LA 1V39A 4G0VA 3FTFA 4FONA 1JG1A 3ZCTA 2H07A 1ML4A 4HX5A 4HNVA 1ODKA 2P6UA 3CT4A 3P27A 3STWA 1JTFA 4KQGA 3FCYA 4ZC1A 2F3UA 3MF4A 4J1SA 5C8YA 2X9NA 3M9WA 5BR4A 3LH5A 4CDMA 4DC9A 4US1R 1EVLA 3LW8A 4RK1A 2BFDA 5LSAA 1P0MA 3OOSA 4LTMA 4P33A 1J9GA 2HHHB 1V43A 1K8ZB 2FOIA 2ZAGA 5EJ8A 2HAEA 2PZKA 2BGMA 2Y76A 2BOVA 2FSGA 3WB0A 4FEGA 1ANKA 2TECE 3MCTA 4P1ZA 5E3JA 5EUCA 1O5TA 3G0CA 3NO4A 3PCXA 4GZ3A 4IXMA 5T67A 1NBOA 1ZD3A 1BIFA 4LNAA 4X60A 1TPYA 3G88A 4O0LA 3O1HB 4N0QA 3ZCUA 1CEEA 1TD1A 3L93A 2XQFA 3UWDA 2O3UA 3E2PA 2D1QA 2J46A 3QVVA 4CMBA 3GYBA 2AK3A 1YUBA 3VGJA 1SM4A 3ZXUB 2P9YA 3G23A 4N4AA 2L42A 2VNAA 5K8JB 3GPBA 2J4DA 1D2HA 1W4ZA 1LPPA 5D3MA 2H2IA 1HDCA 3HKBA 3IEIA 3K9GA 3R6WA 4G67A 4PC6A 2PKRA 1Q11A 5GV7A 1ECGA 1P1FA 4MV4A 1Z4MA 4KPUA 1G3QA 1YQWA 1U8EA 3MGKA 1V5EA 1RJGA 4MWEA 5DI9A 4BXOA 5AWFC 4M9QA 3B1KA 2A9VA 2E87A 3OOJA 2CJWB 3JPYA 2ECOA 3DOJA 1U3WA 4I14A 4IJMA 3NBFA 4REQA 3OM0A 1QQTA 4Q48A 3CBQA 3TRFA 4GLOA 3GYGA 5AW2A 1KDVA 4YLGA 5JC1A 2X7JA 3DT9A 1NN0A 1FQWA 2VBGA 1BE6A 1PZMA 3FGPA 5J2TA 4OQZA 4UTZA 5EINA 3GVHA 3DZJA 1REQA 1Z3IX 3IVXA 4J9VA 5JDCA 1AGXA 1NN1A 2BMJA 1QFYA 4IL5A 2OLEA 2JLZA 5KIAA 2C99A 1L4FA 3BCSA 4D7AA 4M9UA 2UZ1B 4F85A 5KQGA 5GIPE 4JLPA 3B3AA 4B76A 1WPRA 4B3RB 4PVCA 4QYTA 3R0IA 5KO2A 1WETA 1X1QA 4KO1S 2P41A 4DQVA 2Z5FA 3LZDA 1IVYA 1K8QA 1NV9A 3NBMA 1RPJA 1SOVA 3NGLA 2G1AA 1MAAA 4FIZA 4FQ5A 4E88A 1KIMA 2RG1A 4RFSA 3PUWA 3PGKA 5CXSA 1L5RA 2DR0A 5L7TA 1ZRMA 1DBRA 1GUAA 1I80A 4UUQA 4MVJE 1I30A 4EO4A 1QIIA 3U7FB 4WY8A 1P3Y1 1E7MA 5KYWA 3EISA 1A9TA 4YAJA 4MGIR 5MN6A 1OAAA 3ED1A 2XWQA 3KT6A 1QU3A 2YWDA 1UUFA 2X8JA 4D0NA 2P6RA 2B94A 2YWJA 4Z9BA 4ZU6X 2SCUB 4AN4A 2BEKA 1ZCZA 3IB6A 3RV4A 2LKDA 2P6PA 3T9FA 2XQGA 2O1SA 3I23A 2OCAA 1ZXBA 3G6WA 3UHFA 5K8UA 2CJWA 2HXYA 3ACCA 1EA5A 1LZLA 4IDNA 3LZ6A 4LDJA 1QYWA 3KAJA 3O1LA 1E20A 2OT3B 1TVCA 1SZJG 3JWGA 4UPVA 5TE9A 2WWFA 3OFVA 2YV1A 3IT2A 1N5KA 2CN1A 3DZ8A 4PCVA 5H3LA 1VHJA 3N87A 3OFKA 4N7MA 3URMA 4ERNA 2G09A 1XYGA 1KBQA 3EUEA 2F4NA 3ONNA 4MA5A 4WA7A 1BN7A 3VU1A 1Z6XA 3QVSA 2XQIA 4RVUA 5BR7A 2NV0A 4OV6B 2IYZA 1RYZA 4XWGA 4C0BA 5JAQA 5C4MA 1IY9A 4B3DA 4R1TA 2VNSA 1Z0KA 3AFOA 3HXPA 1YCDA 1OGYA 1TJPB 2UZ1A 3L1HA 2GFQA 4GUDA 3B52X 4JLWA 4RIIA 5BPFA 4QRDA 2BE7A 3D4OA 4XGKA 1D4FA 2ADFA 4YPFA 4KREA 2CL6X 3RVSA 5TMEA 3CZCA 3R74A 1YB5A 2IVFA 4LDPA 2IU6A 5IG2A 4BO5A 2ZKLA 3SZ3A 3GUHA 2LIPA 3HJHA 4NBRA 1CQWA 4Z5XA 4NWIA 4IDGA 1Y9AA 1QF6A 1E6UA 3AEXA 5JXGA 3C45A 1XQ6A 1DC7A 1JF8A 3FPSA 1RHKA 1BYUA 1C1XB 3A0UA 4M1QA 3VO8A 1RXEA 5AVXA 2WWVD 3MCWA 2B21A 5JAOA 1WP4A 2WEKA 2IS1A 5L3SB 2HLHA 4ENTA 2DU8A 3ASUA 1JYSA 1DXOA 3LCMA 4JJAA 3NDPA 1ZHFA 1JLKA 4OHMA 5ECWA 5HMLA 2O8DB 1RYNA 2BGJA 1AGNA 3QEJA 4HAUA 5KPJA 1UK6A 1G2IA 2SCUA 2P9GA 4BLSA 2ZZNA 2G1JA 3UQYS 3LLVA 5EJMA 4C05A 1Y3FE 5IFLA 2HDOA 4WZ6A 2H8GA 4P81A 3DAPA 2OFPA 2G5CA 3WSTA 1UPTA 1WM1A 1AKTA 3N3BC 2RHWA 5DBGA 4EHHA 4R0MA 2XD9A 2JEOA 1R9JA 3L4BC 4L5JA 3SHQA 4CR7A 5B12A 1XRSB 4OD0A 3AF6A 3IVRA 3CB4A 4XR9A 3I58A 4EZEA 4KQ9A 4QDJA 2D6FA 1KZGB 1NNUA 4G0MA 1RP7A 4DCGA 4CEIB 2OBNA 5KVSA 2CSUA 2BGIA 4L8WB 4IVRA 1KF0A 4YA6A 5GMOA 4W82A 1J00A 3E81A 3W9UA 3G2KA 2PIAA 5GZ1A 3IQWA 5FL3A 2FFJA 3CSUA 5HQ3B 1KOJA 3O4IA 2BKAA 4TQGA 4Z53A 1ZN9A 4KXNA 3TKAA 1Z36A 4CFSA 4CYMA 1D5WA 1FLAA 1F3OA 2OFOA 5KVQA 2QRJA 1D2AA 3HVJA 5DT2A 3EIFA 3MBIA 2BAGA 1SUDA 4UHFA 4LHWA 1GRVA 5J5CA 3KFXA 5E0KB 5JJIA 2V8BA 1HDOA 4KRXA 1ZUWA 1WSWA 2IXDA 4LE2A 3U81A 3A9CA 4NS4A 3NHZA 3TQFA 2VKQA 3RV3A 2D0IA 3LGXA 4PQEA 5IJXA 3GY0A 5KINB 1U8TA 1YQEA 2PT6A 4Y6QA 4KR3A 5L3SA 3BD9A 5IZ4A 2P6OA 1VSQA 1YRLA 3OFND 4LS3A 4DPKA 1VP9A 4RIEA 1QPBA 3G0BA 5ICCA 4X7PA 2JVKA 2JKZA 3QVKA 1Q83A 4B5LA 4JV5B 3G82C 3EVBA 4GBMA 3ZY2A 4BMYA 3GEEA 2CFSA 5CLIA 3QMWA 3SYKA 1PVVA 3KQMA 4FYHA 4ER0A 1MJGA 4L74A 4PXSA 1MH9A 5C34B 5FR1A 1W4LA 3W2GA 1BU5A 1HM5A 5TVKA 1OIWA 1W8IA 5KNDD 1JX6A 4ARVA 1YQUA 3PJDA 2VTKA 4D4LA 1IK4A 1Q7EA 1V9LA 3R09A 3ZEIA 2CBZA 2GO1A 3P5SA 1QO0D 4BIMA 2ZTHA 5KX5A 4B79A 5GM1A 3FNBA 4HNRA 4D9CA 4ZAGA 4MR9B 5WRFA 2XXAA 1ZSNA 4ZO4A 3HU2A 3QBTA 5A1TA 5DH9A 3MQ2A 3F49S 4B3MB 3H17A 1IK6A 3IP7A 2RGEA 4TV9F 5JANA 3ND7A 5HQ3A 1PJ8A 1XNQB 5F2OA 3N5KA 3PNOA 2RH4A 2YHAA 4EABA 1KI9A 4OOFA 4JB8A 4TKVB 4WJKB 1BE0A 4R3NA 3DG9A 3CRVA 5AHXA 3TZCA 3EGXA 2WB4A 4I99A 4TWAA 1IN7A 3MVEA 4ABTA 1CF4A 2KB0A 2XNJA 3JQRA 2AFHB 4OQFA 4XIJA 3ANXA 4MV6A 4K1XA 4WV3A 3IHKA 3MW8A 5LB2A 1GGMA 1AIPA 1E6EA 2PQ6A 1EP9A 2BWJA 2PH5A 4QJ5A 5BWMA 5HK8A 1VJGA 2PJUA 4XB1A 5IF3A 1H2ZA 3DMHA 3ANSA 2ZBUA 2PS9A 4MVJI 4YRCA 3BCHA 1QC5B 1W93A 3M7IA 4FZ3A 4UMDA 4WL0A 4B44A 5DHTA 2FMHA 1KR2A 3HCBA 1QOZA 4IDEA 1PDOA 2W2XA 5E9WA 1PSDA 1Z0DA 3ESCA 4HFMA 2QIOA 3IKTA 4U63A 1QKKA 5JNTA 2D5IA 2PNFA 1OV6A 2CCKA 3QXJA 5EFOA 2CXTA 2JI6A 5AOVA 2DBQA 4YBRA 2DUUA 3IJRA 4DBLC 3CXUA 4H7JA 3TTWA 4F4IA 2J09A 3DDSA 3ZDEA 1G3UA 4KGDA 5ECDA 4ZJPA 2JGDB 3ENWA 4DMUB 1OIVA 1NUTA 2J3DA 4IQFA 4KFRA 4Q24A 4PNZA 1VE1A 5ELLA 2G9NA 4KVGA 3RSQA 4BV9A 5EHZA 4W5TA 4KZPA 3MXOA 1P1JA 3TTUA 1WUTA 3JZAA 1YNOA 3WYGA 4DHEA 4IEIA 3O8DA 3NBYC 4K26A 1A8HA 1E9AA 4IZ6A 2J0QA 2PRJA 5EKUA 3WL6A 2JD1A 3TG8A 1QGOA 1VP3A 1B0PA 2X4GA 1IBSA 1SKAA 4KBFA 4O4HF 5T3UA 2PGAA 3A9VA 1P3DA 3OCCA 2AFHA 2NQ2C 1BFKA 3QLJA 2BVNA 2O05A 4H16A 5DTQA 2XZTA 3MSCA 4Q3BA 1T4CA 5BSKA 4E6PA 1VBFA 2CVOA 3DZDA 2YX1A 2C7QA 2GGSA 3FD8A 2B98A 3P9IA 3L8EA 5F21A 4AP5A 2CD7A 3WLNA 5FUWA 4NPAA 4EYSA 2W9XA 4F5DA 3NVKI 4QPCA 4GOOD 4AUEA 3ENZA 1AC5A 4IGAA 4MMYB 3RFUA 1QC5A 1GEGA 2Y1XA 4I1YA 4LX8A 4W8HA 1VL5A 3HCAA 1HYGA 4RXUA 4YI5A 1AQIA 4JT8A 1JYFA 3NOQA 5BSGA 3T7IA 1PAUA 3O4FA 2FUG6 1PWYE 1VMDA 2DUNA 2I9PA 5HIIA 4J16A 1UXKA 3KT8A 1PQYA 4JVSB 3AR3A 4OB7A 3B3QA 2BE9A 5DYWA 3LCUA 5FRDA 2NUAB 3VYTB 4DC0A 3VH1A 4JLOA 1QF7A 2PKEA 2JDID 4A1FA 3ERCA 4FOPA 2OTCA 5LQAA 1PR2A 3DO8A 3ZD8A 2R68A 5I7OA 4YCSA 2ZDGA 3F1KA 1DB3A 2WD9A 4XSGA 1PS9A 2QUJA 1OLSB 3W4IA 4E1BA 1TVMA 1NYRA 5BNWA 1N6OA 1IHUA 3AP1A 4B2IA 1H93A 1Q17A 1XP8A 4TMYA 1QLJA 3OT1A 1TUBA 4J1TA 2AV6A 4HOYA 4MYCA 5G0TA 4BRUA 3BQMB 3EC7A 3QVTA 3KQNA 1UDRA 2HSZA 1OFHA 3FXAA 1NMEA 3FIJA 3A3KA 3B1YA 4PQRA 3CH7A 2GEDA 4IO0A 1G291 3G2MA 1NXXA 1T8YA 1W5EA 3O2SB 5TQ0B 3ZWQA 4NS1A 3PJFA 1CS4C 4RL4A 1PTKA 1AUOA 3CH6A 3TXYA 5DI3B 3PHGA 1ZNYA 1PEKE 4OHRA 3U16A 4D9JA 3P26A 4HJXA 4YMLA 2XQVA 1H3NA 1TYCA 3B5EA 1L8LA 1CHNA 1QM5A 2CUKA 1J0EA 3EGVA 4FGKA 4XX0B 1E2PA 5CNJA 1T13A 2ZZMA 1DKQA 4RE5A 1TIPA 1D8AA 2YWCA 2QSYA 1V4NA 5AI8A 4AO6A 1JSRA 2H18A 4AO8A 3F8TA 4QIHA 5CBPA 1XVIA 3WLLA 4E09A 5BNTA 2VCEA 2NGRA 2ZSAA 3GXBA 3UN1A 3ZI0A 1GZUA 1ZGHA 1P19A 4Y6GB 5HXAA 2RGGA 1PJBA 4EVSA 4QOIA 2AWNA 1N6LA 3UWOA 3WWCA 3OZIA 1C0EA 1PR1A 1IONA 1RWKA 4OHXA 1RYMA 3B1FA 1AURA 3D2LA 4RPKA 3V7FA 3CNLA 1M10A 4YMVA 1SIWA 5A9SA 3LXRA 2UUBB 1Z83A 3ROGA 1SVNA 3HUUA 1N0HA 3IVCA 1GCAA 2XCIA 3Q40A 5DM60 1YNSA 4G9GA 2O48X 1D2RA 1OLSA 1TQ2A 3E18A 2RGXA 3CT6A 4XEHA 2YHSA 5IWCA 2FSHA 3NWBA 4KH0A 5IS2A 2EOAA 2YFYA 4TTSA 2IS2A 1QRSA 3IP6A 4KR7A 5TQ2B 2FPUA 3I1JA 2BM8A 1UC9A 2IXFA 4IIFA 4KCGA 3EAQA 3HGQA 4UXHA 3EZ7A 3IUSA 1AN0A 4UPEA 3ZDBA 1M76A 4OLHA 3N0WA 3OTHA 3TQCA 5ALJA 4L15A 3KJXA 2WU0A 2ZSHA 1FA9A 5TQ0A 4BQPA 1PZFA 1N77A 1F6WA 4NL4H 4BPRA 1RZRA 4IHKA 3TGPA 1QYRA 3LF1A 3N2YA 2CD9A 4IVQA 2VHJA 2X5NA 4HAZA 4YAWA 2DG2A 3FYCA 2JGKA 3S55A 3VU9B 3P0HA 1TADA 1V41E 2OQ2A 3KJZA 5CNKA 5L9AA 1Z62A 4XX0A 1QFMA 1GVHA 1RVV1 3JD1A 3V8BA 1USKA 3KZ1E 4TS1A 3P0JA 4IDQA 1ECPA 5AHKA 5AW7A 4PAOA 2VUHB 3AHGA 3THXA 4WCFA 3F5DA 5JD5A 4JS0A 2AMLA 3LDAA 5KHAA 4UTOA 4FDUA 3NYIA 3EGCA 2WUGA 4GFDA 1FSZA 4E7OA 4Q34A 2NTNA 3DP9A 2LNDA 1SA0B 5JH7F 3I0MA 3TUJC 1XBTA 1S02A 3RHFA 3G9QA 4G65A 3CVVA 5IZCC 1CFZA 4CIDA 1IM5A 5B57C 3PFFA 3W5SA 3IP1A 2XZLA 1VGRA 5JO0A 1C80A 2J5KA 1IHXA 1JU4A 1RHQA 4X9XA 1Z22A 2LD4A 4IIEA 4EOGA 2FH5B 2Q5EA 5AK3A 2JHAA 2X5JO 5F73A 4BYMA 5KOJA 4KYTA 1FVXA 3AR8A 2AIRA 1T5OA 2MDTA 2RB5A 2B61A 1J0DA 5DLPA 2O2CA 1L7BA 2UXDB 1RP1A 1XTKA 3IP3A 3A36A 2CLDX 2HIGA 1CULC 2QSZA 3A2MA 3FTCA 3IPXA 3KIPA 3NU1A 3M6IA 5K4AA 2UU9B 1X3LA 5I9SA 3RG2A 1SNYA 4J49A 4UHDA 4U7DA 3PYMA 1C4WA 4V0MA 4EUFA 2XDYA 5FTWA 1GUDA 1YL5A 2QP9X 5JXJA 2LGJA 1X1TA 3DR5A 3OAAD 5GY7A 1Y3AA 5TXGA 3WO1A 4F9FA 2I62A 2VPPA 1YI8A 2YCLA 3F9RA 2IV2X 2XAAA 4LF8B 2K7ZA 4EECA 3OF3A 1FRNA 1NAHA 3VOBA 3W8RA 3BMCA 3WGYA 1QU2A 3S27A 1TO1E 4X3CA 4G26A 1GTZA 3AR6A 4BNJA 1XKQA 2OXTA 3WL3A 1SRQA 2QD3A 4MS1B 3WK5A 2EZ9A 2UVDA 1TK3A 5K7SA 3GARA 2K2WA 3K5PA 3RYCA 3A6FA 3SE0A 1KYVA 2WTXA 3ANTA 5IJ0B 2JBAA 2WIDA 5C1BA 4MSUA 3P9CA 1UDXA 1YBMA 2FLVA 2NV2B 4G4JA 2QT1A 1J7JA 4JD5A 4OQLA 4U02A 3EC2A 4XLZA 5DW3A 3V1UA 1QHHB 1USUA 3UFXA 1KOFA 4Z54A 5JYBA 3WGLA 4S24A 2OZLB 5TY0A 3IIJA 5ITSA 4IIUA 3UAVA 1J9ZA 3VR5D 3TBKA 5GONF 4EHLA 1EVZA 2J3MA 1YZFA 2OYSA 2VATA 4Y8VA 1SCBA 3GU3A 2C1XA 2RKWA 3UHOA 4FFSA 4G5RA 2QZ9A 3WIDA 3AZPA 2BLLA 1PR0A 3EHDA 3BIJA 3H2IA 1D04A 5D6OA 4PYNA 2TRSB 1JECA 1FFBA 1FF9A 5FB3A 2W2VA 3F8SA 4P7GA 2YBEA 5HRUA 3U3XA 2WNSA 3OLVA 4JU9A 4YACA 1B15A 2P9CA 2Q6KA 1S4MA 3C6YA 2QZ4A 3EZFA 4J07A 3GEMA 2JH9A 1DNPA 1I4EB 2PKXA 2VP6A 3OZCA 2WJZB 2HIMA 3SQDA 3ML1A 1QANA 3ZVKA 1L6IA 3OJOA 4GRIA 1JJ7A 4A8TA 5MFPA 4D0RA 3GLGE 4LTDA 5BPHA 2PE5A 1L7DA 1ZK2A 1L4MA 1IL0A 1T1IA 2GBPA 5KU1A 1T0PA 2ZLBA 1N3BA 3H6GA 4LK3A 3AG5A 1RE1A 1XWWA 3W05A 3I04M 5IJ0A 1JH8A 3SEFA 4ZDIA 3EEQA 4R2JA 2AB0A 2P5UA 4JX9A 3UTDA 3UV3A 4RX1A 5H9WA 5KYTA 2UAGA 4ZEVA 1QHHA 2QN9A 1VPLA 1A9QA 3A4IA 3K31A 1FDUA 3IBCA 4G5FA 4C88A 2WM9B 3IFSA 3O8NA 3PNYA 2PPLA 1Q20A 3U19A 4O0MA 2X2EA 2HPZA 2REBA 1IZ7A 2ZZKA 4H6XA 4G4SP 3D7RA 5EGNA 2AA3A 1WCV1 4QTZA 1ORVA 1XLTA 2FOXA 2VF2A 4MTCA 4WCDA 5AJWA 2XDAA 4FR5A 1ENYA 2P1ZA 1XRLA 4OPMA 1ESMA 5TMPA 1J8YF 2GPBA 2FCRA 1TZBA 4Q9DA 4X8OA 2G40A 1P2VA 3ZKAA 3VU8A 5JTUA 3SGLA 3ZGZA 2AE1A 2CDAA 3JZIA 3COVA 2DVMA 3IVGA 1EGVB 3HA3A 1A7KA 3ZW7A 2W90A 2JK1A 3EPRA 4O4JF 3W9SA 3CB2A 3B7WA 5ED4A 2QJRA 2XB4A 3GLKA 2AK2A 3KKPA 1SR8A 1CZKA 2QEQA 1G20B 2PU5A 1CUSA 2QI9C 2Y0BA 3FA2A 3H97A 2VAVA 1YS1X 4KTTE 5FR2A 3ASYA 3MTQA 1LXCA 1W2HA 4WNYA 1K89A 4DQXA 3ZXSA 1NVMB 1Q1AA 3IUNA 3QBVA 4X24A 3TPCA 2YZMA 4A2QA 2YRXA 1X0XA 3BREA 3WSVA 4DBVO 1L5YA 2CK3D 1XQ9A 2D1YA 2H31A 2ZT5A 4HPWA 4N39A 4XPIA 3WLEA 1WMAA 3PX2A 2K87A 4GPIB 2UZ0A 1EFAA 1DFGA 1UPAA 1WU7A 1IM8A 4PG4A 4XYGA 5J1TB 1FC0A 2J87A 2P9ZA 2PM8A 4OFBA 4AQDA 3O4JA 2HO5A 3SDZA 1OTHA 3QBJA 3P2IA 2KQUA 4C9BA 1E3MA 4PHTA 1G8SA 1ZVQA 1W52X 2QS9A 4NNJA 1NI4B 1R4NB 4J0FA 3UA4A 4D99A 2XZDA 3A05A 3GPIA 1KJNA 1TUGA 4GQBA 4ZT3A 3T3MB 2NSYA 1C14A 3KKKA 3NT5A 1NVWQ 3NOOA 3E9DA 4CT5A 4MW7A 3WNVA 4TSFA 3JQFA 4JKIA 1D2GA 1B1AA 4P0QB 1E1KA 5DO9A 4GL4A 4A16A 2COUA 2B92A 3Q7TA 3LA6A 1E9FA 2ISSD 3SDBA 2JA1A 2AI3A 3EXHA 1ZEMA 1DBPA 1BQEA 4IZOA 4QUEA 5E8JA 3TAXA 3OCXA 4R7GA 3HZOA 4QOSA 5CK4A 5CXQA 1JDJA 4LZLA 2XUGA 4TT8A 3SF8B 3NFRA 3OQ6A 5IT0A 3G59A 3L7IA 1JEYB 1BXGB 3EF0A 2H59A 1NNI1 3DA8A 3MMXA 3LZCA 4BKPA 4KV7A 1G1AA 3QXCA 5FV4A 4P82A 2WJIA 2VZ9A 1AE1A 4ZREA 4B9EA 3C7AA 1X3SA 2PV7A 2KYRA 2WDPA 1YHZA 2IUYA 1BHQ1 4HS4A 1RWXA 4E5KA 3MHTA 2IGTA 5AI4A 2D1TA 3DLTA 2Y1KA 4QPNA 3ANNA 4I19A 5FTLA 1EVJA 3HUTA 2YIDA 4EVIA 1NT2A 3L7CA 4KIGA 3ZW8A 4CL8A 2QVZX 1FXWA 1GYRA 1X7GA 4RK7A 1K75A 2E37A 2PGOA 4QO8A 4JBLA 1DXHA 1LDGA 4NFYA 4KSCA 2GXUA 4BZWA 4XJVA 3OO0A 2KWIA 1GZ5A 3SC2B 3L18A 1KNQA 2P75A 3Q87B 3LF2A 2QUHA 5JT1A 1C0KA 2R2AA 3RHZA 2V0GA 1UL1X 6REQB 2BEWA 1R4NA 2IUFA 3EQ8A 1VLHA 3KWMA 1RBQA 4HQ0A 4XYBA 4CQMD 1QKJA 1ZOLA 2LUOA 2PJZA 1KA9H 4G0QA 3NHUA 4HH4A 2GCIA 5KWJA 3CFYA 5KWSA 1TKRA 3ZOZA 3IUMA 5B4VA 5DRYA 4XDHA 1DBWA 4ND3A 4TKUA 3PKJA 1GGEA 2Y0PA 4N5NA 2SKCA 1EFHA 3LQFA 2AXQA 4MYDA 3WHKA 4A10A 4CM6A 4S04A 4RTPA 1HYQA 3G5AA 3S4YA 4KN9S 3THSA 2ASVA 3EZGA 4FW8A 1YJQA 1TYEB 1I8TA 3OIUA 3OTGA 1EVYA 4MDHA 3SF8A 1MQ9A 1YA8A 2P3OA 2ETXA 4QX6A 4ND7A 3WGJA 1IDN1 5IK2D 1BXGA 1JEYA 1AK9A 2E82A 2O23A 3K2QA 4CG3A 5JBIA 1MJFA 4LOHA 4GAEA 4QARA 5HM8A 4QDZA 3IOCA 3AV3A 2YNMA 5JO9A 2CXSA 1G2OA 4OQDA 1DRKA 5DHFA 5JNWA 5C4GB 1KYZA 1PT6A 2J67A 4HUQB 2WHPA 1OW3B 4HYYA 1ZZGA 4PZLA 2IH4A 1GGVA 2HBYA 2I7TA 3FR8A 4OKSA 3ZLJA 2ZVDA 4PLHA 1N5LA 4LHZA 3TAUA 1YB4A 3EC1A 1ZESA 4FOTA 1YRYE 4P4GA 1TM7E 2EL7A 3F6SA 1DRUA 2M6KA 5F9FA 2FSUA 4QO7A 4M8NE 3HDGA 5B3AA 2CLCX 4M8SA 3T15A 4OJQA 4GU5A 4TLEA 3DFZA 1X94A 2G1PA 4IR7A 1OF1A 4P6VF 1A88A 3F2VA 3SC2A 1PV1A 1ODLA 3HLKA 1YR6A 3OA0A 2A59A 1P5HA 3MYYA 4BLTA 2CJFA 1N8TA 1UPXA 3B20A 3GNSA 1ZINA 4RA9B 1KEPA 4CGYA 4LJKA 3T1QA 4F71A 6REQA 1JR4A 1QIHA 2R86A 1I01A 3R0VA 4YYEA 3U44A 4BMNA 5G3ZA 4QTXA 1EQ2A 1SD1A 5ALUA 1BDIA 2AEMA 3WV4A 1U0GA 2XRZA 3CTPA 3RJ5A 4XUGB 1FSGA 2R6DA 3MS2A 4HDRA 4MEAA 2C5GA 2ZI3A 4GPAA 4BE9A 1CQIB 3P97A 3LCCA 4JOBA 4P93A 5CVEA 4D3YA 1C8BA 1A72A 5A05A 1NQUA 1KYTA 2CDBA 4C7JA 4QAQA 1M8PA 4AZ0B 2OHGA 2BI4A 4MA0A 1GTL1 3D3KA 5HZKA 2J6CA 3W2EA 4PYQA 4BP9A 2CLSA 3PLNA 2EARA 3OHPA 5ABPA 1MOSA 1HTTA 3IHTA 5JATA 3KEQA 1NZFA 2W2LD 5G0SA 3HEAA 1KI8A 3VUEA 2KE5A 3T1VA 2JHFA 1JPUA 3NUGA 3CZAA 4DLUA 4O29A 4WZBB 5DXFA 4PINA 1Y6FA 1HE1C 1SBIA 3LUDA 3PE4A 1XD2B 1ABFA 1F5NA 3R5SA 3SKVA 4A8PA 2O54A 1YUNA 1NQVA 2LVBA 4G23A 1TIKA 1XTQA 2YY5A 4HEJA 2DQSA 1SHUX 3QPAA 4TXNA 3V80A 3VR5H 4Z8XA 1M6EX 4ALLA 4BTVA 4ACBA 1EEXB 5DASA 1K5PA 1N2HA 4FP9A 3STUA 2PANA 5G4KB 3IPYA 1UC5B 1U7DA 2J5QA 5FIUA 4RCYA 4I3FA 2QSJA 2BR5A 3OCWA 1CDOA 3HBAA 1XRJA 3GEIA 7AT1A 4D9FA 5BQFA 3A2KA 3DQPA 3AWIA 1M1NB 1XZLA 4M1KA 1ZMRA 1V6SA 2XCUA 4ND4A 1U2TA 5KWVA 3G1TA 4QGHA 4QBFA 4AY4A 1CQIA 3LHFA 2GSWA 3AVWA 1NJGA 3FPAA 3HLTA 4PYMA 1PJRA 4OHWA 5DX1A 3SXUB 3U0VA 4DIOA 4CW7A 4L27A 1VKRA 3LC2O 2AXPA 1IOZA 4AJ4A 5KREA 3QVGA 3H0CA 2DH6A 4B33A 3KYDA 5AW4A 4L8GA 4WX2B 5CT6A 2IITA 4DY6A 5M29A 5IXJA 2OZKA 1W1UA 3UWMA 4ND5A 1CB7A 4DARA 2OM2A 3ZE0B 4DA6A 4R6WA 1J25A 4QDUA 3WJ2A 3DC2A 3DZCA 5DYNA 1DSSG 1QRTA 1H2BA 3TZKA 1G4HA 1U1CA 1WF6A 1XD2A 2Q1TA 1NU8A 3PQ8A 3VPBA 1VIAA 2QN7A 4ZEXA 1CETA 3HCEA 4R51A 5FADA 4RYLA 4ENRA 4NBNA 3TF5A 1G6KA 1ZA2A 1YR8A 1NHWA 2MIIA 4MW4A 4B3IA 2DJIA 4QM6A 5DDIP 1Z5GA 3QTBA 5LOVA 4LSWA 3OFJA 3U9SA 4G0UA 1AHIA 4RLHA 1P61B 1Z15A 4DVJA 5FWAA 2PFGA 3LXMA 4OF4A 4IH4A 3U3DA 4B3FX 5C52B 2QRKA 4EFMA 2FQXA 2CVHA 2ZE6A 4KXUA 3E82A 1SC4A 2Y27A 3KJEA 3OOWA 4YMGA 1EH5A 1NATA 4KXLA 4AF6A 5LQCA 3QSYA 3SJUA 3B8HA 2QQGA 4EJ0A 4MO9A 1VJCA 3NBZC 1M1NA 4TYMA 4QBTA 1M5UA 1P39A 2BFOA 1UBFA 3WNDA 4CNBA 3A1UA 1BSVA 3DBRB 3GF4A 4UXJA 4R9RA 3E2MA 2TSYB 3T95A 4V3BA 5I4BA 4TT3A 1AXEA 1U8ZA 3ETCA 4QYWA 3HB5X 2H92A 1JH9A 1CIVA 1DPGA 3DDNA 3LHIA 3ZXXA 5FBQB 1T1JA 3F6PA 3RTBA 1W5FA 3ZE8A 1TAGA 2ZI9A 1BKDR 3EG5A 4Q4AA 5ILQA 3ICCA 2OCBA 4FYWA 2WF6A 2LCIA 3U0BA 2E4WA 3NHKA 4FS3A 1U0OC 2GWRA 5HF8A 3T94A 4OYYA 4KRFA 1RI2A 2V1XA 3A6HA 3IJPA 1XMIA 4MJLA 4PPYA 4DV0B 4JXZA 4DXAA 2OUIA 4LCBA 4OM7A 4OLAA 4BGVA 5IBRA 3GRUA 1SBZA 4EI2A 2G5TA 3IESA 4FDMA 4DLNA 3LFTA 3ZJVA 4MR8B 4DXDA 1ZR4A 3BB1A 3OIDA 5CH8A 2C5HA 3CLRD 4GX2A 3SIXA 2E18A 3FTNA 3AILA 1KEVA 3BCUA 3FZGA 4NFLA 3TNFA 2EQ5A 1JBQA 2OO5A 1OFUX 5IDQA 3MPUA 1ZD1A 3HO8A 2G8NA 3AF2A 4M0LA 3NP7A 3AVOA 1RXSA 1P0IA 4RETA 3EK2A 3M34A 4E13A 2EJTA 4FCTA 1Q7RA 1Q0UA 4JI8B 5C46F 4BP1A 2BKLA 4MI3A 3IO3A 1QFXA 3BIWA 4HDKB 4NR0A 1PU2A 2X2FA 3QU4A 3SVLA 2PL9A 3ZZUA 4C21A 3PR2B 5HMMA 3V00A 1U4OA 3K9FC 1DC3A 2IYNA 5JJKA 3D7LA 1ZW1A 3DBRA 1M6HA 2RHLA 4MUJA 4AF7A 4DBLE 1GR0A 3VKVA 4N1AA 4B87A 4V1CB 5FX2A 5KSZA 2V5AA 2VWHA 5L3RA 5DLQC 1ORHA 2PJDA 1E5TA 1H8EA 1G8GA 1L1EA 2AVNA 1VE6A 3I1FA 3H5IA 4OUDB 2H1WA 3G85A 2BT4A 1TKAA 2HQ1A 3QI2A 3FKQA 4UBIA 2QRUA 1TT7A 1UXJA 2AXEA 3FUVA 4JUIA 3T4XA 1WHSB 4FM9A 3TQTA 3R5XA 4C08A 1P2FA 2H1OA 2CLEB 4JUFA 1U8UA 3T0IA 3ENNA 3CVWA 4QECA 5ER9A 4BNLA 2IDKA 4YAKA 1T2EA 5C8XA 1I36A 1ES9A 3QYJA 2QIPA 3KWJA 2I0FA 1QQAA 1I4WA 2XF2A 1FJHA 4R69A 1LW6E 4B2LA 1KK1A 3K5IA 3FPEA 4DIKA 1BX3A 1ENPA 1RADA 2L0XA 1TVEA 2UZ3A 3B1WA 3LE8A 2XVMA 2Y2UA 2YOGA 1JKFA 1BD3A 4GYWA 1Z8FA 3C6MA 4L6IA 4NYMR 3HCWA 5CDFA 4OQQA 2FPPB 1SU4A 2PLWA 5BV1A 3JYNA 4BS9A 1FJXA 5HPYB 1OYOA 1RTKA 1VZ2A 4C89A 4D4KA 2O8CB 5HR5A 4FE4A 3CU5A 3RK4A 3K9CA 2HJGA 1EG2A 2ZJ5A 2GA8A 3PFKA 3EOAI 3UAXA 1BKSB 1BCRB 3WLKX 4GKKB 1R88A 5K05A 2Q0SA 3P9ZA 3S2ZA 2PMFA 4HDKA 4EKNB 2IRWA 1YRBA 3JATB 1K68A 4QGAA 1EG7A 4D3FA 4INOA 4EYGA 1XHLA 4PXYA 1J2JA 5DGTA 1IM2A 1MTZA 4LF4B 2FUNB 4BMCA 3FWPA 4KIJA 4Z8YA 2V7VA 3IALA 4YXWA 4HUTA 2B25A 1KFCB 1KI2A 1J2UA 4W7SA 5IBQA 4CLRB 1FIUA 3SZRA 3RVJA 3ZY5A 1IMJA 3L0OA 4FN4A 4OUDA 2X3UA 4LXTA 3PNSA 4LDZA 1YF3A 1G6OA 3C14C 4N0MA 1KE1A 2FMUA 3WL5A 4WRRA 2DC1A 4YCBA 5FPPA 2ZT8A 3TTSA 1U2DA 4I1OA 1ARZA 1SK8A 5FEUA 3TCXB 3GIWA 1XU7A 1CS0B 3HBLA 1XTRA 1N2XA 4KPEC 1CX9B 2NZJA 5ALDA 3JYLA 5HRCA 4NQZA 1P2BA 1MFPA 2A0WA 4EGAA 2HHJA 2VK4A 1GTMA 4CMHA 1R6XA 3JS5A 2OORC 1BS9A 3QXSA 5DT9A 4QU8A 1P6UA 3EDQA 4OHOA 2I2BA 1ZVJA 1UBRS 3E58A 5TF0A 2O8CA 1GQ2A 1WZ2A 1Z68A 3BILA 4OHFA 4QU0A 2DPMA 1SUFA 2J7PD 4KE6A 3HFJA 4MUKA 2VRNA 2EATA 1MZPA 3VR4H 3WKCA 2J8ZA 1AKQA 2O7SA 3H2GA 2AKYA 2C5FA 3GLGB 1EUCA 1QNLA 5IKXA 2BMFA 3JATA 4N3AA 5A62A 1PBNA 2JLYA 3I42A 4XDZA 3CEHA 1KNXA 3K8OE 4P8RA 5A0TA 2ZM5A 1HG1A 1E64A 2HLNA 3C5EA 1VHQA 3J7TA 4AZ3B 2PUTA 1XAHA 1QFZA 2JAXA 1JHQA 4FPXA 3U7GA 4QL3A 1GA4A 2C9DA 1E58A 4FSXA 3REQB 4CLRA 4GOJA 4IHQA 4WN9A 4C5BA 2I80A 3G5TA 3RF6A 4N9WA 4CWAA 2ODEA 3H9EO 2XITA 1R50A 3AUSA 4NJEA 4BQIA 2FG7C 1P5FA 1OHHA 1WIWA 4UVHA 1QGUB 2HY7A 2FX3A 4WACA 4NULA 1XA3A 1SCUB 5IMBA 3K09A 5CA1B 2FA9A 1RC8A 3EWAA 1HO3A 2X2OA 4ZQBA 3LK7A 4DC1A 5CA0B 1IZZA 2IJGX 1HDRA 4GLLA 2D2IA 3OOYA 4UKDA 1NG9A 3QKTA 2ZE8A 4FGLA 1U98A 4W1RA 4RK6A 5JASA 3NH9A 1PK7A 4E2WA 2O06A 3NHYA 5CLHA 1OB5A 1GKUB 2J5BA 1WMEA 4B4KA 3MTDA 3BJMA 2BI8A 3H1PA 2GB4A 5G2OA 1NYTA 2GH1A 3MNFA 3I76A 1T1GA 4EYKA 2P91A 4X66B 2D0OB 2YXLA 4L4SA 2IDZA 3BMOB 3ZR4B 1IOWA 2CGEA 5C1PA 4N0DA 2XY4A 1MH1A 4PQGA 1XMSA 3BFPA 5ALMA 1AKNA 3CN7A 3KPYA 5C5IA 2BFFB 1GTVA 3DDOA 2XDWA 4L8YA 3ED5A 2Y1FA 1GQOA 3JQEA 4B82A 1UEIA 3PK0A 3F2IA 1R0LA 3S5JA 2FUKA 1XZEA 3GLGA 1F4PA 4A36A 3DAOA 3KJQA 1EU1A 1OYVA 2W6QA 3IQZA 2OA0A 3AO0B 3F1LA 3CNNA 1U6JA 4LNUB 2G9ZA 4XLLA 1VJTA 1MXHA 1LDYA 1UAYA 2BHRA 2C07A 2NOAA 3OJWA 3SE7A 4ASUD 4BNMA 3TVTA 3LK6A 3DLCA 4DILA 4Q12A 1EFCA 2ID7A 1E3DA 3ZPXA 4DCCA 2IH2A 5AVYA 1K3FA 3GQVA 2B82A 3T41A 1HPLA 2JD2A 1UJ2A 4CTKA 3IE2A 5BYAA 3PU6A 1PUXA 2H0QA 4L4RA 3DOIA 2LPMA 4BNIA 2Y1CA 4DNQA 4JNKA 2GZHA 5FA8A 1NSTA 3LPCA 1DTSA 1O6ZA 4JFRA 4CLOB 1NVBA 4HNSA 4POOA 1Z18A 2HT6A 1RZ3A 3E7DA 5ALZA 1K98A 2C2OA 4ADSG 2HMUA 2P68A 3R7AA 4L3OA 5DV9A 3RADC 1FYWA 1TM1E 5THXA 4EQ6B 1DQZA 4HK4A 4R98A 1TF7A 3WWZA 1INLA 4C29A 1ZR2A 1L5OA 1RRCA 3K0CA 2Q5IA 4DSNA 1XZPA 4NDZA 3JASB 1TEVA 3WSWA 2QRMA 5K20A 3FBWA 4KQEA 3EBLA 1UOQA 3FVTA 4JL6A 4UEKA 2Z04A 1H2EA 2NZ8A 3CMCO 4A6PA 1YE5A 3G2IA 3H87A 4AZWA 2D2XA 4IIXA 3R3YA 2Q3FA 1WXEA 3UT6A 3ZHYA 2JLUA 1QZTA 4ZN6A 4UDXX 1XTUA 2JJYA 2HF7A 2Y66A 2YZGA 4M53A 1K88A 4N0PA 2XIJA 5B36A 1THTA 2RBEA 1CZUA 4RULA 3NKVA 5HQTA 5F7XA 4DLVA 3FDXA 4GSLA 4ZV9A 1CY1A 1W96A 4KLNA 4K6MA 1PR3A 4WDRA 4KW7A 4LNUA 2WF8A 2ZATA 4JC4A 2UZ4A 5IASA 4TGLA 4O2AA 1FTGA 1Q0LA 2H2AA 2E6KA 2MSCB 2QT9A 2Z5GA 3NRBA 4W1QA 5HIJA 3WADA 2Z6UA 2OVBA 3RIYA 2ODTX 2XR1A 1DKPA 4LY9A 2QM3A 2D5CA 3MMZA 3NIBA 4N03A 4XD2A 1SEPA 3L2OB 3IAAA 2FWRA 1GITA 3LC7O 2O7RA 3FUWA 1KAOA 2XMGA 1G2QA 2YYSA 3WZMA 4GOND 4R1LA 3V4OA 1WVIA 2F8MA 2P7IA 3F6CA 3EGIA 5DCUA 3ICPA 4EHBA 5HGXA 1U9JA 1CE8B 1NF8A 1EDEA 2EX0A 2FR8C 3M1LA 4R0VA 1N9GA 5THKA 4EQ6A 4ZVKA 3ZVLA 4LVNA 1Y6QA 4MUYA 2A6PA 1E1YA 4DS3A 1Q12A 1R12A 2X42A 1J8VA 2H1LA 3D8RA 3JSAA 3GLRA 4OP1A 5C31A 5BMVA 1R9MA 1DINA 2PSEA 3SAJA 1KSFX 2GBIA 4ZZ3A 2FRVA 5BXQC 2BMEA 3WICA 5EE5B 1XTIA 5AVKA 3ZCSA 2E49A 2G5GX 4HWKA 3GGJA 1XD8A 2PTHA 4UBLA 3BXZA 4FD3A 1ZUD1 2JFGA 4XFJA 3TQQA 1RW4A 1UMBB 3W6PA 1GKKA 1QYCA 1H0SA 2B4QA 2H1CA 2BF4A 2FQWA 3WOVA 1MJ5A 5CM2Z 1PG2A 4BGIA 2VNJA 2Y4OA 4HNAB 3SIPA 2DPLA 4TTQA 4F5YA 4LF7B 3WDKA 3M4ZA 3H6KA 1EX9A 4QYIB 5AXBA 5DF1A 4BKUA 2O2DA 5C7OO 1XLVA 2GKSA 5LP6B 5LWQA 4OX9B 4K9SA 3TZLA 4E5SA 3AY0A 4J9UE 3M1AA 1GGKA 2VJKA 4HVAA 1JSCA 3SK0A 5BUQA 5FUQA 1CC1S 1OGJA 2PL3A 2VRCD 2WJVA 4AY3A 2DXIA 1UJ5A 1Z0UA 1CY0A 3DEHA 4TQ9A 1Z9BA 2H29A 3AHIA 1XQ1A 4ZQHA 1YFJA 2H1SA 3CJQA 3N3AC 1WULS 3PB3A 3UK7A 1OZHA 3EY9A 2D3WA 3GLIB 5JLJA 1Y5MA 3WV5A 4O3MA 3TLYA 4OATA 1NOJA 1SKMA 1EDZA 3LLSA 1N6KA 1VKHA 4KP7A 2YV4A 1MHPA 3PUXA 4NZZA 3U4AA 1DOAA 1FLNA 3QMMA 1CE8A 1CTQA 1NN5A 1S5PA 1QR2A 2QMQA 2XUJA 3A9TA 3DMGA 1F17A 3EUFA 3NYWA 4GBJA 1U7HA 1LBHA 1IXSB 5ESRA 1W48A 4KLCA 4L9SA 4TSKA 3P4YA 5LQJA 1DQRA 2X0RA 5IDYA 3HL4A 3WKEA 4EX6A 4FFRA 2ZAMA 1CJCA 1VSBA 1Y1KE 4OYHA 4ZAVA 4R8RA 4GF5A 3T9CA 1UXGA 1VRVA 1WD7A 3E15A 3PSHA 3VISA 4RMIA 4Z0NA 1ECLA 1UMBA 1EWRA 5HKKA 4G5HA 4FKZA 1JE0A 4CCYA 3DMYA 4WKGA 2CMHA 3BVPA 4MQ4A 3MCAA 2FE1A 1BS1A 3L7BA 2KBEA 2RGBA 2RIPA 1SXHA 5DNUA 1RKBA 2E3JA 1VKZA 1ZBDA 4QYIA 3VGPA 3VPFA 3X43A 4D3DA 5KTOA 5LP6A 4E5NA 3C3WA 4UQLA 1HOTA 2QM8A 2UYGA 2ZQ5A 1WBJB 2YVKA 4RK4A 5DYTA 4GIBA 1OUMA 4I3GA 1ZCJA 1NDHA 3LCRA 2HLDA 3CIOA 4FYXA 4M1SA