3LWNA

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
181
structure length
181
Chain Sequence
SAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 61
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lwnA00
3ZVRA 3QENA 1IN5A 4A1FA 2QE7A 4GI7A 4IFEA 4JSTA 3HU1A 2XOKD 3GJXC 1SXJE 3K0FA 2UKDA 4MUAA 4R9UC 4A0FA 5E3HA 1NVUQ 5G53C 1UBEA 1LV7A 5FBQB 1EWQA 4KI0A 3QF4B 3GPLA 5TB5A 4C4PA 3WBKA 4MDEA 3NVAA 4PPQA 5JCPA 5G3YA 1TAGA 2JLVA 1WDTA 1Z0FA 1T5LA 1ZP6A 1NJGA 3AGPA 4QHYA 1XX6A 3AVWA 1X1RA 2J45A 3GJ4A 3AKCA 1N5JA 1Z63A 5KHOC 1VYUA 1W36D 3Q5EA 4ON9A 3EA5A 4AWXA 1YZLA 5C4GB 3CX7A 3TBKA 4B2LA 4AKHA 4LV5B 2G88A 5DH9A 4E03A 1XXHB 4AC9A 4JBWA 5E7JA 1D2NA 3QPVA 1XTIA 4E09A 3CM0A 1R5OA 521PA 2HT1A 1MO5A 1BOFA 4XH9B 2FG5A 2CJWA 5F9FA 4GMXA 4HB0A 2IYYA 2I3BA 2Q3MA 3ZH9B 2J41A 3C14C 3U6KA 5KOYA 5ANRB 2JGNA 1XNJA 1GKUB 2JDID 1WBBA 4PZYA 3U60B 2HXSA 2R6DA 2BHRA 1N6LA 1NY6A 2ZRHA 2JCSA 1G5PA 3CPEA 3X2SA 4ZKEA 4DLTA 4DZZA 4AG5A 3EX7C 1P62B 2XB2A 1TF7A 2Z43A 3B1VA 2ZS7A 1UFQA 5CIWA 3PUYA 1PV4A 3GFOA 1MR3F 3AF0A 3OIUA 1W2HA 2O8EA 1UKEA 4B74A 3L82B 2C04A 2N1BA 4PAMA 1GP2A 3B1WA 1Z0AA 3K0CC 3UG7A 5L8VA 1F48A 4B3BA 4LJ7A 2V7QA 1KOFA 3FGNA 4G01B 1IY1A 1IJFA 1FX0A 1VG0B 2JASA 5AWFC 4A4DA 5KNBA 2GA8A 1CS4C 4B3GA 2KE5A 2XZLA 4RD4A 4MGZR 3DDCA 4LI0A 2EFDB 1R5BA 4C7OB 3REGA 1S0UA 4P0TA 5EE5B 1N0VC 4LJ4A 3A6PC 3QG5A 3K8YA 1IXRC 3KTAA 4ZCLA 3QKRA 1EFRD 1PLKA 5JS8A 2XTNA 4KAXA 3KKNA 1XJCA 3OFND 4PO1A 4QL3A 4Q47A 2OE2A 2QU8A 4LJ9A 3FVQA 4JT4A 1KNXA 2BIFA 1ZD9A 2YVUA 3CNNA 4RSGA 4TL6A 1BS1A 1W7AA 4OQFA 3LX8A 4BRWA 2AHOA 1EK0A 1XTRA 1KTVA 4HDQB 2IUTA 3T1VA 3SYNA 2EQBA 1N6KA 3W9YA 1OKKD 2A5YB 4PHGA 2FOLA 4MH0R 4DKXA 1G21E 2G0TA 1P72A 5J4HA 1KIMA 1W48A 4C2UA 3P27A 4OK3A 4M4SA 2IXFA 3U2QA 3RC8A 3TW8B 1E2LA 2PZEA 4HDCA 3C15C 5GJCA 2P5TB 2JEOA 2GBLA 4HAVA 3ZD7A 1ZNWA 1GL6A 5LB2A 1RVDA 1TTTA 1Z6TA 2VYFA 4GZMA 2MMCA 1OXSC 2C9OA 2RGGA 2QM7A 4QGFA 2AKAB 2HUPA 2PZGA 3WMEA 3LBHA 2OG2A 2SHKA 3GQBA 4OI4A 1XEXA 1FZQA 3DKPA 4QG7A 1M1YE 1W4BA 1ZIOA 3U3MA 1CIPA 2X2EA 4DCUA 1KMHA 1E96A 2ODWA 2NG1A 2IA5A 3VR5A 1TU4A 1Q44A 2AKYA 5KPJA 3EPJA 4KJZA 4MKFA 2R62A 3W3ZB 3VNVA 1UPTA 1EFUA 2ZE5A 1AJEA 4TLCA 1DADA 2DR3A 2OM2A 4DLYA 1ZW6A 3DZDA 3CNLA 1QF9A 2EFEB 2IWRA 1EFTA 4Q4AB 2LKDA 1X6VA 4OK6A 4Q9HA 4O3MA 1Q12A 1KSJA 1NBMA 1OIVA 2VHUA 4LZZA 1JB1A 4CEJA 1RRFA 3ZYCA 3K09A 4N1AA 1UADA 1XZPA 3KKQA 5UKDA 4HLDA 4AG6A 4JZKA 4Z1MD 2ZM5A 4QOSA 3PUWA 1KI6A 4AKEA 3QOFA 2W0SA 1SKQA 1GZSA 4HAZA 2FSFA 3TAHA 2XNDD 1RYHA 1G41A 3CF2A 4OQNA 2LWIA 5J4VA 4FCWA 1E4YA 4GDFA 2OHFA 2OLJA 1CTQA 3WY9A 2BBSA 1CLUA 2O8EB 3ZQ6A 3ND9A 4FMDB 2ZRCA 4FI3C 4V0OA 1JXMA 1K5GA 1Q21A 2ZI3A 3QJYA 4PAOA 2P67A 5CLLA 4BEBA 5E4FA 1P2UA 3P32A 821PA 4OBEA 2J9RA 4PC6A 3PUVA 1W4RA 1FX0B 1G7SA 2ZS9A 4Z51A 1E9RA 3BH6A 2QUZA 5AUQA 3TE6A 2R6CA 2WPDD 4LOAA 3TRFA 2YWEA 4BE7B 4I1OA 3MUFA 1U0HC 3FOZA 3LW7A 2C2HA 3L2OB 2CL6X 4D0GA 1CJUC 1KDTA 3QKRB 2NTYC 4PQFA 1OHHA 3HWSA 5DSZA 3CKLA 4IJMA 1YE8A 1YR9A 4LRWA 3CW2A 4PAQA 4Q03A 3VAAA 5H8WA 5CYOA 3CZQA 4MA4A 1Q1QA 1C4OA 3PCRB 1XCMA 3UATA 1GSIA 2FFAA 4QHTA 4C0JA 3I8XA 2NOAA 2QSZA 5EE1A 2GEDA 2GETA 2LCFA 4QJ5A 4XSHA 3U7EB 2R6FA 4NMMA 1M6NA 3WP1B 2W6IA 3FKSA 2CCKA 1U94A 2QN6A 1DARA 3R9IA 3OF5A 1H8HD 1W44A 1NN1A 4URYR 1TUEA 2ATXA 1VG1A 4LWZA 5DE3A 3F5FA 1UEIA 2R6GA 3RANA 4MYHA 5JZVA 1R0YA 4B76A 2QAJA 2OFOA 4NCIA 4WAUA 1KMQA 3RS7A 1II8B 1Q1EA 3K1JA 4H9GA 3VU9A 2PH1A 2JJ1D 2BDTA 2D06A 3N2EA 3DOEA 1GKYA 1I2DA 4CT4B 1XRJA 1E2IA 3B8HA 3TK1A 1E2QA 2NMVA 2HYIC 4BFSA 5BN3A 2HV8A 1XEXB 4DT1A 2TMKA 3WNBA 4F7WA 5AJXA 5DO9A 4NCJA 1W46A 3LXXA 2F55A 4Q18A 3E70C 1KMHB 1FL9A 1FTNA 3WHKA 1GRRA 1KDPA 3G5UA 4BFWA 2FU5C 2UZIR 1D9ZA 2ORIA 2GHIA 5FBVB 3A1SA 1G1MA 3R9XA 3O8DA 4HYYA 2HLDA 3CB4A 3B85A 2CXXA 1U8AA 4RFSA 4PX9A 3GJ7A 1IQPA 5HE8A 4AYTA 1R10A 1OIWA 4NTZA 3WRXC 3Q3JB 5JFGA 3D7MA 4QC2A 4IOKA 1KAGA 2WHXA 4XIGS 2BCGY 4B3FX 1CR4A 1KI6B 5GVRA 3T12A 3WXMA 2XSZD 3C4JA 3VNUA 3NTUA 1M7HA 1R8SA 2DWQA 2QROA 2XZOA 1T6NA 2GXAA 2IYZA 1LS1A 2E1RA 4JIMA 1DAGA 1UBFA 2A5DA 1YZUA 2WAXA 2WWIA 4HAXA 4N0EA 2ZRKA 3KKOA 3OE7A 4G3XA 2FGJA 4RKFA 3T35A 2OEPA 4KLZA 5AJZA 1JECA 1Q22A 3WMGA 4EPTA 5IF9A 4C0BA 4RKEA 2PZFA 3TSOA 4BUJA 3AKYA 4ZI2A 2IUUA 5A5GA 3EIEA 4US2R 3RC3A 3H84A 1SVMA 3AB3A 3NBXX 3WBJA 4JLPA 2ZR7A 3HPQA 4G5SA 4PHFA 3BH0A 3THXA 4DSUA 4UXHA 4DLZA 4LJ6A 5HR5A 1Z0IA 2GAAA 3ZLJA 1J70A 1RPZA 2RHDA 1E94E 1DBSA 2ZSAA 4BZXA 3QUSA 1GFIA 4NHOA 2OXRA 4C0LA 4LX0A 1YKSA 1U8YA 4M1KA 1G5TA 3GJ5A 4DVGA 4M9XA 4IXMA 4R71A 2YOFA 3U3OA 1CXZA 1M34E 1T8UA 3AQ4A 5TV2A 3ZIAA 4Q9KA 1DO0A 1LS6A 1J90A 1ZM3A 2J5XA 3IDQA 2GK7A 3AV0B 4BFVA 3BB3A 4PHTA 3KJIA 2A5JA 1D5CA 3SYKA 1M8PA 2CL7X 5LBIA 2QM8A 2PL3A 2GRJA 3QIAA 1YZGA 4KFRA 3RS2A 1IONA 3RABA 2ZU0C 1RRCA 3AVYA 2IS4A 4G0NA 1Z2CA 3EASA 3HYRA 4B3XA 4TSFD 2IEYA 3VU9B 1E99A 2F43A 4CW7A 2GBLC 2OCYC 3GLGE 4ESHA 4DLWA 4EQ6A 3U4QA 4BLOA 3NIBA 2ZR0A 2A30A 4NP6A 1OE0A 2FFQA 2QZ4A 2ZRNA 4Q00A 2QA5A 3M4YA 4JLVA 4AYXA 4OHWA 4G1UC 4PO8A 3RRYA 4EFLA 1C1YA 2Z5FA 2XJ9A 3ZQJA 4DJTA 4HZUA 2CL0X 2HJVA 1OB2A 2REBA 4EPXA 4DLSA 5LD2C 3PJRA 4QBFA 5DN6D 1Q3HA 1X3SA 2BBTA 4DT1B 4IDHA 1W0JD 1GRQA 2Z4SA 3QXJA 3LVQE 4MRRA 4IEIA 4X8MA 5FOUA 1VCOA 1JR6A 2WWGA 2ORVA 1S8FA 4C0QC 1E9DA 1LW7A 1FMJA 1AS3A 4BGDA 2XITA 4A9AA 4M1MA 3A4NA 1II9A 1KO4A 2VBCA 2A3RA 3UK6A 2NZ8A 4RFSB 5GJWC 3TVTA 2E87A 2ZRGA 1GOTA 1MH1A 1ZMXA 3K70D 2AK3A 2WAYA 4HAYA 4JVSB 3GP8A 5BQ5A 3T1TA 4MRPA 1LY1A 2H8KA 2R65A 4W7SA 2ZR9A 2UZ3A 2VHCA 2FJUA 3PUXA 1KK2A 1JI0A 3BOSA 2JIZA 4O25A 3AVPA 3ONWA 4HUQB 1W2GA 1OLOA 3NKVA 2JJ2A 2PJRA 1A2BA 3CNOA 2ODEA 3L43A 1XMIA 2H17A 3CF0A 1N6HA 1G6OA 4LYAA 1DS6A 4IW3B 1E32A 2QTVB 2QG6A 2ZJ2A 3FKQA 4LCBA 1HTWA 4JBXA 1JEEA 2NPIA 1DEKA 5DIFA 1HYQA 4MKGA 2VF8A 3DOFA 4JYCA 4NONA 2WMNB 5FFMA 1TNDA 1TF2A 4PSKA 3SFVA 5JBQA 3THXB 1G4UR 2J7KA 3LWNA 2HJGA 4PC2A 4NYIR 3F8TA 4BFUA 2WJIA 1OH7A 4M8NE 4Q9LA 3CRRA 3ZVLA 1NIPA 2IL1A 3ZZTA 4TLBA 3ZDQA 5LB4A 2GXQA 2REXB 5DGXA 3A4LA 2WSSD 1UBGA 5CK4A 4RZ2A 1E9SA 3E2IA 4PSVA 4FWIB 2IYVA 3BAFA 1YVDA 4UJ3A 2AX4A 2Z83A 4ZDIA 1Q20A 1OSNA 1HY3A 3O8BA 1QHIA 1FPMA 2YWGA 3V4FA 2ZAOA 3E1SA 5SZKB 5F9HA 4UQOA 2FMXA 5AK0A 2AN9A 2GDJA 3NEYA 4DSTA 4O0MA 1ZM4A 2RH5A 4DUGD 1P61B 3FPAA 2GVZC 4P31A 2C98A 1W5SA 1FP6A 3QF4A 4M2LA 2OCBA 4YXWD 1P5ZB 2HF8A 1KJYA 3FFBA 3NC1C 3C7KA 4GFDA 3FMOB 2F43B 2ZI6A 1FP7A 4EQ6B 4IHQA 4EAQA 1XJ0A 2ANBA 4AY2A 1X8JA 2JLXA 2CEAA 4HI0E 4RCYA 1E0AA 4M9ZA 2YJTD 4K46A 1SXJA 1OYYA 3G0HA 1BIFA 5FUVA 1RFLA 1N6OA 3U5ZB 2E9SA 1U98A 4HZUB 1YR7A 2PMKA 5JHHB 4DCTA 1OT3A 1TADA 4KODA 4BASA 1XTJA 4E5UA 4DCNA 2OBMA 2QMUA 1XXHA 1VCMA 3CIOA 3B60A 2W58A 3AVXA 3QG1A 3WRYC 2ZRMA 4RD0A 1AQUA 1QG2A 1SHKA 4KV9A 3BK7A 1E1RA 2VSFA 4UNNA 4LC0A 3IHWA 4U7DA 1SVWA 1WQ1R 1ZCBA 3B1XA 4M22A 3H4MA 3EZ2A 1L4UA 4ZKDA 1F2TA 4D0NA 1KJWA 3BORA 4PHHA 3PQCA 2J0VA 2LKCA 2GJAA 2V55B 2ZRLA 3HU3A 4JSYA 5FPTA 1G8FA 2IK8A 3GLIE 1D8TA 4TMZA 1A7JA 1U0LA 4FIDA 5SZHB 4M9SA 3IIKA 3FHTA 1E79A 2N46A 4DDUA 4BFYA 2BMFA 1E2JA 4PTLA 3NH9A 3BWDD 1QVRA 3EWSA 5FPHA 2DWOA 4A82A 4CIDA 3EG5A 4LBVA 2O8DA 2XB4A 2BV3A 4C3ZA 1FUKA 2VLIA 4Q4JA 2QBYB 1XPOA 5K8IA 1B23P 5DYIA 2F9LA 3WP0A 2ONKA 1Z5ZA 2H1LA 3KFXA 2KSQA 5JI2E 1IY0A 3GLIB 5E7MA 2JLWA 4C7OA 2CK3A 4F93B 4HAWA 1BO6A 1T3LA 4MGKR 5J47A 2ZUBA 1Z08A 1S96A 4US1R 4LGMA 1JAIA 4Q4HB 1HEIA 1T91A 1SVIA 5EXSA 3GEIA 3RLFA 1BYUA 3GFTA 4KCGA 3IBYA 3NG1A 3MWLA 3NBYC 3SHWA 5H70A 5EXPA 4NCNA 3CBQA 3LY5A 2GCOA 2WJHA 3GMTA 5C1BA 4LBZA 1HE1C 1ZUIA 1JJ7A 3O47A 3QEOA 4R2IA 4V0LA 5KO2A 4OI0A 1NVVQ 3CF6R 4PZLA 621PA 4DLVA 2ZPTX 4EIWA 5BYKA 5JECA 2IYUA 3AVVA 3RRNA 1QHSA 1JAHA 1G18A 4F91B 2BKUA 3EZFA 5EUQB 3TSZA 4CT5A 1W49A 1ZJ6A 1TEXA 4GP7A 4Q1BA 4XD7D 4Q5IA 4LDJA 5H1YA 5M04A 2BC9A 3TR5A 3K70B 4IDNA 4HB2A 4DSOA 2AWNA 4UNRA 1U9IC 5JJKA 5C46F 1ESMA 1KAOA 2R8RA 3HU2A 1EESA 3VX3A 1P7CA 1TL7C 4D4KA 4D4MA 1KZ7B 4XWAA 1AS0A 1SXJB 2PCLA 1YZQA 2GZAA 2B7BA 2ZYTX 2C96A 1SVKA 2HXYA 4LUCA 1L7VC 4HB3A 2F9MA 3ECCA 2NZJA 1NI3A 3SC3A 3QF7A 4BLRA 3TW4A 2BWJA 4B75A 1TU3A 1MO6A 2GCPA 5SZIA 5A4JA 1HH4A 2VP2A 1ZRHA 4IVQA 4DDTA 4E22A 3AKEA 3OIYA 5EXXA 4OQMA 4UNSA 5SZJA 4NZYA 1VG8A 2FFHA 1COWA 3QVVA 4P4TA 4FMDF 4QHSA 4Q4AA 1IHUA 2PX0A 2W6JA 2NO9A 1G6HA 4DXAA 3FTQA 1GG2A 4JLJA 2Q9AA 5AJYA 3KFVA 5AR1A 1F2TB 2EFGA 5FL7D 4PQYA 2DY1A 1NKTA 1ZCAA 3SHFA 4LV8B 1D9XA 1S1MA 1OXXK 3ZGXA 2PMDA 1GVNB 2XXAB 5CDFE 1XEWY 5HCNA 2XX3A 3BD9A 4URXR 1NRJB 1ZU4A 2P0EA 2VHTA 4NBSA 1EFCA 1HA3A 4POAA 1IY2A 2ZROA 1XMSA 2REOA 4Q48A 1KI9A 2YV5A 4PXAA 2ZVPX 1P2TA 1OYWA 4NCHA 1LNZA 2XOKA 5KYKA 2XEXA 4DLRA 2B7CA 3AVQA 4B6EA 2O8DB 4MYTA 2R44A 3J81k 1E2KA 3UWOA 4Q4JB 1R5NA 3ICQB 3BGWA 2RGDA 4QXAA 1HUQA 3FFAA 1YRAA 4PPGA 2EYQA 2ZSEA 4ACAA 5B2ZA 2ZTSA 5TARA 1RRPA 4D82A 3I61A 3GFPA 2QRNA 2D4HA 4B35A 2A5FA 2GJ8A 3DL0A 3GCGA 3OAAD 3MMPA 5KDDA 1E9EA 5FR1A 2GZDA 2AFIE 4GPTA 4BFTA 1F60A 3KQUA 2JJ8A 3GJ8A 4P4UA 4RZUA 1GNQA 4MRSA 1T4GA 2ZYUX 4LHWA 4LJ5A 2OUKA 2A7QA 3EARA 2GCOB 5CB8A 1GL9B 2WJVA 3PR1A 1P9WA 4R7ZA 4EUNA 4TYNA 1OH6A 4MDFA 1D2MA 2O8BA 1BH2A 4CDGA 4CEHB 3NBZC 3DPUA 2PJZA 2ZANA 3LA6A 4TN1A 5DI9A 1AIPA 5ELXA 3AUYA 3FMIA 1LB1B 4XVRA 3MG9A 4JL5A 4XVQA 1II8A 4RD1A 3VKHA 2NO7A 1T3HA 2JDIA 4MYUA 1J8YF 3BH7A 1NLFA 2QI9C 3AUXA 5TXGA 4BECA 3C5CA 3Q72A 4A6PA 3U7GA 1NP6A 3PEVA 3RS3A 2CHGA 2ZEJA 5P21A 1OW3B 4TL7A 1YZKA 1XCPA 1XD9A 4BRUA 4TZ6A 2IYTA 4XSGA 3SDZA 3ADDA 3B5JA 4LPSA 4B3DA 4DIEA 4LHYA 4A36A 2YC2C 2FH5B 1MO4A 3GJ0A 4LBWA 1K5DA 3V4RA 2ZUDA 2VA8A 5FBRB 2ZI7A 4TMWA 2HDNB 4Q19A 4A2WA 3EC2A 2YWFA 1UKVY 4XWKA 2D7CA 5EE9A 1XWIA 4EPWA 5BN4A 1QDEA 3D3QA 4P4SB 1VECA 1ZUNB 4HLQB 4Q7JB 3PXGA 2GK6A 4ITRC 3TVDA 4FN5A 4V03A 3ETLA 5IK2D 4UXIA 3X1DA 4ZCMA 1JR3D 3A58B 4WVFA 2KJQA 2VP4A 2VQSA 2GEVA 3A37A 4PPNA 4QFMA 2WICA 3B7GA 2BOVA 3KXKA 2J0QA 2HCJB 2OILA 2L0XA 4UNPA 2P3SA 1EFRA 4QGAA 4RD2A 3ICEA 3OFNA 1WA5A 3KDSE 4G5RA 2AD1A 1W0KD 2JLUA 1MT0A 1R6BX 4OJKA 3OESA 4L16A 3QXHA 4B33A 4DIDA 1J2JA 4HAUA 2RGXA 4A92A 2J0UB 1YQTA 4MQBA 2BEJA 3UWKA 1WRBA 421PA 1M7BA 3KUDA 1YR6A 1U0JA 3BERA 3MJHA 4KFSA 1DAIA 2XTZA 5DLQC 2EYUA 4B48A 3GLFE 1OKKA 5E7IA 5FUXA 4JJKA 3EW9A 4A2PA 1DOAA 1R4AA 5AUOB 3AH8A 4QGGA 3RDPA 1R2QA 5AUNB 1SQ5A 3GD7A 1Z0DA 4MGYR 2ZYVX 2JLQA 3FE2A 3BJIC 5JSZB 2IHYA 4Q1DA 4Q1FA 2YNMA 4A0GA 3LW8A 2JATA 3W6NA 1NSFA 2ODNA 1YR8A 2Q0HA 5D3QA 3Q85A 2ZS8A 1E3MA 3L0IB 4NL4H 4Y0AA 1QZXA 3UG6A 2JLRA 2J7PD 1US8A 1NMXA 4ZV4A 1KKMA 4KBFA 5CJ2A 2ZSDA 2G77B 3CPHA 4TL9A 1W36B 3C41J 4DLUA 2GKSA 4V0ME 2NO6A 1T3SA 2ZXUA 1MO3A 3NDBB 1WE2A 3LD9A 1DAMA 1QHYA 3BFXA 1KSGA 5EJEA 2QT1A 4MITA 4G5OA 4L8GA 2G3YA 2DB3A 2O8BB 3T1OA 1GIAA 3GEHA 4TMKA 3CX6A 2YWHA 5JWOA 1TQDA 4U5XA 1N5LA 4GZLA 4MRNA 5FOSA 2WWXA 1G8PA 1KO1A 4EJSA 4JT2A 2D2EA 4TYPA 1N25A 1CKEA 3R20A 3LX5A 2ERYA 4DB4A 1F3OA 2EWWA 2OBLA 2HEIA 1ZBDA 4Z1MA 2FEOA 5K8LA 4XWOA 1GTVA 3I1FA 1MOZA 4IKEA 4PSAA 3TNFA 1UEJA 5GJBA 2WJYA 1YHNA 1PLJA 4RD6A 1G8GA 4ABYA 1CBUA 2ZI5A 2XNDA 2ZETA 1OF1A 3C8UA 4N3NA 1R0XA 2KB0A 2QQ0A 721PA 1RZ3A 3K0EA 1S9HA 3WMFA 4B43A 2ONJA 1NIJA 2OAQ1 3VR3A 3VKGA 2QPTA 1U99A 2VL7A 3SN6A 3BE4A 3JVVA 3GLGA 1AGPA 2GZHA 4OL0A 2ECKA 2IYRA 3B2EA 3OEED 2C03A 3KZ1E 1E9CA 2C95A 3R8CA 1I4TD 3CO5A 1E0SA 2CMKA 2WPDA 1RJ9A 3SYLA 3VX4A 3AP1A 1AKEA 3PITA 4WZ6A 2J1LA 5AJVB 3X1YA 2QMOA 5E95A 4PR0A 4TT3D 1KSHA 2ZSBA 1KK3A 1E2EA 5CJPA 1V43A 1XD8A 2H7VA 3F0TA 4E07A 3ZZ0A 3EPLA 2VH5R 2YZ2A 1PLLA 2P6RA 4HUQA 1M2OB 4KLNA 1FQJA 1DG3A 1E9BA 4Q7KA 5FOWA 4AI6A 3KJGA 1EX7A 3CWQA 2RMKA 3R7WA 3AVOA 1FFHA 3UMSA 3QXSA 2EFCB 1DELA 2ZAMA 5EP3A 3TQFA 2MSDB 2KBEA 2O5VA 1H8HA 3N70A 4LHXA 4B44A 3AVUA 3IIJA 3NC0C 3Q5DA 3O8RA 3HDTA 4JLOA 1Z3IX 1AK2A 1YRBA 2CLDX 3A1TA 5CM9C 3QKTA 1Q1BA 3T34A 3U7FB 4EFNA 3RSOA 1IXZA 1PZNA 2BJWA 3U7HB 1N6PA 2QL6A 2BCJQ 1AZTA 3BC1A 2PLFA 2JJ1A 2BM1A 2WTUA 5HZHA 2CCJA 3ZS8A 4LJAA 1G5RA 3A1WA 1KI7A 2VPPA 4L9SA 2OZEA 1TUIA 1JR3E 5FUYA 4LY6A 1O3YA 1VMAA 1KNQA 1PVOA 2JLSA 2DCUA 1ZAKA 1US8B 4URZR 4PPFA 3D31A 2OT3B 5FBLB 2B6HA 3MCAA 1K8RA 1YU9A 1OFIA 3ND8A 3B9PA 3LLMA 4WOPA 4RFVA 2QORA 3FWYA 1QHNA 2ZRDA 1ONBA 1XBTA 1IN6A 3MRSA 1OXUA 1HURA 4F92B 5CB6A 1DG1G 1R0ZA 2QAGA 3IILA 4CZ2A 1NLYA 4D81A 4QJ3A 1W5TA 1ZC3A 2RGNA 2ZRAA 4N0DA 1IN7A 3MD0A 4W5HA 4A8JA 4EJSB 1NN0A 1L8QA 3VR1A 1IAQA 4YMSA 1XZQA 5F2EA 2VSOA 1SKYE 3F3YA 2ERXA 2OV2A 3A36A 3REFA 1YZTA 2JLYA 3EXAA 4KVAA 4TYWA 2QGZA 2XSZA 3VR4A 2Z6VA 1XTQA 4OHZA 3WHLA 4FCVA 4BLQA 2Q9BA 1KJZA 4LHVA 3OIWA 2IF0A 3LXRA 1ODFA 2VP5A 2YYZA 3TUZC 2J87A 2Y8EA 1EXMA 4IDQA 4C0SA 1DVRA 1FQKA 5EE0A 3RAPR 3I92A 2J59A 1XFAA 3V9PA 3DM9B 5FPYA 3GLGB 3PFIA 1RIFA 4M1WA 1RYFA 1RKBA 2J0SA 5KPDA 2PEZA 2Q3FA 2FEMA 2QSYA 5CYPA 3LNCA 4ASUD 3WYAA 1RJ9B 4V0KA 1N6NA 2BMEA 2PCJA 2PLRA 2WWHA 3MSXA 4JL6A 3K09C 4TLAA 1D6JA 3SFZA 5HZKA 2OAP1 4EKDA 3FB4A 3T5GA 3QI2A 1XB2A 2NGRA 3C5HA 4ZPXA 5AUPB 1JPJA 5FTLA 1KSFX 4OI2A 2FZ4A 1OB5A 1CJTC 5L3SA 1RRGA 3EA0A 1HT2E 4HZIA 3IQWA 5FOXA 3R7WB 2G0NA 2DPXA 3P1JA 3P4XA 5IHPA 2I4IA 2QY9A 5KTYA 4ERNA 2D74A 5TY0A 4D4LA 2VF7A 4LYFA 3GLHE 1S1CA 5DNYB 1WF3A 3TJZA 2DFLA 1DTSA 1E0KA 2BEKA 2QBYA 3KQLA 4BFXA 2R9VA 4RZXA 4NYMQ 1NG9A 3OEHD 1E1QD 3IO5A 4OKSA 3IGFA 3GLIA 1QRAA 1CR2A 1CULC 1SGWA 5JHGB 5EUMA 4PQRA 3EAQA 4TSFA 3THYB 4IDOA 4I1VA 1SVOA 1P3JA 1WP9A 1MABA 4Q4HA 5FPKA 4CGZA 4P3YA 1U2RA 3QEJA 1OJLA 2AFHE 2O8FA 2B92A 4C0HA 2GNOA 2WVJA 2IWHA 3TLXA 1NG1A 5DN6A 2ZVQX 2V9PA 1W0JA 2VHQA 4CEIB 3VQTA 5IDVA 4QNRA 2K5UA 2ZJ8A 3EIQA 1MRSA 4UJ5A 4LC1A 2GXUA 2J3EA 4B3CA 3RRMA 5JRJA 1HE8B 1G3IA 5D3MA 1KY3A 3EIHA 3QNUA 4Y0VA 1VIYA 2F6RA 2PX3A 1SULA 3HPRA 4CRWB 2QAGB 4TYQA 5CK5A 4F4CA 1MRNA 2IYLD 3ZVNA 5FUWA 1P2VA 4DC9A 4DCSA 2BMJA 3RWOA 4A8JB 3CH5A 4IVRA 2IW3A 3U6BA 2AD5A 4FCTA 4XVUA 2D7DA 1LF0A 1JPNA 2MSCB 2ZJ5A 4IXNA 2IT1A 1KY2A 2X1VA 5DI3A 2CNWD 2QNRA 3EZ9A 1KI8A 2A78A 2D2FA 2IXEA 3W6PA 4OQLA 4JL8A 5EE3A 2FA9A 4EDHA 1H8ED 5CM8B 5BXQC 1II0A 2KI5A 4RZ3A 1AQYA 4FINA 4NE2A 2QEQA 4HUTA 5HKKD 2G6BA 3B1YA 1AS2A 1ESNA 2OFWA 2X19A 4PZZA 4V02A 1XPRA 2H16A 1XEWX 4LV6A 3RVBA 4TLDA 4G5QA 4DB2A 1E2HA 1XP8A 5GJVC 4QNMA 2B21A 4GOKA 1UF9A 3CONA 1BMFD 5JEDA 4NYIQ 5HPYB 2FPKA 4JLKA 5DYGA 3U3JA 1TX4B 5JS7A 2YKGA 2ZJOA 3X1XA 2HT6A 1NVWQ 3QPWA 5AJWA 4RCZA 3IIMA 2V6IA 1XPUA 2XXAA 2IXGA 2WSSA 2QE7D 4Q9JA 1ZINA 3SQWA 1Q1ZA 3BB1A 2GTPA 4X8OA 2OO7A 3N2IA 2G83A 1TQ2A 5L3SB 1NVVR 3U3KA 6Q21A 2FSHA 1G3RA 1DAFA 1XU4A 1JQLB 3L0OA 2EU8A 4BEJA 5B30A 4AKIA 2F7SA 2FX3A 3QPUA 4JS0A 5IT5A 5DHAA 5DHFA 1DE0A 2I1QA 4LPKA 1KK1A 3T5DA 2IYQA 4M0LA 1FNMA 2RHMA 1IXSB 2QP3A 2RAPA 1E98A 1A2KC 1VKJA 5G40A 4P33A 1LVGA 4B47A 4BLPA 4KSBA 3TUJC 2MSEB 4FMBB 4R98A 3RWMB 4DUGA 5CDFA 1AN0A 4JBYA 1Z6AA 4TQ9A 4YXWA 1JBKA 4EPVA 2A2ZA 4EPYA 1HT1E 3VR6A 3VMFA 3R9WA 3W5JA 2FFBA 3QBTA 3GJ3A 3T15A 2Q21A 4WIAA 3W5IA 1MABB 4DWJA 2ZRFA 4ZIRB 1HQYE 1T8TA 1FW6A 3JVUA 2AWOA 1Z0JA 2Q3HA 1QHXA 1JALA 1FTSA 4IRUB 3SJBA 3CWZA 1ZU5A 4TLEA 2RGBA 2GCNA 3UKDA 2O8FB 1LF5A 5BWMA 4YMUA 1Z8FA 4S2EA 5B64A 1TPZA 3K9HA 3VHLB 1OFUX 3RRZA 4WZAE 3LH5A 2R6AA 1F2UA 4CEHA 2N42A 4CVNA 5FTKA 4D80A 2IC5A 3LBNA 5BN5A 5D3MB 3HYTA 1NLZA 1V5WA 3CPJB 4S35A 4B34A 4BWYA 1QHGA 1PUIA 2WBLC 3AP2A 1A1VA 2VP6A 4HATA 3THWB 1A82A 4YMVA 2VHJA 2PT7A 4LHZA 1KK0A 4BFZA 3SQXA 4KYIB 2CLCX 2X8AA 4BPBA 4L9WA 3NHBA 4YMTA 1IOZA 1FMLA 1J99A 3HR7A 2ZI4A 1R8QA 5DI3B 2GILA 1VYTA 4J0QA 4NU0A 4UKDA 2NQ2C 4FXPA 2V7QD 4QM6A 4NYJQ 3I73A 2JA1A 1JJVA 1K6MA 1KHTA 4A15A 3AF1A 4PC1A 5HE9A 1R7RA 5B57C 5JI3E 1XXHE 1FUUA 1S2MA 2ZIAA 4P4SA 1E2NA 3TH5A 5KSZA 5G41A 2QTHA 1XF9A 4W9MC 1UKZA 1E2GA 4GMDA 3BFKA 1F6BA 2CDNA 3NHAA 4HLUA 4GSYA 4QBIA 3I72A 4RD3A 2O8CA 3LBIA 4JVLA 5JEEA 2ZUCA 4MRVA 4QJ4A 2W83A 4R2HA 3TMKA 3FHCB 4NH0A 2B8TA 2BMDA 1G20E 1G7TA 4GOXA 5DISB 2CE2X 3VR2A 2QTFA 3ASYA 4MKIA 4YC7A 4KITB 3KQHA 4I99A 5FTJA 4PANA 4PC7A 3PENA 3PEYA 2P6UA 3KXIA 2V54A 4OYHA 221PA 3OIVA 1XMVA 2VRWA 2VTKA 1OFHA 4M1YA 5KSOA 1NKSA 4AIIA 1VCIA 3RSLA 1P9NA 4XTCS 2J0UA 2WKQA 4RVCA 1XD2A 1T5IA 3PEWA 2XGJA 2P5SA 3FHOA 3OZXA 4FMCB 1SVLA 1XTSA 3M0EA 4OK5A 3ASZA 2ZJAA 3TKLA 2D62A 1A4RA 4KYUA 3ADBA 2IS6A 1CR1A 4ZDKA 1KI4A 1GWNA 2JLZA 1W1WA 4DBLC 4RY2A 3PV0A 1I2MA 1QG4A 1QVAA 1N0UA 4Q21A 1NN3A 1WCV1 1EFHA 4FD2A 4YDHB 3QBVA 4DDVA 2Z0MA 2QP4A 4GP6A 4XD7A 2ZSFA 3K9GA 4H1VA 1P60A 1N0WA 1Y3AA 4TWZA 3CRQA 5JSZA 4QRHA 1SZPA 1E4VA 4M9QA 4DEXA 4QKQA 3IPXA 4KO8A 1QBKC 4X8HA 5L3RA 2ZRJA 3PVSA 1NL3A 3GLFA 3LO5A 3QE0A 3NXSA 3O8CA 3U44A 4M1OA 2C9YA 2OFXA 2RCNA 4HSEA 4KU4A 2WKPA 2CBZA 2BKEA 2GF0A 2IX3A 3B9QA 1G7CA 4TYYA 4LYHA 4ZDWA 1NBMD 4D6PA 2H57A 3KX2A 1QHHA 4XOIA 4DRZA 3JZMA 3N5CA 1IN8A 2BJVA 1F2UB 2XZPA 4F38A 1OXVA 3B13B 5J4YA 3LLUA 1S3GA 2G9NA 2VEDA 2RB4A 5HCIA 4WW0A 3QKUA 3BBPA 5EXTA 4B32A 4JLMA 1GKIA 3Q9LA 2FGKA 5EP1A 2ZRIA 3K70C 5FL7A 4AYWA 4D25A 1T9HA 4KXFB 4V0MA 1I4LD 5C4MA 3CRMA 2FSGA 121PA 3W6OA 2P65A 4OHYA 4LK2A 4DHEA 4ARZB 2CHQA 4L4UA 1N5KA 3I5YA 2W0MA 3EPHA 1IJEA 3D8BA 4OHVA 3BFVA 1IM2A 3RHFA 5KUTA 1SXJC 3K0FB 3D6TB 2WWYA 1ZC4A 4JVNA 2EWVA 4KFUA 1NVXQ 4V0NA 3CUEF 5LPNA 4Q1CA 3SOPA 1LTQA 1VTKA 2AR7A 1BKDR 5J4LA 3I62A 1OH5A 2FNAA 2ZYWX 3I8SA 2GJKA 3C16C 3SJAA 2O0JA 1ZD1A 4G5GA 3ADCA 3CH4B 3TQCA 1ZIPA 1OHHD 4Q1AA 1FOEB 3U3RA 3K53A 2O8CB 3MFYA 1EX6A 3A1UA 5CIQA 4O2RA 5KDOA 2IEZA 3PIRA 3HJNA 2ZQ5A 1VG9B 3VHXA 4I1UA 3DO6A 3OAAA 2KBFA 2W6ID 3FKSD 5KDLA 1Z6GA 1CRQA 3CR8A 1U81A 3TGPA 3SJZA 4URVR 4IEEA 3SI7A 3R8FA 5LDDC 2P6NA 2CJWB 2ATVA 5EZ5A 4GNKA 1KYIA 1XD2B 2I1VB 1E69A 3KKMA 2AL7A 1CJMA 2A9KA 2OSBA 4ILEA 2J46A 1GILA 3VKWA 1WXQA 3H2YA 1ZNZA 2IS2A 5JLJA 1OV4A 3IEVA 3MJRA 2B8WA 4TL8A 2WM9B 4UNQA 2BM0A 2Q6TA 3P20A 1CP2A 2IBMA 4Q66C 1WB9A 3IBGA 4I81A 1P75A 2VIIA 4H1UA 1G3MA 4WA7A 1I4DD 3AVTA 2VSXA 3GLFB 2F1HA 1N5IA 3W8NA 2GJSA 3AP3A 4CYMA 3U44B 3KJEA 4W5WA 1E2DA 3W3AA 2NPFA 1GNRA 3QXXA 1HQCA 5FI0B 3KKPA 1MKYA 2YHSA 2ZJYA 5FOTA 4TTQA 2GF9A 2HLDD 1JNYA 4ZIRA 1RC8A 1KGDA 1Z0KA 3MWYW 3I3SR 2VP9A 2G1JA 1ANKA 1QHHB 4O2LA 3TIFA 1VHTA 3KTAB 1KI2A 5IK2A 1JR3A 5TMPA 3FMPB 2XNSA 1E9AA 2ORWA 1GDDA 2O52A 1SHZA 4JVMA 4AD8A 1NNEA 4C30A 1N2CE 3G82C 1P4SA 1KZGB 1N6RA 2WIAA 2IUSA 4PO9A 3OE7D 1S9DA 5JWHA 1W0KA 1G64A 2DBYA 3SZRA 4WXPA 4PC3A 3NWJA 2ODBA 4Z8YA 2DWPA 2WOJA 2IYSA 3GEEA 3B6EA 1GRNA 2H92A 4URUR 1G16A 2WKRA 3MLEA 3X1WA 1GUAA 3TAUA 1Q3TA 1UDWA 1CR0A 5JJIA 2QMHA 1XMJA 4I4LA 3U61B 1Z83A 5JRZA 2QP9X 3L0PA 4TMVA 4HLUC 1G17A 1HV8A 1T0HB 3KJHA 4ZCIA 2OXCA 1NBME 5CITA 2ZE6A 2ZE8A 4GL2A 1OH8A 2ZU6A 4B2IA 3ZIAD 1A5TA 1TQ6A 2F3TA 1X86B 1OXTA 4ZO4A 5GVSA 5LD2B 1AA9A 1NSTA 4JLNA 1FNNA 2YOHA 3UANA 2J7PA 5G3ZA 3SEAA 5KNCA 3NDPA 2FWRA 4JMPA 3RYTC 3UXMA 2BBWA 4Q9IA 5FL3A 4C0AC 1RW4A 1N6IA 4K81B 2X77A 2GESA 3EWAA 4BLSA 2QPOA 2DFNA 5H68A 4D2IA 1O87A 2XAUA 4U02A 3EZ6A 3X1ZA 3ADKA 2CLSA 2UVQA 4JLBA 3BXZA 4JLDA 4ESVA 2V3CC 2V1UA 5TDHA 2NIPA 3DMNA 2NO1A 1Z47A 1X8LA 1M7GA 1NMZA 3M1IA 4NDZA 3V00A 5K8TA 4CEJB 4TZ0A 3CZPA 3W90A 2A5GA 4B2PA 1G7RA 4Q02A 3KQKA 1W4AA 4TMXA 5FTNA 1AZSC 3SBEA 1DAKA 1NN5A 1G291 3B82A 1P73A 2XTMA 3LQRA 2WZQA 1KDRA 4Q7MB 3THYA 4IVPA 1NF3A 2RGAA 2O0KA 2IS1A 1E2PA 4JKYA 1VIAA 2FV8A 3ZZUA 3ZVMA 1P9RA 3QXCA 5C2JB 5C18A 5J4KA 3DZ8A 2FSIA 2HCBA 3A4MA 2QMEA 3GLHA 3L0SA 2AK2A 4IOJA 4KFTA 3LAWA 4XJXA 1W36C 4M1TA 1C9KA 1UDXA 4MYCA 1DAHA 1E0JA 3LDAA 2C5LA 4K8OA 4PFSA 4QBGB 2W2VA 4CEIA 1VDZA 1XCGB 4HDOB 5L3VA 4IDPA 4DLXA 3DKVA 3M6AA 1Z6YA 2CCGA 2ZJBA 2FZLA 1ZYUA 1X1SA 3A1VA 1UBCA 4JJZA 2GWHA 4KVGA 2XJ4A 3EZ7A 3OEEA 4Q1EA 2GXSA 1XTKA 4LYJA 1VYVA 4LSGA 3LRPA 5BYJA 3HP1A 3IPYA 2RGCA 3QKSA 1KO7A 1DAEA 3KB1A 2JIZD 2JJ2D 1KI1A 3SBDA 1CU1A 1G8YA 3GJ6A 3LVRE 4TT3A 5EZ6B 3PEUA 5L3QA 3MWKA 5GADl 5B58C 4LJYA 2WJGA 3DHWC 3IO3A 4NCKA 2ZI9A 1KI3A 4C2TA 3BB4A 4UXJA 4KBGA 3EC1A 5KU1A 2OCAA 2HYDA 1G19A 1GITA 1KO8A 4YDSA 1Z28A 3IEUA 2HF9A 1T0JB 1LFDB 1UJ2A 4Q4LA 3SE0A 2NO0A 4F4JA 5FBWB 1KDOA 4NYMR 1UAAA 3Q7QA 2ASEA 4DEYA 1TEVA 1G8HA 2ANCA 3UMRA 1AGRA 2CVHA 4AK9A 3DVLA 5BW8A 1ZNXA 4D26A 1SKYB 8OHMA 1P6XA 4B71A 1NY5A 1U9IA 1Z29A 3TSWA 3RS0A 1TQ4A 4JLAA 3A8TA 1SVSA 3P26A 2CVFA 1NMYA 4X8LA 4MGIR 1CJVC 1W4CA 2WSMA 2QRZA 4TQAA 2BVNA 4AURA 2AXNA 3KXLA 4BQSA 2CHVA 2C8VA 1CEEA 2VO1A 4U00A 1AKYA 1Z2AA 2IHBA 1CJKC 3S1AA 4AKGA 2V6JA 4Z54A 2F1IA 3NEJA 4DDWA 3QSYA 2KWIA 3T61A 3H1TA 3UIEA 1ZM7A 2V4ZA 3PG5A 1U90A 2WOOA 2JAQA 2WWWA 4OI1A 5JJLA 4KSCA 4QBHA 5FI1B 3IKJA 3WYFA 2V8OA 2G1KA 4FWTA 2ZRBA 4ZDJA 5EP2A 2C99A 4OHXA 4B73A 2WV9A 3H86A 5F3WB 3AF3A 2DYKA 2GVDC 2X2FA 5F98A 1IN4A 1Z07A 3LV8A 1SXJD 3WNCA 3MWJA 4WZBE 3JZAA 3TR0A 2OESA 4OJQA 4HLCA 2D3WA 4M21A 1R0WA 4YLGA 1BYIA 4QM7A 1YZNA 2WJJA 4JKIA 5FH9A 2F3RA 4CF7A 1GNPA 3K0CA 2OBNA 2W2TA 4ACBA 3Q7PA 1W47A 3KUCA 5HTKA 3EPKA 3GLHB 3ZD6A 4F4IA 1E1RD 1U8ZA 5J40A 1XEFA 2IYWA 2QT0A 4GBMA 2P2LA 1TF5A 3PUZA 4LJ8A 1RE0A 4BZPA 1P2SA 4II7A 2FF7A 2C78A 3CR7A 1KO5A 2PT5A 3NBFA 3TUIC 1CRPA 5JCZA 4WXRA 3I32A 3QY0A 3K0AA 3AF2A 4FW9A 1ETUA 1X8KA 4NKRA 3THOA 3BRWD 2YINC 3I5XA 1IBRA 1GM5A 3AEZA 5CLQA 4ASUA 3MAAC 1J7KA 1UKYA 2ZREA 3QKSB 4WBSA 4EJSC 3SS8A 3THWA 2OLKA 4JYBA 4L5BA 3K0SA 1ZVQA 1L2TA 1E79D 2VP0A 1F5NA 2ZRPA 2ZITA 3BS4A 4IOLA 4YONB 5J5CA 5L3QB 1WBDA 2H18A 1JXOA 4IFBA 4MUBA 1UM8A 1NJFA 2RKOA 3CRW1 4Q7LA 5FTMA 4DSNA 4YQFA 1WMSA 4KHZA 4Z8XA 1E9FA 4YMWA 2DHRA 2QPAA 2W2XA 1ZM9A 4A6XA 5FOVA 3H0KA 4C9BA 3L8YA 4A0HA 4D4JA 4EPRA 3CRVA 4US0R 2QENA 3RS5A 4M1SA 5K8UA 2O0HA 4TQUS 5FPSA 2GEUA 2PEYA 3UMFA 5IRCD 3UPUA 1G4AE 1N3BA 3W8RA 3VFDA 1B0UA 5TVKA 3BIFA 2CK3D 4BLTA 4M53A 3AM1A 3MGCA 3U4QB 1G9XA 3OEHA 3AF4A 4FMCF 1E1QA 2GAOA 5FR2A 1Z06A 1S4QA 5A0FA 5EQTA 2F1RA 1G3UA 3T1QA 2GJ9A 1J8MF 1DPFA 4GT1A 5EP4A 4D0LB 3DMDA 1H65A 4XTRA 3SU8A 2DFKB 3SR0A 2YOGA 4TTRA 4BZQA 1EWRA 4URWR 2ZE7A 2BBOA 2IF2A 3HR8A 3S1AB 3SJCA 3QVUA 2R2AA 1D2EA 3DM5A 2WIBA 1VCNA 4NPHA 4LBYA 4MKHA 1AM4D 1OIXA 3DEFA 1VHLA 2PBRA 5KSYA 1Y63A 1EGAA 3ZJYA 1E2FA 1Q0UA 3VTKA 3RS4A 1L4YA 3IQXA 3NH6A 2W00A 1G3QA 3B1ZA 2FN4A 1S3SA 2C9CA 3CLVA 1ELOA 1JQJC 2RGEA 4TMTA 2EVWX 1YJ5A 4C0KA 1CF4A 3L8ZA 1ZD8A 4GOJA 3SNHA 1GAJA 4GRAA 3ZS9A 1Z6XA 3B78A 4TTPA 2F1JA 1EG7A 1ZNYA 1KKLA 4HB4A 4A0RA 2H5EA 2FPMA 3IHLA 4HEJA 4NYJR 1XDBA 2WWFA 4OQXA 2CNWA 4P32A 3FMFA 4EFMA 3E5HA 4QGHA 3T06B 2C77A 3AKDA 5JWRA 2ZJZA 2MMGA 1OFTA 1H8EA 2CE7A 2QGNA 1PJRA 2FDCA 2V1XA 1JEDA 2OCPA 1E6CA 1MV5A 3LQQA 5HKKA 1GL7A 3K9LA 2DFTA 1COWD 3QQ5A 4IOMA 2WMOB 4B6FA 2AXPA 3WYGA 2Q9CA 2W6JD 3KQNA 1PUJA 3P4YA 3KL4A 2YC4C 5KNDA 3CX8A 1OPXA 2IYXA 3LFUA 3Q8XB 3K0AB 4L15A 2Z4RA 3K9NA 5KSPA 3RNLA 2QAGC 2EFHB 1E2MA 2QQEA 1BMFA 1TMKA 1ZM2A 1ZUHA 4RJLA 1M74A 1Z22A 4Q01A 2RGNC 3WNDA 4W5JA 4A8JC 4ZI3A 4A2QA 2FPLA 4DCVA 3FDIA 1VPLA 1Q57A 2FE4A 3IUYA 1DO2A 3I4LA 3W34A 1XJQA 3AGQA 3FYHA 5JMTA 4I1SA 2EW1A 4ARZA 3OHMA 3KB2A
chains in the Genus database with same CATH superfamily
3ZVRA 3LF1A 4A1FA 3OQOA 2V7WA 4GI7A 4HF7A 1LDYA 2NYUA 2WA2A 1J49A 3AR8A 4P7FA 3C85A 2OV4A 1NE7A 1NVUQ 4ZZ2A 2UVDA 1JJBA 1UAYA 3B6MA 1FPQA 1MU0A 4BV3A 2LVBA 5FBQB 1ZH0A 1EWQA 2CFTA 3F46A 3W9BA 8AT1A 5LYJF 1GUDA 1NJ1A 3QF4B 3NTQA 3IT2A 4FYYA 3OD5A 3M82A 3MQ4A 4IRMA 4MDEA 2HK8A 5G3YA 2JFUA 3ISJA 3CCFA 4TVOA 2NU8B 1WDTA 1T5LA 3FAKA 2VNJA 1NJGA 4NJOA 4RL6A 1J8DA 1MAWA 1PHPA 2ZAYA 4YGYA 1VSUA 3W5UA 3GJ4A 1EB8A 5HG0A 1VE6A 2BFEB 1N5JA 1LCIA 5LZ8A 3X0DA 4DR6B 1XRRA 2QV0A 3Q5EA 3S40A 4IH4A 3JQCA 1IBSA 4ON9A 4J0GA 4H1WA 3CWCA 1ML4A 3TBKA 2QD5A 4B2LA 1NXQA 1FSFA 5I9BA 3AM5A 5EVJA 5LYJA 3TIGA 3UUWA 4E03A 5ALPA 1XTIA 1RXSA 2GPAA 4MYSA 3A6GA 2H5LA 1C3JA 3QVWA 5ALOA 1FLVA 1DAPA 3BWMA 4ZALA 4CR6A 3K1YA 4HDKA 3P5BA 4X93A 5F9FA 1JHMA 1G8KA 3TS1A 3V1KA 1VLLA 5IP5A 3PFHA 5ICSA 4QFBA 3E9MA 1ORWA 1KP2A 4N65A 4QIHA 2J41A 5EOVA 2G5PA 4I4IA 4EG3A 5KOYA 2XUFA 1U5AA 1JXQA 2JGNA 2JDID 1GKUB 3D43A 5ANRB 5LNK1 2QVYX 3F1LA 4Q15A 5I9SA 4AQDA 1OC4A 4RMGA 1WBBA 1I5RA 2HXSA 3JQ7B 1IYZA 4HYQA 1N6LA 4O4IF 1AQIA 1HFWA 3X2SA 2ZTLA 3GP3A 4ZKEA 4H6PA 4G9BA 5K4AA 4AICA 3X43A 1P1BA 3ZDYB 1J9EA 1GPYA 4HUJA 2XB2A 3B1VA 2C7VA 3OLYA 4RK7A 4D3YA 2VT2A 5C9ZA 3JQRA 3L0DA 3OIUA 3QWBA 1NXOA 1W2HA 1DXYA 5CBPA 3AKZA 2E4ZA 1UKEA 4B74A 2CKDA 3O73A 4GG1A 4BMDA 4BDTA 4YRZA 1F48A 1VLQA 1G6KA 3FWHA 4WESA 4LJ7A 5FHRA 4IDCA 1ND5A 1YE5A 2FETA 2IH4A 4Y18A 3I1JA 1IY1A 2JASA 2JFFA 1B8PA 4AUNA 3K1TA 4NMXB 4CHGA 2GA8A 2CXHA 1Z4NA 3O2SB 3RIMA 2M6KA 2BH2A 1V6CA 1ENPA 2WZCA 2FPIA 4KQ6A 4MGZR 4X91A 1E4OA 1J22A 2EFDB 2FMKA 2XV1A 4R9VA 4O4IA 5CMLA 3K9QO 5I01A 4YY3B 3CC8A 3HKDA 3CE9A 4YRQA 4DR7B 3KTAA 1TUBA 4NU5A 3QKRA 2QRVA 5F77A 1PLKA 1PQUA 5JS8A 3CT6A 1OR8A 3KQYA 1XJCA 1J8FA 3OFND 4PO1A 4WASA 2IE8A 4Q47A 4C4RA 2OE2A 4MS1A 3MUNA 2QU8A 3FVQA 2YVUA 1H4SA 3H2SA 4CIYA 2JK0A 1EVYA 4IX9A 3L8DA 5ALEA 3SF8A 1YBVA 3WL5A 3ETCA 1FFGA 3LX8A 5HGXA 1B2LA 5K0NA 5EZYF 2AHOA 5BQOA 3QMMA 1RCUA 1KTVA 2YIJA 1E6UA 1AVTA 1IWBB 3SYNA 4F5WA 4ARSA 2C0QA 3R3UA 4RHEA 4EHDA 4B3TB 1K7EB 2FOLA 2W43A 1WKBA 4P98A 1HZZC 2CZGA 4R0VA 3HA3A 1Y6RA 4MUEA 2IPAB 1P72A 4NU8X 4ADSG 1IU9A 1PV1A 1ADCA 3I28A 3ZNPA 3D6MA 3PQFA 3P27A 2IGTA 4M4SA 4MVJA 3L8FA 1QGUB 3E7WA 4R2MA 3AC0A 3OCUA 4NNJA 3LCUA 5IZCC 1C7ZA 1MQAA 2AIRA 2GBLA 1KHHA 2KYRA 2NTNA 4WBXC 1HG1A 4ALLA 3R0IA 4DY4A 5F1PA 4GZMA 1HRKA 2MMCA 1M1XB 4LRXA 2DPLA 3HGQA 2OR3A 2AKAB 4QGFA 5EZYA 1HPLA 1RCTE 1YE3A 1ZKDA 2HUPA 2PZGA 1KRHA 2OGTA 3BULA 4I4TB 3LBHA 4OSOA 1TIPA 4OI4A 1A96A 3KYCA 1XEXA 3LTEA 4GI3A 2AMFA 1TVMA 1Q0QA 1GNSA 1FZQA 1U1EA 1TMYA 3FETA 1RCFA 3L9XA 1R27A 3BTVA 3D0OA 2X2EA 2WYOA 4H0CA 1SUBA 1KMHA 2CN1A 2ODWA 3S2YA 5LR6A 3MJDA 2OYSA 2QN1A 3B3JA 5BMOA 3KAJA 3D4OA 4TS4A 3ET4A 2VJDA 4R2LA 1EFUA 2E37A 3WGLA 5FCDA 1H2BA 1UJNA 4DNFA 5CA1B 1T5BA 1YRLA 4PYMA 4HNVA 2EFEB 4XM1A 1EFTA 2IWRA 1X6VA 4OK6A 3V4ZA 3TNJA 3S2SA 4B1FA 4J1TA 4H08A 3I0NA 1NBMA 5EJ6A 1RRFA 2QTGA 1LBTA 3RD5A 3M3HA 4CTJA 1X14A 3E9EA 2BSXA 1UADA 1VLMA 1XZPA 3CSUA 3NEPX 3V1MA 3PNSA 4HJXA 4JZKA 4Z1MD 3ZLVA 4ZVLA 3PPYA 3VR4H 1KI6A 1M1YB 2Q8NA 1NGSA 4DQ0A 2JH8A 3GUYA 1GPDG 4KX5A 1N33B 4TXMA 3TOVA 1MPTA 3DWGA 2Y3IA 2CXSA 4FDUA 3O9ZA 4Q4CA 1DX4A 2Q41A 1BOOA 2I67A 2IP1A 4OXRA 4K9OA 3PSHA 1LD3A 4IS3A 4JXJA 5FA6A 5K3SA 3R7SA 3LZ6A 4GLLA 3DZCA 2JA2A 5AVYA 1J39A 2IZ7A 3EY4A 2RBKA 3A4IA 2W9XA 4FI3C 4OY3A 3U0VA 1E6WA 4H7EA 5AVTA 821PA 1UZLA 5CLLA 5E4FA 2VHYA 4MKZA 3TMYA 5BV2P 1JR4A 2HQ1A 2QN7A 3BWVA 5K0CA 2ZS9A 4EY7A 4ZOAA 4Z51A 1E9RA 4BNTA 4OH1A 3JATB 1FP1D 1KBOA 2AYZA 4GD3Q 2QUBA 5I7FA 1K7CA 2DTEA 3L3BA 4TXHA 3H2BA 3RIXA 2BFBA 3VJMA 1Y6FA 2Q45A 5KOHB 4FZJA 2IITA 4L0CA 3CRZA 4FYMA 3E7XA 2CL6X 3ADPA 1CJUC 4AJIA 1KDTA 2A0KA 1U8FO 2CFIA 3FTEA 1F6DA 1DWQA 4QELA 2BI8A 1NW3A 3I58A 4G5YA 4KV7A 1IB6A 3VAAA 4K2AA 2Q1XA 3CZQA 1C4OA 3FZGA 3UATA 1LBEA 1GSIA 4QHTA 4URVR 2QSZA 5BSWA 4ENWA 4KFCA 3NHRA 3U7EB 5EWLB 4NMMA 3NX4A 2W6IA 4MRMB 5M7EA 1XZCA 4NVRA 1DARA 1Z35A 2J8ZA 1T24A 1T2UA 3FN4A 3R9IA 4EA9A 5KYYB 1K9VF 2P40A 1NVGA 1FSZA 1TUEA 2ATXA 4MQFB 4P4GA 3RANA 5JZVA 4FYHA 4MYHA 3RVLA 1M2HA 3WK4A 4B6OA 3KKEA 4B76A 3R09A 2XQJA 2WF5A 3ZGOA 3DDUA 1KS2A 2L17A 3VU9A 2I80A 2PH1A 3ZDFA 2UYCA 2D06A 3N2EA 3QRWA 4JXZA 3DOEA 1E1LA 3G6WA 3JQEA 4TRMA 1QJCA 4GPZA 2I62A 4JXKA 5AKJA 3VZQA 8MHTA 4PX5A 3K2BA 2DHDA 3ZBTA 4BC0A 1ZWKA 2OD9A 1U2QA 5TC4A 4GYYA 2ZUWA 3R8XA 4S05A 3FCYA 5JAUA 3SQNA 3SAJA 4HADA 3H83A 2WG0A 4MJ3A 1B8OA 3IAFA 2LD4A 3FDZB 1FDVA 4IY1A 1NUUA 3H2KA 4F7WA 5DO9A 3RFUA 1HDYA 3LY8A 5AKGA 2OTCA 5DU2A 3FPFA 4BX2A 5KYNA 3H9QA 1EDOA 1VP9A 4Y1FA 5CW1A 5IJ0B 2W2LA 1BU8A 1GRRA 1NRWA 4ZGBA 1NF2A 1N8TA 5CB4B 3NHPA 3QYPA 4I8DA 3ETGA 4MW1A 3S7ZA 2O2YA 2UDPA 3MFQA 4KXVA 4Q7EA 2VAVA 2VNIA 1XDSA 4OFWA 3PXEA 4PX9A 3KSAC 2VUUA 4L51A 3GJQA 5KQLA 1JSCA 2MCFA 3AUSA 4BDSA 3Q3JB 1KH2A 4Z4EA 2BSAA 2GLTA 5JFGA 1BC5A 2BFCA 4IOKA 4KQEA 2IU0A 4EG6A 3MERA 3DNMA 3UJHA 4YV0A 3S70A 3OOHA 4PO3X 2BCGY 1A3CA 2B99A 1CR4A 1C7IA 1PDOA 1YJXA 3MK31 3T12A 3C4JA 3GARA 1ECPA 1FFSA 1UKCA 3VNUA 3WG9A 1R8SA 2GXAA 5DGTA 1T6NA 3ZN2A 3JVEA 4UEQA 1LS1A 5ARBA 1WHTB 2FOIA 4HG2A 3WWZA 4AMYA 1UBFA 3MAGA 3R24A 4N0EA 2KS6A 1PKEA 3CZ5A 3KKOA 3LK6A 3OE7A 4G3XA 3FJOA 4CF4A 1LA2A 1JECA 2YN0A 4R7TA 4FSXA 2EKPA 1HT0A 3DTNA 4DYVA 3HCPA 4OSPA 3DT6A 2AEFA 4O4JF 3RC3A 3B52X 1NMQA 3L8GA 4TWJA 5DHSA 1SVMA 2NPOA 2WKWA 2Y05A 1UJCA 1RI3A 3AB3A 4LW8A 4JLPA 2XMCA 4GYJA 1NR1A 1DKLA 1TXGA 2DGDA 2ZVDA 3HPQA 5EPUA 3TX6A 3V1YA 4C3OB 4DSUA 5EJ7A 5HKOA 1O5OA 3N3BC 1KP3A 3NHZA 4DLZA 5HR5A 1GCAA 1P45A 1Z0IA 3STWA 1J70A 3WWEA 2VTBB 3MQ2A 1E94E 2ZSAA 3FJ1A 2P2NA 2KW5A 2OXRA 2P7HA 5K6AC 4IJWA 4OGLA 3NV9A 2EARA 4BNZA 4XYMA 3IJEB 4QYMA 5ER6A 5ISMA 3N86A 2LIPA 2Z3VA 3VVCA 4MX8A 3M3DA 3AQ4A 1T8UA 4DMLA 4YCNA 1DO0A 1FP4A 1SMKA 2YHIA 4O4JA 4AJKA 4ZI7A 5JBIA 5IKMA 4EABA 3DKIA 3VDRA 4IJVA 3LUHA 2YN4A 4C03A 1XV5A 4FCCA 4Y2XA 2Q5EA 3SYKA 1YGPA 2YYAA 4X1IA 5A9TA 5HCUA 3KOZA 1C7RA 3MTBA 5LBIA 4D9KA 4MMZB 1JFLA 1XAGA 2QM8A 4UFPA 5ICCA 4NAVA 5KVSA 1YZGA 4IJQA 1THGA 1TFRA 5DCWA 5ALHA 2E5FA 4W5NA 2D7JA 3URMA 1EZ4A 5B5SA 3TMAA 2BUAA 1IJKA 4BQRA 1K97A 1XA4A 4G0NA 2GSDA 1NQAO 3UOWA 1CETA 3HYRA 1LZKA 4U2DA 3T3GA 2IEYA 3VHRA 4E2XA 4G07A 2EQ5A 3IEMA 1JAXA 3GLGE 3ER8A 3GLTA 4ESHA 4EQ6A 3L7DA 1H4QA 2WHPA 5EJFA 3F7MA 1BSVA 2ZR0A 4UUNA 3UUGA 5LDGA 4BP3A 4MWGA 3HKEA 2BGTA 4KXNA 3NIFB 3ZCQA 1R15A 3HDQA 1RAIA 3P71T 4G1UC 4AYXA 2H1OA 4EFLA 1C1YA 2G5GX 3QOYA 3ZQJA 1Q77A 2PKXA 1XVAA 2C29D 3CSSA 3WAKA 4ALMA 1OB2A 3CUSA 2XBMA 2REBA 4EPXA 1ODSA 1E6EA 4QBFA 4UE6A 4YRTA 3WGVA 1K7FB 1AF4A 2OO5A 4IDHA 4CL8A 3CLKA 1GSAA 1JBQA 3DKKA 1CHNA 4YBRA 1GRQA 3ZDZB 5AW8A 5FUQA 2HWUA 3QXJA 4O2BB 4HDMA 1FYWA 3H11B 3MWEA 3LVQE 4MRRA 4IEIA 1SC4A 5AI5A 4X97A 1NNSA 4C0QC 1TKRA 3E9ZA 1LW7A 2EP8A 2A59A 3L4EA 4KIWA 3DB1A 4OQQA 4QATA 2PXHA 4C43A 3ROQA 4D8YA 1PFKA 1SC3A 3IXLA 3R40A 1A9XB 1V3QE 3LLVA 2FDXA 4M1MA 5JSQA 3FYTA 3MLBA 3R9XB 5F5NA 1II9A 3BIWA 2G80A 2X13A 3PLNA 4I8IA 4RFSB 5GJWC 3TVTA 3UK6A 1W88B 3COSA 3H9EO 3HY6A 1MH1A 1VA4A 2FSUA 4AXBA 3KUKA 4HAYA 3GNLA 2R97A 5BQ5A 2GYWA 2R65A 4W7SA 3SJUA 3MB5A 3PUXA 3STYA 3C3DA 1Z68A 4LCEA 2P0AA 3AVPA 3E5NA 3O8NA 2O8NA 1OLOA 3NKVA 3ZHVA 4BVEA 2Z1NA 3FFWA 1MBZA 1VHWA 1PZXA 2PV0A 3HO1A 4AKSA 2IZ0A 2XZDA 3CS3A 4RAOA 5EJGA 3P4UA 1E32A 3OQPA 1I3LA 1WY7A 2QG6A 1B26A 1LPNA 1JLLB 2PRZA 1JF8A 2ZJ2A 3OE1A 2QZZA 1PR0A 3ABIA 4GSLA 1JEEA 4WNYA 5DIFA 2SICE 4RIGA 1LX6A 1WXDA 1HYQA 4NONA 1A5ZA 1DIOB 3U7QB 1T43A 1JFFA 1YK0A 2Q2OA 2X76A 3NASA 3T9AA 5KQPA 4G0XA 4M6WA 1CUXA 5KTMA 4D9MA 4MPPA 3THXB 2PQ0A 3UK1A 4ZVRA 4E5YA 1BVHA 5LQDA 4PC2A 1JW9B 2P9EA 2VNKA 3F8TA 1HE2A 1OH7A 4WDRA 4M8NE 1U7XA 2Q6LA 3PWZA 4B6SA 1SIUA 1NIPA 3PWTA 1I1OA 4H7PA 4TLBA 1O94C 4OD0A 3HKBA 5LB4A 4INAA 3W2TA 4KAJA 2C2KA 1T0IA 4Q9DA 1A8QA 5GOTA 1L7AA 2FWNA 4A23A 4QT4A 2R79A 5ECYA 2B2CA 2Z58A 1W94A 2P2SA 2CHFA 3KIPA 4GDMA 1Z4IA 4IV0A 3TIIA 4UJ3A 1AH2A 4ZDIA 1H1LB 1LJ8A 4OAOA 1OSNA 5AHKA 1HY3A 1H85A 1HNXB 1DJQA 2HMAA 5REQB 4UBLA 3KT0A 2INGX 3UWMA 3VDQA 4F96A 4Z7NB 3AI3A 1QOZA 1W75A 1FYVA 1YT5A 2YWGA 3GHYA 3Q87B 5JS6A 3QFFA 1H0KA 1ZH6A 2ZAOA 3GROA 2ZW9A 4R31A 2FMXA 1JHXA 1T9DA 1CY8A 1I1NA 4OOFA 1O08A 4DSTA 3U09A 4LE2A 1DKOA 1P61B 1Q0LA 5AM0A 4F1JA 5GTDA 4NK5A 4C7XA 1IWPB 2A1TS 3LVFO 1TPYA 2N0SA 1NBIA 2C98A 1B8UA 1W5SA 4M2LA 5FLXA 2NSHA 1VRVA 2OCBA 3L6RA 3Q3HA 3M5WA 1RQRA 4JR2A 4KN9S 2ZCUA 5CVUA 2A9RA 2BN4A 2XW6A 3ET5A 3GGOA 1N9GA 3ABRB 4GFDA 2OBYA 4FZRA 3DMFA 4ZAYA 1YL5A 1ECCA 3O92A 1E0AA 3G2JA 3ESCA 1LLDA 2QTNA 4K46A 3EIOA 4FUQA 3G0HA 1QIJA 1PWXA 2E9SA 2JBHA 4O1IA 1DQYA 2PMKA 5JHHB 4QUEA 3ZDXB 2PS0A 1JTVA 1SBHA 4XWWA 2B6NA 3INYA 3MWFA 4DCNA 4JUFA 4E5UA 5K0EA 2F17A 1XXHA 2HRZA 1TYZA 4B7AA 4MW7A 2O5CA 4HQFA 1AK9A 2W58A 3ZC3A 3AVXA 3WRYC 1U3CA 2ZRMA 1AQUA 1BX3A 1SHKA 3CINA 3MXOA 4PCLA 1E1RA 4N03A 3ZV6A 4BVFA 2VSFA 4IF4A 1EK2A 1U7DA 1U9CA 5HDBB 3MSCA 4U7DA 2I6UA 5ALIA 3RI3A 4L2IA 1XZLA 3H4MA 3T9DA 1U9YA 2BJHA 1PR4A 2GTIA 3JSXA 4KXQA 2I9PA 1HM5A 2AG8A 2RGWA 3PQCA 1JB9A 2C4TA 1XN4A 1G20A 3HXMA 1J00A 3IJRA 4J9UE 3DA8A 3I42A 1V35A 2R7NA 5ALLA 4AX4A 4E88A 2V55B 2UAGA 4H3SA 4NEGA 3N76A 4YV2A 4IDDA 1V48A 1F0NA 1NW9B 4EGJA 1WB5A 5KKNB 4NS4A 5G1OA 1P7VA 2IK8A 4UUQA 2QTLA 4DA8A 2FQYA 3ZXYA 5FWXB 2CVPA 3O82A 2AJCA 2GI4A 3FCSB 3R3XA 4PONA 4LVCA 3IIKA 5FBKA 3ZE7A 4YJHB 5CAEB 2N46A 1XZIA 2AX3A 1I5EA 1QO0D 4J0DA 4KREA 2QUAA 3NH9A 1EDZA 1D6MA 1V25A 1ZKMA 4N7JA 4ZHQF 2H5JA 4Y6PA 5KQMA 5E3IA 4LC9A 3C4VA 3HJFA 3UAXA 4A82A 2OB1A 3KKZA 2RAUA 4FZ5A 2O8DA 2X4DA 2BV3A 1FUKA 3OPVA 2D1RA 1YB5A 4X45A 5K8IA 3DBIA 5DYIA 5EKSA 1Z5ZA 3ELYA 2GO7A 2KSQA 2Q3LA 1OTYA 4R9RA 1EYZA 3WV5A 4C7OA 2O3RA 4BO2A 1U8TA 2R47A 3PC8C 5KEIA 1IVNA 4AULA 1DDGA 1EA7A 3P0IA 2I54A 1Z08A 3DFUA 3N7AA 3V48A 3BXFA 5BW5A 3QX3A 4Q4HB 2WJPA 3MB8A 4R1OA 3E81A 4HNGA 5KNBD 6ADHA 4LF4B 1WSBA 2FQ1A 2VNHA 1CS0A 1L3BA 2EP5A 2H3HA 2OAEA 4RLQA 4KCGA 4BVGA 3IBYA 1YZFA 3KVRA 4FS3A 5H70A 4XRGA 1XG5A 5MGNA 3CVVA 4UZEA 1UPFA 3GRUA 5A6SA 1H6DA 4H3VA 3GEMA 3JARB 4ZJYA 5C81A 3KPYA 3KVYA 1GA1A 2GCOA 3GMTA 1RADA 5C1BA 1XN1A 3WLOA 1ZUIA 2F3SA 3QUAA 2QTZA 1NXSA 1JA9A 2VDWA 4YAGA 4OI0A 2MSLA 2VHWA 5SY9A 4HDNA 2AFVA 4DLVA 4HXFB 4EIWA 2XMDA 3AVVA 5C7OO 2FLVA 1QHSA 4QLAA 6PFKA 2OORC 1MUUA 4E3ZA 2YCBA 4F91B 1KPGA 4MUGA 3L05A 4LGCA 5CLIA 5TR9A 4YRRA 4HGZA 3EGDA 3C45A 4MV5A 1ZJ6A 2FEXA 1TEXA 4Q1BA 4QYSA 4YPFA 1GV0A 1N2ZA 3PJGA 4IHKA 4LDJA 3ZHOA 4IDNA 4Z1OA 4RYLA 4HB2A 4OYLA 1QE3A 4DSOA 2AWNA 4GPBA 5JJKA 1O0BA 1VQ1A 1EESA 5TMBA 2PRKA 2R8RA 3SD7A 2C3MA 3VX3A 2VQFB 1P7CA 4ODIA 3MC1A 4PZAA 1KZ7B 4PX2A 1SXJB 3U37A 1G55A 3M4JA 3RBVA 2FW8A 2ZYTX 2C96A 1SVKA 2G25A 3DEAA 3GRKA 1L7VC 4LUCA 3BMXA 5L7YA 5AVJA 1CY1A 2B2XA 2X0NA 4AZVA 3LCMA 1RLTA 3U3ZA 4BVLA 2BFWA 1YQQA 1BQ3A 1AQLA 1LC3A 5LA6A 2HA2A 4RA9B 2VP2A 5ADHA 4B5KA 4Z6KA 4RTMA 4L9AA 2WLTA 1O77A 1DMSA 2SCUB 5BUZA 1QOPB 4R40A 4UNSA 4NZYA 1VG8A 3BGOS 3WLNA 4WNIA 4PR3A 4Q4AA 2PX0A 4QUGA 1AMOA 3U19A 3DS8A 4PNZA 3C97A 1IN1A 1GTMA 1VL2A 2YUIA 1D3AA 1Q6ZA 3FKJA 4IJKA 1F2TB 4K6GA 3FUCA 2PMFA 2Q62A 4JHXA 2QS9A 3QU9A 1NP3A 1R74A 3IEIA 1D9XA 3R6WA 3USCS 4EB6A 3KOUA 3KWMA 1S1MA 3M1AA 1KQOA 5HX7A 1OXKB 3ZGXA 1NI4B 4MUFA 1NWHA 2F48A 4R01A 5DMHA 5EYPA 2EJCA 3KD3A 5KIAA 3BG5A 4NZPA 5FADA 4KXMA 1UFOA 1PL7A 3B6KA 4NBSA 1SOWA 1GA6A 4UW9A 4Z3KA 2QR3A 5KYXB 2I7CA 4GM1A 3K71B 3AR4A 1FFCA 4G0ZA 3EEBA 4Q48A 3PYXA 5AXBA 1P2TA 1OYWA 1T2EA 4ALIA 1G8JA 1LNZA 3P9ZA 4LDRA 2WU0A 4LJRA 3AVQA 5AK5A 2W8ZA 1OAOA 2H0AA 2R44A 3P9YA 4MYTA 3RSZA 2H65A 1GEGA 3EDMA 4P3PA 4HS9A 3BGWA 1DKUA 3WV4A 3JW8A 2JEZA 3UHAA 4CCAA 3K0KA 5JR3A 3A31A 4R7GA 2UYGA 1YRAA 2QMZA 4ZGWA 3D3WA 3ADOA 2WJ4A 5TARA 4D82A 4E1AA 3L79A 2N9UA 3WIOA 1Y7IA 5BRNA 2DWCA 5T7BA 2A5FA 3DL0A 3SX0A 4EFKA 4MUIA 4LYGA 3GCGA 2WTXA 1Z13A 3WB2A 1N4AA 4YLYA 2XF8A 1FX1A 4HAOA 4GPTA 1F60A 3L01A 1UBSB 2JJ8A 4KB5A 5E6UB 3WQRA 3ZJ5A 4CE6A 1OTHA 2QTAA 3WK9A 4WLNA 5KKAA 5L6LB 1X0XA 1T9GR 2Y9PB 3CZ4A 9LDBA 2A7QA 3O03A 3D6AA 4R7ZA 1L5YA 4EUNA 1OH6A 1PGNA 3COZA 4E14A 3DNPA 4FONA 3B51X 4CDGA 2WJ3A 1F8YA 1JSXA 1HE4A 4C4SA 4KR3A 4CEHB 1NUPA 5JCXA 5DI9A 1AIPA 2M9MA 5H0IA 2P2CA 2X15A 3AUYA 2X42A 4MQEB 1JLRA 3VAZA 3ZWWA 4U2BA 1A9QA 2PU5A 3BFJA 1I4WA 2IE0A 3DAYA 2OGZA 5JQGF 2VAMA 4TWAA 3UYLA 2JDIA 5JOQA 1APBA 1J8YF 3AUXA 5FBZA 1RWVA 3IVGA 2XQIA 2DX7A 2Y27A 2OOSA 2R8PA 3C5CA 1OOEA 4DRXA 1VMEA 1JS1X 3LT5A 4GC5A 4U2KA 3SXJA 1XDWA 3U7GA 3PEVA 1JPUA 5P21A 1OW3B 5G4KA 1YZKA 4QLOA 2IYTA 3OFJA 1QAQA 5HGJA 3BD6A 3W3AD 2QAIA 3EWNA 4B3DA 1G21B 4LHYA 5JO9A 1JVSA 1VXRA 4LBWA 3V4RA 2ZUDA 4ILKA 1ZOOA 2ZI7A 5FBRB 4A2WA 1O97D 4JQZA 3EC2A 3BMNB 4MW5A 2IV2X 1G60A 2D7CA 2PGDA 4P34A 4RXTA 5EE9A 4WXMA 1R8JA 4ND8A 3DAFA 4KTTE 1QDEA 2VRNA 3D3QA 5ARDA 5JQGA 2BEVA 4K88A 4QWWA 3EBPA 4CIVA 4G0QA 3UK0A 1J2YA 4RMHA 4KO2S 4Y2VA 2Z98A 2O23A 5IAEA 3H8VA 1JKFA 1GXSB 3A9SA 4IQFA 3B20A 3C70A 1N92A 2D0PB 3PDIB 3VO9A 3JALB 4RBNA 2WICA 5CG2A 2ONYA 2BOVA 5FYQA 1ZK4A 1IRXA 1ZCFA 3DV9A 4KUHA 1QP7A 3EJ6A 2EGHA 4PW0A 3ICEA 3RIHA 3OFNA 4G5RA 1L5LA 3D4LA 3HY3A 4LY0A 4V0QA 1R6BX 3VO2A 1AUQA 4DIDA 3QXHA 4B33A 3BTUA 1JJAA 3B89A 4WLUA 3UA4A 2RGXA 3F3SA 1ZVKA 3HI6A 3WOVA 1YQTA 5M34A 3FY4A 1K0FA 4IWYA 2B1JA 4D9EA 4IYRA 1NYTA 1WCIA 1ISPA 5FAXA 1RAGA 1C9EA 3W2HA 2XTZA 2I33A 1IDOA 3C6KA 3JQBC 2RAFA 4M9UA 5DBFA 2DQ4A 3AB8A 5FUXA 2NZ2A 3VOTA 4Q3CA 3EZYA 3EW9A 1DOAA 1L0BA 4XVHA 5DSTA 3A27A 3NM6B 1AQJA 1W25A 1MW8X 3FTFA 1WW2A 3DBHA 3OJWA 3WLSA 3U1BA 2ZYSA 1IY9A 1MLDA 3OMLA 4MUKA 1PO7A 2C9BA 2W11A 1O6GA 4R6XA 1Z0DA 1CB0A 2VWPA 1WZ2A 1YV9A 3NJRA 2VTVA 2ZOSA 2JLQA 5CW2A 4B3RB 4XX1A 2NXJA 5THKA 3R7AA 3V8EA 2PFSA 3VSCA 3OPYI 4D9IA 2WR8A 3ELWA 1RWXA 2JATA 5LBUA 4AF6A 2ODNA 3HLKA 1SUCA 4ZJPA 1WNTA 1TE2A 5AI4A 1QZXA 3UG6A 2IHZA 2JLRA 5C5IA 1US8A 4ZV4A 3GQVA 3A14A 2G77B 4TL9A 2Z9DA 5E1OA 3C41J 1W36B 1E5DA 4DLUA 3L7JA 5EEHA 4JB0A 4EA8A 4F06A 2HUNA 2Y71A 1D1SA 2ZXUA 1MO3A 3NDBB 1WE2A 3LD9A 3DHVA 3W8EA 1N1MA 5FNVA 2AEJA 3ZHRA 1KSGA 5EJEA 3NHMA 4BB6A 1AHIA 1SB9A 3I30X 4L8GA 3RU7A 2G3YA 3CW8X 1TAQA 3L7OA 4J4BA 3S2FA 5JNSA 2O8BB 4RORA 5I4KA 1I8TA 3PU6A 1L5RA 2RHLA 3KK0A 4Y6LA 2E4UA 5F5XA 1ECJA 1G8PA 4HTFB 2GH1A 2D2EA 2CYCA 2J9ZB 1H3NA 3HH8A 4KQGA 5ALMA 2MINA 4EI9A 3TE7A 3R20A 2GPSA 1ISHA 2IHVA 1CRWG 4M36A 2C88A 3P0HA 1ZBDA 2HEIA 2G36A 4UHJA 4Z1MA 5T4EA 4BU1A 4XWOA 4BKRA 3PD7A 4PSAA 1K4MA 1C5KA 2H85A 4EHLA 2WJYA 4DV1B 1ODJA 1YHNA 3F96A 2WJ6A 3NHLA 1CUAA 1J9ZA 3UMYA 2ZI5A 4N3NA 2R5FA 1R0XA 4L0MA 2HM7A 2QQ0A 1GDHA 3GDGA 5C4IA 5LIRA 2IPOA 2OAQ1 3EMBA 5LM3A 4UDOA 3CT4A 4J1QA 1MAUA 3FB1A 5JY6A 3C8HA 3I2IA 1FJXA 2AVDA 3SN6A 3J80A 4OXNA 1PE0A 4HD8A 5AVKA 4ZT2A 1ABBA 1XMQB 4HVTA 5GONB 1K08A 3BE4A 4MICA 4E4TA 3NBQA 3GLGA 2CNOA 1IFXA 1QOQB 4C4XA 1NTRA 2V3WA 1YUNA 4KQKA 4OL0A 2ECKA 2QVXX 3PLAE 2C03A 4CMBA 1E9CA 1T9CA 1WSWA 2C95A 4LXHA 3VX4A 1OPRA 3SYLA 1E7SA 3TLMA 1H5NA 2FHSA 2FJ0A 4NPCA 3ESRA 2P75A 3M6VA 2VKTA 3A4TA 4EH1A 4MAAA 5E95A 4JEIA 3SKXA 3UGKA 3AESA 1KK3A 3TZQA 1GUFA 1YIOA 1V43A 2NSLA 5DKFA 4JDUA 1C9MA 4E07A 1ISSA 1I24A 2VDRB 4Q24A 2WWVD 4W6ZA 2VH5R 2JGLA 2YZ2A 3GDWA 1TTPB 4MUYA 5AIBA 5EJ8A 1DFHA 1IBMB 1DG3A 1EVEA 4AI6A 1EX7A 2AOTB 5E2IA 2NXWA 3CWQA 5KYUB 3PCTA 1PSZA 2Q8PA 3R7WA 3AVOA 3LWDA 4P7GA 3EE6A 4J0IA 3I2JA 5KOJB 2FPPB 5AM4A 2EFCB 3RRFA 4EOGA 2V96A 5K3FA 3DNFA 4QSMA 3KZKA 2MSDB 2Y0EA 4O4LA 5KYYA 2O5VA 4LFBB 3TINA 3L1IA 5EIFA 3Q5DA 1FCJA 3HDTA 1GPAA 2CLDX 3H04A 2I71A 1NYRA 2K87A 5A1TA 2GK4A 3VC7A 2NYRA 5HMMA 5LC1A 3DO5A 3MF4A 2F3UA 1JDBB 4JUIA 3U7HB 1J1IA 2I4NA 3IVMA 5DW3A 2QL6A 4EY6A 1PFQA 2BCJQ 2OZLA 2PLFA 4MS3A 1J8QA 4TMYA 4TV8F 3RYFB 1UBRS 4LJAA 1Q74A 3OF2A 4G8CA 1V2HE 1KI7A 1K8YB 3SHVA 2OZEA 1RQGA 1TUIA 1EGQA 4M7PA 2CT8A 3D6HA 2WFLA 1BCRB 1VMAA 3WK8A 3GRFA 3SFTA 1ZAKA 5ALKA 3HCAA 4BP1A 2FKAA 4A5OA 2ZBUA 2OT3B 2CYAA 3BTOA 4WUVA 1UC8A 5CFOA 4GI5A 2B6HA 3MCAA 5IASA 4F84A 1YU9A 4K87A 4PZCA 3B9PA 4J43A 2PZ8A 2WWTA 2Q6VA 5G4LA 2NUAA 2QORA 1NF8A 1QHNA 5HQTA 4B6PA 2PMCA 4C3VA 2XQKA 4MEAA 3RVDA 2O0MA 1DG1G 3F5DA 4TV8A 5F78A 2G4LA 2Z8ZA 2QUHA 3LHKA 3Q11A 4IKPA 4QJ3A 2OL4A 2ZRAA 3MD0A 2CLOB 4AJOA 1RXIA 4X62B 1KZHA 3KYDA 1L9KA 4RA6B 1M34B 4COOA 5IJWA 4NF2A 3DEZA 2G07A 1CUIA 1F12A 4OQYA 2I29A 3AEUB 4KVAA 4TYWA 1RTKA 3OP4A 1SXIA 3EGXB 2PUTA 4PICA 1ZK0A 1SOVA 4COKA 3VAYA 3BZBA 4HYTA 1RPNA 2XWJI 3U1TA 3CSDA 4BLQA 1G4HA 1QH0A 2JFZA 1QIKA 2FEKA 2GPBA 3FZEA 3REQB 2OCIA 3WWDA 4CWAA 2IF0A 1ODFA 4BQNA 1SURA 4RSHA 2DPHA 1EXMA 2Y8EA 4V2UA 5J5VA 1MJ5A 4IDQA 4EZBA 4WI1A 4A16A 2CZQA 2K2WA 1BWRA 3I92A 2ISCA 3KOMA 4E2FA 1J5XA 5K05A 3V9PA 4QLBA 1ESCA 5HYVA 2J3KA 1RIFA 4M1WA 3W2FA 1RYFA 1RKBA 3JYPA 4O3FA 4OFXA 5HW0A 1M0EA 1FRVA 3TO5A 1BE8A 2Q3FA 1JIQA 2FEMA 2QSYA 4ASUD 2GF2A 3MNFA 4J1TC 4ZVUA 1RJ9B 1K2VN 3SIWA 1X7HA 4WA8A 3SLRA 3UK7A 3Q3IA 2ZAGA 2Q5JA 2WWHA 1Z33A 3AHGA 1HTTA 3H1BA 1CY7A 3M3PA 1RWWA 2X86A 3WZMA 5LUAA 2NV2B 3FB4A 2VG8A 1OMOA 3C5HA 4C6SA 1HMPA 1MNAA 3ENQA 3HFSA 1T1GA 1IIRA 3DUFA 4HN4B 1KSFX 2Z6UA 4WOKA 3QTLA 2EDAA 3BEDA 3L8CA 1RRGA 4MIEA 4P3OA 1J09A 1QIGA 1UK8A 4HDSA 2DPXA 3P1JA 4WKNA 2FWBA 4K3VA 3ZWKA 2E18A 2YYYA 2OHIA 2VOJA 5FFNA 4FFOA 5DTJA 4JQCA 4DUYB 4U5QA 1V5FA 3DE0X 3I37X 4Q6WA 4DCPA 3MLAA 3HRIA 3GLHE 3HB1A 1KVRA 4RTOA 3G0BA 3IKMB 4MQLA 1JKMA 3NWPA 4BFXA 1O4VA 1XJWA 5AM3A 5U9CA 4NICA 3U56A 4YI3A 1W6UA 3PFWO 5KVVA 1I0ZA 1AG9A 1QRAA 2WU3A 4CQMB 3AXSA 2BTOA 5TJHA 4F9FA 3NHWA 4I1VA 1QC5B 3EXEA 2J30A 2V4MA 5AJUA 2X1HA 1J7JA 2Q8QA 3HJBA 5FPKA 1HDIA 1JMVA 1Z74A 1N2HA 2HLNA 1U2RA 1GZ5A 1OJLA 1IHXA 1YA4A 1ZL2A 3JYHA 5IVKA 5EJIA 3GLSA 4FFBA 3COVA 4BQFA 1FDUA 2CUKA 3EDQA 1S2DA 3BM5A 1KVUA 2WVJA 3OT5A 2IWHA 3TLXA 4C0HA 4YT4A 1GSHA 1W85A 1O5TA 4WXHA 2ZVQX 3CZMA 3WJ2A 1OV6A 4CEIB 4G65A 2PSHA 4O8CA 3VQTA 2DFPA 4XQ0A 1CSEE 1QANA 2K5UA 3EIQA 2NW6A 4BN0A 4EG4A 3SHTA 1CDZA 3GRRA 4FLEA 4LC1A 4Z9AA 2WNIA 3MMXA 4ZARA 5D3MA 4PZEA 1PHRA 5IYZA 3EIHA 3BE6A 2QNIA 1KORA 3LQKA 4IIJA 3SXUA 2ENUA 1C30A 1P2VA 4DC9A 1DRKA 2ZYIA 1MVLA 3BMCA 2BGMA