4Y6LA

Human sirt2 in complex with myristoylated peptide (h3k9myr)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
288
structure length
277
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Kinetic and Structural Basis for Acyl-Group Selectivity and NAD(+) Dependence in Sirtuin-Catalyzed Deacylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 90
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4y6lA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4y6lA01
1OZFA 4TWJA 4QQ8A 2A1TR 3EYAA 1U2GC 2VBIA 2NYRA 1HZZC 4GM0A 1OZHA 4IAOA 1POXA 2DJIA 1MA3A 2EZ4A 1O96B 4ZZIA 5K2OA 4RJKA 2FWNA 4V1CB 2H4FA 4UU7A 4Y6QA 2IHUA 5BWLA 3PDHA 1PNOA 4RMIA 3GLSA 1Q6ZA 4FEGA 1PNQA 4Y6OA 3GLTA 2NXWA 2OO5C 1PT9A 4D5EA 1M2NA 2Q5OA 2OD2A 2H2IA 2IHTA 4L2IA 5D7NA 1OZGA 3CLRD 4C78A 1EFVA 4J16C 2B4YA 2UZ1B 4HD8A 2JI7A 1M2HA 5BWOA 4JUAA 3EY9A 2H59A 5K6TA 3IAFA 3CLTD 4L3OA 1M2JA 5EJ7A 1YTLA 2QQFA 4K9PA 2VJYA 1Q1AA 2H4HA 1PVDA 2Q5QA 3E9YA 5IMSA 1U31A 1SZCA 4Y6LA 3U3DA 2EZTA 3RIGA 3EA4A 4KGDA 1ZPDA 4GG1A 4UTRA 1YHYA 1Q17A 3FZNA 2FSVC 4MQ5A 1YC2A 4X3OA 2WVHA 1M2KA 2AG0A 4UUBA 4HDAA 4BN4A 1T9DA 1UPCA 4RJJA 2EZUA 5EJ4A 4BVBA 3HWWA 4BUZA 1JSCA 3LQ1A 4JU8A 2H2DA 2EZ8A 2WVAA 2QQGA 1V5EA 4K9KA 2UZ1A 2PANA 1XLTC 4JUCA 3FLMA 1PYDA 3D7KA 4O8ZA 3K35A 3OE1A 4IG9A 1YNOA 4V1CI 2VBGA 1Z8NA 1S7GA 2JIBA 3JWPA 4QPZA 2Q5JA 4F4UA 3D4BA 5MF6A 5EJ8A 3CF4G 1PI3A 4FEEA 1U2DC 2FN3A 5DEIA 5DGTA 4UUAA 3IAEA 4F56A 1T9CA 4JUFA 1YHZA 1BFDA 5EJ6A 2H2FA 4JUDX 1PTJC 2VK1A 2EZ9A 3ZG6A 1POWA 1Q14A 1T9BA 4MZXA 1QPBA 2JLCA 2W93A 2PGNA 4D5GA 3CLSD 3PKIA 4UU8A 2FR8C 2Q5LA 1MCZA 4KXQA 1YI0A 1E3TA 1N0HA 4JT8A 1DJLA 4COKA 4K9QA 4BVHA 2OORC 1U28C 2H2GA 5BWNA 2JI8A 3RIYA 1OVMA 2JLAA 4GP9A 5DGDA 4FVTA 1Y9DA 1S5PA 5EJMA 1M2GA 3ZGVA 4GM4A 3CLUD 2WVGA 1V5FA 2HJHA 4UTXA 1EFPA 2C31A 3PKJA 1YBHA 4K9LA 4GPEA 3HWX1 1YI1A 2OD9A 4TWIA 5FYQA 1V5GA 4ZP1A 5K3SA 4C7BA 2BRUC 4RJIA 1UPBA 4JT9A 4IF6A 5FEMA 4UTNA 2JI9A 4JSRA 2H4JA 5MGNA 4BVEA 2AG1A 3GLUA 3D81A 2VK4A 4JU9A 2Q29A 4BV3A 4JD5A 4J1TC 2X7JA 5K6RA 1ICIA 2PGOA 4UTVA 1O97D 1D4OA 2Q28A 3F6BX 4MPRA 4KPUA 3U31A 1SZDA 4K9MA 3JR3A 4QELA 4GM1A 5EJ9A 4G1CA 4Q9DA 4I5IA 5MFPA 4JUBA 1J8FA 4BV2A 2JI6A 4BVGA 4X3PA 1NM5C 1UPAA 4BN5A 4FZ3A 1PO7A 5MFZA 4MPPA 1YC5A 3F6EX 2Q27A 4BVFA 2VK8A 4RMHA 2A1UA 4V1CA 2VBFA 4UTZA 2OD7A 2FRDC 4K9OA 3GLRA 4RMJA 5AHKA 4RMGA 5EJ5A 1T9AA 4K9NA 3ZGOA 4MPJA 2H2HA 4R8MA 2IHVA 3FSJX 5EJAA 2V3WA
chains in the Genus database with same CATH superfamily
5BRNA 5JAIA 2K5UA 3L6RA 2HBYA 5F73A 1CYDA 4NPHA 3PI7A 1XTIA 4R1OA 1SCNE 1D8TA 3AF2A 3KYJB 5K4HA 2FMKA 3AYXB 1J8YF 2YR0A 3DLPX 3GYBA 3QI2A 3NHFA 2XMBA 2VQ3A 1IHDA 4LXTA 4UCWA 3SR4A 4RVFA 5LZ4A 1ZCZA 3U0VA 3D43A 3B52X 3DSRA 3BXEA 3HBJA 1N4DA 3RV3A 4HDNA 4Q21A 5CLGA 4TTRA 1NVFA 1L7XA 1ZA2A 3T9BA 1FC0A 1X3LA 4R1LA 4F6RA 2OFOA 2W8BA 3BBLA 3LUPA 3C8ZA 3T7CA 3ZLJA 2ZBGA 2FW0A 4RJKA 2X40A 2VI5A 1GSHA 1BCRB 4XPZA 1ZGCA 2FWNA 4R9UC 1FDIA 1Z06A 3ZYCA 4MYRA 4GKVA 2XXJA 2Z4TA 3EMBA 5DWVA 4BDTA 4UU7A 2JG3A 2F8MA 3U37A 1C1DA 4FKBA 1IBLB 1OYWA 4MGHA 1E4EA 1W0CA 4NE9A 5EIWA 1GAQA 2AZDA 2W2KA 2C04A 2PRKA 2JKVA 4H6VA 1AKMA 2C99A 3BF7A 4Q19A 3TW8A 1GPDG 5AW7A 3F96A 2WJZB 2Y68A 1RHMA 5JR3A 5ALHA 4D97A 2NYUA 1TVKB 4KIWA 1Z2DA 2J45A 1EQAA 2CVOA 4U6QA 1IM2A 1N6RA 1UK7A 3Q41A 4IIUA 1QGOA 2B4AA 2JAPA 4PAOA 1Y8QB 2P2YA 3U3JA 4DQ0A 1M2NA 3EZNA 3UMBA 4BE4A 2GRAA 3AO0B 3O8RA 3T5CA 3TH5A 1S02A 1YVPA 5SY6A 3VSAA 2WTEA 1IZYA 2PL9A 3HYNA 1I1NA 1KEZA 4F7WA 1L7AA 1QWSA 1R0CA 4K6OA 3GEPA 2IP2A 4ZVRA 2PBLA 2PHZA 1M6WA 5KQGA 4FMDF 5JS7A 5HZHA 3AOGA 1HKHA 1TTQB 3RUFA 3T3EA 1IM5A 1I7PA 1XD2A 1N6HA 4G86A 1TUBA 2RC5A 1QTQA 4PW0A 2C8VA 2Q4EA 4WZAE 2G88A 4ZFNA 1DELA 5E1MA 3KZMA 3F8TA 1CRPA 1AG9A 2NZXA 1U28A 1EIWA 5IAEA 1I4EB 1G9SA 3COVA 1RXCA 1XZJA 2XTJA 2O14A 4GI1A 3GJSA 2CLHB 1O6ZA 1H5UA 2P9BA 3GW8A 3W2FA 3IAAA 3ILHA 3TZQA 2JZCA 3WWZA 3I28A 2XDYA 3G2IA 5HQTA 1W0JA 1Z6XA 5AKEA 4ZRDA 7GPBA 3LCUA 2H59A 1AXEA 3PWSA 4IWNA 4LK2A 4MLZA 5FWDA 4CDGA 5CPBA 1PEYA 1ZRHA 4S1NA 1XDDA 3G2LA 1X1EA 3JARB 4PEVA 4GPAA 4HKTA 1SXJE 5AKIA 4Z86A 5L53A 3Q0TA 2I5PO 1ISMA 2ZBPA 1WZNA 2EJVA 5CCDA 4UQOA 1Z7GA 2IX9A 2RGGA 4GH5A 3RSGA 1IBKB 4BFUA 4ZKDA 5CPFA 3E9YA 3DPSA 2Y9MB 4RD2A 1X7DA 2QN1A 4IJQA 5TS3A 4AG3A 4TMFA 4QULA 1EHYA 3PTZA 3O1LA 4RHFA 1GV0A 4MV7A 4RPCA 1JLMA 1TZBA 1JR3D 2FCRA 1E6WA 2Y2VA 3P9NA 4KJXA 4FYKA 3CSDA 1YI8A 2DFDA 3D4PA 4QUIA 4JEUA 1VXOA 4YJ2A 1PJTA 4D9BA 4N8DA 1PLKA 4Q4CA 2M1XA 4INPA 5EMKA 2KLBA 1N7HA 4JYZA 4BLOA 4KGDA 4MQ4A 2FW8A 4DWVA 1EFKA 3U5ZB 3KNZA 1NUPA 3SEFA 4DCSA 1N2JA 2ZT6A 3LPLA 2CCGA 2IY8A 3H5AA 3I52A 5D5QA 4OUDA 1GUYA 4UTRA 3COSA 6NULA 4QM6A 3GGCA 1RQXA 1WTAA 4MRRA 3ZBQA 5CXUA 1F2VA 3EXEA 3CINA 3GPIA 2WJ4A 3PCTA 2BTQB 3KQLA 2B8TA 2WMDA 3KOUA 3QUBA 1M6NA 4OHKA 5FLKA 3W6ZA 1EBBA 3HR8A 4RLQA 5FPYA 2QW8A 1AQUA 3FFBA 4OGLA 2AZ4A 3LFHA 4G65A 3X1MA 5LDDC 3OQMA 2XUGA 4MYUA 3SXUB 4I2VA 2BFCA 3HN7A 1UAGA 4RZ3A 2KX7A 4A6PA 5GAJA 5ITVA 1SMKA 4JP3A 2WTUA 1R4NB 4QUJA 2ZIZA 4YMVA 1L3BA 4PTZA 2YJ6A 2QU7A 2G06A 2NSHA 1PU2A 4CQNA 2X5NA 3FLBA 3SGLA 3WBJA 1ZH4A 1XQVA 3KKOA 1HFJA 1IUNA 2HY7A 5FL7A 3ZW8A 1UKYA 5EJ4A 2HADA 1Z5VA 4ZC8A 5EZ5A 3RARA 1RJFA 5I8PA 3ESCA 4H3VA 1BCSA 1IJBA 4A2PA 4X8MA 3DTVB 1X8XA 2VHXA 3BDIA 5BYAA 5DMXA 4A15A 1UJMA 3LX8A 4IQ8A 3F78A 1ZGHA 2O3SA 2DERA 1TA0A 4JIGA 2JIDA 3VKUA 5F3RA 2UZ1A 4OBEA 2JA1A 2LP4Y 3V5NA 1JT2A 4Q7KA 1DT5A 1XRPA 2EBFX 1WOYA 4ZCRA 2XMPA 2ZB2A 4LQLA 4RMNA 5F1KA 3QWAA 2MOKA 1UBKS 2WJYA 4MLDA 3TXYA 4B5LA 3G7NA 3ABZA 5FHRA 4O8ZA 4Q3OA 2BZ0A 4JX9A 1IWPB 4QYWA 3QFFA 1C1XA 3UHAA 3DAPA 5KYYB 3DAHA 1V1JA 1QIFA 4XYMA 1KJZA 1KQNA 1QH9A 2C97A 3HV0A 4KIJA 1WIWA 5EAIA 3W4IA 4XWOA 2FQWA 1E1RA 2VBGA 4DIDA 4QFMA 3GARA 2XB8A 5TV2A 2EKDA 4WQMA 5C4MA 4CEJB 3JWPA 3CWZA 1N9GA 5K8VA 4RZIA 4QPZA 5HFJA 4IPTA 4P7FA 3TLCA 3TSYA 2BGLA 2NU7A 5CHEA 3T52A 3LL4A 3IC5A 3ZGNA 1UP6A 1YZNA 2HNBA 1UT6A 1L7OA 2NUTA 4AWBA 2C7OA 5TF0A 4UKDA 1Y7IA 2MYPA 2RBKA 3D2CA 1F8FA 1SXGA 2D4AA 3N6VA 3O9MA 4R3NA 4CMHA 1EM8B 5JY6A 3JAMA 3CEMA 2VT3A 2FW6A 3WWDA 7REQA 3ECCA 1L8XA 1Q92A 3QE3A 3OMXA 3MBOA 4ALLA 1UT5A 3FMGA 4L5BA 4NCKA 2R00A 2FN3A 2BM0A 5TDHA 2OVFA 3RRFA 4BQRA 3AKEA 2X6RA 3DO6A 3GRFA 3NM4A 4J6EA 5F5NA 2YVQA 4P82A 4RHUA 4JZYA 3COJA 4IYJA 4JLUA 5K9ZA 1HNZB 3ROGA 3REOA 1SQ6A 3ENVA 2YFQA 1QIIA 2I03A 4JB3A 1FFGA 3F9IA 4HN2A 4B8YA 2E89A 2GETA 1ZOOA 3CU5A 1RQNA 1U2SA 1XDSA 3W7VA 1YHZA 1UIMA 1Y3AA 2NWQA 3CEPB 3RFVA 5EJ6A 1F51E 3CR8A 3LY5A 3MUOA 3S29A 4ZGGA 4OHXA 4WIAA 5JCZA 1XQ6A 1IWOA 4D8UA 3CX7A 5A71A 1P62B 4EG1A 3KLNA 2YXNA 2JD1A 1W0JD 3ETGA 3K05A 4J0QA 4H08A 4D79A 4X85A 5HGXA 4DSNA 5EZQA 4E2WA 5K8JB 5L7WA 3BMNA 1O0SA 2W93A 4O4JF 2AYXA 4KFTA 3WOVA 3ROEA 1Y34E 3GZTB 3ZVMA 4I5FA 4H77A 4ZPJA 3AJAA 5DYYA 4RTMA 4NDAA 5LP1A 3M70A 3IV6A 4WI1A 1Y37A 1LU9A 4G1MB 3ND6A 4F4FA 3T5PA 2GN2A 3BIFA 3QK7A 4GECA 2QLJA 3KR2A 4NZZA 2JAWA 4N7JA 2C4UA 2WICA 3OD1A 1GUDA 2ISSD 4YMWA 1O89A 3QSYA 1GRVA 1E63A 2HF8A 3BHMA 4UHBA 3WKCA 1EP3B 2AOXA 2I3BA 2UXCB 2VTEA 7MHTA 1Z83A 4QJ4A 1QFYA 2Q62A 5TR9A 4J9VA 3SIXA 3SIPA 3I42A 3ZY3A 2X3YA 2XJ9A 4V2IA 3UFXB 4WJZA 4CR6A 2WJJA 2OOKA 3CJTA 1KMHA 4QUDA 2P5UA 4V03A 1DJLA 2FWIA 3ESDA 5J63A 3EC7A 5DTMA 3N7TA 4Z4CA 3NC1C 1EZ1A 4JLJA 4GYWA 3ZE8A 2X1HA 5LN1A 2FMHA 5HKAA 1RYFA 2OGWA 1Z4KA 2VO1A 2QUZA 1MRZA 3NAZA 4ARCA 3W5CA 3PC4A 2R47A 3IUQA 3KHTA 4W1RA 1Y8ZA 4RK4A 4ER0A 5CA1F 1Z4NA 4R5HA 1K6EA 3FZYA 4MYDA 4WN9B 4L28A 4E15A 3BC1A 2GF9A 1R27A 4N3AA 1V9CA 2QT9A 1UMBA 3B85A 1G19A 1XK6A 3K92A 3KTAA 3WG9A 1TPZA 3NJ8A 1GCGA 2CFIA 3MQFA 4IV8A 4H1WA 4U7GA 2C3PA 4NY1A 3U17A 1S1CA 4EHDA 4G41A 2AFVA 4KXXA 3JWIA 3STWA 6GPBA 4Y2XA 4BRUA 1PEAA 4RZUA 3NR2A 4X5OA 1PWYE 1MRNA 3FYCA 3SMQA 1GPYA 1QYXA 3GEGA 3JU3A 4JQCA 4EFMA 2Z1MA 4HNTA 5FL7D 3L3BA 2WAAA 4UTXA 2H9AA 1FDTA 3E5MA 1YZLA 2WU3A 5F77A 4GX0A 3JS5A 1MJNA 4HWSA 5TJ9A 4FMPA 4RW0A 4S1OA 1ND6A 4M37A 4ZU1X 3S2EA 1T1RA 2I2WA 3GHHA 4ATNA 4GZLA 4NDNE 5CH3A 2QRUA 3F0TA 5AXBA 2OD9A 3K1YA 2ZJ4A 1DHTA 1QF6A 2XAUA 2RK4A 2EX1A 2QX8A 2REOA 3ZWAA 5IJ0B 4OXYA 5LVAA 3DEFA 1MVLA 3ZWQA 1FQWA 4BWGA 3QE4A 3QPBA 2PZBA 2V7TA 1XVIA 4YFYA 4IMIB 4AJ2A 3LT4A 2PBZA 4L8WB 2KQUA 1D09A 1JJ7A 2EFDB 1QG0A 4HH1A 4MA0A 2X9LA 4J7UA 5JQGB 1V96A 3HVRA 5T5QA 3DUWA 5FLXA 2O7VA 2VAPA 2VPIA 3V1UA 2QLFA 1K7CA 5BN3B 3EG5A 1MX5A 4P7KA 1F6BA 5FR2A 1YVDA 3WLFA 3T7SA 2QLMA 5IZCA 4M0DA 3HNOA 4O5AA 5BO5A 3PRKE 1EK0A 1T91A 3ANXA 3D81A 1GCOA 2LPMA 3R6DA 4I7EA 5ULLA 5A3QA 2VKQA 4FONA 4BFCA 4GYJA 4J91A 4M1MA 2DUNA 4B6GA 3JPWA 5I8WA 3BD6A 3AV3A 1UKZA 4U1RA 3QPAA 2Q5FA 2Z0MA 3GRPA 1E2IA 4E14A 3Q7QA 1EDDA 2C2XA 5BP7A 1JT9A 3OPYI 1E5VA 1GA4A 1LRJA 2J3EA 3Q7EA 1G41A 1XRSB 3E7WA 4A5SA 2PGOA 3SSAA 1JA0A 2D4HA 3PPWA 5FWYB 2C4TA 3CNLA 4M89A 2Q3MA 1K4YA 1IAQA 4ZJYA 3WIOA 3KQPA 3O1HB 4B3IA 5G3ZA 3DOCA 3K5HA 5KNBA 5AOBA 5IJAA 4HT3B 1TZMA 1OBHA 2ZANA 4J7AA 2E6KA 1HEIA 4M1OA 3WE7A 3UM9A 1OFIA 1OXVA 2Y8EA 4FZ5A 4GWLA 4LTNA 1X2EA 3F98A 4MX8A 4N18A 4X0EA 1NC1A 5CM8B 5A0FA 3PD0A 1BXRB 2J3DA 4YWJA 5DHFA 4PVCA 1X15A 3WLNA 1YE5A 2I9KA 2ISQA 2G82A 2ZJBA 3LBYA 3IO5A 3EWIA 4L22A 3ORHA 2E48A 5GZ6A 1U6JA 4LJ8A 4ZXFA 1NF3A 5JVDB 4B0OA 3DTYA 4OY3A 4YUAA 3P2KA 2VTDA 2RK3A 4CVNA 4CF7A 1M5UA 3PGMA 3LOUA 4URVR 4N0EA 4R84A 2E49A 4EX6A 3NH6A 1Z7EA 2P69A 5HDBB 1FSGA 1OC2A 3CZ9A 1TJNA 2IOYA 4JVLA 4U2BA 2DBZA 2VAVA 2AEEA 3OQIA 1Z74A 2XUIA 3ZBTA 4IXDA 4GXTA 2PUWA 2JKZA 4LY9A 4YRDA 3TIFA 5GZ1A 1FSSA 4DMFA 1KAHA 1NM5C 1OAAA 4LI0A 2X2FA 4FZ3A 3GXBA 3ICOA 4IXTA 4R0VA 4PLPA 4ZTBA 1SVLA 3MWYW 2H16A 5ITWA 3GLGA 4BWVA 1RIIA 4MV8A 2IF0A 4P35A 5T4HA 5EXTA 3WLAA 1SC3A 4MRMB 1DVRA 2O8CB 4ASUA 3NKLA 4Y1GA 2OAGA 2JIZA 4EJSC 3VTAA 4TMVA 1Y1RA 4H3KB 4EVQA 4JZKA 1XXLA 3FMFA 4BVFA 2L42A 4L2IB 1CR2A 1CYEA 4AULA 3LG2A 3QRWA 5ELMA 4NBKA 5CBPA 1SU4A 5I5GA 3DBHA 1PCXA 3RVMA 3BL8A 4F86A 3URKA 2BGIA 1D1SA 1UJ6A 4G8CA 5LOVF 4BNJA 4N0DA 1YK0A 1TFUA 3OJXA 2V45A 4P3NA 4BFTA 3P20A 1C8KA 3O95A 3TSCA 2FB9A 3UB2A 5IULC 4XVHA 2UVPA 2XT9A 1DE0A 4X45A 3DC2A 1QAQA 2B99A 2HLNA 3SKVA 4R8RA 1K9SA 1OX6A 2FKAA 2IE8A 2JASA 3AVPA 3RYIA 4WNYA 2VT6A 1XTQA 4R5MA 6ADHA 1A2OA 1MMFB 2JLRA 4AJ1A 1HQKA 2AG6A 1YB6A 3QV2A 1R3DA 1C7FA 4OHBA 5JXIA 2IH5A 2EEZA 1FLNA 4Z0HO 2VNKA 2XGJA 1RRVA 3UK2A 1RKBA 1V71A 1WAMA 1TUEA 1ZM4A 2QP3A 2C4WA 2BFWA 2ZJOA 3IAM6 4W6QA 5TEWA 4FC7A 4O4HB 4YQFA 5KWJA 5KWVA 2NYRA 1JDBC 3X3HA 3D3QA 2YWRA 4LZAA 1B15A 4K6HA 4MKRA 3E0XA 4R31A 1G20A 3E3MA 5TS2A 1ZG3A 4OL0A 3KZXA 3D6MA 3JQGA 2IV3A 2C4NA 4Y9RA 5C1DA 1BEEA 1LDEA 3TCKA 3D64A 3KJNA 1H05A 1UK9A 1KL7A 2X23A 3C87A 3PQ3A 1Z9BA 3OF3A 4GZ3A 5KOYA 2XECA 2VNAA 3DZIA 2GBLC 4CLHA 4C9BA 4E5NA 5K1ZA 3L8CA 5AH0A 3CRMA 3OQ6A 2H2WA 1G8PA 3BOSA 1IXZA 2EDAA 2W6PA 3KT3A 4LDNA 1KJNA 3AG6A 1N6IA 2LCQA 4AI6A 5GY7A 1JHAA 2HA0A 2O1WA 2QRNA 2WILA 1U65A 2OM6A 3FE2A 4IQ0A 2FQXA 3L1JA 4KK3A 1IBRA 3CE9A 5T8KA 3IVCA 3O9VA 4R1NA 1JHYA 1TKAA 4OQNA 1OV4A 2ECOA 3KE8A 4OP1A 5JH7A 3NLLA 2B5OA 1DO8A 3LU1A 1MB2A 3PHLA 2D3WA 4GOXA 2ZIEA 2UZ4A 4M0MA 4GEKA 4Y6OA 1GV1A 4GPIB 3FNEA 4XJXA 1RC1A 1KEEA 1WW8A 2A67A 2BZSA 2OT3B 3DL2A 1US8B 1JG1A 1N75A 4TUYB 5EXEA 5HIKA 1Z8DA 2XYQA 5DBEX 1XLWA 4QXPA 3V48A 2XKBA 5JNRA 2NYVA 3R0VA 3CLVA 3DBLB 3EGDB 2HXYA 2R8RA 3MJVA 2P9QA 4F6LA 1U0TA 4IIJF 3BSFA 2E5WA 5FXMA 4HB3A 2QRLA 2NZVG 2Z9DA 1P7VA 3M3DA 5FBVB 5JZBA 3TZBA 2IH2A 2C00A 4UHFA 2QPTA 5T6BA 1XDUA 4N4AA 3RSLA 3SQOA 1YFLA 2BFBA 2YIMA 4ARZA 4X1OA 1E7RA 2LKDA 3ODGA 4QDZA 2LVBA 4DUGA 4MMYB 4P8RA 1KJ8A 5BV1A 2CWWA 2RONA 1SG6A 3CJQA 4G5HA 1S8NA 4LC9A 4OJYA 1IRXA 3KVVA 3L2OB 4NYMQ 1FIUA 1MO6A 4CLEA 2Q2VA 3AVVA 1Q1BA 4FQ8A 2DHRA 3RIHA 5AVKA 2WD7A 1JEYB 4QU8A 3CVYA 3GP8A 4NEQA 4DANA 1QLJA 1TRHA 1JSZA 4D0NA 1E79D 3WQQA 4OHZA 2OGUA 1SCUA 1P0MA 4O59O 1NBAA 1KKLA 1QBGA 2OHJA 1W0KD 2XE7A 3CF0A 3K0AA 3H87A 3L0CA 2FEOA 4FQ5A 1ANKA 2QAGC 4XLLA 1MH1A 2OB2A 1JB1A 5EKXA 5H02A 1IZZA 2ADMA 2FWPA 2IDKA 4NFSA 4OUKX 1FYVA 4PRYA 1CRLA 1ECJA 1BNCA 1G98A 1PLJA 1R00A 3DHEA 4KWCA 3OESA 4QQNA 1K6XA 1NW8A 1BS1A 3OZAA 1EM6A 3PR1A 3X44A 1IXKA 2A9KA 4GW3A 4BP1A 5FUXA 3PB3A 4UXJA 4IBOA 4WCVA 2J3MA 2RG1A 1JDJA 3HKEB 3BGIA 3K0KA 4K9PA 4LY6A 4UD6A 5SYAA 1AU9A 1Q1AA 1F4PA 3CVWA 1SD2A 5E38A 1X80B 3C97A 5A04A 2UUBB 3ECSA 1ZS9A 3P1JA 4BJHB 3JZMA 1VJDA 1R9MA 3QPUA 3ZIDA 3H3XA 2QDKA 2DCUA 4XKJA 4DDUA 1HSOA 5A02A 2YFKA 4YRBA 3D3KA 1FFYA 1N2EA 1XELA 4TV9F 5ALLA 3RI3A 7YASA 4H27A 2EZTA 1C8LA 1L5HB 1XK7A 1WW3A 2JIZD 2N47A 3BEOA 2GJ8A 3I5MA 3AHEA 3IQDB 3LWNA 4M9ZA 1LRLA 4ND4A 4PV7A 4YRRA 1ZXLA 3W5DA 4XUEA 2H51A 3EGWA 3S81A 1VA5A 2XHEA 3C85A 3A6EA 3C3KA 4EM6A 1IG3A 3ABQB 1YR3A 3OF5A 4NMHA 1WBDA 4Z4HA 4S3MA 2XW6A 1UAAA 2JJ2D 2BGTA 2G07A 1A5ZA 1TT5B 1ZBDA 3I2HA 1N0VC 3GLFE 1TKBA 1O8BA 3P7MA 2BBTA 3B20A 4W7IA 1DTWA 3LT0A 3ESQA 1LDMA 3IXQA 3ZUPA 4DT1B 2XCQA 1U99A 2PSFA 2W2TA 4PG7A 4RCVA 3FUUA 1QJ4A 3PC2A 3M5WA 3DEZA 4RKWA 4CMEA 2PT5A 1T2EA 2ZSEA 4TVBA 1G42A 1U3GA 4W5HA 1VIVA 4FFWA 5FPTA 5HILA 3VMFA 3ZWCA 3UMMA 4PAMA 4QT4A 1WXEA 2ENWA 4CMIB 1XL0A 2D2IA 4U7PB 2XUFA 1B7GO 2AXEA 3DQQA 3RHFA 3R3VA 1IFXA 3K1ZA 2PLWA 1JG3A 4WBNA 1AHIA 1I01A 2CLFB 3WRYC 2IV7A 1G6KA 1P9WA 3QUCA 2V7XA 1VJRA 4FJ0A 4UZSA 3IUEA 3G2HA 4YCJA 1BRMA 1G4UR 1MH9A 2D8AA 1L5VA 3VHXB 1IYZA 1OI3A 3A4LA 2QY6A 1EU1A 3MT9A 1OFGA 1NRXA 4UCQA 2DU8A 1K4MA 3QX7A 3O4VA 5P8WA 4MJXA 1P2UA 1XXHA 4XQEA 2WQ7A 1DOZA 3AVQA 3KCQA 4UMDA 1PW5A 1ZJ4A 1N8TA 3QWIA 1G2IA 2ZJAA 4WOJA 1R0SA 2Q4TA 2F3QA 1RMTA 3RUCA 121PA 5IKEA 2JLZA 4KR6A 2VS1A 3GFPA 1T9GS 4P3YA 2ZJ1A 1FFDA 3ZWMA 3KKKA 4F46A 2GTPA 4YIKA 4IG9A 1ZH2A 1QKIA 2FKNA 3LO5A 1JIIA 9ABPA 2JHCA 2CK3D 5DNAA 3K31A 3CHYA 1A4RA 3HSYA 4I4TF 5FR1A 4AY4A 1ADBA 5CX1B 1NLUA 4YJ3B 3M6VA 3NNDA 3Q3EA 1SHTX 5I6DA 2RG7A 1K92A 3SXJA 3WWPA 1ML4A 3GJRA 4IICA 3VO1A 1SB8A 3ZHYA 2XGGA 1QF9A 1N5JA 1L7RA 1YKGA 3KQYA 3PUVA 1YNSA 4FJ2A 1KSHA 1Q19A 2NO7A 4RM3A 3WGTA 2HDWA 3UH0A 4LDQA 1II9A 4JJKA 1O6GA 3NS7A 1NGSA 3L7KA 4GR4A 1IEXA 1KZ7B 1SD5A 1NT2A 3I0ZA 3LC7O 4CM8A 3VFDA 2XADA 4FR5A 4ED9A 3EAGA 3VPDA 2R1VA 4BTVA 4FT4A 1ZSVA 3P19A 1MAAA 4M22A 4OL9A 2ZETA 5B3JC 5BN5A 2A5LA 5EZ6B 2A3NA 4DUGD 1YKFA 4HAVA 2PUHA 1SR8A 2P67A 2QX6A 2WJIA 1QH1A 1QOZA 2CBXA 3CTPA 1KVRA 3OLCX 4CM7A 2FEPA 2JJ1D 3JQ9C 3A7DA 2H08A 3IRVA 4WK6A 4F56A 2GWRA 4Y0AA 2BISA 2Q8PA 4P3XA 4TYNA 3T7TA 3WLPA 3VSEA 1U2TA 1GLGA 4QHSA 1CJSA 2DQKA 2NTJA 4IV5A 3U56A 4KPYA 3RT1A 2RH9B 4I6EA 2WFMA 2EX0A 1WHTA 1ECPA 2HO5A 4FDAA 3QY0A 4WRRA 2IYLD 4DNQA 4DA4A 1VDZA 4KUHA 3V8NA 4BJ6A 1ZNQO 1WB6A 2NO5A 4JFAA 1UKCA 3CR3C 1OD6A 2AW3A 2QAGB 3C3JA 4G8BA 3WMEA 4BTEA 4PSCA 5KWSA 4C5AA 1L5MA 2TSYB 3VV3A 3UG6A 4MRAA 2NVUA 4D5GA 1OLXB 2WKPA 3O74A 3D4LA 4KVFA 4PZZA 1QC5B 4YP6A 5B1DA 4Y2GA 1IATA 1XHFA 1Z0IA 4A3SA 1T4BA 1E2UA 5L3RA 4F6CA 4I14A 2WTNA 2WJGA 4MQEA 2I7CA 3Q15C 1KK2A 3W7BA 3FPHA 1KDRA 2DHCA 5HVNA 1U4OA 2BL4A 3MGCA 1MCZA 4QJ5A 3HBLA 2AR9A 4ZJUA 4WZAA 2EAUA 3KSDO 5CVDA 4YXWA 1I7DA 2JA2A 1RXEA 5CXXA 3LVBA 4L57A 5ICMA 1XZMA 5LA6B 4LCJA 1LBSA 4KVZA 3D6HA 1IHYA 4DV5B 1A88A 1UDAA 3QYPA 4TS9A 2H06A 1I2AA 2WAOA 3DYIA 3ZU6A 1K66A 2J4FA 2I7XA 5BQ3A 5T3UA 4G1EB 4CZ2A 4ZHQA 3MFYA 1BKYA 1C9DB 1EK2A 1PFVA 2PR2A 4DM3A 2HUNA 3A1DA 5AQ1A 3RAEC 5DH9A 5EXPA 5FT9A 2ZIFA 2FPXA 2ZSDA 3STTA 5BWCA 1NSTA 5K3OA 4B3CA 1K2WA 3RUDA 2IXBA 4IJMA 1K3TA 4FE4A 3ZDQA 4GC9A 1QMGA 3MGAA 2JI8A 3F6CA 3V1YA 1TK3A 1UAYA 2PLAA 1NF2A 4GZMA 4IDGA 5KJFA 1MNQA 1OC4A 2Q0QA 3KHUA 5J5VA 4ZEVA 5FI1B 2OO5A 1XCPA 2WPDA 2DM6A 3ENZA 5EJMA 4FK8A 4JKYA 4HTFA 1JL3A 1OKKA 1X70A 1GQYA 1J8DA 1JR4A 2RHBA 3E18A 2C0CA 2QN8A 3HU5A 4G9BA 2O3JA 3ZGVA 3OLZA 1GFIA 3W2IA 2G1UA 2QLNA 3CLUD 3LZ6A 4IUBS 5TPWA 4Z51A 5LSAA 3SC2B 2LW7A 1WPXA 2OV3A 4YRMA 1CR0A 1HDYA 2OG2A 3KQWA 3P9CA 3SPXA 5DK4A 3UAGA 4FINA 1EFPA 1ZZGA 2GPJA 3CEJA 4G5RA 3HLKA 1Q0QA 2Q5HA 3EZ2A 1JPNA 3K4PA 2BDTA 4IOJA 3SX2A 1PN3A 2PSJA 1ECCA 1IQRA 1XU7A 4HYQA 3GJYA 5KYXB 3ZJTA 2C7BA 2Q1UA 4GMXA 3DWIA 2CV0A 4LRQA 4MW4A 4HWRA 3ZN2A 2HJVA 1YIOA 3U4CA 1FOEB 2GN8A 3O03A 3U3OA 1V5GA 1CUBA 3PDIA 2BKAA 1SHJA 3SQNA 3VR1A 3NBXX 1MQ9A 3RFTA 3GUCA 3WFIA 1A27A 2BGWA 4ARIA 3SR0A 2JL1A 2E3JA 1M1NB 2FMIA 4XSVA 4CV0A 3AI2A 2VBCA 4NL4H 4QBIA 5B6JA 2Q6KA 3Q3IA 1S89A 4UARA 4BFSA 4V0NA 5CDTA 1PF7E 1EGAA 2XXAB 1JLLA 1NTOA 4BKMA 1RPZA 4R8LA 4BNDA 4HGYA 4LSZA 4BVEA 3H1BA 3C3AA 4WLUA 2Y1LA 2WSBA 1HXHA 4YCCA 3HXKA 3UKDA 4EITA 3OLYA 1NI4B 3LP6A 2MTBA 3GCWA 5LXTB 4CFSA 1HDOA 2Y0BA 1N36B 1IJFA 2BR3A 3GA7A 4G81A 1Z6PA 4PS1A 1UODA 4PLFA 2C5AA 2HDHA 2UXDB 3UMSA 4L5JA 4MPDA 1JQAA 3T4UA 5EERA 5FPKA 4BV3A 1CUDA 1XA3A 1JPUA 1LX7A 1QTRA 1X2BA 2FLKA 2HCFA 1NMSA 2YUIA 2JCVA 2X7JA 4HUQA 4WSOA 1J2UA 2ZI7A 3OKPA 2IU3A 3EXFA 2I3ZA 1Z2OX 3NO4A 1Q7RA 3QHQA 4OQLA 3L07A 3DLTA 1VSTA 3PEUA 4ZRMA 2OAP1 2DTEA 4BAUA 5KKNB 1Q11A 1B6SA 2JCYA 1D4OA 2CCKA 3BAZA 4ONEA 1VE7A 4QDXA 3RK0A 3WQHA 4Y1RB 3I2KA 3OTHA 3AM3A 4JQOA 1U9YA 5KNCA 1QZ3A 1U8XX 3PD1A 4P7BA 1S3IA 4L76A 5K6AA 3FAZA 3IIMA 5KTRA 4ND8A 3S1LA 4PZYA 4AZ3A 2Y1FA 4K9MA 3WRXA 4E6PA 3C41J 4Q37A 4CG3A 1ZONA 1MGOA 3SQDA 4AK9A 4RSMA 1IPHA 4GGMX 3GGJA 4KR9A 2TMKA 1JKMA 2SKDA 3FYHA 3NDIA 4I3HA 3THXA 5ENVA 3DXYA 3LP5A 5AJTA 1PJQA 3CX8A 5IC6A 5BPFA 2XE4A 1TIBA 5GMOA 4TYMA 2ZR9A 3WGNA 4I5IA 5ALVA 4BNNA 4ZYXA 2GK3A 2P2LA 2UVQA 4QJBA 4MB2A 3NKFA 4YJGB 2XUHA 3IOMA 4WXHA 4AN0A 1SPBS 2XA1A 4A2CA 3C6YA 1M0WA 2C5HA 4NEHB 5DK6A 4DC1A 2I3AA 1HF3A 3EY4A 5JO9A 4AJJA 1QHHB 5KVSA 5CA0B 1H6DA 1B0ZA 1JSXA 1QDLB 1TW2A 1WDWB 1XIVA 1VXRA 3HSKA 3BWYA 4PN7A 2PLFA 2N9UA 3ONEA 4OB8A 5SYNA 4BXOB 1KAOA 1VPVA 2YIVX 3R44A 2G6BA 2F3PA 2XUZA 1XZFA 2O0HA 3MT8A 3GPLA 2ESRA 4YXWD 2Z6QA 3CZCA 3DBIA 3OZWA 4J7XA 4MO9A 3V4PB 1AE1A 1YBAA 3HA5A 1FJXA 3PC8C 2A6PA 1W76A 3U3MA 5CH5A 1X9HA 1VJ0A 2PSHA 3GBPA 1CZNA 2FE4A 2OHOA 1AMNA 3HACA 5J2UA 1X7WA 1UK8A 4LVCA 3H13A 4N7BA 3M3PA 5BUQA 4RH3A 4OI0A 1PEDA 2X1VA 3KT8A 4Y6RA 3TN7A 3I4FA 3RTBA 1WOMA 3WDLA 2CDRA 2YL2A 5IUKC 1ZNYA 4L02A 1AKEA 2IY9A 3UJBA 1V8ZA 1SELA 2OBFA 1LH0A 2NZJA 2PO7A 2EIXA 2HCTA 2IPAB 2WUEA 3PXXA 4NHOA 2C78A 4JQSA 1YK1A 3PRJA 2ZRPA 4TL9A 1OZAA 2OCXA 5HUHA 1U0SY 5KX5F 4LBZA 2XMGA 3NORA 2ACVA 5FBKA 3GT7A 1ECGA 1N2CA 2X8LA 3DHVA 4NCNA 4X63A 4XX0B 3SCZA 4BZXA 1G6Q1 3GH1A 2FZCA 4LGYA 3WI7A 2XVMA 3C7DB 4HUJA 1Y3DE 4OTZA 5T57A 4TWJA 3CNNA 3ZCPA 4YAUA 5EXDA 2C2ZA 4H6XA 1VBFA 2GNPA 2A1TR 2WIJA 4IHAA 3O8QB 4KQEA 1P4JA 1VG1A 4XFDA 3TTXA 1UPFA 5EVCA 3WFJA 3U4IA 4UM9D 3IUNA 3IP1A 4QBFA 5BNTA 4JT4A 3QLVC 1E66A 4FFPA 4RH1A 2P2DA 2FPIA 1ORIA 1XKQA 4ISCA 4RHTA 1TYEB 4F5YA 4XM1A 4F0JA 3A05A 1NHGA 2ZVJA 5CTAA 4IZ6A 4AKHA 1WUHS 3F7OA 2NPFA 1ESNA 4D9HA 1SUIA 2I2BA 3OC6A 3QBTA 3EN0A 3O31A 3W6NA 1XEXB 5AKKA 3VU9B 2JLYA 1JEOA 3HPRA 1XMOB 1OH6A 4Y6QA 2ZRBA 2ZRQA 3BHIA 3PF8A 4ID9A 1O6CA 1YU9A 3F5MA 4RD3A 4ROTA 3VR4H 5C8DA 4OKNA 1XRLA 4WFIA 4MR7B 5EZYA 1QUEA 2PQ6A 3UYKA 2CJWB 1M6HA 4NECA 5B55A 1Q6ZA 4I46A 1UBGA 3K9WA 3OCUA 3RAFC 5IABA 3ZDBA 4IOKA 4YRLA 2VH5R 2R6ZA 2OHXA 3TIGA 5DASA 2B8WA 2NXWA 2C03A 1PT9A 4EPXA 4MEAA 3GRKA 1Z0UA 3MJDA 1ZAKA 3DV0A 3RJTA 3TVDA 1UPTA 5A3JA 2GYUA 3KSBC 2CE7A 5B7GA 4BNLA 3TFQA 1TAHA 3R0ZA 1A82A 4N5LA 5E2BA 4YEDA 3R24A 2XMSA 3IEUA 1VB5A 1PR4A 2Z98A 3DZBA 2YJ3A 4B4KA 3PTLA 4J43A 2A33A 3GVHA 4HNUA 2HC9A 5SYMA 1L5LA 1XZ8A 4TXLA 4EVIA 3UANA 3O47A 2Y1KA 3N39C 3GY0A 4U2DA 2XCRB 3KR1A 5D7NA 4DJDC 1QVAA 1UXJA 1FYEA 1Z3IX 3NVAA 3MEQA 4D4LA 5KNCD 5LZ2A 2W8BB 1E2PA 1JEJA 1PK9A 3CLRD 3D2AA 4KYIB 2GM4A 4CEHA 3OE5A 1VKRA 4C2BA 5HFNA 4BU1A 3GN1A 4FCWA 3WV4A 3JVEA 4YROA 4R40A 3HBAA 4MI3A 1QE0A 1ZNXA 2P4HX 3UVEA 1PR3A 3CZQA 1UDRA 1ORHA 4CKZA 5GZ3A 4D45A 4LHVA 2HH9A 1C1DB 1PQWA 1PX0A 3CNEA 3UXMA 1E4EB 1RWVA 3N8IA 1S3FA 3WYBA 4UHKA 1TTTA 1AZWA 1YFJA 4WKOA 3TZEA 1GXSB 2BGMA 3SHFA 5A4MS 3GDFA 2OGTA 3HCCA 2D2XA 3HJUA 4KXYA 1VYUA 1YONA 2OCPA 2VHWA 3DZCA 5JS1A 1DC4A 1M5RA 1DRKA 4LVNA 1N6NA 1OFHA 4L3OA 1WQ4A 3B1ZA 5DBGA 3M1IA 5TMEA 2R25B 3JYLA 2RHLA 2C4HA 3H2HA 5EGSA 3TKYA 4WLEA 3SBEA 4E5UA 1N25A 4KODA 4LX8A 3S5UA 1R3UA 2N0SA 1YL7A 2YVUA 1CERA 4DDTA 2VLIA 2XEXA 2VPXA 3FWYA 3AI1A 1QG2A 1S2IA 1ZBQA 3GUYA 4I1SA 1T0UA 4ZVTA 5D3ZA 3WYNA 3U5TA 1IM8A 2FEWB 3EXIA 3I23A 1TCBA 1V8DA 2ACKA 3NHRA 2W6NA 4MGYR 1WQ1R 2VRCA 3TI9A 1NVDA 1Q91A 3RIGA 1M33A 1BXGA 3IELA 3I5AA 2FCAA 3PP8A 4QUHA 2Y77A 2CF6A 2XQGA 5COQA 4A6EA 1A5AB 1TUBB 1EDOA 3ZZMA 2F8SA 2X9QA 3P9PA 1J5EB 1VHWA 4FN5A 4B40A 2QD3A 2YXPX 4LDRA 4BMZA 4Q82A 2FY8A 3WLIA 4N76A 1P80A 2RGXA 2GZ1A 2IUSA 3FZNA 5AJYA 1P33A 1T3LA 1NNLA 1XZBA 1YZ3A 2FSVC 2A0KA 4MYSA 4JLNA 3ZK9A 4Y2QA 1IE3A 1YC2A 2PQ0A 3NOQA 2REBA 4DNOA 1P0PA 4DMRA 1WLSA 2JAXA 3C3WA 3D8BA 4LZJA 1B2RA 3GYGA 5KTOA 1G4HA 3G0DA 1NBOA 2I78A 4DMLA 2BUAA 1WY5A 1L5WA 1KY3A 3N2YA 4H7HA 4RY2A 1YS9A 3E7FA 2ODBA 3ZNPA 3D0RA 4XYGA 4D44A 2B0CA 1G8MA 1H1DA 2JI4A 3A1NA 5AMXA 2OEPA 1KEWA 3FHOA 3LPDA 1QO0A 3MB8A 4QVIA 3CEHA 1DAOA 2PLRA 3FDJA 1SWVA 4RFSA 3VGJA 4JR0A 2ZIUB 2ZSIA 1ZA1A 5C7YA 3EH2A 2B1JA 1G3IA 1Z5WA 2KI5A 3P9ZA 3QKIA 4FCTA 5ALRA 4K28A 3U7QA 5CFRA 2EP8A 821PA 1NQTA 1GM5A 1NG1A 1RPAA 4G4GA 1YJ8A 1ZVQA 3IUBA 4R05A 1FQJA 4YJ2B 3UBTA 3D7RA 4HLDA 1RWKA 4MVJM 2GO7A 3V7WA 5E6UA 1NIJA 1E62A 2ZSBA 4PSUA 2P4SA 4OUDB 2OCKA 1C3VA 4WKGA 5BQPA 3G9TA 1TJ5A 4I66A 5TVGA 2BCEA 3EH1A 2OKCA 4KH0A 4P5EA 5EPOA 4AX8A 3EXEB 4KAAA 2BEVA 4M8KA 2QLBA 4KFUA 4PQEA 2NTYC 3SBDA 5I7RA 1MENA 5JMOA 3IAS6 4DUZB 2BMFA 2ZG6A 4L0CA 3RTCA 3DAFA 3FIUA 4FXOA 4JJ4A 3FKQA 4N6NA 2H00A 3M4YA 5JJBA 3G2NA 3NWOA 2V4ZA 5ISMA 2BFCB 4DLXA 2PZFA 3DMTA 4BFVA 4C76A 4AYWA 1NLZA 3IQGX 3QVWA 3RS9A 2QD5A 2IS1A 2RGCA 3O6VA 3SYLA 4EG4A 3IDQA 4EO7A 4QGHA 4W9MC 2Q99A 4OLJA 1C7JA 2FJPA 1SQ5A 3ANSA 1USVA 2DP4E 4QPNA 1EVZA 4Z0TA 5EJ8A 3GLIA 2AN5A 3AEZA 2H18A 2XF8A 3VDXA 1EFAA 3BYZA 4QODA 2IC5A 2J0SA 2PJRA 1M1YA 3R5FA 4KG7A 1U2DC 4FU0A 4DV3B 3LDHA 1OMOA 3C14C 3WL8A 4LJKA 3THYB 3FFWA 13PKA 1K68A 3T15A 4PAGA 4J4TA 3WRWA 4GI5A 4ES6A 3F6RA 3HRHA 1YS7A 1M74A 3KLPX 3RSOA 4BZQA 4F5WA 3MGKA 4IXMA 3ZR4B 3EUFA 2ZUCA 3K2QA 3FPLA 3OLVA 3KDAA 3MINA 2C9YA 2NPOA 1PS9A 1T9CA 2PMKA 2BSXA 1CUFA 1COWA 1I10A 1M2EA 5IDYA 4ZXPA 1UINA 2FOXA 5FBZA 1UADA 3H2SA 1GPNA 1H8EA 3OT5A 3FW1A 1C1XB 3ELDA 3PHCA 4TKUB 3USCS 3WVNA 5JDIC 2WE8A 3NUGA 3FVRA 4QNNA 1AKRA 4HGZA 1ZSNA 2ACEA 2KS6A 1AGRA 3AZPA 1C8BA 3NNSA 3O26A 4K1XA 4IIGA 4TMWA 3GJ4A 5IYZA 2G4VA 2CXRA 3F49S 4HVAA 2HO4A 2IE0A 3DF7A 1A96A 3OQJA 4KQFA 1R4AA 4UREA 5CYPA 2NSDA 3OEHD 4KBYA 4TMXA 4XM0A 5TXGA 2HEIA 3NFRA 3TQRA 1DWQA 4LSMA 4UU8A 3ZE7A 1E0JA 2HMWA 2Z09A 1BU5A 3H2YA 3TVTA 4D8XA 2AZTA 2F4NA 5BSFA 5JAPA 1YZVA 2GEJA 3K0HA 2GRJA 3R7NA 5D3MA 5CW1A 1OLSA 3TIXB 3JYHA 3T35A 2CDNA 1JHZA 3GFGA 1GPKA 1XCBA 1U7ZA 4QU9A 2OK7A 4U5QA 3EQ7A 1RQLA 3DC7A 3ZTWA 3OEYA 3M49A 4OXNA 1SULA 3F3KA 4ZOLA 1UC9A 4F8YA 3NB0A 2X2PA 5FNVA 2DOKA 4Q7MB 1W4RA 1C9KA 4FX5A 4X6LA 5EHIA 2J09A 4D02A 2ZIWB 1PHPA 3KTOA 1JHXA 3FWZA 5FFFA 3UTCA 4C4XA 2JHAA 3UATA 5GWXA 1LGYA 5E2AA 3DZGA 2Q9BA 4LKRA 3SOZA 2WZCA 2DHEA 1DIAA 3B1JA 4HAXA 4QGGA 4RESA 1NDUA 2ZROA 4BL5A 2R65A 4RS3A 4NESA 3OTGA 1UBFA 3FRJA 3VX3A 5BSGA 3OCCA 4LIPD 1VPLA 1KQ3A 1YBFA 2FN7A 2G83A 3WGMA 1UBJS 3ED1A 4TT3D 2H8KA 2ZTUA 4J1QA 5CRIA 4YJHA 4ZT3A 5B2ZA 1ZN9A 3U4HA 4C6SA 2GCIA 1FRFS 4ZQFA 4EY7A 3KEOA 3NEYA 4W4TA 5IXSA 1JH9A 3PPYA 4YH1A 5FDFA 3DYVA 4GM4A 2BMDA 4CE6A 5KEIA 2PE5A 3ZS8A 1OJ7A 3HC7A 3P0HA 2O8NA 1V1MA 2YY6A 3JZFA 1V5FA 1UK6A 3IQIX 3LNCA 3WWYA 2O54A 3GK3A 1ZU5A 1KU0A 1DBIA 4AUMA 4JLVA 3LHFA 4CJXA 4NOKA 4XR9A 1CJCA 1P5FA 1P9OA 4E3ZA 3NXSA 3IV9A 4QUBA 2G5GX 1YI1A 1VMKA 5CG2A 3VBCA 4DLZA 1UZNA 3KEMA 1JE0A 1BC5A 2PRSA 1LLUA 3DVSX 5JQGF 5D7BA 4CG0A 3T5BA 3U9TA 1G7CA 5K3SA 2DMRA 3K32A 3H4IA 5K6AC 2SNIE 1L7VC 5BSEA 3VNAA 1GZ4A 4IF6A 1I3NA 1KQOA 2I55A 3LJKA 3LT5A 1O95C 4QARA 4RFLA 1E92A 3CURA 5JLAA 1JKFA 2Z04A 3TLXA 4DR4B 4DLYA 3VZCA 4F8JA 4Y2YA 3OM8A 2VJQA 2NNLD 1C0LA 3HCFA 1XKLA 3H7IA 3HE3A 4I5DA 3A2NA 3R40A 3BCUA 3RQIA 3V9AA 5I9IA 4Q3EA 2QTRA 4LF5B 2AX4A 5EYPA 4XM2A 4N49A 1D0SA 2VDJA 2HLPA 3U61B 1SBCA 4LA4A 3JWEA 3P96A 4RGYA 2H5IA 3T4PA 1WXHA 4Q9LA 4GGPA 3DOOA 4HXGA 1RDFA 2OAQ1 1SIOA 3ZW7A 4Z4IA 2AKYA 2ZE6A 4J1TC 4GLJA 1G38A 1SG0A 4EHBA 1ZH6A 2OCBA 3OZXA 5D8DA 5JATA 3S2ZA 2OZKA 3L1VA 2M32A 1XG5A 2C9BA 3I83A 4OHVA 4MIEA 3WLQA 2D62A 1O97D 4MKFA 4RA9A 1YZUA 1JV2B 2FZLA 3MPOA 4INJA 5ARCA 2Q28A 2IZ5A 1CHDA 4KFRA 4MPRA 3NHMA 5JJKA 3IP5A 1NDQA 5JVDF 2O20A 4YNBA 4PLTA 1G16A 3TF5A 4AO6A 1JMKC 2CVZA 3NYIA 2WRZA 2GCPA 1Z63A 4TTSA 1KOLA 4ZCSA 4DSOA 5AFSA 1QRUA 3R3YA 3K6RA 1ACLA 4KRFA 4C2AA 4GOJA 4LYEA 4RPHA 1HT3A 3K0EA 2RGUA 3GMTA 4XD7D 4TWRA 2NSLA 1L4HA 3LWBA 1RWMA 3RHZA 5HTOA 4Q01A 1SCJA 3CIOA 1CZKA 3JQQA 1WULS 3RUEA 2Z2JA 4L4SA 2IUUA 3AVUA 4IO0A 5JXGA 4OBXA 2DUJA 4UPDA 1EK1A 2OESA 2RAPA 3B6JA 1JAXA 3WO1A 1U8CB 2F9MA 3BK2A 2CXNA 3GEIA 4RA6B 4Q4LA 1AUQA 1C3OA 1OI4A 3A3PA 5CNMA 1NP7A 2GI4A 1ZMXA 3PNMA 1IBCA 1RXIA 3FYUA 4KOAA 3UWDA 3AF5A 3SJBA 5BW4A 3DPUA 3CE6A 3II6X 1I94B 3MTDA 1LPOA 1QS0B 2WWHA 4BO1A 4QZVA 2WSLA 3QXGA 1K3UB 3KQMA 4Q9HA 4DBLC 2ZYWX 5DSTA 1W5EA 2ZRAA 1UPUA 1H1TA 2IYSA 3MRSA 1XZGA 1HDEA 1LDNA 1RWPA 2YZGA 4NC9A 3GA5A 1HDZA 4FYXA 2ZAOA 3TB4A 5CFLA 4HWKA 4I9NA 1N2HA 1SBNE 4LVUA 1ECFA 2B2CA 3G1UA 2RBGA 4X6YA 1L5SA 4YGYA 2FF7A 1TD1A 4C3VA 4QREA 1R6VA 1JDPA 3BQ9A 2YJ4A 4FDLA 5DIFA 4IVNA 3TCXB 4EA9A 3DXXA 1G5FA 3WR5A 4FZJA 4NKRA 1R0WA 3GG9A 4JYBA 1P18A 1ZOSA 2V7GA 4J8PA 4UTZA 3O7MA 4IILA 4R1PA 3H11A 4X1IA 5E4JA 3FTCA 3K94A 2QRKA 4DQVA 5DRYA 4E11A 4YP7A 4JBHA 4FGZA 5EJ5A 3C24A 5BPHA 5KOHA 3BL6A 3ELUA 2P3OA 2XZLA 2FDCA 4O4HF 3TKLA 3O8OA 2VSYA 5G4KA 5LJIA 4QDKA 1ST2A 3HJAA 4W63A 1CS4C 4IJUA 2VSNA 1S3SA 4Z9BA 4XIFA 1P17A 5EVJA 5KYKA 5EIXA 4OQXA 3UJPA 4AB1A 1C1HA 1OZFA 2Q4OA 2XYGA 3HKCA 1GN9A 2WJWA 3SE0A 1LF0A 1N1DA 3QKUA 4D9GA 1E61A 1K5PA 1TRKA 2HK8A 2WT8A 3UG7A 9MHTA 2V6MA 3LFTA 2GEDA 1UOOA 1JKJA 4PXAA 1DARA 4CM4B 4AY3A 1MO2A 1LPBB 2QKYA 1Y1TA 3DZDA 3USZA 5AW1A 5DWQA 3GJ7A 3ZH2A 3VOTA 3QPVA 3NBQA 4GPZA 5BRJA 1E3IA 3AC0A 4CIYA 1I4TD 2OZVA 1SOUA 3COYA 3KKEA 4RIEA 4M6WA 5F64A 5FTJA 3ZU4A 4B5KA 1H6AA 3FNQA 2GK6A 4J1NA 2V74B 2DAPA 4BE7B 3T5MA 3HUFA 4TVSA 2WIBA 4WPGA 3L93A 2WF6A 4J0KA 3ETLA 4OIMA 3S27A 4Z2AA 5BV7A 3EEBA 4CQJA 4FGSA 3L9WA 1PZXA 2ADFA 2JRCA 1F06A 1CY8A 3CT6A 3OOEA 4TUYF 3WLEA 5FLEX 2XYRA 3CIFA 1Q2UA 1QHSA 3A6HA 4RTRA 5ENZA 3UGTA 2XE8A 3MN1A 1IOVA 1E1CA 1Y89A 3FROA 1BS9A 3O8DA 1TA4A 2JATA 3IXMA 3KJIA 4J29A 4CT4B 2WWYA 3RVQA 4W5RA 2VYVA 4K05A 3GLTA 5HKLA 4G5YA 4XGRA 1DRUA 2COKA 2Q4BA 3SHOA 2PUFA 4UE3S 1M6EX 1NXXA 1Z0JA 1BA2A 3OPYB 4YAJA 4QPPA 4OXRA 5F5LA 1SRQA 2H4YA 1DG3A 3WA7A 1XU4A 4CLOB 3RLFA 4KFSA 5DWDA 4YASA 3KALA 2YMMA 3B7GA 3JQEA 3MOSA 5KJ6A 2DB3A 2FTKE 3DTNA 1X39A 4AJEA 1JKIA 3O4HA 4RTLA 2I2AA 3I2GA 1DL5A 3R5KA 2YOGA 3REFA 2H7VA 1EIZA 2IGTA 3JQGB 1VZ3A 3WZ2A 4ZA2A 1MJGA 1K2VN 3L7CA 4D41A 3OQBA 1R0YA 1A4IA 1U7PA 4K88A 4P81A 5HA5A 5AW4A 1F5NA 4BPRA 3WLKX 1B8PA 1E9AA 3EZ9A 4LF8B 2EL7A 1S2NA 4ZVMA 2BE7A 2OK8A 4X24A 4YAGA 1CPYA 2IEYA 2Y6UA 3UENA 4CKEB 5JPDA 2FPLA 1Z0SA 4IX1A 1HZJA 1YSCA 4KNVA 1LI7A 5DTEA 3UJ7A 5AXCA 3WADA 2H63A 4Z4GA 1QIDA 1PR1A 1YFKA 1D2RA 2CSUA 4E3WA 1WZ2A 1ONBA 3PWTA 4KVGA 5FWXB 2Q6OA 2OXRA 5LPNA 3GX1A 2VHCA 3HA2A 2GJKA 1T1SA 4ILKA 1D1QA 1MC1A 4F2DA 1GADO 5IF9A 4PZAA 4R7GA 4M9UA 1AZTA 4LJ5A 1ORWA 2O05A 4JVMA 2I2CA 5E9JA 2XKKA 2V3CC 1KEEB 1ODCA 2XCIA 4TTQA 4CV3A 5A4IS 5IT9A 3OP4A 3PSHA 2C7PA 2AFHE 4IRMA 5EKDA 5C5IA 1STOA 4NE7A 2FSSA 1LNZA 1QHNA 4FBMA 3CB4A 4RH0A 2FN4A 3ZXSA 3EDRA 2GEVA 1Y1LA 4RK6A 4EBFA 4ETNA 4F1WA 2H1HA 4M53A 1GR1A 4RE6A 4EABA 1D2NA 1N2BA 1Y63A 2Q3BA 2BFBB 1TZ2A 4U6NA 3UK1A 2OZLA 3QP9A 1VTKA 5HCIA 3CVJA 4LPKA 4U7DA 4IGAA 3N0WA 2ZB7A 4AZVA 1DLIA 3OCJA 3GLHB 2Y1CA 1V3VA 3KJHA 3PJRA 1L4YA 1HE2A 2B92A 5ALWA 2YWDA 1IPEA 1P1HA 2X0RA 2H52A 3MWGA 4C4AA 3LW7A 1M2WA 4JR1A 3X0DA 4TPKA 5LMNB 1DFGA 4DIMA 4CMAA 2Q3JA 1UC5B 1GNTA 1G8SA 3E48A 1SCUB 3E84A 2HTEA 3DD1A 3ORSA 2QN3A 3PFNA 4OBWA 3TR0A 4AJKA 4MQ5A 3UJCA 2TRSB 2ORWA 2PRJA 3AQIA 1UDCA 2B4TO 3B2NA 1FLAA 2JARA 1BE1A 2ISCA 1SN7A 3LF1A 2CLDX 3A1VA 2WVHA 3ZLUA 1YQTA 2R0QC 1Y7LA 1SHLA 4UQPA 1SZJG 1M2KA 1V7QA 4G5GA 4G4SP 4GPBA 3D3WB 3DAGA 5HJ5A 1NNI1 4LJSA 3NH9A 4FYIA 4GBGA 4UCFA 1UZMA 2CKMA 2VRNA 1SXQA 4AKGA 4WLVA 5KTYA 4C0JA 3EEFA 1YACA 1O9BA 4NK5A 3IP9A 1KOGA 3NJ4A 4ND2A 2JGAA 1PV2A 2YHAA 4OHUA 2X9VA 3DOEA 1JI0A 1G5IA 4G5FA 4RF4A 4BNXA 1LPSA 4JBLA 2BP7A 4WZ6A 3CTMA 2WVAA 1V5EA 4M86A 2XSZD 1RWXA 1VSVA 4RDCA 4NNPA 4PLYA 5DHPA 5I48A 3HZZA 4NYIR 1ZHOA 4UDNA 2KE5A 4MQ6A 4DIEA 1LK7A 1X94A 1TD9A 3ABIA 3RYFA 4KQGA 1T3GA 4Q4HA 5EUQB 4AJ4A 5GVRA 3AP2A 4JUCA 1JEAA 4KLZA 5MDHA 3VNUA 2HGSA 3LHIA 4YJ3F 3QVJA 1GG5A 3GVIA 1SXJC 5HQ3B 4IKPA 3T9FA 3NC4A 5GVSA 1CUAA 1KVQA 1A8QA 4J75A 2HKIA 3V1KA 4TV8A 1M34A 1DTWB 3A9TA 4AQ7A 5A5EA 5ALUA 1OA1A 5KVAA 1GTJ1 1M83A 3L0YA 4PGHA 3R0QA 3G0OA 4JAVC 4B2LA 3O21A 3PVCA 4DQUA 1BDMA 4HEQA 1Q7EA 1U8FO 1CJBA 3OKCA 1XDZA 4LW8A 5DLPA 5CEFA 4TQUS 4INAA 4QYIA 1E1LA 4PSKA 5JS2A 1U0NA 3NX4A 2O6HA 3TPFA 4X54A 3OY7A 4JI8B 4IP0A 1YTUA 4P22A 1J9ZA 3P4XA 2EBWA 1ZW6A 1QX4A 1JQEA 5KSZA 4NZYA 1JXOA 4AURA 3E3LA 1F4LA 1FNBA 1I30A 2PMDA 3AH8A 4MLCA 1MOZA 1OTYA 3MCZA 1YIDA 4FNGA 5HNKA 5EY5B 4QOIA 3IEIA 3HKDA 3PGXA 1VCIA 5CDYA 5AI6A 3IQXA 4JI3B 5FI0B 5T4FA 3RPEA 3T1NA 1IOLA 2Z8YA 5I8ZA 5C3MA 5JALA 2JRLA 1M67A 2B21A 2QMQA 3C1UA 3MS7A 4X6UA 3AX6A 1U0RA 3IAEA 3R4VA 3ZVLA 5C1PA 3HA3A 5IZ4A 3L8GA 4LYYA 2ET6A 2I6UA 4HY3A 4YQZA 2B82A 2VT2A 1EGQA 1XXHB 2M6RA 2X5OA 4FI3C 4PYLA 3AF6A 1PQYA 4C14A 4BYGA 5IW8A 2WSSD 3INGA 2CVHA 4BQPA 5B30A 2OWEA 4OQ4A 4ZMSA 4EF5A 5TF4A 3AMVA 5TX7A 4WECA 1VC2A 1ORRA 1B0AA 1XNJA 2LUOA 3KPJA 4ZZ1A 1QDEA 2C92A 3U6BA 4DCGA 1Z08A 1L0BA 3K30A 3LGSA 2HIMA 3I58A 5KJEA 4DIUA 3G89A 2VJPA 1DMSA 4UBLA 3RU3A 2ON6A 2IBTA 4OFBA 1U8TA 2CNNA 1Z16A 221PA 2PGNA 2GF2A 2QY9A 2Y93A 3PR3A 2VRWA 3UHJA 4W9NC 1DCKA 1KPIA 3CLSD 3DE4X 4MPTA 2DEUA 3IV7A 1FZQA 2R8YA 3OVMA 5LA6F 3VR5H 4CIWA 1Z0DA 3HJCA 3M4JA 3FNHA 3PKIA 1J8VA 5SZIA 4MV0A 3TSWA 2WOJA 4R83A 5BSRA 4EOGA 1DEHA 1N0WA 4DJAA 3ELYA 3Q8KA 4QOFA 2Q9AA 5DM0A 3U39A 4KKVA 1EXMA 3AEUB 5TQ2A 3AVYA 2QJTA 3S1AA 4ZI3A 4D4MA 1TDJA 3U9LA 4URFA 5DW0A 5BN5B 4QDJA 3KTFA 4ZT5A 4XDYA 5CT5A 1IQ0A 3GPDG 4UBNA 1RYBA 3CLKA 2XRFA 3AHJA 2NQ8A 2A0YA 4OGFA 5B6PA 1CVIA 5IPFA 1XPRA 2YZ2A 3IOBA 3OZSA 1RYYA 3QKRA 2REXB 2YFYA 4EO9A 4GP7A 3N2KA 1OE0A 3QMPA 1WMEA 4ZOEA 3IP6A 3C6MA 3UPTA 4EUSA 5LU9A 1NKVA 2P2GA 4M36A 1EGVB 2C57A 5EKUA 4AZTA 1AK9A 5JWRA 5EP2A 1WHTB 2GR9A 4HN9A 1PJ2A 2OMKA 4IFEA 1R2QA 2H6EA 4LMBA 3IIKA 4RQTA 3GI1A 3ZY5A 4B3BA 4YYZA 3THOA 1IAVA 1VL0A 3EVEA 4OYYA 1H2AS 3RT9A 4QTUB 4DJJA 1ZD3A 3JPYA 4AMVA 3Q8MA 3GCDA 1QLHA 1T5OA 2ZJFA 3D6FA 3F74A 2ONZA 3N1UA 5AW0A 4KQHA 2EFGA 1KTVA 2FK7A 3JAWA 4B4DA 4B9EA 1UWVA 1OR8A 5JARA 3JTEA 3N2IA 4TGLA 4B3HA 4M1KA 3TNJA 5JW6A 5HJEA 2JFNA 1BKSB 1C3LA 2VA8A 4IDHA 3X1DA 4EAQA 3Q2IA 3O8CA 2BMEA 1FS4A 2DPLA 3PU6A 3QWHA 1JXAA 4KYVA 4N3NA 2P2CA 4XPIA 2X0KA 3KOYA 2O9JA 5DNWA 2PUGA 3SNHA 4MQEB 4O1IA 4CF3A 4FFMA 2X5KO 1IBSA 1UJ5A 1FP4A 2RI0A 2WHEA 4ZO4A 5IKOA 1UJNA 3X1ZA 5GINE 4ZAWA 4H59A 2OFFA 4WZAB 2DQ4A 5DHQA 3IR6A 2FG7C 1GPLA 1YOVA 5CLIA 3I9MA 4WX2B 1XMPA 1W9HA 1D2EA 2DPGA 5ELLA 3GRCA 4L51A 4HQOA 4U4AA 4FDUA 4PWZA 1QG4A 1GVNB 3VPCA 2YXLA 3L0OA 2C3OA 5LYJA 2TMGA 1A3CA 1QGDA 1X7YA 4OU5A 4CODB 4C7BA 2GX6A 1DDIA 1JRLA 1AVTA 2O5RA 3M5DA 1XALA 1Y9ZA 3FFAA 1P9NA 4Z1OA 1HKUA 3JQAD 4LCEA 2YICA 5EWMB 5ETJA 3QBDA 1CQJA 3AUSA 4M0PA 5LXTF 3NU1A 4RELA 5TGTA 5CFMA 1KI1A 1YJQA 2GA8A 3PCXA 4DJ5X 3MJHA 3PJDA 4UTNA 1ZUNA 1CY0A 3MXOA 2VG8A 4EDHA 3FOCA 3QYAA 1DQYA 5EI5A 1PS8A 3SICE 1G64A 2NV0A 3KBBA 4GQIA 5E95A 3HU2A 5DM1A 2OP0A 4IKOA 1MU0A 1ZNZA 1DFIA 4R8SA 2HD4A 1QPZA 1UKEA 2HDOA 3DDCA 3GEMA 3REQA 2Z30A 4HTFB 2P40A 1AF4A 4QX6A 2ASEA 2ZZNA 1UJ2A 4BASA 2QP9X 3KJQA 4OOFA 4M54A 2EJCA 4B6OA 3W5JA 1TCVA 2FH5B 3D4IA 2YWJA 3TI7A 5TPWB 1GG2A 1LPMA 1JQBA 5K8TA 4CMGA 1PDVA 2J32A 1AV7A 3M2TA 4EL0A 3AZQA 4M0EA 2Y1OA 4HEA1 3BRWD 4UM9B 1EFPB 3R5TA 4E22A 2J9RA 3E9MA 1IY0A 2Z8ZA 3E7DA 4GUAA 4LYGA 1QNLA 2J85A 2ZSJA 4NCJA 3UFBA 4PNHA 4RD6A 4CIXA 2QGZA 4F06A 3OZUA 2CXSA 2G7ZA 1K88A 1FXSA 2FFRA 2JVKA 3QMWA 4OQQA 4J3NA 4B3JA 4G0XA 2QRVB 4BATA 5DNYB 2MINA 3Q2KA 3PDIB 4FFSA 4O3FA 5DT9A 3HGQA 3RO7A 4YPFA 2HJRA 3CS3A 2Q4DA 2B3DA 3N76A 4JLPA 2E82A 3OEEA 1KOFA 2AOWA 3CLHA 1PK8A 3BA1A 1KSGA 4L8VA 3TPCA 5KPJA 4J6FA 4MWZA 1N5MA 5EE3A 4H1HA 5THQA 3QV1A 1GOTA 2QTLA 3P2OA 2Y9PB 3G0IA 1JLLB 1A71A 4DWWA 3AILA 3OG9A 4G1CA 5CA0F 4BNDB 1QQ6A 3ZJVA 2QSUA 3OH8A 4CGZA 3L82B 2WT9A 4CIDA 1LCIA 3SJCA 4U9UA 4BP3A 3HZRA 1G66A 2V03A 4ARSA 1E9BA 1NMYA 2CLSA 2AZMA 2GCEA 2JI6A 3PF9A 4Z7QB 1IIRA 1EB8A 4KWIA 5C7OO 4YCAA 3UKOA 4IDEA 4I9HA 4FJ1A 3VU3A 3NTRA 1W5AA 3P0FA 3USES 1JA9A 1P0CA 1Q0ZA 1QQ7A 3I37X 3I2FA 1U7DA 3VGPA 1JECA 1J97A 3SXPA 2CHEA 3V4LA 3IDSA 3TLAA 2A5FA 3GT3A 5DTQA 4WH0A 1NTRA 2PNFA 4NBRA 4X41A 4YALA 3R5SA 4JWTA 3AB8A 3S2SA 4DRZA 2WHXA 1XLTA 1YZQA 4ZQHA 1KMNA 2QUHA 3OM9A 2ZS9A 4E07A 4MLPA 1DJNA 1LS6A 2POCA 5T4BA 5J4LA 2CLEB 3K0CC 4WJKB 5WRFA 5I4BA 1IJKA 2NAPA 2VK8A 1VMEA 1EE2A 4ND8B 1CV2A 4XTRA 3T7IA 5FTLA 4D3ZA 2QRMA 2OLKA 4XCXA 1QIMA 4QT0A 1U8ZA 4XVRA 5JEEA 3V7UA 2OD7A 4OYHA 2HSDA 2GK7A 4QICA 1SVMA 2BZGA 3BG5A 5JLJA 4J3JA 4DDKA 1JEQB 2N42A 1NFRA 1I7LA 2GXUA 1ULAA 2JLSA 2X58A 3NV9A 3QOFA 4KIGA 2O8BA 2HJWA 4MPJA 4R1MA 5KCZA 3B6EA 3AGPA 5HKOA 5L8VA 1T6NA 2H57A 3QNMA 1OXKB 4OA8A 1H65A 4ICIA 4GWKA 3JXEA 4CM9A 3RVOA 2GARA 1E2NA 3FSJX 2H92A 3KQSA 1RNLA 4UZFA 3RIXA 4D8WA 2XHZA 4BGEA 1C0EA 3Q7SA 4RGVA 1ESDA 1E8MA 2PD3A 5EN4A 4X71A 2FWAA 4JFRA 5ALTA 2HMTA 2DZDA 3KS9A 3H8WA 4DTCA 2GBCA 4OHCA 2JGEA 1SC1A 1EMDA 4P5DA 4Z5XA 1XZNA 2C77A 2O8FB 1NATA 1INLA 2GN6A 1MN6A 2A5YB 4C7JA 3C3XA 2MSCB 3W3AD 2J7PA 1DEOA 1PG2A 1XPJA 3QFRA 4EF4A 2YY5A 3VPFA 3PLNA 3Q6IA 1DWUA 2VZ0A 3OE4A 1BRTA 1I3CA 2E37A 3RFCA 4QECA 4PN3A 2O1XA 2XNCA 1XYVA 1X7WB 2AC2A 1EH5A 2PKXA 2QX9A 4X66B 3PXCX 3UK6A 1NXWA 3IX7A 3E2PA 3SQMA 1PJLA 2DF8A 2GILA 2PWAA 1QO7A 4PO1A 2RHGB 5EMLA 5EWJA 5C1OA 1XD9A 1ZMBA 3O91A 4CKBA 3T3NA 5LP6C 1R6DA 4KIUA 4C0KA 4X00A 5AM0A 1CX9B 4INZA 4WK4B 3AIOA 3ULKA 3DVAB 1W1UA 2D0PB 1TIKA 2IP4A 3NW9A 4ZO9A 2I9PA 4HX9A 3MAJA 3PHBE 3EB9A 4MVYA 3PQFA 4EUEA 4LUCA 4JJ6A 3BMOA 2GS9A 5DYGA 3MTQA 2WMYA 2ZM6B 2PUBA 1GSOA 1TF2A 3N3BC 5GPBA 4JJEA 5K3FB 2QV7A 2HA5A 3WFZA 4F9FA 1MV5A 5J2TA 1JNXX 3LC0A 4JC8A 3MELA 4HFRA 4Q1VA 3I32A 2OD2A 2C3UA 1ZU4A 4ECEA 2HL6A 1Q57A 1I1HA 3FGNA 2ZIXA 1ETHA 5AKGA 3GXOA 1IEVA 3TW6A 4FOTA 4FHZA 2PBFA 4AJOA 1YHNA 1PDOA 2DQZA 2UDPA 3M7IA 2GH1A 2IYQA 3AWDA 4FLFA 4KBFA 3SDSA 4CGYA 4D6PA 2W43A 5ADVA 5JXHA 2XMZA 1A72A 2EW2A 2WMOB 4D9IA 3E22A 5IFLA 1VCNA 3GJ5A 4EPVA 3PNKA 5DM70 3L4BC 3ROQA 5DO9A 3ZQUA 3G88A 4FYHA 3LV8A 3STXA 3FVTA 3TLJA 4MK4A 3WNCA 3UT5A 1KYQA 1QXSA 1R5NA 3PFBA 2HZ7A 4KFCA 4LYHA 3RCBA 4YN3A 5CR9A 2Q1XA 1VKOA 3UWMA 4W99A 4BMOB 5EZYB 1AHHA 4EMSA 3E9NA 1KQPA 4HQLA 3ADOA 2IS4A 4DBZA 5I7EA 3A7EA 3ZWDA 3IAFA 1O9HA 5J40A 5AR1A 2OCGA 1V3UA 1M2JA 1CUUA 3BTVA 3AB7A 3WP0A 5KU1A 1GNPA 1HGXA 4UVHA 1PG0A 1N32B 2L0XA 1HTBA 2OCIA 2QENA 3HQ4O 3B1XA 3K09C 5EXSA 3VYTB 3NHUA 3BTOA 1W59A 3KUUA 3BTUA 3I9FA 5K0EA 3T3IA 1WNTA 3GP3A 4FR0A 1O97C 1XZHA 3A1EA 2HPVA 4G97A 4KI0A 5LLDA 5HM8A 3OICA 5DSZA 4RTKA 1Z82A 1ULUA 3R7FA 2FG5A 3HY4A 1FNMA 1ZO8A 5BMOA 4KACA 3WQSB 3PE6A 3NTVA 3C0KA 2DPHA 4OV6B 2HI0A 1YR6A 4TWAA 2PKCA 1XWIA 3AP1A 4JVSB 5E1BA 2RAUA 5C1BA 1T36B 3I61A 4IIBA 4CT0A 4CEHB 2A1IA 3LW8A 4CEIB 4XDGA 3DWEX 4EUFA 1W4LA 1L1QA 1YHYA 2CXTA 2O50A 4RVUA 4B7ZA 5I9NA 1DUSA 3KZ1E 1XTRA 1RQRA 3NBAA 1JI3A 3EHDA 2QQ0A 4H2DA 2OA0A 1DX6A 3L4SO 3WIUA 5BY2A 3X43A 1JFTA 3CB2A 4LHZA 3TBHA 3U1VA 4Y9TA 3PFCA 1J9EA 2PWBA 4G85A 4V0RA 3SSMA 1NVUQ 2R8PA 4S12A 4BMCA 1Z4QA 1WV0A 3JD0A 1EFLA 1D7AA 2FPPA 3QE9Y 1I8TA 3OKAA 3QUSA 1NWHA 1I51A 3HVKA 1E1QA 4LN1A 4A92A 3PFKA 1NURA 2O2ZA 3TTWA 2FLWA 3BWDD 4KU4A 5BVGA 1MXHA 1EBFA 4YJ2F 2FWBA 3OWXA 4H16A 1AS2A 3OUZA 2ZJ2A 1YDFA 3OIDA 4EHHA 2ZJYA 5K7SA 1Z45A 1JHDA 3ZBPA 1CFZA 2WM2A 2P8JA 3EXIB 3K9GA 2NVOA 2OXTA 2OYRA 5DNUA 1SXIA 1BXGB 1VYVA 1KK3A 2AC7A 2LR0A 2WSMA 2ZCUA 3CKLA 1KNQA 2BC9A 2I4MA 5TRTA 4AO7A 4DR1B 1X87A 4Z9FA 2JFFA 5I9TA 3VZDA 5KOJA 2QTVA 2E2WA 3T3OA 4DLUA 5EQDA 3LPCA 3ISJA 4ZDWA 2ZR0A 1P5ZB 3BZUA 3ZK7A 4TKMA 2CGEA 3EVAA 4RHEA 5KTPA 2HR1A 1PYDA 3LY7A 1ZHFA 2O0KA 1GITA 3FSGD 3HJHA 3RABA 4JSYA 3JVDA 2G9NA 1YF3A 1W85A 3H8VA 4U2CA 3GB9A 3DE6X 4YHBA 4YV7A 2OR3A 5LZ7A 3OQHA 1E3MA 3VU8A 3N6XA 4LDAA 4L6CA 1V8FA 4L8GA 2CUZA 2JIBA 5A5FA 4Q9KA 1B1AA 1AUVA 1V26A 1PGJA 3Q10A 3UHFA 1VKJA 2E4VA 1XROA 3WYAA 2RGBA 2FUG1 4G5XA 4NVRA 3TDMA 1DGQA 1SGWA 3UCFA 2ECKA 1Q3HA 3AIIA 3L5OA 4D1YA 3N0XA 3W8EA 4DVGA 1H8HA 4RULA 1JHOA 1YT5A 4BGDA 3RS3A 1AGYA 3SS8A 3QVOA 3TAXA 1PI3A 1F7UA 4N40A 4QD3A 5DCYA 1TE2A 3VISA 5AUQA 4KNYA 1SUDA 2ST1A 3U7QB 3BB1A 4EYEA 3FWPA 1XLVA 4A26A 4NIMA 1EHIA 4OJQA 4DF3A 4U7FA 3BKXA 4BBJA 1HE8B 3T54A 5JPCA 1MP0A 1O87A 3N28A 2OILA 3EDOA 1UM8A 2LCIA 2ROQA 3Q3GE 3ITEA 3BJRA 4JBWA 2VEDA 3VH4A 3WJAA 1ODKA 2QG9A 4WDQA 5CM9C 3UK7A 2C7RA 4GQBA 3M82A 3WAJA 4FP9A 3ED5A 1NJGA 1H0RA 3FY4A 3M34A 3FOFC 2JB9A 3NUQA 4JGGA 1GKYA 4K40A 5AHRA 5E6SA 3N59A 4IMRA 4PO9A 2QG6A 3RVRA 1PEKE 3Q8LA 4RADA 1H2XA 2O7NA 3NHSA 4U9HS 1PFQA 1AQYA 2HUPA 2ZB3A 3QPWA 4ECAA 4DB4A 2IYEA 3QMVA 4US1R 2E0IA 3IAHA 5A9TA 1SQSA 5IJXA 1KEVA 1BO6A 1HOTA 4F72A 4LY3A 3A10A 1KK1A 5DDIP 4GKKB 2XEDA 2Y0PA 2N1BA 2YVLA 3MCWA 1VG8A 4Y6GB 4NS4A 4F92B 4LZWA 2PL3A 2BHRA 3IP7A 3BIJA 1KSFX 4E13A 4GO1A 3CRRA 3TTTA 1ZMTA 3W78A 3K9BA 4FZVA 2J1LA 1C9EA 4JMPA 1NXTA 2UV8A 4WFJA 2WDPA 1P2FA 5HKBA 2J0QA 4WKNA 3A3YA 2R97A 1RYZA 3ZS9A 3CUEF 3GLIB 2HA2A 2NU6B 4RIHA 2GBIA 1MORA 2HDNB 3U7FB 1WSAA 2YY7A 3WGUA 4OFXA 4YMHA 5F78A 3ANYB 2QL6A 1M1YB 4KO4S 4RK7A 1E0DA 2XNHA 4DLBA 2O23A 4B83A 2P9YA 1N0HA 2IH4A 4ZVKA 3JRNA 4BQNA 3RSSA 1CT9A 3CG0A 1MABA 2J3QA 4L3VA 3CO0S 3LPMA 4B6RA 2NQTA 3QNUA 3KKPA 3ZXXA 2ZUEA 3KP1A 5I7OA 4IZOA 2C94A 1T9ZA 3LDAA 4JOQA 2QN9A 5IBPA 3G6WA 1BVRA 1ZC4A 3H1PA 4DV2B 4QASA 1WL8A 1GTZA 3MINB 2PU5A 5HUQA 1JAZA 5FUYA 1VMDA 1PKEA 4UUOA 2IV2X 1XOIA 2DTDA 3KWLA 3R8XA 3BH7A 4US2R 1ZR2A 1OAOC 2HHJA 3G49A 6AT1A 4XQ0A 4B6FA 4JI6B 3R75A 1Z3CA 3AHGA 5FP0A 1V16A 4FYYA 4RM2A 4E31A 2AMVA 3AEQB 5IKPA 1OVMA 1NMEA 3FGOA 3H5OA 4E5VA 5I7SA 1KRHA 4DDMA 4JCCA 5IYZB 3SE7A 3OCZA 1XYYA 2EKLA 2JZNA 2VAMA 3LC2O 4L9WA 4PPFA 16PKA 6PFKA 1I7QB 3PXBA 2QM7A 3RUHA 3ST7A 3UJ8A 5LCXA 3FYUC 1NULA 5KKCA 2PX3A 3V42A 5KPDA 1QVRA 2BR5A 2LIPA 3L8HA 2P9CA 1Q7GA 2RHDA 1UQTA 2CVQA 5TGDA 3U7IA 1FTNA 2ECFA 2BH9A 4MJ7A 2NO9A 1WCXA 3EEQA 1YJBA 1TW3A 4RHCA 4NQZA 3H5RA 1TCUA 3OP1A 5DZSA 4QC2A 1OLSB 3PI6A 3LA6A 5KB3A 1ZMOA 3A6GA 3QW2A 1SVNA 3QE2A 2M6LA 4JT2A 4DJEC 2QGFA 3NAMA 2WKRA 1KI3A 2YDYA 3AL3A 3AFHA 3BWXA 3HMQA 5JFOA 1OXSC 4X20A 2ZYUX 3Q88A 3BAFA 1AKVA 4GQAA 1C8VB 3SYKA 3V00A 4YMGA 5FNVB 2LCFA 2ZRFA 2WD8A 1E64A 1W1WA 4C7VA 4XARA 2AOTB 3R5XA 4JMLA 4MP8A 5JTUA 4LOHA 4YJDA 1IN5A 4MRPA 1F9AA 3IJPA 5BMVB 3I6ZA 4B7CA 2CN1A 4QXQA 3Q8WA 3A37A 2BGRA 4BJ3A 2GBFA 2JI9A 2BUBA 4AX4A 4IEIA 3F4KA 4UBOA 5ADWA 2MHCA 2IYUA 2RAFA 5EGNA 4HQ6A 1B6TA 3MJRA 4FGWA 1WB4A 2C4KA 1R6XA 1U9IC 2IXFA 5DBOA 1NOKA 2AG1A 2XQVA 4TSKA 4ER3A 1Y3IA 1CG6A 4Q3BA 2RGWA 2PDAA 3GMDA 5A4AA 1OBCA 1XMIA 2IOFA 3A6JA 4K1LA 1GLNA 4YJHB 2C9MA 1ID8A 5CCXA 2WU8A 1RRPA 4FYJA 2EEPA 1KO5A 4L1KA 4BX8A 4EWLA 2XYVA 1BX1A 4JUIA 3UMRA 5C5DA 2CYCA 4D80A 4I55A 4OSPA 3SZMA 3O2NA 4YAIA 3JQRA 1Y9JA 3LLUA 1ZJJA 3URMA 4Y0NA 1T5SA 2NXNA 3SQXA 4PNEA 5CNJA 2QX7A 3Q9SA 3WQBA 2P5YA 2PVSA 5BQ5A 3SLGA 3JATA 3K8OE 2V8OA 2MSEB 4HBGA 4B43A 3E3NA 2BN4A 5C5CA 3COPA 3O84A 4UNNA 5G02A 5JNWA 1JLHA 2BFDB 4PS0A 1E4VA 3W5SA 1BHO1 4HH3C 4LDJA 3LBIA 1Q5PA 3D54D 1Z6GA 1FUKA 1CCWA 3NT2A 2ETVA 1UC4B 2PZAA 4HR7A 2GNOA 3BZBA 4PRLA 5F33A 3GLFB 4X97A 1KZ6A 3BJEA 2NUPA 1TQ6A 4PAQA 1C2YA 3HABA 4C87A 1U4NA 3ORFA 4ZI7A 4REOA 5JMWA 2SKCA 4MKIA 1YAJA 4H3SA 5LU8A 3W2HA 1MW9X 3L1KA 2VTKA 1PE0A 4FTWA 4EYKA 3ONWA 1H9BA 4JY7A 5E8JA 4FQ7A 5MFPA 2ZJ7A 3B8EA 3VR2D 3AUTA 2O1EA 1W73A 1OIWA 3NHKA 2W98A 3OZDA 2FAXA 4HWPA 4O2AA 3W5UA 1IVNA 5EYPB 4ZHSA 3OC0A 2O6LA 3MWDA 3U3ZA 3HCOA 1J56A 4Q93A 4K2AA 2P62A 4ZAFA 4LMAA 1NR5A 1UFQA 3BF8A 1GU7A 3EVDA 4Z3OA 2Z6UA 3T5GA 3MPUA 4RTPA 3U4GA 4FHEA 5KCMA 2E21A 5F2OA 2QS9A 5HJ7A 1C9JA 2HPZA 2ZXEA 1MB9A 4PLHA 4AAYA 4GOOD 4A6DA 2DG2A 3GJQA 3SSNA 1U1FA 5FPHA 2IODA 3G59A 4S0XA 2CNWA 3CQ9A 1NLMA 4RA9B 5ALFA 1Z4MA 1M9NA 3F6EX 1RU3A 4GMHA 4ZOCA 1K7FB 4G1BA 2ATCA 3MK31 2VUHB 3WTBA 3RU2A 1TJ3A 1ISJA 3ZVRA 2JHGA 1JNYA 1PT6A 2VDNB 1R12A 1N5OX 2DULA 1FB5A 3L84A 3N6RA 4PR0A 1J7KA 1EFUA 2XTZA 1F3OA 3W1WA 1D4FA 5BUZA 1NUSA 1JYSA 1I2CA 3S2FA 4OI2A 2CYBA 3QW4B 3LP8A 3NDJA 3GR6A 4LFCB 2R68A 2AGVA 4I9GA 3U0BA 3ZWVA 1RQGA 2NSYA 2Q3CA 1JU3A 4P4GA 3DQPA 4L5IA 4X91A 3IUJA 4HEHA 1DCMA 1GL9B 1D4AA 1G7SA 3L8YA 1OT5A 3CLSC 3N8KA 4GP6A 1LDYA 4FDMA 2D7CA 3NIDB 5CLHA 3ZWPA 2DECA 3LPNA 4OPMA 2GZHA 1QIKA 2H0QA 3B78A 2DY1A 1QHFA 3NYQA 4D8VA 1C3OB 4X8HA 3DOHA 1N7IA 2JFWA 5EZSA 3BIWA 5JCPA 3TEFA 2ZT7A