3LWNA

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
181
structure length
181
Chain Sequence
SAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 61
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lwnA00
2ZE6A 1JB1A 1Z28A 5H1YA 2FOLA 5E95A 2JLQA 2A78A 4PQRA 1TQ6A 2Z6VA 1HE1C 3UMSA 2DFTA 2O8CA 1GG2A 2I3BA 5HPYB 4G0NA 4IVRA 4TSFA 1KSHA 4KODA 1ZJ6A 4TYQA 5FOWA 1CTQA 2AFIE 2EFDB 3L43A 2G3YA 2YHSA 4I1OA 3CH5A 4KITB 2FX3A 1G5RA 4K8OA 4B71A 1RRPA 1P61B 5HE8A 1X1SA 1U9IA 1G19A 2ZI9A 4TMTA 4KI0A 3GJ7A 4YONB 3OIVA 4X8MA 2NGRA 5DN6D 1QHGA 2ZRLA 1ESMA 4URVR 4DLSA 4DC9A 3PQCA 5C18A 2QUZA 3I62A 2QE7A 4MRRA 2JASA 4MKHA 4RY2A 2WJVA 1ZP6A 3KTAB 1U8AA 2PMDA 4DSNA 1GTVA 4FW9A 3A58B 3HYTA 4F4IA 2F1HA 4M1WA 4RD1A 3U3RA 5GVRA 1KO8A 4P4TA 3SU8A 3LX8A 1FL9A 1EWRA 1Z0FA 1Z6YA 2D2EA 2IYLD 3EARA 1ONBA 3EC2A 3PV0A 1CU1A 1XD8A 3FFAA 3VR1A 4P4SA 2CL7X 2D7DA 4B3BA 4LYAA 2HV8A 4BFVA 1J2JA 2OO7A 3SNHA 5LPNA 2HCJB 2OE2A 1E1QA 4D81A 2B6HA 4LJ5A 2GVDC 1ZBDA 2FZ4A 1IY0A 2ZR0A 3KKOA 4QL3A 3TMKA 3CLVA 3I8SA 4ASUD 1N3BA 3NEJA 1S3SA 2QTVB 4LDJA 1SXJC 2VPPA 4DWJA 1S1MA 2VTKA 4I1VA 4LYJA 1G8GA 1E2PA 4CT5A 3N70A 4BLQA 3RRYA 3KXLA 3UMFA 3GFOA 3QBTA 4OHWA 5L3SB 1XPUA 3ICEA 2O8FB 4HAWA 2O8BA 1NLFA 5JCZA 2JA1A 2QMHA 3CPEA 3K0AA 1YU9A 2ZSEA 1NI3A 5HZKA 2G1KA 5EXSA 5JSZB 3SQXA 1TF2A 2Q0HA 4JS0A 1P75A 1QG4A 1JQJC 2BMEA 2C99A 3QXXA 2CHGA 5AWFC 3ZD7A 1R0WA 1VYUA 1JR6A 5DHFA 4A8JA 4YMWA 3QF4A 4Q03A 2J46A 1S9HA 1YZNA 1YZLA 2NZ8A 5HCIA 1JI0A 3PENA 1BMFD 4IEEA 5KNCA 1MKYA 3F0TA 3EZ7A 2J0SA 2ZQ5A 4GNKA 2ODBA 1QHHB 1XD9A 3CRQA 4ZDJA 3KQNA 3LXXA 5LD2C 5BXQC 1ZRHA 1MH1A 3BRWD 1P9NA 1XP8A 3UG7A 1RVDA 1XTIA 2NOAA 4LBYA 4A82A 2OLKA 3WHKA 3QKTA 3QKRA 2JLVA 4NYJR 2JDID 3MWKA 1ELOA 4LSGA 4QBIA 5FL7D 1I4DD 5KPJA 4GMDA 3A37A 3AGQA 3ZGXA 3EPHA 3P26A 2EVWX 5CYOA 2C9CA 1OH6A 3K9HA 3NBZC 1XPRA 1T5IA 1IXZA 2ZI7A 2IYTA 1SKYE 2VP0A 4A0RA 3VR6A 2IEZA 1DPFA 1V5WA 5FR1A 2OXRA 4Q47A 3I92A 3CONA 1F2TA 2ZROA 1NVWQ 4C0SA 4ZPXA 2VHCA 1DAKA 4IEIA 4F92B 2ZM5A 1S96A 4C7OA 1K5DA 1GKUB 5GJWC 1OH8A 2F1JA 3AKYA 3Q7PA 1M8PA 3GEIA 1VCOA 3MAAC 4CIDA 4RZ2A 1CS4C 5JI2E 2HUPA 3SYKA 1OKKA 1AGPA 1W2HA 2FGJA 4Q66C 3X1YA 1NY5A 1KJZA 2QG6A 1AQYA 3SI7A 1G5PA 3WNBA 5DGXA 1YRAA 2W6IA 2HJVA 2QI9C 4JVSB 4GL2A 4BLTA 1XJ0A 4JL8A 5FOVA 4GDFA 4C4PA 3SR0A 1NMXA 3GJ3A 1E96A 1NIPA 5CK4A 4E07A 3OIYA 1GAJA 5EP1A 3T34A 4M9XA 1OXXK 2ZRDA 3M4YA 4F4CA 2O8EA 4GRAA 4IOJA 1X86B 2BCJQ 3A1VA 4KAXA 2HEIA 2Q9CA 4PO8A 1Z63A 4QHSA 1Z0KA 2GKSA 4OI0A 3W3ZB 3I1FA 1KO1A 1EWQA 4R2IA 2VEDA 4ZV4A 4PC2A 1NF3A 3LQQA 1Q12A 4XOIA 3SBEA 2O52A 3THXB 4OK3A 3LBNA 4X8LA 1OFHA 1QZXA 2ONKA 1R0YA 4B44A 1P2VA 4JBWA 3ZZUA 3G82C 4E03A 4ARZA 1BO6A 3N2EA 2VH5R 4TQ9A 2EWWA 2QSYA 1AA9A 3D6TB 4NZYA 3FGNA 1G3UA 4I4LA 4PC3A 3A4MA 3S1AA 1DE0A 5JJLA 3BB1A 1T6NA 2XJ9A 3GLHE 2HT1A 2FPMA 1E9AA 4LK2A 3PUXA 2RKOA 3X2SA 1IM2A 1RC8A 4Q9JA 2WWGA 3KFVA 1JPNA 4FI3C 4NYJQ 1NL3A 2J59A 1U99A 3KB1A 4M53A 2YZ2A 2GCNA 2W2XA 4Q7KA 4C0HA 2P67A 2ORIA 3GLHA 3NEYA 4QRHA 2C96A 2YNMA 3TIFA 3CO5A 4A9AA 3GD7A 2GBLC 2OM2A 3DPUA 3L8ZA 1G8PA 1XXHE 2GZAA 2A30A 2NIPA 2C9YA 3F5FA 3KJIA 3K70C 4DCVA 4C2TA 1WXQA 4PO9A 2Q3HA 4LBWA 4QGGA 3OHMA 2GHIA 1VMAA 2ZSAA 3I73A 1ZUIA 4XJXA 3NBXX 3B1XA 5G3YA 3KKMA 4ILEA 4LCBA 1R2QA 1QRAA 5SZIA 3SZRA 2JJ2D 4TTRA 3B2EA 3U5ZB 1NJFA 4Q48A 3F3YA 1DAMA 1W5TA 4KJZA 3I32A 4ABYA 2V6IA 3Q72A 2P2LA 2XZLA 2AD5A 5JECA 2RGEA 5BN4A 3EX7C 3TK1A 5FBQB 2VHQA 2XSZD 4DHEA 1DG3A 1IHUA 2AK3A 4KHZA 1NBME 1GNRA 3JZMA 4DIDA 3Q9LA 4QGFA 3AP1A 2C04A 2QORA 4EQ6A 3TUJC 4HAVA 4GFDA 1OH5A 2IK8A 4R9UC 4KFUA 3B13B 1LS1A 3TW4A 2GVZC 3VTKA 2UKDA 1CULC 2FA9A 3GLGA 1ZD8A 4BFXA 3FB4A 4AI6A 2ANCA 2ZRFA 3L2OB 5IHPA 2CEAA 1RIFA 2ZRJA 2VP6A 4AC9A 2LKCA 2R62A 2X8AA 3VFDA 3CR8A 3PXGA 3CIOA 1HURA 2K5UA 2GRJA 5KSPA 2RGNA 3TR0A 2OV2A 3TVDA 1KI7A 5DO9A 1LV7A 4HLUA 5K8TA 5KO2A 3GPLA 4Q4LA 5B57C 2FEOA 2GNOA 4HAYA 4M9ZA 5H70A 1Q0UA 4AKIA 4DB4A 1XMVA 1DAGA 4RFSB 3ZD6A 2RHMA 4A2WA 4D4KA 4KYIB 4P31A 3N5CA 4V0LA 3B1YA 3GMTA 1P4SA 1P60A 4M1YA 5EXXA 1FQKA 5FPTA 1VCNA 4QG7A 5AUNB 4NCJA 1KK1A 5JEEA 5G40A 4DCSA 4P4UA 4NBSA 2VBCA 3B7GA 1MO4A 1ZUNB 1Z07A 4B33A 4OJQA 5AK0A 2WOJA 1XTJA 3KFXA 1XTRA 1H8ED 2NO6A 2NO7A 4IFBA 3EPKA 1E0AA 3KL4A 3SS8A 3C14C 3HPQA 3IO5A 2ODWA 5CJPA 3V4FA 4UQOA 4ZDIA 1KNQA 3MFYA 1TPZA 4Q5IA 4TT3A 2IYVA 3BH6A 2C78A 1G8FA 2JJ1D 1FP7A 1LVGA 3P20A 3SHWA 4MGKR 1EFUA 1YR6A 2N1BA 1FX0A 2OFWA 3LO5A 4QXAA 5FOXA 3REGA 2JLXA 1M2OB 1P62B 4TLCA 4Z8XA 2OCPA 2EYQA 4YQFA 1Z83A 2WIAA 3ASYA 4QC2A 2CBZA 2VSFA 4Q4HB 2CVHA 2HT6A 4DRZA 4RD0A 4B3GA 4IKEA 3ONWA 4BUJA 4DKXA 1LS6A 2AWNA 3T5GA 1GVNB 4L9SA 1VHTA 1D5CA 3AV0B 1BYUA 4QGAA 3PEYA 1A4RA 2QBYB 1SVKA 4UKDA 4ZCLA 3AVPA 4CEHB 4NPHA 4GP6A 1CR1A 4EPWA 2FWRA 2ZI3A 1DG1G 3RRNA 2Q6TA 4N0EA 4BGDA 3C16C 1ANKA 1SKYB 4UNRA 2HYIC 1CEEA 4JVLA 1GNPA 2V54A 4L9WA 4NCIA 4NCHA 1UAAA 1T8TA 1NSTA 4KCGA 1OHHD 4DBLC 5AUQA 1OXTA 2VF8A 4ZIRA 4GSYA 2IC5A 2ATXA 4EFLA 3CZQA 2WWHA 2GCOA 1XJQA 4BRUA 4L15A 4RKEA 3WNCA 2A5FA 1HQCA 2P0EA 1CKEA 1SVMA 2LWIA 5J4HA 2VP9A 3K1JA 3GJXC 1CJTC 1GP2A 1YZQA 4OQFA 4PO1A 1UBCA 2J1LA 1US8A 1E98A 4Q9HA 1EFHA 1R0XA 1Q1ZA 4L8GA 3CF2A 1Z0DA 5JZVA 2Q3FA 4FWIB 3WBJA 1SVWA 2CE2X 4LRWA 2R6FA 1LNZA 1TMKA 3LDAA 1T3SA 4BE7B 1Z6GA 1GDDA 4A6PA 3PR1A 1XMIA 3QOFA 4PX9A 3WP0A 3BK7A 6Q21A 4YMVA 1KTVA 4TL6A 5CIQA 3FPAA 2XTMA 1J8YF 2FFBA 3NHAA 1Z0IA 4KLZA 5F98A 2OLJA 2YOGA 1SXJD 1KZGB 2IT1A 4ARZB 1W36D 3QJYA 4HZIA 3U3JA 4BECA 3ZVRA 1KJYA 1IQPA 1S8FA 1XZQA 1ZNYA 3HPRA 4PSAA 3X1WA 4C30A 4DDWA 4LUCA 2WVJA 3X1DA 2WJJA 5EE5B 2VA8A 2W0SA 4BRWA 3DM9B 3QXHA 4NYIR 1DARA 1G5TA 3W5IA 2D74A 3U7EB 4Q19A 4JYCA 1E9SA 5DYIA 4F7WA 5HR5A 3KQUA 4H1VA 4CVNA 4CEJB 3KTAA 3QG1A 4FMCF 4V0ME 5JHGB 3SQWA 4DB2A 1OPXA 2CE7A 1YKSA 4PSKA 421PA 5HKKA 1E1RA 1OFUX 4JJZA 3O8DA 2QAJA 3CRW1 1K5GA 1E9RA 2QU8A 2WPDA 1G7CA 2NO0A 5CLLA 3UWOA 2VP5A 4MRVA 2VIIA 1E0SA 1FZQA 4JT2A 4WZ6A 4TYNA 1Q1QA 2G0TA 1ETUA 3EIEA 3OAAD 1RFLA 4NTZA 1XXHB 5AJXA 2H17A 3HU2A 3MCAA 4PQYA 4RD3A 2QRZA 5C46F 5EP4A 1F5NA 1KYIA 3EW9A 2X2FA 3CPJB 3AB3A 5L3RA 2H5EA 1U81A 2F1IA 3K0CC 4MGZR 4U00A 4QKQA 1KO5A 5CB8A 3KQLA 5IF9A 4MQBA 3U3OA 2X2EA 4ZKEA 2W00A 4JBYA 2O8FA 5L3SA 3KXIA 1N6KA 2GJAA 2GETA 1N5IA 1BS1A 4QM7A 1EFRD 1YRBA 4WAUA 1IONA 2O8DB 4PHFA 1OV4A 5KTYA 5JSZA 4YDSA 2V4ZA 1XPOA 2JLZA 221PA 2J3EA 4IDOA 1NVVQ 2RMKA 2GILA 4GI7A 2ZPTX 2IX3A 1YZTA 3A1SA 3QXCA 3TQCA 4PSVA 5EE0A 2GESA 1JAHA 2GBLA 3IHWA 3IPYA 3QEOA 1NJGA 1H8HA 1JJVA 1Z3IX 3QVVA 3GLIB 3W34A 2YKGA 1UPTA 4NP6A 4BZPA 5FUWA 2ZUDA 1KSGA 1G3MA 2P5SA 1JR3E 1I4TD 2J7KA 2NPIA 4QJ5A 1A2KC 5BN5A 4Q7LA 5HTKA 2R44A 3QG5A 1FOEB 2CLCX 3A8TA 1EFTA 1Z5ZA 3DMNA 3PUVA 3ZYCA 4ESVA 1Q3TA 4JLBA 1UBGA 2R8RA 3AKCA 5CJ2A 2J7PD 1W2GA 1Q3HA 3L0SA 4GOXA 4HDCA 2NO9A 4JLAA 1OXSC 4AK9A 1XBTA 4Q1EA 3T12A 2GA8A 1E69A 2L0XA 4O3MA 4TLEA 2B21A 3AP2A 3IEUA 1E2HA 5EZ6B 2V7QA 4RD2A 1KK2A 3EZ9A 4AKEA 3W3AA 4BFTA 2QL6A 1M74A 1X1RA 3W5JA 2ZXUA 4V0NA 2NG1A 1YR8A 2ZRMA 1SXJB 1VPLA 2GTPA 3O8BA 2ZJ8A 4X8HA 4KFSA 3W9YA 3C5CA 2ZE8A 5FUYA 3W6PA 2DHRA 3CZPA 2PZFA 3ZH9B 1GRNA 2XJ4A 2ZETA 2BBTA 2IUTA 3HJNA 3I61A 2FZLA 3D7MA 4DSUA 4MUBA 1Z47A 2V1UA 4IDQA 2ZRPA 5KUTA 4Q1AA 2Z0MA 2PT5A 4IFEA 2A5JA 2GEDA 2R6AA 3SJBA 3C4JA 4U02A 3BH0A 3HYRA 1QHXA 5TV2A 1OF1A 5IK2D 2IHYA 3D31A 1HEIA 1Y63A 1WDTA 3AP3A 4G5SA 4URZR 3VMFA 1NLYA 1DAFA 4OQNA 4L16A 3MLEA 1OB5A 4EUNA 4GZLA 1GKIA 3SOPA 4F91B 4JLNA 4Z8YA 4B35A 3IUYA 2OCAA 2W6JD 4R98A 1G9XA 4XD7A 1G3RA 2YWEA 1TQ2A 3RRMA 2BBSA 2ZRCA 5FUVA 1D2MA 1T0HB 3HWSA 1KI4A 3BS4A 3N2IA 1WE2A 4KLNA 4B34A 4ZKDA 3VHXA 2IS2A 2YJTD 3KX2A 1N0UA 3NC1C 1VIAA 1ZCAA 2AHOA 3THXA 3RC3A 2ERXA 4TZ6A 2VRWA 4YMUA 4W9MC 1Z2CA 4Q1DA 3FHTA 1WMSA 3LWNA 3ZDQA 2IEYA 1C9KA 1UJ2A 4ASUA 3NH9A 4DSTA 1Z6TA 4WZBE 3C8UA 4G5GA 2ONJA 1JNYA 2WWIA 3EA5A 1N2CE 1RYHA 1E9EA 5KDLA 1QDEA 3B1WA 4Z1MD 4C0AC 4V0OA 1XNJA 2H1LA 3LXRA 1ZM3A 2OBMA 3QPVA 4K46A 4D25A 1D9XA 4KO8A 3M1IA 3OESA 2YV5A 5EP3A 4BEJA 5JCPA 1OT3A 1RPZA 1MRSA 1NLZA 3HU1A 1FNNA 3QXJA 3UK6A 3LD9A 2WM9B 1II0A 4M1MA 3ICQB 4P3YA 2UVQA 1BMFA 1G21E 2A3RA 5KYKA 1LY1A 1CJMA 2VHUA 4WXPA 4CYMA 1AM4D 3LX5A 2IUUA 1OIXA 1U8YA 4LX0A 4G5QA 3CX6A 1YR9A 3OEEA 1E4VA 3BGWA 3PVSA 2IUSA 3U6BA 1SGWA 3AVTA 2JDIA 3I5YA 2KB0A 5KNBA 1XU4A 3NXSA 1MV5A 3ADDA 3GEHA 4JL5A 1N5JA 2C5LA 4HZUB 3OFNA 1KI2A 4WA7A 5B30A 1LB1B 4H1UA 4MH0R 3BD9A 1P72A 3W8NA 3IQXA 3BJIC 1S2MA 3RS5A 4NL4H 1RRCA 1UF9A 2IBMA 1OYWA 2QPAA 3DKVA 1TF5A 2GWHA 3FMOB 3MJRA 5CLQA 4O2LA 2OCYC 2IWHA 1D9ZA 3QQ5A 1FFHA 2P6NA 2BWJA 4JKIA 1KMHB 3LLUA 5M04A 2CNWD 1YR7A 4B6FA 5F3WB 2ASEA 1LW7A 2OESA 4PTLA 1W36C 4HLCA 2PT7A 4LGMA 2FEMA 1SQ5A 3AQ4A 2G9NA 3FOZA 1F60A 2IXGA 2HDNB 2QT1A 2VYFA 5KHOC 3VNVA 1CF4A 4Q01A 3HDTA 3ND9A 4AURA 1XZPA 4XVQA 3X1ZA 3AKDA 3TQFA 1IJFA 1VG1A 4BQSA 3CRMA 3T1QA 2GJKA 3WMFA 2DCUA 4RFSA 1YZKA 1GWNA 2C03A 4KSCA 3MJHA 3TLXA 5JJIA 5D3QA 1PLKA 1XMSA 2BDTA 1F2UB 3SFZA 1YQTA 2BJVA 4EAQA 3K70B 1R8QA 5GJVC 3ZS8A 2BC9A 4TZ0A 3CRVA 4XTRA 3P4YA 3MGCA 4WIAA 4A36A 2HXSA 2OAQ1 4DEYA 4KU4A 4A0HA 3GCGA 4URUR 3P27A 3B1ZA 2AKYA 4P33A 5F2EA 4TSFD 3UMRA 2QMUA 1QVRA 721PA 1KK3A 2XZOA 1F6BA 4LC0A 5G53C 4HUQB 3KB2A 4YLGA 1NIJA 3K0CA 3TBKA 2Z83A 1HA3A 3Q5EA 4HB0A 4B75A 4E22A 1SULA 1G18A 1FP6A 3QVUA 2W2VA 4Q4HA 3AVVA 4A0GA 2OFXA 4ZCIA 4DDVA 5FOTA 4S35A 1OJLA 2V6JA 4I1SA 2DYKA 3GFTA 1E2DA 1Z06A 4MKIA 5EE1A 1QG2A 3B5JA 3W6OA 2QBYA 4HYYA 3BERA 1W0JD 4CEHA 4IRUB 2VF7A 4IDPA 1DBSA 2HF8A 3HR7A 3RABA 4X8OA 1E79A 3K0FB 1L8QA 1X3SA 1DADA 2ZREA 3REFA 2E1RA 3ADBA 2BIFA 2VP2A 4ON9A 5ELXA 4KBFA 3CNOA 1KAGA 2B8WA 3AVQA 2ORVA 3H2YA 2BEKA 4DLTA 3AGPA 1TF7A 2XNDD 1KY3A 2HJGA 2V1XA 2YINC 2CK3A 4NYMR 3ASZA 4IOLA 1VDZA 4M1KA 1U0LA 4A1FA 521PA 4E09A 4J0QA 2OXCA 2HXYA 3A4NA 3VAAA 5E3HA 1KKLA 2XSZA 4DLUA 2CL6X 2F9MA 5FH9A 5DI3B 3U4QB 1DVRA 5FTNA 2NO1A 4LWZA 1LTQA 5FI0B 3RS0A 2ZS7A 2CJWB 4K81B 4A6XA 3U44B 1KNXA 3R7WB 5CDFE 4LYFA 5FL3A 1GFIA 1GZSA 4I1UA 4DJTA 2J0VA 2PJRA 1KI6B 3CW2A 4RJLA 3THOA 1E2MA 2WKRA 4PANA 2F3RA 1XX6A 1W0KA 3DKPA 4CW7A 1EXMA 3C15C 3RS7A 3WRYC 1EGAA 2IF2A 4RZUA 4DXAA 4JLDA 4I99A 4XH9B 3AUYA 1E2KA 3SN6A 3TSOA 5EXPA 5EQTA 3K09A 5CDFA 1OFTA 4LBVA 5JRZA 3IILA 2QAGC 4PAMA 1N5KA 4UXHA 3B60A 4YXWA 1FPMA 2G77B 3T61A 4DLXA 2QGZA 5E7JA 2YOHA 4EJSC 3U7GA 3VKGA 3BFVA 1M6NA 2YWHA 3P1JA 5J4KA 4AYTA 1T4GA 4CEJA 1KK0A 3J81k 1AIPA 3IKJA 4GOKA 2H92A 5FOUA 5DISB 3RRZA 4IHQA 5CITA 1E0JA 2PX0A 2Q21A 5AJVB 1RRGA 4Q4AB 5JFGA 1QVAA 1I4LD 2QSZA 3BB4A 3HU3A 3GP8A 1KHTA 1UDXA 2FGKA 3GJ0A 1DAEA 3DZDA 1XB2A 4LHZA 2P65A 4A15A 1P2UA 4DVGA 2ZVPX 4YC7A 1TUEA 4PC7A 1E2EA 3EWAA 1XFAA 2JJ1A 2ZAMA 3PJRA 1XXHA 5AUOB 2WKPA 4TLAA 3U2QA 3NBYC 5EE3A 2QQEA 2BHRA 3EG5A 1YE8A 2JLUA 3A1UA 5GJCA 3WY9A 1FNMA 2WMNB 3KJHA 4TN1A 3FHCB 4CDGA 2J9RA 4YDHB 4G5OA 1FQJA 1DELA 1NSFA 3CF6R 4EPYA 3AF4A 5B58C 4NYMQ 4QJ4A 3T15A 4AYXA 1E99A 3AVYA 2UZIR 2XOKA 2O8DA 2QEQA 2W6ID 3FMPB 2V3CC 1Z0JA 2GXAA 3GLIE 2MSEB 1G6HA 4RZXA 1NBMA 2G88A 1TX4B 4QM6A 5JLJA 3CF0A 3RWOA 1VYVA 4AYWA 4Q1CA 4IXMA 1Y3AA 3V4RA 1COWD 3AF2A 3E1SA 1HUQA 1IXRC 1IN4A 2IS4A 1O3YA 1S4QA 1HQYE 2FU5C 1OHHA 3PUWA 1E2GA 3BAFA 5B64A 2GF9A 3GLIA 4HAXA 4OJKA 1ZM7A 3UG6A 1KIMA 1N6OA 3GLFE 4U7DA 3LBHA 4C0BA 3R9IA 2ZS8A 2J0QA 2EFEB 4D0NA 4JLJA 4MYHA 3D8BA 2VSOA 3K9GA 1Z22A 1G3QA 2XGJA 1G7RA 3NHBA 3ZQ6A 1W48A 4M21A 4PPNA 4B3DA 2ZRHA 4OL0A 2QM7A 1T8UA 5AUPB 3CR7A 1DAHA 4KV9A 1CP2A 5CK5A 4AWXA 2ZJZA 2BMDA 1WB9A 1NN1A 2OEPA 2Q9AA 1SXJE 4PZYA 2QNRA 3R20A 1HT2E 3SEAA 4OHXA 2REBA 5KSZA 2PX3A 2IXEA 1JBKA 3CX7A 3EC1A 3H1TA 4LY6A 1GITA 4DLWA 2GXUA 3H84A 3W90A 4DLZA 4BLSA 2ZR7A 3K0SA 4WZAE 1JQLB 1U2RA 1SXJA 1TUIA 3BB3A 3B9QA 3DL0A 3VKHA 2PJZA 1U94A 2JIZD 1IXSB 5AJWA 1KMQA 2F43B 1KO4A 3ECCA 2WJHA 4LHYA 4GOJA 4FD2A 5D3MA 1MO5A 4DLVA 1E6CA 1EK0A 3TH5A 4DLRA 5E7IA 3LW8A 4RFVA 3AF3A 5EE9A 2DWOA 4Q1BA 2F3TA 5G41A 1N6IA 5KU1A 4HEJA 2QP9X 2IXFA 3LFUA 4FIDA 2DFNA 2ZRBA 4OQLA 1UEIA 2FV8A 2PBRA 2ZRNA 2F55A 2IYQA 4LI0A 4MRNA 4B32A 2PEZA 4TWZA 1VCMA 4B6EA 3R8CA 3OEHA 3V00A 2BJWA 2PLRA 3KDSE 1JXOA 1XDBA 3AF1A 1ZYUA 3D3QA 1ZD9A 1OH7A 1G16A 2YYZA 4FCVA 3WHLA 4TYYA 3OAAA 2KE5A 2ZVQX 1N6LA 1D6JA 1XEXB 5LB2A 4F93B 3LW7A 3QENA 3QBVA 2CCKA 3A6PC 5FTLA 2QMEA 1UKYA 3BORA 1XRJA 3LVRE 4TL8A 4TMZA 1KGDA 2D3WA 2WV9A 1R5BA 4BZXA 1JEEA 1W7AA 3OE7D 1CBUA 4JLMA 4MYUA 2RGCA 2BV3A 2CHVA 2HLDA 3T35A 4Q4JB 4QHTA 3WXMA 1OE0A 1Z8FA 4WBSA 1EFRA 2MSDB 4UJ3A 3ZVLA 2ZSDA 4MKGA 4PPFA 3AUXA 2CMKA 4BLRA 4JYBA 4CF7A 4PXAA 5J47A 3IIKA 1BIFA 3GQBA 2QQ0A 3MWLA 3Q7QA 2C95A 4HLDA 3LA6A 5K8UA 1W47A 4HB3A 4LJ6A 4TMVA 3W8RA 2IWRA 1XD2B 4B76A 4FMDB 5JS7A 3O8CA 2ZITA 1KDTA 3HP1A 1IJEA 4S2EA 2JLRA 1BYIA 1P73A 2C2HA 2BKEA 2WWYA 2ZRKA 2VP4A 5TXGA 2R65A 3OZXA 4LJ4A 1OIVA 4M9SA 2BEJA 5DIFA 3IHLA 4LHVA 3MRSA 3VR2A 1DOAA 3DOEA 3KJGA 1ZD1A 2D62A 2I4IA 3DZ8A 3W6NA 2JLYA 2PZGA 4ZCMA 4TT3D 2ZI4A 1A2BA 3VHLB 1E4YA 3H86A 4O0MA 4P32A 4OHZA 2BMJA 2ZANA 2DPXA 4F38A 2C9OA 4NCKA 4B3XA 2REXB 5EXTA 3UWKA 121PA 1VYTA 3EA0A 5JWOA 4HZUA 3G5UA 4Q7MB 4BFWA 3FWYA 3QE0A 3QF7A 4Z54A 4V0MA 2FSGA 1KAOA 4HDQB 4C0KA 4DUGD 1AZSC 5TY0A 1WCV1 2IYXA 1FMJA 5KNDA 1J8MF 1RYFA 5BWMA 3ZVNA 5F9HA 4JL6A 1ZNWA 3THYB 2AWOA 3C41J 5EUQB 5JMTA 5JWRA 1LFDB 2JEOA 2PEYA 1KI8A 4WOPA 4BLPA 1GUAA 5CB6A 2WTUA 4B2LA 1KMHA 3KZ1E 3NWJA 1FW6A 1W49A 1BH2A 2R6DA 1GILA 3DOFA 1PLJA 3QKSB 3ZZTA 3U3MA 2ZAOA 5TDHA 4DCNA 2WWWA 4I81A 4ACBA 2E9SA 1UEJA 1A5TA 1CR2A 2O5VA 1Z6AA 1ZNXA 3DO6A 2MSCB 1ZC4A 3CM0A 2XTNA 5J4YA 3LQRA 4W5WA 1CJVC 1A82A 2IA5A 2XAUA 2J0UB 5JBQA 3UANA 5SZJA 5IK2A 3PFIA 1PUIA 3UIEA 5FBLB 1HY3A 1G8HA 4ERNA 1OIWA 4QNRA 3T1OA 1UBEA 2B92A 4Q9IA 4BZQA 4FMBB 1F2UA 2JJ8A 2Z4SA 1GM5A 2W6JA 2ZJ5A 2D2FA 1HYQA 1UM8A 3BFKA 2AL7A 4FN5A 1TAGA 2CLDX 1WP9A 4TLBA 3K8YA 5F9FA 1OYYA 3LAWA 1J99A 1HT1E 2EYUA 4IXNA 5HZHA 3ZIAD 4UNSA 2GDJA 4D0GA 3BFXA 1SKQA 2GJ9A 4LV5B 2HCBA 4TL7A 5L3QB 3FKSD 4W7SA 1C4OA 2FSFA 4FMCB 4HATA 4HUQA 1MR3F 3GLFB 1DO2A 2WSSA 2XX3A 4XWKA 1X8LA 4D6PA 4TMWA 2RGXA 3FYHA 1JR3A 2V8OA 4MDFA 4NYIQ 3UPUA 2A5DA 2ODNA 3BE4A 3TVTA 2YWFA 1CRQA 3EAQA 4NKRA 1X8JA 5DNYB 4HI0E 4NCNA 1T9HA 3TUIC 2VL7A 5KDOA 4E5UA 4O25A 4XWOA 3V9PA 2QTFA 5FPKA 3EIQA 3WMEA 1FUKA 3EZ2A 4U5XA 2Z43A 4OHVA 3CUEF 1W36B 1R5OA 5HKKD 4Q02A 1M1YE 2DFKB 2GXSA 4M9QA 2AXPA 2XZPA 1KSFX 3K0FA 4OBEA 1TQ4A 2YC2C 2ZE5A 2FPKA 4YMTA 1WF3A 2WPDD 3UKDA 3NVAA 5DN6A 3EXAA 4AG5A 3B1VA 3QXSA 2RGAA 5D3MB 4BFYA 2P5TB 1WQ1R 1MRNA 1AN0A 3WP1B 2CLSA 5GJBA 3L82B 2JGNA 1RJ9B 3FMFA 2DWPA 2G1JA 3Q3JB 4BPBA 3JVVA 2EW1A 4AD8A 1OFIA 4HDOB 4JJKA 4B73A 2QN6A 3I72A 1SVLA 1XCGB 4C2UA 2WHXA 3P4XA 2ZE7A 5DI3A 3U4QA 1G41A 3AKEA 2FFAA 3SYLA 2GAAA 2H7VA 3TE6A 1D8TA 1WA5A 2CJWA 2V55B 2FJUA 5FOSA 3U44A 4M2LA 3R7WA 1W5SA 1AKYA 1QBKC 3QIAA 1KI6A 3QPUA 4P0TA 2AX4A 3ZZ0A 1M7BA 1NG1A 1G3IA 3B85A 5E7MA 2BKUA 3A1TA 1NVXQ 2YOFA 4URWR 4A0FA 1H8HD 1CJUC 3VR5A 4CZ2A 4JSTA 1MABB 3LRPA 1UBFA 4LZZA 4G01B 5LBIA 2PMKA 3WYGA 1AS0A 3RVBA 2BVNA 2QP4A 1HV8A 3AVWA 1GL7A 3C7KA 2GK7A 2WKQA 4RD6A 1JXMA 2C98A 1AK2A 1O87A 4TTPA 4FINA 2O0JA 3I8XA 3SYNA 1RW4A 4OI1A 4B2IA 4URXR 3C5HA 2TMKA 4Q4AA 2XTZA 4PZZA 1G64A 4KFRA 2JCSA 2NPFA 1CIPA 1KDOA 3IIJA 3RS3A 4R71A 2IYZA 4IDNA 1FTSA 1E2QA 3LY5A 1KI3A 5IRCD 1ZU5A 5A0FA 4W5HA 1OLOA 3IBYA 2AFHE 5DHAA 2V7QD 2DY1A 2DR3A 2OILA 5EZ5A 4MYTA 1G291 2IYWA 4WVFA 1PJRA 3ETLA 5FPYA 4TQUS 3SHFA 1W4RA 2ZYWX 3PUYA 2PCJA 5FL7A 3R9XA 1NY6A 1EG7A 3CWQA 2J45A 3FE2A 4JVNA 3MMPA 3MWJA 4C0JA 4Z51A 1TTTA 1ESNA 1U0HC 3SC3A 4EPXA 2ZRGA 2IYYA 2G0NA 4UNQA 2RCNA 2RGNC 3GJ5A 1ODFA 4IW3B 5EP2A 3SBDA 3M0EA 2DB3A 4HLUC 2OBNA 2FMXA 1XEWY 2KI5A 1P3JA 1JPJA 4US2R 621PA 2WOOA 1W0JA 1P2SA 3Q8XB 4MGYR 2CCGA 4MRPA 5IDVA 2WSMA 5C4GB 4UNPA 1KOFA 1W46A 1NMZA 2CHQA 3OIWA 3ZQJA 2PZEA 2QROA 2QAGB 2F7SA 5LDDC 4XD7D 5CYPA 1QHNA 4QBHA 4EJSB 1Z0AA 2ZEJA 4MDEA 4XVUA 5DI9A 4Y0AA 2JLSA 3I3SR 4D4MA 5A4JA 2H16A 1R8SA 1G20E 4JLKA 2XNDA 4M0LA 1HTWA 2IYRA 5BQ5A 1R6BX 2IYSA 1YZUA 1G17A 1KDRA 3I4LA 3VQTA 4B43A 4DT1B 5JEDA 5JJKA 5FTKA 1NKTA 4L5BA 2WWXA 1G7SA 1DS6A 4UXJA 1ZVQA 2ZYVX 4CEIB 1ZMXA 2ZIAA 821PA 2OSBA 5FFMA 1KZ7B 1ZM4A 5DH9A 4D26A 3PIRA 4A2PA 4Q18A 4NE2A 3F8TA 4RVCA 1NN5A 1CLUA 4DIEA 3CNLA 1L2TA 2XXAB 2FN4A 1GNQA 1E3MA 3BXZA 4TMXA 4EFNA 1DTSA 5FR2A 5SZKB 2CCJA 4DDUA 3RS4A 4IOKA 3A4LA 3FKQA 4IJMA 2CL0X 1GSIA 1X8KA 3CB4A 3THWB 1SZPA 2QPTA 2GZDA 3NDBB 4R2HA 1IY2A 3B82A 5TVKA 4KBGA 4FWTA 1II8B 4QFMA 4TTQA 3IQWA 5AJZA 2ZJBA 3ADKA 2D7CA 2G6BA 4PHHA 8OHMA 4LHWA 4BEBA 2LCFA 2D4HA 2HF9A 2F43A 4LHXA 1N6HA 4HB4A 1RRFA 2GEUA 3NIBA 1XJCA 2QE7D 5BW8A 1PZNA 4CT4B 4OK6A 3KXKA 2IYUA 1NMYA 2F6RA 4US1R 1R5NA 2QP3A 3OEED 4RCYA 2ORWA 2J41A 1S9DA 4LV8B 4DZZA 5K8IA 4LJYA 1Z2AA 4MUAA 4KYUA 5G3ZA 4JZKA 1HE8B 1VTKA 4M1SA 4RSGA 4KXFB 5JHHB 3PEUA 3OFND 4LC1A 2WBLC 1L7VC 1JECA 1D2EA 2GK6A 2KBFA 4MRSA 2ZJYA 4URYR 2A5YB 1U8ZA 3CPHA 4GT1A 1T5LA 2W0MA 2ZRAA 4TLDA 2MMGA 2Z4RA 4GZMA 4PR0A 4LYHA 2IW3A 1NVUQ 5DYGA 3QI2A 4IVPA 1FMLA 2KWIA 1IN6A 2QT0A 4CGZA 1NN3A 2QGNA 2BM0A 1E1QD 4BLOA 5J4VA 1XEXA 1IN8A 2JJ2A 2GZHA 2P3SA 3FDIA 4RKFA 5JI3E 1IOZA 3U61B 3L0IB 4EIWA 2ATVA 3BH7A 4II7A 5IT5A 1XMJA 1TEXA 3T06B 1JAIA 1X6VA 1ZIPA 3VU9B 1CR4A 1LF0A 3KJEA 1W4CA 1M7GA 1W1WA 4AG6A 2A5GA 1RZ3A 2FF7A 3NKVA 4DCUA 4Q4JA 4ZI3A 1D2NA 2QENA 2WJIA 1E9BA 1AZTA 1G4UR 1ZU4A 1Q22A 2C8VA 4POAA 2XITA 3GFPA 3K9LA 2H8KA 2FFHA 4FCTA 2X1VA 2OCBA 4Y0VA 2X19A 4QOSA 4PPQA 2A9KA 4OQXA 2RGDA 1II9A 1T0JB 1UKVY 5BYJA 5TMPA 1COWA 4KVAA 4AKHA 4B3FX 5UKDA 1Z08A 1DO0A 1N0WA 3KUDA 1PV4A 1GIAA 1XD2A 4TL9A 1E2JA 1Q1EA 3E5HA 3Q85A 3RANA 3AVUA 1E94E 4HB2A 4B2PA 2A7QA 2ZJAA 5FBWB 1G8YA 1ZIOA 2EFCB 3QEJA 4QBGB 3TUZC 1B23P 4QJ3A 4BASA 1PLLA 1N0VC 1NKSA 3CX8A 3IBGA 4DSOA 5A5GA 1VKJA 1E2NA 1VHLA 2PLFA 3KQKA 2FH5B 5JRJA 2F1RA 4M1TA 4WW0A 2WJGA 3UXMA 1YJ5A 4FXPA 4MGIR 3RSOA 3EZFA 1XTSA 1VECA 3I5XA 3ZLJA 4D4JA 1H8EA 3RS2A 5FUXA 1XEFA 2C77A 4MKFA 1T3LA 1SVIA 1NP6A 3QPWA 2O8CB 1U0JA 1TNDA 2G83A 1NNEA 2B7CA 1R4AA 2AK2A 2F9LA 3T1VA 3MWYW 3TNFA 4TYWA 2ZTSA 3THYA 2J87A 2UZ3A 4PFSA 4EPVA 5EUMA 5KOYA 1SVOA 3BWDD 4B47A 4BFZA 3LVQE 4EFMA 1FTNA 1L4UA 1OXVA 3L0OA 2XB2A 1E79D 2JIZA 1U90A 3M6AA 3SJAA 2DFLA 3AM1A 2ZSFA 3FFBA 5GVSA 4NH0A 3QKSA 3R8FA 3MUFA 3VR3A 1F3OA 1J7KA 1AKEA 2QPOA 2ZSBA 4EKDA 5J40A 1OKKD 2PH1A 1KJWA 1N5LA 3K9NA 1EFCA 3EASA 4LPSA 2ZRIA 3OF5A 4NDZA 1W4AA 2Z5FA 2KSQA 3WYFA 4BWYA 2J0UA 4UJ5A 1N6RA 3IGFA 1TADA 3NTUA 3Q5DA 3CBQA 3H0KA 4C9BA 2CK3D 1A1VA 4QHYA 2OT3B 1AQUA 3IDQA 5BYKA 4XSHA 1XTKA 2GJ8A 4GMXA 5ANRB 2RGGA 5J4LA 2BBOA 2ZU6A 4HLQB 4JIMA 1Z6XA 3L8YA 3KQHA 3WNDA 3GLGE 2FDCA 2BOVA 4L4UA 4P4SB 4Q7JB 3X1XA 2IS1A 1XTQA 3CKLA 2VHTA 5C2JB 1FUUA 1EX7A 3RYTC 4D4LA 2EQBA 1F48A 2ZI6A 4O2RA 4JMPA 1IBRA 4PAOA 5BN3A 5JWHA 2AD1A 5L3QA 4JVMA 3TSWA 2J5XA 2NTYC 4EPRA 3KKNA 1A7JA 4MA4A 3ZS9A 1W0KD 1TL7C 2GEVA 2OHFA 5L8VA 3GLFA 1E9DA 1S1CA 2QZ4A 3JVUA 3QUSA 4PAQA 2RAPA 4QBFA 4ZI2A 1IN5A 1P6XA 1PUJA 2EU8A 3OE7A 4B74A 3LH5A 2GAOA 2NZJA 2O8BB 1SVSA 1CRPA 1K6MA 1XF9A 3K0AB 4YXWD 5DE3A 3H4MA 4KSBA 1E2IA 1P9RA 3EZ6A 2OBLA 4EDHA 1KSJA 2AKAB 3U7HB 3WYAA 3CH4B 4FCWA 2LKDA 3T5DA 3NDPA 1T91A 5P21A 1ZCBA 3ZVMA 3MSXA 4WXRA 4A8JB 1Q57A 3CRRA 1H65A 4G5RA 1ZM9A 3QF4B 2IL1A 3DM5A 5FTJA 4N3NA 4Q1FA 4A2QA 1ZAKA 2QA5A 2N42A 4JLVA 5FPHA 2Q3MA 1I2MA 2W58A 4IVQA 1NRJB 4OI2A 4N0DA 4QGHA 2ERYA 2WAXA 3RC8A 1G6OA 2JATA 4LPKA 5TARA 3TR5A 5TB5A 1GL6A 1AJEA 1N6NA 1VG8A 1TU3A 4R7ZA 1IAQA 5HCNA 1RJ9A 3QKRB 3EWSA 2ZS9A 3MG9A 1RKBA 1J90A 3DVLA 2RB4A 2FG5A 2ZUBA 3AF0A 4FMDF 3CWZA 2O0HA 2GJSA 3WMGA 3KKPA 4AIIA 4PHTA 1E9CA 1TEVA 3CNNA 4YMSA 1UDWA 3U60B 3PUZA 5CIWA 5FI1B 5FBVB 3JZAA 2WJYA 3NBFA 1S3GA 1GKYA 2BBWA 1R10A 1DEKA 4PHGA 1ZNZA 2VHJA 4DEXA 4BFSA 4DUGA 1KI9A 2ZR9A 2IF0A 2QRNA 2REOA 5C4MA 2XOKD 4V0KA 1F2TB 3AVXA 3GJ8A 4F4JA 5KDDA 1XWIA 2W83A 3A1WA 3RWMB 2NMVA 3SE0A 1NBMD 4C7OB 1N6PA 1YHNA 1UKEA 5FPSA 4ESHA 1VIYA 2R6CA 3PITA 2EFHB 1MO3A 4M22A 4ACAA 1AGRA 1JEDA 2FNAA 1SHKA 4JKYA 3VR4A 1U9IC 1NN0A 4TQAA 1GOTA 2DWQA 2PL3A 3NC0C 2OG2A 3TAHA 1QF9A 2ODEA 4XTCS 3KUCA 2ZJ2A 1Q44A 4V03A 1MABA 4TYPA 2IHBA 2VO1A 4HAZA 4ZO4A 4XVRA 3VX4A 3QY0A 4BFUA 1MOZA 2WIBA 2IS6A 3QNUA 1EESA 3EPJA 2YVUA 2RHDA 1E0KA 1KI1A 1KO7A 2OZEA 4B48A 4EPTA 4UXIA 2GF0A 3EIHA 5DSZA 5L3VA 1NVVR 2O8EB 5KSYA 4OK5A 4JLOA 1WBDA 3EPLA 2OFOA 3IO3A 1XCMA 3IPXA 4RD4A 5C1BA 1MT0A 5CM8B 4Q00A 4AY2A 3ZIAA 2W2TA 2WZQA 3B78A 3VKWA 3RNLA 3RHFA 4PPGA 2P6UA 3SDZA 1TQDA 4OYHA 5EJEA 1U98A 4D0LB 3RSLA 3K53A 1AS2A 3FKSA 3BOSA 4PZLA 5GADl 2ZYUX 1TU4A 4D2IA 5H8WA 2EWVA 4NHOA 5K8LA 2CXXA 1AS3A 2B8TA 3RLFA 2J7PA 4KVGA 4ZDKA 4JSYA 1S0UA 3S1AB 2N46A 2GCPA 1Q21A 2AN9A 2I1QA 5B2ZA 1OSNA 1QHSA 1KY2A 1P2TA 2ZJOA 4M4SA 4NONA 2O0KA 3TW8B 5KPDA 3BIFA 4PQFA 3RAPR 5KSOA 2YC4C 2JLWA 1LF5A 2ZUCA 4IOMA 2AR7A 3TSZA 2BM1A 3PG5A 2XNSA 1J70A 2ANBA 3GLHB 3IIMA 1IN7A 1KKMA 1OW3B 2FSHA 1WRBA 3VX3A 1G7TA 3DMDA 2FSIA 4A8JC 5AJYA 4XWAA 3DHWC 1UFQA 2JAQA 1I2DA 4TMKA 4US0R 2QAGA 4NMMA 3AH8A 1ZUHA 3OEHD 4PC6A 1JALA 2SHKA 2Y8EA 3FMIA 1ZINA 5CM9C 5AR1A 4EJSA 4G1UC 3G0HA 2AXNA 2WICA 1R7RA 4LJAA 4PC1A 2MMCA 4DCTA 1L4YA 2XEXA 4Q21A 4D80A 1N25A 3KKQA 2ZI5A 1QHIA 1HH4A 1V43A 4D82A 3E2IA 3FVQA 2QM8A 2ECKA 5J5CA 1G4AE 2XB4A 4AKGA 4DT1A 4GBMA 4RCZA 2WMOB 1ZW6A 4GPTA 4N1AA 1E9FA 4JBXA 1P7CA 1JJ7A 3SJZA 4CEIA 1CXZA 2OUKA 3WBKA 4LJ9A 1B0UA 4NU0A 4Q9LA 1Z29A 2HLDD 3ADCA 2X77A 4EQ6B 1IY1A 1UKZA 3OIUA 1OXUA 3A36A 1M7HA 1R0ZA 4C3ZA 1PVOA 2R2AA 2XXAA 3ND8A 4XIGS 3O47A 4Q9KA 5HE9A 3LV8A 1XCPA 4UNNA 1Q20A 1P9WA 1M34E 5H68A 1UADA 3L0PA 1CJKC 3GLGB 3AVOA 1NG9A 3THWA 3UATA 3ZJYA 1OB2A 3K0EA 3U7FB 2EFGA 1MO6A 2B7BA 2QMOA 1II8A 2CDNA 1W4BA 2VSXA 4Z1MA 3E70C 4DDTA 1G1MA 4G3XA 4C0QC 3TGPA 4LJ8A 2GXQA 3T1TA 3O8RA 2YWGA 4OKSA 5JS8A 1QHHA 4LBZA 1VCIA 2OAP1 4GP7A 1E2LA 2KJQA 1YZGA 4H9GA 2QTHA 4HAUA 3B9PA 4OQMA 2HYDA 3FHOA 3MD0A 4OI4A 1E2FA 2ZYTX 4MITA 3TRFA 1BOFA 1E1RD 4HUTA 3SJCA 1QHYA 1ZC3A 3AEZA 4CRWB 2VLIA 1E32A 3B6EA 1K8RA 4B3CA 4C0LA 4M1OA 2H18A 2Q9BA 3GEEA 3DEFA 3B8HA 1C1YA 5LB4A 3LNCA 5E4FA 2KBEA 4ZDWA 3LBIA 1GL9B 1T3HA 4A4DA 3GJ6A 4HSEA 5SZHB 1KDPA 3BBPA 4A92A 3NG1A 1FX0B 4XSGA 2FPLA 1EX6A 2WWFA 3RDPA 4KFTA 2A2ZA 1CR0A 3WRXC 2FE4A 2V9PA 1XEWX 2PCLA 3VU9A 3BC1A 4RZ3A 3K09C 1VG0B 2BCGY 2D06A 5DLQC 4DLYA 3GJ4A 3DDCA 4W5JA 3TJZA 3QSYA 4ITRC 4MYCA 1RE0A 3TKLA 2E87A 3NH6A 2R9VA 4JLPA 3VNUA 4JT4A 2DBYA 4LJ7A 4LOAA 2ZU0C 2I1VB 3R9WA 4M8NE 2CNWA 4OHYA 1SHZA 4IDHA 2BMFA 2RGBA 1YVDA 3K70D 2R6GA 1ZM2A 2H57A 3TAUA 1Q1BA 3SFVA 3PEWA 5FTMA 3U6KA 4ZIRB 5LD2B 3P32A 1DAIA 3PCRB 3QKUA 1W44A 2CVFA 3FTQA 4LV6A 3PEVA 1BKDR 2GCOB 3U3KA 3HR8A 2RH5A 1VG9B 3IEVA 2NQ2C 2QY9A 2VQSA 2WAYA 1P5ZB 2P6RA 5FBRB 1GRRA 3LLMA 1US8B 2FFQA 1GRQA 2WSSD 1WBBA 1JR3D 4QNMA 4V02A
chains in the Genus database with same CATH superfamily
2ZE6A 1YB2A 1TYAE 1OTXA 1XZHA 1JB1A 3HABA 4Y7DA 1IQRA 1ODSA 4G1VA 1O54A 1PWEA 5H1YA 2VAPA 4YRZA 2FFRA 1QFXA 4BOYA 3FNEA 4X95A 4UTRA 5B3LA 3UOWA 3OZSA 2A78A 3O2SB 5IYZB 3NVKI 1DRUA 2Z6VA 4WNIA 1VQ1A 5I45A 2HA4A 2J9GA 3EMVA 2H4JA 4MULA 3RSZA 4KODA 2FPIB 2I4LA 3TTUA 4L2IA 1U04A 2AFIE 5FUBA 4B4VA 1JLLB 3W3AD 5ALVA 4B3MB 4KTTE 4O02B 1B16A 2G3YA 1KHHA 2H4FA 3GEBA 1XQYA 1BDHA 1RRPA 4K9SA 4AULA 2CZQA 1AF7A 1DKNA 2SBTA 5IF3A 2BP7A 3PGMA 3ABZA 1K7CA 1UBTS 2BM8A 4TMTA 2VDPB 3KG2A 4OHRA 4S1OA 2R6HA 3VPAA 1PGNA 3HXLA 4J2OA 3CB2A 4YHBA 4CGYA 4CKCA 4EZEA 1HDRA 4G0QA 1D0SA 1GZUA 4UUAA 3SSOA 4URVR 4X62B 1FRZA 4EY3A 1AUOA 1C41A 4DLSA 4M55A 4DC9A 1PT7A 1RXYA 3PQCA 3ITDA 4RV5A 4EG6A 2QE7A 3HBMA 4MRRA 4AKSA 3C7TA 3UKOA 4MKHA 4IDAA 3ZHXA 1TZJA 2VK2A 1GGNA 2WJVA 2Q2QA 4G1CA 2AIRA 1U8AA 4GI5A 1UWVA 4IIUA 5E4JA 2NXEA 2VEOA 1BC5A 4NJOA 4DSNA 4F4IA 1U3CA 2GTHA 2LNDA 3A58B 4X92A 5EN4A 2F1HA 3FPLA 1PTJA 1R0SA 4RD1A 1UXKA 1G4HA 1N78A 3WLMA 5DWDA 3UBTA 4MP3A 3L77A 1NYTA 5ALTA 2Z30A 1DJPA 3FF1A 3RAGA 1FL9A 4R2MA 4FKBA 5K0SA 1Z6YA 3EARA 4RH1A 4X6LA 1XMXA 3SC2B 4WADA 4KE8A 4TRNA 1NW4A 4ECEA 2D0OB 1QM5A 2J5BA 4YAGA 2D7DA 2IJGX 1TVKB 5M29A 2OO7A 2RKBA 1Y89A 4GC9A 1CQJB 3IKTA 3JVDA 2B6HA 5AI0A 4OOFA 2HTFA 3QE3A 4AO7A 1Y3BE 1PDOA 3ETHA 1NNLA 3PQ5A 3MB8A 3CLVA 4II3A 3L6DA 4QTUB 4ASUD 2VDUE 2Z2ZA 2QTVB 2NUPB 4P2GA 5ARCA 3DXZA 2VTKA 3WX0A 3E48A 5T4HA 1G20A 1G8GA 3GOQA 3AIIA 3N70A 2H1OA 3KXLA 3A26A 3GFOA 5CM2Z 1ADCA 1Z16A 4Y9RA 4HRXA 1NPDA 2QMHA 3CPEA 3HKBB 1EVJA 3BULA 3R7BA 5JCZA 3PNSA 2YXPX 1BU8A 4KVFA 4KPFC 4DGSA 2G1KA 5HZKA 4DFDA 4PCUA 3NYIA 3HCDA 5E6UA 2ECOA 4G56A 4J1SA 1M75A 2Q28A 3OT1A 4CKZA 2JKYA 4PBRA 2P8SA 5AWFC 3KDPA 1K06A 1R0WA 3O84A 3BA1A 3Q9SA 3V1KA 4G86A 2NVUB 1TO1E 2J46A 1YZNA 3KPWA 1YZLA 5HCIA 1ZH0A 3U80A 3ZK9A 1JI0A 4DLBA 3AYXB 5TC4A 5LQDA 4UHKA 4HX5A 1N2HA 3DQQA 2ZSIA 1M34B 1BMFD 1M1XB 4GUAA 1EGHA 5KNCA 2IQIA 2QG4A 2J0SA 2X1HA 3TIIA 3HB0A 4ARUA 4IV8A 2ODBA 1QHHB 4YV7A 5B7GA 5CVJA 1CX9B 4QAQA 5AI9A 1U5BB 1ZRMA 2GQ0A 4IDBA 3TLCA 4AXXA 5BXQC 1RAHA 1XP8A 2I9KA 2JIRA 4DMMA 4BVHA 4A82A 1WSAA 3KDAA 3WHKA 3BIOA 4PRKA 4CTJA 1T6BY 2H0QA 1L5RA 1AXGA 3HCWA 3I83A 4NYJR 2JDID 1CZHA 3DD1A 1KC1A 1I4DD 5KPJA 3S4YA 5AKZA 3ZGXA 2ZDQA 2ENUA 4QQRA 2C9CA 2V7WA 2OD2A 1OH6A 4ZGWA 1IXZA 3NGMA 1JHVA 3WFJA 2LRHA 2VF5X 2XCLA 3A6LA 3K9WA 3LQ1A 3O8NA 2IEZA 4M54A 4PZAA 5FR1A 4A0RA 4LF5B 1NVGA 3JQDA 1P5FA 4UVDA 4O2BA 1F2TA 5KKCA 4A03A 3MA0A 1SBCA 3DSRA 1Y82A 1QZTA 4ZPXA 1XLTC 1B8OA 3ODGA 3BCSA 4GVLA 4LMAA 4O4IB 5EQDA 3G8YA 1AF4A 1L4GA 2P0AA 2QL5A 3D4PA 4FR5A 3ROTA 3PE3A 4DQXA 5JROA 1FS5A 4YRLA 4Y0NA 4YWJA 1K5DA 4BB9A 3R5TA 2RAUA 4R6XA 1WULS 4DMCA 4F11A 2F1JA 2XUJA 1HL3A 3Q7PA 3MAAC 1F0NA 3TECE 3TJRA 1S5PA 4DS3A 3DL7A 2DPMA 3PYLA 4BEWA 3V2GA 1CF9A 2FGJA 4DG8A 1E1CA 4NBRA 3HKEA 5ADWA 3U7JA 3SI7A 4JJEA 3IOMA 5BOSA 1W0CA 2UZ1A 3WYEA 1YRAA 2W6IA 2HJVA 2C3UA 2Z1NA 4JVSB 4GL2A 1PJBA 4WESB 2NQ8A 1E6UA 3PHCA 4OB7A 4JELA 4BLTA 7YASA 1JH9A 4S2UA 2X5NA 3EQ6A 1SIOA 4IJWA 3WKEA 3ETDA 4EGSA 3DT9A 3SR0A 4C4PA 3R24A 1LRKA 4IUDS 1E96A 2DM6A 3FCSB 1YWGO 2VOJA 5CK4A 1KYXA 4E07A 2VDLB 1Z6ZA 1XDWA 1GAJA 3T34A 4S12A 4D8XA 2CVZA 2O8EA 1L4NA 3URMA 3KT8A 3UY4A 1HG0A 1C4KA 2BCJQ 3VBCA 2QLMA 4AJ2A 2Q0SA 1CUDA 4YRTA 3UNXA 4KAXA 2HEIA 3KYDA 4PO8A 4RVFA 2FPUA 3LCRA 1KBQA 1C9JA 1Z0KA 3BICA 3WDSA 4XDYA 3IH5A 5CR9A 3W1VA 3H7AA 4R7GA 1ZK3A 3VHXB 2IHTA 2NO5A 4GYKA 4PC2A 2O7VA 1Q12A 5IN5A 5T5QA 3HKCA 1GNSA 3SBEA 3VYVA 3B2NA 1SB9A 4ID3A 4QELA 4OK3A 3LBNA 4GOLD 1O95D 1HXHA 1QZXA 4ZVNA 3W8FA 3JWEA 1Z5PA 4N6GA 3TKAA 3WGMA 1B41A 1DEOA 4JBWA 3IVCA 4PIMA 3G82C 2HRBA 2CYBA 2I66A 3NYWA 3ZZUA 2VPIA 4AJ9A 3AUTA 3WK4A 1BO6A 1UQRA 1ST3A 4ARZA 2PWYA 3D6TB 1AA9A 1NT4A 4I4LA 3A4MA 1BS2A 2DHCA 3D1VA 3S1AA 4BMOB 3G85A 1T6NA 1Y1RA 3SOZA 4ZHQA 5B2EA 3Q9UA 4H4DA 4M0KA 4QIHA 1C7IA 4CM6A 5EKUA 1SC6A 5KWSA 3X2SA 4PICA 1BXRB 1W52X 1JMVA 1DNPA 2FRDC 1RC8A 3KFVA 1JPNA 2XBMA 3DF7A 4WNAB 1WV0A 2EFYA 3C8ZA 1FRVA 1F5SA 1U99A 1Y0BA 4UBNA 1OWNA 3AZPA 5JNVA 2YZ2A 3HI4A 2GDZA 2I6TA 3EQZA 1R4ZA 2PS0A 1PGOA 4Q7KA 1NULA 5GZ1A 1JFTA 3HBLA 2ORIA 4JUAA 3WB1A 1WSDA 1XEAA 1ENYA 2ID8A 4RX1A 2G0AA 4MUFA 1LI4A 1DLIA 2PUFA 2YBDA 5ALOA 3SVZA 1RI4A 2VFAA 3UJPA 3IEXA 1UZUA 2O4CA 2XMSA 2VT3A 3KAKA 1Z62A 2Q3HA 5EMMA 2I7VA 2LZ0A 2P9FA 3L0ZA 4AL4A 3VR5H 3WGUA 1IDOA 2ZSAA 4WEOA 3OT4A 1ZUIA 3QUTA 1NPYA 2H2DA 5A0TA 1RZRD 3N7AA 4O8CA 3B1XA 4ZQGA 3Q3VA 2R8PA 3UV3A 4LCBA 1G21B 4YO8A 1R2QA 2A5LA 1QRAA 4M9RA 5A62A 5DCYA 1VJ0A 3T0IA 1NJFA 1NJ6A 4Q48A 4HYTA 1B93A 1W5TA 2DT5A 2CWWA 1TCBA 4HFMA 4R8MA 4X20A 4ABYA 3Q72A 4EB6A 5A9RA 2AD5A 2RGEA 3EX7C 1D6NA 3JD4A 3N53A 4M1EA 2H1FA 2AK3A 5BV7A 2PSHA 1GNRA 4NOKA 1NMEA 2PBFA 3DUFB 4QGFA 4U7PB 3AP1A 1KQNA 5JZ9A 2QORA 5AKJA 4XPIB 4EQ6A 4GFDA 1SKAA 2B6NA 3SIXA 3NV7A 5CXSA 4B6GA 1XJWA 1LS1A 1QC5A 3VVBA 2GVZC 4R1NA 3NOVA 5C9ZA 2F2TA 1IEVA 1HM5A 2JZOA 1BVRA 2A1TR 1MIOB 2A1IA 3GB9A 4K88A 7REQB 3GXOA 4UZFA 4X44A 5AK3A 2OL4A 2CUTA 2ANCA 2BISA 2ZT8A 2XB6A 3MBIA 5LCXA 2CEAA 3QM1A 2M6KA 1Y6GA 2VP6A 1LU9A 4AC9A 2HWUA 3VFDA 1DMRA 3CR8A 4LISA 3A6JA 1RYYA 4OQZA 4QTZA 1HURA 3LT0A 5E6RB 5HM8A 2RGNA 4G0WA 4RH3A 4AO8A 5HKLA 1KI7A 1UZAA 1SUWA 4BLVA 2YHAA 3FMGA 4UASA 4IILA 1K88A 2C2KA 4NU8X 4U9HS 1DOZA 5KO2A 3F8SA 4Q4LA 5B57C 4ENSA 4YAJA 3WGKA 4O2BF 5J1TB 2IXBA 1QRUA 5A04A 2C5BA 4GBED 4JASB 1T5HX 1GVHA 2V7UA 1JEOA 1HEYA 4J07A 1ZN2A 4V0LA 3WAGA 3N2GA 1V96A 4HVLA 1VCNA 5A2GA 2WHEA 3IUSA 4M0PA 4DCSA 2OY0A 3A1DA 3HDHA 4P4UA 4YI3A 5EMHA 2O9JA 5K05A 1MW8X 3B7GA 4RPKA 1MO4A 4MHSA 4JK3A 4GNRA 4HTAA 2G4VA 2WFLB 4QTTB 1GGHA 4KSYA 4NICA 5EHQA 3JCZA 1RABA 2JH9A 3CUSA 3K2QA 5KJFA 2W2QA 3BEOA 1JZQA 4RWEA 5DHSA 1DKOA 4BGEA 4RPGA 2YN0A 1G0NA 3KLMX 1GSAA 5BO5A 2EF0A 4YJ2B 2W43A 1GGMA 2WF9A 4IZ6A 4TT3A 4ZOAA 1G8FA 2JJ1D 1B1AA 2P0YA 4MVJH 4N0PA 1T9CA 4MGKR 3FNQA 4IIHA 3LO5A 4PIPA 3DULA 3GAZA 4I4TA 2H52A 2V7EA 3BWEA 4TLCA 3CZAA 1BOOA 2VXBA 3QMMA 3VSBA 4PYOA 1K7XB 2WIAA 4YQFA 3WA7A 2CBZA 2VLBA 3ICCA 2ADMA 3PF9A 2HT6A 1ONPA 4IIBA 4LHSA 1FBNA 4U7FA 2BKVA 4RD0A 4BMZA 4C5BA 2UAGA 4KV7A 4B3GA 3ONWA 4W8OA 4DKXA 1LS6A 3W9UA 2WP8J 1K3TA 2Y0EA 1D5CA 1SBZA 1BYUA 2E89A 2P9BA 5DNEA 1UJ4A 3U19A 1NQWA 4UKDA 3IVGA 4ZCLA 1Y7HA 1JVSA 1LI7A 5HUHA 2FWAA 2C2XA 4GP6A 1CR1A 2DCMA 2IHKA 3D5TA 3BMQA 5KWVA 3K2EA 5H9WA 4G07A 3NRCA 4HPWA 1TYBE 2HYIC 1CEEA 1GNPA 1V3UA 1U1IA 2V54A 4BHTA 2XMQA 5KYYB 1VMEA 2PS1A 1UAAA 1G2IA 1NSTA 5LJIA 2QK4A 1JIJA 1FVXA 1LBSA 2J6IA 1IMOA 4JJ4A 4KK3A 2W6ZA 3ESBA 4LF4B 3T8YA 1YC5A 4RJTA 2ATXA 1KH1A 1VPTA 3TYXA 4EFLA 4MWBA 3U4CA 5AVWA 3V3KA 5EZYA 4BRUA 2AXQA 3FSGD 2OWEA 4URFA 4K05A 3WNCA 3OTGA 1SVMA 3OA0A 5J4HA 6CHYA 4JOCA 2UUOA 4KACA 4OQFA 4HJXA 4UE2A 2RHRA 3FBGA 1UBCA 1E3DA 1OI7A 4E5SA 1US8A 1R0XA 4MKRA 3EOBI 5EJ7A 1SUDA 3STTA 2OPHA 1PYGA 1RI5A 2O2SA 3CF2A 4D1YA 1U1FA 3O6VA 4G84A 2CE2X 3TOZA 3X2EA 4EUHA 5KSWB 5FP0A 2NU7A 5SYAA 2OBBA 2ZSHA 3EFOA 4BE7B 4WCDA 4YHHB 5EWMA 1NVEA 1GDDA 2FF5A 4C2AA 3PXDA 1N2IA 3IAEA 3CZMA 3LK7A 4PX9A 3FDZA 4NLLA 2HWYA 2WIDA 1MT3A 3FGZA 3HVIA 3LPLA 4WH0A 5JCOA 3P71T 1T2FA 3KUXA 5CIQA 3SHVA 1H9BA 4YJGA 2FFBA 2GYUA 4MVJG 2ZRQA 1Z0IA 4F8JA 4KGZA 2OLJA 4U2DA 2SECE 4F0JA 2X3UA 3GAMA 3TD2A 1EGQA 1W36D 4QEZA 4HZIA 1UXGA 4R51A 1QZUA 1OXBB 1XZAA 4PAGA 4DRYA 2ZDGA 3RC7A 4EFDA 2WJJA 4FGJA 4JDUA 3G1TA 5I4KA 3X2FA 3RU2A 3QXHA 1JG6A 4NYIR 4PGMA 4OBBA 4QYWA 1G5TA 3B3QA 3L02A 1M1NA 4XASA 1H66A 4JQYA 4EVRA 5C8YF 1E9SA 5DYIA 4H1VA 3CUUA 1QBGA 3QG1A 3VU1A 4FMCF 4IQFA 4P5PA 1EUYA 1JLRA 1EWVA 1OPXA 1ZWKA 1YKSA 2FOXA 5CW2A 4JI5B 5KYXA 5EY5B 4N12A 3Q2IA 2QAIA 3O8DA 5LZ5A 2A86A 4DEXA 2EL9A 1IG0A 3S68A 5JADA 1EUDA 4HWTA 4PTZA 4I55A 1E9RA 2QU8A 3NATA 4N5DA 2JFYA 4J3JA 4PSDA 1YCHA 1DIHA 3GNTA 2GPTA 2HY7A 2Q4BA 4V3CA 2VP5A 3E3MA 3LWBA 3EUAA 2VIIA 4UMFA 4UHCA 2BTQB 2XRYA 5LDGA 4WZ6A 1NNSA 5K20A 4TYNA 4O2AB 1ETUA 1WW2A 4K9OA 1YJCA 2JFUA 2VI5A 3OAAD 4AMBA 3RRJA 3TLKA 3HUTA 3MCAA 3OD5A 4UUBA 4Y2GA 1MAAA 5EP4A 1V5FA 4JBNA 5JSYA 1KYIA 3GEPA 2X2FA 3QWFA 1M5TA 3AB3A 4H3KB 3JD0A 4U00A 4MGZR 3IDAA 5L3RA 3KYCB 2R6JA 4MQBA 2DPYA 4BQQA 1R4NB 3RJZA 4ZKEA 4YQZA 3KXIA 5IVPA 3GVIA 4BKOA 1XFDA 1N8NA 5ECGC 3QEBZ 1YRBA 3RC2A 1K8ZB 3DAPA 2P9CA 4GZ5A 3DE1X 5KTYA 3RABA 2D0PB 5EQJB 2NSHA 1VJDA 2JAXA 4QU0A 3VOSA 2JLZA 4Q12A 4LYEA 2WF7A 4AUKA 2BR4A 2BHNA 2RMKA 5AW2A 2L2QA 5JD4A 1KRWA 3A9RA 3BA6A 2E4WA 3R6DA 4GI7A 2CDAA 2X0NA 1KP3A 1IEQA 4I4TF 1YZTA 2I5PO 4BX9A 5CBPB 4JITA 2QUHA 2IYAA 3QEMA 1RBYA 4TRRA 1RCUA 1TZBA 3ORQA 1YU6A 3HN6A 4ETNA 1NJGA 1H8HA 1ML3A 1N2BA 2WNHA 4H6WA 4WV3A 2WWRA 4BO2A 3L4EA 2I6SA 4KLAA 4NP6A 2J08A 5FUWA 2VPTA 5GP1A 2AG0A 4V1CB 1E2BA 1VJGA 1C3XA 1MVLA 3PXCX 2J7KA 4R5MA 3ESXA 4EZIA 3W8DA 4O33A 2QLTA 1OTHA 3F6PA 1U0EA 4Q9DA 3G5MA 2ZZKA 5HTKA 2V9ZA 4OUDA 1PJ2A 3N59A 2CLCX 1V35A 2QD4A 1Z5ZA 3ZYCA 3HFSA 3RVSA 1E3JA 7GPBA 4A27A 5K6AC 1QF7A 2ZCUA 4D9EA 1AQNA 3TLAA 3GDFA 4J8PA 2V7XA 3GRAA 5CRIA 1V8FA 1RLIA 2VJPA 2XUDA 3AKCA 3EIUA 2J7PD 1PFVA 2I4NA 2WP0A 1E3TA 3KWFA 5C8VA 2B35A 4KQWA 3GFQA 3OX3A 1CQPA 2XYPA 4MR8B 4MV1A 3V48A 1V37A 4EO4A 1ONNA 1O89A 4RKQA 4REQB 4P08A 2Z4TA 5EZYF 1UK7A 1ZD2P 1EJ0A 4MJXA 3OJXA 5KNDD 3Q8KA 4AJJA 2P6MA 3E15A 1J9GA 1GCAA 2VRBA 2Z3ZA 5HF8A 4MV9A 4OD0A 4EB8A 5KVCA 3H6HA 4TTTS 2QYTA 4V0NA 1YR8A 3OI7A 4EG5A 5B1EA 4ZVLA 1PUXA 2ZJ8A 1PQYA 4NBWA 4X8HA 3RBVA 2FW1A 3W9YA 4E30A 3F1LA 2D1TA 3FMVA 1T9GR 2KS6A 3R75A 3T41A 1FJXA 4FNAA 5C37A 5IVKA 3RBAA 5TS3A 3OC6A 3I61A 3UJDA 3G5TA 4DSUA 3OD1A 4GX2A 4RIFA 2O3QA 1R1DA 1JEJA 4Q1AA 3OY7A 1F9AA 1NVKA 4DY4A 3L7NA 4D99A 1NOJA 2HU2A 4QFDA 2WTXA 1UJBA 2KX7A 4MW5A 2IHYA 3JAWB 5IZCC 2AEEA 4K7JA 4M76B 4B7ZA 3E8XA 3HMKA 1WNFA 4OQNA 3TR6A 1I3CA 2FWPA 3O93A 3MLEA 1WHSB 4L16A 5FHRA 3RNOA 3WYCA 1G1AA 5CEJA 4GZLA 4RTOA 1GKIA 2QVLA 3CR3C 1GPBA 4EATA 1W1IA 4Z8YA 3BJRA 2W5UA 2YFHA 4R98A 5CA1A 1QO0D 1OGYA 3PJEA 1B7GO 2J3DA 3LFTA 4HG2A 5TGTA 2YWEA 1EWTA 2GTIA 3C39A 1TQ2A 5BYAA 2BBSA 3IV6A 1T0HB 2WZDA 3HCPA 3N2IA 3W2TA 4EH1A 1JHUA 1WE2A 4L6IA 5K3DA 5LZ2A 1UMCA 2YZKA 2YJTD 1F0YA 1PR1A 4KQHA 2QW8A 4DQDA 2BEWB 1R6VA 1YSCA 1YS4A 4W5NA 5JAIA 5CT6A 4OH7A 1QQ5A 3LWNA 1QH8B 3NBKA 4UM5A 2C2MA 2G5PA 2FEWB 2WK1A 3FSJX 3LDFA 5ECWA 3EDYA 3NH9A 4DSTA 2C0CA 1GDHA 1Z6TA 3FKJA 4H7PA 2DQZA 5ALEA 1JDJA 2QLLA 3UUEA 4G5GA 1Z7EA 4MB6A 4XWWA 2VOEA 1RYHA 3PPYA 4W99A 5C7IO 5FKJA 3BHMA 5KDLA 3C2QA 2FZ5A 4B83A 4C0AC 3AY0A 3M6MD 3KHTA 3CEJA 5TQVA 3WSWA 2WUWE 4LQDA 2WYWA 4RAOA 2IDZA 2H1LA 3NONA 1ZM3A 5DNCA 3QPVA 4DBLE 4KO8A 2XWQA 2PD6A 3IV7A 2DGDA 2YV5A 5EP3A 4BEJA 5JCPA 3KV1A 1QOZA 3MGKA 4YRQA 5A4AA 3O26A 1DRVA 4MYDA 1QB7A 3LD9A 4MQFB 4YREA 3RR2A 3W5SA 2Y66A 3ICQB 2V6MA 3IHKA 3MINB 4Q6WA 3HE3A 3U7QB 1N8TA 3I34X 4OA8A 5GY7A 2A3RA 1BAPA 2V74B 1O5OA 3A9UA 2XIJA 1CJMA 3A25A 3F67A 4HAIA 3OPYI 3R5SA 3E03A 4J0EA 5E1OA 1AQJA 3RU9A 4DDKA 2ATEA 3SVLA 3NETA 5AICA 3LX5A 4MWEA 1CUIA 3G5LA 2IUUA 3EOAI 4TSKA 1FP1D 4HH3C 4WT7A 4G5QA 4IYJA 1HE2A 1XAGA 1YR9A 2PLWA 4ZT4A 1YS9A 1OD6A 4EGQA 3E9ZA 1JZSA 3QZUA 3VPCA 3AUJB 2NU8B 1PJ3A 1QSGA 1SGWA 3U6BA 1JIVA 4TWJA 1WDKA 5KNBA 3DBVO 4V2IA 4XYGA 4DIMA 2ONYA 1JG1A 2N9UA 4HZUB 2WF6A 1KI2A 3OFNA 2WU4A 4WA7A 4DKJA 3G0CA 4FGKA 3IP6A 2V0NA 2HNKA 1GLNA 2HHLA 2JCBA 3BD9A 4LXUA 4P8RA 1AT1A 5J63A 3B6IA 3KQPA 1JHDA 3BE5A 1T25A 3GH1A 4BQIA 3Q7SA 5E3IA 5AM2A 2Z09A 3BJIC 1I4WA 2QN1A 4X00A 1VB3A 4OGLA 3ZE7A 1VHJA 1ZVMA 2C1ZA 4ZGGA 2B69A 3UGTA 1U9YA 2IWHA 3LL4A 2OCYC 1D9ZA 2W6OA 1EU1A 2ZB8A 2BWJA 4G6ZA 4XVCA 1Z8NA 3ESDA 5KVQA 1HTTA 1WX1A 1YRLA 1T5DX 2FQ1A 3NPMA 1Q84A 4EENA 1J8DA 4ER0A 2OESA 1SCBA 1J09A 1BRTA 1GHTA 3A3KA 1YA4A 4XR4A 2G9NA 4YYZA 1AB6A 3K6SB 2IXGA 3EGXB 5U1PA 3FOZA 3LYUA 5BSEA 4Q01A 2V97A 1H1DA 3Q6MA 4MLDA 3QXGA 4XVQA 4UOEA 3F4LA 3AKDA 3AIMA 3TQFA 4RC9A 4ZOLA 3UHJA 5JALA 4FONA 4RFSA 5K3FB 3H18A 2OD7A 2C03A 5HRCA 4IZOA 2WHPB 3H04A 3CKKA 1J07A 5GM2A 3K96A 1XMSA 2BDTA 3IMFA 4ZU3A 3SFZA 4F6LA 2BJVA 4E94A 1FP2A 4MTCA 5HUQA 2HK9A 3MQFA 3ZS8A 1JG2A 4KPUB 5FLYA 1ZUNA 3ESYA 5DBEX 4PLZA 4WIAA 1KPGA 2F8SA 5BN5B 2Z5LA 3P27A 2VPZA 3U4AA 3ROGA 3M5PA 3V4VB 1UWLA 1YFJA 3CX3A 3IC5A 2ZQZA 4TSFD 4UUNA 4EMBA 3NLLA 3B8EA 1F6BA 3ZU6A 4X94A 5TT1A 3UMGA 4Q05A 3MUOA 4PYQA 3MRTA 1NIJA 1V4BA 2YMMA 1O97C 2BUBA 2GGSA 1EM8B 3GZ4A 3K0CA 5DOZA 3LLVA 1I94B 1UJ6A 4KE6A 4B75A 3HJRA 2WM3A 4L08A 5CA1F 2OORC 1M2OA 3SEZA 4BXOA 4DTCA 3RRFA 4IVNA 1E6MA 1H1TA 5I7HA 2XWSA 4E70A 5CYGA 1ST2A 3RYCA 4O0LA 1BWPA 5CT4A 4C05A 4ZCIA 3SSMA 3ORFA 2XQKA 5FOTA 2WWVD 4ID9A 4S35A 2M32A 3HWX1 1J22A 2HQRA 2DYKA 3AM4A 4MIOA 1FDWA 1ZMBA 1V11A 1DBRA 3ABOB 4NENA 4CDNA 4MKIA 3O73A 5A3QA 1RAGA 1KZ9A 2I6GA 4RGVA 1RE1A 4JI8B 1KAMA 2P9GA 4IDPA 1Y1PA 5AIBA 3QTBA 4M8LA 4AKTA 4GAEA 2QM0A 2Z6QA 3M4NA 1C2TA 2HF8A 3FTCA 5T41A 5JAOA 1JYEA 1U3GA 3GFGA 1P6UA 3N0TA 4P1ZA 1IXKA 3I5AA 1L5GB 8ATCA 1CCWA 1VE9A 1DADA 5DX0A 3UK1A 3GAFA 5SZIA 2E1RA 4REMA 4YMGA 3GXBA 1EJBA 4ON9A 3S70A 1DUSA 3HDYA 3IJ5A 3EDQA 3AVQA 4MB2A 3TJMA 2XBUA 3MLBA 2BEKA 1AY0A 1V8PA 1C9DB 2PK3A 4MMXB 1ZOOA 3LCCA 2HF7A 3IVMA 1XZCA 5AKYA 2CK3A 3EXG2 3ASZA 2MHCA 4M1KA 4EB0A 2PHZA 1W88A 2FZVA 3HKDA 1DU4A 4LRTB 4N5NA 3ROKA 3VC7A 1DWQA 2X1LA 2XCOA 2AE1A 3V8NA 4CMBA 5FCDA 3PHBE 1SKBA 5BMOA 5DI3B 3GLGA 2GN8A 1SU6A 3L01A 3O31A 4PZEA 3WB9A 2V03A 5GZ3A 3BCUA 3UF0A 5AP9A 3UV7A 1OPRA 5C7YA 5FLEX 4K81B 1E59A 1RI1A 5AXAA 1KNXA 2C29D 4KG7A 1QFZA 1J1IA 4I1UA 1Z0ZA 2XCUA 3PDUA 4LXIA 1W25A 2PVSA 2GX6A 1XVVA 2DLDA 2IPNA 3CW2A 1RWOA 4ICIA 3K5PA 4PANA 5KTPA 3G7SA 4CW7A 1Y1TA 3CWCA 3PD0A 5INTA 4XH9B 3AINA 4QU9A 4GM4A 4QXRA 3RFXA 1M1UA 2EERA 2HCTA 4BRSA 1VSBA 1STOA 3K0KA 2FX2A 1UPXA 2HJSA 2JCYA 2G71A 3MS2A 3NQ41 3OTWA 4IH1A 3F96A 4FUTA 1HOTA 4NQZA 4TVOA 3A05A 1D1QA 3IR7A 3BWYA 2BDEA 4DM7A 3UFXB 5E7JA 3U7GA 4H16A 2IELA 3VKGA 4D8TA 2IOHA 2GAFA 4IQ0A 5BUZA 1M6NA 2P78A 2A9OA 1C3LA 1Z5OA 4D9FA 1PCXA 3I1IA 3AKZA 3OZVA 3BDAA 1AIPA 1HO3A 1NMQA 1LK7A 1RYMA 2O2HA 3IKJA 3RRZA 1FDOA 1BTOA 4FYIA 2FWJA 2AN1A 2GYWA 1X77A 3HU3A 3N75A 4K6GA 3ZXYA 1UDXA 3PFNA 2FW7A 3GJ0A 3SYMA 1DAEA 4N03A 2PBLA 4LHZA 2P65A 3LWZA 2JW5A 1V1MA 1HT0A 4D45A 1P2UA 5CNIA 2EJBA 4GKAA 1TUEA 1NM5C 4H7JA 1EUCA 5DM4A 1E2EA 4ZFNA 4G9BA 4OMCA 4GW3A 1L4LA 1XFAA 4AROA 3GCWA 3D4LA 2ZAMA 4ND6A 1R5JA 1XXHA 2AMLA 4KGVA 1SCAA 1XAHA 4R3NA 4RLFA 5ILOA 3DF9A 3LIIA 3NBYC 4IIYA 1RM4A 2PS9A 2QQEA 4FDMA 4X7BA 4F9GA 5C5CA 1NI4A 2AFHB 4ZZ2A 4YRPA 1M54A 1O9HA 3I05A 4FR2A 3UJCA 3KJHA 2ZWMA 3FHCB 3FYDA 4H7FA 4RMJA 1FQJA 1NSFA 1ZGAA 3CF6R 2B3DA 3AF4A 3DKIA 2ZBUA 2W6MA 3EGIA 3I45A 4JX8A 5B58C 1X80B 2X0IA 2IYEA 1E99A 3BMCB 4IPTA 1TKRA 2O8DA 1QIJA 3QFFA 1SAYA 2O1XA 1BXKA 1SBQA 5HKOA 2FPPB 1I1HA 2MSEB 2YJ3A 1EX9A 3GLIE 5CVVA 3RK0A 1X74A 4XAQA 2BHSA 1LA2A 5KQSA 2XQIA 2Z2XA 2EZUA 3AF2A 1KYYA 3FYCA 4YCNA 1C0EA 1T0BA 3N0RA 2ZBPA 4L50A 4AJKA 1OHHA 2ZVDA 3DCNA 3IB6A 3FOWA 4HAXA 3D3EA 4CKEA 5CVEA 5FDFA 4OJKA 4WK6A 4PINA 3TLGA 3LBHA 4OGKA 2O3SA 4Q3OA 1VCHA 2TRSB 4J0DA 4WY2A 3VGJA 2JFZA 4D8UA 1BQ3A 1XYYA 4OYYA 5I9TA 1GA6A 5LL6P 2OFPA 1R9MA 2B4QA 1DEHA 2IGBA 4FC6A 4D0NA 1PFWA 3R5FA 4MYHA 2AC2A 1RS0A 3FOAA 1QKIA 1G3QA 1Z22A 3KYJB 4MJ3A 1G7RA 4KO4S 3AJEA 1JPUA 2Z9DA 3OQVA 1U8FO 2JHGA 4OL0A 5EXDA 3O7WA 4F5YA 3QSGA 4HNAA 3SNKA 4Z4CA 3P96A 4KV9A 3EXG1 1C8KA 1PTKA 2K6GA 3NVDA 3GHYA 5DXAA 5IMSA 1LQUA 5JDCC 5FB3A 1GGVA 1TUGA 3Q3IA 2QNRA 2VVTA 2GK3A 3MWGA 4B7XA 1HT2E 2P4EA 1P7ZA 2A67A 2IXEA 3CX7A 4ZQBA 4LY6A 2XMDA 4BNNA 3C8MA 3UJ6A 2AX3A 2LR0A 2LVBA 4MQUA 1S02A 3H84A 3T3GA 3W90A 1MEOA 5F76A 2JIPA 1QPGA 2FKNA 2P91A 1U2RA 2MSNA 1TUIA 5I51A 3LQ2A 3KZOA 3V3TA 1BWRA 3VNAA 2YMPA 3DL0A 3BMNB 3CTMA 4GKJB 1I33A 3LQYA 2FPOA 5LQNA 3K2BA 2HNBA 1HMPA 3GY0A 5BMVB 2F43B 2QTGA 1U2PA 1VPVA 2F4VB 2I80A 2WJHA 3M4XA 5LNK1 1RM5A 4MZXA 3ZQ4A 1PJSA 1U2ZA 1ZI6A 2HLNA 4JKOA 5D3MA 3U16A 3TH5A 3LW8A 1RBZA 5JBNA 3P9PA 3AF3A 3AI3A 5L7TA 1CRLA 5EE9A 5FUMA 2DWOA 2BGUA 4Q1BA 4CLEA 4UZEA 1GTZA 1M8FA 3OCJA 3ENQA 5KU1A 1FTQA 3DMYA 3FTDA 1SA0B 4FIDA 3ZNNA 4ZO6A 5A1TA 4F4UA 2FV8A 5T3UA 2BYTA 1HDGO 2IYQA 4MRNA 4RY8A 4ZV9A 2G9QA 3UJ7A 4MCAA 4ZYUA 2I0FA 3OA2A 1M10A 4MOWA 5DXFA 1WD7A 2OHJA 3KDSE 4HTFA 4KWIA 5EIBD 1OH7A 5DYWA 1U7PA 1XQ6A 4FCVA 5FADA 4TYYA 4D96A 1HORA 2KE5A 2ZVQX 4Q16A 3R2JA 4P83A 2DEUA 3OX1A 2QDKA 1D6JA 1XEXB 5ERYA 5LB2A 1K0UA 3G0OA 3LW7A 4C6TB 3S2YA 3TOCA 1UXJA 5HFJA 1T6ZA 1H5NA 3LVRE 3IPCA 3NANA 2IOFK 4TL8A 3B7WA 4FDTA 2D3WA 3KZVA 1BJRE 4W6QA 2RAFA 3SF0A 2CXRA 1D1TA 1SBIA 1N2EA 2RGCA 1J7JA 2BV3A 2HLDA 1EZZA 4IIFA 4A6EA 3TPCA 5A9SA 3WXMA 2XD4A 3E2MA 3OZEA 4WBSA 3QVTA 4ZXFA 1EFRA 1L5SA 2W2LD 5C81A 1DIRA 4PPFA 4HMQA 4BLRA 2Q5JA 3A6KA 3MSCA 4JYBA 2CXUA 1JLSA 3MTQA 2I3DA 3TD6A 2ENWA 3IIKA 1CY7A 1U0SY 2C95A 2G09A 1OYOA 3AFOA 4ZQCB 2PJDA 2RIRA 4HLDA 3BK1A 5K8UA 4GMKA 4HB3A 3W8RA 3C7AA 1IM5A 1TTHA 2Q0QA 1CPYA 1R8JA 3VYUB 2ZKLA 3RSQA 3NHSA 2W8ZA 3PDIB 1E5VA 2HX1A 3EDOA 4XX0A 1DKRA 3VOBA 5JNTA 2JLRA 3SX4A 1MX3A 1P73A 2AS0A 3RFVA 1IZZA 2ZRKA 3ONVA 4MHOA 2R65A 4N8DA 4LJ4A 3SAJA 5LA6A 4JJIA 5I01A 4JOQA 8AT1A 1T13A 5DIFA 3VR2A 3MRSA 3M70A 3KJGA 2D62A 2ATIA 1TUBB 3CS3A 3DZ8A 3FETA 4JP3A 2JLYA 4HEA6 1HDXA 2X0FA 3RFUA 4Y6SA 2PL1A 5D7NA 1EJ6A 5FV7A 4YJ3A 4B0PA 4Q1VA 1JW9B 3E61A 4LK3A 4B3XA 1UBJS 4FYVA 1C7FA 2WRZA 3UB2A 3U48A 121PA 3KSRA 2YS7A 3OQPA 1BXGA 5L4LA 1R9JA 1NE2A 4BFWA 2LGJA 2NYAA 1Y3DE 3QE0A 4KQ1A 4Q3EA 1T1RA 2I1WA 4V0MA 4TS3A 2FSGA 1RP1A 3JR3A 1L6RA 4HDQB 4WKCA 3RM3A 3UAYA 3IA2A 3GT3A 3LZDA 3MIZA 5BQPA 2OXIA 3SP1A 2Q1UA 1FMJA 3MFQA 3JQQA 1J8MF 5BWMA 5F9HA 4JL6A 4OLJA 1WAMA 5JWRA 4QLBA 3B6KA 4RDCA 2C4TA 3IUPA 1XOIA 2WTEA 3UUFA 2HRCA 1DRJA 1TYZA 3HEMA 3QTLA 1GUAA 1Z68A 3DNFA 4UHDA 4WOPA 4OREX 5EVJA 1C7JA 1PG0A 2QD5A 4WN9B 2IZZA 1FSZA 3EAGA 1FW6A 3H5LA 2RH9B 2C31A 1Z5NA 3NUZA 1I1NA 4PF1A 3VR4D 3ZZTA 1J42A 4G0OA 2JGDA 4ACBA 2E9SA 1A5TA 5LZ9A 1ADYA 1ZNXA 2AZMA 1FXUA 2FRDA 1ZC4A 3LQRA 4W5WA 3UMVA 2IA5A 1GQQA 3HI6A 5BSGA 4KQGA 4CM7A 3UANA 4W5OA 2OCXA 3LDHA 2VDOB 5AHKA 4ERNA 2R1VB 4Y6RA 1R0BA 3X0DA 1DT3A 2JAWA