2QUZA

Crystal structure of the activating h-rask117r mutant in costello syndrome, bound to mg-gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNRCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Mutation analysis in Costello syndrome: functional and structural characterization of the HRAS p.Lys117Arg mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, hydrolase
total genus 63
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2quzA00
2QPTA 1BIFA 4BEJA 4YDHB 2YHSA 4MGIR 4ZPXA 5JHGB 1KTVA 3L0PA 1XTSA 2ORIA 1P2SA 1YE8A 2YV5A 4B6EA 4WXRA 2XNSA 5JRZA 2AX4A 3K8YA 1DO2A 3QVVA 3I62A 4DLTA 4BFSA 4P3YA 4V02A 1TF5A 3NH9A 4PSAA 4QBIA 1G1MA 2O8BB 2WIBA 1KO4A 5K8IA 1AM4D 2IHBA 1VG9B 3VR3A 5BWMA 3CNOA 4LHZA 4Q47A 4NPHA 1OB2A 3H2YA 1W48A 1M2OB 3N70A 5EE3A 4ZI2A 2JIZA 4K46A 3C16C 3AM1A 1KJWA 3ONWA 4ZIRA 4QG7A 4YONB 4BE7B 4EKDA 1XJ0A 3GLGA 2BMFA 3W34A 4D0LB 3KUCA 2QQ0A 4HEJA 2Z83A 4V0LA 4DDWA 4JLJA 4I1OA 1GVNB 3NTUA 3VX3A 1ZU4A 3AB3A 3EASA 2IUSA 3E2IA 5GVSA 4D4MA 2IYSA 4LCBA 3AH8A 1WXQA 3LLUA 5CK5A 4II7A 2JLXA 4TLEA 4PTLA 3U2QA 1Z22A 4HLUC 1Z3IX 4UXHA 3QQ5A 5DSZA 3AV0B 1T5LA 3U3MA 2WHXA 3WYAA 4EPRA 1FX0B 3SZRA 1KKLA 1EWQA 4W7SA 3C4JA 4B3GA 2CE2X 3GCGA 4MGZR 2OILA 4US1R 3GLIB 1U0JA 2FDCA 1SGWA 2IF0A 5DI3B 3SYNA 4Q48A 1GDDA 1XTRA 2OCPA 4LYFA 4AYWA 1EXMA 2E1RA 3D8BA 4FCVA 4K8OA 3B2EA 3EPHA 4P0TA 1CJMA 4PZZA 2QE7A 1XTKA 5A5GA 4OK5A 2XITA 4PHHA 1OFHA 4JSYA 2IK8A 4IEIA 2OAQ1 1UF9A 4GFDA 1NVVR 1T91A 4HB4A 4I1SA 1OIVA 5L8VA 4MGKR 2JA1A 5FR2A 3I5XA 4NYJQ 5KOYA 2FMXA 4GOJA 4JLKA 4C0LA 1F3OA 2RAPA 2H18A 1U8YA 3GJXC 2WWGA 4BRWA 1SQ5A 2J1LA 3L43A 2CL6X 3IIJA 3OAAA 2OXRA 2VEDA 2BJWA 2ATVA 2IA5A 2FGJA 8OHMA 3NXSA 4DSNA 2NO6A 4GP6A 4BLPA 2GAOA 4NYIR 1NBME 1ZNWA 5DN6A 3EPKA 4DEYA 4LJAA 4KFSA 5FOXA 1E3MA 3IHLA 2O0HA 2PCLA 1GL7A 2E9SA 2IYQA 2ONKA 1TNDA 3QBVA 4KYUA 1IHUA 5CYPA 3B85A 3Q72A 4TMVA 3K1JA 1TTTA 5B58C 2H16A 5CIWA 1W36B 1NMXA 1I4LD 4W5WA 2ODNA 1OYWA 4RD2A 1SKQA 3IILA 4F92B 1ZAKA 2DHRA 3L82B 1P3JA 3PEUA 1DELA 4GRAA 4PPFA 4R2IA 4EPYA 2CNWD 4M21A 3RHFA 5KSYA 1CEEA 3VTKA 4EPWA 1R10A 4BUJA 3C41J 4MRVA 5DGXA 2JLUA 4WOPA 5JI2E 1UKVY 1Z6XA 2RGAA 4MA4A 4CDGA 2OEPA 2Q3MA 2FFBA 3DKVA 4XD7A 1SKYB 3WRXC 2N46A 5F9HA 2X8AA 5KSOA 3KXKA 2ORVA 2GXAA 4Y0VA 4PC3A 2IC5A 2QSYA 4XVRA 3CIOA 1MO4A 1KZ7B 2REOA 2KI5A 4ESHA 4FMBB 2VQSA 4URYR 1HQYE 3SNHA 1COWD 1XCGB 1KZGB 1Z0IA 1ZBDA 2QMEA 3LAWA 1OFUX 3CWZA 5CM9C 2OO7A 2QQEA 4A6PA 1G3MA 3LXRA 2OM2A 1EFRD 1T0JB 1T9HA 4MDEA 3BD9A 3NH6A 2Q6TA 1SXJD 4KVAA 2BHRA 1TQ6A 5KNCA 1Z47A 5CYOA 5K8TA 2ZSEA 1R2QA 4JLMA 3GLFA 2C9YA 2P67A 5IT5A 2OT3B 3EC1A 2ZEJA 4YLGA 4CEJB 5FR1A 3ASYA 2GCOB 4PSVA 3VR6A 3PQCA 2B8TA 4NYMR 4BWYA 1G3RA 1G5RA 5SZIA 2KE5A 3BGWA 1Z5ZA 3IQWA 5E3HA 3C15C 3UANA 4B34A 2WMNB 1EFTA 2JDIA 2F43A 1PLJA 3SE0A 1BOFA 3C5CA 2LWIA 4TL6A 2R6FA 1P6XA 2X2FA 4KBGA 1WRBA 2F3TA 4IJMA 4Q4AA 2PZGA 2CK3A 2YVUA 3W5IA 4A2QA 3AKDA 2B7CA 1CJKC 4DBLC 1L4YA 3QVUA 2VP2A 4TMTA 4M9QA 5SZKB 2WKPA 4M1MA 2QBYA 2IL1A 3CR7A 3T06B 2I1VB 1JQLB 2V55B 1S3GA 2FV8A 5KTYA 1YU9A 2QNRA 2ZR9A 2XXAA 1R6BX 2QTVB 1S8FA 4NCNA 4U02A 1KSHA 4Q4HA 4OI1A 3RVBA 4DXAA 3BFXA 2P3SA 3ICEA 2H7VA 1P2VA 3UMSA 2ZJ2A 3CX7A 1GWNA 2XOKD 2J0SA 3TNFA 4DVGA 2V9PA 4IDNA 3QXSA 3AQ4A 1Z08A 5AUQA 1UBGA 1VYTA 1KK0A 1TPZA 2P5SA 2WIAA 2ONJA 3WMGA 4C0KA 3OEED 2HT6A 4ZDIA 1D9ZA 1M6NA 2R6AA 1G7RA 3T61A 2CEAA 4QJ5A 4V0MA 3AVTA 2GF0A 2VTKA 1DO0A 3SHWA 4O25A 4GOXA 3DM9B 3UG7A 4IOJA 1ZW6A 5DO9A 4MH0R 3S1AB 1XP8A 1L8QA 2FN4A 2FU5C 3IKJA 4M1YA 1KDRA 3ZD7A 2WWHA 2IX3A 1OXUA 3B1VA 2X19A 3BOSA 1XMVA 2F1JA 3W8RA 4QJ3A 1RZ3A 2FPLA 3QEOA 3AVWA 2FEOA 1XXHE 1L4UA 3W90A 2OFXA 2YJTD 2WV9A 4IW3B 1ZP6A 4TTQA 1U94A 3ZVLA 5IK2D 2WJGA 1A4RA 3WP0A 4L5BA 3UK6A 3LXXA 4D25A 3PITA 3K0FB 3SR0A 2ZE7A 4EUNA 2FE4A 2J0UA 5A0FA 1IJEA 4PC6A 3DOEA 5CK4A 4OI0A 3GEEA 2W58A 4PO9A 1UKZA 4MYTA 1NI3A 4HUQB 1OH6A 2ZS9A 5HE8A 2QY9A 2GCPA 2DYKA 2FX3A 3OZXA 3AEZA 4LV6A 3ZS8A 5EE5B 4IDPA 1E9FA 1R0XA 4MKIA 2BBTA 3BB3A 2ZAOA 1JEEA 2PMKA 4DWJA 3HWSA 1TEXA 2WJYA 1JJVA 2NQ2C 4CVNA 2VLIA 3PFIA 5D3QA 3K70C 3GLGE 1AQYA 3WXMA 3THXB 3NHAA 3Q85A 1FTSA 1OE0A 3R20A 1GM5A 1NVWQ 1KO7A 1TMKA 3IBYA 3MSXA 2W6IA 3NBFA 1RRGA 4RD4A 5M04A 3DMDA 1ODFA 1T6NA 1F2TB 3WMFA 2ZI4A 4OQLA 1WMSA 1MABB 1IN7A 5KDLA 1ZVQA 1FPMA 1PZNA 4A6XA 4HAYA 4XJXA 2IS6A 2YNMA 2ZRPA 3U44A 1XCMA 2ZR0A 1QVRA 3Q5EA 4M1SA 4M2LA 3BB1A 3GEIA 3TSOA 3GD7A 2YC2C 5CDFE 3W6NA 4OBEA 4A8JC 2J3EA 2ZRMA 2YOHA 3CRW1 4PPQA 5L3SA 2JLRA 1E2DA 3REFA 3T1TA 3AGQA 4B75A 2YKGA 3BH6A 4TSFD 1CBUA 2C78A 1JEDA 5DHFA 3RWOA 2R8RA 3LBNA 3T1QA 1Z28A 3CX6A 1XD9A 3PVSA 5JJKA 4Q00A 3VKWA 1XCPA 4WBSA 1MO5A 1SVIA 2ZSDA 3RRYA 3BJIC 1M7BA 1LY1A 1EX6A 1JI0A 2X77A 3AUXA 1ZM4A 2JCSA 2PJRA 421PA 3PCRB 4JJZA 5A4JA 2YWHA 1W0KA 2DWOA 4Q5IA 1R5BA 1LNZA 3NBZC 4D6PA 1XRJA 2LKCA 2GJAA 4UJ3A 1RRCA 2KSQA 3BFKA 3QKTA 3TVDA 1VYVA 2HLDA 3NIBA 3CNNA 1NN1A 3I8XA 5ELXA 2V7QD 1G3QA 3JVUA 4XWAA 3OEHA 5IDVA 4AKGA 1NIJA 4DC9A 2GJKA 1XF9A 1R5OA 4JVLA 2A5YB 2HJGA 4KVGA 4F93B 3TW4A 2A78A 1FOEB 4P4UA 3BORA 1GITA 3K9NA 2KBEA 3GFPA 4XSHA 4TQ9A 3QKSB 2ZYWX 3GQBA 1H8HA 1LF5A 4LPSA 1BYUA 2J7PD 3K0SA 3TH5A 2EFGA 1N6KA 4HDCA 4PC2A 2RB4A 1CP2A 4MUAA 2ZJYA 4AYXA 1UBFA 2JAQA 1YZQA 1E9BA 3LW7A 3L0OA 4BLRA 3A4NA 3BB4A 1U8AA 4W5HA 1NMYA 1XDBA 2AXNA 2DFTA 2ZRIA 5EE0A 2R6DA 1YZNA 3DMNA 1LVGA 2YOFA 4A82A 4LJ4A 1G6HA 1D2NA 2JJ2A 4KXFB 4ABYA 3FYHA 4D81A 3GPLA 2GZDA 4V0OA 3LLMA 2MSEB 4DT1B 2VA8A 4OKSA 2G0NA 1NY5A 1YKSA 4LBZA 4H9GA 4C3ZA 4U5XA 2QPOA 3D31A 3EZ7A 4QGHA 5E7JA 1EFCA 5FI1B 2W0MA 3VU9A 4F4JA 3HR8A 4KU4A 4TT3A 2WJVA 4RKEA 2WOOA 4UNNA 3U5ZB 3OHMA 3VR4A 2XSZA 1TEVA 4FN5A 2B92A 3B9PA 1QG4A 3IPXA 4HDQB 3EWSA 1SVWA 1YZKA 2FA9A 2NZ8A 2ZRLA 1UKEA 1SVMA 5EQTA 4PFSA 2CBZA 2FEMA 1SVSA 2GK7A 3BBPA 3ZJYA 2QAGA 2AWNA 3QENA 4NHOA 1XB2A 4WA7A 4Y0AA 4YXWA 4TYYA 5JWRA 1PLLA 3GJ3A 4Q02A 1EESA 4F38A 1E2HA 1G8HA 2NOAA 5EZ5A 3RABA 2JJ1D 4JLBA 3AF3A 2GK6A 2WICA 2WBLC 2BKUA 4URXR 1E9AA 1MT0A 2ZUCA 5J4VA 3I1FA 5KSPA 1A2BA 2JGNA 3C7KA 1KI2A 1IOZA 2RGCA 5HCIA 4MRRA 1Z0KA 4OHVA 2BMEA 4IFEA 3LWNA 3VMFA 5JCZA 2A7QA 2PBRA 1D8TA 5HZKA 1FNNA 3DKPA 4XVQA 4ZO4A 2HXYA 5JSZB 5AWFC 1ESMA 3H4MA 1QHGA 4A92A 4E09A 4UXJA 2V1XA 1U98A 2IUTA 1ZUIA 4JLDA 2BIFA 3NBYC 1ZU5A 4JBXA 3SQXA 4M53A 4KO8A 2J41A 4M1WA 3AUYA 1GKIA 1MO3A 1FTNA 2G1JA 2WSSD 4RVCA 4HAZA 3GLFB 2AFHE 4AWXA 1W36D 2ODWA 4JT4A 2AR7A 2JLVA 3SN6A 2QTFA 5EXPA 3L0SA 5L3VA 4DLXA 4KFRA 5IF9A 4O3MA 1NSFA 2Z4SA 2FSIA 1NVVQ 1NJFA 1NF3A 2ZE6A 3N2IA 3QPUA 1GKUB 4P4TA 1AKYA 4M1OA 3UKDA 2NMVA 3DDCA 4IXMA 1OYYA 3Q3JB 2GJ8A 3THWB 5GJWC 3H1TA 1X3SA 2A9KA 2WWFA 4TZ0A 2CL7X 1F60A 1KI1A 4IVQA 3SJZA 1E9SA 1E94E 4S35A 5BN5A 1AIPA 4NYIQ 1O3YA 1FUUA 4O2RA 4DLYA 2FFQA 2FZ4A 5JEEA 1HY3A 4BLSA 1DAHA 2ZUDA 4QNMA 4RD3A 5KPJA 3FMOB 1VIAA 1DAGA 1YR6A 2XXAB 1RIFA 4BLTA 3TIFA 4WAUA 4Q4HB 4NL4H 2NGRA 1EGAA 4Q1BA 4TMWA 3ZZUA 5CJPA 1E1RD 4LYJA 1N6LA 1DADA 4QKQA 1JPNA 4DUGA 2IXGA 1EX7A 1GL6A 3W3AA 3ZQ6A 2ZJZA 5B2ZA 4B32A 1S9HA 1Q12A 1Z2CA 3K53A 4D4LA 4RJLA 1OKKD 1T3LA 2JASA 4G5OA 3REGA 3RRNA 4DJTA 2ASEA 3SBDA 1II0A 3TSWA 1LW7A 3SU8A 1P75A 1UBCA 1E79A 4QHYA 4AYTA 2W2XA 3T5DA 1KY2A 1P61B 3NEJA 3B1YA 5C18A 1XFAA 2Q21A 3LNCA 2YINC 3UATA 3BK7A 4LV5B 5C1BA 4OHZA 1CS4C 3A1TA 1JNYA 2PT7A 2OV2A 2Z0MA 5HPYB 3LDAA 1WQ1R 2D62A 2WPDD 2ZRCA 3FFBA 4ASUD 3FMIA 4NP6A 4POAA 1KMHA 1FUKA 3LO5A 3KTAB 1GOTA 4ILEA 5J4LA 5AUNB 1N25A 4NYMQ 3SOPA 1R0YA 3EIHA 4G3XA 1E1QA 4OHYA 2UKDA 3QUSA 4FD2A 4R98A 3LBIA 3B9QA 5GADl 1ZC4A 1E0KA 1N6IA 2VPPA 1J7KA 2YOGA 5BN4A 2FSGA 5BYKA 3EIQA 4Z54A 1TF2A 2RKOA 3EA0A 2A5GA 821PA 4LJ9A 1Q3HA 1GNQA 1V43A 2V4ZA 5JZVA 1G19A 1HTWA 3DOFA 4D26A 1NJGA 4BGDA 2DFKB 2WWXA 3JZMA 3VR1A 1H65A 4US0R 1CKEA 1HEIA 4TMZA 4ZKEA 2MSDB 4KYIB 1PUIA 1ESNA 2WMOB 1DARA 3R7WA 2I1QA 3KKOA 3GJ4A 1T3HA 4LC0A 5C4MA 3IO3A 1JR3E 3B1XA 1XXHA 1YQTA 1JQJC 4I4LA 5AUPB 5KDOA 5FUXA 4ACBA 1OXXK 2P6UA 4V0KA 3WHLA 3EX7C 1IXSB 4AKHA 1E96A 2ZU6A 1KAOA 3KQHA 3IO5A 1KJYA 4HAXA 1LFDB 1CF4A 4G5QA 3PENA 3KZ1E 1IM2A 3ZVRA 4C2TA 1CJTC 4A1FA 4E03A 1MR3F 1I4DD 2UZIR 4IVPA 4PANA 4KSBA 1DEKA 4QOSA 4A36A 3BC1A 1G4AE 3I4LA 1E69A 4MRNA 3HPRA 3GJ6A 4QGGA 4RFSA 5JWOA 3THYA 4E22A 3UMFA 4WZAE 4DDVA 2F55A 2EYQA 4ZCIA 3TR5A 1CJUC 4JLOA 1E2JA 1ZUHA 4LSGA 4ARZB 5JS7A 2NG1A 2ZROA 1H8ED 3SFZA 3EZFA 4AIIA 5H8WA 4JT2A 4EFMA 3RAPR 3UG6A 4Z8XA 1C4OA 3CRMA 2W6JD 3K0AB 2CNWA 1QHIA 2VF7A 1QHXA 3T12A 4M22A 3AF4A 5CJ2A 1HE1C 2RGNA 4C4PA 1AGRA 5TXGA 4DCVA 2W2VA 4JL8A 3VAAA 4A0RA 1FMLA 2WZQA 121PA 4MGYR 2VH5R 3IUYA 3WBJA 1VCNA 4M4SA 4F4IA 2IS2A 4OQMA 1MRSA 4CEIB 5CDFA 5DE3A 2ZSAA 4OJQA 4EPXA 2MSCB 2R6GA 3T5GA 1COWA 1G291 3H84A 4LZZA 4I81A 1ONBA 3ADKA 4Q01A 4AY2A 2AK2A 1UDXA 1KK1A 5P21A 4B71A 3ICQB 2WVJA 4NU0A 5FOUA 3UMRA 3W8NA 1AK2A 2VSOA 4PO1A 4HAVA 3F3YA 2BJVA 4LDJA 2QA5A 4YC7A 2YYZA 5FUWA 1W49A 1X8KA 2XTMA 3TVTA 2GF9A 1DG3A 2G6BA 2CCJA 1G4UR 2EFDB 2EVWX 3FVQA 2CDNA 3L8YA 4M1KA 4NTZA 3A6PC 1TX4B 2CJWA 3DVLA 4ZI3A 2Y8EA 2XTNA 2IWRA 2ZI9A 2QEQA 2CMKA 2QENA 1G7SA 3ADCA 1HH4A 1VMAA 2VP9A 1FW6A 2YZ2A 4KI0A 3TLXA 1K5DA 2GXUA 1E2PA 5EUMA 4B2LA 4GNKA 2B6HA 3AP3A 3K0EA 2Z4RA 2UVQA 3NWJA 3IEVA 2OAP1 4JMPA 1MRNA 2O8CA 2BEKA 4IOMA 2BDTA 2WWWA 4LHWA 2QM8A 1YR8A 1PV4A 4EIWA 4GI7A 3R8FA 5DYGA 2JIZD 3VNUA 3WNBA 5F9FA 1P4SA 3AF0A 4GT1A 4DLZA 4B48A 3A8TA 2ODEA 3QF4A 3W5JA 2D7DA 5DYIA 3T1OA 2D7CA 1RJ9A 3HU3A 1Z0FA 1GP2A 2G1KA 2XOKA 3LA6A 3KQUA 1U0HC 2DR3A 5LD2C 4DSUA 1I4TD 4I1UA 2ZIAA 3H86A 3OEEA 1NLFA 3X1XA 2BM0A 2N1BA 4RSGA 1NN3A 1C1YA 1QHYA 2CVFA 4UQOA 5BN3A 4DB4A 2ZRBA 1G41A 3AVUA 1G16A 1US8A 1J99A 5EP4A 1FZQA 1Y63A 2GTPA 2Z6VA 4ZDKA 1CR0A 1II8B 4TLCA 221PA 3F0TA 2BVNA 3CO5A 3G5UA 3LVQE 2QAGB 1TQ2A 4KV9A 2QMOA 2PZFA 3IGFA 3PUYA 2FSHA 2P0EA 5AJYA 4XSGA 4NCJA 5AJWA 3SQWA 4A8JA 3CZQA 5KDDA 3NG1A 1N3BA 1IQPA 4GBMA 1ZM2A 4L15A 5DIFA 4CEHB 2A5JA 2QE7D 2GNOA 1TQ4A 1HURA 2WOJA 1DAMA 3AVXA 2ZJBA 2IUUA 2ZITA 2RMKA 2ANCA 4NKRA 2GILA 1OHHD 4ZDJA 2BMDA 3TJZA 3EC2A 1XEFA 4LYHA 1KSJA 1XNJA 3RLFA 4MUBA 2IYYA 2P65A 2QP3A 5E95A 1KNQA 1ZM7A 3D6TB 3OAAD 3ZVNA 5CM8B 1N6RA 2ZJOA 2XZOA 1R0ZA 1IY1A 5GJVC 1XTJA 3TKLA 2W00A 4R2HA 1F2UA 1DAIA 1MV5A 1JJ7A 4P4SB 3W3ZB 2BM1A 2AHOA 2HEIA 2RGNC 3X1DA 3W9YA 3DEFA 3NDPA 3D3QA 4BFXA 2BBWA 3ZVMA 3KKQA 1IY0A 3BRWD 1IXRC 3KQKA 4Q7MB 3MFYA 4E5UA 2ZR7A 3JZAA 4URUR 2GJSA 1P9WA 3B13B 3CH5A 5FPHA 4TTPA 2QMUA 2OXCA 5FPTA 2KWIA 2L0XA 5HKKA 3U3KA 3U7FB 3HR7A 5G41A 3CRRA 1N5KA 2F6RA 3IHWA 3P20A 1VPLA 2IT1A 3QPVA 5IRCD 1YR7A 2QPAA 1SXJC 4XD7D 2WKQA 3BWDD 2XB2A 4EDHA 2D74A 4IDHA 4Q1AA 4HZUA 2GZAA 2OFOA 3KL4A 3WHKA 1I2MA 2D4HA 2JATA 1U9IC 2HF9A 4QBHA 4LBVA 3NC0C 1OH5A 1A7JA 1XMSA 1RVDA 1FP6A 1Y3AA 1G5PA 4URVR 1DAEA 2XNDA 4KBFA 1Q0UA 2V3CC 1CULC 4PQFA 4DZZA 2CCKA 2QRNA 2QORA 4IXNA 1C9KA 2ZRGA 1R4AA 2FGKA 2J46A 5L3RA 3AF1A 1W44A 4IRUB 2Q9CA 4Q9IA 4B3XA 1OH7A 1MO6A 1A82A 3DM5A 5EXTA 5JLJA 4G01B 4NH0A 1PVOA 3ZH9B 3QBTA 3VR2A 4ACAA 4ZKDA 5F2EA 2RCNA 4BFZA 5E7MA 3K9GA 2ORWA 3QNUA 2VP5A 4M8NE 4C7OB 2C04A 2XJ9A 2CLCX 4U7DA 2RGGA 1ZC3A 1G64A 2CE7A 5FL3A 4FI3C 4HSEA 2CK3D 1YHNA 4I1VA 4Q1FA 1E4YA 1NLYA 1S4QA 1VIYA 5G3ZA 4E07A 2JLQA 4K81B 5EZ6B 5DNYB 2V6JA 4KSCA 4IDQA 5EJEA 5E7IA 1IBRA 2ZU0C 2V7QA 2OCAA 3A1VA 3C14C 4OJKA 2H1LA 2VIIA 3R9WA 3LQQA 2O8FB 4KITB 3AF2A 2PX3A 1KIMA 4RD6A 2PJZA 4C0AC 1KMHB 1OIXA 1NMZA 3FDIA 4DHEA 3CNLA 3K0CA 4B74A 4RCYA 3QPWA 3SS8A 1D2EA 2NPFA 5H70A 4A2PA 2G83A 5B57C 2C03A 4X8LA 3U61B 1ZCAA 1IJFA 1WBDA 1KHTA 4Q4JA 5H1YA 4V03A 2YWFA 1E32A 3K9LA 3KXIA 4AG5A 4PZYA 4DEXA 1S0UA 5C2JB 5LB4A 3SEAA 3FHOA 3SJBA 3TSZA 4PAMA 2IXEA 4Q9JA 3RS3A 2JLWA 2FF7A 3KQLA 3AVVA 1KYIA 2C9OA 2R62A 5JEDA 1G3UA 2P6RA 2QTHA 3LW8A 1SXJE 3X1YA 3RSLA 1GAJA 5E4FA 2IS1A 4D82A 1TADA 3FMFA 4URZR 3QI2A 3DZ8A 2F1RA 2QUZA 1AGPA 1T4GA 4XTCS 3A37A 5FOSA 3EZ2A 1XXHB 5KNDA 2WKRA 4LX0A 1IN6A 3CPJB 2C2HA 3K09C 5JHHB 1ZD1A 1XJCA 5KU1A 4ITRC 5FI0B 1G9XA 2ZANA 3MWYW 3NKVA 2IYUA 2Q0HA 2DB3A 4TYWA 2VHJA 2DFLA 2AN9A 3BH7A 4R71A 5FTLA 1QHSA 5TDHA 4YDSA 1Q57A 4NMMA 1UAAA 3P32A 3GLHE 3SJCA 3FMPB 3E70C 2O5VA 3PG5A 3BFVA 1K6MA 3THYB 3O8BA 2VP0A 3QF7A 1N6PA 2RGEA 2CXXA 4ZIRB 5J5CA 1E2IA 1OSNA 4Q1DA 3FKQA 4IOLA 3GLGB 1LF0A 2OSBA 1JR3A 3OIVA 2PLRA 1Q21A 1UDWA 2O52A 3QXJA 3GLIA 5DI3A 1TUEA 2AFIE 2JJ1A 4C30A 4P32A 2WJHA 2RGDA 3AKEA 3P4YA 3FFAA 2W6ID 3BIFA 1XWIA 3RRZA 2IYTA 3U4QA 4FCWA 1CR4A 3V4RA 1Q1BA 3A4MA 1KDTA 4FWTA 3HDTA 1WDTA 3EWAA 3B8HA 2SHKA 3RSOA 1F48A 3VFDA 2GESA 4Q7KA 4PX9A 2WAYA 5EE1A 2GETA 3LFUA 4R7ZA 4B3CA 4PC7A 3OIUA 4YMWA 1W0JA 2V6IA 4AURA 4Z1MA 4AD8A 4GL2A 1Z06A 3CRQA 2VP6A 3RS5A 1IAQA 3U3JA 4Q03A 2BEJA 4QGFA 2GXQA 3TE6A 1E2GA 5AUOB 3CKLA 4OK6A 3HJNA 4OI4A 2WWYA 1YVDA 3QKRA 1UBEA 2ZE8A 2ANBA 2ZI6A 3ASZA 1ETUA 4FW9A 1Z29A 5KHOC 4BFWA 4RZUA 1BMFD 1WCV1 3BERA 2CLSA 5FBRB 3AVYA 3QXCA 1SVKA 1AA9A 4LGMA 2Z5FA 3VHXA 3WY9A 2VSXA 5B64A 1DG1G 2CJWB 3CX8A 1GIAA 3MWLA 4EJSC 4PO8A 4DLSA 4HLDA 5DI9A 2AD5A 1DPFA 2QL6A 4QM6A 1SVOA 3M1IA 4IKEA 2DWQA 3P1JA 3I3SR 1SVLA 1GZSA 1GILA 2HYDA 2FPMA 2QN6A 3RS4A 1BKDR 1W0KD 2VF8A 4XWKA 1EFUA 3FKSD 3K0CC 4FWIB 2ZJ8A 3ZD6A 2RHDA 4LV8B 2O8CB 1OW3B 1QF9A 2ZAMA 3CZPA 3UIEA 3R9IA 4CGZA 5JS8A 2ZSBA 1CXZA 3GEHA 1BO6A 2GEUA 2HLDD 3IDQA 3PR1A 2AKAB 2CVHA 3H0KA 4BZPA 1Z83A 1ZIOA 2HCBA 3OF5A 4B6FA 4JKIA 3ZQJA 1E0JA 1IN8A 3LD9A 4Z8YA 4ZCMA 3ZIAA 4A0HA 1IXZA 1NL3A 1AKEA 1SHZA 4BFVA 3K70B 1RJ9B 3L0IB 1E1RA 4HDOB 4CEJA 2J0QA 2JEOA 1DAKA 4MRPA 1Z6AA 5EXSA 2ZRJA 4LUCA 1H8HD 3EARA 1OKKA 5BXQC 3X2SA 4KFUA 1GNRA 1YZGA 2MMGA 1AS3A 1KSGA 3WP1B 1VCOA 3AGPA 2DFNA 2OLJA 4C0BA 3HYRA 3KJHA 5GVRA 3CRVA 4O0MA 1Z07A 2W2TA 4L9WA 4LJYA 1P9RA 1OFTA 2GXSA 2OUKA 1Z6YA 4LOAA 4PPNA 4BFUA 5EXXA 1VCIA 4A8JB 2J7KA 3IQXA 5JFGA 4DLUA 1M8PA 3NEYA 1AS2A 4HZIA 1E6CA 1PJRA 2JJ2D 4ASUA 1CLUA 1J8MF 1HV8A 4A9AA 4HATA 1KDOA 2WM9B 1HT1E 2F43B 1MKYA 4N0DA 1KJZA 1KDPA 3K9HA 3WBKA 4JLAA 3FTQA 4Q4AB 1XD2A 1W4BA 3V00A 4B35A 1IY2A 3W6PA 1IN4A 3Q5DA 2C5LA 3KUDA 3OE7A 4RCZA 4LWZA 4TT3D 4H1VA 5TVKA 1Z0AA 2NPIA 3KJIA 5FL7D 2ATXA 1NKSA 1GKYA 1PLKA 2BC9A 2PX0A 1JPJA 3OFND 2QBYB 3UWKA 3VNVA 1XZPA 1U8ZA 2GBLA 1KI7A 2ZTSA 1T8UA 5FFMA 3FPAA 1M7GA 3TAHA 1G21E 1T3SA 1E2LA 3S1AA 1HUQA 1XJQA 2P2LA 3N5CA 4G0NA 3TQCA 4D4KA 5LB2A 2ZETA 4XVUA 1W46A 2I4IA 2IYWA 3CPHA 621PA 4AKIA 4CRWB 4UNQA 4I99A 5G40A 3Q8XB 2ZYTX 2H17A 3NDBB 3ETLA 2DBYA 1A5TA 3BAFA 3ND8A 4F91B 4NCKA 2DCUA 5FTMA 521PA 4P31A 2O8DA 2E87A 2XTZA 1VCMA 1BS1A 1JAHA 4IVRA 1OT3A 3CWQA 3ND9A 3K0FA 4JBWA 2WSMA 2IYVA 3TAUA 4HI0E 2QU8A 5FOVA 4M9ZA 1GTVA 2B7BA 3MAAC 1KI8A 1W36C 1W7AA 2R9VA 4LK2A 1EK0A 3PEVA 1CRPA 5KNBA 2J59A 1M34E 3E1SA 3B78A 5H68A 3TUJC 5F3WB 1P62B 4LJ7A 4D0NA 1NBMD 3CH4B 1T8TA 4FMCF 4BPBA 1CU1A 3P27A 5CLQA 2A5DA 2ZQ5A 4C0JA 1KO5A 3NVAA 2R44A 1NP6A 2G3YA 2N42A 4M9XA 4RZXA 1XPOA 1UEIA 1Z2AA 3LX8A 2J0UB 1G8PA 1UFQA 3CUEF 3THXA 2HDNB 4CT5A 1RRPA 4PQRA 4X8MA 3BE4A 3LRPA 5FPKA 1OXTA 2TMKA 1ZD9A 1S1CA 3GJ8A 3UXMA 1TAGA 1FFHA 5C46F 4D0GA 1X6VA 2HUPA 3VX4A 2RHMA 1MABA 4EPTA 3U7GA 5JMTA 2ZRNA 5AJZA 3QSYA 1J70A 2LCFA 4OI2A 4CIDA 4XWOA 3RRMA 1FL9A 2IYXA 1VTKA 5TB5A 3R9XA 4B73A 4YMTA 2HV8A 3JVVA 5CB6A 4Q1EA 1W47A 5KPDA 5HTKA 4B44A 4PSKA 1HE8B 1J90A 3GLIE 1P5ZB 1RYFA 4S2EA 1N2CE 4PHTA 1RFLA 2FZLA 1V5WA 2XX3A 1R8SA 2CHQA 2H5EA 1I2DA 2ODBA 2XZPA 4LHXA 1G17A 3NBXX 4EPVA 3PJRA 1KI6A 3MMPA 2D3WA 1TU3A 2EYUA 1QHNA 2IYLD 2IXFA 2QT0A 1QRAA 4L9SA 4PXAA 6Q21A 3U44B 3IEUA 3A1UA 1VECA 2VP4A 4Z51A 2C99A 4QM7A 2QZ4A 2V1UA 2R2AA 3A58B 1GRNA 4Q4JB 1UPTA 4PR0A 4C0QC 5FTJA 3AP2A 4DUGD 2V54A 3U3RA 4G1UC 1OLOA 2ZE5A 3Q9LA 5BW8A 4TYNA 2NZJA 1E2NA 5SZHB 1JALA 1II9A 3E5HA 1KK3A 2RH5A 2Q3HA 5L3SB 2ZREA 1K8RA 2CHGA 2W0SA 4M1TA 4O2LA 2CLDX 2AWOA 2J87A 5FBVB 3PUZA 1E79D 4PZLA 2BBSA 2Q3FA 1RC8A 2QM7A 3UPUA 1HYQA 3CF6R 3GFOA 4DSTA 2ZRAA 5LDDC 4C2UA 5J4YA 2OG2A 4WVFA 3TR0A 1ZNXA 2A2ZA 3T35A 1XTQA 3O8RA 1QBKC 3PUWA 5KYKA 3EPJA 1OIWA 2EWVA 2GBLC 3GJ7A 1FP7A 1FQJA 1XZQA 3LBHA 1SKYE 3L8ZA 1NLZA 1VYUA 4QGAA 2BKEA 3MGCA 4FMCB 1E1QD 3QKSA 3OESA 3T15A 3TBKA 2ZS8A 4OQNA 3ADDA 1SZPA 2OESA 3SBEA 4NBSA 3KB1A 3M4YA 1EFRA 2NIPA 3EIEA 4X8HA 1E98A 1SXJA 4GPTA 5HE9A 4W9MC 1D9XA 4UKDA 1Z6GA 4WZ6A 1LTQA 1ZJ6A 2PL3A 4QBGB 2D2EA 2NO7A 4G5GA 5JCPA 4JVSB 4ON9A 2EFCB 2IS4A 1U9IA 4BEBA 4XIGS 1Z0JA 2ECKA 5FH9A 1WB9A 4JLPA 2FFHA 4FMDB 4L8GA 3CLVA 1AN0A 2F9MA 1OH8A 1ZM9A 2EW1A 2ZYVX 1J8YF 4JBYA 4QXAA 3U4QB 3KB2A 3AVOA 4DRZA 1GRRA 4DDUA 4TQUS 4DT1A 1T5IA 2ZS7A 1DTSA 2NTYC 3VHLB 1YRBA 2VSFA 4UJ5A 1HT2E 1OHHA 4KHZA 5JJLA 1W4AA 3MRSA 3TUZC 3HYTA 2OE2A 2VHCA 4AI6A 4YQFA 5HZHA 1W5TA 2ZI7A 3PUVA 4TMKA 2QROA 4LI0A 4QHTA 3GLHA 2DY1A 4QJ4A 5FUYA 1QHHA 2HJVA 4YMSA 1ZRHA 4DB2A 2DPXA 5DISB 1E0SA 1WBBA 2GCNA 1CTQA 3PV0A 4PQYA 3IIKA 2FFAA 3GJ5A 2FJUA 3QKRB 2YWEA 3VR5A 4QFMA 3AKYA 3CBQA 2ZRKA 1E9DA 3KFVA 1M7HA 4HLCA 1VHLA 5TV2A 3RWMB 3VU9B 1E2QA 2QRZA 3ZZ0A 1NY6A 2REXB 4TLBA 3MJHA 3QJYA 3P26A 3A1WA 1KY3A 3F8TA 1AQUA 4BRUA 1U81A 2VRWA 4BECA 3ZYCA 1DE0A 2XGJA 3QXHA 1S1MA 4Q19A 2J9RA 1KSFX 4DIEA 2PH1A 2KBFA 1S3SA 4C0SA 1UKYA 4PHFA 5KUTA 4JSTA 4B43A 5JSZA 2ZSFA 4JJKA 4AKEA 2CCGA 4D4JA 3EZ9A 1HA3A 5D3MA 2ZYUX 4OL0A 1Q22A 1KNXA 1G5TA 3A1SA 4TMXA 3I72A 4X8OA 1B23P 4IEEA 1JXMA 3AVPA 2IHYA 3LX5A 1YR9A 1JECA 5IK2A 1ZM3A 2O8EA 3I92A 1Q1ZA 2W83A 4PPGA 2OCYC 2ZI5A 4N3NA 4DCTA 2J5XA 2OLKA 3THOA 4EQ6A 1XD8A 2H8KA 1DAFA 4GSYA 2BWJA 4R9UC 1KOFA 4A0GA 1CIPA 4EFNA 2GEDA 2P6NA 4N1AA 1ZCBA 3K09A 2AL7A 4TZ6A 2ZJ5A 2BCGY 2ZXUA 3THWA 3BH0A 1XEXA 5DN6D 1DVRA 1NN5A 2VHQA 1CR2A 3TGPA 2ZPTX 3IIMA 4TYPA 4NCIA 4QRHA 1RYHA 2G0TA 3UWOA 2HT1A 4ZDWA 1G8GA 1P2UA 2A3RA 1X1SA 4GDFA 1GUAA 1RW4A 2F9LA 5HCNA 2RGBA 3AVQA 2I3BA 1E9CA 5BYJA 2ERXA 2GZHA 3TMKA 1E2FA 4BLOA 4DIDA 4CF7A 4MDFA 4WXPA 2YWGA 3WMEA 3DO6A 3TK1A 4MITA 2O0KA 4JVMA 4JZKA 4OQXA 5L3QA 3KFXA 4V0NA 1CR1A 1GG2A 2Z43A 5TY0A 2EWWA 1A2KC 4YMVA 3QG5A 1NKTA 1VHTA 1EWRA 4D80A 2CHVA 1VDZA 3B1ZA 3K70D 3RC3A 5KSZA 4KAXA 2WJIA 2DWPA 4RD1A 1KO1A 1E9EA 1XD2B 1ZYUA 2GDJA 1DS6A 3W6OA 2F3RA 4LJ6A 3SFVA 1R0WA 1KMQA 4OHWA 3V4FA 1Q1EA 2VBCA 3RS7A 1N5LA 1AJEA 1OB5A 4DSOA 4XTRA 4KLZA 1JAIA 1W2HA 4QC2A 1Q3TA 3X1ZA 3A36A 1DOAA 1E2EA 1LS6A 1N0UA 2XEXA 2ZRHA 4QL3A 4TSFA 1RPZA 4JLVA 1MH1A 5EE9A 1ZNZA 3WYFA 1E2MA 3R8CA 5FBQB 2ERYA 4LY6A 4NZYA 3HP1A 2CL0X 4MQBA 3QG1A 4JLNA 2GEVA 5TMPA 3I32A 2XB4A 1G8FA 4GMDA 1XMJA 2XJ4A 2R6CA 4GMXA 2NO9A 4DCSA 3KTAA 2JDID 3TQFA 4FINA 2O8DB 5JECA 1ZMXA 3QY0A 3GJ0A 2KJQA 2C77A 4PHGA 3PUXA 2ZVQX 3ZLJA 1IONA 2BOVA 4UNSA 4EJSA 1L2TA 4MRSA 1YRAA 1GL9B 1R8QA 2H57A 4ZV4A 4Q7JB 5J47A 3ECCA 4Q66C 3RANA 4AC9A 2WWIA 2QGZA 3FGNA 3MWKA 4P33A 4D2IA 1EG7A 3LV8A 5FOTA 2VHTA 4JKYA 1YZLA 1Q44A 3RS0A 4LHYA 3QOFA 1P73A 3B60A 3WYGA 2A30A 4GZLA 2QGNA 3I61A 2WJJA 3PEYA 1YJ5A 2EQBA 2IF2A 4Q4LA 4HB3A 2ZVPX 1G18A 2J7PA 4US2R 1ZIPA 3KJGA 1VG8A 3MG9A 4NYJR 3Q7QA 2OCBA 1WA5A 4BFTA 2FNAA 4B2IA 4CZ2A 1W5SA 2C9CA 2ZRFA 1S9DA 5HKKD 3C8UA 2IEZA 3L2OB 3I5YA 3PIRA 2R65A 5LD2B 4RKFA 5EP1A 3EPLA 2O8BA 4Q18A 1IN5A 2FWRA 2Q9AA 4QNRA 3U3OA 1R5NA 3AKCA 3R7WB 3V9PA 5GJBA 4RZ2A 1NNEA 2IW3A 3CF2A 4UXIA 5CLLA 5K8LA 721PA 1P2TA 4C0HA 5KO2A 1LV7A 4MYCA 4DCUA 1E99A 1N0VC 2AXPA 2IBMA 2P5TB 1XEWX 1KKMA 1NIPA 2XNDD 3B1WA 1JBKA 2PEZA 2O0JA 4J0QA 4BFYA 4JL6A 4Q21A 4RZ3A 3CB4A 5HR5A 1WE2A 4ARZA 4TTRA 1N5JA 1BMFA 4DLVA 1KI6B 4HAUA 4BZQA 3HU1A 1KGDA 4LJ8A 4Q1CA 1GRQA 5AJXA 3K0AA 3SYKA 1LS1A 4L4UA 3EW9A 3EG5A 3IBGA 4LHVA 1VG1A 2WTUA 2EU8A 4MYHA 1KK2A 3BXZA 1FX0A 2B21A 2GVZC 3FWYA 1G3IA 4RFSB 2ZM5A 1OXSC 4BASA 5BQ5A 4B33A 1O87A 1XU4A 4JYBA 4N0EA 2IWHA 1R7RA 5AK0A 2IEYA 3KJEA 3ZGXA 2BV3A 2LKDA 1U0LA 2GKSA 3FKSA 4L16A 5EP2A 2REBA 3QE0A 4CEIA 2V8OA 1E4VA 4OYHA 3Q7PA 3U7EB 5K8UA 1JXOA 5LBIA 4QBFA 2PMDA 5JI3E 5JWHA 2QSZA 3F5FA 3D7MA 1RRFA 1K5GA 4HB2A 4H1UA 1OJLA 1X1RA 4TL7A 4FIDA 1E0AA 4ZCLA 2PT5A 4GP7A 3T1VA 4DLWA 2QP4A 4CW7A 4MKGA 4HYYA 4AG6A 3TRFA 1ANKA 4HAWA 2K5UA 2ZRDA 4LBWA 3LH5A 3X1WA 1U90A 4WW0A 5CITA 2AD1A 2C98A 1XBTA 3I8SA 1ZNYA 3FB4A 5IHPA 1F6BA 2RGXA 2HXSA 1KO8A 2OBLA 4B3FX 2OFWA 2EFEB 3QKUA 4JL5A 2FSFA 4AK9A 5FTKA 4Q7LA 1SXJB 2GA8A 2WSSA 3LVRE 3FOZA 1B0UA 3SI7A 1XEWY 2GAAA 5SZJA 3G82C 3O8CA 3G0HA 1A1VA 2J45A 1NSTA 4C9BA 3GLFE 4B2PA 2XAUA 5EUQB 5B30A 1ELOA 1ZUNB 1UEJA 3P4XA 5FUVA 3MUFA 3QIAA 3KKMA 1WF3A 1QDEA 1N6HA 4KFTA 3HU2A 1QG2A 1UJ2A 1Z6TA 3B6EA 4WIAA 2F1HA 3GFTA 3EAQA 2G77B 1TUIA 4JIMA 1KI3A 2C8VA 2MMCA 1NVXQ 3FHCB 1J2JA 3VKGA 4KJZA 2C95A 3C5HA 3MWJA 4OQFA 4IDOA 1YZUA 3BS4A 3DPUA 4IFBA 4A4DA 3U60B 1G7TA 4QHSA 2J0VA 2OBNA 1N6NA 4XH9B 5FPYA 2QT1A 5FL7A 3GLHB 4A0FA 1UADA 3QXXA 3OFNA 1KI9A 2JLYA 1QHHB 2GVDC 2GHIA 1II8A 3OEHD 5CIQA 1QVAA 5DLQC 2IYRA 5C4GB 4B76A 1TL7C 1CJVC 3I73A 1RKBA 4LYAA 3QF4B 4KODA 3TUIC 1SULA 4YMUA 2GCOA 3KKNA 3ZZTA 2FOLA 2UZ3A 2C96A 1JR3D 1G20E 1VKJA 5AR1A 3CR8A 3RC8A 1YZTA 2F1IA 4CEHA 2ZJAA 5FBWB 5CB8A 5F98A 3SC3A 4A2WA 4TL8A 1G6OA 1D2MA 2OZEA 4JYCA 4TQAA 5GJCA 1QZXA 1US8B 4B3BA 1FMJA 3MJRA 5J40A 3RNLA 4A15A 5TARA 1S96A 1P7CA 2VYFA 2A5FA 1E9RA 4V0ME 4TL9A 1W2GA 4IOKA 2KB0A 1ZINA 2BBOA 1U2RA 2G88A 1S2MA 4JS0A 1GFIA 4MKFA 3PEWA 3SJAA 2FG5A 2EFHB 2GWHA 2WAXA 2X2EA 3MLEA 2GRJA 3ZDQA 1OV4A 2NO1A 1W1WA 1M74A 3MCAA 4LJ5A 5EP3A 4BLQA 1NBMA 5D3MB 3GP8A 1NG1A 1W0JD 2FPKA 2QP9X 2WPDA 4RFVA 3RYTC 4Z1MD 3OIWA 3IPYA 3CM0A 4PC1A 3WRYC 4P4SA 4DLRA 1X86B 2PZEA 4TN1A 5G3YA 3TW8B 1NVUQ 4TYQA 3LY5A 1KI4A 5JRJA 2PEYA 2ZI3A 4PAQA 2O8EB 2QMHA 4LRWA 1U99A 1CRQA 1AZSC 2QG6A 1N0WA 3RDPA 5J4KA 2GJ9A 4EQ6B 4NE2A 1SHKA 4BQSA 3NC1C 4CT4B 5LPNA 1E2KA 2XSZD 1G7CA 1XPUA 1OF1A 2BMJA 2YC4C 2VO1A 2NO0A 4TLAA 1AZTA 4NCHA 5DH9A 1Z8FA 5JJIA 1OPXA 4NDZA 2Q9BA 1F2UB 3J81k 2JLZA 1JB1A 3ZS9A 1XPRA 1XEXB 4PAOA 1P60A 4MKHA 4URWR 5DHAA 4XOIA 4CYMA 5G53C 3QEJA 4EAQA 1D5CA 1FNMA 1MOZA 4YXWD 1GNPA 5FBLB 2XZLA 3MD0A 4UNPA 4GZMA 4HLUA 1P72A 2VL7A 3DHWC 4JVNA 4FCTA 2X1VA 3EZ6A 4KCGA 5L3QB 3SYLA 4Q9KA 3FHTA 2VHUA 5AJVB 4G5SA 3AP1A 3ZIAD 1PUJA 1N5IA 1OXVA 1X8JA 1BH2A 2AK3A 1D6JA 1NRJB 4FXPA 4HZUB 3CPEA 3NHBA 4DKXA 1TF7A 4HUQA 2D2FA 1P9NA 4F7WA 1GSIA 3GMTA 3KX2A 3KKPA 4HUTA 1WP9A 1W4RA 4TWZA 3SHFA 1Q1QA 2H92A 4F4CA 5J4HA 1JR6A 3DL0A 4KLNA 1L7VC 3B82A 3O47A 3B7GA 1T0HB 1M1YE 4C7OA 4B47A 4NONA 1EFHA 3CW2A 4Q9HA 3U6KA 1F5NA 4OHXA 1TQDA 2JLSA 1H8EA 4MYUA 1OFIA 3WNCA 3WNDA 3U6BA 2PLFA 1NG9A 1AS0A 4HB0A 2B8WA 3DZDA 3EA5A 3A4LA 5FPSA 4DCNA 2W6JA 1KAGA 4RD0A 4WZBE 4ERNA 1LB1B 1F2TA 3CF0A 3OIYA 1ZD8A 4UNRA 3T34A 3RS2A 3HPQA 2O8FA 4LPKA 3KDSE 5ANRB 5FTNA 4FMDF 2OHFA 1UM8A 4IHQA 4EFLA 2D06A 3VQTA 3KXLA 2OBMA 4OK3A 2JJ8A 3ADBA 3KQNA 1BYIA 2F7SA 4RY2A 3M0EA 2QAGC 2QI9C 1Z63A 3U7HB 3FE2A 2AKYA 5FOWA 3SDZA 3N2EA 3OE7D 4HLQB 4EJSB 4BZXA 1X8LA 3B5JA 3EXAA 1RE0A 5JBQA 1G8YA 1XX6A 4M0LA 1N6OA 1XTIA 2FH5B 4W5JA 1TU4A 4U00A 4B3DA 3LQRA 1VG0B 2IYZA 1NN0A 1HQCA 4Q9LA 4LBYA 2PCJA 2G9NA 1Q20A 2BCJQ 2HYIC 4M9SA 1FQKA 4LC1A 4TLDA 3M6AA 4DDTA 2HCJB 5UKDA 1XMIA 1DBSA 4GOKA 1W4CA 3PXGA 3O8DA 4ESVA 2HF8A 1Z0DA 4G5RA 2ZUBA 3VKHA 2QAJA 3CONA
chains in the Genus database with same CATH superfamily
1D6NA 3HJCA 3IQGX 3SDBA 4KAFA 4BOYA 4W7IA 4YDHB 4MGIR 5LOVA 2BF4A 3ROTA 5JHGB 1KTVA 1UBSB 3AJRA 3KJNA 3V3KA 1O0SA 2IDKA 3H87A 3MS7A 1FSGA 3ESRA 2YV5A 1HNWB 5BVHA 4YWHA 2QV0A 4ARAA 5C5DA 3ETJA 4OPMA 2UYYA 4P3YA 4V02A 4LMAA 1QWOA 4IQ4A 1LZLA 2WU3A 5LP6A 3LCUA 4PCLA 3W9SA 3DE4X 4NCXA 2JZOA 2XCRB 2PSEA 4H77A 1VG9B 1Q16A 2Q5OA 4Y98A 3AUAA 2VTBA 3CNOA 3O31A 4HQFA 4NPHA 4Y9UA 1WXEA 1WXIA 4C43A 2VNKA 3BE5A 4YJHA 3H2GA 4MVJP 2VBGA 2XGSA 3EEIA 4MXDA 1Z2OX 5AVQA 3PKJA 1EE2A 5LYJB 3EAFA 4WH0A 3TLJA 4D46A 2EW2A 4O4LA 1KJWA 2AOVA 2J9FA 3ONWA 1LBTA 4ZAWA 3C7CB 1DJPA 3ZXIA 4YONB 4X95A 5I9IA 1Z17A 2R7NA 3EQ6A 4ZEWA 3I6IA 4EBBA 1QOZA 2WILA 4PBSA 2Z83A 4I1OA 3IP8A 5KTMA 3NTUA 3VAYA 1AHIA 3NNNA 1FSPA 1ZU4A 3D7KA 3AB3A 3EASA 1SQFA 3OJXA 4M89A 4ITVA 2FW8A 1ECJA 1V11A 1OJ7A 3LLUA 5IJXA 5CLHA 4UHHA 1MV8A 4K28A 4PTLA 5B2FA 4BMOB 1Z3IX 3QQ5A 1SCUB 4HTFA 4PZ0A 5LNK6 4C6HA 2PM8A 3WYAA 4ZCTA 1UPFA 3T8YA 3KT6A 5K0GA 4UTRA 4B81A 2FQ1A 1U2QA 1ZOSA 1CYEA 4B3GA 4XQEA 3W9BA 2DBRA 2GN8A 1YUMA 3DXXA 3B52X 3NOXA 2OILA 4HH3C 1UXJA 1TPYA 3C3BA 3Q7IA 5EJFA 3UK1A 4US1R 1F5SA 1XRMA 4K1LA 5I3CA 3TMKA 5DI3B 5KYXA 4Q48A 1WSWA 1GDDA 1XAJA 1XTRA 2OCPA 2VNHA 3EWNA 2HK8A 2E1RA 2X5XA 1RQPA 3EPHA 4KO1S 1CJMA 2J3LA 3KU4A 5MHTA 3I6BA 1UFRA 3FOWA 4PHHA 3KDPA 2OAQ1 3F90A 1UF9A 4HB4A 4YVFA 2CNKA 2Z3WA 1MEOA 1Z7EA 4ZYVA 3JD3A 1LPBB 4GOJA 1F3OA 3KM0A 2G70A 2H18A 4HGPA 4ND7A 1C9MA 4BYGA 2XYRA 2Q0SA 2IZ0A 2CL6X 1VPDA 1Z34A 2OXRA 3AERB 3RV4A 4AZWA 3TLEA 3OFJA 3EFBA 4EW1A 2UV8A 5K8CA 1BA2A 1E1DA 1M83A 4Z49A 1QPZA 3WR5A 4RK6A 2RHRA 2GAOA 1XWFA 5TGZA 1W73A 4N6GA 5EMMA 1ZNWA 3SJ7A 3DBLB 3PLNA 1P1FA 4HN4B 3EPKA 4LJAA 4BVHA 5IDWA 3IHLA 3PFFA 2B4YA 4UREA 2ZIGA 4JDPA 3EULA 4BGVA 3BE6A 1LC0A 3HXPA 1CZUA 5B58C 1NMXA 3VDQA 3H2KA 1CFZA 4IIYA 4FFOA 3WS7A 4YX9A 1TCAA 3AIMA 4A8TA 3BT7A 3WLSA 2AUMA 5HIMA 2RHCA 1CDOA 1P3JA 1P74A 1GFSA 1E63A 2SBTA 3E9CA 3L82B 4G09A 1UXKA 4IIJF 4K0RA 3LT4A 4PPFA 4RORA 5FEUA 2CNWD 1Y89A 5KSYA 4IHJB 2XCQA 4EPWA 3AR3A 3C41J 2HI0A 1EK5A 1Z33A 4MRVA 3V7NA 3NPMA 4WOPA 1B14A 2HMTA 4BJHB 1Z6XA 1YDGA 2RGAA 2NTJA 3HSYA 3R5XA 4NAHA 3UXEA 5C35A 2C59A 5C51B 1D7OA 3PJEA 4QJBA 3HXMA 5F9HA 1RWBA 3SEZA 3TOVA 3TIIA 2P1RA 5EWMB 1CJCA 2GXAA 4ARCA 2JFPA 4ER3A 4YLYA 4EB0A 1AK1A 1T0BA 3UUFA 4X62B 2REOA 3OLWA 1B6SA 5DNWA 4AJOA 3KQSA 3BF7A 1CYDA 3THSA 3UJ7A 3DDSA 3GLKA 2OZPA 2P7IA 4PAWA 4R2WA 3K1YA 1HQYE 1ISFA 1O03A 4URYR 1Z0IA 5EMLA 2QMEA 5HMMA 1NJ6A 4HNHA 2NSDA 5LL6P 4PX5A 3LXRA 3OKAA 3U9SA 4MDEA 2FR8A 1NUUA 5SYNA 4KVAA 2BHRA 1VJ1A 1Z47A 1AHHA 2VRNA 4E5SA 4LFBB 4R0MA 3JVDA 2BDUA 1KFCB 2ZWOA 2HO5A 4YLGA 2P30A 4CEJB 2Y1WA 1S8AA 1DTEA 2GCOB 4BCDA 2ZM6B 1GV0A 2VDPB 5EXDA 3VR6A 3ZX5A 3PQCA 2WM3A 2B8TA 2XD4A 3CJQA 3P71T 4NRDA 4NYMR 5JLAA 1G5RA 1U9JA 3EGDB 4BWYA 2FI1A 1THZA 3WDMA 2DQYA 2OV1A 3UANA 1EEXB 4JBIA 3IUQA 2BLNA 3P2IA 2O3QA 4QO7A 1RYZA 3K0KA 2EKPA 3K2EA 3FTEA 1TT7A 2H2FA 3C3MA 4OV6B 5KJ1A 5BSRA 2C3UA 1RT9A 3KSDO 2DGDA 1SY7A 1ENPA 3W3AH 5I45A 1WRBA 2F3TA 1JHUA 2CK3A 6LDHA 2ZIVB 1TJNA 2XWSA 4TXNA 2BDEA 4DBLC 2B35A 4TMTA 1NWHA 2WJWA 5SZKB 4ABTA 2ZTUA 4DWWA 3N5KA 3TTYA 1UBUS 2V58A 3DMPA 2H3EA 4PCAA 1Q77A 1A9TA 3CR7A 3T06B 2I1VB 4GLBA 5I01A 3LZDA 5I8WA 5FXMA 3JYQA 2FV8A 4DV1B 3SYTA 2XXAA 2QNRA 2QX9A 4ZVSA 4MVJG 4NCNA 1GD1O 4OI1A 2C54A 2K7ZA 1KXJA 3BFXA 3VR5D 4XM2A 1WZEA 5AW7A 4X20B 1GWNA 3TNFA 2LTAA 2V9PA 3AQ4A 5TRTA 1V4VA 2DBZA 1VYTA 1KK0A 2FZGA 2P5SA 4IJ6A 2GJ4A 3X43A 3PE6A 1T9ZA 1M1ZA 2VSNA 5TS2A 2HT6A 1Q7EA 7MHTA 3KQQA 1CDDA 1G7RA 2R6AA 1JLLA 3HUFA 3KXPA 5HBGA 2QRQA 4MJ7A 1WB5A 1R6DA 4GI1A 4JZYA 1RHMA 4N47A 1GUBA 3WK8A 2A1TR 2M6SA 2AI2A 4NNOA 5I8PA 1DO0A 2FMHA 1DG9A 5HILA 4O25A 2AJ8A 3DVRX 3DH0A 5L7WA 5L6LB 1KQ3A 1ZW6A 4MH0R 3S1AB 4P22A 4Q3AA 3IKJA 4M1YA 4TN5A 1KDRA 3CZAA 3N2ZB 3NFYA 3PQEA 3ZD7A 3G1WA 2JGAA 2IX3A 3W2HA 2CKDA 3ZCTA 2PS3A 4I5DA 4LXQA 4K6GA 4QJ3A 3ZWYA 2V5AA 4E5YA 5BSUA 3QEOA 3AVWA 5JISA 2PWYA 1L4UA 3W90A 1FYFA 2YJTD 5DNEA 2H48A 1FYXA 2WV9A 4GYJA 1ZP6A 3AUSA 3MS4A 4UAUA 3HKEA 1AUVA 3OBIA 2WJGA 3VOBA 3BMNB 3R0JA 3UK6A 4ZVQA 2QHXA 3LXXA 4OH1A 3HCAA 1KAHA 1QYCA 3K0FB 1T6YA 3GF4A 3PITA 3SR0A 4CM5A 5A0FA 2AE2A 3M89A 1RLTA 3ZV7A 4NOLA 4BV9A 3LMKA 5T8KC 4LFCB 1PR6A 1Z9BA 2W58A 5IDQA 4F97A 4HUQB 1M9NA 1HI9A 5HE8A 3SQNA 1Z5GA 1FEZA 2HZBA 3TINA 3KOUA 2R6ZA 4LV6A 5C81A 3S81A 3ZS8A 4I3FA 4F21A 2HSJA 1DBRA 1E9FA 2P69A 1N34B 3QPCA 1AOXA 2HUNA 3F6YA 1ORWA 4FFNA 2BZ1A 1ISRA 2VDKB 4J43A 4ODIA 1TEXA 5HKLA 3RFVA 3ROPA 5G02A 3NPAA 3K70C 3LQKA 2Q4EA 2AJTA 2RAFA 1I6WA 3AEKA 3R20A 4RD4A 1MP0A 3MSXA 1DINA 1RRGA 3ANNA 3DMDA 3GGJA 3I2GA 1F2TB 2ZI4A 4J0KA 2DG2A 1WMSA 1MABB 3MPUA 2YYSA 3TECE 4X65B 1KEWA 2JIOA 5KDLA 1BA3A 2WM2A 1ZVQA 1PZNA 4A6XA 4ZJYA 3AEUB 4HAYA 1C8KA 2BEUB 3INYA 5BV1A 3NHJA 4RS4A 1M2NA 4WY5A 1ZJZA 2HA3A 2YNMA 1DV2A 3N8GA 4LOKA 4M98A 1N57A 4M1SA 1AB6A 3LTEA 2TSYB 2V7UA 3BB1A 3VU8A 2BI4A 5KHLB 4OX9Y 2H06A 2NNLD 4O1MA 4HCJA 3EEYA 4RHCA 3TSOA 3L9XA 4QLOA 5BPHA 3DZBA 1KP3A 3C87A 3OZ7A 3JZFA 5FPQA 1A9ZA 2NXEA 5CT4A 4A8JC 3FCCA 2AMFA 3B89A 2YWJA 4HDKA 3LYHA 2C2YA 1F2VA 3CRW1 5JXHA 1IUNA 2XYPA 3QWIA 4UDOA 1NW9B 2EHDA 2ZSIA 1E5LA 4ENSA 3M5CA 1BDJA 1E2DA 1WUKS 4UTOA 1DDGA 5G1OA 3AGQA 2VJYA 3IP6A 3BH6A 3E53A 4Q7EA 5A5FA 4OIMA 5ADVA 1CUJA 5LKAA 2TRSB 3EXG2 5DHFA 3RREA 3AB7A 4LDQA 1DQNA 3PVSA 1JDZA 2HZ7A 2QNIA 5FCDA 4PBRA 3DLAA 3OZBA 2ZSDA 3COSA 1CY7A 4W7HA 1PV1A 5KKNB 3BJIC 1J2EA 4ZZ1A 5AQ1A 3TX2A 3VKFA 1NNUA 3H9GA 3CA8A 1J20A 2JCSA 3JPWA 2OG1A 4MP6A 1BDBA 2PJRA 3ILHA 4ND2A 5JD5A 1PX2A 3MELA 1ZJ4A 4BZZA 4JJZA 5KYUB 2EAUA 4OVKA 4Q5IA 4TLLB 4Z9XA 4XXHA 1R5BA 2NV6A 3NBZC 4HFRA 1XRJA 5IAAA 1WB4A 2LKCA 1TUBB 4MHSA 1K86A 3HKBA 4BCCA 4UJ3A 5JAMA 1VP3A 4XARA 2RHOA 1RRCA 2FYTA 4Z4FA 3I12A 2V7VA 1SH7A 3TVDA 4N7BA 3MJVA 3DMGA 2HLDA 3FSGD 3NIBA 1NN1A 4JFAA 4QVKA 3ZBPA 1Z8HA 1SCAA 2JBWA 3FNQA 4YROA 3DL4A 4KL8S 4WTOA 3SS7X 1XF9A 1QPBA 4JVLA 1IBSA 4RXUA 5A3VA 2E6UX 2VBIA 3U3XA 2A78A 1WW8A 1ZMOA 1W96A 5TPZD 1R6VA 3GN2A 2AFVA 1KOGA 1N7GA 1ETHA 2ID7A 1GQ2A 1QX4A 4DM4A 3KOWA 3ANYB 3O4VA 4V3CA 1I0IA 1Y5IA 3NFRA 4OGWA 4XSHA 4DCCA 2ZYWX 3RK4A 4HDRB 4LPSA 3TB4A 1NQTA 3TH5A 5B4VA 5DM60 2EFGA 2G4LA 4HDCA 1AUQA 1K2VN 2C5AA 1KBQA 1V7CA 1CV2A 2X3UA 1CP2A 1FQOA 3DFIA 3NAZA 4UZSA 1EWTA 1MB9A 2KLHA 1K8XB 3IOEA 4ARIA 1NW8A 1P3Y1 2YVQA 2AYXA 3LW7A 4NDNE 1BD4A 1Z56C 3ILYA 1Z62A 3L0OA 2IP4A 4NS4A 3ZHTA 1OZGA 2V3VA 1FLDA 2AMVA 3DMNA 2X1LA 1PR0A 3NBQA 2RHGB 2OFFA 4HQOA 1UC5B 2DPHA 4G4JA 4A82A 1OBHA 2I8LA 1QGYA 4DG8A 1G6HA 3ONEA 5KTTA 2DPLA 4KXFB 2OCDA 4BMZA 1BHJA 1KEUA 3PC8A 2QU7A 3ISJA 3I01M 2VOEA 4R51A 3ZWDA 3PWSA 1Y8ZA 3H8WA 2GZDA 3OCJA 4CQLB 4V0OA 5EHNA 2QMZA 1HMPA 3CZ9A 2PUAA 2VA8A 2X9GA 4QRDA 5EVCA 5IBRA 1E3WA 2CZCA 4MWBA 4XWGA 4IGFA 4ZREA 4ZALA 2Q7OE 4EI8A 4B3TB 4ZT2A 4C3ZA 3HM9A 4U5XA 5E7JA 4E30A 3Q2OA 2IDMA 5BRNA 3FTDA 3FH0A 1SUDA 3HR8A 3VYUB 4RKEA 4UNNA 1DJQA 1U28C 3WOVA 3U5ZB 5C8YA 4KQKA 1NBAA 3MINB 4FN5A 5CT8A 4MUHA 2WG0A 2ZT5A 3GAMA 5B3JC 4NBTA 4A5SA 2FA9A 2ZRLA 4GM4A 1V5IA 4RTQA 1UKEA 4RTOA 4E7PA 1I1QB 1YQWA 3F49S 1JDJA 3T9EA 2QVXX 2JH9A 1SU4A 2WT8A 2GK7A 1ZY2A 1RLJA 4IV5A 4IWYA 3ZJYA 1PJLA 3HI6A 3QVGB 4OJTA 4URFA 3SWWA 1QCDA 3BMXA 4PNZA 4INJA 4WA7A 1MVLA 4L2IA 4Y0AA 5DHQA 3CUWA 4YXWA 3TKYA 1TO6A 3KKZA 2FQXA 1PLLA 2GASA 3GJ3A 4Q02A 3EEOA 1WD7A 5MFZA 4F38A 4GPIB 1G8HA 5IC6A 1H2BA 3DR5A 5AI9A 2EBUA 2Q4BA 4HEA1 4JC0A 4Y2PA 4JLBA 1X9IA 3PLAE 1GHTA 2D5AA 1U1GA 3EGOA 3CLSC 4A1OA 5L7TA 2BKUA 3DLHA 3EVAA 1GT91 3OZEA 1QBGA 5JDCC 1G98A 5J4VA 1YMUA 4YRTA 1QUFA 2JGNA 2NTEA 3IQEA 5DBOA 2QX4A 4C3UA 5HCIA 3TEMA 2P9QA 2IEIA 5ALIA 4S12A 5HEKA 3VKUA 3DZFA 2J08A 2ZYDA 3K2IA 3L6RA 3VMFA 3HWRA 5JCZA 1VBKA 3V8VA 5BMVF 1I80A 1QUEA 2C0QA 4UUNA 5DHTA 4FZVA 4GR4A 1YXMA 3WYDA 1QHGA 3NX4A 4NQZA 2G17A 2N0SA 2HC9A 3H5LA 3WWDA 3H8JA 4JLWA 1U98A 2IUTA 4GPBA 1D6SA 4MJXA 4UAJA 4QDJA 3H1BA 3OHSX 3MUOA 3DBOB 4JBXA 4N54A 3LPMA 3ZCPA 5B12A 1N33B 3PQ7A 4KO8A 4M53A 3NHYA 4IBOA 5C1IA 4MR9A 2HA6A 4QQNA 2X0FA 3DT8A 4EG5A 4NBUA 2G1JA 1P4HA 1TOAA 1JSCA 3L02A 4HAZA 1T6ZA 3R5KA 4J16C 4NJEB 1VJCA 5ALWA 1W36D 2ODWA 3E8SA 3G0CA 4JT4A 4DQVA 3VYSB 4HAIA 4C08A 2PFSA 3RSQA 5IT9A 4HXGA 3L0SA 1DOZA 4JU8A 4DLXA 3IP5A 3IAXA 1BJTA 4Q0MA 2E21A 2NU8A 1MOQA 2GPYA 3H2SA 3LOPA 1NSFA 1QS0B 2FSIA 4MKXA 1NJFA 4NJMB 4CLHA 1DI0A 5JLJA 1DJMA 3HFRA 4M1OA 1NHGA 4RZQA 3D1VA 2JI9A 2BEWA 4AZ3A 1C3LA 3D02A 4MEBA 4U2EA 4WV3A 2PD6A 4OCZA 1MAWA 2CV2A 4B2YA 2GJ8A 3THWB 4AB1A 4B31A 2Q6OA 3SAJA 2A9KA 4AUKA 1KRWA 2VNJA 4DXDA 1BJKA 1BTOA 1CHDA 1F60A 1DIBA 2O8VA 3OVMA 4FWBA 4WX2B 4U2CA 4RSMA 3RHSA 2AYZA 3WDLA 1NW4A 3KC2A 3JU3A 4U9HS 4BPRA 4CLXA 1O3YA 1W30A 4YJGB 4XIJA 3SXPA 2E4ZA 1GRCA 2POQX 1EU1A 5E38A 3L8CA 3HL4A 1H6DA 3S2IA 1QH1B 1DEXA 4RX1A 1MQ9A 5I7HA 4R8MA 4GVLA 3K8OE 5CH3A 1WBJB 1X77A 1GPWB 1YR6A 2CYBA 3LT0A 5FA6A 2NVWA 3QLUC 1NJ5A 1K89A 1H2AS 2HJRA 1R0KA 2NGRA 1EGAA 2PT6A 4TMWA 2QT9A 5DBFA 5DTEA 1G20B 5IN5A 5KTRA 1N6LA 2LNDA 4IGAA 1TZKA 1K7YA 2C4KA 1W9HA 2I3DA 3E9MA 3W3AA 2XWJI 2ZJZA 4ZWNA 2R3SA 4ZCPA 5B2ZA 2QTZA 3P9KA 2BE7A 1U1DA 2WAMA 4QXRA 4RJLA 1LBQA 1OKKD 2JGDA 4P2BA 2JASA 3PNPA 4G5OA 1G6Q1 4N7JA 4PYIA 3RRNA 2ASEA 2ZCUA 5DNDA 5INTA 5ALUA 3AL3A 4RV5A 1BZYA 2AZDA 1E79A 1FJHA 4M8LA 1W1IA 3ZU6A 3R3WA 2GPTA 4M76B 3RLIA 1PSWA 2ODTX 3T5DA 1YQGA 2LCIA 1G2IA 3LYLA 2Q07A 3H6HA 3NEJA 5FF9A 1XFAA 5C18A 2Q21A 5BNZA 2YINC 2RGWA 4F1KA 1ORIA 3ZI4A 1JNYA 1HDEA 2PT7A 1U2EA 2OV2A 3R3SA 3D6JA 5HWSA 2WIJA 2E6KA 2FCAA 4B4WA 3LDAA 4I4NA 1RBZA 1VXOA 1E66A 2OHHA 3A4VA 3T3PB 1QVVA 3ZE9A 2WPDD 4MQEB 2QD3A 4LJLA 2G71A 1YS6A 3IESA 4GKVA 4IJVA 3KAKA 3VHRA 2OWDA 3LO5A 2O2CA 5LWQA 2AZXA 4PIMA 2PQ0A 4ILEA 4LRSB 1EEHA 3RSFA 1UT8A 2ZAIA 2ZPAA 1QQTA 3ESXA 3FYUA 4W8OA 3JQAD 3SOPA 3NM5A 5B7PA 5IMSA 1KR2A 3Q4GA 4ZICA 2MSNA 2QY6A 4AQYB 4BQOA 4OHYA 3S2YA 3QUSA 3T3HA 1I01A 3DNPA 3N39C 1TJ3A 3RC2A 4TMFA 2O3UA 1LA2A 1I7DA 3NR2A 1M54A 2YYAA 3C3KA 3PC3A 4Y2UA 1KU0A 1TF2A 1Z35A 5F7JA 2EZ9A 3I0ZA 3UJAA 4QTTB 4DIKA 4Z54A 4LJ9A 5H3CA 1GNQA 4ZVLA 2V4ZA 4R8LA 1G19A 5JZVA 3P9IA 5HS4A 4BGDA 4OBXA 3BXXA 3Q1KA 4HDMB 1RZVA 2HLHA 2WWXA 4ZOBA 3JZMA 3WGGA 4BQFA 2OMKA 2PR2A 3QWHA 1U9CA 1FDIA 3CZRA 4K9KA 2Z57A 4YCAA 1G38A 4FC6A 4Q93A 4ZAZA 4G85A 1KYVA 1G4HA 4IMIB 1DARA 5FLEX 3GJ4A 1T3HA 1KORA 2VUIB 4FHGA 3IO3A 4LNUB 3B1XA 1RM0A 1JQJC 1CPYA 2FN9A 2VYQA 3KYDB 4K6CA 2V7BA 2B4AA 3T0GA 5AUPB 2ZZMA 4ACBA 1OXXK 4QJIA 2PN1A 2YL2A 4R2XA 1GNTA 3ZE8A 1SEVA 1KJYA 4BO8A 3S8YA 2B61A 3FRHA 3KJQA 4A5OA 4D4GA 3BIJA 1M0SA 2V8BA 4U6QA 5AKGA 1IM2A 5AXCA 1UM9B 2D7JA 5DXFA 5JPIA 1AMUA 4QDOA 4C7KA 1MR3F 1QQAA 1HE2A 2UZIR 5BWBA 3NGXA 4QUGA 4BAUA 5LDHA 5B7NA 1KE1A 1G42A 1JTVA 2JIMA 4OFWA 3MQ2A 1YC2A 1KS2A 1PI3A 1IY8A 4O33A 4QOSA 5DDIP 3ZVKA 1K9SA 3O4JA 4XLLA 3PRKE 4C7XA 5IKEA 1G4AE 4UFPA 5JZMA 1UEXC 1WSDA 3MRXA 4MRNA 1TAHA 1EVQA 3V1YA 5JAHA 3V8QA 1M1YB 5JWOA 4HP8A 3THYA 1XMQB 3SHTA 1U2GA 3DJYA 3UMFA 4ID3A 2GAFA 4ZVPA 2F1KA 3EOBI 5I8ZA 4ZCIA 5JH7F 1U3WA 2AN3A 3D6NB 1ZSVA 3SX4A 2QVGA 1YU6A 4FPXA 4ARZB 5JS7A 1AT1A 1VGVA 5IX8A 4K87A 3EZFA 3MERA 5AYVA 1JA9A 4AIIA 5FOQA 4ANFA 4DQUA 4AN1A 1MN6A 5FJJA 4MIOA 3ZHQA 5JSFA 2W6JD 1BX0A 2YV3A 3KWFA 4GNRA 2HCRA 1JHQA 3WQBA 1NUAA 3HEBA 3T12A 5I7EA 2DWCA 2X13A 3A9CA 4DCVA 1AGRA 3ZD9A 1MZVA 2GPAA 5CLJA 3UJ9A 3PX7A 1YS9A 1T0PA 3PNSA 2QL7A 4IJ5A 1Q0QA 3OLYA 3RS7A 1BRMA 2IHNA 1KHHA 2DRIA 2C0PA 4H08A 3U3DA 5GIPE 4M4SA 3TCXB 2EKBA 2LBPA 1GTMA 1WXFA 1M75A 2HQBA 5FYDA 2BELA 4CEIB 5BSTA 3DWGA 4IVNA 1J8FA 4EPXA 2D54A 2H65A 1Z0SA 2MSCB 1GGVA 1VL1A 2VPWA 2R6GA 3EH1A 3NHSA 1VSVA 4F56A 1RXVA 5GV7A 3VR0A 3H84A 3N1UA 2CUTA 1V25A 4H7IA 1ONBA 2NXNA 4AY2A 4Q9DA 1KK1A 5P21A 4AJ2A 2Q2OA 2XB9A 4GZ6A 2WVJA 3F74A 3GA0A 1I2BA 4NMXB 3OF2A 5FOUA 3UV3A 5JZBA 3WQHA 2J6CA 4PO1A 1NR1A 2AEEA 3PXBA 1FDOA 3F3YA 4KXMA 1PQ4A 1QV7A 2DT5A 2FOXA 4OXQA 4GGMX 4E14A 4DIOA 5ITWA 3JQ9C 4PIPA 3ZHZA 1P7ZA 1ZUNA 2H1HA 3LX6A 3L5KA 2CZGA 1XN4A 2J3IA 2P4QA 3MT0A 3PDUA 1ENOA 3RT1A 2YBDA 4CFZA 2CDNA 3R77A 1KA9H 1C4WA 1GQSA 2JAUA 3OWOA 2CSUA 1P81A 3PFNA 1KPIA 1P17A 1E7RA 4E5KA 1NVFA 3HLTA 3CGGA 2QEQA 5FWYB 2HWUA 3VPFA 4MQFB 1G7SA 1WQ4A 3KZOA 4I3GA 2EQ5A 2VP9A 5I9MA 1Z0UA 3ITDA 3PR2B 3TLXA 1YONA 1V5GA 4JP8A 4EY4A 2R7AA 4J1QA 4GNKA 1D7AA 1RCTE 2CFSA 2Z4RA 3HRKA 4OLFA 4V0RA 4EHAA 1FDRA 1I24A 4JMPA 1JQEA 3F2VA 3I39X 3PNYA 3PDWA 2BEKA 3AOGA 3DZCA 2EL9A 3LRXA 2MOKA 3AXSA 3EY9A 4Y9RA 5D5PA 4L27A 2YFKA 3L6OO 1EUDB 3WDSA 1YR8A 1PV4A 4KI7A 3G8YA 4TRJA 4BEWA 1DKOA 2JIZD 4TZTA 3P0JA 3RQSA 3WNBA 1ZD3A 3GVHA 3FUXA 4DCMA 5HX7A 1VOTA 2H4FA 3T4UA 4ALMA 4ZO8A 3G3EA 3P52A 2D5CA 2Q29A 5A7GA 1CVRA 1B41A 1P7WA 5DYIA 1RJ9A 1Y33E 2G9RA 3HU3A 1NUPA 1Z0FA 3BM5A 1EFVA 3LUHA 2R1TB 4P58A 4X54A 4MP8A 1IRIA 2ZWAA 3RVDA 3KQUA 3HVJA 4DIUA 2PE5A 2BRUC 3A1DA 4MGEA 1AG9A 2Q41A 4ZAFA 2ZIAA 3H86A 4A0SA 3DTVB 1PF7E 1RLMA 1X39A 1ML3A 2O4CA 4CHGA 4DG5A 4UQOA 3K9CA 3QE3A 2CVFA 2VYVA 3HUEA 3NQ41 1JPUA 4I2VA 4DB4A 1G41A 4J7CA 5KINB 2ZZNA 3GEPA 4GIBA 5COAA 5F1YA 2FRDA 4ZDKA 5CXXA 4TVOA 3L4BC 4EVIA 2NP7A 1LEHA 2Q5LA 2ZBVA 4RJIA 4WWHA 4YUZA 2GPSA 1RBQA 2BVNA 2IRWA 1QPGA 3IB3A 4KO2S 4PYQA 4WA8A 1AGNA 1WR8A 3ZLUA 2UXCB 3IGFA 3N59A 5AJWA 5E6RB 1OWPA 3A28A 4PVCA 4JAVC 3ZTTA 4AO7A 3S8MA 3PD7A 3NI2A 3NG1A 3B3JA 3MGGA 5DNVA 1KQNA 3S2UA 1IQPA 2FPUA 1DBIA 4Z53A 4ZOLF 3LRTA 1OX6A 2AIRA 5HKOA 1JVNA 3PVCA 3EDYA 1I7LA 1VMEA 3GAAA 1TQ4A 1HURA 2DHDA 3AVXA 4BP3A 4ZA2A 4IZIA 3AO0B 1ABEA 2WD8A 3UMCA 4DV3B 3EQ9A 4TTTS 3ZWXA 5TQJA 1N8SA 4XOUA 4ZDJA 1EDEA 4DR2B 1XNJA 4JV5B 3OM1A 4IIUA 5E95A 1GUZA 1UT5A 1FYDA 4IR7A 1OX4A 3GZNA 1GUDA 3D6TB 3OAAD 4OM8A 3WNQA 4EYKA 5CM8B 1N6RA 2VKTA 3H9CA 5KQLA 2PKCA 1BHO1 3OQ6A 1XTJA 2QSUA 3HCBA 1GSAA 1JIJA 1KIAA 1SBNE 2CDBA 3DAHA 4E1AA 3IOBA 3T3EA 1FDWA 4A91A 2GAJA 2HEIA 3X1DA 4G0MA 3W9YA 2XMBA 3DEFA 4F85A 4GEGA 4MP3A 2HSWA 3AHIA 3HU5A 4M0MA 4BWVA 4C1NA 4J1SA 3ZVMA 1YGYA 1EUCB 5FI3A 1Y7IA 3FWNA 3KLOA 3OE1A 3V7YA 4TTIA 1Z38A 4E5UA 4EO7A 1CJSA 1VKHA 4JX9A 4RVHA 1EWQA 3L1IA 5AI0A 1Q5PA 4OB6A 4REMA 1C8VB 5FPHA 2OB2A 4TTPA 3IEPA 2QMUA 4P81A 1WPQA 4BNNA 1EVKA 1Y6RA 4II3A 3H0EA 1QYVA 4UATA 4YK7A 4UOEA 3BULA 3CRRA 3O73A 3P20A 2PGOA 5IRCD 1YB4A 3AKZA 4NECA 4I4TB 1NP7A 5AVSA 3HABA 3V1KA 2QPAA 5EQDA 1SXJC 3BIOA 4YAIA 5CYFA 2DUUA 3AT1A 3BEOA 5JTUA 4D9IA 2BKAA 1O54A 4Q1AA 4CCYB 1ZEJA 3L6UA 3PC2A 8AT1A 1F4LA 1U9IC 2HF9A 3R0ZA 1CEXA 2L2QA 1T4CB 3H3XA 3NC0C 4ROTA 3HB0A 5E3IA 3TPZA 5ADUS 1Y80A 1XELA 1FXUA 5TGTA 3BAZA 3FR8A 4B9EA 3L01A 2V3CC 3IMGA 3WLIA 4QUBA 4XB2A 3HFJA 4C0XA 1GUFA 2VEOA 1H2YA 1W5AA 1C9KA 3NTQA 1R4AA 4JA0A 1A77A 4MV5A 5GINE 2FGKA 2IE8A 1VBFA 1L8XA 2J46A 3HB5X 4DLNA 1RJGA 3RVKA 2Q9CA 3BGOS 4LMRA 2DQZA 4PINA 4WBNA 2ZTMA 3AI7A 3H9UA 2HSDA 3ZY4A 2YFYA 3HNRA 4G01B 2BM9A 3D8UA 3AHJA 4ACAA 1JHRA 2W6OA 3JR3A 1RI5A 1SHUX 2E4WA 3A3PA 4IO1A 4JI2B 4BFZA 4F6RA 3VSBA 2ORWA 2OV4A 1G2QA 2FHSA 4XIFA 4E11A 1WSBA 1E3EA 2CE7A 1QORA 4D9GA 1WCIB 4FI3C 3KT3A 1INLA 2C3PA 2WSLA 2NU6B 1A71A 1YHNA 1E4YA 2C07A 3GRKA 5A4IS 1VIYA 2HMAA 3L1KA 5G3ZA 4E07A 3DDUA 4K81B 4R8VA 1ZGBA 4A10A 3FJYA 1AKUA 5B4UA 1TU0A 2ISQA 1IBRA 2J9YB 2IYOA 5FBKA 2OCAA 3NKFA 3O95A 3GIDA 2GKGA 4M0KA 3UM9A 3LQQA 4U2GA 3WIOA 3R9WA 2O8FB 2VBFA 1XNHA 4KITB 2PX3A 1KIMA 1Y1PA 3ROQA 4RCVA 1O9HA 4HRVA 1KMHB 4IXDA 1Y81A 4FQ5A 3AIIA 5T64A 5K6AA 4ZYWA 2XBLA 3W5AA 2R47A 3AFOA 4A2PA 4P7KA 1JEYB 5B57C 3RC9A 3LC0A 1IUPA 3WKAA 1J09A 1ZCAA 4AJEA 5CCEA 1WBDA 2ZBPA 3VBCA 2EZUA 4AG5A 1ISIA 1C9DB 1ZJYA 4F96A 1CVLA 5C2JB 5LQCA 3SEAA 4CTOA 2IU4A 4RULA 1GGNA 5CLGA 5AT1A 5BN4B 1RBMA 1MIOB 2IXEA 4NMLA 2FF7A 3F6BX 4XPZA 4UEQA 4C78A 1KH3A 4LF4B 3M5DA 2C9OA 3QELA 2QVZX 3C8HA 1G3UA 2IGTA 3LW8A 2VH2A 2YZ7A 1TVKB 3DBVO 1R64A 3K6JA 4LN1A 1M34A 2H4HA 2AR0A 3SC2B 1E6UA 3DZ8A 1VRWA 2QUZA 4EI2A 4JA2A 1JEQB 3WL6A 4XTCS 3A37A 1ENYA 5H4HA 4BNJA 1WOMA 2WSYB 1FRZA 2WKRA 2ZB4A 2V0GA 2CXTA 2QYTA 3HR4A 4DQDA 2HWXA 3J7TA 3MGKA 1IHYA 1IWPB 2HDHA 2O4UX 3Q7TA 2NP6A 2FSUA 4JUIA 3GMSA 1VPEA 1XQXA 1FS4A 1ZD1A 3VSCA 4EG4A 5BVHB 5KU1A 3URMA 3MWYW 5E9WA 2IYUA 2QUAA 4CM8A 4CODB 1BE0A 4DLLA 2B4TO 4F8JA 1XIVA 4LVUA 1C9EA 5CG1A 3PI7A 1IDOA 5FYQA 1GZ7A 3COJA 1JHXA 1OD6A 3RE1A 4EARA 4JOBA 2DECA 4R71A 5FTLA 4DM7A 1UAAA 3GLHE 2YHIA 3FMPB 2O5VA 2W2MA 3BFVA 3OLQA 3N0RA 1Y0BA 3QF7A 3RIEA 5C31A 3IH5A 1T43A 4O4LB 2J9FB 3RC1A 2CXXA 4QPDA 4XM1A 1V35A 1ZCZA 1V6AA 2I3AA 3OIVA 3NOQA 4GXTA 2DQ4A 4V2UA 2JBAA 2CBXA 2O52A 2PLRA 3D3WA 3PGJA 4ND5A 4EJ2A 2D0PB 3BMCB 1OYOA 2ZJ6A 3TVYA 2CW5A 2JJ1A 2PZLA 4Q16A 3VR5H 3FVVA 2WJHA 5DGIA 3P4YA 3BREA 3KPYA 4HVTA 4R31A 3U4QA 3O8OA 1KZ6A 3GDHA 1UAYA 3ER8A 4FCWA 2GDZA 1CR4A 4CM3A 5I4IA 5JAIA 3V4RA 1QWSA 3L8MA 2FUKA 5ICMA 1SCNE 4JASB 4JJAA 1U3UA 2RBKA 3ANXA 2QZPA 2J9ZB 2SHKA 5KVSA 4BLUA 3RUPA 1XROA 2IOQA 1T29A 4Q7KA 4FFSA 5ITSA 3OQIA 1Q17A 2GFQA 1XQWA 3LFUA 1HX7A 1D4OA 3E22A 2R00A 3WTCA 1RE1A 1RM3A 2Z6UA 3OIUA 4WY8A 4Y1EA 2QNBA 2XE8A 4Z3DA 1D5WA 2D4AA 4ZGWA 1EI9A 2O5RA 3GUZA 4NBKA 3CRQA 3U3JA 4GL2A 1WG8A 2PGXA 4Q03A 4QGFA 5GP1A 1E2GA 3UUGA 3WGMA 1YBVA 4OI4A 3ST7A 2WIGA 1V16B 3E6AA 1YVDA 4KIJA 3AXTA 3BDAA 1OASA 2ZR8A 2ZI6A 3HSKA 1ETUA 3C6QA 4ZHSA 5DTQA 3BERA 3K5PA 1O8CA 3WL4A 2C7OA 4IQGA 3QXCA 3WLKX 4LGMA 3FBGA 2C0CA 4RU1A 3WY9A 5H3LA 3M6LA 5HF9A 5B64A 3OQNA 1A4IA 1RWKA 4UTNA 1DG1G 1QGAA 2CJWB 3MWLA 1GIAA 1XQ9A 3PYXA 3ZV6A 3JYNA 4CQJA 4MVJD 1GTL1 1T34A 4FFDA 5CXSA 5DLPA 3RGGA 5DI9A 2AD5A 5GZ1A 1NF9A 5CFLA 4QM6A 1TA9A 2F3QA 2GZ2A 4OQ4A 4INZA 1WNTA 3P1JA 5IS2A 2GCEA 4K9LA 4EMBA 1KU6A 2FPMA 3GGOA 3RS4A 1XDWA 3E0QA 5D1NA 3SEQA 2VF8A 4LSZA 3WLAA 1Z5VA 5A02A 4XWKA 5BNTA 4G1MB 3AFHA 3PQ4A 5M3BA 3ZD6A 4R05A 4Q1VA 2ZAMA 1O08A 3UW1A 1YRYE 5JS8A 1XP5A 2EX0A 4QELA 3GEHA 1BFKA 1BO6A 1H5UA 1N2ZA 2AKAB 4F45A 1Z4IA 2UZAA 3H0KA 3QIVA 3IR5A 1RRKA 3PXDA 2CT8A 1Z83A 4W1PA 5DLDA 2G5PA 3HXKA 4EY6A 3N7TA 3E35A 4Z8YA 2EKLA 1TK9A 3T5BA 2YQ4A 2NZUG 4CKBB 5U4XA 4WCDA 1VHQA 1IXZA 1AF4A 1BWQA 1NL3A 1ZH2A 4ZK6A 2GUWA 3OIDA 1E1RA 2YWCA 3ORYA 4HDOB 3OKCA 4J0IA