2QUZA

Crystal structure of the activating h-rask117r mutant in costello syndrome, bound to mg-gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNRCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, hydrolase
molecule keywords GTPase HRas
publication title Mutation analysis in Costello syndrome: functional and structural characterization of the HRAS p.Lys117Arg mutation.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2quzA00
3K70D 1U0JA 1G21E 2YVUA 4MYTA 2WWIA 4Q9KA 5KUTA 3VNUA 4G3XA 1L2TA 4HB0A 3OIYA 3PIRA 4OKSA 1OH8A 1FQKA 1U2RA 2XX3A 4FD2A 2G83A 1E98A 4UKDA 2AK2A 4V0ME 5FBLB 5A0FA 1U0HC 1U9IC 2FSGA 3W9YA 4BFXA 2ZR7A 5EE5B 4YDSA 2GXQA 3CZQA 1IY0A 5FTNA 4Y0VA 4BLQA 4OQNA 1FP7A 4LPKA 3A1SA 3WBJA 4AKGA 2ANBA 4GRAA 5J4YA 1Z0JA 3SYLA 1KMHB 3K0EA 1KMQA 2ZRGA 3TR5A 2QT1A 2ZAMA 2ZE7A 1KI9A 1SKYE 3S1AB 1FX0A 3ZVRA 2AHOA 2ZITA 1ZNWA 4EPYA 4Q1FA 3SYKA 1Q57A 1VIAA 2W0SA 1RRPA 1P2TA 3KXIA 1IONA 5JECA 4ACBA 1SHKA 2G77B 3UK6A 1E1QA 1PLLA 1VYUA 1E79D 1ZCBA 2CLSA 3FFBA 5FI0B 4I1VA 3IIMA 1D2EA 2ZSEA 2XGJA 4ZPXA 1CP2A 4GFDA 1EFRA 4PAQA 1XZPA 1M7HA 5AJZA 2AWNA 2CMKA 1TPZA 4PHTA 2XEXA 4R2IA 3GLIB 4DCNA 1S1CA 2PL3A 1R5NA 1Q20A 4C0LA 2EQBA 4GZLA 1Z28A 2ZYWX 4ZIRA 4CEJB 2BV3A 1RFLA 3LBHA 1ZBDA 2NO9A 2X19A 3RYTC 4KITB 2CE2X 1MO5A 2DWQA 2GCPA 2KWIA 4NYMQ 3RSOA 3AVVA 2WV9A 3B5JA 1G7CA 2OLKA 1F2TA 3IKJA 1E6CA 3IHWA 4LYJA 2ECKA 2QP9X 1VG0B 4JJKA 4NCHA 4PAMA 4IXMA 3BB3A 4QNMA 3W34A 5L8VA 2F1IA 4QJ4A 1W36D 4OHVA 3NIBA 2VP5A 1WQ1R 2W6ID 1AGPA 3I73A 2OT3B 2FSFA 5EE0A 4MRSA 3SJZA 3KQUA 3DDCA 3HP1A 3D31A 3FVQA 3SU8A 2QP3A 2PCLA 1ESMA 1GKYA 2O52A 3WP0A 2JEOA 2G1KA 3DZ8A 4XVQA 5FL7D 1L4YA 2J0VA 2P6UA 3P1JA 4KO8A 5TV2A 1J2JA 2BBTA 2GCOA 3HU3A 4NKRA 3T06B 2DFKB 3K0AA 1NLYA 4BUJA 1KIMA 1QHSA 2EWVA 1WE2A 3PUYA 3UIEA 1OJLA 4MKIA 1NL3A 1CJKC 2IYRA 3FHCB 3LBIA 4QBHA 3R7WA 1N6OA 3AKDA 4H1UA 2C8VA 2ZAOA 1G291 4Q7JB 4JBWA 1JXMA 2B8TA 4D6PA 1XJCA 3LQRA 5FBRB 2LKDA 1NBME 1P2VA 2G3YA 1NF3A 4D25A 4RZUA 2Y8EA 4RFVA 5FOWA 2ZRFA 1WDTA 1YJ5A 1NRJB 2YNMA 3L0OA 1R0YA 1TF2A 4JLPA 3Q85A 2FG5A 3AF2A 3L8YA 1RJ9A 1P9RA 4D82A 3X1ZA 2HLDD 1MR3F 1GAJA 4RD1A 5F9HA 4HUQA 1KGDA 2Z83A 4F38A 2VP4A 4DT1A 5JWRA 1JECA 4KCGA 3BRWD 4JLJA 4WBSA 5JS8A 1ZIOA 1OB5A 2C9OA 4GBMA 2UZIR 4BPBA 4BGDA 2WBLC 1D9ZA 3PQCA 3QOFA 1RC8A 3KJEA 4FINA 3BERA 3OEEA 5LDDC 1G3RA 4W5HA 1HE8B 1RYFA 2X1VA 1I4DD 1P4SA 4JBYA 1M8PA 3NH6A 3EA5A 4MRVA 3VU9B 2HCJB 3I61A 5HCNA 1Z0AA 1AS0A 1X1RA 4FW9A 2QAGB 4WAUA 1DO0A 4DSNA 3QUSA 3B2EA 4ZDIA 2YC4C 2OCAA 4CRWB 2IK8A 2GEUA 2OG2A 2NG1A 5TB5A 4C4PA 1EX7A 3L0IB 3O8DA 1Q21A 4BQSA 2CHVA 4QBFA 2F6RA 2J7PA 3BXZA 1RVDA 1Z0IA 4RZ3A 2B7BA 2KJQA 1MV5A 4HYYA 3J81k 1CLUA 1M2OB 4B3GA 4UJ5A 4KVGA 1KKLA 1IXSB 2X2EA 1JBKA 4BE7B 3U2QA 4LUCA 2ONJA 1R5BA 2WAYA 3I3SR 3WNBA 1CR2A 4A0FA 3AF1A 4V0MA 1ZNYA 1SVOA 4URXR 4TLDA 2JCSA 1AZTA 1DARA 1MT0A 1HT1E 2OBLA 2NQ2C 4R9UC 1KO1A 4Q03A 4BFYA 1J8YF 1D5CA 4WIAA 3AM1A 2IWRA 4DUGD 4DSOA 1SXJE 1OIXA 3FOZA 4WXPA 3U6BA 3IQXA 3LFUA 2GTPA 1GILA 4YMVA 3BIFA 2ZYTX 4LHWA 4PHHA 4CEIB 4OK3A 4OBEA 1E2GA 4FCWA 2CJWA 3CIOA 2PT7A 1YZTA 1G4UR 4CYMA 4IDQA 4P32A 4CT4B 3GP8A 5DE3A 3I5YA 3U61B 2ZRJA 4F4IA 1HTWA 5L3SB 1G6HA 2ZJ2A 3NHAA 4OL0A 2WJGA 1Z07A 2XXAB 2HEIA 2HDNB 1E1RD 4RKFA 4RY2A 2VHCA 1ZU4A 4MGKR 4A8JB 2VF7A 4MKGA 4URUR 4YLGA 3GLGB 3FMOB 3NEJA 3TR0A 2BVNA 3NC0C 3EIQA 2DFLA 1E4VA 2ODWA 4HAVA 2OV2A 4LSGA 1XTJA 4PQRA 3O8CA 1G19A 4PANA 3CO5A 3BH6A 1G5PA 3WYFA 1S2MA 1F48A 2JJ1D 4V03A 4L8GA 5HR5A 4W7SA 4HUTA 3M6AA 3AEZA 2OFXA 5GJBA 1G8HA 1NKTA 1Z0DA 3OAAA 2P2LA 4Q9LA 3GCGA 1SKQA 3OIWA 4V0KA 5CIQA 4QNRA 1YQTA 5TMPA 2G88A 2JASA 3DKPA 4G5RA 2F43B 3TGPA 3GFPA 3K53A 4DDWA 5JS7A 3T5DA 3VX3A 3C4JA 2XB4A 2MSDB 1T3HA 2D2FA 1G9XA 3GD7A 4IOKA 2XITA 2OAP1 4PPFA 2ZREA 2ZRAA 1TU3A 2KE5A 4LV6A 1IN4A 1E9BA 5HE8A 3DM9B 4EPWA 5F9FA 1XZQA 4NE2A 4X8MA 1EFTA 1FX0B 1T5LA 4M53A 3PITA 3GPLA 1AKEA 3DPUA 4FMBB 4AWXA 2JIZD 4Q01A 421PA 3NEYA 2AL7A 1S0UA 2MSEB 2FZ4A 5FOXA 2WSMA 2VF8A 2WHXA 3Q7QA 1CRPA 5GJWC 1DADA 1OIVA 2C03A 1P2UA 2QAGC 3MSXA 1FZQA 3SHFA 2ONKA 3SE0A 3EPLA 3SOPA 4QHYA 3QPWA 1NBMA 2ZTSA 3V4FA 1FFHA 1QHHB 3C8UA 1XTSA 3T1TA 5FBWB 2VRWA 4M1MA 1KJZA 3K09C 3SBEA 5G40A 4Q18A 3WYGA 3ICQB 3U60B 2HV8A 3SFVA 3UWOA 3BJIC 1ZYUA 4TTPA 3RWMB 4GNKA 1N25A 4KYIB 2W83A 3FWYA 4Q7MB 1E99A 1XB2A 4P3YA 5IRCD 2O8BB 2FU5C 5FUVA 3DOEA 5D3MA 3MUFA 5B2ZA 1TQDA 4KBGA 1AKYA 4CF7A 1WF3A 4HLUC 1CR1A 3CPHA 4M0LA 1F2TB 3TVDA 2JAQA 1YZKA 1QHNA 2WIAA 4UXHA 3LQQA 3TJZA 3UG6A 5F2EA 4Q1BA 1BIFA 1BO6A 2ZRKA 4ARZA 2ZI9A 2CK3A 4ZCMA 1W0JA 1RPZA 3I8SA 1NG9A 1E3MA 2GESA 4DDVA 4AD8A 1CS4C 1R0XA 1PV4A 3U7EB 1M1YE 1ZW6A 2JLRA 2DB3A 2ZS9A 1ZP6A 1XTQA 3THYA 3IDQA 4LRWA 4ZO4A 4WOPA 5AJWA 4X8HA 2I3BA 2WJYA 3QKSB 4LJ5A 1DS6A 1Q3TA 1GITA 1VCNA 3LVQE 4DC9A 1E9FA 2J0QA 1E2PA 2GCOB 4UXIA 3PXGA 3K0AB 3LY5A 2EFEB 4LBZA 4FWIB 4A8JC 2OSBA 4KAXA 4NCJA 5CM8B 1FMJA 1KI8A 3LX5A 3DO6A 3CX8A 4Q4AA 3R7WB 4OI1A 1HEIA 2GXSA 1Q22A 3A8TA 4QJ5A 4XIGS 3SJBA 3FDIA 4GMDA 4EDHA 1D9XA 2WSSD 3TKLA 3U3KA 2WWYA 3D7MA 2IYQA 4M8NE 2FFAA 2SHKA 3BAFA 3QSYA 4UNPA 3U3MA 3SI7A 1WMSA 2ZYVX 3IO3A 1OT3A 3B1WA 4PC3A 2IX3A 4PHGA 4TMKA 4YMSA 1RJ9B 1W49A 2IYUA 3JVUA 3UATA 1U8AA 1SVKA 4HUQB 3TRFA 3CH4B 2REBA 2HYIC 3WNDA 2ASEA 4DT1B 4L9SA 5M04A 3RRYA 1VHLA 2IHBA 4NBSA 1JEDA 1ETUA 5EXPA 2CLCX 3MG9A 4JVSB 4PFSA 1LNZA 3T12A 1GL6A 2V9PA 3VR3A 2D2EA 2W0MA 3AGPA 1ZCAA 3SEAA 4MUAA 5FL3A 4HDOB 1X8LA 3AF3A 3WXMA 4ZI3A 3BH7A 2IYYA 3OFND 1LB1B 3EZ2A 4IFBA 1XTIA 1TQ6A 3CWQA 4Q9HA 4IDPA 3FMPB 3W90A 1GVNB 2A5GA 2IYVA 2QY9A 2WKRA 3CONA 5KO2A 3QKUA 2KBFA 1V5WA 4DWJA 3BH0A 4QBIA 3FKQA 3WNCA 4DB4A 1MRNA 1GUAA 3D6TB 1W5SA 4TYYA 3IGFA 3LDAA 3PEUA 1LVGA 1XBTA 3HR7A 4LOAA 5FUWA 1ZIPA 1Z6GA 3B1YA 4H9GA 1XRJA 5EE9A 1G5RA 3PEVA 4PC2A 4QG7A 4DCSA 3RDPA 4ON9A 2LKCA 4M22A 3T1OA 2X77A 2GHIA 1NMZA 2QTFA 5KHOC 2IS6A 1AQYA 4FN5A 4MRNA 3QXJA 1Z29A 1H8EA 2JJ8A 4ZKDA 3QXXA 2BWJA 1AN0A 3FMIA 3SZRA 3JZAA 2ORIA 4KFRA 1VPLA 1KOFA 2AFHE 4US0R 1CEEA 1XJQA 1MABA 1WCV1 2QU8A 3LO5A 3CRMA 3QPUA 2BCJQ 4XSGA 4A2WA 2NZJA 5JSZA 4B35A 3B13B 1W4AA 2O8DA 1CJUC 1YU9A 3X1DA 1ZC4A 1W2GA 1SKYB 4C2UA 4IJMA 2R6DA 4FMCB 1AJEA 1P9WA 1H8HD 3Q5DA 2R65A 1N0UA 1P61B 2ZRNA 5FUYA 2FGKA 2GZHA 1IXZA 4AG6A 3U5ZB 2C99A 4KFSA 4A15A 3A4MA 2ODNA 2HJGA 1UF9A 1NSTA 1SULA 3A4LA 4UXJA 1FQJA 1Z8FA 2W6JD 3CKLA 2PH1A 1VDZA 3NXSA 1XF9A 4BEJA 1NIJA 1BYUA 4US2R 1COWD 5L3QA 3ZD7A 3QXCA 4DIEA 2VA8A 2Q9AA 1DAMA 5FOSA 4XH9B 2NO7A 1G1MA 2D06A 3K1JA 4KV9A 3THXA 2JLYA 4PO8A 2DWOA 3RC3A 1G7SA 5AWFC 2DFNA 2J7KA 3C16C 4DSTA 4Q00A 4JLDA 5JHGB 3IPYA 4E07A 4O0MA 1E2DA 1R10A 2W00A 4GOJA 4LHZA 5SZKB 3ASYA 1KZGB 1J7KA 3PUZA 1A2BA 2ANCA 1E4YA 4DBLC 5CITA 1A1VA 3A4NA 1OW3B 3VX4A 2GCNA 1KDTA 4HLDA 1IQPA 3W6PA 2RGCA 1BYIA 4TMVA 4OK5A 3L82B 1Q1EA 4R2HA 5H70A 2V1UA 2ZE5A 2QI9C 3E5HA 4XTRA 2A5DA 1YRAA 4BZXA 2G1JA 1W44A 2H1LA 5K8UA 1KSGA 2RGXA 4LJ7A 3ZS9A 2JJ2D 4ESHA 1IBRA 5FTJA 5J4HA 4A0RA 1AA9A 4HEJA 2O0KA 2OESA 3K9LA 4U02A 3BFXA 2IF2A 5FH9A 3RS7A 4DDTA 4QL3A 2O0JA 2I4IA 2FN4A 3IBYA 4TL9A 3EX7C 3OF5A 1O87A 1ESNA 2FSHA 3RS0A 3NDBB 1DEKA 2REXB 4KLZA 3GLFE 2P6RA 1ZD1A 2VEDA 1P62B 4U5XA 2B6HA 1W0KA 1FP6A 3UMRA 5DO9A 2O8FA 1YVDA 4IEIA 2N1BA 4RD0A 4EQ6A 2QGNA 3ZZ0A 2QUZA 4Z1MD 4C30A 5CB6A 2BC9A 5KDOA 1TAGA 2VL7A 3HYTA 1TUIA 1IN7A 4M21A 4NMMA 5A5GA 1YZUA 4M1TA 2PMDA 4B75A 5JFGA 1TEVA 2ZRBA 1PUIA 4ZCLA 3FYHA 3ZQJA 1KO7A 3FTQA 1R2QA 4NYJQ 4DB2A 1OLOA 3H86A 5G41A 4CZ2A 3GMTA 3GJ5A 3P4YA 1T8TA 3V00A 4O3MA 2GF0A 4IDNA 3EWAA 5D3MB 4DEXA 5G3YA 1G3QA 2JDIA 3U7GA 1UPTA 2GK7A 2H7VA 3EXAA 1OHHA 2ZRMA 5FBVB 4HAXA 3GJ3A 4P0TA 1UJ2A 2E9SA 1JQJC 5A4JA 3K0CA 4ARZB 5B30A 1VG1A 3QI2A 5J4LA 5FPKA 1JB1A 4NTZA 5J4VA 3THYB 1E2QA 2DCUA 4B2LA 3U6KA 4MGZR 1FNMA 3NVAA 4KFTA 1XEWY 3JVVA 3MCAA 2VP9A 2C98A 1G3MA 1IAQA 2FA9A 2YZ2A 1F5NA 3P26A 2ZRLA 3MMPA 5KNBA 1OFTA 5FTKA 1GWNA 1IXRC 4FXPA 5BYJA 1RYHA 4B34A 1YKSA 1M7GA 2Z5FA 4Q4AB 5KPDA 3O8RA 2ZPTX 3K0SA 2WPDD 3AP2A 2ZSDA 1CKEA 1DG3A 4O2LA 5E7JA 3SJAA 1QBKC 3TQCA 5J40A 2H16A 3ZIAD 4BRWA 1FPMA 1DAGA 2PJRA 3MFYA 2QE7D 3NG1A 4XD7A 3KX2A 1CBUA 2CNWA 4KSBA 4TYPA 3U7HB 1Q1ZA 4LWZA 1QZXA 4F91B 3CNOA 4AKHA 3W6NA 1ZNZA 2FPKA 4YMWA 2PZFA 3VFDA 2F9LA 3QF4A 1WP9A 2PT5A 4Z54A 1ELOA 4RVCA 3DOFA 4FI3C 5AJXA 1N5IA 3QBVA 1QHIA 2KBEA 1BMFD 2WWGA 2ZQ5A 1N6LA 1FOEB 1OV4A 1TEXA 1Z2CA 1E2JA 2JLUA 4B33A 1EESA 1NVWQ 5F3WB 4V0OA 3EZFA 1HT2E 1XEXA 4I1OA 4F7WA 4GI7A 1TU4A 3K9HA 2A30A 4JLNA 5HKKA 1XPOA 3RC8A 2R6CA 2RGNA 2HF9A 2IXEA 3CX6A 3NTUA 2R8RA 2W58A 2KB0A 2QRNA 3BB4A 4TLCA 4FCTA 3TK1A 1W1WA 1ZM3A 1H65A 3W6OA 1P60A 2I1VB 3A37A 2K5UA 4A2QA 5B57C 4GOXA 3KFXA 2EWWA 1S3SA 5JLJA 2B21A 2OCBA 1E2NA 3KJHA 2BJVA 4IFEA 4KVAA 1GNRA 1KSJA 3EC2A 4KFUA 4PZZA 3LWNA 4M1OA 1EFCA 3F8TA 8OHMA 2FWRA 3ECCA 1U8ZA 1VYVA 5HZKA 2BBSA 4IOMA 4KBFA 4UNSA 1G3IA 4N3NA 3H2YA 3HDTA 5TVKA 1YR8A 3PUVA 4P4UA 3U44A 1YZGA 1OYWA 3FGNA 2X8AA 3OEHD 4YC7A 2YOHA 2GJSA 4PC6A 4RZXA 3DEFA 3Q5EA 1G8FA 4XWOA 5FR1A 3QJYA 1PLKA 3B78A 4RCYA 1KY3A 2CL6X 2ZSAA 3GJ4A 4KU4A 3X1XA 2O8CB 4UNNA 3REGA 5JSZB 4M9ZA 1Z08A 4XJXA 2O8DB 2AD1A 1M6NA 2QEQA 5L3VA 3AKCA 3DZDA 3QKRA 3SDZA 2A9KA 3VMFA 1P72A 4B47A 3TW4A 4C0BA 3IIJA 5DI3B 1EGAA 2BBWA 2C77A 3L0SA 4OK6A 2NPFA 2BKEA 1WA5A 2XSZD 3RSLA 4D4LA 4A82A 1J99A 1WXQA 2AWOA 3LXRA 1C1YA 1XWIA 4M4SA 3RS3A 2UKDA 4XTCS 2Z6VA 4OQXA 4L9WA 3GLFA 2G9NA 1KSFX 1NN1A 2GVZC 4B48A 3LRPA 1YE8A 4FMCF 4Q4HA 5FTMA 2GJ9A 1GFIA 4PC1A 3NBXX 4B73A 1II8A 4M9SA 3VKHA 4HZIA 5L3QB 3AKYA 1VYTA 3A1VA 4KYUA 3B82A 3O8BA 4QHTA 4A92A 1I4TD 5L3RA 4TYQA 4JL5A 1CJVC 4EJSA 1T5IA 1DBSA 2QL6A 4TWZA 5HTKA 3DM5A 1XXHE 1J90A 4IHQA 1Z47A 1C9KA 5H68A 4C0JA 2HT6A 5SZHB 1K8RA 3MD0A 4NCIA 3KXKA 3TSOA 4D4JA 2VSXA 3CUEF 2JATA 4Q21A 5JZVA 4JT4A 1R8QA 3CWZA 4IDOA 2GRJA 1KK1A 4TZ0A 4URWR 3P32A 1NN0A 2G0TA 2IYTA 4CEHA 4EKDA 2F1HA 4TZ6A 1E1QD 3HR8A 4K81B 4Z8XA 4UNRA 3EARA 3JZMA 2IYXA 1UBEA 2VH5R 2G0NA 4LJ9A 4MITA 2ODBA 4PSKA 3VKWA 2PEZA 3PR1A 4TT3A 3N5CA 4DLRA 4MH0R 1ZJ6A 2YKGA 1EFRD 4DCTA 2OZEA 3A6PC 5DN6A 1TMKA 4P4SA 4V0LA 2ZSBA 1AK2A 1PJRA 4Q5IA 1YR6A 3OE7A 5GVRA 5FI1B 4Z51A 1OKKA 1BS1A 3ZVNA 2DPXA 1DE0A 1LV7A 1G7RA 1KYIA 1T8UA 2XTMA 2V3CC 1QHGA 3WY9A 4B74A 4I1SA 5CIWA 4JZKA 3HWSA 5K8TA 2EFGA 5J4KA 1M7BA 4LHYA 2OFOA 3KZ1E 4AURA 1Q1QA 1KNQA 2V6IA 3HYRA 4ABYA 3OZXA 2VTKA 4EQ6B 4LJ6A 3P4XA 3UG7A 2PJZA 4AK9A 121PA 4OQFA 1KNXA 4DLTA 2ZXUA 3TNFA 2C04A 2XNDA 2O5VA 1OPXA 3DMDA 4OJKA 5DH9A 4IDHA 4MKHA 4RKEA 2A5JA 2QP4A 5E7IA 1DPFA 2QROA 3VR1A 1ZM4A 3ETLA 4B2IA 2OUKA 4IEEA 5H8WA 4HATA 3I4LA 2Q3FA 4B43A 4X8LA 4BWYA 1UADA 2IS1A 1N3BA 1VHTA 1YRBA 4LX0A 4MDEA 2V7QA 4JLBA 1YZQA 2AN9A 2O0HA 2GF9A 4LV5B 1KY2A 2DR3A 3WBKA 5JRJA 2OXCA 3AQ4A 2HUPA 2BCGY 4YDHB 1XPRA 2V8OA 1R6BX 3GJ7A 3W8RA 1EXMA 3AF0A 3GLIE 5DHFA 1XCMA 3KL4A 4NYMR 3T1VA 1A5TA 3B1XA 2IEZA 3BFVA 1OXUA 3DKVA 2TMKA 3O47A 2QPOA 1FMLA 3TUZC 1U9IA 4GZMA 4DSUA 2EFHB 3KKMA 1PLJA 2J5XA 3NWJA 2WWXA 2QBYA 3PVSA 4PTLA 2G6BA 1XTRA 3D8BA 4U7DA 4A6PA 1ANKA 4YXWA 1IOZA 3I1FA 4RFSA 5EJEA 2WOOA 4N1AA 1R4AA 2OAQ1 3OEED 4X8OA 2AR7A 4I1UA 4PXAA 4XWAA 5TXGA 4C2TA 4TQ9A 4DLUA 4N0DA 5E95A 1W4RA 3FKSA 5KSZA 1T0HB 2F7SA 1US8A 1F2UA 1ZU5A 3QVVA 1WB9A 2AFIE 4LPSA 1OFIA 3QF4B 2ODEA 2O8EA 4JVLA 1KAOA 3SR0A 2BJWA 821PA 2WJJA 1RZ3A 2VLIA 3KJIA 4IKEA 4NPHA 1XEFA 5DYGA 4D81A 3IEVA 1JR3E 1E2EA 2GZDA 1XEWX 2FX3A 2J1LA 5C18A 1OSNA 3X2SA 2H92A 3QXHA 3RS5A 4NCKA 1XEXB 3CF0A 4PC7A 4TL7A 3IBGA 3B1ZA 3C5CA 1X8JA 3W3AA 4JSYA 2J7PD 1E9CA 2P3SA 3THWA 3KTAA 2F3RA 1VCIA 5KTYA 1K5GA 1RRGA 1BKDR 1ZUNB 4LV8B 4DLVA 3H84A 3PENA 1UM8A 4O2RA 5EP3A 2JLWA 1S3GA 1N0VC 2JLZA 3HJNA 3RRMA 3ZS8A 1KK0A 2LWIA 4ZIRB 4MKFA 3QXSA 1R8SA 4Q4JA 1XMVA 5UKDA 1UDWA 3AGQA 2BEJA 2XTNA 4W5JA 4EFMA 1S1MA 3TAUA 3MJHA 1U98A 1VG9B 1JI0A 1S9DA 2XZOA 2QMHA 1NI3A 1OF1A 1NJFA 2YC2C 2IUUA 1JXOA 1GRRA 4F93B 4S35A 3GJ8A 5BYKA 5FOVA 4LJAA 3C41J 4Q1AA 2J45A 2EW1A 4BRUA 2YWHA 3LNCA 3C14C 6Q21A 1XXHA 4RSGA 3ONWA 1A7JA 3RAPR 4JLKA 1EWRA 4NCNA 3TIFA 1ZM7A 3U44B 5TARA 1LS6A 3PEYA 4TYWA 2IA5A 5LPNA 2NMVA 4JLOA 3E1SA 2QZ4A 3RABA 2QQEA 5JJLA 4G5OA 2CHQA 2JGNA 2VPPA 3RANA 5GJCA 4PR0A 2J9RA 1OIWA 4JJZA 2Q9BA 1XCPA 2H17A 2C96A 5KNCA 5LD2B 5EZ6B 3LLMA 2XZPA 3OIVA 1VIYA 3K0CC 3D3QA 1DOAA 3I62A 1WRBA 2QGZA 4LBVA 4ZCIA 4PO9A 2V54A 1GTVA 4HAYA 4P4TA 3SBDA 1JPNA 1M34E 1GP2A 1TUEA 3CR7A 4G0NA 2HYDA 1R0ZA 1E9SA 4AYWA 3W8NA 3SQWA 3X1WA 1HQCA 3EIHA 3OAAD 4C0AC 4NL4H 2FEMA 2ERYA 3CBQA 3RRZA 1E2FA 3KQNA 5B64A 4R7ZA 2QSYA 3K0FA 2R2AA 3GLFB 5JEEA 2F55A 2GEVA 3CRRA 4Q4HB 1E0JA 4XSHA 4C9BA 3R9XA 3ASZA 1II8B 5EP4A 4BLRA 3VNVA 2FPMA 2XAUA 1SXJA 3ADKA 3LAWA 1Z0FA 1GSIA 1CTQA 2N46A 3KB1A 3SS8A 2D7CA 1EX6A 3I8XA 4BFTA 4DXAA 3H1TA 1KMHA 3QY0A 2ZS7A 2A2ZA 2YHSA 4EJSB 2Z4SA 3GFTA 3FB4A 4F4JA 2RMKA 3QPVA 1T3LA 3E2IA 1KSHA 3R20A 5JHHB 4CVNA 4PZLA 2IT1A 1R0WA 5KNDA 1AS3A 1U94A 4C0QC 1D6JA 3EAQA 4DLWA 4AKIA 1TX4B 4B6EA 2IHYA 2A5FA 2WMOB 2B7CA 4Q1CA 4CEHB 1Q0UA 1P9NA 1C4OA 4QM6A 3KQKA 3LLUA 3DMNA 2RGBA 2C95A 2IS4A 1BH2A 2ZR9A 1Z83A 1NBMD 5IK2A 4JL8A 2A78A 5LB4A 2BBOA 2FFQA 4CT5A 4QFMA 4P4SB 2NZ8A 4LYHA 3F0TA 3NBFA 1P3JA 3IUYA 1KJWA 5CB8A 4WZ6A 5CK4A 1TF7A 1L4UA 3UWKA 1FNNA 3B85A 4CEJA 5JCZA 2EYUA 2H57A 2IXGA 2ZRIA 5E7MA 1G6OA 4FCVA 2Q6TA 4ASUA 3V4RA 3HPRA 1CU1A 5C4MA 4TQAA 4DLSA 1QG2A 3AUYA 3FMFA 1SVWA 2GBLA 3GLHE 2XOKD 4EPTA 2XJ9A 3W3ZB 4KHZA 2FDCA 3P27A 1ZUHA 4N0EA 2WMNB 1G3UA 2CK3D 3EW9A 1W0JD 5FOUA 3ICEA 1Z22A 1GRNA 1MOZA 3MWYW 4TSFA 2H8KA 3SJCA 4B3FX 2BM1A 4HAWA 2CJWB 2J3EA 2VHJA 4D0LB 2B92A 3FFAA 1CXZA 2FMXA 3T1QA 2W2VA 1QF9A 1KTVA 1QHXA 4G1UC 5JMTA 3QENA 4QGGA 3NBZC 1EG7A 2WAXA 4OI2A 2W2XA 1U8YA 3KQLA 1AM4D 4LBYA 3TUJC 1ZM9A 3Q8XB 5G53C 1JR3A 1JR6A 2P6NA 3A1WA 3UANA 2F1JA 4E09A 3QKTA 5HPYB 4BEBA 3EPJA 2PX0A 4MUBA 3AVUA 1P6XA 4NDZA 4EPVA 4FWTA 2MMCA 1NMYA 5LD2C 1Z6AA 3LD9A 2IL1A 1XD8A 3L43A 4P33A 1HYQA 1W47A 5JEDA 3VR2A 1KKMA 2CXXA 1RKBA 1GKIA 3FHTA 1TF5A 2NPIA 2OM2A 4GDFA 2DYKA 5K8LA 1OFUX 1TQ2A 2JLXA 1W2HA 4LZZA 2IWHA 3RWOA 5KSPA 1G4AE 4W9MC 2BMFA 1SVIA 5FPYA 4HZUA 3ZJYA 2VBCA 2QMUA 2CCGA 2C9CA 5CLQA 2WTUA 5JI2E 4P31A 4DDUA 1T4GA 4NONA 1II0A 4AI6A 1FW6A 3GEEA 5E4FA 5CYOA 4PX9A 3M0EA 1Y3AA 1N6HA 4WXRA 4RFSB 4QM7A 3P20A 3LBNA 2YOGA 1KDOA 4A6XA 1CR4A 1G18A 4ACAA 4YMUA 1NJGA 2VSOA 4BFSA 2P5SA 4K8OA 5BN5A 2ZI4A 3ZVLA 4RJLA 4BFWA 3LXXA 4TL6A 4EJSC 3EASA 3PCRB 1CR0A 3CLVA 3HPQA 3LW8A 4WVFA 4C0KA 1US8B 1F2UB 3MLEA 3REFA 1XPUA 5AK0A 4FIDA 2ZE8A 5IF9A 2O8EB 4YMTA 1QVAA 1SZPA 2ZVQX 1E2KA 2IYWA 1OE0A 2CDNA 3UPUA 5SZIA 1Q12A 1XCGB 3BC1A 1E79A 1XMJA 2DBYA 2Q21A 3WP1B 3Q3JB 1XJ0A 1VKJA 3K09A 2LCFA 3THWB 1NVVQ 2A3RA 3KTAB 5BQ5A 1E94E 4GPTA 3QVUA 3TW8B 1CRQA 1P5ZB 1KZ7B 3TUIC 4JLVA 2AXPA 1XD2A 2FEOA 4TTQA 5KSYA 1P75A 2FPLA 3E70C 3EG5A 1AZSC 2HCBA 4Q4LA 2UVQA 3IQWA 2CL7X 5E3HA 1H8ED 5KOYA 1TL7C 5DLQC 2F3TA 1K5DA 5TDHA 4Q4JB 2FH5B 2OE2A 2R6FA 4LJYA 4CDGA 2E1RA 3ADDA 4PPQA 1DAFA 4HB3A 3TLXA 3WHLA 4A0HA 4MGYR 5HZHA 1LF5A 4QKQA 4ZDKA 4ESVA 1P2SA 2RGAA 2PLFA 1JALA 1UKYA 4L16A 2YYZA 1XX6A 4L15A 1S9HA 3TSZA 1XXHB 2W6IA 3Q7PA 2IYSA 2QA5A 5L3SA 2NO1A 1G8PA 1HUQA 3FE2A 4AYXA 2D62A 4TMXA 5FPSA 3PJRA 2ZE6A 3UXMA 2BHRA 3CZPA 2A5YB 3PV0A 4ZDJA 1IHUA 1IN6A 1VCOA 4RD3A 5FL7A 3AVOA 1GM5A 4GP7A 5BN3A 5EXTA 2RGDA 4LJ4A 4WA7A 3AP1A 5DYIA 4E5UA 2OBMA 3AVXA 1EFHA 1V43A 4HLQB 2H18A 4GT1A 3EZ7A 4UNQA 3L0PA 2AK3A 4LCBA 1WBBA 1JNYA 4KXFB 2KSQA 1Z5ZA 2VHTA 4JT2A 4UQOA 3IPXA 5ELXA 4NZYA 5FBQB 2RKOA 3Q72A 3OIUA 4BECA 2Q3MA 1W4CA 2QQ0A 5JBQA 4JKIA 5J47A 2ZRCA 4Q7KA 1KO5A 4IVQA 2HT1A 4HB4A 1PVOA 4L5BA 2QM7A 2XZLA 4JYCA 3B9QA 2WKQA 4B3DA 2HLDA 3K0FB 3CH5A 4BFUA 4ZI2A 5FFMA 3TQFA 4WZBE 2PMKA 2YWGA 4NH0A 1NSFA 3GLHA 2F43A 1G20E 1MKYA 4G01B 2WM9B 2IF0A 2R9VA 3C15C 2GA8A 1KI7A 1CULC 1NLZA 1SXJB 1NVUQ 2JLSA 3CPJB 2QM8A 3H4MA 4BLSA 4I81A 3GFOA 1GG2A 2JLQA 3LH5A 1E2IA 3U3RA 5J5CA 2QG6A 2EVWX 2H5EA 4PQYA 1I4LD 2P5TB 5JWHA 1L7VC 3GJ6A 2GK6A 3HU2A 1I2DA 3AB3A 3K9GA 1GNPA 4C3ZA 1ZNXA 2KI5A 4IOJA 2J87A 2WVJA 4V02A 4DRZA 2ZJYA 1DAHA 4U00A 2CCKA 2OFWA 1N5JA 1G41A 1XDBA 2FGJA 2ZI7A 4WZAE 2QPAA 1QDEA 4GMXA 4D2IA 1UBCA 3RLFA 5C2JB 2HXYA 3ND8A 1W0KD 4M1YA 4PSAA 2ZJOA 1KO4A 3CPEA 4JVNA 2OCYC 1U99A 3AF4A 1QHHA 4I99A 4HAUA 4EPXA 2GXAA 2BMJA 5FPHA 3DVLA 1ODFA 3AV0B 5IT5A 3I92A 3KXLA 1J70A 3V9PA 5BWMA 1OH7A 2P0EA 4C0SA 3T34A 5DNYB 1E2LA 2VHQA 4RD6A 1SHZA 2R6GA 3NHBA 3I5XA 1IN5A 3MWJA 2O8BA 2FF7A 3X1YA 3QIAA 3TVTA 2JDID 4IVPA 1N0WA 2IUTA 1OHHD 1O3YA 4MGIR 2CE7A 3NBYC 1NG1A 2ZI3A 2ZUDA 1MABB 3CNLA 2EYQA 1Y63A 4PHFA 4DUGA 1DAKA 3MGCA 4B6FA 2FZLA 1LS1A 2Q3HA 4B32A 5HE9A 4EAQA 4QC2A 3M4YA 5LB2A 5GVSA 2WWHA 1OXXK 1E0AA 4Y0AA 3QQ5A 1HA3A 4O25A 5FOTA 4AC9A 3A36A 3LA6A 3QG1A 2XNSA 1QHYA 1UFQA 3QKSA 5JRZA 4DCVA 1N6PA 2BKUA 2MMGA 1E1RA 1MRSA 1GZSA 2D3WA 1JJVA 4QXAA 1W48A 2R62A 3KDSE 1F60A 5D3QA 1T3SA 4EFLA 3CRW1 4BLTA 1DAIA 1NVVR 1ONBA 2VHUA 1ZVQA 3CRQA 5CDFE 4GSYA 1NNEA 4QOSA 3KKOA 2ZS8A 2YWFA 3ADBA 1RRCA 1HV8A 1NLFA 2ZUCA 1T6NA 3QNUA 1XU4A 1KI6A 2NO6A 3U3JA 4NYJR 2CBZA 1E9AA 2QSZA 4QBGB 5EUMA 3AKEA 2YWEA 3FHOA 3PFIA 4C0HA 3IIKA 3THXB 4XD7D 2JJ1A 3CNNA 2CNWD 1D2MA 2ZR0A 2PX3A 1CF4A 3U4QA 3K70B 4D4MA 4HZUB 3AVYA 2GAOA 5DISB 4H1VA 2ERXA 2GEDA 3EZ9A 2RCNA 1AQUA 1E2MA 2QN6A 5EUQB 3TE6A 1T9HA 3G5UA 4ZDWA 3SFZA 3ND9A 3AVTA 1R5OA 4I4LA 4AYTA 3B6EA 3GEIA 4DLZA 5DHAA 3SN6A 2GWHA 4MYHA 4Q19A 1JQLB 1SXJC 1X1SA 5HKKD 1IY2A 3AVPA 4B2PA 1U90A 2Z0MA 4G5GA 2VQSA 1XMSA 1OB2A 1N6RA 1QRAA 1N2CE 2AKAB 1L8QA 4EFNA 4MRPA 3F5FA 2JIZA 4MA4A 3KFVA 2ZI5A 3NH9A 1E96A 2F1RA 5C1BA 3R8FA 1UKVY 4DJTA 2J0UA 4QHSA 1N6NA 2RH5A 1IY1A 3B1VA 4TLAA 3LV8A 1QVRA 4LYFA 4F92B 1F6BA 3I72A 2IW3A 1ZD8A 1XMIA 2DFTA 3TSWA 4Q1EA 2CHGA 2QENA 1OXTA 1ZC3A 4D0NA 4TMWA 4LK2A 4ILEA 5KU1A 1UBFA 2O8FB 4AKEA 3C7KA 3CX7A 4F4CA 3CF2A 4BFVA 4JLMA 3SQXA 1KI2A 2FFHA 221PA 2GETA 1KI4A 3KUDA 4POAA 1XD2B 2CLDX 3PG5A 4B44A 3THOA 2ZRDA 3B8HA 4JBXA 3VTKA 1W7AA 3DHWC 3CR8A 3BS4A 2WIBA 4A4DA 3CRVA 2GVDC 3RVBA 4S2EA 2Q0HA 4JS0A 1X3SA 4TMTA 2PEYA 2QNRA 2WJHA 2D74A 1D2NA 3EWSA 2ZVPX 1UBGA 1OFHA 2GBLC 3BD9A 1TNDA 4OI4A 5CLLA 2V1XA 4AG5A 3ZH9B 1W36B 2XTZA 3Q9LA 2AKYA 5EP1A 5C46F 1KHTA 1GOTA 3ZD6A 4K46A 2FV8A 2RAPA 4G5QA 2ATXA 3WMFA 4XOIA 4E03A 3N70A 4DVGA 4JIMA 3EIEA 3R9IA 4NYIQ 1Z63A 4PPNA 5AUQA 5CK5A 4M2LA 3AVWA 4TLEA 3EZ6A 2N42A 4TTRA 4URYR 3PUXA 1DELA 2IBMA 5FTLA 3GQBA 5DGXA 1JEEA 5F98A 2PCJA 5KPJA 1CJTC 5B58C 2WZQA 2XJ4A 4HDQB 4LHXA 4M1WA 2ORVA 4QJ3A 2QMOA 3GJXC 1Z0KA 4MQBA 2UZ3A 2B8WA 2WSSA 621PA 3VHLB 1N5KA 1UEIA 1AGRA 3ZGXA 3M1IA 1AS2A 1XP8A 2ZYUX 2VSFA 1Z6TA 3TMKA 3A1TA 4AIIA 3KQHA 5IHPA 1XTKA 3LVRE 1PZNA 2NO0A 4PSVA 2IS2A 4C7OA 3SC3A 4MYCA 1SVSA 3EC1A 1OYYA 3QE0A 5BXQC 5KSOA 3T5GA 3K70C 2OEPA 5CJPA 1E9EA 2ZUBA 2BMDA 3ZYCA 1F3OA 3CB4A 1B23P 1Q1BA 4ITRC 4D0GA 1FUUA 3GLHB 4JL6A 2OHFA 5DIFA 4YQFA 2NGRA 1QG4A 2E87A 1E0SA 2P65A 1SVMA 2R6AA 4EIWA 5JWOA 2C9YA 4TT3D 1RRFA 4GL2A 3T61A 2R44A 2ZJBA 1JAIA 2ZJ8A 4Q66C 2JLVA 2BDTA 1J8MF 4II7A 2WJIA 1OXVA 5DN6D 3NDPA 2WWFA 2BOVA 2FFBA 2JA1A 3OFNA 2ZETA 2WOJA 3OE7D 3W5IA 1OKKD 2Q9CA 3VR6A 4A2PA 2BEKA 3SNHA 1NIPA 3NKVA 1W5TA 1YHNA 1P7CA 5HCIA 4B71A 2VYFA 4BASA 4JKYA 1B0UA 3KB2A 1VECA 2NTYC 5FPTA 4NU0A 4OQMA 3ZZTA 721PA 5CDFA 2FNAA 4D4KA 4FMDB 2AX4A 3BOSA 3BGWA 1X6VA 3CM0A 3WMGA 1CJMA 1KK2A 4R98A 4US1R 4ZV4A 4OQLA 2PLRA 3PUWA 3T15A 1A82A 1VMAA 1OH5A 2HF8A 3MWKA 3R8CA 5AUOB 2EU8A 1RE0A 4ERNA 4L4UA 4TYNA 1MO6A 2XNDD 4KJZA 4TL8A 3QF7A 4OI0A 2FOLA 4OHZA 4MYUA 3G0HA 5CM9C 4TN1A 3VR4A 2REOA 4NP6A 2ZJZA 4RCZA 1MO3A 4XWKA 5JI3E 5KYKA 3KUCA 2IYZA 1KDPA 1UKEA 2WICA 5KDLA 4QGAA 3A58B 3OHMA 4DCUA 4XVUA 2XOKA 2IYLD 4G5SA 2GKSA 5FUXA 1Z6YA 2QTVB 1ZINA 2V7QD 4W5WA 4E22A 2F9MA 1E9DA 3VHXA 1IJFA 4BLPA 2ZM5A 1E9RA 4OYHA 3ZDQA 2CCJA 1XD9A 3RS4A 2XB2A 1W36C 1LFDB 4HLCA 2EFDB 1KO8A 3QKRB 4JYBA 4LC1A 2ZSFA 3W5JA 2WKPA 1KI3A 1WBDA 1ZRHA 2CL0X 3C5HA 1NVXQ 4B3CA 1YZLA 5JJKA 1H8HA 1UDXA 1JAHA 1E0KA 5K8IA 1NY6A 1XFAA 2VP0A 1KJYA 2QAJA 4TLBA 1DG1G 1R7RA 1KAGA 2VP6A 2X2FA 1A2KC 1SGWA 2W2TA 4EPRA 2D7DA 4Q02A 1ZMXA 3K8YA 4BZPA 5GJVC 4DLYA 2W6JA 4Q1DA 1ZAKA 1SVLA 3L2OB 5EZ5A 2CVHA 3VR5A 3GJ0A 4JVMA 1TTTA 4YXWD 3BK7A 2GJAA 2NOAA 4KSCA 1COWA 1YR9A 1DTSA 4RD4A 5CJ2A 1KI6B 2A7QA 4KI0A 4MDFA 1VTKA 1KK3A 5JCPA 3IILA 3AH8A 4B76A 3FKSD 1EFUA 1GKUB 3S1AA 1U81A 1X8KA 3U4QB 2BM0A 2QPTA 3EA0A 3I32A 5DSZA 4AY2A 2PZEA 1Z6XA 3FPAA 3VQTA 3OESA 1GDDA 5DI9A 2GDJA 1G8GA 1G17A 1LTQA 4OJQA 3GLGE 5BW8A 2ZROA 1U0LA 5EE3A 2AXNA 2EFCB 1OH6A 1S8FA 2C78A 4M1SA 4NYIR 5G3ZA 3VKGA 1N6IA 3ZLJA 1N5LA 4M1KA 4JLAA 3QBTA 3ZZUA 4V0NA 2GNOA 1MH1A 5EXXA 4GP6A 2JJ2A 1PUJA 1S96A 2RGNC 3GLIA 4LC0A 4B3XA 2ZU0C 1VG8A 2OXRA 1TQ4A 2J59A 1M74A 2YINC 2J0UB 3QEOA 3R9WA 4HSEA 4LDJA 3BORA 4KLNA 1HE1C 4Q9JA 1Z2AA 4UJ3A 3A1UA 2FE4A 1S4QA 2ORWA 2QMEA 2V4ZA 2V6JA 2ZJ5A 3TH5A 1NY5A 3IHLA 4PZYA 1ZD9A 5JJIA 5LBIA 3PEWA 2ZI6A 2RGEA 3BB1A 5AUNB 2ZU6A 1HURA 3IO5A 5ANRB 3RHFA 1FTNA 3KKQA 4LYAA 1LY1A 4Z1MA 2ZIAA 4A1FA 2IUSA 4Q7LA 2GAAA 3AUXA 3H0KA 2PZGA 4BZQA 4XVRA 1UAAA 1JJ7A 3MRSA 1SQ5A 4PAOA 1T91A 2HJVA 4LY6A 3EPKA 4JMPA 5AJVB 2IEYA 1OXSC 1Z06A 4Q9IA 3HU1A 1YR7A 4HB2A 1IJEA 1BOFA 1JPJA 5TY0A 1HQYE 2O8CA 1E32A 1HY3A 4BLOA 3ZVMA 2ZEJA 5SZJA 3UMFA 2GJ8A 3BBPA 4PO1A 5AJYA 2FSIA 4KODA 4D26A 4QGHA 2VP2A 1X86B 2I1QA 4URZR 4DEYA 1GL7A 4HAZA 1NKSA 1W4BA 4LGMA 5DI3A 2D4HA 1LW7A 5EP2A 4LJ8A 3KKNA 1RIFA 1II9A 3SYNA 1DVRA 1MO4A 1IN8A 4GOKA 4IVRA 3CF6R 4JSTA 1UEJA 4HI0E 2QBYB 3MJRA 2DHRA 1G8YA 4M9XA 4EUNA 1G16A 1ZUIA 3DL0A 5AUPB 3ADCA 3QG5A 2WPDA 1SXJD 4OHXA 2DWPA 4MRRA 4B3BA 1FL9A 3B7GA 2OLJA 3ZQ6A 3RNLA 4DZZA 1K6MA 2NIPA 3ZIAA 5EE1A 3WMEA 1E69A 1GL9B 4RD2A 4TQUS 2IXFA 5H1YA 4CIDA 1RW4A 2QE7A 2RHMA 4WW0A 5C4GB 4A9AA 1IM2A 3B9PA 2PBRA 4OHWA 4C7OB 1D8TA 2C5LA 2GZAA 3LX8A 3KJGA 1GRQA 1UKZA 1G64A 2V55B 3CW2A 4IXNA 3VU9A 521PA 2ATVA 1FUKA 3TBKA 3SHWA 1KI1A 5GADl 2QTHA 2J46A 3BE4A 2QAGA 5BN4A 5KDDA 4RZ2A 3LW7A 1BMFA 1N6KA 5FR2A 2J41A 5EXSA 3N2IA 4QRHA 1Z3IX 2VO1A 4A0GA 1NMXA 1ZM2A 4Z8YA 2WJVA 3WRXC 2GJKA 4IW3B 1I2MA 5IK2D 1P73A 1AIPA 1Q3HA 1YZNA 3F3YA 2OO7A 4CW7A 1G7TA 3QEJA 2VIIA 3WHKA 2YJTD 1EK0A 1EWQA 2BIFA 1HH4A 2OCPA 5EQTA 4URVR 1KDRA 2L0XA 3NC1C 1TADA 4D80A 2ZANA 4LHVA 4DHEA 2C2HA 1G5TA 1XNJA 2RGGA 4DIDA 1E2HA 1A4RA 2GXUA 3U3OA 3MAAC 1CIPA 2OILA 4HLUA 3VAAA 2GILA 4IRUB 4ASUD 1Q44A 2QRZA 2QORA 3AVQA 1NN3A 3RRNA 4R71A 4LBWA 2HXSA 3KKPA 5P21A 2RB4A 4PPGA 2WWWA 1GNQA 3AP3A 4Q47A 3UMSA 2DY1A 2ZRHA 3EPHA 4ZKEA 3L8ZA 1FTSA 4TSFD 2J0SA 1LF0A 4CEIA 2OBNA 2Z4RA 2AD5A 5AR1A 4DLXA 1GIAA 1DO2A 4QGFA 3GEHA 3WYAA 4FMDF 2CVFA 3N2EA 1NP6A 2CEAA 3IEUA 3BWDD 1DAEA 1W46A 2ZJAA 4PQFA 3OEHA 2XXAA 4IOLA 4M9QA 4Q48A 3B60A 3TAHA 3U7FB 4A8JA 1JR3D 3GLGA 4OHYA 2YV5A 2QT0A 4CGZA 1NN5A 2MSCB 3K9NA 3T35A 4BFZA 4A36A 4HDCA 3G82C 3BFKA 2BMEA 4NHOA 4LI0A 2FJUA 2P67A 4YONB 1VCMA 2Z43A 3MWLA 4TMZA 5IDVA 2IC5A 2RHDA 4J0QA 3RS2A 3WRYC 4DKXA 2ZRPA 5CYPA 1T0JB 2YOFA 2XSZA 3UKDA
chains in the Genus database with same CATH superfamily
5EJ9A 1A88A 3WJ7A 3GPDG 3VNUA 2QMQA 1BCRA 4NZZA 2NYVA 3R0JA 4GI2A 4ZVQA 3OCXA 3OIYA 1VMEA 3ZTTA 2G83A 2XADA 3I09A 3U4DA 1PIWA 4HDMB 4M98A 3D3EA 4LXQA 4WA8A 5EQDA 3R9KA 3L18A 2CN1A 4BFXA 3GLRA 3LBYA 3K92A 4TROA 3JRWA 2EGUA 1UMCB 2G70A 3H2HA 2Y76A 1XKXA 1R15A 3WFZA 1SPBS 4BLQA 5KZMB 4LPKA 3A1SA 3WBJA 2VNHA 3K6SB 2ZRGA 1ADGA 4E4RA 1BDIA 1DDIA 2D0IA 2PG3A 4O4JB 1H93A 2QU7A 1YONA 1DWUA 1GO2A 4X84A 2O7RA 4MINA 4EPYA 4GF5A 3KK0A 1N1EA 4Q1FA 1WETA 2VJNA 1PZEA 4LS3A 3UFBA 2HEGA 4OJMX 1RRPA 2ZUSA 1VOTA 3ME5A 2ZJ3A 2W2MA 5HUQA 5C1PA 5F35A 6LDHA 1XZ8A 1SHKA 3FTNA 2WQZA 1DEHA 2OQ2A 3LCCA 3OZEA 4KP7A 3M2PA 2E49A 4AY6A 3I52A 1HOXA 1PLLA 3FFBA 3K8ZA 1DT3A 1L4NA 2JBHA 4QTZA 4YGYA 1MNAA 1BFUA 2GBGA 5A1TA 3IIMA 1D2EA 4G2TA 2I3DA 5AM0A 4HMQA 3IP8A 4Q6BA 3I5AA 2VYCA 2VYNA 2AWNA 4XD2A 4LFBB 4R2IA 1OWOA 3GLIB 4DCNA 3ICPA 2V7UA 2IDJA 1FDUA 5HF9A 1S02A 4C0LA 5KQRA 3ANYB 3EVDA 4NATA 1JVSA 3QITA 3O8QB 4K86A 3N0RA 4PRLA 1RFLA 3CLRC 4KQEA 5JNRA 1MO5A 2DWQA 3RSOA 3ITEA 4B7XA 1G7CA 3FJ1A 4YJFB 3IKJA 3F7NA 2XHZA 1FX1A 4NCHA 4F3RA 1TK9A 4RPHA 1EVEA 1XLVA 5AQ1A 1P3DA 2J3MA 2NUAA 3NIBA 4AMZA 1TZJA 5TQ2A 3RIXA 5D85A 4U3JB 1USGA 2FSFA 4GAEA 4P8RA 4XFKA 3KQUA 4AF8A 2AOTB 4U2BA 3W79A 2ATIA 3WP0A 1V96A 5EJ6A 2BI7A 2VNAA 4FDLA 1KR5A 3T99A 3O26A 1RWMA 4HWRA 4QDKA 3DZ8A 3L7KA 4XVQA 4Y9UA 2KYRA 1CERA 3BMXA 1GTL1 3TSZA 1J2JA 4BUJA 3K0AA 3EVGA 4QFMA 3VSCA 1H3NA 1CS0B 3VU9A 1JVNA 1UDCA 2AJCA 2G08A 3PUYA 4Y2XA 2B82A 1U3WA 1D2AA 4JK3A 3FF4A 2VNIA 2IOFK 3LBIA 4QBHA 5CTJA 5EPUA 3U81A 2OL4A 5LLTA 5IJ0B 2LKDA 1PTJA 3PT9A 1LBTA 1NF3A 3GP3A 2IZ1A 5LM3A 1PAUA 4WBNB 4HX5A 2ZRFA 4IIJB 4UE6A 4UEWA 2MINB 2YNMA 3EDOA 3M89A 1NFQA 1TF2A 1YZVA 3Q6IA 4OB6A 3ZLBA 3CZRA 1YS6A 3UV7A 2VOEA 4JT9A 4NAUA 4O0LA 1RJ9A 4JNKA 3KLOA 4ND5A 3RFVA 4RD1A 2JHFA 1NW7A 2XUQA 4JQSA 4P2GA 5EGNA 3VU3A 4C3UA 5F9HA 1CZNA 2VP4A 1TK3A 1XZLA 4TVOA 1W93A 4XDGA 1LWNA 1Y4UA 4IUBS 2C5FA 2HCFA 4NZMA 3O8LA 4GEGA 1XDSA 4JA2A 3BXGA 4I0WB 5FF9A 4GBMA 4FZ5A 4XGKA 3UWMA 4BPBA 1P17A 1D9ZA 1U0OC 2HSJA 1JP7A 1Y8QA 2JFWA 2WBLC 1B6GA 3E03A 4XQGA 1SJ9A 3KAQA 2FMIA 3OEEA 4W5HA 1OXBB 4CPDA 1U1DA 3UJHA 2QRHA 4JYAB 1JV2B 5A03A 2IY7A 3OD1A 5IF3A 4E46A 1I4DD 1R18A 4M60A 3VDMA 1TVMA 3LSTA 1PWHA 3ID6C 2HCJB 4GR9A 1DUIA 3MT0A 4GPEA 5DW3A 3KOOA 1H4VB 2OB2A 1NU6A 2WTMA 5J5VA 5B5SA 2DUNA 2GYWA 3QUSA 4M54A 4RESA 1N4DA 3IRUA 5IM5A 3GR6A 1Q92A 4CLOB 2Y05A 4KN5A 4K6GA 4KVZA 2C5EA 2IK8A 2EC5A 1V3QE 4RF5A 2OG2A 2NG1A 5F9MA 1RI4A 1XRLA 5LJLA 4P58A 2DBRA 1OILA 4X71A 4AJNA 4B8ZA 2OXIA 2ACEA 3ZCUA 4EX7A 1ULUA 2A94A 2OHJA 1M2OB 1TECE 1X0XA 3DT6A 1UCFA 3CPSA 3QX9A 1T9GR 1JXQA 3LLVA 4LRSB 4UJ5A 1KKLA 3FR8A 4AS3A 4U6NA 1IXSB 2NAFA 3PNVA 4AECA 1L5NA 1QNFA 4LJSA 3IV9A 3U2QA 4LUCA 1OMOA 4F2GA 4R8LA 1R5BA 2WAYA 3IVCA 5EIOA 2FPXA 4NZPA 5C81A 5KCZA 3HN6A 4Z53A 3T7EA 4INZA 4WLNA 3HVJA 4RJTA 1SPXA 1MT0A 4ECEA 5JDCA 4O4LB 4FP9A 1G4HA 4BFYA 1G20A 1J8YF 2DT5A 3C3EA 3KE9A 2IWRA 3OT4A 1F0YA 2PN1A 1SXJE 1MENA 1OIXA 5DTJA 4UD6A 3IQXA 2ZIVB 3LFUA 2GTPA 4YMVA 4ARUA 4YV7A 1ITZA 4PHHA 1BHSA 3G9UA 5AI0A 3MJSA 2CJWA 3G2IA 5HS4A 4HBZA 3VSBA 1G4UR 2UYQA 5KX5B 4ZYZA 4P32A 4PZDA 1KH1A 2WZDA 1NX6A 2ZRJA 1HTWA 1Y1QA 5LFAA 1U7WA 2X76A 4JI4B 3L05A 2OA0A 5FD8A 3ZU2A 1L7DA 1UBNA 4NBKA 1KAHA 4OL0A 2MYUA 2HEIA 1XVAA 2EWMA 2HDNB 1E1RD 4RKFA 3RIHA 4KQIA 3VH4A 2VHCA 3K6RA 2VF7A 4URUR 4XZ3A 2HU5A 4YLGA 5FAXA 3FMOB 5EJAA 3VU1A 4D56A 4RJ2A 2BVNA 2QSJA 4NQRA 4CQMB 1Y34E 2RI0A 4HAVA 1I32A 3STTA 3DEHA 4C3OB 3IP9A 4CKBA 1SUCA 2FWAA 1C0KA 3P9YA 4LSGA 5BMVB 5AVSA 2JVKA 1SN7A 3K8QA 1XTJA 4RQTA 3UZUA 2N9UA 1D4FA 2WIKA 1J06A 1G19A 4Z7QB 5I4IA 1IUNA 4JV5B 1ZXLA 2J6BA 2WFMA 5A9SB 3BH6A 3W90A 1G5PA 2C2GA 3R6DA 3WYFA 4I3HA 1ISJA 1F48A 2BFCA 5JZMA 2XXBA 4V03A 2HHCA 3B3AA 4L8GA 1KERA 5FT9A 5G1PA 4ED9A 3D8HA 3W5HA 1EVQA 1YJBA 3CV3A 2CW5A 3F3KA 5AW1A 1BCRB 4NR0A 4YQEA 3WNZA 2VDQB 3GCGA 5F4BA 2I29A 3DAGA 5HBRA 2OBYA 3ETHA 4QNRA 5I5EA 5TMPA 1H2XA 2YQZA 2UUAB 4G5RA 4H2DA 5DNVA 3Q40A 1Z4PX 3T7DA 1H5NA 1B0ZA 4MLCA 3TGLA 3BF8A 3GRVA 1HGXA 2BP7A 3G9XA 1T3HA 3H6GA 3HZHA 2C4NA 4Y6RA 2VHXA 1AKNA 1Y7IA 4EW1A 2HJHA 2R4TA 3PFWO 2V58A 2ZRAA 3ZGOA 5AW6A 1E9BA 2CYBA 4EG4A 3DM9B 3MMZA 4JHXA 1XZQA 1G5IA 4EEZA 1T5LA 3B1KA 3K94A 1IHDA 2ECPA 3CQ9A 4E2FA 4TTAA 1EGMB 1VCHA 4FMBB 4M0PA 1XA3A 2ODPA 1OGYA 2C1ZA 4Q01A 3TFOA 4ZTZB 2PUHA 2BGRA 3FN4A 3U1VA 2Q9UA 3IDFA 1GU0A 1EDDA 3DR3A 2WSMA 1P29A 1Z2NX 2VF8A 2NTNA 2WHXA 4PVCA 4QDZA 4RTNA 1ZN7A 1JHRA 1DADA 4PCUA 1XZHA 4POOA 2FZEA 1WAMA 5KC9A 2QAGC 1U2TA 1YCDA 3HUEA 2CXPA 1BE1A 2Q2VA 1O58A 4IIGA 4ODIA 3ER8A 5F77A 3SE0A 5L6LB 3EPLA 3VRHA 2XMSA 2QRMA 1ZK4A 5ER6A 1B8NA 2ZTSA 1JTFA 5JAOA 1FFHA 3ZV6A 3C8UA 3NI2A 3PPWA 2QLFA 2PM8A 1VLHA 2FYTA 2QW8A 1KJZA 2GM9A 2PXAA 3A6GA 3HDVA 3OTQA 3QX8A 4M1MA 5G40A 1RQRA 1WBJB 3EVTA 3TCXB 3VYVA 1QMGA 4DIMA 4ZVUA 4QQFA 4HYQA 3AUTA 4OF4A 3SFVA 1ZYUA 4IZ6A 1XTVA 2PUGA 1T1EA 3ZWOA 2W83A 1AO3A 1NI5A 3FWYA 4ID3A 5IUJC 2UUPA 2FU5C 3D7SA 5FUVA 3DOEA 5CA0A 3MUFA 4DAOA 2PA0A 5B2ZA 4KBGA 2PHZA 1Q1AA 3TOXA 1CR1A 4C20A 2G8NA 3JYLA 4MWOA 5T8KA 4QTYA 1NI4A 4JELA 3TJZA 3SZLA 3SDBA 4B4KA 4DQVA 5BSGA 1JLHA 1SBQA 1XZBA 2C7VA 1UOPA 1QH0A 2QTAA 1Q0SA 2WTXA 2NUAB 1RZUA 3U4HA 3I8SA 1V39A 4HADA 4QATA 3RTAA 4N5LA 4CIBA 4F4HA 3MHTA 2PBZA 4MA5A 1CS4C 1R0XA 1R12A 3KBOA 4PLHA 4JI6B 1Q91A 3O2QB 4A16A 1ZW6A 1PV4A 2DB3A 3HLKA 1ZP6A 2XCRB 3THYA 5CNMA 4B6JA 3ETCA 1IUKA 4ZO4A 4EG5A 1JJFA 2WQ6A 3QKSB 2PWPA 1NJ5A 3UQZA 2CXRA 5DNCA 3P9PA 1IB0A 2J85A 1GITA 1VCNA 3LVQE 4PX5A 5A62A 2J0QA 4I4TA 3I45A 2O05A 1ZHOA 1NWHA 3CVOA 1Z6ZA 2IU6A 2R8ZA 1U1EA 2WLTA 2J4FA 3K0AB 5JVDF 2OZKA 1B1CA 2ZIXA 4NCJA 4YCJA 3JYNA 5CM8B 1CQIA 1KI8A 2AX3A 1NBHA 1DT5A 3LX5A 4EFKA 1DWPA 4Q4AA 1OR8A 1PL8A 2Y0EA 1ZI9A 3WDSA 4P82A 4PWZA 4BO5A 3ZY3A 2I80A 3SJBA 2Z5LA 3HEAA 3WGYA 4KQMA 1D9XA 3TKLA 3PS9A 1YB7A 4HFRA 2V7BA 1LPNA 1W5BA 3OBIA 3UNXA 3ETGA 3F78A 3D7MA 2FCRA 3IMEA 3BK1A 5B3KA 1HLDA 4XB6B 4YRLA 2WWVD 4KMRA 3S68A 4UNPA 3U3MA 3QSYA 4X92A 1WMSA 1TKRA 3IO3A 4L4SA 1DQSA 1MH9A 4J7AA 1FBNA 2Q5OA 2OV8A 3AW8A 3B1JA 4P80A 4Y6LA 1RJ9B 2BM8A 3TRFA 3WSTA 3WO1A 4H4CA 2HRRA 2XMPA 1E18A 4J16C 3RRYA 1VHLA 2IHBA 4NBSA 5L95A 4CM8A 1ETUA 4QICA 2CLCX 3PC6A 5HF6A 4ZOAA 1LBSA 3H75A 4JVSB 4YFYA 1FEZA 1GXSA 2D2EA 1Y8QB 4BTLA 2OZPA 3PZBA 3AGPA 1BDBA 1M10A 4OJTA 3VDQA 2D59A 1EB8A 5B53A 5KYWA 2NZWA 3WXMA 4ZI3A 4CKZA 5MN4A 1EVIA 4EY6A 4KK4A 3L6RA 2PMCA 1XZCA 4OGWA 2OPHA 3HSSA 3SZ3A 1KMNA 2HKIA 5F7XA 4R01A 4P81A 5K0ZA 1E20A 1RAHA 4IFBA 4XRRA 4EECA 1NBWB 1TQ6A 3Q3VA 1YDMA 2PYIA 1R4MA 2CFOA 4KN9S 5BR1A 4Q9HA 3QY9A 1KJJA 2CVOA 2I2FA 2P2ZA 3H3XA 1Z2DA 5FWXA 4ZEXA 4Q82A 4KG7A 2QY9A 2UZAA 2IYVA 3CONA 4O5AA 1DBPA 4CI0B 4E5SA 1Q7EA 3AUUA 1V5WA 2M6KA 1V4BA 2VYVD 3BH0A 2B6NA 3FKQA 2FR0A 1MRNA 1K5HA 4PS1A 1A97A 4TYYA 3WC4A 1B26A 2VAPA 1OWNA 4G0YA 4BWVA 3HKBA 3AM5A 1I9CA 1L7BA 3QRWA 3RBXA 2WFAA 3GG9A 3OBBA 1P80A 5MFZA 3R5JA 1Z6GA 4H9GA 3GZNA 1AO0A 3DD5A 3JW8A 3PEVA 4PC2A 4J4TA 1PR5A 1X42A 1BX3A 3EDMA 3JYPA 2LKCA 3N7AA 4M22A 2EKDA 2GBCA 4ON9A 5GGXA 1QKKA 3RG8A 3T1OA 3ZXUB 2ZB4A 1R66A 1K1EA 3C6BA 4NI5A 2I67A 2LZ0A 3E23A 3QXJA 4Q05A 1PR9A 1DX4A 5AKKA 1QKIA 3OCZA 2RJNA 1IIRA 2Z57A 1A1SA 2GH1A 2JJ8A 5CMLA 5SYAA 1AQIA 4E5NA 2HRDA 3ETEA 3FMIA 5KTPA 4RDIA 2ORIA 2ZBDA 1CEEA 2AFHE 3V3TA 1RYEA 5IYZA 1FFYA 1G20B 3N05A 5P8WA 2XZTA 4HPXB 2L17A 1GYRA 1NTOA 3HO1A 3HG7A 3PQDA 1XAJA 4GPAA 2CY0A 3SG0A 1F2DA 3PD7A 4XWWA 4O2AF 2O8DA 1YU9A 3UWPA 4YIKA 3X1DA 1ZC4A 2NZ2A 1UUFA 1DX6A 1YJ8A 1NVBA 3C6XA 4J2HA 2GYVA 4UUAA 2H9YA 2LIVA 4JI7B 3Q5DA 2V45A 1JG1A 1AK9A 5AIAA 4BNZA 3HKDA 4J2TA 5HFJA 5I7FA 1IXZA 1NHWA 1RXCA 3EXIA 4AG6A 3U5ZB 2KX7A 3MT7A 3PNOA 2HW8A 1ICIA 3C8DA 1CVRA 1EE9A 2CKMA 2YYAA 4O59O 3NUGA 4N49A 4ALNA 4F21A 3VGPA 4Q15A 1JIQA 2PQ0A 4JB2A 4KIWA 2ZW9A 1P74A 4G85A 3VR5D 3ZJ4A 4BEJA 5BVHA 4FDTA 3NOXA 2P4HX 4LE2A 2QJFA 4JP8A 2C5HA 4OQ4A 4XWTA 3NNDA 4XUEA 4CKBB 2Z1MA 1RJEA 1W5AA 2EBUA 3N2ZB 4I08A 5DHTA 3S8EA 2H1IA 4N3BA 1MXHA 2C88A 3COVA 1Z5GA 3S2FA 5GPBA 1WU8A 4QQ8A 4QYIA 2D06A 3E48A 2YVQA 1IEQA 3ZE8A 4AP9A 5C7IO 2BFCB 1A8IA 3ED5A 1G7SA 2JLYA 3M4JA 1M83A 4AQ7A 2C94A 2J7KA 3C16C 3R0XA 2IVFA 1Y5NA 3GDFA 1XLUA 4M55A 3ILXA 5C1DA 4MVJG 5ALWA 3EGOA 3K96A 4O0MA 4FHDA 1Y6JA 3AEUA 3RNOA 4I46A 4DV1B 1JEOA 1KZGB 2WUDA 2XXJA 4QWMA 5E9QA 4Z9XA 4XDZA 2ANCA 4YP5A 1FTQA 4A26A 5CITA 1A1VA 3A4NA 5AKXA 3R6TA 4HS4A 2GCNA 4ZCSA 2PKQP 1IQPA 3W6PA 1GAQA 1P44A 1BYIA 4DBVO 3SC6A 1C3LA 2GUWA 1V37A 3T3DA 2VR1A 1QO9A 2F48A 1Y3CE 2BP7B 2GX6A 1ISMA 1NLUA 2PD4A 2YIDA 3DXFA 4N8DA 4R2HA 5EJ5A 2F8TA 4A23A 2V1UA 2XAAA 5C9ZA 3E5HA 4M99A 2HNAA 1JBEA 4I50F 2ZOSA 3M81A 1CF2O 3CLUD 3HU5A 1FSFA 3PKJA 1CDZA 4N0PA 1UP6A 1Z25A 1KSGA 5ELMA 3ZS9A 3H2SA 1Z4JA 4D42A 3FBTA 3CG0A 1KYZA 3F74A 2VSYA 3R23A 4NFSA 3WXBA 1B7GO 3KM0A 2PMEA 5BQ3A 4D8VA 4A0RA 4HEJA 2E5WA 3G8YA 4O29A 4RMJA 4U02A 3BFXA 3Q2IA 3USCS 5FH9A 1GGEA 2GERA 3I12A 3RS7A 4DDTA 3LYLA 4TL9A 2OC4A 4QFCA 3L8MA 1IPFA 3U5TA 1B6TA 2REXB 2P6RA 1VA4A 5A0TA 2AXEA 2WLSA 1P62B 2VAWA 1XVLA 3F6EX 1J0CA 4ND1A 3FPFA 2R60A 4ZOLA 4KUGA 3UMRA 4L7VA 3KPJA 5IHXA 4Y9DA 4A8PA 3SVLA 1BVHA 1P0PA 1R6XA 1YVDA 2F3SA 3MRXA 4IEIA 2W11A 5D51S 3O0TA 3WGOA 4PNZA 4Z1MD 5E1OA 1XPJA 5DM60 2BC9A 1TAGA 3HYTA 2IP2A 1OTHA 4BO3A 4B75A 2NXJA 4MWEA 3SCZA 6ADHA 1RHKA 4KSYA 4QOGA 2R7KA 3TLCA 3ZQJA 1KO7A 1U5AA 3C3DA 5AK4A 2QRPA 1R2QA 5INTA 4KAAA 2Q5LA 4D74A 4RSMA 3CYFA 1KL7A 3GJ5A 1T8TA 3UYKA 2YV3A 2GF0A 4IH4A 5EWLA 3ZXSA 5CA0B 5KWIA 1Q84A 2ZBVA 3I6MA 1G3QA 4CMAA 4H7DA 4J0KA 4PM4A 3SC2A 1OHHA 2WHYA 2ZRMA 2BELA 4FE3A 3CW9A 4F2PA 5BR8B 1NI4B 5HKBA 5AKZA 4ESOA 4WK4B 1J0DA 4BB0A 3ED1A 2F8MA 3SZOA 5K0CA 3EMVA 5BW6B 5B30A 3QI2A 5ALUA 5LWHA 4JFRA 4NTZA 5LLDA 3DYBA 3O94A 4E0BA 4G25A 2DHDA 1M67A 1ZX1A 1E2UA 3BCUA 3DZIA 2UXCB 4FD3A 1AN9A 2IEDA 4OPMA 1E2QA 1I1OA 5LQMA 3THYB 4B2LA 1FNMA 2CD7A 5CB0A 3C6ZA 4WD3A 3HGTA 3P0JA 3MEQA 5DLDA 1TYBE 2BM9A 1SEPA 2Z1DA 1V2HE 4ENRA 1ES9A 1CQPA 3OOHA 3IR6A 4N6GA 1HE5A 1NBEA 2OGZA 2VP9A 4K26A 3OQBA 1QHFA 1F5NA 1QOQB 5JSKA 2ZRLA 3ZBQA 1T1GA 2ZIXB 4PYQA 2BMWA 5BYJA 1CQIB 1RYHA 3Q0EA 4B34A 2Z5FA 3KQSA 1X7YA 1CUJA 1ZKDA 4FYKA 4MDYA 4Q4AB 1TLTA 1Z5UA 3O8RA 2NW6A 5FFFA 4OEHA 4ZWNA 1Z7EA 4I6GA 4JN6B 2O0MA 5E8RA 5JYEA 3ZIAD 4YR7A 3F71A 2QRUA 3S2GA 3S55A 1FPMA 2PJRA 3JWPA 3MFYA 2QE7D 5FUQA 5DK6A 4L08A 4TYPA 3ECSA 4B45A 2H48A 3UY4A 5BUQA 3CNOA 2H2DA 3L7JA 4MWZA 3SMVA 3W6NA 4AKHA 4AT1A 3RF6A 2X6QA 3CKYA 3KQTA 3QF4A 4E2XA 4TYMA 4ZGBA 5CFZA 3SKYA 2CWDA 3JQCA 1BJKA 3DOFA 5BRNA 3OA2A 2B4KA 1GFZA 1EGQA 1WXHA 5CW1A 4CM8B 4DJEC 1RLTA 3PUJA 3SZUA 1UT8A 3K2QA 2V6MA 4LVUA 3AUSA 3VR4H 1GXSB 1R37A 1UXKA 2H1CA 4YP9A 2WU1A 3HTXA 1I3LA 3U17A 3DB2A 3LK6A 1BDHA 2RB5A 4I1OA 4OD0A 5DCWA 3ZDAA 4JLNA 5HKKA 5IBRA 4EL0A 3I9LA 4GOLD 2HF9A 3ONVA 1MDFA 4M8SA 3CX6A 3NTUA 4OHCA 3I2HA 4R2LA 2F3PA 1WPRA 1SURA 1R4MB 4FC6A 5EVJA 1B8PA 1VLZA 2XI4A 1SC1A 3FW1A 2I03A 3H9GA 5A7GA 5KMGB 5FWXB 2ZYAA 1C3EA 3A37A 1I3OA 2B2CA 1R0RE 3TDNA 5JAHA 3VPFA 4GOXA 5LP6C 4JEIA 3EG9A 3R5HA 4Y2YA 4GMHA 2PX2A 3AUJB 4LTMA 1PR3A 2BJVA 4Y2PA 3WWYA 4PZCA 3HKBB 1YGYA 4QLOA 1K7XB 1UBJS 3EC2A 3F6RA 1W9HA 4YPFA 5KVAA 3ROMA 3MRVA 3GZNB 2ZYIA 2AUNA 5H81A 4MP8A 5KYUB 3HJRA 4ZT7A 1HNXB 2FWRA 1APBA 3ECCA 3IOYA 1QP8A 4IOMA 2IFTA 1JA0A 5A4AA 4MJ7A 1OX4A 4PN3A 4JXXA 1HXHA 4CF5A 3GMDA 3PUVA 3QWIA 1B74A 4XFJA 1C0IA 3IOCA 4M1QA 2NN3C 3U44A 3LO8A 1N2IA 2X8AA 3T54A 4UFOA 5AH0A 4PGMA 4PC6A 2BTOA 2D2XA 4RZXA 1WXFA 4XWOA 3ZWMA 5E9WA 4XGIA 3WNVA 5ESWA 1GPKA 1WUHS 4K87A 5IYZB 1GTG1 2W98A 1KY3A 3GT7A 2CL6X 4YRGA 3GJ4A 4KU4A 3X1XA 5ITZA 3ZHQA 4LXYA 4RABA 4J43A 3C5VA 4IGAA 4KRYA 1AQNA 1WQ4A 3MGGA 3WVNA 2O8DB 5IKXA 2RGUA 4M8KA 1A9PA 1T25A 4ZQIA 1M6NA 3AKCA 3PQ4A 3DZDA 3TFWA 2QLTA 2CFRA 3MCWA 4CDMA 2VBIA 2X5KO 5A9TA 4JP5A 2POCA 2XVXA 3RSCA 1PJCA 5BW5A 2C77A 2BBWA 4OK6A 1KVUA 2EKPA 3L0SA 1T8RA 4G4GA 4UU7A 1NR7A 2P41A 1C4WA 2JFZA 1Y1RA 5ENZA 5BOSA 7AT1A 4FXOA 3EXIB 4A82A 4D4LA 3WWDA 2ZLBA 4TV9F 1ZIXA 1WXQA 1WMAA 1C9DB 2YZ7A 3Q3IA 2AWOA 3R5FA 5T5QA 1BXZA 1TYEB 1EQ2A 4LOIA 4XTCS 2Z6VA 4OQXA 4L9WA 1YVEI 3GLFA 2QAIA 5BVHB 1QYRA 2HWUA 4RTSA 1WXDA 2GJ9A 2Z9DA 3VKHA 5SY9A 5KREA 5LZ2A 4LY3A 3S99A 1OY1A 3I5YA 3KT3A 2OYCA 3A1VA 5AVOA 5FULA 3LYAA 5CCEA 5HGXA 2GZSA 3D5EA 3IJPA 4QYIB 3NAQA 4TYQA 1CJVC 1T9CA 4AG3A 4IMIB 1JDJA 1V8BA 1ZGGA 1E61A 4IHQA 3QHPA 4BVHA 2AT1A 2ERCA 2NO5A 1C9KA 5H68A 3AEUB 4LISA 2HT6A 3MD0A 1C5KA 2OC9A 3INYA 1WB5A 3KXKA 3QW2A 2OXEA 4GX0A 5CT4A 3ZK8A 5IANA 1JQBA 1R8QA 5IXYA 1GYPA 1RAAA 3HJHA 4IDOA 1QPBA 5EC8A 1TJNA 4BP3A 1KK1A 2Q5IA 1ZA2A 4LWPA 3WGZA 2G0TA 3N7TA 3QEBZ 4CEHA 1VLLA 1KJIA 1W1UA 3R3YA 3EARA 2IYXA 1UBEA 5B55A 5KJCA 1JF8A 2ODBA 2PEZA 3PR1A 4ZT4A 4FBGA 1LX6A 2G1AA 1COZA 2XOEA 1ZJ6A 3I04M 4RY8A 4DLRA 5JAIA 5LQRA 5M5BA 4GKKB 2B5VA 4DCTA 1ILWA 1PBTA 3TNDA 5DN6A 4DILA 4RHYA 3VA7A 1ZICA 5GVRA 1AK2A 4Q5IA 4GXTA 1YR6A 3OE7A 1LVHA 3PICA 3ZVNA 1BS1A 2PH7A 4L7QA 5HIJA 2DPXA 1DE0A 4QOIA 3DWFA 3BKWA 2WIFA 3RM3A 4PNPA 3GBPA 4LDNA 2V3CC 3V4VB 4U7FA 3V97A 2WJZB 3KZKA 3PRJA 1RC1A 4I1SA 1ENZA 1SAYA 1HOTA 2IHZA 2QTLA 3HWSA 3JQBA 3LWZA 4G2NA 4JZKA 5DWDA 4ZOLB 4LVCA 4QA9A 3P9QA 3TXYA 5AI6A 3PDCA 3OM0A 2O4CA 5KQLA 2ZUVA 3BXHA 3HGMA 3JD0A 3GUCA 4CG1A 3UMVA 1ZAYA 3EZNA 1UDRA 3RSHA 4AK9A 4OQFA 4B3TB 1PZHA 1AF4A 2XKJE 3ICOA 4DLTA 3TNFA 1YB4A 2C04A 3KEQA 3NYWA 3N87A 4F8EA 2O5VA 4LYGA 4MKHA 3DA8A 4H7HA 3HDHA 5EWLB 3BQ9A 4MCHA 2IIQA 1POWA 1XHEA 5E7IA 3AL0C 2QROA 3FH0A 1O9GA 3FZYA 1PJ2A 4B2IA 2J3HA 3PGVA 3LPMA 2O7SA 3Q41A 5T3UA 2XUGA 1UT6A 1EUDA 1VDMA 3IELA 4FYPA 4AWBA 3N28A 3RU3A 4XCQA 3LOUA 5DYNA 2FN3A 5IVPA 2XT6A 3BHJA 2HNKA 2YFKA 5H9WA 1PT6A 2AN9A 2O0HA 2ZBPA 2CC2A 4LV5B 3WBKA 2X9LA 1ZK2A 3AQ4A 4QRDA 3QW4B 5EAIA 1T2EA 1SU6A 2VRBA 3O1IC 1YDGA 2P0YA 1M1NB 3AR8A 3AR3A 3W8RA 5A5FA 5KYXA 2C7PA 3WWPA 4IIBA 1MCZA 4I14A 1C1XA 1V5FA 1XCMA 4LVOA 4NYMR 3T1VA 3W5DA 1PG2A 1TPYA 3BFVA 4HDAA 1OXUA 2TMKA 2QUHA 2YICA 3SAJA 2YZMA 3S3TA 4MGEA 3K7EA 4WMLA 4YS6A 2JRCA 2CMHA 3MF4A 1GQQA 1PLJA 4AW9A 2WWXA 3B53X 3G9ZA 3PVSA 4YCAA 1EKXA 1X7YB 1S8OA 1G55A 1HSOA 1CZOA 1ANKA 4ZMBA 1VE9A 4RJJA 2QM0A 3DHYA 3QYPA 2WOOA 3E61A 2B36A 3U3ZA 1R4AA 1R00A 2O5EA 4GM1A 5HIAA 3UJCA 2AR7A 2O2HA 3LOPA 4XWAA 1Y37A 2IU3A 3C70A 2YXLA 3PQ8A 5E95A 1E6UA 5D2CA 2RBGA 1U8UA 5KSZA 3SXPA 2Y0PA 1T0HB 3IKLA 1GCAA 2I71A 2QPLA 3F9IA 3H65A 4KIFA 1ZU5A 1NT2A 2CFIA 2AFIE 3QVVA 1FS6A 1HFEL 3FLBA 3JQPA 3QF4B 1MEOA 1KIAA 2O8EA 4JVLA 1KAOA 2BJWA 3LCMA 4N0MA 1ZESA 4MUMA 1X7ZA 2YIMA 3EVZA 3W5AA 4NPHA 3C8MA 5FWDA 1Y3IA 2CUNA 3IEVA 1XEWX 2EARA 2FX3A 2P9GA 2FQWA 5C18A 2PUBA 1OSNA 4X44A 1DBRA 3X2SA 1J2RA 4XB1A 3QXHA 5FEUA 2GCEA 4M7OA 3H2ZA 4AZ3B 2PSSA 3WLKX 4J49A 3C5CA 1X8JA 4TTJA 2FW7A 1ABEA 1QGAA 2P3SA 2COEA 4DNQA 3QFSA 1ZL0A 2F3RA 5KTYA 3GHHA 4L0CA 4OTZA 3TW8A 3MTDA 3FETA 1BKDR 1BGVA 4LV8B 1HM5A 1ZI8A 2AMVA 3IEIA 1UM8A 4DPLA 1ZGAA 3KG2A 1I80A 4QPCA 4MUEA 1W8IA 4CLRA 1TCBA 4RZHA 3QXSA 2Y27A 3GT3A 4Q4JA 3DUFA 5AMXA 5ABPA 1UK9A 3EG9B 4IBOA 4G5HA 4P6VF 2X8LA 1GLGA 3RRXA 2IGTA 3UICA 3G8DA 1U98A 1U0BB 1ZQ1A 4IGKA 1H5UA 3I2JA 3KQVA 3T4PA 2Q3DA 4IG4A 4RH1A 3QEMB 4X95A 2ETXA 2IUUA 1JXOA 1GRRA 3E9ZA 1AB5A 3FZNA 4EZEA 3GJ8A 4P0PB 1MEJA 2VSQA 3C41J 4JXJA 4EK9A 2EW1A 1J25A 3ISVA 3OIFA 4UC0A 4BRUA 3C14C 1XXHA 3NT2A 1OX4B 2M32A 3BSYA 3D3KA 4N39A 2B99A 3M6UA 3U44B 3P9XA 2H0AA 3LHSA 5JATA 2JFXA 1H2EA 3NHPA 3WLJA 4TYWA 5EG5A 3PF8A 3VKUA 1A2OA 3CLSC 4GWLA 4MEAA 2QQEA 2YIJA 1FP2A 3WLFA 1PQPA 3M34A 4X5OA 5GJCA 1YIOA 5TGTA 2JFFA 1V3UA 1CUHA 3MQFA 3KUKA 4LE1A 5B37A 2J9RA 4JJZA 5DBOA 2RG7A 4Z2YA 2H17A 2C96A 4QULA 4R1PA 2YWBA 3HLTA 3LLMA 5ICEA 3ENVA 5AXCA 1FMCA 3K0CC 1V5EA 2R97A 1HE3A 3AYXB 4Y3UA 4EYSA 1ACJA 1YULA 1EGHA 4F45A 1ORDA 4MS4B 4PO9A 3M3HA 3RADC 4HAYA 3S5JA 3K1AB 4P4TA 2FMHA 4L22A 5H3HA 3X44A 2PMBA 5AIBA 1JPNA 1NONA 1GP2A 2UYOA 5DOZA 3LQ2A 4CR8A 2HYDA 4DIBA 2WVHA 3GEMA 5BOSB 3M4XA 1E9SA 1VBKA 4XARA 5J5AA 1S2NA 2FWNA 3W8NA 4UZEA 4IMRA 2HIHA 4L0MA 2FEMA 5BT9A 1WV1A 3KQNA 1E2FA 2CLMB 2NX2A 3OWOA 1PW5A 2QSYA 4MPDA 1W96A 4UBJA 5DTMA 3GLFB 3DYIA 3N8GA 4ME6A 4MPPA 5FO1A 2F55A 1NZJA 2R6JA 4FGZA 4OHBA 1UBMS 2II6A 4Y30A 4C9BA 2F4NA 2VCHA 4DJDC 2PMWB 2VJKA 1MU0A 4EB6A 2UZ0A 1SXJA 3SS8A 4BFTA 2XYRA 1G60A 4HY3A 4BRZA 1KMHA 5ALSA 1NC1A 4IGFA 4CM5A 5LZ7A 1EDOA 3EVAA 3KHSA 3SVZA 2YWXA 3QPVA 1D07A 2RGRA 2GN6A 1R0WA 1HLGA 3QEAZ 3JX9A 2YZGA 1J9ZA 3RJ9A 1P19A 3EAQA 5ALVA 1FDVA 2I9KA 4GZ3A 4FHCA 3TNYA 3INGA 2PX5A 1DXQA 3EX7C 2E48A 2QQGA 1U02A 1G42A 2K4MA 1GPMA 2C29D 1DU4A 4Q1CA 4B87A 4CEHB 1RWOA 2X6RA 2AV6A 3F5SA 4QM6A 3DMNA 2RGBA 4J1TC 2Z3VA 3H2IA 3PE6A 5FX2A 4RZIA 1HDIA 1GAEO 1BSVA 3NUQA 1U8XX 3ODPA 2BBOA 4BQRA 2W2PA 4CT5A 1QK4A 3TIIA 3KALA 2NZ8A 1TCCA 3AFGA 4BV9A 1XQ9A 3H16A 4WZ6A 5D1HA 1NAIA 4FFDA 2BDUA 4AJOA 1TF7A 2DTDA 2XKKA 5IDYA 3UWKA 4QO7A 1CEYA 1DC8A 4E70A 4E15A 2EYUA 1SFRA 3UJ3X 3HDJA 4HH3C 5E7MA 1U7ZA 2JIMA 2R86A 4JC8A 3FCUB 4FCVA 3F98A 1Y48E 3HJBA 3U39A 2BGGA 1FFAA 3TEFA 3BD8A 4L2IA 2BFFA 3V4RA 1QG2A 1H0RA 1WCYA 3QVJA 4M76B 2XCOA 2GBLA 3GLHE 1XTZA 1QYXA 3ZWPA 5A4IS 1SU7A 1KC1A 4F4FA 6REQA 1WSBA 3AJEA 2DH6A 2GSWA 1NRWA 1GRNA 1MOZA 1SBTA 4AMVA 2X86A 2QVCA 4MV4A 5E2BA 3SJCA 3IAS6 5IPFA 4R1QA 3WISA 4D6XA 3WDMA 2J3EA 2O5RA 1D6MA 1XVTA 5B2EA 1CXZA 2FMXA 2W2VA 3IALA 1QF9A 1HKUA 1K6XA 1IH8A 4U1RA 2WQ7A 2B20A 1R16A 2WAXA 2V6BA 1Y0BA 4OI2A 4XYEA 4CMHA 1U8YA 4DRXB 5LN1A 2NXNA 3VHRA 2CNLA 2NV2B 4K88A 2Z4TA 3D7LA 1E5DA 2HK6A 1JDBB 1EUDB 1CUGA 2P6NA 2JGIA 2XA2A 4WY2A 3UCEA 4E09A 3ZKWA 2PX0A 3EPJA 4MUBA 3AEYA 1LXCA 1R8XA 5DW0A 4E30A 4EPVA 2J3JA 2LW7A 2P90A 2JGMA 3V8EA 1VMDA 4HRXA 3TTVA 1KKMA 5L51A 3DP9A 5BPFA 1GKIA 5D84A 1C3JA 1TF5A 1W59A 2NPIA 2OM2A 3EXEA 3UMYA 1IDOA 2CDBA 3JWHA 3N8KA 4FS3A 2FZVA 1TQHA 1C1XB 2GPAA 3RWOA 5KSPA 1Y5MA 3GQVA 3LL7A 4PLFA 3I9V6 5J58A 3SIXA 2XNHA 1ISIA 4GBGA 1GGHA 1AU9A 5E4YA 4PLWA 1SD5A 1EXNA 2CCGA 1TVEA 3IBSA 2DKNA 3OPMA 1P1FA 4DDUA 3QVTA 1T3TA 3R3UA 2C31A 3GEEA 3HV2A