2QUZA

Crystal structure of the activating h-rask117r mutant in costello syndrome, bound to mg-gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNRCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
molecule tags Signaling protein, hydrolase
source organism Homo sapiens
publication title Mutation analysis in Costello syndrome: functional and structural characterization of the HRAS p.Lys117Arg mutation.
pubmed doi rcsb
total genus 63
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2quzA00
1NL3A 2H1LA 2HCBA 2GZHA 3QKSA 1FW6A 3TNFA 4A0GA 2O8DA 2GILA 3C5CA 3RRYA 4IHQA 4US1R 4W5HA 3K09C 5CYPA 3OEHD 2JCSA 2ZJBA 3FMOB 4URWR 3OIWA 1T5IA 2ZANA 3HU1A 3W5IA 3ZZ0A 3QG1A 5H70A 1F60A 3VKHA 1YQTA 5L3SB 1YR8A 5IRCD 2A3RA 1SULA 3HP1A 5TVKA 1KI6A 5CLLA 5CM9C 2JLRA 2EFCB 4EFMA 1NIPA 1OH8A 2P0EA 4LV5B 4U00A 1D2EA 1KDRA 3VMFA 4DIEA 2NO9A 3PG5A 3UIEA 1WBDA 3Q9LA 4AK9A 3CX6A 4KITB 1E0JA 3A36A 1SVWA 4NKRA 2Q21A 5JI2E 4QBFA 4MUAA 2IUSA 4RFSB 3VR6A 5IT5A 3GFPA 1JEEA 1M8PA 1T6NA 2IXGA 2XSZA 4NCJA 4RY2A 2H57A 3J81k 1II8B 5P21A 2ZYUX 2VHJA 2P6UA 1Z6YA 3G82C 2WWYA 2W2TA 4B47A 1N6HA 3U7EB 5GVSA 2G77B 1MT0A 1F3OA 3GJ4A 5KSOA 2WJHA 1XXHB 4KFRA 1KGDA 2ZVQX 1JAHA 4PPNA 5TV2A 4YMVA 4G5SA 3EW9A 1DAGA 2GXAA 2WOOA 3PCRB 3NH9A 3TW8B 1KO8A 4RD2A 4P33A 4QL3A 3ZJYA 1XZPA 4WOPA 5AUQA 4G3XA 2W6ID 1PUJA 2P65A 3T5DA 5C2JB 2ASEA 1P61B 2GJ8A 3VR2A 2C03A 1Y3AA 4CF7A 3SYNA 4MKGA 3D3QA 4FD2A 4B76A 3EPLA 1NBMA 4RCYA 4MGYR 2GJ9A 1E9CA 1VCNA 2ZI5A 2ZJZA 4US2R 4AY2A 4ESVA 5FR1A 2C5LA 2YWGA 4IFBA 4RZUA 1N5KA 3CF6R 3KX2A 4G1UC 1JR3D 2CJWA 3AF4A 1FUKA 3AKDA 2EW1A 1G5TA 4CIDA 1RPZA 2GEVA 2ZROA 4W9MC 3H86A 3ZGXA 2CVHA 1O3YA 2PJZA 3QPVA 2RH5A 4FCTA 3U7FB 1UDXA 3DMDA 3LDAA 2YZ2A 3LW7A 1MKYA 5JHHB 4BWYA 4LYJA 1F2UA 2LKDA 4C0LA 2Z4SA 1U2RA 3EARA 4JYCA 3T1VA 2O8BB 3OIYA 2HXYA 1J8YF 2W00A 3PEVA 2HJVA 1SVSA 1U8YA 4GBMA 4BFSA 4V0KA 5KDOA 1S9HA 1JXMA 4Q1DA 1K8RA 1I2MA 4QBGB 3THYB 3B6EA 4UXIA 3C7KA 2FEMA 1JECA 1E9DA 2WTUA 3L0IB 4WVFA 4QHTA 1J2JA 1XTKA 1M1YE 2ZITA 2W83A 4ASUD 4DEYA 3ICEA 5KTYA 4ITRC 4BLQA 3R9IA 4MRNA 2Q9AA 3U2QA 4NYJR 2PMDA 2VLIA 1E1QD 2VHQA 3DEFA 4F4CA 1NRJB 3EA0A 2B8TA 3CNLA 1Q0UA 1TUIA 1XJQA 2QMEA 2AWOA 3S1AB 3TE6A 2GBLC 3VX3A 1KK0A 1T3SA 2G3YA 2VF7A 3I72A 4PSKA 2H7VA 5BXQC 3DZDA 4M21A 5KOYA 3ZQJA 2WVJA 2C2HA 2IHBA 2V3CC 1G4UR 2C9CA 3TK1A 4PFSA 4XD7D 5HTKA 2W0MA 1JJVA 4CT4B 1OXSC 3TH5A 2JJ8A 4NONA 3LBHA 4D82A 1AK2A 3I8SA 1M7BA 1LV7A 2VIIA 5FPKA 4AIIA 1KJZA 1HE8B 3U7GA 2BOVA 1CULC 5KNDA 2F1HA 4JLOA 4BUJA 1DELA 2GCOA 4XJXA 3I3SR 3Q85A 1Z22A 3AP3A 4MYCA 3IIKA 3C41J 3DMNA 4IOMA 4QG7A 1E32A 2WOJA 3GMTA 4G01B 1AS2A 3ASYA 4OQMA 4P31A 4PZZA 3R9XA 2KSQA 2JIZD 4M1KA 4EAQA 3CPEA 1BYUA 1ZU5A 1BOFA 1W0KD 1VHTA 3Q72A 4IFEA 4L5BA 3P26A 2VEDA 1JQJC 2H92A 3MJRA 1Z8FA 2J59A 1IXZA 1MR3F 4Z1MA 2Q6TA 4LGMA 4LYAA 4BZXA 2EQBA 5TXGA 3B1ZA 4CRWB 4WZBE 1W46A 2AKAB 3CWQA 4Q00A 2ZSEA 1ZUHA 3A4NA 4EQ6B 2NPIA 3X1YA 4E03A 2O8CA 4RZ3A 4NCHA 2IYUA 2PCLA 1AN0A 4UXJA 3K70B 3ZVLA 3SYLA 4A82A 1YR7A 3EASA 2GVZC 1KO4A 2PJRA 4KVAA 1GOTA 1G8HA 1PVOA 4WZAE 1F2UB 1VHLA 2RGGA 4EPTA 1QHIA 1NBMD 2QM7A 4TQUS 1YHNA 4D4LA 2ZU6A 1FUUA 2FSGA 2AXNA 4BGDA 1E6CA 1NIJA 2KWIA 2GJKA 3ASZA 4AG6A 1IN4A 4LI0A 1CIPA 421PA 4RZXA 4AKEA 1MO3A 1CP2A 1N6RA 2XB2A 4MRSA 3EZFA 4TYPA 3PUZA 4B32A 5CB8A 1E0AA 2EWVA 4ERNA 4MDFA 4XWKA 2TMKA 2WPDD 1XF9A 3KB2A 1DOAA 1GL9B 3SBEA 2PZGA 1U0HC 3U3OA 4A2PA 1YZNA 3GLHB 5G40A 2ANBA 1IXRC 4OI4A 4B3XA 4BEJA 4ON9A 2BBOA 1VYUA 4WAUA 2F3RA 2ONJA 1NF3A 1SVLA 3ND9A 4LJAA 4HDCA 5JBQA 1NVVR 1VCOA 2B7CA 5DNYB 4RJLA 2BBSA 3BJIC 1QHXA 1S8FA 1UKZA 2CEAA 3WY9A 1ESMA 2AX4A 3PVSA 2BJVA 4D25A 1XTQA 1OKKA 1M34E 2REXB 3ZIAA 4BE7B 3OHMA 4HB4A 4Z8YA 4B71A 2G1KA 3I32A 5FTNA 721PA 4TLDA 2WHXA 3RAPR 3PV0A 2KB0A 2JLUA 2BC9A 5BN5A 5JECA 1OJLA 2XNDA 2IYXA 1G8GA 1P75A 2F7SA 1S9DA 3BS4A 5B57C 1KY2A 1DAFA 4DB4A 2FH5B 4B3FX 4Z51A 1R2QA 4P4SA 2D06A 2VO1A 3M1IA 1G6OA 1Z0AA 4DUGD 3OE7D 3BGWA 3VHXA 1QHSA 4JL8A 5CITA 2IC5A 4TQAA 4JVSB 4D6PA 2FFAA 4E09A 5KO2A 3F8TA 2O5VA 2VQSA 2FPKA 3K53A 3E5HA 3HYRA 4JL5A 2VBCA 5CIQA 4DDWA 1YVDA 3W8NA 4PO1A 5F3WB 2IS4A 4X8OA 3BH0A 1M7GA 1XCPA 2ZVPX 3IBGA 3CRW1 2WICA 1H8HA 4H1UA 4RFSA 1DO0A 2QQ0A 1TU4A 3MRSA 1H65A 1LF5A 4MGZR 1UEIA 2IXFA 3SJCA 5K8UA 1G18A 1COWD 2ZI9A 3QBVA 3AP2A 3VKGA 2IS2A 2V55B 1FX0A 4YLGA 5JRJA 2J0QA 2VP9A 5E7MA 2N1BA 4QM6A 4AG5A 3JZMA 2VP5A 2W0SA 2FZLA 3IIMA 5FL7A 5K8LA 2GF0A 4PAOA 1G3UA 1E99A 3P4YA 5CJ2A 2HT6A 4XWOA 2BBTA 1Z0KA 2G83A 2XB4A 1IJFA 1QDEA 3QKSB 1R0ZA 1NVVQ 1Z06A 2GCOB 2WM9B 4LHXA 5C4MA 4X8MA 1KSFX 3UG6A 3W6PA 2QGZA 5KDDA 1Q3TA 3WP1B 4TWZA 2ZJ2A 3WMGA 2WJIA 2ZI3A 4L4UA 3NBYC 2OT3B 3UWKA 1KNXA 1RRGA 4B73A 5FUYA 2VF8A 4HLUA 3I5XA 4V0NA 3T1QA 1Z08A 4ZCIA 1QHHA 4TLAA 2WJGA 3NDPA 2OCBA 4UKDA 4C4PA 4BPBA 5EE5B 4IVQA 2CK3D 3T34A 3RS3A 4X8HA 2IK8A 3SNHA 1AS0A 2E87A 2EWWA 3AV0B 3EAQA 4M9SA 4WA7A 1ZYUA 3GLIB 3CF2A 3FMPB 3NG1A 1QBKC 1MABA 1Z2CA 2I1QA 3NBXX 4Q02A 3ZD7A 1G64A 2BMJA 4BFZA 2L0XA 5AUOB 1MRNA 3KXIA 1QG2A 2QSYA 2ZS7A 2XTNA 3QNUA 1YR9A 3UG7A 2YWHA 2ZI7A 1P7CA 2QG6A 2XSZD 1R5BA 4JLAA 5LD2B 5FOUA 1OKKD 3BE4A 221PA 4CVNA 5LB2A 4C3ZA 3U61B 4RD3A 4TSFA 3KQKA 1TTTA 4ESHA 3GFOA 2BMDA 4YONB 4NBSA 4PHTA 1YZTA 2OILA 1OE0A 3QPUA 1G5RA 1I4DD 2C98A 1L8QA 3P20A 2ZREA 4MITA 3H2YA 4TN1A 3EIQA 3QKRA 1JEDA 2Z5FA 3AKYA 4PHFA 5FBRB 5G41A 3UXMA 1XXHA 1ZUNB 4KI0A 2G1JA 2GJSA 5JFGA 1N6NA 2ZIAA 5DISB 1QHNA 2KE5A 4LC1A 2X2FA 3OIUA 4RFVA 4Q9HA 5EE3A 1XTIA 2FG5A 2GJAA 1KIMA 4G5OA 4CGZA 1NY6A 4L9SA 3VR3A 1OXTA 3QENA 1TUEA 2O0JA 4JSYA 3AF2A 4XSHA 2ZE8A 4DLUA 1NLYA 1NP6A 1TADA 4ZO4A 4OL0A 3ADKA 5HKKD 4DDTA 3AVYA 2J1LA 2XZLA 2BM0A 4XTRA 3F0TA 1UBFA 1OT3A 4LUCA 2H5EA 3DDCA 2FPMA 4UNQA 4KHZA 2V7QA 1W36B 4Q18A 1WE2A 2IWHA 4HLQB 1NY5A 3PUVA 1GKIA 3LD9A 2UKDA 2ERYA 1N0UA 1VYTA 4FCVA 1EFTA 3DKPA 1GFIA 4JJZA 1GRRA 3LX5A 3QSYA 3EZ2A 4UNPA 2ZRNA 4B43A 3PUXA 1OXVA 3IHLA 5HE9A 2H16A 3EZ9A 1U0JA 5LDDC 2JAQA 2SHKA 4XH9B 1H8HD 3SQXA 1AA9A 1QHHB 3WHLA 2OXCA 3QKUA 4OJKA 1SXJE 2FNAA 3RWOA 3U3KA 1IM2A 3H0KA 5EZ6B 2ZETA 2WKRA 2ZRIA 1NMZA 4Q1AA 1E1RA 1OB5A 3GJ5A 1P72A 4ACBA 2ODWA 3TBKA 121PA 3Q7QA 1A7JA 1CR4A 2BMEA 5B64A 4C7OA 1TEXA 4C0QC 4DLZA 3LV8A 4NYIQ 1G6HA 2P67A 4A8JB 1RVDA 4HUTA 4Q66C 1DS6A 3C5HA 2ZE7A 3U5ZB 5AUNB 3U4QB 5EP2A 4CZ2A 1FPMA 4I1SA 5DI3B 5J47A 4PHHA 3F5FA 2AWNA 3LLUA 1HT1E 1KAGA 4AKHA 4LV8B 2QRNA 1QHGA 1KAOA 2OLJA 2GHIA 2VH5R 3IO3A 4LWZA 2PBRA 1B0UA 3A58B 1KKMA 2VP4A 2N42A 3NKVA 5EXXA 3PJRA 2C9OA 4DCTA 4DLVA 4JLVA 1HQCA 4E22A 1E79D 4E5UA 1ZU4A 2FGJA 5EUQB 3NBZC 3KUCA 4IXNA 4TLEA 3R8FA 1T3HA 2R6FA 1EFRA 4IRUB 3CB4A 4DKXA 3ZLJA 5L3QB 4OHVA 2A5YB 1SXJD 4ILEA 4KYIB 2DWPA 3BERA 5K8IA 3O8DA 4BRWA 3DL0A 4QRHA 1OB2A 1QRAA 2IL1A 3THYA 1U94A 2XTMA 3GJ6A 1RW4A 3QPWA 3AUYA 4A8JA 3W8RA 4DVGA 3K70C 2HYDA 2QM8A 4FXPA 3ZS9A 1KDOA 3QKRB 4HAVA 1KDTA 1S1MA 1Z6XA 3N70A 2VPPA 4TQ9A 2P5TB 4B3CA 2FE4A 3K9HA 3B1XA 1NBME 2QI9C 4B2PA 4F93B 5F9HA 2N46A 3N2EA 4LX0A 4UNNA 1EFUA 1W4CA 2PCJA 2Q9BA 4A1FA 5C18A 1XPRA 4LJ8A 1I4LD 4C0KA 3NC1C 4N3NA 2O8DB 3CX8A 3TSZA 1YRAA 4O0MA 1SVOA 4F4JA 3DOFA 4I99A 3U60B 3KTAB 4EFLA 1WA5A 3BFXA 4MRPA 1P62B 2GNOA 1CR0A 2HEIA 2EFGA 1KYIA 1GZSA 4P4TA 1IQPA 3AF0A 3K0EA 1QVAA 4JLJA 5KSZA 4XIGS 1PV4A 4OHYA 1SXJC 1UJ2A 4N0DA 3FPAA 1EWRA 3GJ3A 3IPXA 2EYUA 2AHOA 2ZR0A 2FPLA 1XXHE 1VG0B 2JJ1A 2RHMA 2C96A 3RVBA 5FL3A 2WBLC 1FX0B 3RNLA 2HT1A 4BFWA 2DR3A 1Z6GA 3I4LA 3CRRA 4TLBA 1P9NA 1T91A 2ZRDA 1N6LA 1RFLA 4Q1BA 1W0KA 2JLYA 5KNBA 1XMIA 1RJ9A 1N5IA 1W5TA 2OUKA 1HE1C 4UJ3A 5CJPA 1JJ7A 2ORWA 5ELXA 2QE7D 1N6OA 1W44A 5FTMA 1TQ2A 2DWQA 1ZJ6A 2FSIA 3KKQA 3EC1A 1FP7A 2WSSD 4N1AA 4GFDA 5HPYB 1GNQA 1SVIA 3CH5A 3GQBA 2WWFA 3AVXA 1KI9A 1HYQA 3SEAA 2J87A 5DN6D 2QBYB 3RC3A 4NCKA 4FW9A 5BWMA 5FOVA 1E9EA 3BB3A 2J3EA 1CS4C 2DCUA 4Q7JB 5EP3A 4FMDB 5CK5A 2IX3A 4QGFA 3VKWA 1D6JA 4DUGA 5G53C 4FI3C 4WXPA 3SC3A 4Q4LA 1CJUC 5EP1A 2YOGA 3TSWA 2C99A 4B2IA 4UNSA 5B30A 3DHWC 4CT5A 4ARZA 2XJ4A 3SHWA 3TLXA 1E9SA 1R5OA 1BO6A 2YINC 3D6TB 4MQBA 2OCYC 1XEXA 2BEJA 2JEOA 1HQYE 3ZH9B 2BBWA 2XITA 4D81A 2QT0A 1OXXK 3SJBA 4NYMR 3IEVA 3L8YA 5EE0A 1OH6A 1E2QA 4PSVA 4R2IA 2QPAA 2RHDA 2HV8A 4D2IA 1Q44A 1SXJA 1OIVA 4POAA 5TMPA 5L3SA 1UBCA 4ZCMA 1E9RA 1E96A 2QBYA 1UBGA 2GK7A 2QMOA 521PA 1P2UA 1UFQA 4AYWA 5GVRA 1I4TD 5EXSA 1WCV1 2HF9A 4JJKA 2YWEA 5SZKB 1US8A 3T61A 2XXAB 2CL7X 3P4XA 4GOXA 3QJYA 4LSGA 2Q0HA 2JGNA 3IKJA 3RRZA 3B1VA 1J8MF 5JI3E 3BAFA 1E2DA 4HLUC 5JS7A 4GMXA 3OEED 3TW4A 2IYZA 4XWAA 4ZDWA 4C9BA 3S1AA 2A5GA 3PEUA 1IY2A 3H84A 5B2ZA 1G19A 3RANA 4DCNA 3EIEA 1E2EA 2Q3MA 2Y8EA 5FUVA 1U0LA 3THWB 3NDBB 3GCGA 2ZJ8A 2CXXA 4Q4HA 3GLFA 2FN4A 4LBZA 4DLRA 4RD0A 3U7HB 1R8QA 1GKYA 2D7CA 4JS0A 2Q3HA 3GLGE 4EPRA 1W48A 3IPYA 2WWXA 5EZ5A 3K0CC 1G4AE 2DYKA 1P5ZB 1A2BA 3AB3A 4DT1A 5TDHA 1OYWA 1LY1A 2XXAA 2ZRBA 1TQ6A 4YC7A 1Z28A 3QKTA 3ZVRA 1DTSA 4DLSA 1Y63A 1IBRA 1DG3A 2ODNA 4TMVA 1IHUA 4P4UA 1L4YA 1OF1A 3NHBA 2Z6VA 2I4IA 1E2FA 3DPUA 3GFTA 3ZS8A 1D9XA 4LJ4A 2IS6A 2E9SA 2QY9A 4OYHA 2ZUBA 3AKCA 2XX3A 1G1MA 3NEYA 5FOSA 2AL7A 2ZJ5A 2IYWA 1FTNA 4TSFD 1COWA 3MGCA 3G0HA 4URZR 3LNCA 1UKYA 1SKYB 2FSHA 4LRWA 2XZPA 3RC8A 4V0ME 1B23P 2B7BA 3OESA 4BEBA 1Z07A 2CE7A 4K46A 1N6KA 5AJZA 3HYTA 3TMKA 3BXZA 2ZJAA 4BECA 4BFYA 4HUQA 4M9QA 1KSHA 1HURA 5F98A 4QXAA 1WQ1R 4PC3A 4C0JA 2D2FA 2QAGB 1PLJA 1OHHD 4DEXA 1JPJA 1KO1A 3Q5DA 4KBGA 5JLJA 2ZTSA 3EC2A 2RGBA 2EU8A 1GNRA 3CF0A 4YMTA 3GP8A 1GKUB 4JBWA 5FTKA 3R8CA 3ND8A 2ZR9A 5HKKA 2DPXA 4GL2A 3SZRA 1E2LA 2QEQA 5KPJA 4IW3B 5DIFA 4EPWA 1O87A 4P3YA 4GSYA 4HB2A 1NSFA 3G5UA 4DCVA 2RAPA 1TNDA 2VRWA 1N5JA 3B1YA 4L9WA 1G3RA 4D0LB 2J41A 3MAAC 1YR6A 1P2VA 2QMHA 4A0HA 3T12A 1X1SA 2D62A 3B60A 1Z47A 1U81A 2YV5A 4AC9A 1CF4A 3D8BA 1HH4A 2QTFA 4R98A 2FFQA 1XD9A 2JLSA 1JPNA 2VP0A 1Q1ZA 1G7CA 3KJEA 3FMFA 3EZ7A 4AYXA 1J7KA 2A2ZA 3BC1A 3QY0A 4YDHB 2OBMA 1TQ4A 3MWLA 4LBVA 4O3MA 3QI2A 2J0UA 3ZVMA 2BKEA 2DB3A 1XBTA 3FYHA 2JJ2A 4PQRA 821PA 3PENA 1F2TA 1KO7A 2BV3A 3CNOA 4EKDA 4DDVA 4URXR 3K0AA 3ECCA 1SHZA 1XRJA 3CO5A 3HWSA 1E1RD 1RYFA 4CEHB 4OBEA 2ZRGA 5KU1A 1NJGA 1YRBA 3WBKA 4LY6A 1SKQA 1DE0A 2I1VB 1WF3A 2Z83A 1GIAA 3FDIA 4QGAA 2JLQA 1MABB 1S96A 1FL9A 4R9UC 1XJCA 2J46A 4Q1FA 1OIXA 2XAUA 1N6IA 3DM5A 1FQJA 5FUXA 5LBIA 3MMPA 4F4IA 2G0NA 4G5GA 2IHYA 4DDUA 4EPXA 1S3SA 3IQWA 5H8WA 2YVUA 4R71A 2PZEA 2V4ZA 1NN0A 3FKSA 5JWRA 2PMKA 2QN6A 2WWIA 2CJWB 4M2LA 1AIPA 5LPNA 1ZNXA 3ICQB 3ONWA 3RABA 1KSGA 3B1WA 4TMKA 4C0BA 1F2TB 3GEIA 3OAAD 3AVOA 1GAJA 4LOAA 5IF9A 2ODBA 2P6RA 1GILA 4MKFA 1IONA 3LA6A 2QPTA 4EUNA 3W3ZB 3SU8A 3I8XA 3PQCA 2VP2A 3R20A 5J5CA 4ZDKA 3L2OB 1G7RA 2OCPA 2QP4A 4DHEA 4BLTA 3TAHA 4OK6A 1E9AA 4AWXA 4DIDA 2J0SA 2R2AA 1JXOA 1S2MA 4OI2A 5FPSA 1EWQA 2P3SA 3L0OA 1GUAA 1XEFA 3OE7A 2ZSDA 4TTRA 1Q3HA 1Z5ZA 3EXAA 4EFNA 2JLWA 1ZD1A 2JIZA 4QGHA 2R9VA 3X1DA 1FNMA 2IXEA 4JLBA 2QAGA 5JJIA 3RS4A 3A4MA 1II8A 4TYYA 3L8ZA 4Z1MD 2ONKA 3M4YA 3C16C 2OFOA 3EPKA 1G3MA 3BK7A 2OM2A 5KDLA 2QP3A 2IEYA 3VNUA 1R0YA 1UM8A 2IS1A 4NDZA 2HDNB 4DSUA 3RLFA 1L2TA 2CLSA 1XFAA 3GEHA 1N5LA 4EPYA 1L7VC 2CBZA 2NIPA 1A5TA 4HDQB 3O47A 3CLVA 5J4LA 1H8EA 1IOZA 3NC0C 4Q48A 3QF4A 3KL4A 2WIBA 2XZOA 4IDPA 1QF9A 2X77A 3CUEF 3IDQA 4NP6A 4G5QA 3B9QA 5M04A 1W4AA 1RRPA 4QC2A 3ZVNA 1LTQA 2ZSFA 5FPYA 2WSMA 2EFDB 2MSEB 4QBHA 2ZAOA 2FEOA 2IYYA 3KXKA 1KI8A 2C78A 5KPDA 2F43A 2H18A 1E2KA 5H68A 5JSZB 3QUSA 2VSOA 4P32A 4BLRA 3B2EA 1Q57A 1W2HA 2FSFA 4IDQA 2OBLA 1CRQA 3GLIA 1FQKA 1G41A 3LQRA 4FWIB 1Q1BA 2CHQA 2XNSA 2F9MA 4C2UA 4YMUA 1XMJA 5IHPA 3X1XA 2GTPA 4TT3D 1RYHA 1R4AA 2RGEA 2NO7A 5CIWA 1FOEB 1ZINA 4KLNA 3AGQA 1W5SA 1KDPA 5TY0A 2PL3A 3SYKA 4IKEA 3BB4A 2IYQA 3ZDQA 1G21E 5UKDA 3AVTA 2ZRMA 4ZI2A 2V54A 4MGKR 1Z63A 2O52A 3MWYW 4LPKA 4OI1A 4KXFB 1YZKA 3HJNA 4TLCA 1XPOA 4DZZA 3I61A 2R62A 3O8CA 3KQHA 3I5YA 1SVMA 3FGNA 3VQTA 2QUZA 3AQ4A 2GZDA 3I62A 3AVWA 4C30A 5H1YA 2QAJA 1NSTA 1W4BA 1XTSA 3QVUA 3SHFA 3K0FA 4V0LA 2ZUDA 4O25A 4M4SA 4A0RA 1NN5A 3DKVA 1GRQA 1OFUX 1ZC4A 2IWRA 2R44A 1UEJA 3V00A 2RGCA 1CEEA 2QTHA 4AKGA 5SZHB 4ZI3A 3PEWA 2IF0A 2BEKA 3U4QA 1HV8A 3SS8A 2VA8A 1EFRD 1GTVA 1KK3A 3AVPA 4S2EA 3K09A 2REBA 2KBEA 2ZJOA 1KY3A 1E94E 3IIJA 4H9GA 1KMQA 4MGIR 4TYNA 5AK0A 3KKPA 4Q4AB 2GF9A 1BIFA 3PFIA 4JVNA 1P2SA 3VHLB 4M1YA 4CDGA 5EP4A 4M1OA 1E2MA 1TU3A 2J7PD 2ZQ5A 1IXSB 5FFMA 1ZD8A 2F1JA 1D9ZA 1VG1A 3CZQA 3IBYA 3SE0A 2K5UA 2NZJA 1PZNA 2QQEA 1IN7A 2YYZA 4JBYA 1N2CE 3D31A 4O2RA 2BWJA 3IQXA 4KFUA 2J7KA 4ACAA 2GAAA 3K0FB 3RS2A 2PEYA 3NEJA 3WBJA 2J45A 1YU9A 3U44B 1A82A 4DBLC 3U3JA 3QEJA 5J4YA 4RCZA 1XEXB 5FTJA 4C0HA 2PEZA 4DT1B 2RGDA 1U8AA 1ZP6A 4PQFA 2J0VA 4KV9A 3JVVA 1Z0IA 1CLUA 3REFA 2IYSA 1ONBA 4NE2A 4A2QA 3CIOA 1R0WA 2CDNA 2R6DA 2OHFA 1LS1A 4W7SA 4QM7A 4LHYA 3KXLA 5LB4A 4OQLA 1SQ5A 3W6OA 2ZEJA 2KBFA 4FCWA 3B9PA 1RE0A 4CW7A 4DLYA 1OHHA 1HT2E 3R9WA 2DFTA 3A1UA 5GJBA 4HAUA 1K6MA 4KSCA 2NPFA 1ZBDA 3BWDD 1LB1B 3SQWA 1M2OB 4URYR 4ZPXA 3QIAA 1E9BA 1VCMA 4IEIA 3NBFA 1Z29A 1KNQA 1DO2A 2J5XA 2PT5A 2A30A 2ZE5A 4IOLA 1KKLA 2BVNA 2XOKD 3L0SA 4F38A 2P5SA 4JLMA 3L0PA 3TSOA 1P73A 2NO1A 2JLVA 2RKOA 2Z0MA 1YZGA 1TPZA 4LZZA 1KI1A 5HZHA 4CEHA 5IK2D 2F9LA 3R7WA 2IT1A 4IVRA 1MO6A 3FHCB 3CW2A 2KJQA 4Q03A 2JDID 3CZPA 5F2EA 1NVWQ 4GP6A 5EJEA 2FZ4A 5KYKA 2HF8A 2IA5A 4TL7A 1EFCA 1G20E 4D4KA 3SR0A 2OAQ1 1GRNA 2HCJB 4I81A 4X8LA 2G9NA 3ZYCA 2EFHB 5E95A 2BCGY 4QJ4A 5EXTA 3HPQA 4BASA 2QT1A 5DSZA 1YKSA 4ZDIA 3MWJA 4RKFA 1IJEA 5G3ZA 2QZ4A 3KKMA 3CX7A 4OQNA 4FMBB 3N5CA 1KMHB 2W6IA 2ZAMA 3C8UA 3WHKA 5J4VA 3TGPA 1XP8A 1CKEA 2VP6A 2ZRKA 1LVGA 3U3RA 1IY0A 4Q4AA 4HAYA 2V6IA 3H4MA 2IF2A 2NGRA 1FMLA 1VPLA 3KJHA 3LY5A 1E3MA 3CWZA 2RGNA 3TRFA 2V1UA 4CEIA 4HATA 1WB9A 4OK3A 2A5FA 4PR0A 3RWMB 2LWIA 4NH0A 2WWHA 1W0JD 5E3HA 1II9A 1M7HA 4OK5A 4LC0A 4RD1A 1KHTA 3THOA 1UF9A 2WJVA 1KJYA 1G8PA 3WYGA 1Z0DA 3WNDA 1DPFA 1Z83A 3IEUA 4KAXA 1BKDR 2CK3A 1ZM4A 3FHOA 2VHCA 3AF3A 1G9XA 5CDFA 2OEPA 4NTZA 4WBSA 3P27A 1OH7A 4GZMA 1YZQA 2G88A 4OKSA 1LS6A 2A5JA 4JL6A 2B8WA 1J99A 2JATA 4YQFA 4MH0R 2WJJA 3EIHA 4LBYA 4GZLA 3T06B 4DSTA 5FPHA 4GPTA 2DHRA 2JLZA 4OI0A 1HUQA 1PLKA 1S3GA 3BFVA 3HU2A 5FI0B 1IAQA 3UATA 3VR4A 4M9XA 3TVTA 3WXMA 2MSCB 3V4FA 2QENA 5SZIA 3UMSA 4IDNA 1RRCA 1LFDB 1KK1A 4A0FA 2CNWD 1FTSA 2OFXA 3DM9B 4JSTA 2W2VA 4HDOB 1LNZA 1G8FA 2QP9X 4IOKA 1MV5A 1CTQA 1FP6A 2C8VA 3WP0A 1E0KA 3AP1A 1A1VA 4B48A 3SFZA 4XSGA 3AVQA 5A5GA 3TKLA 2IBMA 3A1SA 1Z6AA 4JMPA 4LYFA 4XD7A 1E98A 1TAGA 4PZLA 3DOEA 3KTAA 3W6NA 4GT1A 1YZUA 5L3VA 2PT7A 2FDCA 3LRPA 1KI4A 5HCIA 3AUXA 2VHTA 3A37A 2DFKB 5FBLB 2O0HA 1QG4A 2YC4C 3MSXA 1HY3A 2R6CA 4CYMA 2F55A 3E2IA 4L15A 5CLQA 3TVDA 4B75A 1E2HA 3BFKA 1VCIA 2WSSA 2ZPTX 1P6XA 1ZCBA 5HZKA 5JMTA 3ADCA 5IK2A 1AZTA 4FMCB 2JA1A 3NTUA 2X1VA 3JVUA 3R7WB 2FX3A 1R7RA 2NTYC 1U99A 2CMKA 1RKBA 5EE1A 4OHZA 4HB0A 4IOJA 2ZXUA 1NG1A 1ZIPA 4NMMA 4B3DA 2C77A 2NZ8A 3ADDA 1XWIA 1G8YA 5C4GB 1VDZA 4B35A 4HLCA 1K5DA 4PC6A 5FPTA 1XNJA 4GMDA 3PIRA 3KQLA 2GXUA 2GK6A 5C1BA 2JJ2D 2R6GA 2WMOB 1XPUA 2ORVA 3K9GA 4Q7MB 4YXWD 4D26A 1A4RA 5DYIA 3OF5A 4LJYA 4PO9A 1E2JA 3AEZA 4QHSA 4ZDJA 4WXRA 4HZIA 1KOFA 3B85A 6Q21A 5D3MB 1D2NA 4FMDF 2GDJA 3AVUA 2ZRPA 3BB1A 4PPFA 3ZZUA 5E4FA 1XTRA 4BRUA 3K70D 3VFDA 4M1MA 4CEIB 2W58A 1GSIA 5GJVC 2ZM5A 3B13B 2AD5A 1DAHA 3TUZC 2IYTA 2D2EA 1MOZA 4FWTA 2O8CB 2R8RA 4Q47A 1KSJA 3WYAA 4Q1CA 2A78A 1OSNA 4Q1EA 2GXSA 5FOXA 4KJZA 1EX7A 3OZXA 2FGKA 2GVDC 5CM8B 1JNYA 1UBEA 2IEZA 2OFWA 1GDDA 3EPJA 1ZUIA 5TB5A 1ZD9A 2B92A 2BM1A 2GETA 2YKGA 4D0NA 2UVQA 1ZC3A 1E79A 2P6NA 3I73A 2BIFA 2C04A 2HXSA 2WZQA 5G3YA 4DRZA 1SXJB 2X19A 3NHAA 4TTQA 3CR7A 4JT2A 3FWYA 4D4JA 1ETUA 4DWJA 3SDZA 4XVUA 4TT3A 1WXQA 2JJ1D 2X8AA 2B6HA 4HYYA 2PX0A 2W6JA 3Q7PA 4A6PA 4URUR 2VL7A 2ZRLA 3H1TA 3RS0A 5B58C 1KI2A 4M9ZA 1EFHA 4MKHA 3EG5A 4NHOA 4TMWA 1OIWA 2EYQA 2AR7A 4Q9KA 2OV2A 1W47A 1EK0A 3SN6A 4HEJA 3WNCA 5HCNA 4NPHA 1G3IA 3RRNA 1P9WA 5KUTA 1NI3A 1PUIA 1K5GA 3VNVA 1VG9B 1Q1QA 4TZ0A 2ODEA 1E2GA 4PPQA 3X1WA 1CU1A 3LAWA 1FZQA 3FHTA 3CRMA 3SJZA 4KVGA 3LXXA 2AFIE 1E69A 4TMZA 4V0MA 3BOSA 2ZYWX 2ZRFA 2I3BA 1ELOA 1XEWX 2ZRJA 5KSYA 2ZYTX 4DXAA 1XD2B 4TYQA 4UNRA 1EGAA 2GEUA 3QG5A 3KKNA 4FMCF 3CRVA 3MD0A 3A8TA 3CKLA 2OBNA 2CE2X 4M1TA 4PXAA 1XMVA 4GRAA 2AXPA 1GITA 1DVRA 1ZM2A 1P9RA 1X8KA 1YE8A 3T15A 1GP2A 4QJ3A 4LCBA 2YNMA 2JASA 5FR2A 4BFUA 5JCPA 3GJXC 1X6VA 4ABYA 2QTVB 1CJMA 4R7ZA 1QVRA 2ZRCA 2Q9CA 2BMFA 2E1RA 1X86B 2HJGA 2FWRA 1M74A 3FMIA 3QEOA 4KLZA 3AM1A 4DSNA 1UPTA 2UZ3A 4RD4A 4Z8XA 3SBDA 2QU8A 2PLRA 1OPXA 1PJRA 3TUJC 2NMVA 2GWHA 3O8BA 4EJSA 3GLGA 1F48A 3LXRA 1NNEA 1C4OA 1G7TA 4JLDA 1XB2A 1FNNA 1IN8A 1KZGB 3PUWA 1VG8A 4ZV4A 2HLDA 3B7GA 1S1CA 1W36D 1YJ5A 2NQ2C 4M0LA 1GG2A 5EQTA 3RSOA 2ZUCA 5BYKA 1U98A 1XDBA 5BQ5A 3V4RA 2CLCX 1BH2A 1OFHA 1KZ7B 3QF4B 4QBIA 1XCMA 3HU3A 4U02A 2O8EA 2DBYA 2VTKA 4DC9A 4EJSB 1NVUQ 1DAEA 1GNPA 3I92A 1WMSA 2BCJQ 3BRWD 5DE3A 4TTPA 3VU9B 3B5JA 3CNNA 1G7SA 3THWA 3QF7A 2EFEB 4Q9JA 4UQOA 1ZM9A 2ZSAA 1J90A 3KDSE 1SZPA 3JZAA 4Q19A 4F92B 4RKEA 5FI1B 2XGJA 2QGNA 2WJYA 3LO5A 2KI5A 4B74A 4HLDA 1DARA 1T8UA 1E2IA 1KI3A 1UADA 2FU5C 4TMXA 5HR5A 5DI9A 1Z0JA 1JR3A 4F91B 2V6JA 2QL6A 4WZ6A 1XMSA 2AKYA 1CRPA 2YWFA 1VKJA 3K0CA 4II7A 3VAAA 1OFIA 4CEJA 2A9KA 5CB6A 4LBWA 2V1XA 1UKEA 1RRFA 1TF5A 5EXPA 2GAOA 2W6JD 4XOIA 4U7DA 1SGWA 4Q5IA 4QFMA 3CH4B 2JDIA 4ZKEA 5BN4A 5FOTA 5FBVB 4DCSA 4FN5A 4L16A 3C14C 4Q4JA 4WW0A 4RZ2A 3K9LA 4H1VA 4JYBA 1ZIOA 4PSAA 5DYGA 3GJ8A 3QE0A 1E4YA 3N2IA 3GEEA 3IHWA 5IDVA 3FE2A 3FVQA 4Z54A 2ECKA 1P3JA 3KKOA 1G3QA 2FOLA 2R6AA 1OW3B 4OHWA 3HR7A 3U3MA 3GPLA 1G291 5CYOA 3KQUA 3ZZTA 3BH6A 4GI7A 4A36A 4LPSA 2FFHA 1NMXA 1WRBA 2RGAA 5JEEA 4FINA 4AURA 1GWNA 4DSOA 3U6KA 1V5WA 3FOZA 1Z2AA 4LHWA 2A7QA 4S35A 2FV8A 1KI6B 3BBPA 5JEDA 1T0JB 4B6FA 1W2GA 4M53A 2GXQA 1G17A 3C4JA 1FMJA 5FH9A 1VMAA 4BLOA 1U9IC 2FMXA 2GZAA 2W2XA 1KI7A 2XTZA 3P32A 4B6EA 1Q20A 1T0HB 1Z3IX 4BFTA 3TAUA 4EJSC 1I2DA 1NKTA 4TL6A 4MYHA 2GA8A 1X8LA 1ZVQA 3MG9A 4V03A 4MKIA 4Q9LA 4ARZB 4GOKA 4IDOA 4A4DA 1JAIA 1UAAA 2RCNA 3LVRE 1TF2A 4PANA 4ZIRB 5C46F 1WBBA 4IDHA 3AF1A 5L3QA 4GNKA 1XD2A 4YDSA 2D3WA 5F9FA 3CONA 1Z0FA 2WAXA 4XTCS 3DO6A 1ZNYA 2FFBA 1AZSC 3B82A 3GD7A 5D3MA 4L8GA 1VYVA 1X3SA 3KJGA 3X2SA 3AVVA 3OEHA 4G5RA 4HUQB 1NJFA 2CNWA 2RGNC 3K1JA 1AJEA 1WDTA 1DG1G 2IYLD 4PC1A 4OHXA 1F5NA 4C0AC 3GLHE 3MJHA 4I1VA 2WV9A 4JBXA 1XD8A 4IJMA 3GLHA 4JZKA 1OYYA 2CCJA 3D7MA 3UWOA 3FTQA 3L43A 1KJWA 3RSLA 2CCKA 3CPHA 1SHKA 1T3LA 1JR6A 5ANRB 1N3BA 3VTKA 2RMKA 3GJ7A 4MYTA 2WWWA 1AM4D 2ZI4A 4C0SA 2B21A 3P1JA 3HDTA 4QHYA 3I1FA 5DO9A 1ZM3A 2MSDB 1W49A 3CR8A 4IEEA 3RHFA 1JBKA 1RC8A 1ZMXA 4JLPA 4B44A 1Z6TA 2PZFA 4IVPA 1PLLA 3LQQA 4G0NA 4XVQA 5E7JA 2AN9A 1NLFA 2IYVA 3WMEA 5AJWA 4JLNA 2OG2A 2BHRA 1R0XA 4Q7LA 3LBIA 3AH8A 4MRVA 2CVFA 2F3TA 1C9KA 1ESNA 1EESA 3HR8A 2WPDA 4HAZA 4W5WA 1ZW6A 4OQFA 2ATVA 5AJVB 4EQ6A 5BYJA 2HUPA 2F43B 4B2LA 2MMCA 1RIFA 4M8NE 3IGFA 1JALA 3U44A 1GL6A 4D4MA 1W7AA 1BS1A 2AFHE 4QOSA 1EG7A 4BLPA 3UMFA 4HI0E 4JIMA 3W3AA 5DLQC 2VHUA 3T1TA 4R2HA 2FA9A 2FF7A 4RD6A 4QNRA 1AS3A 1P2TA 2PH1A 3A6PC 2GEDA 4TYWA 2CL6X 2V7QD 4LHVA 3RS5A 2X2EA 1BMFA 2XJ9A 3EZ6A 4BQSA 3QQ5A 3WRYC 2QNRA 2PX3A 1NG9A 3HPRA 3QXHA 4A15A 2UZIR 2BKUA 1R5NA 4GOJA 2HYIC 4OQXA 4I4LA 2JLXA 1IN5A 4OJQA 5DHFA 1ZCAA 1DAIA 3CM0A 3QXXA 4A8JC 2C95A 3IO5A 3KJIA 3QXJA 1ZAKA 1AQUA 1J70A 1OFTA 2GESA 1F6BA 3LFUA 2WKPA 5FOWA 4QKQA 5KNCA 2J7PA 4TMTA 4F7WA 1T9HA 3DVLA 1ZRHA 5L3RA 4QGGA 1E4VA 4B3BA 1WP9A 1HEIA 4JKYA 4UXHA 2OESA 4PTLA 3NIBA 5JCZA 1V43A 2D4HA 2H8KA 3FKSD 2O8FA 5JJLA 3W9YA 1DAKA 5DI3A 3GLFE 4NYJQ 2YJTD 4PQYA 3CBQA 5A4JA 4JVMA 5JSZA 2D74A 1AKEA 3B8HA 5HE8A 1BMFD 2F6RA 5K8TA 2NO6A 1FFHA 5AJYA 4E07A 3QOFA 1XU4A 2J9RA 2IUTA 5GJCA 1W1WA 3MWKA 4Q21A 4ZCLA 3UK6A 4US0R 5CK4A 2ERXA 5FBQB 5TARA 3B78A 4D80A 2YOFA 1CR2A 4MDEA 3OFNA 3VU9A 4PAQA 1X1RA 3K8YA 2NOAA 3CPJB 2OAP1 3E1SA 4P4SB 1UDWA 1NN3A 3IUYA 1U8ZA 3T35A 4BZPA 4PZYA 2DY1A 4MRRA 1DBSA 4PC7A 3K0SA 1G5PA 3NXSA 2YC2C 4B34A 3TQFA 4K81B 3TR5A 3SFVA 1RJ9B 2YOHA 1D5CA 2ZU0C 4M1WA 4B33A 1Q12A 3W5JA 2O8FB 3REGA 3Q3JB 1Q1EA 2ATXA 2O0KA 3MCAA 2OXRA 4EDHA 1OV4A 4BLSA 2D7DA 2DWOA 3QXSA 3VX4A 3PUYA 3QXCA 1R10A 3ETLA 4HZUA 2ZE6A 4KBFA 4HSEA 2AD1A 3CRQA 1G16A 5AR1A 5FUWA 3RRMA 1Q21A 2QROA 3QBTA 3GLGB 3VR5A 1TMKA 4KFTA 5JJKA 4NYIR 1N0WA 4Q7KA 4DJTA 5E7IA 1T8TA 1XTJA 4TL9A 1W4RA 5D3QA 3RS7A 4A2WA 1LF0A 4EIWA 621PA 3OFND 1GVNB 1ZNZA 2GKSA 4BFVA 4LDJA 4LK2A 4Q01A 4NZYA 2CHVA 2WMNB 4A9AA 3KZ1E 2XNDD 3T5GA 1XCGB 1TEVA 5AJXA 4LV6A 1VIYA 2QRZA 4QNMA 1W0JA 3O8RA 4PAMA 1TX4B 4HAWA 1AKYA 3EPHA 2ZRAA 2ORIA 3MFYA 5DH9A 3TUIC 3NVAA 3EA5A 1GM5A 5GJWC 3DZ8A 3LVQE 4LJ6A 2OCAA 1JR3E 3K9NA 4TL8A 2QORA 2O8EB 3NH6A 4D0GA 5LD2C 2GCNA 4DB2A 4JLKA 4ZIRA 5SZJA 1D2MA 1NMYA 4K8OA 1LW7A 2F1RA 4URVR 1Q22A 3FFAA 5J4HA 2ZRHA 1CJVC 3EWSA 3SJAA 4KSBA 1XEWY 1A2KC 2ZSBA 3E70C 4LYHA 2GCPA 3A1VA 1E1QA 2J0UB 4NU0A 4MA4A 5EUMA 1ODFA 1C1YA 1CJTC 3AKEA 3LH5A 5DN6A 3K0AB 3OAAA 3Q8XB 3KFVA 5DHAA 1OXUA 1N0VC 4NL4H 4Q4JB 4W5JA 2VYFA 3SOPA 2RB4A 5FL7D 5BW8A 2O8BA 1KK2A 4IXMA 3ZD6A 4Q4HB 3GLFB 2P2LA 1IN6A 2G0TA 1JB1A 1KO5A 2VSXA 3M6AA 3MUFA 1KTVA 4GP7A 4JKIA 2QA5A 3THXA 1EX6A 4M22A 2H17A 4I1OA 3ZQ6A 4CEJB 4NCNA 5KSPA 2WIAA 2ZR7A 3FFBA 2OSBA 3BD9A 4GDFA 1ZNWA 4KODA 1E2PA 4KFSA 5FBWB 5GADl 2NG1A 4BFXA 2QMUA 2Q3FA 4KU4A 4KO8A 4NYMQ 4DLTA 4LJ9A 1P4SA 1N6PA 5JWHA 4BZQA 4DLWA 3W34A 2GRJA 1JI0A 3A1WA 2XOKA 1TL7C 3PR1A 5JS8A 1XZQA 5JRZA 4Y0VA 2ZI6A 4AD8A 1NKSA 2ZJYA 3RDPA 4LJ5A 8OHMA 4Y0AA 3LBNA 1U9IA 3TQCA 3UANA 5JZVA 3PXGA 4A6XA 1H8ED 1DEKA 2VSFA 3ADBA 2QE7A 4RSGA 2OE2A 2Z4RA 1S0UA 3UKDA 2ZS9A 2CL0X 2OO7A 1X8JA 3UMRA 3BH7A 1CXZA 1SKYE 4MYUA 4JVLA 2C9YA 1N25A 2CLDX 4V0OA 4LJ7A 3X1ZA 5KHOC 1CJKC 3M0EA 3C15C 4XVRA 3EX7C 5A0FA 1DAMA 1US8B 2QAGC 1QHYA 2BDTA 4HB3A 4WIAA 1T5LA 3F3YA 3V9PA 3WYFA 1GL7A 1W36C 4FIDA 4TZ6A 1CBUA 4AKIA 1AGRA 4U5XA 2AK3A 1KMHA 3A1TA 3LW8A 1BYIA 4JT4A 4P0TA 3TJZA 5JHGB 1R6BX 3OEEA 3BORA 4I1UA 2PLFA 4HAXA 1VIAA 2XEXA 1XX6A 4YXWA 4AI6A 3TR0A 3IILA 2BJWA 4KYUA 1ZM7A 3PITA 4QJ5A 3KQNA 1ANKA 1MH1A 4M1SA 4DCUA 2IYRA 2Z43A 2ANCA 1P60A 3LLMA 1RZ3A 3OIVA 3FKQA 3AGPA 4ZKDA 2V9PA 3WMFA 1L4UA 2R65A 3BIFA 2LKCA 4EPVA 5J40A 4LHZA 2HLDD 3PEYA 3L82B 1IY1A 2IW3A 3LX8A 5L8VA 1EXMA 2F1IA 5BN3A 2OZEA 3TIFA 4PC2A 3KUDA 2NO0A 4J0QA 3RYTC 1HTWA 2DFLA 1MO4A 2G6BA 3GLIE 2AK2A 2V8OA 3WNBA 1CR1A 1M6NA 1OH5A 3GJ0A 1D8TA 3SI7A 1MO5A 2WWGA 4Q9IA 2WKQA 1AQYA 2OLKA 4RVCA 5CDFE 4C2TA 4DLXA 3ZIAD 3NWJA 4MUBA 1UKVY 3A4LA 5FTLA 3THXB 1II0A 1YZLA 3LWNA 3FB4A 1E0SA 4HZUB 1QZXA 1DADA 4O2LA 5JWOA 5AWFC 1VTKA 1NLZA 4YMSA 1S4QA 4AYTA 3KB1A 4N0EA 4PO8A 2FJUA 2REOA 4A92A 4YMWA 1SVKA 4B3GA 4PX9A 4C7OB 2DFNA 2QPOA 3U6BA 4NCIA 3Q5EA 3EWAA 2IUUA 1E2NA 3T1OA 3KFXA 3W90A 3WRXC 4PPGA 1R8SA 1MRSA 2ZYVX 1E9FA 2MMGA 1TF7A 5DGXA 1AGPA 3VR1A 2GBLA 2YHSA 1T4GA 4ASUA 1NN1A 2WAYA 2ZS8A 2QSZA 2CCGA 5J4KA 4PHGA 1OLOA 1JQLB 1U90A 1VECA 2EVWX 1HA3A 5EE9A 5AUPB 2CHGA 3MLEA 2RGXA 4UJ5A 2LCFA 4KCGA 3UPUA 1NVXQ 4V02A 1XJ0A 3QVVA 2A5DA 1TQDA
chains in the Genus database with same CATH superfamily
4CPDA 2HCBA 3ZWQA 3HFRA 2AT1A 1FW6A 1XAIA 1YMUA 1X19A 4RANA 3UGTA 3C5CA 2VWPA 4DMLA 4IHQA 5A7FA 3ZU4A 1GQYA 1IIRA 2Z30A 2P9QA 2FP4A 1RYNA 3PK0A 3TLAA 4PN3A 3SLKA 3EFHA 4URFA 3ZGLA 3C3CA 2CHEA 3GW8A 2QTRA 1G5FA 4PBTA 5ALWA 3CINA 4UOZA 5MF6A 4CUKA 1KEZA 1JYFA 2FZVA 3BWVA 1YQTA 2GPTA 5CBPA 3ABIA 5IRCD 2A7XA 2QNBA 3TL3A 4G56A 4BUCA 1KYTA 1EJ6A 2PFKA 2G63A 3BZWA 1NIPA 4LV5B 1WBDA 1Q0PA 2NO9A 1M6VB 1U2GC 3Q9LA 3M1YA 3CX6A 3PGMA 1E0JA 4Y0NA 2N47A 3A36A 1KEEB 3T54A 4NKRA 2Q21A 3OLZA 1F17A 4MUAA 5C53B 4A73A 1O97D 1OPRA 3DYVA 5IAGA 3GFPA 1JEEA 1M8PA 1MT3A 1U5AA 2WHPA 2XSZA 4PZDA 3C2QA 2WYIA 4IFIA 4L1KA 1II8B 2XKBA 4MEJA 4RY2A 4WOCA 5FPQA 2ZYUX 3SVZA 5A0VA 5EVCA 2W2TA 4B47A 3QFRA 4IHJA 2FETA 1U7DA 5KSOA 1AY0A 1ZUNA 2WJHA 1ZO8A 4KFRA 1JAHA 4PPNA 5D01A 4EUEA 3BIJA 3RC7A 4ER6A 1ISIA 1HSOA 4G5SA 4B4UA 4RFLA 5F2KA 2GXAA 3W3AH 3PCRB 4AXBA 3TW8B 4N5LA 5HDQA 2JC3A 3BFJA 4P3PA 1NI5A 3K31A 3HB0A 4O1IA 4OFXA 2YN0A 4RA6A 4YRKA 1UMCB 1ZXLA 1E4OA 2ZM6B 1DG9A 1CERA 1EFVB 3E9NA 3R1IA 3E81A 3ZI4A 5JTUA 3SYNA 4MKGA 4UU7A 4FD2A 4B76A 1NBMA 3L8GA 1E4EA 4P34A 4MGYR 1KMIY 3OA2A 2PZLA 2GJ9A 2VNKA 4M3NA 5HIIA 1LJ8A 3G5LA 2CC2A 2ZJZA 3ZVNA 1MEEA 1QKKA 5BW8A 2I1WA 3V1MA 2C7BA 1N5KA 4Q6BA 4G1UC 2L69A 1MDBA 2HNKA 1FUKA 3AF4A 5E6RB 1IWBB 4CIDA 4HNAB 3BDIA 1RPZA 3F6PA 2ZROA 4W9MC 1C7EA 2FUEA 2CVHA 1IUNA 3QPVA 4WRRA 2AUTA 5B4TA 2PO7A 3Q3VA 4JOQA 1E62A 3U7FB 4D8TA 1K6IA 2YZ2A 4C2AA 2B3DA 2GLXA 5C0OE 3PFBA 3A3OA 1V3VA 2RHBA 3HXKA 3T5MA 3M6VA 4ZAGA 1OOEA 2WTXA 2O8BB 2BEUB 4Z3KA 2HXYA 4WNIA 2QTTA 3JQCA 1J8YF 3G9UA 2W00A 2FPWA 2Y05A 1U8YA 3L7KA 4GBMA 4WE3A 4LRUA 4ZVVA 1R0KA 5AVRA 4V0KA 2VHXA 2L2QA 5BMVA 2GZ1A 2PPVA 1FSSA 1G2OA 2GN0A 4GR9A 3MN1A 3UHOA 5DXAA 4AJJA 2C2YA 3A05A 3B2QA 4UXIA 3C7KA 2QUHA 2ZSHA 4JP5A 4YRTA 3C1UA 1JTFA 3RRFA 3N75A 3G8DA 5D87A 1YS6A 4R9RA 3G13A 2GPYA 4KMRA 2WB2A 4IRMA 1M1YE 4L9RA 4AJPA 3ENWA 4YR7A 3V97A 2ATCA 3NIWA 4OGWA 4WY5A 3STWA 1W76A 1FUIA 3S81A 4NU6A 4ITRC 1YDFA 3O2SB 4TROA 4AUNA 3N39C 5LYJF 2HBRA 3C3YA 3A0UA 3AMVA 2PMDA 3ZV4A 2VHQA 1GZVA 1J8QA 2H4JA 5IBPA 2WTNA 5J1TB 4P8RA 3VDMA 3HDYA 3HY4A 2OD7A 4BNFA 2QVZX 3RADC 1HO3A 2B8TA 2CXTA 4FE4A 1Q0UA 2EJVA 2QMEA 3TZBA 2AWOA 2JAUA 3RLIA 4CKXA 1T3SA 1OGIA 2G3YA 2XYHA 3HSSA 2FUG6 5BXQC 4M21A 1JXQA 2P30A 2C2HA 1CT9A 1EAYA 3UBTA 3OPYB 4HFJA 1ILEA 1S5PA 1T2EA 1K92A 2XQGA 3C7AA 2DFVA 2LDBA 1GTG1 1MF7A 3TK1A 5IVPA 4NF2A 2W0MA 1EFAA 3F3KA 2I76A 3GRYA 2ECFA 2AJ8A 2D0PB 2JJ8A 2XDWA 3DB2A 4KKXB 2JGJA 3I2YX 4YJFA 1M7BA 1LV7A 1N7JA 3PR3A 2VIIA 3E9CA 4I14A 2ADOA 1F1BA 3H5WA 5KNDA 5FP0A 3KQYA 1XLUA 1P8JA 1DELA 3K30A 3N6VA 4XJXA 1Z22A 3D4NA 4MYCA 3IIKA 4EHIA 1E32A 2HMSA 4QO8A 3JQAB 1AS2A 2EGUA 4OQMA 4M1KA 2JIZD 4EAQA 3V2IA 2VTEA 1EUDA 1ZU5A 1BOFA 1CZKA 1VHTA 2XUJA 3PUIA 3Q72A 4IFEA 3P26A 4PX3A 3ZD8A 2H92A 4X1YA 3IIEA 1DC7A 1GL3A 4PIPA 3KBOA 4N47A 1IXZA 4XASA 4AROA 3JR7A 2XUKA 5SYNA 1J9ZA 4Q7QA 1IY8A 2HU5A 5A02A 3JSXA 3SPXA 1H1LB 1UANA 2JAXA 3AL3A 2Y1FA 3L7DA 2GEJA 1V95A 4L6IA 1EAMA 4EGQA 1W46A 4Q00A 1YS4A 4D1YA 4ML3A 2Y2VA 4EQ6B 4BVEA 2NPIA 3MBOA 4Q05A 4MI3A 2VPIA 4XM1A 1JFTA 2YW2A 3JD2A 1N78A 1AN0A 3NW9A 3LE8A 2Q29A 3BD6A 1QSGA 5EMMA 3SYLA 4MV3A 4DDKA 1NF9A 2FR1A 2RJ3A 1JQDA 2GVZC 3MWEB 1EGMB 4I4TB 3OI7A 4YX9A 5A62A 4XB6B 4J6EA 4U7JA 2P2YA 2BGNA 3QELB 4D3YA 3T52A 4KVAA 1GOTA 2XRFA 1PVOA 1A1SA 1OWPA 3FSGA 1JSRA 3TIIA 3L93A 4BHTA 4HTFB 1VHLA 3FJOA 1IM5A 1P81A 4EPTA 3PLAE 1BQEA 4M6WB 3VSAA 1N5DA 1FUUA 1JLLB 5ERXA 3WGMA 4CL2A 1KEKA 2YIVX 4RK5A 1M2VB 1T4DA 3ASZA 2GJKA 4OMFG 4ROTA 5CLIA 3V7WA 1IN4A 4YHHB 3PYMA 1CIPA 3NTRA 1WLYA 3GB9A 2E6UX 1PAUA 3N3AC 4RZXA 1CP2A 1SCAA 4DF3A 3LSTA 4MRSA 5A3RA 1YUNA 2PSEA 3PUZA 2XMRA 3WC4A 2C4HA 4M76B 1IZZA 1U9ZA 2C57A 4MDFA 1X7XA 2TMKA 4Y6LA 2WPDD 3RSFA 2FEXA 1YJQA 2ADFA 3KUUA 2PZGA 4FS8A 3SBEA 4CF6A 4QASA 3A4YA 4WDRA 3TPZA 3U3OA 1T2DA 1V9LA 4LRQA 1DUSA 2X3YA 4MR8A 3HN2A 3U40A 4L3OA 4B3XA 1RVV1 2GN1A 2LCQA 3GUYA 2BBOA 4BGEA 3KQSA 2F3RA 3F7OA 3NT4A 2ONJA 1LDBA 2DH5A 1C4KA 1SVLA 1WY5A 5LBTA 3ND9A 2M6RA 1EFVA 3LQKA 1Z82A 3AUUA 3OZVA 4KQIA 2RBGA 3VHQA 5DNYB 2DKFA 2JGDA 1QHXA 4FFMA 1O0SA 2K7FA 3UB3A 2AX4A 3PVSA 3PHIA 4D25A 1XZEA 2VCYA 3HP7A 1M34E 3O1IC 3NM5A 2ZIZA 2REXB 4BE7B 4WBNB 5AKHA 1O8CA 2C4TA 4HB4A 3GO4A 4WFJA 1SBTA 4Z8YA 4LNUA 3K2BA 3OPNA 3CMCO 4XVCA 4TLDA 3RQIA 2WHXA 5JS1A 3FOBA 3PV0A 4OSPA 2KB0A 3Q6MA 4ZXPA 2NXCA 1XALA 3MYYA 5BN5A 5JECA 2GBCA 1GPDG 2XNDA 3OZUA 3N8KA 4BNXA 4F72A 1TCVA 3BD7A 3Q7RA 1G8GA 3QNMA 1G20A 4CM4A 2B9EA 3G7UA 4XQCA 5BSFA 1KY2A 3ZXYA 2IELA 4K0RA 3ZNPA 2AXEA 1K68A 1P19A 1R2QA 2VSYA 1V8OA 3ABZA 1OBFO 3WMRA 4EUSA 2B4QA 1XWWA 4DUGD 1JJFA 2F59A 3KSMA 2PD4A 3FTPA 1TA0A 1QTNA 3E1GA 1DXYA 4JL8A 1T10A 5K3CA 5CITA 4JVSB 1BD3A 3S28A 5ALNA 4D6PA 4E09A 1JG7A 3G59A 3NUQA 3T7RA 1LWOA 2O5VA 3BSWA 1B15A 3L6EA 3B51X 3HYRA 1QZUA 4R69A 1J2TA 1VSTA 3B5IA 3IKMB 4RELA 1J06A 4X8OA 5K3FA 4OKIA 1PW7A 1MFZA 1MX5A 1NR7A 4HGZA 3HXPA 3SC2B 2H4WA 2UYGA 1DBPA 3CRW1 3TKLA 4GZ6A 5K2MA 1GAQA 2HSZA 1EDEA 3I64A 3LHFA 3OFJA 1UDBA 4N6OA 1EHIA 1UEIA 1Z6PA 3OOWA 2YASA 2BEVB 4NBLA 3MHTA 2XECA 4BMNA 1L7BA 4GC9A 4U0JA 3UT0A 2DLCX 1COWD 1P1KA 3AP2A 4EJ2A 5CCXA 3KZNA 1OWMA 3PS9A 4HGNA 2GAJA 4YLGA 3QKWA 5IJ0A 1GAXA 5E7MA 2PO5A 2FW0A 5A4AA 4RH0A 1Q15A 3VU3A 4OM7A 5GIPE 2PTGA 2GUGA 2GF0A 3KOXA 2EX1A 4PAOA 3P4YA 1K3UB 1Q1AA 2E3JA 4D45A 3GFQA 1Z62A 3IQHX 3MB5A 1CX9B 3CNHA 2BBTA 4Z99A 5CB4F 4LDPA 3QKSB 4E32A 1NVVQ 1SMKA 3KZKA 2YFHA 4C4SA 2IOYA 1KSFX 1QGDA 4QFBA 5K0FA 2Q2VA 3LZCA 2OL4A 2WJIA 2PRZA 3FGZA 3O4FA 4L4UA 3C7CB 2CGEA 3BGOS 3NBYC 5LP6A 2XQKA 5IKPA 3UWKA 5JTTA 1RRGA 3CXRA 4OA8A 1E61A 1EVKA 4P5EA 1RFGE 3LUPA 7AT1A 1TJNA 2O20A 2R97A 1BGWA 3A6EA 3GARA 2MHCA 3NDPA 2SCUA 3ZHXA 5C7OO 3OM0A 3CZ4A 5EE5B 4IVQA 1LD3A 5F78A 3T34A 4EECA 5KYUB 5EZSA 3RS3A 2CXSA 3LHSA 4EYQA 1WMEA 3CLHA 3PHBE 3HB1A 2PS0A 2C0PA 3PBKA 3HO8A 3OE5A 2AI1A 5IX8A 3CF2A 3NG1A 3VZQA 4YHBA 4L5YA 3ZD7A 4Q02A 4DMFA 3QELA 4O4HA 5EJMA 5B1EA 2GNAA 3MT9A 1EMDA 1SU6A 2BLLA 4ZVTA 1MLDA 2QSYA 2ZS7A 1MHPA 4DMCA 2WE7A 2YWHA 3V5NA 2ZI7A 3RTCA 2QG6A 1QIKA 4XFDA 4RTRA 4DA7A 1ZGAA 1R5BA 4IGKA 5FOUA 1I3OA 1T26A 3BE4A 3TWOA 4MUIA 1U7XA 1UXJA 3I0ZA 3RAGA 1WPQA 5HMMA 5IAKA 4X3CA 1TIKA 2JBAA 4X5OA 3VHXB 3LZ6A 1Z56C 2J31A 3ECSA 4YQYA 5TS2A 3MYRA 4E5VA 3AETA 1A9RA 2AEFA 2VYVA 4PZUA 3EULA 4DE5A 2JRCA 3GNLA 3K5IA 5FBRB 4WD3A 1JHDA 3AEKA 1Z9BA 1ZUNB 3AOGA 4FE3A 2G1JA 2O1EA 2GJSA 1XQWA 3AC0A 2VRCD 2NSJA 2CXRA 2EEPA 3B52X 1UWCA 1QCDA 3BGVA 5E9JA 5EMNA 3FOEC 2X2FA 4RDCA 1JNXX 4GEKA 2LVBA 4Q9HA 3LPMA 1PX2A 3VR2D 4B8ZA 2FG5A 1IBCA 4CFYA 1NRWA 1ZN2A 4G5OA 4CM9A 2OGSA 3FR7A 4A0QA 5JDIA 3GK3A 4ERXA 2B8JA 2I29A 2LIVA 2O0JA 4HGRA 3N2YA 5F1KA 7REQB 2YVQA 4DLUA 5J2TA 3DE0X 3TB6A 1NP6A 1TADA 4ZO4A 2RB5A 3ADKA 4OL0A 4UBKA 4EENA 2QL7A 5HRUA 5HUQA 1QFYA 2J1LA 5CTAA 3MIIA 2XZLA 5AW9A 4QATA 4JITA 2BW0A 3L02A 5ARCA 1ZGHA 4JLSA 1UBFA 4Y2HA 1XE3A 4G0PA 1OT3A 2ZBDA 4LUCA 2HSDA 3MJTA 4PYLA 4OGGA 1K1EA 2EATA 3ZHSA 1XDUA 3EDCA 2I2XB 5HK8A 4IG9A 1EP2B 2PMBA 1EVIA 2QYHA 1R8XA 1ZMBA 3H75A 4I4TF 5REQB 3TRJA 5JXJA 1GO2A 3KD3A 5C3MA 1NY5A 4PYOA 1GKIA 1FYEA 1KVRA 4MVJM 2ERYA 4X92A 4CKWB 1VYTA 1P2FA 1WBJB 2LP4Y 2UYQA 4JEUA 1GFIA 2C5SA 4DCGA 2PKQP 2F8SA 1ULAA 5I7VA 3DH0A 4LTNA 2PSFA 3IHLA 3OM9A 5HRAA 3EZ9A 5LDDC 2EDAA 1VLLA 2JAQA 1RHQA 3CZ9A 1SU7A 3QM1A 4O2AB 3SQXA 3DWEX 3LP8A 3R2JA 4UATA 3EFOA 3TIGA 3WHLA 3QKUA 4JP8A 3UK1A 3D8TA 1QNFA 1K5PA 4OHRA 3ZZMA 4R84A 2FNAA 4JXKA 2WUEA 1IM2A 2NQTA 5EZ6B 2PIAA 1VRWA 1NMZA 3OTOB 3FVRA 2JFVA 1OB5A 1P72A 1YRLA 3GDOA 4ACBA 5ARBA 1KZ9A 121PA 3OZGA 2BMEA 4YQEA 2IBSA 4FZVA 2JBWA 4JIGA 2FR0A 2ZIUB 3DVAB 4BBZA 4W1PA 1MD9A 3LV8A 4ZT2A 4NYIQ 4UMFA 1E8DA 1P74A 2B1QA 4Z0TA 4B45A 3RJTA 1DS6A 3GEPA 5ULLA 5GZ3A 4I5GA 4GOMD 4PU0A 2JFFA 4B6JA 3U5ZB 1PDOA 2XNJA 3L0ZA 3OQHA 5EP2A 5DI3B 5TJHA 5J47A 3MAGA 3K71B 1ZGCA 2CNNA 3HKEB 4BX0A 1GV0A 3OPYA 2AWNA 2CFSA 5AM1A 1M33A 5K0ZA 1K9VF 2VDQB 1MNAA 3DS8A 1X1DA 1KAOA 2VH5R 2GI4A 3KSBC 1MV8A 1Z36A 2PBRA 1B0UA 4YROA 1G98A 3A58B 3MM4A 2C9ZA 2N42A 1S2GA 5EXXA 5FWXA 4AJHA 4BJ3A 1M5TA 2BFMA 4JLVA 1HQCA 4B4WA 1SB9A 3C7TA 3CJTA 5LUAA 5I5EA 2ISCA 5CW2A 3KUCA 5CVUA 1ZWKA 4HPXB 5HA5A 4EABA 1T3HA 4BTVA 1EFRA 2PAFA 4EITA 4HNUA 3ZLJA 1RWWA 3NHFA 4MW0A 1QQ7A 4J0KA 1N4DA 2YJ4A 2ALJA 4MUFA 4H1TA 4S1NA 2K7ZA 2VWQA 2O06A 4AS1A 1QRAA 2E18A 2IL1A 3THYA 1U94A 3QLVC 3GJ6A 4A8JA 3BQNB 1QUEA 1U2DA 3JQAD 3N0RA 1FDIA 3ZS9A 1KDOA 1WZNA 3E18A 5FEMA 4HXGA 4ZGGA 3R6DA 2EBWA 4H18A 4QYTA 3ER8A 3G0CA 3MCUA 4G8BA 4TQ9A 4B82A 2P5TB 1XRQA 1H3EA 1H2RS 3EG9A 4K28A 1NBME 1C1DB 3DDHA 1C0IA 1N3LA 3I9V1 1LVHA 1RWXA 4CU2A 5BYAA 1M2EA 1D4ZA 1EFUA 1W4CA 1YSCA 4JCOA 5EWMA 1KQ3A 3OD5A 3RUDA 1NDUA 2RHLA 1I8TA 4D02A 1I4LD 4F21A 3A27A 4C0KA 3NC1C 3ERCA 4N3NA 1SG0A 4BX9A 2NU8B 3S70A 4O0MA 3DOFA 2K2QB 3P0HA 3URMA 3BFXA 2OHVA 4D8UA 2C9BA 1P62B 1NOJA 4RBNA 3OO0A 3C6YA 1H0RA 4OXYA 1MOQA 4N8DA 5DX0A 1IQPA 4YJ3A 2VRCA 3HRKA 3MT8A 2A9QA 3IEXA 5AVKA 3V1YA 3N0XA 2AHOA 2ZR0A 2C20A 4R2LA 2QUBA 2RHMA 3H4IA 3JWIA 5FL3A 1P0MA 2RI1A 4DLAA 3RTBA 3ILYA 3RNLA 1Z5GA 1V4BA 2PRYA 2W2KA 3BEOA 3DNPA 3IR5A 3V8VA 5F52A 8GPBA 1RI4A 1JE0A 2PGJA 1E92A 5AHWA 3GEMA 4TLBA 4MR8B 1ZKMA 1IJKA 2XVAA 5JAHA 2ACWA 1V7QA 3CEAA 4KWIA 2ZRDA 2YHIA 1AV7A 1N6LA 3A7EA 3KWLA 3WGYA 5IUJC 1KBQA 2JLYA 1PWXA 1NF2A 2PRJA 2MSLA 4H3SA 1PSWA 1W5TA 4L7VA 5AICA 5CJPA 1JJ7A 1FFSA 5IYZF 5IBQA 4GX1A 2NU9B 5ELXA 1JQBA 1W44A 2QE7D 1TQ2A 4YO8A 4WK2B 4NLLA 1S02A 1H2HA 3KKQA 1S89A 2JIDA 3OC6A 3ND5A 3EC1A 3E7PA 2LV8A 4AO8A 1K8YB 3ICWA 5AW7A 1GEEA 1GNQA 1SVIA 3CH5A 1R00A 1QQTA 3MJCA 1HLDA 5L7TA 1JVNA 2RJOA 3SEAA 5DN6D 2J87A 3AVXA 2Q8QA 5F76A 1KAMA 3VZDA 3OZFA 4FW9A 4TMFA 5EEHA 5FV4A 5FOVA 2WF5A 1KPIA 3FTDA 3HFSA 3JR3A 2J3EA 5BSTA 2JEZA 4JB8A 2HA2A 2W22A 4OBWA 5ED0A 4FOPA 5CK5A 3KZOA 3IJRA 1PFUA 1D6JA 1DJQA 4HQNA 1O94D 3D6NB 4FI3C 4HPWA 4ODIA 4U39A 4WXPA 3SC3A 1BTOA 1RLMA 1MVLA 2YOGA 3ETEA 1HFWA 1NJ6A 4NV1A 5TVGA 3ZDYB 1GPBA 1WY7A 3DHWC 2R66A 3S29A 5LYJA 1PFQA 1E9SA 4FR2A 4OV6B 1SQSA 2YINC 7ABPA 2X8JB 1B8OA 5U1PA 3EUWA 4O4HB 2ZVDA 2ZDHA 4QYMA 5J5VA 2AC2A 1PL8A 1L5KA 1QRRA 4D81A 2BBWA 5CLJA 1T9GS 5AXAA 3AF6A 1PWYE 2RAUA 3MNFA 1XL0A 2FOIA 2WT9A 1OH6A 1CUSA 2FW7A 1ISSA 5LXTF 2IGBA 1E2QA 4PSVA 3SEZA 4C88A 4R2IA 5JRDS 3IQIX 2FQXA 3WAKA 4CFZA 5KKNB 2IHNA 4RK1A 4MVXA 4YMIA 1Q44A 1SXJA 3PDCA 4POAA 3RTAA 2BFFB 4LISA 2PGOA 2IEAA 3FCCA 1P2UA 1UFQA 2O4UX 5GVRA 1KZ1A 2A3NA 2G76A 4FHDA 2C4KA 2YWEA 4GF5A 5SZKB 1CQIB 3A1FA 1FRFS 3M83A 1XHLA 3T61A 3NBUA 2AE2A 4DCPA 5LNK1 4GOXA 3WI7A 4LWOA 1KORA 2Q0HA 1J8MF 2DMRA 2ZIFA 1PG2A 3BAFA 1E2DA 4AY5A 5JI3E 1VL6A 2PHZA 2XOEA 4TWIA 1DHTA 4H7EA 3A1NA 5JCJA 3AESA 5I5GA 3OCYA 2YY5A 4GMXA 2W2QA 4DTIA 3OEED 3IEMA 2HA5A 2IYZA 3B8EA 4C9BA 1ZN9A 1WABA 1IY2A 3PEUA 3R4CA 3A26A 1RXCA 1R9GA 1G19A 4DCNA 2C7OA 5JNSA 1B16A 3PDIB 4QVGA 5EJAA 3NDBB 3B1JA 3GLFA 2FN4A 2GPNA 4YCSA 4ZCPA 2UYHA 4RD0A 3JZIA 3WDKA 1J0DA 4EY4A 5HM8A 1GFWA 3U7HB 2Q3HA 3O9VA 1IIBA 2Q2OA 1WHSA 4N49A 2HI0A 1FP4B 2WWXA 4AMVA 2JVJA 2X58A 5EIHA 5EZ5A 1G4AE 1VJTA 5FULA 4F04A 2C9MA 2WABA 3ME5A 3D1VA 3H9JA 3PGJA 5JAPA 2NUPA 4MZXA 1BS9A 2QDKA 4RM2A 1TQ6A 2VDNB 1Z28A 4BLVA 3GAMA 1PR5A 4NNJA 4CKCA 3KB8A 3B6MA 4KQMA 1ST3A 3G02A 1ID1A 3IUSA 1DTSA 5IDYA 4RTKA 1O6ZA 2XYQA 3D3EA 4OLFA 4GYWA 2E4UA 3GLVA 1UXGA 1R37A 3JATB 3PFCA 4ND5A 4X1YB 4CM9D 1U6JA 4P4UA 4P7JA 2C4UA 1OF1A 1PS9A 2ID8A 5EWMB 3T99A 2BFNA 5KIAA 2IZZA 5KOJB 4QEKA 3DPUA 3NO4A 2IS6A 2H0QA 2EBHX 3LCVB 1KC3A 3AKCA 5ITZB 1G1MA 5DLPA 1KJNA 2AL7A 4O4IA 5I9SA 2J09A 3UK2A 4TSFD 3MGCA 4H4DA 3DAFA 1U0SY 4O63O 4GKKB 1DUIA 4LRTB 2FSHA 3GPCA 5HVNA 4OYLA 3BCUA 2B7BA 2RAVA 3OESA 2C94A 2YYAA 3A28A 4IJVA 4BEBA 2V4UA 3EEYA 1N6KA 5C1DA 2YR0A 3T4XA 2WUFA 3HYTA 3N8IA 3TMKA 4BECA 2HO5A 1JJIA 4KREA 2H7CA 2OZLA 1HURA 3ILHA 4CMIA 5KX5B 2PUFA 5CX1A 2DBRA 4Z9YA 1WQ1R 1TM1E 3WLEA 4KLCA 2QAGB 5LN1A 1ORVA 4QLAA 3KZXA 4NZOA 3NYQA 1ZIYA 4X7MA 3TR6A 5JSUA 2ZJ3A 2ZTSA 3BTVA 2EU8A 3WSTA 5KVSA 1Z33A 2Q41A 3FRJA 3EGXA 4L2IB 1A3CA 4CN9A 1IYZA 1IEVA 2CFIA 2FK8A 1F8UA 1J49A 1AZLA 3GUCA 1HI9A 3FPFA 1OX4B 2PYZA 3QVGA 4QX6A 3WGOA 1LK0A 1EYZA 4OLAA 2ZR9A 5HKKA 4IDBA 2JZNA 3SZRA 4D99A 2QEQA 4MRAA 4I3GA 4OGKA 5DIFA 4C78A 5EVJA 3D02A 2O19A 1VJ5A 2Y1CA 1Y89A 3C6XA 4KQ6A 4N6GA 4DTCA 5JROA 3C3AA 1EDBA 2IEBA 2VDJA 2QTVA 2IEIA 3ABQB 5EHIA 1GTSA 2Q4DA 2RAPA 1YC2A 3EAGA 3UJPA 3AT1A 5JALA 4XLLA 1I1HA 4FQ8A 4HS4A 4A0HA 3H9UA 4PR3A 1NRXA 1X1SA 2WLSA 1ECPA 1Z47A 2QR5A 1U81A 1M5RA 4TRNA 4N9WA 4BBJA 1TVMA 2C3YA 3T7TA 1GTRA 3KK0A 1HH4A 2QTFA 4CUJA 4NDAA 1CF4A 1NQXA 5BN4B 5CAEB 4EWLA 4MJLA 3SQOA 1I4WA 1G7CA 1Q1ZA 2ACEA 4YCBA 3FMFA 1SD1A 3BHJA 2B69A 1DQNA 3QY0A 5CA1F 3HCPA 1I3NA 1BXGB 4JBHA 2EF1A 3FUTA 4IIJA 4F2PA 5JQGA 1URPA 4DGSA 3FCSB 1OYOA 2JD0A 3FROA 1XKLA 3MWDB 4YRFA 4EVSA 4EKDA 3ECCA 2HPHA 1SHZA 1XRJA 4YCAA 1G20B 1XDGA 3CO5A 4N7MA 1DV2A 1YQQA 5FV7A 1P31A 1E1RD 1Q2XA 4U7GA 3VO2A 5TGDA 2B1RA 3DV0A 1NJGA 5IW8A 3K6JA 1GSOA 4K87A 3AM4A 4LY6A 4DANA 4GLLA 1J2RA 1DE0A 4WACA 3W5HA 3WVNA 5AW4A 2FJ0A 1HE2A 1GIAA 3ZNQA 5AESA 3ZHCA 3U7JA 4Y2VA 2PS1A 4P80A 4E7OA 1FL9A 3F74A 3FLAA 1G0NA 4Q1FA 5CA0B 2HIHA 1JAYA 1N6IA 4RJJA 4JAVC 3EOZA 3OKAA 5KCZA 4JNCA 1HZZA 1DKLA 4W1QA 4F4IA 1L5RA 2G0NA 2REQA 3IVAA 3HYNA 4DDUA 3L4BC 4MV7A 2FP4B 1S3SA 3EDMA 3ESXA 2YVUA 2GM5A 3OOEA 4R71A 1AKMA 3LM8A 4MVYA 2XDQA 3SAJA 1YS7A 2PMKA 2VJNA 1JG2A 2WWIA 2P6PA 2Z2YA 4BC1A 2VATA 5IT9A 2PSHA 1MX9A 4UUAA 4WFKA 2GWRA 5B64A 3NOXA 4DOMA 4X1IB 3KS9A 3FDJA 1HG1A 4MPTA 1BROA 3TCNA 4KQGA 3E6AA 4C0BA 1F2TB 3GEIA 1M2NA 3K0HA 3T3IA 1T1EA 1BDIA 1U1GA 2P6RA 1B1CA 5E8JA 4CEHA 2C3PA 1J0AA 4AN0A 4BGUA 2PUDA 1HF3A 1R1DA 1W2WB 1ZR2A 4UVEA 1EXDA 1JI3A 1WXXA 1ESCA 3LQ4A 3R3UA 4YJ2F 4FE7A 3QFFA 3M4ZA 3EDQA 2J6IA 4WGFA 3RSQA 1PL7A 2CVPA 3BL5A 4D44A 3A2LA 3BE6A 3TAHA 4AWXA 2A4MA 3BMCB 4L8WB 2J33A 3N0TA 3UXEA 3W5UA 1A50B 4IS2A 3T5AA 2O2CA 5EJ8A 2P78A 1QK4A 2ZULA 3A3NA 3DDZX 1GNLA 1X1BA 2HK8A 1Q0HA 2FMIA 2JRLA 2UYYA 4KE9A 4ENVA 2OBBA 4KDRA 4BCBA 3OBIA 2JIZA 3DFZA 3X1DA 1SN7A 2XYPA 1Q1NA 5A3VA 4MW1A 1W4ZA 4DGQA 2IH5A 3V8NA 2VHVA 3JARA 3M4YA 4UUPA 1EVQA 3ABOB 3D0QA 3C16C 5EKUA 4JMLA 3UPDA 3P9XA 1RYBA 1YF3A 4CL8A 1MEOA 2O3QA 3T7JA 5AIBA 3WLAA 4G4IA 3FTFA 2PA3A 2I6FA 1NBAA 3AR4A 3TZEA 4WXMA 5IJ9A 5CB4A 1MP0A 3QEBZ 3GT3A 2FPGB 4NDZA 3TRHA 1SCQA 3ORQA 1HNNA 3UC5A 4DQUA 1F0KA 3HXLA 1XFAA 4W7HA 3VPDA 4DY4A 5KVCA 3BRQA 2ZUEA 2ZIVB 5D3ZA 1L7NA 1MA3A 3EODA 3O47A 3C87A 3CLVA 2DERA 2GHTA 4FGZA 1IOZA 3LUKA 4EZIA 1X1QA 3WK4A 1VZ2A 1QU2A 3KL4A 1L5VA 3DB1A 3R8XA 1RQXA 5I8WA 1QF9A 2XZOA 3CUEF 3IDQA 4FSXA 4NP6A 1YASA 2YBEA 4G5QA 5ICCA 1UT8A 4D96A 4E70A 5M04A 1W4AA 1RRPA 1SA0B 1WTCA 3ND6A 1LTQA 3P9YA 4QC2A 4YFYA 2WSMA 2EFDB 5HW0A 1HEUA 4MA5A 2PXXA 1F06A 3KXKA 3L4SO 4X93A 3TD6A 1FJ2A 3PSAA 4YACA 1Z7YA 5H68A 3KSDO 2VSOA 1SCDA 1GPWB 3QUSA 1Q57A 2FSFA 3VR6D 2BUBA 1U7WA 1LBQA 2OBLA 3IJEB 1W88A 1FQKA 2AZMA 2O7QA 2A67A 4WNAB 1Q1BA 2CHQA 3KR0A 4NNPA 2X42A 4YMUA 2NM0A 1CHDA 2DQ4A 5DXJA 3WL7A 3X1XA 1WM1A 2VCEA 2YFQA 1TUGA 1YL6A 4UASA 5E6UA 5JY1A 2OHGA 2ZQYA 1FOEB 1G0OA 4PYQA 1RQNA 1T9ZA 4X1KA 5EXEA 1I2ZA 1W5SA 1GYQA 4PG4A 1NZFA 2IUYA 2WIJA 3DAHA 4GGOA 5H9WA 4F1JA 3RVNA 4Z2AA 4RTLA 3BB4A 3MWGA 1BWPA 4M38A 3GPDG 1E3TA 2CNBA 4LJLA 4Y6PA 3OTWA 3U13A 3AVTA 2HBQA 2V54A 4HDMB 1U2GA 3GBPA 4OI1A 3SS7X 2KHZA 1P1BA 1JH9A 1J24A 1T0PA 1YZKA 3FZEA 3GCDA 3Q2IA 4CR8A 1VLVA 1XPOA 2R62A 1EVYA 2Z8XA 2AF4C 4L50A 1TLLA 1P2BA 3P0EA 3AQ4A 1SXHA 2RHOA 2X40A 3ZHTA 3NAZA 5F51A 5H1YA 4A5OA 2QQ5A 3QU7A 3O3NB 3PPIA 2Q4RA 2ZJ7A 4NG5A 4C43A 1XTSA 1USWA 2P1ZA 4QUEA 2RC6A 1H2BA 5GTDA 1CZRA 5IKEA 2ISQA 5ILQA 4A0RA 1FIUA 1NN5A 5EGNA 1ENPA 2HWKA 1BE8A 3DOOA 1GRQA 1PEDA 4ZHSA 1RJEA 3F3MA 5LQKA 3HCAA 5AI0A 2QTHA 3OWHA 5AVYA 3IQGX 4AKGA 3VPGA 2VQ6A 3RJ9A 3IERA 3PEWA 1F0NA 2O3SA 3DBHB 3P9NA 4QFCA 2BEKA 3NDJA 1FPQA 1YB6A 2W2LA 3FD8A 5EJ7A 5HKBA 2REBA 3A25A 5C35A 1KY3A 3QH4A 1CY8A 4DR2B 4RC9A 2QAIA 3IIJA 2HZBA 4H9GA 1ML4A 4GC5A 4YP0A 1H9BA 2H3EA 4CDRA 4JVNA 1C81A 2VHEA 1NC1A 3QIVA 3WTBA 2ZAGA 4M1YA 4CDGA 3HBMA 4EKYA 3RVMA 2ZB3A 2J7PD 1Q84A 2ZQ5A 3AOEC 3JQ8B 3LFTA 1ZD8A 4FR0A 1L5MA 5DNVA 4EHBA 3A31A 3LIIA 1YE5A 1ZL0A 3FYUB 4JBYA 2EGHA 3FMGA 5A3SA 2HLPA 4QYWA 2BWJA 3IQXA 1VLQA 2J7KA 4QOGA 4QARA 4PNZA 3H1GA 1HGXA 4ACAA 3RS2A 2PEYA 2WK1A 3NEJA 3QW2A 2AOWA 4HDRB 2J45A 3PX3A 3WBJA 1A82A 1FVOA 4ZZIA 1NUPA 4HXFB 1XEXB 2GGSA 2GX6A 3IMEA 4JJ8A 4NHEA 3A14A 3SZOA 3W2TA 3BULA 5FTJA 4LOIA 1XCJA 4PLGA 3G2MA 2PEZA 3ZI7A 4YMGA 4RY8A 2BFCA 2EIXA 3UVEA 1U1DA 3H6KA 2H51A 1JE1A 1SEVA 2J0VA 1CIVA 1KVQA 1Z0IA 1YK0A 3K0BA 4Y2PA 4IJQA 4BE4A 1HQKA 1Y3DE 1R0WA 1JIJA 2JLAA 4NE9A 1PFVA 3H3JA 3KE8A 1WHSB 1PR0A 2EXXA 1RAHA 5KAMA 5LB4A 1QS0B 4M1EA 2FMUA 4F85A 4FDMA 1QOPB 3I76A 3OJ0A 2CD7A 3GGCA 3GRKA 2O3RA 2OYSA 4KXLA 2HF2A 3KZCA 4IHKA 3RM3A 2VTVA 3FCYA 2FLVA 3HLTA 4OHKA 2ZB8A 4RF3A 3U17A 5K09A 1VCMA 2OO5A 3PKIA 1EUYA 4R8VA 3LDGA 2GZRA 4LYJA 2J5XA 2A30A 3HCFA 1JFFB 1RTTA 2X9NA 1WU8A 1AV6A 2ZYRA 1NVKA 3TSOA 4PLTA 3ABRB 2X0EA 2ATEA 2WU4A 4LZZA 5HZHA 1KI1A 1RLJA 1XQVA 4BKRA 3A2NA 4PSDA 1UL1X 1QAQA 4DL9A 4M89A 1EGQA 4IVRA 4XQ9A 1MJGA 3KLMX 3ODGA 4PCLA 5F2EA 5EJEA 1ESZA 1HMPA 4OIFA 1FFAA 2HF8A 3O3OB 5DPMA 4UQLA 4D4KA 1N75A 4IWXA 1JUDA 2K6GA 1Z7GA 4MB6A 4LZAA 1RPTA 3P45A 1F0PA 3TSCA 5F9MA 5CBPB 3F49S 4I3HA 3VU0A 3PGLA 1VOTA 4O4JF 1YKSA 1U7TA 5B3JC 1IJEA 1TJYA 3EFOB 1CY7A 1BKYA 5DHQA 3T9BA 3CX7A 1OD6A 1LC3A 3GZNB 1BVYF 5A4IS 5L4LA 4CXMA 2WIKA 4G0MA 2VNAA 3N5CA 1O95D 5JAOA 4H7KA 2Q4OA 1AO0A 2XNKA 2ZAMA 3ORYA 4R41A 4CM8A 2ON6A 1Q0TA 2RK6A 2I2WA 1NSYA 4L76A 1A5ZA 2GAIA 4EUFA 3DE6X 4KOEC 1X80A 2PX5A 2YL2A 4DV7B 3BKXA 5B6PA 4B7AA 4RKRA 5B5SA 2QI9F 2WAMA 3WR5A 4HAYA 5CDHA 4RVOA 3GCXA 2NGRA 3O8QB 4GX0A 3TLKA 3VYWA 2OM6A 1FMLA 1KFCB 3LY5A 3CWZA 5KOHB 2RGNA 4JLWA 3TRFA 1R8YA 2WAOA 3E61A 4HF7A 3DZBA 4PR0A 2BZ1A 3Q0IA 2PMEA 1CZLA 3I9NA 1W0JD 3MIZA 3TNYA 4Z0NA 2VF2A 1I4EB