2QUZA

Crystal structure of the activating h-rask117r mutant in costello syndrome, bound to mg-gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNRCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation analysis in Costello syndrome: functional and structural characterization of the HRAS p.Lys117Arg mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, hydrolase
molecule keywords GTPase HRas
total genus 63
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2quzA00
4Q01A 1U9IC 2ZANA 3VHXA 1QVRA 2V9PA 3RLFA 1J8MF 4PTLA 1DS6A 3AGPA 1Z6AA 1GSIA 3NEJA 1CP2A 1XEFA 3U3JA 1T6NA 2GEUA 4P33A 1S4QA 2F55A 2CXXA 5KDLA 1GDDA 1Z0FA 3A8TA 2ZRJA 3AV0B 1LTQA 1NN0A 2IF0A 4GZLA 1DAHA 4QHSA 1XP8A 4GI7A 1N25A 4ZDJA 1DAFA 4YMWA 1E9RA 4DDVA 2O8CA 1RYHA 4Q02A 4OQMA 1TF5A 5IF9A 1QZXA 3EPJA 1HYQA 2XJ4A 2AFHE 3IQWA 1FFHA 3MGCA 2IYRA 4TSFD 3TQFA 2XZOA 2EWVA 5LB2A 3VR4A 1E2DA 5L3QB 2O8EA 3UWOA 1VYTA 4KAXA 5J4HA 1E2HA 2J7PD 3HU1A 1KK2A 1QBKC 5J4YA 4IDOA 3OIVA 4TT3A 2AHOA 1KMQA 1Z8FA 3LY5A 1JI0A 2GK6A 1G4AE 2FFHA 1CF4A 4FCVA 2PMDA 5LPNA 5DYGA 5A4JA 3RS4A 4JLJA 1G5PA 3DOEA 1FP7A 1PV4A 3X1ZA 2OLKA 4M9QA 4B6FA 3UG6A 1QHNA 3L0IB 2ZU0C 1CTQA 2NO9A 4NHOA 3GFTA 4TZ0A 2W6IA 3FDIA 2W00A 1DG3A 2J9RA 4TQUS 1KNQA 2ZSAA 3IBGA 4W9MC 4ZCMA 2BEKA 3QBTA 3KFXA 1RZ3A 5G40A 2G83A 4PXAA 2J5XA 4US1R 2F3TA 3GEEA 3RC8A 1UADA 1ZM7A 2GAAA 4GOJA 4OQXA 4KHZA 4Q00A 4B3DA 2PX0A 2ZR7A 3DZ8A 3VKWA 2GAOA 4PSVA 3C5HA 5AUPB 2QT0A 2XTMA 4AIIA 5J4VA 1G19A 3ZDQA 2OAQ1 3A6PC 4NYJQ 3ND9A 2F6RA 1ZM4A 4E5UA 2VHJA 3KX2A 2DCUA 3RRNA 2ZS7A 3FMOB 2PEZA 1JXMA 2ZS8A 4RZXA 3KKMA 4TL6A 3T5DA 4AYWA 4HLUC 3TSZA 2IYTA 1KI1A 2F1RA 3LLMA 4LJ8A 4Q4JB 4ZIRB 1YQTA 2GCNA 1OHHA 3U7FB 1G8PA 3QE0A 1OH7A 4ACBA 4Z8YA 3L0PA 3GD7A 4YMTA 3QPVA 1KI6B 4DSUA 1ZCBA 3ASYA 4V0KA 4OHYA 2W2TA 1HTWA 4XWOA 3KL4A 5AJWA 1NG9A 2XSZA 4DZZA 5TB5A 4RJLA 4Q1EA 2NO7A 3AVQA 2QPOA 4NDZA 1MABB 4OHVA 4RD1A 1KI4A 4B73A 2OEPA 1HEIA 1GL9B 1R8SA 5D3MB 1NMXA 1ZJ6A 1SULA 1ZM2A 3QBVA 4B48A 3LDAA 1G18A 5ANRB 4ZI2A 3I61A 3QSYA 2V3CC 3SR0A 1NN1A 5L3VA 4A0HA 3GP8A 1QRAA 2R6AA 2R2AA 3KUCA 2ZRFA 4U00A 1E9SA 4KJZA 4LPKA 3QF4A 4ZO4A 1KAOA 2QENA 2WICA 3A4NA 1CJUC 1T5LA 3CF0A 3M1IA 1FUKA 1MOZA 3MAAC 4JMPA 5EUMA 1DAEA 4DLRA 1KZ7B 2FF7A 4KFSA 3GJXC 4NL4H 1A82A 4KV9A 2GCOB 3IBYA 4MGIR 1QDEA 2MMGA 1TADA 2OFWA 3NH9A 4I4LA 3UANA 2CMKA 4JLOA 3O8DA 3RWMB 3TIFA 5JEDA 3W8NA 4D4MA 3U6KA 3H1TA 4IJMA 1TF2A 3UMRA 1NNEA 2JLYA 3CPHA 2XTNA 2JJ8A 1A2BA 5JZVA 1R5BA 3U61B 1KI9A 1C1YA 4YMSA 4BQSA 1PVOA 2ZRPA 1E9CA 5BN5A 1KAGA 4RZ2A 1GKYA 2A5JA 4MRVA 1IN5A 1DEKA 1E2LA 4P4TA 4MDEA 3KTAB 1AN0A 4JBWA 3DO6A 4S35A 1E2MA 3CRQA 4Q4AB 4BFSA 3U4QB 5FOWA 1YR6A 3PV0A 2FA9A 2VEDA 2YV5A 3SNHA 3VR2A 2ZXUA 3TKLA 4F93B 4LJ5A 2IYLD 4DUGD 4OI0A 3QG1A 2NIPA 5K8LA 2N1BA 3MG9A 1VCNA 2A9KA 2QBYA 2C99A 3PEVA 1P72A 2FFBA 1D8TA 1AA9A 4DCNA 1Z6YA 4ITRC 2RGGA 2Z4RA 4ZCLA 4DT1A 4V0ME 3K8YA 2EFGA 5CJ2A 4BLPA 2OXCA 2ZRAA 1W36C 2XX3A 2G6BA 1ETUA 1CJVC 1N0WA 5FTLA 3LAWA 4DLZA 2LKDA 4W7SA 4GSYA 2IS2A 2WWXA 3SJBA 1YHNA 2J0QA 1XJCA 3D31A 1M7GA 4DLXA 4RVCA 1W2HA 2GBLA 4B43A 4ON9A 4OHWA 2G0NA 1NN5A 1QHHA 3EZ7A 2GZHA 3OEHA 4L15A 5HCNA 1E1QA 3NBXX 4AYTA 3OEEA 3ZIAA 1N6LA 2IYQA 4B75A 2BIFA 3TSOA 4WAUA 1G16A 2HF8A 2KBEA 4OK6A 4DEYA 5E7JA 3QXXA 4CIDA 1KKMA 3R8FA 2QBYB 1Z29A 2RGAA 1OKKA 3LBIA 1VYUA 1QHIA 3CPEA 4D0NA 1OFHA 3BJIC 3KB2A 1Z3IX 1KSJA 1VCIA 1M8PA 2BM0A 2QMHA 5DSZA 4TL7A 2DFNA 3DL0A 1W5TA 2ZREA 1SVKA 2IF2A 1R5OA 3KJGA 3LX8A 5EXTA 4FWIB 1CULC 4DVGA 4JT2A 3BFVA 2J1LA 1WXQA 5IK2A 5J4LA 4LBZA 4GPTA 4PHTA 2PL3A 4B3FX 1XEXA 3QKTA 3WYAA 4CEJA 4F38A 2QNRA 1D2NA 2ORIA 3AVOA 3K0FA 4B74A 2JLXA 5JFGA 3DM9B 2IXGA 5IRCD 3OZXA 4JBYA 4OI2A 5TDHA 1S3GA 4IVRA 1EFRA 4JLMA 3R9WA 2W2XA 3PENA 4X8HA 421PA 1AS0A 4NPHA 3B78A 4B2LA 4P32A 3BH6A 2I1QA 1ZYUA 4DJTA 3KDSE 3VR5A 4ABYA 4JLNA 5FOSA 4LSGA 1SKYE 2BKUA 1L8QA 1J70A 1W5SA 4I1VA 4EFMA 1GIAA 1MR3F 4I1UA 2AN9A 2ATXA 1T0JB 4HDCA 4NKRA 3KUDA 3Q7QA 1XDBA 2I3BA 2QGNA 1D9ZA 3Q5DA 1I4TD 3QKSB 1S8FA 4PPFA 3TAHA 2AXPA 3UXMA 2J0UA 4ZDIA 2OE2A 2WOOA 3VTKA 4TT3D 3B82A 1D2EA 1HT2E 2REXB 2XXAB 1RYFA 2WMNB 3VX4A 3K70D 3Q7PA 5K8TA 3A1UA 4HB4A 4BFUA 1A4RA 3K0AA 1DO2A 2F9MA 1DO0A 3WRYC 3F5FA 1Q1BA 4RD0A 3BFXA 2R9VA 3T1TA 1OKKD 4XTRA 5L3SA 1E0KA 3THXB 2IYYA 5DH9A 2PJRA 1M34E 4ZV4A 4RZ3A 3TQCA 2VIIA 2OLJA 4RD2A 3P1JA 2F3RA 4E03A 1H8HD 1XD8A 2WKRA 2H7VA 4KBGA 4XSGA 1YRBA 1RJ9B 1U99A 3W5IA 4MRNA 5JI2E 3KB1A 1SQ5A 5A5GA 1UJ2A 2VA8A 2ZM5A 4ARZA 4Q1DA 5B58C 3ZGXA 2F1IA 3H4MA 2ZI3A 4LX0A 3F0TA 1P75A 4LRWA 1IJFA 1OYWA 6Q21A 1KDRA 4GOKA 2IHYA 2GVZC 4TMTA 5KPDA 2C04A 3X1WA 1N5LA 3FPAA 1HE8B 4HI0E 4XVRA 4BFXA 3IPYA 1T8TA 1HH4A 3CZQA 2QAGC 3NC1C 2VP2A 4JKYA 2J0SA 1HV8A 2WJIA 5FUYA 2GTPA 2H8KA 4HLDA 1X1SA 4M9ZA 3PR1A 3L8YA 2YOFA 3T15A 3AVWA 4DLSA 1AQYA 1AGPA 5JHHB 2AR7A 1N6OA 2N42A 4FCWA 4Q4LA 4S2EA 2O8BA 1ZNXA 5FUWA 3IIMA 3ZQ6A 4YXWD 3VU9A 1DELA 1ZM9A 1TU4A 4RKFA 3I73A 4WXRA 4IOJA 5HTKA 1GILA 3A4LA 4DLYA 1P9NA 4B3XA 4XIGS 5FBRB 5HR5A 1E96A 4CF7A 2QN6A 2GBLC 1GNPA 2ZRIA 1Z0KA 4JL5A 4DCVA 1D6JA 2C95A 3H86A 1K5DA 4HUTA 2NQ2C 3VAAA 5BN4A 4JIMA 2GCOA 2JATA 1UKEA 3RC3A 4HLCA 2VSOA 1DAIA 4OBEA 3FMPB 3AKYA 1UPTA 4JLBA 2MSDB 4GBMA 2AXNA 3B7GA 5CK5A 5G53C 3W5JA 3AUXA 4GDFA 3LBNA 1M7HA 2AK2A 3LBHA 3TGPA 4UNNA 1UKZA 1W4RA 3EWSA 3MWYW 4UXJA 3GLGA 5B30A 2BBSA 2QGZA 2BV3A 1P3JA 2A5GA 4JLPA 2ORVA 1H8HA 1GOTA 2ECKA 1ZD1A 4MYHA 4V0LA 4B2IA 3ZYCA 4I99A 5KSOA 2R6GA 2PLFA 1KDTA 1YZNA 1GTVA 1GG2A 3NG1A 1TTTA 4MA4A 4ILEA 4MRSA 2CVFA 4EPRA 2BMJA 3A36A 2CE7A 1FL9A 4YMVA 2IYUA 3OHMA 4K46A 2XXAA 1JR3A 1XCMA 4M1KA 2E87A 2RH5A 4BE7B 1U8ZA 2WWYA 4Q4AA 3U4QA 3OEED 4LOAA 2GRJA 1IAQA 2UZ3A 3NIBA 3B60A 5FL7D 2CNWD 1T3LA 4LJAA 4PX9A 1KJZA 1II8B 1YZQA 1XMJA 4AG6A 1Z63A 2VSXA 3W8RA 2IYSA 4KU4A 4NH0A 1VECA 4B32A 4BFWA 1XD9A 3EZ9A 1NKSA 1NMYA 4TL9A 4UKDA 3WHLA 2BVNA 3K09A 2O8FA 3BWDD 4I1SA 3L82B 1ESMA 1G5RA 2VHTA 3Q85A 3TUIC 1YR9A 4LHZA 4AURA 2ZI6A 3BBPA 1XMIA 3AF2A 1FX0B 2ZSEA 2H16A 3T1QA 3BD9A 1WB9A 1QG4A 1XEWY 1OYYA 1E0JA 5H68A 3AF4A 2V1XA 3AF3A 1MO5A 1EFTA 1OE0A 2ANCA 3T1VA 4C0QC 5DHAA 3CZPA 2HLDA 1SXJC 1EFRD 2ZRBA 1F2UA 4DCTA 2GCPA 4MITA 3FYHA 3LLUA 4TQ9A 3WHKA 2O8DB 721PA 1LF5A 4G0NA 2ZR0A 1US8B 4JVNA 1LFDB 5EZ5A 1RRFA 4CYMA 8OHMA 4QXAA 5CJPA 3V9PA 4LY6A 5JWRA 1FQJA 1KYIA 4MH0R 4AYXA 3QENA 3QF7A 4HYYA 5TARA 2EFCB 4TMZA 1ZP6A 3A4MA 2RGCA 3FHCB 2IEYA 2IYZA 3FHOA 4JL6A 4M1YA 2O0HA 3QKRB 1W1WA 2NO0A 2XSZD 4M1TA 1W4BA 2D2FA 4Q1CA 1M6NA 4D4LA 1YE8A 4LC1A 5L3QA 521PA 5FPYA 2V7QD 5IK2D 4QGFA 2WVJA 3KJIA 3B2EA 5M04A 4M9SA 3REFA 3X1XA 5F9HA 4P0TA 1G3UA 1RRGA 2JGNA 2PJZA 2W58A 3BFKA 3IO3A 5SZKB 2FE4A 3B1YA 4PO9A 1EESA 1GRNA 5JS7A 3VQTA 1ZW6A 2FEOA 2P6UA 3CX7A 4PQYA 5FTMA 3RDPA 5C2JB 4WIAA 3X1DA 2FH5B 2REOA 2C77A 2ZJ2A 2H5EA 4TLBA 2C8VA 2YKGA 2CEAA 2FPLA 1U8YA 4DT1B 3C4JA 2R6DA 4BLTA 1Y63A 4JL8A 4NCNA 2P67A 3SBEA 2BCGY 1N0VC 2OHFA 3BAFA 4R98A 5HPYB 3UMSA 4ZCIA 4TN1A 1G41A 3IEUA 2G1JA 3ZVNA 3GEIA 1UDWA 1E2FA 2QL6A 2WAXA 4B71A 3BE4A 1G5TA 3U60B 1JR3E 1XEWX 5EP1A 3HYRA 1FOEB 2OO7A 4JT4A 3PUYA 2F43B 4QHYA 1Z0DA 2FDCA 2HV8A 121PA 2RHDA 1RPZA 1IBRA 2PCLA 2WJJA 1AKYA 3BK7A 3LVQE 1FNMA 2B7BA 1I4LD 2ZE5A 3OFNA 4A4DA 1JQLB 2J3EA 3SJAA 1ELOA 4DBLC 3PEUA 1ZC3A 5CITA 3NC0C 2CHVA 2ZRGA 4U7DA 2G77B 1NVUQ 3LQRA 4QFMA 3TMKA 621PA 3JVUA 4KLZA 4Z51A 1E9FA 2WTUA 3K70B 5FBQB 2CLCX 2D06A 2ODWA 1AKEA 2ZJ5A 4IEIA 1WE2A 3CUEF 3NBYC 2AX4A 4TYWA 2IK8A 1GUAA 3L2OB 4PC1A 3V4FA 4DWJA 4RFVA 3KXLA 3FMIA 2DWOA 1VYVA 2O8EB 1X8JA 3WY9A 3AP3A 2JDID 3NH6A 3I8XA 3R7WB 4WVFA 3A58B 4RCZA 5FUXA 4YC7A 5DI3A 1VIAA 1OFUX 4XSHA 4LJ4A 2R8RA 3EA0A 3ZVRA 2ZETA 4CEHB 3VR3A 1TX4B 1VG8A 4JJZA 2ZRCA 4IDPA 1OXTA 2WIAA 3AH8A 2NGRA 3R9IA 4BRWA 3W34A 4QM6A 4CDGA 2A78A 3RRZA 5KNBA 1A5TA 4V0NA 3T34A 3BB4A 5CLQA 2RMKA 1E2QA 2E1RA 4MGZR 1OFTA 1XWIA 4U02A 1MRSA 2RHMA 2VP0A 4IVQA 4YONB 3H84A 3I32A 4EFNA 4BZPA 4KVAA 1KKLA 1LS1A 2BDTA 2OFOA 4HLQB 1NY5A 2ZYVX 5FPHA 1OH6A 3LV8A 1UBGA 4HB3A 1UBCA 1II0A 3NHAA 1CR1A 4EJSA 2VP4A 1G7CA 1EFCA 4JVMA 1E2EA 3ECCA 1L2TA 1N6NA 3WMFA 5SZIA 2VH5R 4WA7A 3D7MA 3SE0A 1E0AA 4V0MA 4Q4JA 4ZIRA 4ARZB 5F2EA 2L0XA 4TTQA 2XJ9A 1P4SA 221PA 2J41A 3AM1A 1VCOA 4M22A 3VR6A 4TQAA 4TTRA 4FMCB 2JLRA 5AK0A 1LF0A 1R5NA 3CH4B 1WBDA 4Q9KA 3D6TB 1ZNZA 3PUXA 5KHOC 1KTVA 3MWLA 4M4SA 2IBMA 5SZHB 2QE7A 1S1MA 3L0SA 5FL7A 1M1YE 1D9XA 3AF0A 1YKSA 2HF9A 2ODEA 4HB0A 1WBBA 1MKYA 3QG5A 4OJQA 5EE5B 2GF9A 3GJ5A 3RSOA 2DFKB 4H1VA 4DUGA 2FFQA 2YWFA 1LVGA 1YR7A 3KZ1E 4NCIA 4RFSB 5C18A 1CIPA 4B33A 2QUZA 3EA5A 2VF8A 4D81A 2YC2C 2YVUA 5IDVA 1G17A 3UKDA 3GFPA 1A1VA 4BLOA 1BYUA 5KYKA 5LD2B 4V02A 1KI8A 3MLEA 4Z1MA 4B3CA 1QG2A 4AKGA 1W4AA 1UBFA 3QKSA 5EE9A 1FMJA 5HE9A 4DC9A 5TVKA 3AQ4A 4EPVA 4F92B 5AJZA 3G82C 4LBWA 4RFSA 4A8JB 5KTYA 4Q03A 3IGFA 1S1CA 3SYKA 1IXZA 4FINA 4AI6A 2ZRKA 2JLVA 2GNOA 1OXSC 4EPTA 1JNYA 3K9LA 2WJYA 1IONA 1XJQA 3SN6A 1DAGA 4UXIA 3OIWA 4PAMA 1Q12A 2WSSD 5EE3A 2F9LA 3BH7A 1E4VA 4I1OA 1W0JD 2VHQA 4MYUA 3DM5A 4AKHA 1ZU5A 2QMOA 5JWHA 3T35A 2ZYUX 1AM4D 4RSGA 1Z28A 5C46F 1RFLA 4AG5A 3C14C 1G6OA 1FP6A 1P60A 3KXKA 5DISB 1U94A 1G7TA 5HCIA 2ZROA 4A82A 1DG1G 4IDNA 4B3GA 1XTSA 2RCNA 1GKIA 5E7MA 5K8UA 4LUCA 3GJ4A 1RVDA 4FI3C 5E4FA 1AS2A 3CONA 2CE2X 5AUQA 2EFEB 3A37A 3RANA 4A0RA 1Q0UA 4QBFA 4BEBA 4XD7D 3OAAA 3U5ZB 3CR8A 2IEZA 4XOIA 1IXSB 1NY6A 1TPZA 1JBKA 1P2SA 3Q8XB 2HJVA 4HAUA 1E9DA 2BOVA 1XMVA 4KSCA 2GXUA 4TMVA 4NU0A 1G20E 1NRJB 4D4KA 4H9GA 4URXR 4AKEA 1IXRC 1QHSA 1N6IA 4YDHB 5EP2A 2G0TA 2KSQA 4YXWA 4JYCA 3TR0A 2FSGA 1Z22A 4DIEA 4WZAE 5C4MA 1VKJA 2CHQA 2IWHA 1OF1A 1ZCAA 1XTJA 4MYCA 2IYVA 1XCPA 5G41A 4D4JA 3J81k 3EPLA 1KJYA 3KFVA 2HT1A 3C41J 3BB3A 1LV7A 4GFDA 4GRAA 5FFMA 5FH9A 2REBA 1NVXQ 3K9GA 1OFIA 1SXJA 4RD6A 1SXJE 1N5IA 1W47A 1ESNA 2NOAA 5TMPA 1O3YA 2JLUA 5EP3A 3I62A 4P4SA 2DB3A 1UEIA 2ZAMA 4TLDA 1KK0A 3GJ6A 3QVVA 3GMTA 4L5BA 4LJ9A 2WJHA 4TL8A 4MGYR 5EJEA 4L4UA 1X8KA 1N6KA 1W2GA 3AEZA 4EPWA 2I4IA 2GXQA 5GVRA 3EC2A 1SVLA 1ZC4A 2JJ1D 1YZUA 3GLHB 2JASA 3LW8A 4F4IA 1JEDA 5J5CA 1S9DA 2OILA 1NI3A 4C0KA 1KY3A 1PJRA 1FNNA 2ZUDA 1CBUA 3UG7A 3O8CA 2QTFA 4Z54A 1E4YA 2C9OA 4Q5IA 2QP4A 3TW8B 2YJTD 4NBSA 1FZQA 3AKCA 1OIWA 3BC1A 3N2IA 4L9SA 4PC6A 5FPSA 1JALA 4EIWA 4KSBA 3P4XA 2W2VA 2V4ZA 3IUYA 3PITA 2EVWX 2OAP1 1R10A 3ZH9B 2WMOB 4Q7MB 4AD8A 1TEVA 3EASA 4GZMA 2JJ2D 4C0HA 2QA5A 1P61B 2JCSA 2YWHA 5DYIA 2W6JD 3MMPA 2DFLA 2OZEA 4NONA 2DWPA 4M1MA 2AWOA 1S3SA 5FOXA 2RGNC 5DNYB 4L9WA 4ASUD 3KJHA 4OYHA 1Z6TA 3LXXA 3QXSA 5L3SB 1IM2A 3GLFB 1R0XA 2R6FA 5DE3A 4LGMA 1X6VA 3EAQA 2XB2A 2OBLA 4GP7A 4LZZA 4CZ2A 4M21A 3K9HA 3O8RA 4CW7A 2D74A 4PAOA 1F3OA 2DHRA 1SVSA 3DKVA 2VP5A 1OXVA 1Z07A 3CR7A 3FFAA 3UWKA 4KBFA 2JLSA 5EQTA 2IL1A 5LB4A 4N0DA 4LI0A 2LKCA 2RGBA 2WWIA 4Q9HA 4OKSA 3S1AB 2VP6A 2FX3A 3CLVA 3KXIA 5J40A 1Q1ZA 1P2UA 4BLRA 2B8TA 3IEVA 1CJMA 3TE6A 3V4RA 1FX0A 4MKIA 5H70A 4V0OA 2DFTA 1QHGA 1T3HA 1KO7A 1R0ZA 2LCFA 2QY9A 3DEFA 1XD2B 4RY2A 2OESA 3NDPA 3TRFA 3VX3A 1BO6A 1N2CE 3ADBA 2P6NA 3GFOA 2NPFA 2RGDA 4PZYA 3U2QA 2GJSA 5HE8A 4RKEA 1E0SA 3NBFA 3PEYA 2VRWA 2JIZD 3SYNA 2G88A 4XH9B 2DYKA 4C0JA 1IJEA 3PIRA 3AUYA 2XNDD 3FKSA 4V03A 4A36A 1NF3A 2HJGA 1NBMA 2ZRLA 1OIXA 3QI2A 2NMVA 5JECA 1G3RA 5CIQA 5KSPA 2WM9B 2IXEA 3RSLA 4EDHA 1GRQA 1KNXA 1XEXB 4O2LA 3I5XA 4HATA 4LWZA 2QE7D 1A2KC 3LW7A 5EZ6B 3VFDA 4EJSB 1BIFA 2CK3D 2QP3A 5FPKA 4X8MA 2GKSA 3LRPA 3RRMA 4CGZA 1DTSA 2H17A 4QGGA 1B0UA 3DOFA 5AJYA 4MGKR 3KQLA 3MD0A 2O0KA 1TL7C 4JLDA 2P65A 3ZZ0A 5GJCA 1NJGA 2JAQA 1KMHA 3QPUA 2AD1A 4AKIA 2WSMA 3K53A 3LO5A 3TW4A 1NBME 4OK3A 4CEIB 2VO1A 2G9NA 4B44A 1TU3A 1CU1A 1E9AA 1TUEA 1XRJA 1NMZA 4GT1A 3GLIE 2GJKA 2X8AA 5FUVA 2KJQA 1LS6A 1TNDA 4DEXA 3I92A 3AF1A 1HURA 3QEOA 2IS4A 1JEEA 1ZU4A 5EE0A 4CEHA 1XPOA 1WQ1R 4N0EA 3E70C 3QF4B 3WNBA 3W3ZB 1KGDA 5C4GB 3B6EA 3BXZA 4XD7A 4DLTA 4YMUA 2AFIE 2ONJA 5CK4A 1NIJA 4W5JA 2Q3MA 1EWQA 3KKQA 1G7RA 3V00A 2Z6VA 2GESA 5FPTA 4DCUA 3R9XA 4QOSA 1AGRA 2WWFA 4A2QA 2XEXA 3CRMA 4MRRA 3RAPR 4DSNA 5HZKA 5JCPA 1VG9B 4JJKA 5CB8A 3X2SA 1JECA 3F3YA 2ZJ8A 2VBCA 2J46A 4NCHA 4JSTA 2ZEJA 4D2IA 2WIBA 4HDQB 4D82A 2O0JA 4M1OA 4R7ZA 3SI7A 3BOSA 1IN4A 1I2MA 5JBQA 2QMEA 3P26A 3L43A 4TSFA 3W9YA 2FGJA 3EPKA 4Q9LA 5CDFA 4C9BA 5FBLB 3UK6A 1YZGA 3BB1A 1CXZA 4F4JA 3VMFA 4UXHA 1E2GA 3TUJC 4XVUA 1U0JA 1Z0JA 2A3RA 4BEJA 4E07A 3MSXA 4FN5A 1HY3A 2PBRA 4OJKA 1NSTA 3NXSA 5IT5A 3WBJA 2CCKA 3L8ZA 1X1RA 3H0KA 4C0LA 3SC3A 4OHXA 4KLNA 3LFUA 5JRJA 1IOZA 3MWKA 4TWZA 5EXSA 3THWA 2H57A 4LHXA 2D3WA 2RGEA 1W4CA 1YZTA 4A0GA 1JB1A 3CBQA 2XOKD 3DPUA 2GK7A 3GLGB 1E2JA 2Q3HA 2V6JA 3E1SA 1Y3AA 2XTZA 3W6PA 4DLWA 1RJ9A 2JJ1A 3GEHA 4LBVA 1KO5A 5FR1A 2OSBA 3FB4A 1UKYA 2GXAA 2Q3FA 3BS4A 3CM0A 2NZ8A 3BRWD 3SYLA 4DDUA 4Q18A 2QT1A 2IUSA 1PLKA 4QM7A 1TQDA 4MUBA 1M7BA 1VDZA 3THXA 2GVDC 2WWHA 1R7RA 1E32A 4ESVA 1OSNA 5KOYA 4IEEA 2GEVA 2HT6A 1F2TB 3AB3A 2ZIAA 1V5WA 3HP1A 4DIDA 5F3WB 2QQ0A 2FMXA 3PUVA 3GJ7A 5FI1B 2BBWA 3QNUA 4NYIQ 5KPJA 4FD2A 5CLLA 2OBNA 5JJKA 3E5HA 2WJGA 1EXMA 3KQNA 2ZJOA 4HDOB 4ZKEA 1F2TA 2IUTA 3EARA 3LQQA 4PFSA 4QHTA 1U9IA 4QBGB 4Q9JA 5LDDC 4M8NE 4NCJA 1G8HA 3NDBB 1H8EA 1WCV1 1XZQA 5FOUA 4LHWA 3FE2A 4XWAA 4BFYA 1R0YA 3HR7A 4EPXA 3ZS9A 1P7CA 3P20A 1MT0A 2IYWA 2J45A 3B13B 1NLZA 1T9HA 4H1UA 1KJWA 3C8UA 4D25A 5D3QA 4G5SA 2TMKA 4IVPA 1H65A 4IDQA 3Q5EA 1RRCA 1NL3A 5B64A 2HCBA 1NN3A 2PH1A 3KKNA 4EAQA 1DADA 1OJLA 4QBHA 5FTKA 3RS5A 5HZHA 3LA6A 1GFIA 3KJEA 2HYDA 1Q1QA 3DVLA 3IKJA 4QL3A 2YHSA 1TF7A 4BZXA 3CPJB 1E99A 2CNWA 1LW7A 1R6BX 1UM8A 2VHUA 2WJVA 3PJRA 2ZJYA 4K8OA 3IILA 3UMFA 2HXSA 2VL7A 3DDCA 3KQUA 1QHXA 4DXAA 5KDOA 1E98A 2PMKA 4ZDKA 3AP1A 3I4LA 3HR8A 4KCGA 5FL3A 5F98A 5L3RA 1E1RA 3K0AB 2GJ9A 4IDHA 4LPSA 1T4GA 2ZQ5A 3CF2A 4C2UA 4E22A 4FWTA 2FPKA 2ATVA 4UNSA 4C0AC 3TUZC 3QJYA 4R2HA 4EPYA 2R62A 1IQPA 1QF9A 4BRUA 2BBOA 4UNRA 1Q44A 3MFYA 1XX6A 2VF7A 2X77A 5EUQB 5BXQC 4IRUB 2F1HA 3L0OA 4BFZA 3K1JA 3BIFA 2WKPA 3CW2A 3KQKA 2ZPTX 4NP6A 4PHHA 1J2JA 4A6XA 1NVVQ 3JZAA 4D6PA 2QI9C 2FPMA 4HAYA 1KI7A 3QXHA 3P4YA 3REGA 2D7CA 4QNRA 1P2TA 2A5FA 3TLXA 4DRZA 5BYKA 1H8ED 2EFHB 3B5JA 4N3NA 4G1UC 4YQFA 5JS8A 4UNPA 1U0LA 2Q9AA 2PZEA 2GA8A 3A1SA 2BWJA 2GHIA 4O2RA 3U6BA 1XCGB 4CEIA 3UATA 3ND8A 1XNJA 4BWYA 1P9WA 4I81A 4KXFB 2ZI7A 4RD3A 1NG1A 3ZS8A 3FTQA 2A30A 2KBFA 2QAJA 3QXCA 1BKDR 1E9EA 2OCPA 1OB5A 3FGNA 3A1WA 5CYPA 4W5WA 3FWYA 2B21A 5KNCA 4DKXA 3PFIA 5GJBA 2FSFA 1F60A 2CL0X 2HUPA 1D5CA 1N0UA 1T91A 2GJAA 3NHBA 3SQWA 3AVUA 4P4SB 3B1VA 3JVVA 4LYFA 5EE1A 3OEHD 3K0SA 1E1QD 2WSSA 3MRSA 2A7QA 2W0MA 1FTSA 1E9BA 1M74A 4M9XA 2GF0A 5JSZA 1W0JA 2Q6TA 2R6CA 3NTUA 2H1LA 3CNNA 1OT3A 4RCYA 4URZR 2GETA 2IUUA 1XZPA 2AD5A 3FVQA 1XF9A 1U2RA 2ODBA 2V6IA 4FMCF 4DSTA 2BM1A 3E2IA 1I4DD 1OIVA 4B2PA 3ETLA 4DSOA 4KYIB 2HYIC 2QTHA 1N6PA 1OLOA 1ZNWA 1P2VA 1ZM3A 4JZKA 5CIWA 2EYQA 3RNLA 4QNMA 3TAUA 3B85A 3U3KA 1JR3D 1MO6A 3OFND 1G8FA 2WHXA 4W5HA 1YZLA 1FMLA 1W44A 4TMWA 5CYOA 3QY0A 4LC0A 4LDJA 4US2R 2BKEA 5FBVB 1K8RA 1Z06A 2IYXA 1ZBDA 3AKEA 1RE0A 3NEYA 5GJWC 1KI2A 4C3ZA 1W7AA 2LWIA 1E79A 3C7KA 2XITA 2CDNA 1IY0A 3C5CA 3CRW1 4NTZA 3RS3A 3GPLA 2EU8A 1K5GA 4ESHA 2FV8A 2AKAB 2XB4A 3H2YA 4NYJR 5FI0B 4PPNA 5LD2C 2JDIA 4ZI3A 4PO1A 1W0KA 3GLFA 5B57C 1EWRA 3RHFA 1Q57A 1F5NA 2J0UB 2QAGA 3LNCA 4QJ4A 4A2WA 4FW9A 4HAWA 3VNVA 4CRWB 1YRAA 3CNLA 4NYIR 1W48A 2VQSA 3LXRA 1HA3A 4C30A 1G3IA 3K0CC 5FOVA 2XNSA 4A92A 1FUUA 4Q1BA 5JHGB 2GZAA 3OF5A 4DB4A 4MUAA 2EFDB 2FGKA 3AVXA 2YOHA 2QPTA 1R2QA 2A2ZA 3B8HA 2YZ2A 4CT4B 1SXJD 1JAIA 4JKIA 1TMKA 5JCZA 5JSZB 5BQ5A 1OW3B 1GKUB 4DDWA 1MH1A 2GZDA 1G64A 2Z4SA 1XXHE 1L7VC 1HUQA 1R8QA 4NMMA 2CHGA 2FEMA 1NIPA 1ZD9A 3QPWA 4BGDA 2C5LA 4O3MA 1K6MA 4TLCA 3LWNA 2IWRA 3DHWC 4PZLA 4HAVA 1EK0A 2KI5A 3MUFA 4TTPA 1KOFA 1WDTA 2ZSFA 1CS4C 1C9KA 2J7PA 2FZLA 2VHCA 3AP2A 3CWQA 5DLQC 5HKKD 1AS3A 2ZI4A 2QSYA 2G3YA 2IXFA 4M0LA 3WRXC 1PUIA 4Y0AA 4B76A 4IW3B 3SHWA 4PO8A 2XZPA 4FCTA 1T3SA 1NBMD 3WP1B 4NCKA 4GOXA 1J90A 4PQRA 3K70C 3EIHA 3CNOA 5DI3B 1HE1C 1CLUA 1NKTA 5TY0A 1SVIA 3WNDA 2C96A 1FPMA 4Q4HA 1X3SA 1Z08A 2WV9A 2W83A 2B7CA 1EX7A 1GNRA 4CT5A 4R9UC 4UJ3A 3D3QA 3A1TA 1VPLA 2WPDD 2ZRDA 2XGJA 1UKVY 1Z0IA 3N5CA 3M0EA 1W0KD 4LJ7A 4LYHA 1ZVQA 2XAUA 3RYTC 4XVQA 3C16C 4JLAA 3VHLB 1T8UA 1JXOA 2Z0MA 1KO4A 1T5IA 4EFLA 2OM2A 3WXMA 1GM5A 3VNUA 4U5XA 4WBSA 3KKOA 1CJKC 4KVGA 1PLLA 2CJWA 3EIQA 1NVVR 4Q7KA 1KSHA 4G5RA 5JMTA 4PPQA 4NYMR 3CO5A 1DVRA 2ZS9A 1AJEA 4M2LA 4PPGA 1J8YF 3AVTA 1RKBA 1KIMA 4WZBE 2D62A 3WYFA 3ZIAD 1R4AA 1RW4A 2OXRA 4C4PA 4URVR 2PT7A 4Q21A 4MKGA 5JJLA 5C1BA 2QG6A 1QVAA 5FR2A 2V55B 3DMDA 4GP6A 4WZ6A 1Z6GA 2PLRA 4P4UA 1E94E 1Z2AA 4LV8B 3KTAA 1E2NA 1N5KA 3K09C 3ZD7A 1G21E 2ZRMA 3SJCA 1PZNA 2HDNB 2OBMA 1BMFD 5H1YA 4L8GA 4PC2A 3SOPA 1T0HB 2BCJQ 5BW8A 1Z0AA 3NBZC 2ZUCA 3TNFA 3KKPA 1Q22A 2GXSA 1WA5A 3CIOA 1FW6A 3GQBA 2UVQA 3WNCA 4R2IA 1KO1A 5P21A 2A5YB 4BZQA 4IFEA 1IY1A 2BC9A 5GADl 2VPPA 3ONWA 1G3QA 2QM7A 1P9RA 4IOLA 1L4YA 1M2OB 2QQEA 2CL7X 2AWNA 4B6EA 3G5UA 1HQYE 4M1SA 3VU9B 4EQ6B 2JLZA 1R0WA 5TXGA 4QRHA 2VYFA 1TQ2A 5SZJA 3EZFA 3OE7A 5B2ZA 1VHTA 5JEEA 4TZ6A 4QKQA 1VMAA 2O8BB 3QQ5A 1XTRA 2V8OA 2FN4A 1AIPA 1G1MA 3FKQA 3GJ3A 1OXXK 3MJRA 1F2UB 3I3SR 4KODA 3ZJYA 4JBXA 2CBZA 4KFRA 4EKDA 5CB6A 2D7DA 2JLQA 1ZINA 3M4YA 1N6HA 4UJ5A 2DR3A 1MRNA 1XTQA 3EZ6A 2X1VA 4MKHA 2FG5A 4II7A 2ZTSA 2FSIA 1FQKA 1SZPA 3CH5A 1RIFA 3SBDA 4G5GA 4HSEA 1IHUA 1KI6A 2RGNA 4MDFA 5E95A 4BASA 2Q9BA 5GJVC 1JPNA 2ZU6A 4OK5A 1IN6A 3AGQA 4LYAA 3GLGE 4AK9A 4BPBA 1AQUA 1VTKA 4X8LA 4ZPXA 1U0HC 1MO4A 2O8FB 4GMXA 1G8YA 3MJHA 2BBTA 1G8GA 4WW0A 4D26A 1OB2A 4C2TA 2IC5A 1CRQA 1GL6A 1G6HA 4LJYA 4AY2A 3U3RA 4J0QA 4CVNA 4IOKA 4Z1MD 1II8A 1GVNB 1GITA 4N1AA 1G291 1G7SA 1BOFA 1RRPA 1CKEA 4US0R 3GJ0A 821PA 5DIFA 3N2EA 2CCJA 2AKYA 2P3SA 2C2HA 3D8BA 3QKRA 3FHTA 3BORA 1F48A 3NWJA 3QEJA 2V7QA 3QVUA 1ONBA 3DMNA 4WXPA 3IIKA 3THYA 4QGHA 4OI1A 1FTNA 2C9YA 3ZQJA 1S96A 2QEQA 5JI3E 3IQXA 1OPXA 4F4CA 3JZMA 2O52A 2GEDA 2ASEA 3EG5A 1IN8A 1YVDA 3RS2A 3EX7C 1TUIA 2XOKA 1U8AA 4BECA 1DAKA 3IIJA 1KSFX 3BGWA 1Q1EA 3FFBA 4UQOA 3C15C 3PVSA 4B3BA 1LB1B 2OCYC 2CCGA 4M1WA 2ANBA 4TYYA 1S0UA 1Z6XA 3HU2A 3CF6R 4WOPA 1XTIA 4URUR 3LD9A 4KFTA 3MCAA 4D80A 1E1RD 2ONKA 1JAHA 5GVSA 2ZAOA 4URYR 3NVAA 4QGAA 1ZUHA 3B9PA 2FFAA 3IHWA 3MWJA 3O47A 5DGXA 3GLIB 3IHLA 4URWR 5G3ZA 4A2PA 2ZVQX 4AC9A 3AKDA 2P6RA 2HXYA 4LHYA 1XU4A 3HYTA 4A9AA 2R44A 5AR1A 4ZKDA 1COWA 1UF9A 4KI0A 2YOGA 4HUQA 2J87A 3PUZA 2ERXA 3PCRB 3GJ8A 4A6PA 3LH5A 2QP9X 4LHVA 4KYUA 1J99A 3THYB 1MV5A 3W90A 3I1FA 2RGXA 1E69A 4HEJA 1KI3A 2BMEA 5KU1A 1DPFA 2F1JA 3EXAA 3B1WA 1SGWA 3HDTA 2WPDA 3CRRA 4X8OA 1BS1A 3X1YA 4TYPA 5E7IA 3RABA 2YWEA 1ZUNB 3OIUA 4MRPA 5FTNA 4D0GA 2P5SA 4RD4A 3RVBA 3U7GA 3VKGA 1XPRA 5KUTA 3U7HB 1AK2A 1SVMA 2C03A 1SVOA 2ERYA 2CJWB 2PEYA 4Q47A 3THOA 4NYMQ 3ZZUA 4ERNA 4ZDWA 3SJZA 1LY1A 4F91B 4DCSA 3G0HA 1Z83A 4TMXA 3VR1A 5JLJA 3W3AA 5JWOA 4OQLA 1GL7A 1VIYA 5HKKA 4HUQB 5BN3A 4O0MA 3LX5A 4LJ6A 4NZYA 4GNKA 2EQBA 2AL7A 1P6XA 2UZIR 5JRZA 2ZJAA 2OUKA 2KB0A 3IPXA 3AVVA 4KO8A 1ANKA 1XJ0A 3B1ZA 2O5VA 5UKDA 4ACAA 3W6NA 2ZSDA 1V43A 3S1AA 3Q72A 4HZUB 2W6ID 1JJ7A 2A5DA 2OG2A 3PXGA 5DN6D 2F7SA 2GJ8A 1GWNA 1SHKA 2JA1A 4BFVA 4BFTA 2H92A 4TMKA 3LVRE 5A0FA 2ZR9A 2PX3A 4IKEA 3ASZA 2R65A 4FMBB 1U98A 2FNAA 2B8WA 3RS0A 5E3HA 2MSEB 4DB2A 3FMFA 4MYTA 3WYGA 2RAPA 1YJ5A 4PHFA 2VP9A 2ZI9A 3QOFA 5J47A 3DZDA 1CR0A 1TAGA 1NLFA 4EUNA 4C0BA 2WWWA 1XXHA 4JYBA 1US8A 1CEEA 2IA5A 3GLFE 4JSYA 1COWD 2GDJA 2DPXA 4POAA 1II9A 5DO9A 2I1VB 2O8DA 1DOAA 4YDSA 2RKOA 3P27A 1SVWA 4GL2A 1N3BA 2WZQA 3DKPA 4QJ3A 3ZD6A 3RS7A 1F6BA 2PCJA 4E09A 2ZE7A 4O25A 1UEJA 3HPRA 2K5UA 3M6AA 1ZRHA 2W6JA 4AWXA 4TYNA 2FSHA 3OE7D 4Q48A 1OHHD 4F7WA 2IS1A 1J7KA 3OESA 4NE2A 1P73A 1C4OA 3TK1A 1JPJA 4PHGA 4PSKA 4M53A 4KFUA 1WMSA 1O87A 4OHZA 1XD2A 1ZMXA 4LK2A 3K9NA 3B9QA 1KO8A 5FTJA 2V1UA 3BH0A 2ZSBA 1W49A 4JS0A 3WMGA 1JR6A 2OCAA 4P31A 4Q1AA 1BMFA 3K0FB 2BJWA 5TV2A 3TBKA 2Z5FA 2FJUA 3GLHE 1XTKA 2FWRA 1Z47A 2ZITA 3P32A 4PC7A 3U3OA 4A8JA 1N6RA 1G3MA 2ZI5A 2OT3B 4JLKA 4EJSC 1UFQA 3VKHA 1KHTA 4HAZA 4GMDA 2GILA 2Z43A 2B92A 5ELXA 3I72A 4G3XA 1XXHB 3ADCA 1SXJB 3IO5A 3HJNA 4BLQA 2YNMA 2QM8A 1YZKA 3ZZTA 3R20A 1SKQA 4PQFA 1KDOA 5JJIA 1CR4A 2CLDX 4EQ6A 2KE5A 2VSFA 1W36B 4PC3A 1S2MA 3B1XA 4B35A 2DWQA 2NO6A 1Q20A 4DLUA 5DHFA 4DDTA 4PANA 5EXPA 1AZTA 2ORWA 2ZE8A 1B23P 4Q1FA 4HZUA 2ZYTX 1E2KA 4Q4HB 4Q7JB 2QMUA 2JEOA 5KSZA 1SKYB 1HQCA 2QSZA 2W0SA 1NSFA 3Q9LA 4FXPA 4YLGA 4A0FA 2HEIA 4BUJA 1OH8A 1IN7A 4C7OA 2OV2A 2WWGA 2CK3A 3BERA 4C0SA 5KO2A 3CWZA 2BJVA 2VLIA 2QRNA 1W36D 1CR2A 1ZIPA 2V54A 2P2LA 2FOLA 3O8BA 1KDPA 4MKFA 1EX6A 1TEXA 1VCMA 1XMSA 2J0VA 3QXJA 1AZSC 2NG1A 4TLEA 4D0LB 3T06B 3TVDA 2ZYWX 1KMHB 1Q3HA 4K81B 2Z83A 3K0CA 5AJVB 1Q3TA 1WRBA 1TQ4A 4P3YA 4OI4A 4TLAA 2B6HA 2ZJZA 1OH5A 3ICEA 1XPUA 1JJVA 2G1KA 2YC4C 5FBWB 4QC2A 2D2EA 2Q9CA 1KY2A 2XZLA 2JLWA 2X19A 2ZUBA 3HWSA 4Q9IA 4LCBA 3SHFA 3EWAA 2OFXA 4HLUA 1ODFA 1DE0A 3ZVLA 3UIEA 1G9XA 1GAJA 2ZE6A 3GCGA 3SEAA 3SDZA 2C78A 2E9SA 2HLDD 3N70A 1I2DA 2RB4A 2ZJBA 2HCJB 3W6OA 2Q0HA 4UNQA 2ODNA 4R71A 2IS6A 3R7WA 2ZVPX 3A1VA 2QRZA 1G4UR 4RZUA 5AUOB 3UPUA 2DBYA 2GWHA 3GLIA 1NJFA 5K8IA 2PZGA 3TVTA 5CDFE 1N5JA 2WOJA 4C7OB 3PUWA 1HT1E 3CRVA 3CKLA 4JVLA 5AWFC 2Y8EA 1GNQA 1A7JA 4FMDB 1GP2A 4G5OA 4QJ5A 5H8WA 3AVPA 4IOMA 2IHBA 2QORA 4XJXA 4IXMA 4FIDA 3QKUA 1Q21A 3F8TA 1Z5ZA 2BMDA 2D4HA 2YINC 1E2IA 1E6CA 4TYQA 5BYJA 5IHPA 5D3MA 2VTKA 4HZIA 4G5QA 4DHEA 1BYIA 4QBIA 1ZAKA 2Q21A 4LV6A 4IXNA 3HU3A 3EZ2A 2SHKA 4PZZA 5KNDA 3I5YA 1X8LA 1BH2A 2X2EA 2CVHA 4FMDF 3ADDA 5KSYA 1CRPA 2P5TB 3RRYA 1NVWQ 3SFZA 3TSWA 3T12A 2EWWA 1XB2A 3NKVA 3RWOA 4LV5B 1DBSA 2AK3A 2JJ2A 5J4KA 2QU8A 4BLSA 2NPIA 3U44B 2P0EA 3OIYA 1PUJA 1L4UA 1ZNYA 2NZJA 3WBKA 3CX6A 2EYUA 4ASUA 4KITB 1WP9A 4MQBA 3QIAA 2CLSA 3ICQB 2YYZA 3TH5A 1UBEA 5EXXA 2BEJA 2PZFA 1SHZA 2BMFA 2J7KA 5AUNB 1DARA 4DLVA 1CJTC 3T1OA 3QUSA 1QHYA 2X2FA 1S9HA 3PQCA 2BHRA 2J59A 1P62B 1KSGA 2UKDA 1OV4A 1JQJC 3SS8A 1KZGB 1LNZA 3EIEA 1YU9A 3CB4A 4XWKA 2QAGB 2IW3A 3KQHA 2ZRHA 4L16A 4Q7LA 1ZD8A 1KK1A 1PLJA 1UDXA 2QPAA 3GLHA 3WP0A 1EFUA 2NTYC 1VG1A 2CL6X 5EP4A 2EW1A 4CEJB 3WMEA 1X86B 1D2MA 4LYJA 2WKQA 1VG0B 3FOZA 2C9CA 1IY2A 4PAQA 3ADKA 1TQ6A 1DAMA 4G01B 5DN6A 1KK3A 1NLYA 2IT1A 4A1FA 1U81A 2OCBA 1MABA 4OQFA 1MO3A 3U3MA 2NO1A 2N46A 3R8CA 5BWMA 1W46A 4PR0A 2QTVB 3ZLJA 2JIZA 3CX8A 1UAAA 3TJZA 2QROA 2WAYA 2PT5A 1GZSA 1NP6A 1WF3A 1VHLA 3TR5A 1U90A 1XBTA 5AJXA 3Q3JB 3AVYA 3SU8A 4JLVA 4A8JC 3PG5A 1ZIOA 2YWGA 4Q19A 1E3MA 2XNDA 1ZUIA 1GRRA 3FKSD 4PSAA 5CM8B 4A15A 2ZRNA 2H18A 4IHQA 2MSCB 3SZRA 3EW9A 1QHHB 3OAAD 4IFBA 1Z2CA 4Z8XA 3T61A 2IX3A 1EG7A 1OXUA 3EC1A 4HAXA 5FOTA 1XFAA 5KDDA 5G3YA 3PEWA 3EPHA 2O8CB 3IDQA 5L8VA 2MMCA 3I8SA 4XTCS 4Q66C 5DI9A 2DY1A 4OL0A 3ZVMA 4LBYA 1P5ZB 4Y0VA 1E79D 2FZ4A 1YR8A 2QZ4A 1E2PA 3SFVA 5LBIA 1EFHA 3K0EA 5CM9C 2KWIA 4HB2A 4QG7A 3SQXA 3HPQA 3THWB 3T5GA 2C98A 2FU5C 4B47A 1EGAA 5F9FA 4JVSB 2F43A 4OQNA 3U7EB 1RC8A 4B34A 3U44A 2WBLC
chains in the Genus database with same CATH superfamily
2ZANA 1ADYA 3TR6A 4C08A 4OHUA 4AY6A 5AJUA 2V9PA 4L5JA 2I3AA 5KYUA 1JDBB 4PTLA 3VPCA 1FXWF 2BGJA 2I1LA 3MMZA 3AGPA 5CGZA 4ZAVA 3HUTA 1LSJA 3RI3A 2K4MA 3U9SA 3NEJA 3K3PA 3PQ6A 2G9RA 5FWDA 1XEFA 1FVFA 1KMIY 4AS3A 1XVIA 4C21A 2YW9A 4P33A 1S4QA 1X70A 4HBZA 3NORA 3VNSA 1GDDA 2FX2A 1BGXT 4JBLA 4EGQA 2AQ8A 2FOXA 2P79A 1NN0A 2XLBA 4MLZA 4GZLA 1VL0A 3NTVA 4QHSA 1QC5B 4OCZA 3JD0A 4A8PA 1DBVO 2A1UB 3BWVA 4K88A 2VDQB 2ZYRA 4BUCA 4AJKA 1RYHA 2O8CA 3C2QA 5FKJA 3U40A 2A9OA 1R8YA 3JZDA 2AFHE 4RPIA 4L72A 1GZ3A 4M0MA 2EWVA 1BDMA 2F3UA 3VNBA 1QYWA 4P93A 2O8EA 1JQ5A 4MS3A 4KAXA 3UWOA 4F84A 1DTEA 4ZOLB 1Q2XA 5ELLA 3HU1A 4GD3Q 1A71A 1D6NA 3WRYA 4ZQGA 2IDKA 1CFZA 2MR5A 4DLKA 4AN4A 4J7AA 2GK6A 2HNBA 3ER6A 3QTTA 5ECWA 5BV7A 3AFMA 1CF4A 4FCVA 2ZIXA 3HTXA 2COUA 1QRRA 1J5PA 4RF2A 2JAOA 2WFAA 3RS4A 5A4JA 4NABA 3WYNA 2BE7A 3DOEA 2P2YA 1FP7A 2WHEA 2DQKA 4AN0A 2Q4DA 1QX3A 1SBNE 3D8RA 3X1ZA 1PV4A 2OLKA 1YIAA 1SCUB 3UG6A 1QHNA 4MW1A 4QVIA 2HIMA 2SKEA 2IH2A 2ZU0C 3ITDA 3O4GA 3ZWYA 2Q6VA 1YI1A 5IU6A 4R2WA 5EOVA 1K7SN 3UXYA 1MQSA 2E82A 2R5WA 5BUQA 5JDIC 3H97A 5BSTA 4INJA 2HJ9A 1DG3A 4TQUS 3DE1X 2HHAA 1H85A 3DEIA 1USVA 4FOTA 4MCJA 3UAZA 1JTEA 1MVOA 3KFXA 3Q3EA 1RZ3A 5A02A 4PXAA 2J5XA 3RVPA 2Z56A 3WDMA 3RC8A 4Z4HA 1LTHR 3CWCA 1RJEA 3N74A 5A4IS 4CQNA 4FHCA 3RASA 5U4QA 3EB9A 4WXMA 3PWKA 3DZ8A 4FW8A 5KU7A 2PN1A 2G76A 4PSVA 4R9SA 1NC1A 2WU4A 4J4BA 1VP3A 5BMVA 4LOJA 4I1PA 5CEEA 1OGYA 3HB0A 1DDIA 1X1QA 4GXTA 1PJ3A 2GZ3A 3K5WA 3PTLA 4F11A 4WFKA 4X6YA 3IFSA 2Y27A 3RRNA 2B35A 3STYA 2CXPA 4O4IA 2ZS8A 1JXMA 3MQ2A 3ODGA 6LDHA 1UP4A 4A23A 5L6LB 4G6ZA 1A27A 3T5DA 4HLUC 5IBQA 3MTEA 1L5NA 1BRTA 3WLQA 2IYTA 2Q0XA 2F1RA 3GCXA 1Q17A 4MGHA 4ZYLA 3DGEC 4LJ8A 3T7KA 1YB5A 4BNJA 5IM5A 4YP1A 2IE0A 1ZIDA 3COVA 2OQVA 3SKVA 2O2ZA 3DP9A 1OHHA 1EDEA 1Y7IA 2V03A 3LOUA 3UHPA 1JE0A 2VRNA 5IJ9B 2YXNA 3HJTA 3ORFA 3JQEA 2ZUVA 1M8JA 3QITA 3L3BA 3O03A 1XZDA 2OB1A 2OCIA 4YMTA 3QPVA 5GAJA 5J58A 3ZWPA 2DR0A 1ZCBA 4DMFA 2OV6A 4FI3F 4AMGA 3ICCA 2HZBA 3L0ZA 4GKBA 2ZKLA 1U2TA 3OWHA 4KR6A 2XSZA 4I36A 1BD3A 3MERA 4MUJA 5TB5A 3ZGVA 5AM3A 2AJBA 3EZXA 3KOWA 1B8NA 1NM5A 2QTVA 2FHPA 2EBHX 1S2IA 4YMHA 1YS4A 4RPJA 4NDZA 4OHVA 2YVLA 4RD1A 1KI4A 4EP1A 3ROMA 4TKUA 1HG0A 2HPVA 1NMXA 1ZJ6A 4U6SA 3FRIA 3B9RA 3LDAA 5ANRB 1KYZA 5L3VA 1WAMA 4J1QA 2R2AA 1FYWA 2GEJA 4U00A 1DT5A 3D3KA 1MH9A 4LPKA 4OXKA 2BONA 4AY2A 2QENA 3M1IA 1JMVA 2MSNA 1LSOA 5E9WA 3ZDZB 5IMSA 1MOZA 4YTEA 3UHFA 1GGNA 2GKGA 2FF7A 4KFSA 4WY8A 1Q0LA 5JBNA 2EGGA 2B1JA 3BVPA 4LAFA 2YHBA 3OFVA 3OZGA 5FJIA 1S8NA 3B6JA 4KXUA 3TDNA 1E77A 2E2WA 2FEPA 3NHRA 1XELA 5JZ9A 4CM9A 5WRFA 3ESAA 3EISA 3UANA 4S1TA 1E1NA 5F35A 1Z4PX 3RWMB 2P68A 3LNTA 1MHPA 1YB7A 2EX1A 4I5DA 2H8GA 1TF2A 2RHRA 4H35A 4O1IA 3UMRA 3CPHA 3IKLA 2JLYA 4GI3A 1A2BA 5A04A 3I37X 1QOPB 3WX0A 1TA0A 2V6GA 1KI9A 4YPOA 2W6PA 2UYHA 1TZMA 2ZRPA 3E6AA 3ZJVA 3RF6A 1KAGA 1T8RA 1TCUA 5DVZA 1QRSA 1YZVA 3LIPA 2B2XA 2V7TA 1CQPA 4LOLA 1MENA 4WSOA 3HCWA 4MDEA 4AUKA 2B61A 4XYEA 4G1CA 3NHSA 5EKUA 1U8FO 3CRQA 1N2IA 4G4GA 3U4QB 3PLNA 3W2FA 2B3DA 4WY5A 2O1SA 3ESQA 2WPNA 1XZHA 2ZCUA 3EBOA 2FN8A 1FA9A 1U6JA 4KL8S 4TXMA 1J1UA 2IYLD 2XT6A 2Q1SA 5LZ9A 2SKDA 4XUGB 4E32A 3B2NA 4HNSA 1R9MA 4JI4B 3U3XA 3VH2A 1GUYA 3KWMA 1X38A 2R7NA 1VPDA 3L5KA 3ONNA 4KZPA 4YPFA 3OIFA 2FFBA 3K92A 4HVTA 3TAXA 2WF8A 4ITRC 1H1DA 4PZ9A 5ALFA 2PBZA 4E11A 3T3NA 5JTUA 2DP4E 1FDUA 5CJ2A 4BLPA 1ARZA 4BNYA 1RJFA 3CLUC 1I3NA 4TXJA 4BV9A 2PL9A 1G60A 2Q6IA 1CJVC 3GRKA 3AC0A 5DNWA 1NW5A 2LKDA 2A3NA 2BF4A 4HDRB 3UV3A 2WF6A 4C4OA 2D8AA 4DLZA 2LDXA 1D1TA 1SU7A 4L50A 1LBHA 3PGKA 1XCBA 1W2HA 1J0EA 3OEYA 4QAQA 3WHPA 1UBLS 3Q12A 4ON9A 4ECEA 1Z33A 1NN5A 2WD9A 4MWTA 1Q6ZA 2LRHA 5EQFA 1ZOIA 3WG9A 4KPEC 1XRNA 4AYTA 4L15A 5HCNA 3KAQA 4D8YA 1H9BA 1N6LA 4ARAA 4B75A 3TSOA 4WAUA 1G16A 4Z0NA 4MKZA 7ABPA 5EJ8A 5AQ1A 2RGAA 1OKKA 1FYVA 1PEYA 2IW1A 3H1PA 1T5OA 3I1YA 3KB2A 1GPWB 3DBOB 1EMDA 4J2OA 1GQRA 3LDGA 1M8PA 1W6UA 1RQNA 2DFNA 1XVAA 1FJ2A 1W5TA 2ZREA 3DL0A 5C3UA 3KJGA 3RUCA 4IIXA 4FWIB 3UAOA 4RK5A 2QRPA 5MN4A 4M88A 2CLLB 3EBLA 2F59A 4Q12A 1WXQA 3BICA 3KJZA 5IK2A 5J4LA 4JVOA 1PVVA 2X1MA 3NHLA 2XB9A 4BFCA 5AW7A 5JCOC 4HDKA 3ROKA 2IPMA 1T1JA 1N1DA 1Z68A 1IBSA 1IG3A 2EZ4A 1JQ3A 4XIFA 1BD4A 4NH4A 3LYLA 3O4HA 1KFEB 1MUUA 2LE0A 1W85B 2WTMA 1Y81A 1G55A 4P53A 3LBYA 3M4ZA 5JFGA 3SJUA 2H9AA 2WD7A 1XNHA 3QIVA 2IXGA 3TTSA 3OZXA 4P5DA 3DZJA 4EG4A 3NNSA 4AXXA 4IVRA 1UDRA 4JLMA 2W2XA 2QTZA 1T0PA 421PA 1U7PA 4FKZA 1KFJB 3I9FA 3KOXA 4MDHA 4NPHA 3BMNA 5EKSA 4CTKA 3BH6A 4OVKA 3V2IA 1M76A 3T7EA 4DJTA 2GYVA 5CTJA 2VF5X 2BKLA 3UW1A 2VYNA 1KE1A 4LSGA 4MXDA 2BKUA 1CP3A 1J70A 1W5SA 4JBNA 5AVQA 3QX9A 4JJ7A 2C8LA 4EFMA 1MR3F 2FW0A 5A06A 2AN9A 3SOZA 3KUDA 3SIWA 1P1RA 3C4VA 5DYWA 1DDGA 5C5IA 2O2DA 4MI3A 4PPFA 1HE2A 2W90A 3RFCA 3TECE 2FN9A 3UXMA 3S8YA 3P9QA 4ZDIA 1T5HX 3V4ZA 2RAUA 3IDOA 2X3UA 1A9XB 3B89A 4XFDA 2EOAA 3ROEA 4TT3D 3OJXA 3ZWCA 1D2EA 2REXB 3DEYX 2WAOA 1W25A 2WMNB 3AU9A 2I29A 3L0BA 4PX3A 5K8TA 3JWIA 3K70D 3KT0A 1L6IA 2AYYA 3LCRA 2IIVA 5KWSA 3BGSA 7MDHA 3D4LA 3K0AA 4YHHB 3ELYA 3VH4A 1UBSB 3HSYA 3F5FA 3QUQA 2K6GA 3R0QA 1LD3A 1E5TA 1YRHA 3BFXA 4TSRA 4HGYA 1I2AA 4EYKA 4HVCA 1XQ1A 3B7WA 2HK8A 1W1UA 1P1HA 2QRHA 3FGZA 4RZ3A 3ZK9A 1NT4A 4Q6BA 1JH9A 1UIMA 4BWVA 2OLJA 3IAHA 4RD2A 1T9CA 3DZHA 3WOVA 4IX9A 5T4FA 3RAFC 4UD6A 3HL0A 4LZNA 3BUSA 1ZD5A 1EUDB 2CLEB 3VNQA 4HDAA 2HBYA 5JI2E 4A2CA 2EJUA 3CUUA 1E7WA 5ESRA 2Y3IA 2AE1A 4EW6A 2HRRA 4OUDA 3LO8A 4NENB 4TVOA 4NWIA 4CCSA 1NRIA 1GQ2A 4GYKA 2ZI3A 4LX0A 3RTCA 1IJFA 3K6KA 4XDGA 3MTDA 2XYHA 3HCNA 4M3NA 4GOKA 5AT1A 1P80A 3A2KA 5KPDA 1KA9H 2XUGA 4GE0A 3EQZA 2C04A 4G26A 3EPPA 1N5LA 3OOHA 4NZOA 1WXXA 4NOKA 4J0GA 1O2DA 2QUAA 1Z8HA 2NAPA 1HH4A 3CZQA 3DONA 1N2EA 1R4MB 5ES3A 4EYQA 2V3VA 5FFFA 5FUYA 1FS4A 2IXBA 3PR1A 3UB3A 2YOFA 3O84A 2V65A 3WGUA 3AVWA 2JIRA 5C7LO 2FRDC 1N6OA 5A3QA 1PR6A 3K5HA 4G2TA 3WRVA 3ETDA 2O8BA 5DX1A 2LCIA 4WADA 1W2WB 1ZNXA 3IHKA 4YRKA 1PEAA 3ROTA 4Y1GA 1ISSA 1DZIA 3K4HA 1ZOPA 4N65A 3VU9A 3TW6A 3QWBA 3G2HA 3N39C 4QXOA 2Z8YM 1NM5C 4DLYA 1P9NA 2DECA 4B3XA 2NVBA 1PVDA 3PQ3A 1CY7A 1E96A 2R4UA 4OKNA 2QN6A 4CF7A 3IAEA 3ZHYA 5K45A 3SS7X 3U4DA 3A6DA 1NPYA 5LDHA 1ZI6A 2W8BA 1K5DA 3I1IA 4JKOA 3ZWWA 2OQ2A 3VAAA 1I1NA 3DBVO 3HDGA 5BN4A 4NJMB 2EJVA 3VYTB 3JR3A 2CV0A 1B14A 3VR2D 5LOVF 1U1EA 3BE5A 3H3XA 1T13A 2JIQA 2QUKA 3MUEA 1KXJA 5F3RA 4GBMA 1X8XA 1WY7A 4L57A 1WHSB 2HAEA 1RLUA 2PMWB 3B7GA 4B3JA 4GDFA 3LBNA 1M7HA 2IYPA 4UAJA 5F5NA 1T3TA 3HUDA 4EJMA 4IIBA 5AVXA 4RADA 4JA2A 8LDHA 5B30A 1JR4A 1LRLA 3ESRA 3OCCA 2QGZA 5SY6A 1MOSA 1P3JA 3ECAA 3ND6A 1SC6A 1C0IA 3AU8A 1DQPA 3JYNA 1ISRA 3OCZA 3GF4A 4D97A 2P2CA 3ZYCA 5BN3B 1A8IA 4LY3A 5GIOE 1XZGA 2QW1A 1KDTA 3PLAE 1CETA 5CYGA 2FEKA 3NG1A 5IVDA 4B87A 1J42A 3DMHA 3HV0A 2BEWB 4MRSA 2BMJA 3R5FA 1RM3A 4TTTS 3JQGA 3PX3A 4Z3KA 3OHMA 1XHFA 4IJKA 3GUYA 2RJOA 2VDUE 3HUEA 2PYZA 4M1KA 3LTEA 1PJ2A 1ISPA 3O4IA 3TZLA 1G8MA 4HWPA 4Q4AA 2A1TR 3UMVA 1LLQA 2Z5VA 4HDSB 4NC9A 4H4EA 3M3HA 4PYNA 1VGQA 4WD3A 3BXPA 4UCXA 1V8DA 1RIIA 2VCEA 4LFCB 3ID6C 4PG4A 3BULA 1H9CA 2XCQA 5A71A 2EBWA 1YZQA 2BFFB 1R6DA 2VSXA 4M83A 5IYZB 2QL7A 5EC8A 1WHTB 5B3AA 5EJMA 4L27A 2VNKA 3NT4A 2FW8A 1N9GA 3EZ9A 1FF9A 3BWDD 1SCJA 3SSMA 2NVUA 3BZBA 3Q85A 1UT6A 1YR9A 3AF5A 3P2EA 2IXDA 5E6RB 4W8HA 4K05A 2ZI6A 3BBPA 5TIIA 3T1NA 2X3FA 4JJAA 3IQDB 4ND4A 5FWXA 1KXZA 2B5WA 3REQA 2ARKA 4ZT5A 3N05A 4JI1B 1I1OA 4P98A 1WB9A 1D4AA 1QG4A 4M76B 4NQZA 1QVZA 3U7QA 4F0JA 5BV2P 5MDHA 1IFXA 4EB3A 3PUJA 2XKJE 1E0JA 3MOSA 2EARA 1NGSA 3N6RA 4KV7A 1I30A 1UFRA 3AF3A 1Q7EA 2QW8A 2R7AA 3TIGA 3HVUA 9MHTA 4JXJA 4WH0A 1O03A 3T1VA 1EFTA 1OE0A 3JSAA 2QX7A 1DU4A 5DHAA 1TYCA 1SXJC 4OOEA 5BR8B 1FS6A 1EVIA 2GCPA 3FAKA 3SKYA 1F14A 4KWTA 3VO9A 3WHKA 4F85A 5DTJA 3KYBA 1MXHA 3B3AA 4XFJA 4G0NA 2ZR0A 3ADOA 1JE1A 2JPDA 3ELWA 4RH1A 4JVNA 1LFDB 3RKSA 4AUNA 4CYMA 3T52A 1N7JA 4LY6A 3V8RA 3NNNA 5K51A 1FLAA 4UUQA 2I1WA 3OUZA 5FF9A 2IPLA 2WM8A 2XCUA 4EY8A 3G8DA 2GFIA 1QB7A 2GQ0A 2GZ2A 2V74B 4DCOA 2WIDA 4Q3AA 4E21A 4M1YA 6NULA 5LD2B 3E8SA 2O0HA 2E89A 3SNKA 1F8YA 2XSZD 1M6NA 2ONZA 2PA0A 1YE8A 1XROA 2BRUA 5L3QA 2O6LA 2H48A 5HJ7A 1G5QA 3IRUA 4Z0PA 4G4JA 5JSYA 3IUMA 4WVLA 3REFA 1DO8A 1JLLA 2ATCA 3IT1A 2R5NA 4YO8A 5SZKB 5JYDA 5LKAA 1XQYA 5B58T 4D3FA 4J7UA 5LQDA 4PO9A 1EESA 3WYDA 1OX5A 3IULA 4KE8A 2P6UA 4M98A 4PQYA 2ASVA 1Z5UA 2FQXA 5FTMA 3RDPA 2MWMA 3VH1A 3VVCA 1NQOA 3X1DA 1IHYA 4PIPA 5BW5A 1UMBA 2H5EA 2PT9A 3ANNA 1CB0A 1PFGA 1C29B 4B09A 1BC5A 5CG2A 1B2RA 1EGQA 2J6CA 1Y63A 4LJKA 4PBRA 2WKWA 4NCNA 1AF4A 5CVUA 4F1WA 4CIYA 3QVMA 3TGLA 3CKKA 4EMSA 3BAFA 4CHTA 5A5FA 3UMSA 3WB0A 1PWZA 4EFDA 2FE1A 2G1JA 2I6GA 3BGDA 3GEIA 1E5DA 1UDWA 3K1ZA 3QUCA 2XCTB 3ERCA 1IHOA 3BIJA 3IOCA 2WAXA 1C9YA 3DBIA 4OTZA 3Q0EA 4KO3S 4RESA 1USUA 2OP0A 3STWA 2VHXA 3TYXA 5T57A 2OO7A 3MTQA 3PUYA 4IQ4A 2WV7A 3U80A 2JANA 4LDAA 1A4UA 5T7BA 3JAKB 1RPZA 1PG5A 3BK7A 3SQWA 4I3HA 2B7BA 1P0PA 4W8GA 3DOOA 1B4DA 2ZAGA 1QNFA 1C2YA 1BCRA 4YJ2B 5I8ZA 3WSTA 1ZC3A 4FYVA 4NI5A 4W4TA 3LCVB 4LF8B 3V48A 3PHBE 1NI4B 3OFJA 1Q83A 3TMKA 621PA 1YJXA 1PW7A 1EHYA 2I87A 2WTUA 1E9FA 3K70B 5FBQB 3JYPA 1IIBA 2X0IA 2ODWA 1TIKA 1AKEA 2G7MC 1SWWA 1YI8A 2W2KB 3H65A 5FAXA 3KNZA 1FYXA 3NBYC 5E1DA 4F21A 2WA2A 3ANXA 4XQ9A 3OZDA 3RUFA 3SSOA 4XPZA 4HYQA 2IK8A 2XVZA 5CX1B 2XQFA 5IAOA 3L2OB 3S68A 4KO1S 3QVJA 4ZU1X 1DOHA 2C82A 1ECLA 3ZU6A 3FMIA 3ZV5A 3AP3A 2Q0SA 4LXUA 3UZUA 2HGSA 3A58B 1Z15A 3DT6A 3P2YA 3L1IA 3LI2A 4I5EA 1E7YA 4N0PA 2X5KO 3RREA 1VIAA 4EATA 3GLUA 1OFUX 1YBVA 1EPUA 1FLVA 3OKCA 4LJ4A 3FLMA 1TLFA 1PGPA 4C0WA 5HJ2A 1QO0D 2CXNA 3W5SA 2XB6A 1OXTA 2P77A 3DEAA 3I3OA 3FDZB 3KHSA 5HRCA 1I7QB 3STUA 4Z5XA 4DV5B 1YD7A 3W34A 2ZAIA 2L17A 4HDMA 1PJBA 2ZYDA 4GZ3A 1XL0A 3HDYA 2JGDA 3RRZA 4AECA 2D8MA 3ETGA 1TU0A 2AN5A 4IIYA 3RTGA 4V0NA 3UFXB 4CDRA 2QDKA 4REQA 1FZTA 4MGZR 3ZHCA 3G0IA 2B6NA 3K16A 3M4XA 1BOOA 4KXQA 1BDHA 3IERA 1PQPA 3KKLA 2XQJA 3GXBA 5JMOA 4BP9A 4IGEA 1VM6A 3ENWA 3BTUA 1VDMA 3FI0A 1OH6A 2N1MA 4G0YA 1UBGA 3NW9A 4X61A 1UBCA 2HA3A 2I9PA 2PKWA 3FPJA 2PS3A 3G8YA 5AI6A 4EJSA 4ZI7B 3R76A 3TIVA 3R3HA 1XRMA 1NVTA 3KL2A 2C9BA 5DLEA 1JLRA 3CY6A 3ECCA 4ARVA 1XKQA 3WMFA 5SZIA 1HNWB 1OOEA 3FX2A 2DG2A 1J1ZA 5C52B 4V0MA 3IUSA 4DY4A 4BP8A 2X0NA 2L0XA 3C98A 4TTQA 4O4JB 2XJ9A 3H4IA 4QWWA 1KZYC 3NRBA 1L5WA 1IULA 1GTL1 4UHEA 3AF6A 4TTRA 5FHQA 1NRWA 3D2CA 3FKJA 4MI1A 3ZNPA 1XIVA 1T5TA 1JHVA 1I5RA 2AVNA 3O7MA 1LUAA 1KTVA 1LPPA 1YRLA 1JKXA 2PXXA 3JRNA 2IBMA 3V4SA 5D51S 5ARDA 1WQ3A 1A2OA 3ME5A 3AF0A 1D9XA 5A0VA 3CNBA 3B9BA 1QGAA 3S70A 2JIBA 3GT3A 4ZVMA 1MKYA 4OJQA 1WBBA 1K7EB 1TCBA 2B0JA 1ECGA 4DUGA 3TRDA 3HJUA 5DM70 2YHUA 5C18A 1E4OA 2FQ1A 3LPMA 3C6ZA 1XAJA 2DPYA 3JZFA 5KEIA 3T99A 4XI9A 3MGGA 4XM0A 2R1UA 3UKDA 3GFPA 4HWRA 5LA6B 1BYUA 1KOGA 2WYUA 3REOA 2XNJA 1AHHA 4WLOA 4C7XA 3HBJA 2IYFA 1AZWA 4B3CA 2NU6A 3PCXA 2CXQA 4HNHA 4YRZA 3AM1A 1W4AA 4F5YA 5LDGA 4LXIA 3SSNA 5LLDA 5HE9A 4DC9A 1IOWA 2EHJA 5TVKA 2Z6UA 2HQRA 2XEDA 5DGTA 2BUAA 4ME6A 1QJ4A 3G82C 3OJOA 2OD9A 4ZOCA 2NACA 4EHFA 1E4EB 1KARA 2PUTA 2YS6A 4UZSA 4BO5A 3R3ZA 4FOOA 3K9QO 4TV9F 4H0FA 2Y1GA 3JWHA 2AOTA 2DX7A 3A26A 4QRIA 8ABPA 2GNOA 2H08A 4QYSA 4BKUA 5AXAA 3BD6A 1SPXA 2H1HA 3GFSA 5JU6A 4EPTA 3EFEA 2HBQA 2ALJA 3K9LA 1TFRA 3GA0A 4F2WA 3D6NB 1NVFA 3OIWA 2I4MA 4PAMA 4WK0B 4F86A 1JU4A 1CUVA 4JUBA 3TZQA 1UJCA 4KZKA 1VMEA 2HDHA 3I9V6 1MX5A 3C3CA 5EE3A 4XJTA 4I1OA 3HVIA 4MYUA 2BZSA 3DM5A 5FWYB 1VA5A 1QC5A 1RJGA 2QMOA 4X7PA 3T35A 4V2IA 2OBFA 2KYRA 4NAUA 1AM4D 5F1OA 3ZWVA 2QRJA 1QV9A 2PGJA 5C46F 3KQMA 5FRDA 1RFLA 4D9JA 4NXMB 5DX8A 1K68A 3E7DA 1FP6A 4COOA 1CUGA 2VDOB 1M0TA 3RUEA 3O82A 3E2PA 2W4QA 1EDDA 2LXNA 4K9SA 4FSXA 1U94A 3M89A 3OPYA 4Q16A 4JGIA 5DISB 3RIHA 3H2SA 1NU8A 1DG1G 3F6CA 4IDNA 4K9NA 2XNKA 1XTSA 1JDBC 1VMDA 4RGVA 5AHRA 5TMEA 2IY9A 3TLMA 1XI2A 5E7QA 4XA8A 4QQRA 4XDHA 1Z7WA 3KAJA 2QYTA 3DE6X 5E4FA 1FE8A 2QD2A 2CE2X 5DLDA 5AUQA 4L9RA 4X5OA 3RANA 4YS6A 1H6CA 3Q10A 1BE0A 1PWHA 1GZ7A 4FOLA 3OAAA 4AJPA 2IVFA 1E8MA 3U5ZB 3CR8A 5E2IA 5FIUA 4RJJA 1ZFNA 5KKNB 4GX5A 3ULKA 1X0VA 4IM7A 4TKVB 3S8EA 4OSPA 4H0NA 1E9DA 1TTHA 2CNOA 1Z0ZA 3COSA 4KSCA 4TWBA 2GN6A 3E05A 4L2IA 2FXVA 1C7FA 4TMVA 2H4ZA 3G5LA 2IIQA 4ALIA 3RROA 1TMOA 2HREA 4I6GA 4H9GA 4URXR 3H1FA 4JJEA 1WG8A 2ZBFA 3W4KA 5EP2A 3EGXB 2CWWA 5CFRA 2JVIA 2W42A 2PJDA 5HQJA 1KVSA 4YXWA 1ZGHA 5KREA 3UN1A 4RM2A 1O6CA 2JCVA 5AKIA 4GLFA 3GDHA 3OSZA 1PR0A 4QFBA 5TC4A 3HLYA 3P2JA 2AG8A 4OP2A 1ZQ9A 4QYTA 4K5QA 3R6TA 4KXWA 2O20A 2B8NA 4AJNA 4DFDA 1MB0A 3EPLA 1RC0A 2AZ4A 4KGXA 4RXUA 1LV7A 4GFDA 1IZYA 5FH9A 1ONSA 4HKTA 1ORWA 3IE1A 5LP1A 3FUTA 2H4FA 3JD2A 1G98A 2ZBVA 4UE6A 2ZYSA 3IUQA 4TWJA 5CXXA 2NTVA 1G2PA 1TJ4A 2YRXA 3PNPA 1G42A 1O6FA 2Y0CA 1UEIA 5JPIA 5HFJA 5DWQA 2ZAMA 4O4JF 3KSAC 1KBZA 3GJ6A 3OT4A 3QVVA 4TL8A 4MGYR 5HBGA 4L4UA 2LCQA 1GAQA 1IDOA 2I4IA 2IITA 3C5VA 3IL2A 5LVAA 3EODA 2JHCA 1ZC4A 3L1VA 5EQJB 2V96A 2JJ1D 7GPBA 4ZT6A 1WXFA 2YWDA 3I6IA 2XYRA 5J5CA 2Y71A 1V8OA 1S9DA 2O3TA 2P5UA 2PJUA 3D81A 3EY4A 4K9RA 4YDRA 5DNVA 5CDTA 1EE1A 4DL9A 4E94A 1Z2PX 1Q19A 1E4YA 2C9OA 4Q5IA 2QP4A 3G0OA 5AW9A 5IDXA 5JJ5A 4L9SA 3RAEC 2XKBA 3HYCA 1QQBA 4E5MA 2GD1O 1TMGE 2WUDA 3MJFA 3LXUX 4BJ1A 4FGKA 3B3QA 3CC8A 4EIWA 4CODB 1GGJA 1TT5B 3Q8WA 4MW4A 4UARA 6ADHA 4TZTA 2FFJA 2VHZA 4R69A 1YE3A 3N1UA 4J1TA 1KJ9A 1R10A 5KQGA 1R0BA 4P3PA 3TRKA 1I9CA 3BGIA 4NE9A 4Q7MB 3PDUA 3QEKA 1TA9A 3EASA 3LZDA 4GZMA 2JJ2D 4AD8A 2QA5A 1MAHA 1XZCA 5DYIA 3EK2A 3DPIA 3JTMA 3VDXA 2OZEA 2P9GA 1U8UA 2AWOA 4YMLA 1S3SA 3WYCA 3OOWA 5CX1A 1ZG3A 3PE4A 3PICA 1CSEE 4IDCA 4MQFA 5A6VA 1PZEA 4ASUD 4WKOA 4OYHA 1Z6TA 3LXXA 4HADA 3T38A 2XMGA 4CKBB 1IM2A 1GNLA 2R6FA 1VRWA 5DE3A 1OFVA 1VJGA 3R5KA 1X6VA 3L46A 3QWAA 4LGMA 1TVKB 4R84A 4L5CA 4RZSA 5EIEA 7MHTA 4K0KB 3IKTA 5D1HA 1SBQA 1WULS 4RO0A 4CZ2A 3O8RA 2K87A 4LWOA 2OBBA 5K0BA 4PAOA 1PL6A 3VR3D 3QHQA 4H3SA 4UHJA 2VPYA 1DAPA 4UAUA 2VP5A 2F64A 5FUBA 4JYPA 3CR7A 2C92A 3FPHA 5EQTA 5B1DA 3CSSA 1SG0A 1VIDA 2IJGX 2QXUA 3ZZMA 2WP8J 3CT4A 1ZJJA 2WWIA 1LQ2A 1CY1A 1JIXA 3S1AB 2FX3A 1QHFA 1IHDA 3ZD9A 3LQ4A 4DZRA 2P3OA 5EIXA 3VNAA 4AW9A 4HNUA 1Z0SA 2VOEA 5IKXA 3IEVA 4HS4A 1CJMA 3IVCA 2BSAA 1E1MA 4QXPA 2PSFA 1FX0A 4F12A 5H70A 1UODA 5LN1A 2ZJ6A 4V0OA 5F3DA 1HG1A 2AX3A 1QHGA 2WQ6A 1T3HA 3PWTA 2LCFA 5KOJA 2QY9A 1J2EA 1OXKB 3PPVA 3DEFA 4XRRA 2XKAA 1Y9AA 1DP4A 4PNEA 1TM4E 4J0DA 3TRFA 1BO6A 3ADBA 4IWYA 3AETA 3ZBTA 2NPFA 2ZT7A 3U2QA 2R60A 2D5IA 3PQ5A 4D99A 2SNIE 5IMBA 5A7FA 3CG4A 4RKEA 3NBFA 7REQA 2DQSA 3PEYA 2JIZD 1CY0A 2H00A 4HNAB 3CGWA 4JEIA 2G88A 4UU8A 1N8TA 3VKVA 3NOXA 1IJEA 1BW9B 4HO1X 5TT0A 2QQGA 3ORQA 3F8WA 3PIRA 1HE4A 5SICE 3ZBQA 1N5DA 1X1CA 1P0FA 1NF3A 1RJWA 1LC0A 2HJGA 2QX4A 3PHCA 2G04A 4RVNA 2NMVA 4AMVA 1IYZA 5JECA 3DWFA 1JJFA 3RSLA 1GRQA 5GMOA 1CNMA 4HATA 2I66A 5BQPA 3LW7A 1Z9BA 3H04A 3FOFC 3HBFA 1G8SA 2A94A 2A14A 3AFOA 3KB6A 1XKTA 1NA5A 3D6AA 4Q93A 4ZPJA 4DUYB 2GKSA 2ETVA 2CVZA 3LRPA 2JKVA 5KMGB 2WJ4A 1GAXA 4QGGA 1NQ5A 3U0BA 1QMGA 4X60A 1KL7A 5AJYA 2OL4A 3GARA 3H9QA 3WK9A 2AN1A 3KQLA 1DKPA 2O0LA 2O0KA 4I2VA 1HEUA 4OLHA 1O4VA 3RVDA 5I9TA 3H19A 1Q1GA 5HKOA 3O93A 1T26A 2UU9B 5CIYA 2P9JA 2WSMA 3K53A 4IDDA 3HYNA 1NBME 4YBRA 5DOVA 4B9EA 4CEIB 2VO1A 2G9NA 4YRMA 4ITVA 2YZGA 2PGXA 4FS3A 1V1MA 1XRJA 2VT7A 3AI3A 1GCGA 2GJKA 4YB8A 4DXHA 5FUVA 3EIUA 1QQAA 2HIHA 3DNMA 1Z5NA 3R3JA 3MJ4A 4LNUA 4C4XA 3GU3A 5AVSA 2YDXA 4K9PA 4N0EA 5TQJA 5G2OA 3LKDA 3QF4B 4U3JB 5GINE 1SM4A 2C5BA 2OXEA 3I6YA 1JL3A 5C4GB 4CCAA 2CHFA 3AILA 5CT8A 1OBOA 3VOTA 3IBFA 3QYJA 5CK4A 5CLIA 1YCDA 4W5JA 3V00A 1EX9A 1NJ6A 4OF4A 5FPTA 3U3ZA 1X15A 1ZOOA 2Y1XA 3FSJX 3GG9A 4GR4A 5CAEA 3QX3A 4TROA 4IH9A 2DUNA 3CRMA 4MRRA 3RAPR 1X1TA 2I6QA 4B31A 1SRRA 4DSNA 1VG9B 2FWPA 4LE2A 1ZK2A 1T3GA 1JECA 3CLTD 3EXEB 1JS1X 1AB5A 2P69A 2ZJ8A 3T5PA 3UA4A 2RKBA 2J5QA 4N8DA 5I8WA 3Q0TA 2JZNA 2ZEJA 4D2IA 1XAIA 2VAWA 3MCTA 1AQ6A 3BOSA 2XUFA 1I2MA 1NDQA 4JB2A 3LWZA 3P26A 5JBQA 3IAS1 5LQMA 5INTA 1XQXA 2V6MA 3BM5A 1BRMA 1N4DA 3NPMA 2FRVA 4CLXA 1BG6A 2X7XA 2VK4A 4C9BA 5KX5B 1NJ2A 5FBLB 2ECPA 3UK6A 2JD2A 3BGVA 4PVCA 4FILA 3IBTA 2YRWA 3O9ZA 1Z0JA 1MA3A 2XXJA 4HHEA 1AQNA 4YP0A 2PKEA 3IXLA 4WUVA 3L7OA 4X00A 1L5LA 3DTYA 3H5NA 5FPQA 3T4EA 4Z7OB 5L95A 1PUXA 3R3WA 3T1HB 3S2UA 2FQQA 2CCKA 3LT5A 3UUEA 3LFUA 3CUYA 4XIYA 2HDWA 4TWZA 2VBGA 3EVDA 1BEZA 2YWCA 3DZGA 3WTBA 5BY2A 1W4CA 1JB1A 3CBQA 1U11A 2EBUA 3LUJA 5AOCA 1HMYA 2HQSA 3GUCA 2Q3HA 2V6JA 3QA9A 3E1SA 1DC7A 4AZTA 4F6RB 2HMWA 4JP1A 4DLWA 2QUBA 2YY5A 3B6IA 3I4CA 3H9UA 2PWPA 3IB6A 5BSUA 4KR3A 3KUXA 5JH7A 3C3AA 1FX1A 1WHSA 2OO5A 4U3JA 2NZ8A 3RFTA 5PNTA 1YCHA 2YFKA 3UAXA 4YMGA 2OMKA 4IJWA 1R0CA 2ZJ7A 1PLKA 2P0YA 1ZJ4A 2WUEA 3FBTA 4YAUA 5ADVA 2XXBA 4B45A 5LMNB 4OFWA 1VDZA 5HK9A 2QNIA 5FLXA 2WWHA 1R7RA 1BVRA 4CMCA 3F2VA 3R9KA 3NIGB 3LUFA 3RTDA 2FR8A 2GEVA 1KYWA 2SBTA 4Y1FA 3A9WA 3A9TA 1BSVA 3KSZO 4FYWA 5H83A 2QQ0A 2FMXA 3K9CA 3ROGA 1VSUA 3HCCA 4DJDC 1HYHA 4K6OA 4O2BF 1KY4A 4RA6A 1R8XA 2D1QA 2LP4Y 2ZXEA 3UT5B 1GFZA 2HWWA 3CKYA 4FD2A 5CLLA 2RHOA 1QIJA 1EXMA 2QRGA 2WJGA 2ZJOA 1L7BA 4HDOB 2FMUA 3WB9A 3H9JA 3STHA 3EXIB 2WF7A 3O91A 4PHCA 1ZWKA 4KBYA 1P4JA 1U9IA 3NRCA 3PDIA 4QHTA 4NCJA 1G8HA 4QUEA 2ISSD 2AEFA 3F6RA 3GA5A 5FULA 5CH5A 1TQHA 2E4WA 1R0YA 4EPXA 5JNLA 2IYWA 1ACMA 1N2HA 5F4ZA 4H1UA 4DA6A 4UBLA 4XQCA 4JLSA 3U9LA 2P62A 2ADMA 3DBHA 1H65A 3M1YA 3L1HA 3G9TA 1FFCA 2Q8PA 4JP3A 2QI9F 4Y9RA 5B64A 3NAMA 3C6BA 3E5NA 4M0CA 1T4DA 3RVSA 4EAQA 2JVKA 3ASVA 4G8BA 5KYYB 3E9NA 2O1WA 2QXYA 4NBWA 5CD9A 3N53A 2H4HA 3KJEA 4OUDB 5JXJA 2QZJA 3DTTA 2ZWAA 3SX2A 2DZDA 3AJDA 3SXUA 2DRIA 2W6QA 3CPJB 3FH0A 1Y3FE 4EO7A 2G28A 4LVOA 3EMVA 5L53A 2J9GA 5I7VA 2QTNA 3GFRA 1PFQA 3D4PA 4K8OA 3NOQA 2VL7A 4EUSA 2VT3A 3QA3E 3EULA 4DJ5X 2OBYA 1VGVA 3TTTA 3RYCB 2I4LA 1KH3A 5F33A 1LA2A 3NVDA 1GR1A 5F51A 4PLFA 3PI7A 3EW7A 4ZDKA 1RZRD 2BGUA 1PAUA 3AP1A 4QOGA 2AEEA 1H2EA 2X4IA 5F98A 3CUVA 2YXBA 3G2JA 3EWNA 4ZGBA 2P9ZA 3I42A 2Q2QA 4OATA 3K0AB 3UAWA 4L9AA