3LWNA

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
181
structure length
181
Chain Sequence
SAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
molecule keywords Transforming protein RhoA
total genus 61
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lwnA00
4UKDA 4JLJA 5J4VA 4TSFD 4RZUA 1DADA 4A1FA 2WPDD 2CHQA 3B1YA 2B8WA 1NLFA 3THWA 1GILA 1HH4A 1YZGA 1GKUB 3GMTA 1W4RA 5FPYA 4QHYA 4KLNA 5CDFE 1DO0A 2WJVA 5EP2A 2YVUA 1KSGA 3K09C 2XOKD 4C0LA 4MRVA 2VP2A 2OAP1 4PQYA 5B64A 4LWZA 1U8YA 1OSNA 1H8EA 4ZCIA 1M1YE 4RKFA 4NKRA 4Q1DA 1KTVA 3SDZA 2A5FA 2FZ4A 1YZUA 1ZM7A 2NPIA 5JI2E 1NVWQ 4CW7A 3VTKA 3I4LA 2WZQA 2DWPA 3K0SA 4M1WA 3TE6A 3NKVA 5BN4A 5FBVB 2H17A 2WOOA 1D2NA 3AKEA 4YMWA 3T35A 2BBTA 4LV6A 4ESHA 2A78A 1M8PA 2ZE7A 1GL6A 1Z5ZA 2IWRA 2R6DA 4WA7A 1W2HA 1E2DA 4FW9A 4JLNA 3W6PA 3LAWA 4NYMQ 2F9MA 3QF4A 5CK4A 4DC9A 2XXAA 4URVR 2EFHB 4Q4AB 4R2HA 4XVUA 3QPUA 2ZI7A 3LVRE 4NZYA 4EQ6B 3P1JA 2AKYA 2OO7A 2F43A 2DWOA 2RGNC 3A1SA 4US2R 1XFAA 1M7GA 1E94E 1JNYA 2JIZA 3HR8A 4Z1MA 5FTMA 3SN6A 1WXQA 4YDHB 4N3NA 1HYQA 1KKLA 4JLKA 2GK7A 3Q5DA 4NCJA 4G5RA 1SKYE 1IOZA 3BERA 4BFUA 1Z06A 1UJ2A 1T3HA 3SFVA 2EW1A 4A15A 3QUSA 4QHSA 1F2UB 1H8HA 1YZLA 5EP3A 5GJVC 2VF7A 2QMUA 3T1VA 1P72A 4A2WA 1WF3A 1AKEA 4LZZA 1PLKA 3LDAA 5KTYA 2XOKA 3OFNA 4HLDA 1JEDA 3Q9LA 1NN5A 4RZ3A 1XXHA 1MV5A 2ZR0A 3Q7QA 5DISB 5EZ5A 3SJBA 4DEXA 5FI1B 4GOXA 1YJ5A 2WIAA 2WWFA 4MGKR 3QI2A 2ZU6A 1CR2A 2CMKA 5J4YA 2XB2A 2O8BA 3OF5A 1P5ZB 3CONA 2VO1A 2XX3A 5DI3B 4KFRA 3HPRA 2X1VA 4NYJQ 1A2BA 1V43A 4RJLA 2GVZC 4OI4A 2FSHA 4QM6A 2IXEA 1OFTA 4E03A 3QKSB 4X8HA 1SXJC 5L3QB 2PLRA 1KDOA 5FTNA 2I1QA 5HR5A 1TAGA 3BBPA 2CEAA 1CU1A 2KSQA 3M6AA 2GHIA 2QRNA 2NO1A 4HDQB 4NTZA 3S1AB 1LNZA 1XX6A 1NVXQ 1T9HA 1WA5A 1F2TB 1QZXA 4Q9KA 2JLZA 5SZHB 2JLUA 1CS4C 1ZUIA 2IYVA 2OLJA 3SQXA 4QNMA 4F38A 3P20A 1BS1A 3V4FA 3WBJA 4I4LA 4OHXA 1QVAA 3KXKA 1E99A 2X77A 1E6CA 2BCJQ 3EZFA 2VHUA 2IC5A 3AF3A 3K0CA 4B35A 5JJKA 2IYLD 2JJ2D 1D2MA 3NC0C 2B7BA 3B2EA 2G1KA 3QQ5A 3W34A 3TUIC 4PSKA 2FH5B 1T8TA 4LX0A 1L7VC 3B5JA 4JL8A 2RB4A 3QXJA 3Q5EA 4G5QA 2Z5FA 1Z63A 1OKKA 1UEJA 3DO6A 2IL1A 1L8QA 1HE8B 1XTJA 2CE2X 3X1ZA 1W4CA 1S1MA 2ZJYA 1JJVA 5DN6A 4AI6A 4OI2A 2IBMA 4RFSA 4PR0A 5FOXA 3TMKA 2ZE6A 3UK6A 3WNCA 4AYXA 3W3ZB 1XXHB 4LJ9A 4LV8B 4BEBA 1TQ6A 1E1QA 2ATVA 2F1RA 1E69A 2OBMA 2RKOA 4Q4HB 1BH2A 1E0KA 1KAGA 1SGWA 1T5IA 2NG1A 4D4KA 5JRJA 3ZD6A 2YZ2A 5FH9A 1Z6TA 1KJWA 3MWLA 4FMCF 3OEHA 4KFTA 2EYQA 1SZPA 4Q7JB 3SR0A 1I2DA 3BIFA 1LF5A 4B76A 2P65A 5EZ6B 3DEFA 5F9FA 2FWRA 3UANA 2J0QA 1XMSA 2ZJ2A 4M9SA 1SVWA 5B30A 3T5DA 3R9IA 4G1UC 2ZSAA 4WZAE 4I1VA 4CIDA 1DAHA 1IXRC 4PC2A 4YDSA 4EDHA 2WSSD 1CIPA 4TLCA 2HCBA 5D3MA 3W6NA 4DZZA 1CJVC 1D5CA 5FL7A 1UKEA 4MRNA 1US8B 2ZXUA 3O8BA 2ANCA 1PVOA 1NLZA 2NO0A 4A0GA 4PX9A 1KMHA 3WP0A 3UWKA 1G8PA 3WRYC 3QEOA 5J5CA 2XNSA 3I72A 4C2UA 2V6JA 1T91A 4TL6A 4NCHA 1M6NA 2BHRA 1IY1A 1OLOA 2J3EA 5JFGA 3OZXA 1B23P 3SNHA 2ZRCA 2ZJ5A 4L8GA 4FMDF 3SU8A 3U3RA 4A8JC 1RRPA 5H8WA 1KZGB 3FE2A 4DT1B 4PSVA 1EFUA 4EIWA 2R2AA 2IYTA 3SBEA 3RS2A 1ANKA 1Z6XA 3QBVA 2FA9A 1CTQA 3AVOA 4G0NA 1XF9A 4TMXA 1OH7A 1R0WA 1S96A 4LJ4A 4D4LA 2QMOA 1Z0DA 3JZMA 3TW4A 4TYNA 2JGNA 2ZE5A 1W44A 1W36C 4K46A 1JECA 1VYUA 2WWGA 3CM0A 2ZYVX 3CWZA 4IOKA 2ZQ5A 1GG2A 1WRBA 3RYTC 3RSOA 2ZITA 4KFUA 3U5ZB 3DVLA 4OQFA 3PUXA 3QPVA 3P26A 1GNQA 1EFHA 2VLIA 4W7SA 1G8GA 2HLDA 3EZ6A 1JPJA 3N70A 3P4XA 4PHHA 4S2EA 2D2FA 5CLQA 4AYTA 1ZYUA 5KO2A 3HU1A 2Q9AA 2ZEJA 1OXUA 3PCRB 1HQCA 4V0LA 4TTPA 1XEFA 1ZD1A 4EKDA 2ZVQX 3RWOA 2OLKA 5EE5B 4LYHA 1GL7A 2GZDA 2H16A 2ZAMA 4IOJA 1Q20A 3QXHA 1QVRA 3TK1A 1EWQA 1Q0UA 1WDTA 3K09A 4UNSA 3SE0A 3AB3A 3EC1A 1KY2A 1E2LA 3K0FA 4EPTA 4JS0A 2C2HA 2ZSEA 4Q66C 2VTKA 1P3JA 1TQDA 4LCBA 4NE2A 2YWHA 5GJWC 1GITA 4PQRA 3I8XA 4GBMA 3SYLA 1ZMXA 2BV3A 2MSDB 1X1RA 4CDGA 4ZIRA 4XWOA 1IXSB 4DRZA 4A6PA 1MABA 4RD0A 1OH5A 4AY2A 2QAGC 4BZPA 3PEUA 2AK2A 3D8BA 4PHFA 5HTKA 3FPAA 2YOHA 4L9SA 4X8LA 4D4JA 4MGZR 4O3MA 2V7QA 2B6HA 1FP7A 3DOEA 1RKBA 2IF2A 1JEEA 4ABYA 4I99A 5BYJA 2CXXA 4HB0A 2ZI9A 5K8LA 1UBFA 4KFSA 2WJGA 3SHFA 3GLHA 4JSYA 2NZJA 2JLWA 1R7RA 3EIEA 3W9YA 3PJRA 3P27A 2ERYA 5J4KA 1FFHA 5EXTA 2CLSA 2GBLC 2YWGA 2FGKA 1M34E 3WP1B 1YZTA 3ICEA 3TAHA 4D82A 4QRHA 4OHZA 4ASUA 3F3YA 2XEXA 3ADDA 1W48A 3KTAA 3RANA 1W0KD 2F3RA 5IF9A 2X2FA 4MRSA 1FUKA 2BMEA 1SXJE 2DCUA 1NG9A 3VR6A 4AD8A 3AM1A 3SQWA 3DDCA 1M7HA 3WNBA 1CBUA 3LBIA 1W47A 2E87A 4B48A 3LO5A 3U60B 4AKHA 4KHZA 2ZSBA 5FOWA 1LF0A 3AP1A 1Z0FA 5LD2B 2DB3A 4RKEA 3B78A 3K9LA 4OL0A 1YZNA 1HT1E 1MH1A 2H1LA 3ECCA 1N5KA 2REXB 3L82B 1G291 1Z6GA 3K0EA 3LV8A 3R20A 4WVFA 1T3LA 2ODEA 2QPOA 2OT3B 2WSSA 5EE0A 5H68A 2OG2A 3BRWD 2AFHE 3F5FA 2D7CA 4MH0R 4OQLA 4F92B 3E1SA 2OUKA 4EPYA 1LB1B 3T12A 1KK1A 5CJ2A 4PANA 3CF2A 2IWHA 4AG5A 5L3RA 4YXWD 4HZIA 1QG4A 5H70A 4PHGA 1XD2A 4ZDKA 1M2OB 1DEKA 2HXSA 2RGEA 3A4LA 3SOPA 2V1UA 1E9FA 4IXMA 4MRRA 1YZQA 2FSFA 3IPXA 1EGAA 4F4IA 1CXZA 2J45A 5FFMA 1HTWA 3CF0A 1W4AA 5E4FA 1J90A 1J8MF 1XTIA 1AS3A 5G41A 2QE7D 1FTSA 4EPVA 2P2LA 5JHGB 4MA4A 1N3BA 5JJIA 4HB3A 3AEZA 2AHOA 2ANBA 3IHWA 2PT7A 2ZSFA 4ZDIA 2JATA 3FFBA 4NYMR 2JASA 3KJEA 2SHKA 4XIGS 3KJHA 4RSGA 2B7CA 1COWD 1XCGB 4C0KA 4Z1MD 1RIFA 4F4CA 1ZNXA 4C9BA 4ZKDA 4ZCMA 1KI4A 4P3YA 2QY9A 1NBME 2AK3A 5DYGA 4UXHA 4BFYA 1SVMA 2ZRFA 1A82A 4JBYA 1JAIA 4QJ4A 4FXPA 4WXRA 4NBSA 4GL2A 1OFHA 3MMPA 5FTKA 1Z0JA 1MABB 3THYA 1OKKD 3B7GA 4IRUB 4JVNA 4Y0VA 1U90A 5FBWB 5AJZA 2C96A 1P2UA 4LUCA 3RS7A 3ZS9A 2QT1A 3VFDA 1QG2A 1RJ9B 121PA 1Z08A 3H86A 2P0EA 1AIPA 4MDFA 1UKYA 1E2EA 3U3OA 2ZRIA 3O47A 1XEWY 5FTJA 3MWKA 1KI6B 4QL3A 4BFSA 4B3FX 4JT2A 1OIWA 2FG5A 5FPTA 4BRUA 4BECA 3BWDD 2J46A 4PAQA 4W5HA 4XTCS 3GLIB 4Q47A 3RSLA 5KHOC 3LQQA 3GEIA 4QOSA 1PJRA 2WHXA 3RVBA 2ZANA 1XJCA 3MUFA 1W1WA 3GLIE 1PV4A 4JSTA 3KB1A 2IYZA 1R0ZA 2G3YA 3R7WA 2EVWX 3NVAA 4GI7A 1VDZA 4IVRA 5DI3A 1Q57A 2W2XA 3QPWA 3WBKA 4HAUA 2VSFA 4HEJA 1P2TA 1NSTA 2OV2A 1ZD8A 1Z6YA 3A4MA 5AJXA 4XH9B 1Z0KA 1RYHA 2YWEA 4AK9A 3TKLA 4LI0A 5AK0A 3IIKA 4AKGA 3GJ5A 4Q9HA 1OJLA 1TX4B 4UQOA 4DLVA 5LPNA 2OFXA 4HAWA 3PXGA 3EA5A 1GKIA 2PLFA 3CO5A 2F3TA 1C9KA 1TUEA 2G88A 2J0UA 5JJLA 4NDZA 2G1JA 2MSEB 1D6JA 3U2QA 4CVNA 1W2GA 2XB4A 1KMHB 1FMJA 2JDID 1KI9A 4OI1A 2QGNA 1X8JA 2W6JA 1GDDA 2F55A 4X8OA 2IYUA 2VPPA 1UBCA 4D0NA 1GAJA 1JBKA 1LFDB 1CP2A 4OJKA 4KBFA 4Q1FA 4NL4H 3X1YA 4JJKA 5L3SA 1G7RA 3SFZA 1H8HD 4GP7A 1EFRA 1W0KA 4NYIR 2PMDA 4OBEA 1UEIA 1FNMA 2GBLA 4D0LB 3FKSA 4Q4AA 2C95A 2J41A 2W2VA 4B2PA 3KXIA 1Z28A 4Q7KA 1NN0A 5TDHA 1VCNA 1ZNWA 3FMIA 4M22A 1NVVQ 1P73A 5K8TA 2IYSA 1GNRA 3U3KA 3H4MA 2DYKA 1AGPA 1VG8A 4Q4HA 3GLGA 4PZLA 3SBDA 4U7DA 2BM0A 1U9IA 4LJ7A 3I92A 2QQ0A 2V55B 2A5YB 2YINC 3IIMA 1KNXA 1TMKA 2P5SA 4RD1A 3UATA 3QXCA 4L4UA 5H1YA 2FNAA 3H84A 4IDQA 2VYFA 2OESA 3SEAA 5EXSA 2H5EA 1KDTA 4TL9A 3SYNA 3N2IA 4BZQA 1N6IA 1CRPA 3TUJC 3FMPB 3HYTA 4RZ2A 1TEXA 2OZEA 3WHLA 4IOMA 2O5VA 2W58A 4DB2A 4NH0A 1RRFA 2GKSA 3AVQA 2KE5A 3P4YA 3RDPA 1E2HA 2BIFA 5AUNB 2QU8A 1P61B 3QENA 2NO7A 3AVUA 3WYGA 1A7JA 4Q1BA 2HYIC 3HYRA 1S0UA 3IIJA 2CL0X 2GZHA 2NIPA 4P4UA 5EE9A 4TLBA 3EZ7A 5EJEA 3I61A 1TNDA 2XTMA 4M1KA 1G9XA 1P2SA 4QGHA 4P4SB 3R8FA 2RMKA 3KKOA 5BWMA 3SC3A 2ZI6A 4LBWA 3QJYA 3GJ6A 4HLQB 4JJZA 4B3BA 1Z2CA 3DOFA 3RRYA 2A30A 4URZR 5KSOA 1NKTA 1U2RA 4OHWA 2HUPA 5CITA 3VR2A 4AKEA 4BFXA 5C46F 4Q02A 3WHKA 2X19A 3EG5A 1UF9A 4M0LA 2WKQA 1J8YF 2QG6A 3EZ2A 4ESVA 1EX7A 5J4LA 1TADA 5HZHA 2WWXA 1OH8A 2I3BA 2ZYTX 2RGCA 5G3YA 2ODNA 3TQFA 2O8CA 1U8ZA 2PH1A 1YR6A 4HAVA 4QG7A 3EPHA 3NTUA 1DG3A 3SJCA 1MRNA 1R10A 1XTSA 5E95A 2ZROA 3QKTA 1RVDA 1MOZA 3TJZA 1R4AA 1P7CA 4DLUA 1OXSC 3CZQA 3FKSD 4M9XA 1Z2AA 1Q22A 2BOVA 2C04A 3EWSA 3GLHB 4YMSA 4NP6A 4G01B 3CW2A 3HWSA 3CRW1 2HXYA 5JI3E 1YE8A 1J2JA 4Q9IA 2XNDD 4HYYA 3SI7A 1E79A 3AF2A 2QNRA 1OFUX 4HB2A 4TWZA 3GLGE 4XWAA 4IW3B 1E9BA 4ILEA 3QXSA 4CEHB 1G16A 1GZSA 2FZLA 3BD9A 5CIWA 4BFWA 3OAAA 4U02A 5SZIA 1ZU4A 5C4GB 3I3SR 4LBZA 2EWVA 2ZUCA 5DNYB 3KQKA 4TZ6A 1G21E 1CEEA 3B8HA 5TXGA 3SZRA 3VNUA 4PHTA 4A4DA 2FE4A 2ZRKA 3A1TA 3VU9A 2V8OA 4QM7A 2RCNA 4TMWA 5AUQA 4M1TA 3ZIAD 3B1VA 4LHYA 5LD2C 1KI3A 2GZAA 2H57A 5FI0B 1BYIA 1SULA 2VP4A 1QRAA 2F1HA 4ZO4A 1RYFA 5M04A 3CH5A 4BE7B 1JR3A 4DSNA 1VPLA 4KJZA 4QBHA 2IS2A 2DFNA 4G3XA 1II0A 2ZM5A 3D3QA 2ZREA 2CHGA 3LA6A 1XJQA 2J7KA 2PX0A 5TVKA 1BOFA 3EARA 1GRNA 2G83A 3NBXX 5JEEA 1ZUHA 1ZJ6A 4IEEA 4H9GA 4XVRA 4C0SA 2GAAA 4CRWB 1UADA 3DPUA 1P62B 2ZR7A 4US0R 3M0EA 1E9AA 4XTRA 3NG1A 5JSZB 3W5JA 1ELOA 1Z8FA 5JWRA 4NYJR 4CYMA 3I1FA 5KSYA 1W5TA 1VCOA 2WJJA 3IKJA 5KDOA 2QRZA 2XZPA 1N6PA 3N5CA 4MUBA 2OEPA 2CK3A 2FGJA 4BUJA 3U4QA 1RPZA 1QHHB 3GQBA 2GCPA 1VMAA 3TVTA 2HF9A 1KO7A 1AQUA 2OM2A 4O2LA 5HKKD 4IFEA 2GILA 2QUZA 3ZDQA 4CEJB 2GRJA 3FOZA 3MSXA 3LNCA 3FB4A 1E9CA 3VMFA 1G5TA 3GFOA 1KYIA 2BDTA 5IK2A 5DI9A 2IEYA 4UXIA 3CR7A 2QQEA 3WMGA 2FFAA 4GMXA 2IYYA 3IEUA 4ARZB 4LHVA 2J7PA 5KPJA 1KK0A 3FWYA 2AR7A 4H1VA 2VHCA 1Z47A 2GJ9A 4QGFA 4HI0E 5JWOA 3G0HA 3AUYA 2H92A 3ZS8A 2ORVA 3B60A 4FMCB 4E22A 3KKPA 4WW0A 1LV7A 1OW3B 4BZXA 1K8RA 2DBYA 1JB1A 1HT2E 2WAYA 3FYHA 1ZM4A 3BB3A 1IJEA 4FMBB 1ODFA 2OAQ1 5AWFC 3QEJA 4KV9A 3REGA 1XCPA 3B1WA 2ZI3A 1K5GA 2J1LA 3PEWA 3ZQJA 2Z4SA 3AGQA 3C41J 1HQYE 3DL0A 1N5LA 4H1UA 2Y8EA 5L3VA 2O52A 1XPOA 3IUYA 4DCUA 2V1XA 1OYYA 3EASA 3LW8A 3K0FB 4KXFB 2WWHA 4DLYA 3CLVA 1G4UR 1E96A 1Z6AA 2J0VA 2YJTD 3MJHA 4JLVA 1NJGA 4C30A 4CT4B 2GVDC 3FHOA 421PA 4PC3A 1I2MA 5KNBA 2UVQA 4F91B 1OXXK 5A5GA 1F5NA 4CEHA 3SYKA 2R62A 2ZRLA 2QORA 2ZI5A 521PA 3A8TA 5JECA 2J0SA 4JLAA 4JVSB 3HDTA 2PZEA 4MGIR 5FUVA 3B9PA 5CLLA 2BC9A 1E1QD 4QXAA 3FHTA 3VAAA 1ZCBA 1IN7A 5DSZA 4HUQB 3LLUA 4B34A 3LFUA 3THXB 2QN6A 4FN5A 1N6NA 2QZ4A 2GF0A 2JA1A 3HR7A 3W3AA 5E7MA 2J59A 4IEIA 4EFMA 1BO6A 1F6BA 5EP4A 4ZCLA 3H0KA 5C4MA 3JVVA 3DZ8A 1VECA 2WWYA 2B8TA 3KFXA 1G3MA 1IM2A 2WM9B 4DJTA 3LX8A 2C77A 4V0OA 1CR0A 3U6BA 4MYCA 1AS2A 3R7WB 4IJMA 1ZBDA 2LWIA 3AV0B 3C4JA 5FR2A 4XSHA 2CNWD 4RCYA 4S35A 1YU9A 2ZJBA 3GLIA 2ZI4A 3TVDA 3K0AB 4QBGB 3VR1A 4KVAA 1QBKC 2RGGA 2Z6VA 2W6JD 4TT3A 3KDSE 3G82C 1E2GA 1VYVA 3K53A 2FSGA 2MSCB 3MD0A 1JI0A 1XRJA 4BFZA 4Q5IA 3ZVNA 3QNUA 2ORWA 3L8YA 1EG7A 2OBLA 2OXRA 2Z0MA 3W8RA 3I5XA 1Q3TA 3U6KA 1J7KA 2IYWA 1JR3D 3EZ9A 1KO4A 1G7SA 1QHIA 1SVLA 3OE7D 3IO5A 1JAHA 4U00A 5C1BA 1YQTA 3WY9A 3CRMA 4LJAA 5CB8A 3A4NA 2LKDA 1XEXA 4IKEA 3BORA 3U7GA 1S1CA 2Q21A 3MLEA 3THXA 4DBLC 4DXAA 1SQ5A 1L4YA 4PXAA 3VX4A 3UWOA 4URWR 2D74A 1CRQA 2AD1A 3AVPA 4WOPA 2V54A 3ZZ0A 1R8SA 5IDVA 3QSYA 1TL7C 3SHWA 3B9QA 3TNFA 2C98A 5AUPB 1KZ7B 1GWNA 5JRZA 2WKPA 1EX6A 1VG9B 5CIQA 4JLBA 2AD5A 1HA3A 221PA 1EK0A 1WP9A 2ZETA 3EPJA 1DE0A 5CDFA 4TYYA 4KCGA 3LXXA 1RW4A 4RD3A 1IN8A 2D62A 2FOLA 2XJ4A 4LGMA 4MGYR 5HCIA 1NNEA 1F60A 1R5NA 1EFTA 3NHBA 4BASA 2HLDD 2QBYB 3GJ0A 3KFVA 1XTKA 2WICA 1R5OA 8OHMA 1SKQA 1NVVR 4RY2A 1GRQA 3EAQA 2VP5A 5DN6D 1XD9A 4ON9A 1AZTA 1MO5A 2Q6TA 4LYFA 1T4GA 4WIAA 3SS8A 4JYCA 3ASYA 1VHLA 1I4DD 3CB4A 4G5GA 1KO1A 2WIBA 1NKSA 5LB2A 3L2OB 3NH9A 1M7BA 4JLPA 4BFVA 4DSTA 2QENA 4IHQA 2ASEA 2GWHA 1BMFD 3R8CA 2XZOA 3OEEA 2DPXA 1XMIA 5E7IA 1ESMA 1R0XA 3GJ4A 4L5BA 2WKRA 5G40A 2ZRJA 1E1RA 3DHWC 4POAA 2QPAA 4DDVA 3GEEA 1E2NA 1N6RA 4BWYA 1PLLA 2HDNB 4LHWA 5HKKA 2CE7A 3EIHA 3RNLA 4IDOA 2O0JA 3ND8A 1EXMA 2ZSDA 3SJZA 1UAAA 3PUVA 4OK3A 3LVQE 4PO1A 3V4RA 3LWNA 2FU5C 3WMEA 2O8FA 4UNRA 2QAGB 4QHTA 1G8FA 4D2IA 4ZV4A 4RZXA 5FUWA 2YV5A 4HZUB 2O8DB 4P33A 4M1OA 4KSBA 2AN9A 3DM5A 2N1BA 3L0PA 4A82A 2A5JA 4DLTA 4URUR 1N0WA 3NH6A 4KSCA 1IQPA 2EYUA 2OXCA 2HEIA 4OHYA 2ZS7A 1VCIA 1DS6A 1LW7A 5SZJA 4YXWA 4GT1A 5EUQB 1NSFA 2K5UA 2FEMA 3U61B 1CR1A 5FBRB 3HPQA 3EXAA 3IILA 4CEJA 4ZPXA 4GOJA 3QVVA 3FKQA 1KK3A 2ZVPX 2ZRPA 4ACBA 1R8QA 1LVGA 4D6PA 2BM1A 4DCNA 3THWB 4PPNA 4HLUC 2GETA 2C9YA 3BB4A 3OESA 1FQJA 2BVNA 1IXZA 1VYTA 2D3WA 4JLOA 3KUCA 2H7VA 4HAZA 2P6UA 1XEWX 4RVCA 4DB4A 2R6AA 1RC8A 2AWNA 2PBRA 1W46A 1CLUA 3FDIA 3NEJA 1XMJA 2PCJA 3FMOB 3CKLA 3LX5A 3PQCA 5JSZA 4BGDA 3BE4A 4DDUA 721PA 2O0KA 3FVQA 3W5IA 3OEHD 4IDPA 2JLYA 2Q3HA 2AXNA 1N6KA 4ZDJA 1VTKA 4HB4A 2CDNA 4PAMA 1KI1A 1KKMA 2QSZA 3FGNA 4FCWA 4US1R 2YYZA 4LOAA 4PTLA 3ADKA 5E3HA 2PCLA 4A2QA 2PEYA 4K81B 1GIAA 2QAJA 4QBFA 1SHKA 1NN3A 2BKUA 2RGDA 2AFIE 3CX7A 4UJ5A 3TW8B 1F48A 3X1XA 4B33A 5TB5A 4M1MA 1GRRA 1T3SA 3NDPA 2BMDA 1OV4A 1G5PA 1S9DA 2IUTA 3PUZA 1S4QA 4PC1A 1YR7A 1JJ7A 4B3DA 1YR9A 3KKNA 2NTYC 4HDCA 4LDJA 4D4MA 2WWWA 1JQLB 4DCVA 4PPQA 3VU9B 1FW6A 4Q9JA 3IQWA 4AYWA 5LDDC 2GXAA 1TF5A 2JJ2A 2N42A 2CHVA 4O25A 5IHPA 1YRBA 3BK7A 1I4LD 3GJ3A 2KWIA 1EWRA 3GD7A 3K9NA 3QOFA 1OH6A 1AS0A 3CH4B 3LXRA 2GXSA 4ARZA 4PFSA 1JR6A 2GCOA 1MT0A 4WZBE 4I1SA 1XU4A 4XD7A 2Q3FA 2YOFA 3BFVA 2NO9A 1LS1A 2F1JA 4KVGA 4Q1EA 2JJ1A 3K9GA 2FPLA 1UFQA 3PUYA 3ZZTA 1VIAA 1E9EA 1NN1A 4A6XA 1MR3F 4Q7LA 1VIYA 4LK2A 1YHNA 3VR5A 2BWJA 1U0LA 1HEIA 3LBHA 1DELA 2D2EA 4URYR 1SVIA 2Z4RA 3W6OA 1FOEB 1YRAA 3GCGA 4LV5B 1FP6A 1RZ3A 1G19A 2VL7A 3CNOA 4MRPA 5FL3A 4LBYA 3ZVMA 5J40A 1G6OA 2ZRAA 3BFKA 1CJKC 1JXOA 1IN6A 1CKEA 3RRNA 5KSPA 2FV8A 2FDCA 2VHJA 2LKCA 3L0IB 2AWOA 1UM8A 2RGAA 1KSFX 1U9IC 4KU4A 1KI7A 1FMLA 4C3ZA 2CVHA 3K70C 3AF4A 5FPSA 3EC2A 4JT4A 2IS6A 1LY1A 3L0SA 5TV2A 1R2QA 4MYHA 2JCSA 1XTQA 1ZCAA 2ZAOA 2CL7X 2VEDA 2ZJ8A 1ZP6A 4QJ5A 5DH9A 4ZI2A 3QKSA 2FPMA 2PJRA 2V4ZA 1ZNYA 4A36A 4K8OA 3OIUA 4EPRA 1FTNA 1CJMA 1TQ4A 3MGCA 5J47A 5KYKA 2CJWA 2WV9A 2UZIR 3EWAA 3A36A 2D4HA 4LPSA 1T5LA 1DAMA 2QT0A 1FUUA 3U3MA 1G8YA 4II7A 2IHBA 4GDFA 1MO3A 4JVLA 1JQJC 3CIOA 4R9UC 2QP3A 2J5XA 1KY3A 2ODBA 2J7PD 5FUXA 3B6EA 3K70B 3IBYA 1US8A 4TQAA 1HURA 1IONA 3PITA 4C0JA 5D3MB 2VP6A 2X2EA 1QHSA 2G6BA 5L8VA 3UG7A 2QL6A 4OKSA 1N6HA 4M9ZA 1SKYB 3CPJB 4HAXA 4FINA 3T34A 3TSOA 2QBYA 1G3UA 5FPKA 2VHQA 3GLGB 1G64A 1NP6A 2FJUA 3VKHA 2KI5A 3KKQA 1ZRHA 3TUZC 2NOAA 5DHFA 3QG5A 3I73A 3K0CC 3A37A 4NHOA 4BEJA 3REFA 3IPYA 4XWKA 2BJWA 1IN5A 3ZQ6A 3C8UA 4PQFA 2IS1A 2ZS9A 2QGZA 5F2EA 1FZQA 1ZC4A 3NWJA 4FCVA 1G3QA 4J0QA 4OQXA 2QTVB 1O87A 4LC1A 4UNNA 4RCZA 3T1QA 2PZGA 3GLFB 3CRVA 2BBSA 5IRCD 3EPKA 2WJIA 3CPHA 5DGXA 3WMFA 4KAXA 2E9SA 2VHTA 4DDWA 1OPXA 4A8JB 1OF1A 1OT3A 2QSYA 5CYOA 1CJUC 1E2PA 3TSWA 1H65A 1RRGA 3AVWA 1OB5A 1OXTA 1CULC 4FI3C 2Z83A 2A3RA 5BYKA 4P32A 5AJYA 2ZRNA 2RHMA 4M9QA 4WXPA 2F1IA 4EJSC 4MYTA 2ZR9A 1T6NA 2BMFA 3Q8XB 4CT5A 1ETUA 4MKFA 2J0UB 1P75A 2J87A 4FWTA 5KUTA 1N0UA 3IBGA 1D2EA 1G1MA 1E9SA 1NBMA 5FOUA 2QEQA 3GLHE 1QHHA 4BLOA 1SVSA 3PG5A 4JKYA 1PUIA 4BPBA 4PPFA 1K6MA 821PA 3UIEA 5UKDA 1Z29A 1BMFA 1DVRA 4UJ3A 3QY0A 4QNRA 3U3JA 5FOVA 4F93B 3CF6R 1IN4A 3U7HB 4GFDA 3FHCB 1KMQA 1SVOA 3M1IA 4A0RA 3QF7A 4PAOA 2FSIA 2XTZA 1ZM2A 2ONKA 3EPLA 4E09A 3B1XA 3SJAA 3AF1A 4BLTA 4DEYA 3OIYA 4HAYA 4DVGA 4DHEA 4GRAA 1W36D 1MKYA 1S3SA 2RHDA 3KQHA 3L8ZA 1ZAKA 3KQLA 1OFIA 3VHLB 4TLEA 3MFYA 2DR3A 4A8JA 3M4YA 1X8KA 4DDTA 1XXHE 1IY0A 3MAAC 4PO9A 2B92A 3NXSA 3TSZA 5KNDA 2GNOA 2F43B 1PUJA 4UNPA 3KB2A 1C4OA 1NJFA 3QIAA 4N1AA 3WYFA 4NONA 1TTTA 1E4VA 4P4TA 2GK6A 1MO6A 3U7FB 3GLFE 1NIPA 2R9VA 4B2LA 4JLMA 1TU4A 4HLUA 4DUGA 1DAEA 3A1VA 1AM4D 5F3WB 3BFXA 1T0JB 1U0JA 2VA8A 2D7DA 2WMOB 1Q1BA 2I4IA 3ADCA 2JLXA 2WWIA 4XOIA 2HJGA 4Q01A 1DG1G 2OCPA 1GVNB 1QF9A 3HP1A 3GJ8A 2C99A 2HF8A 4RD2A 3KUDA 4C0BA 2FF7A 2GCNA 4KITB 2QP9X 3OAAD 2A9KA 2D06A 2GF9A 2JJ1D 3IHLA 3X1WA 4QC2A 5GJBA 4C2TA 2HJVA 3BH7A 3TAUA 3VNVA 2CNWA 2OCBA 3DMNA 1OHHA 3DMDA 2KBEA 4LY6A 3K70D 2O8EA 1M74A 4RFSB 5JCPA 2ERXA 2R44A 2O8CB 3A6PC 5FTLA 5G53C 1I4TD 3BXZA 4DIDA 4BLQA 4MYUA 4YLGA 4R7ZA 3ASZA 2CCGA 4B2IA 1GUAA 5KSZA 3C16C 1TQ2A 1FL9A 5IK2D 1F2TA 2X8AA 2WVJA 4JLDA 1TPZA 3FFAA 1E98A 1R0YA 2V7QD 4N0DA 5CM9C 5KU1A 4EFNA 3WRXC 3N2EA 4UXJA 1XBTA 2P67A 3GP8A 3Q72A 4P4SA 1T8UA 4BLPA 1Z07A 2YNMA 4ZI3A 4FWIB 4OYHA 3VQTA 1CF4A 3CUEF 5DIFA 4CZ2A 2XZLA 1KI6A 4A0FA 4Q1AA 3TIFA 4GPTA 1XDBA 5B2ZA 1ZINA 4B6FA 2XGJA 2CLDX 3QVUA 2P6RA 1DO2A 4V02A 4DLSA 5KPDA 1ZIOA 4B73A 1G5RA 2VP9A 4IVQA 3BC1A 3MWJA 1K5DA 1TUIA 2F7SA 4V0MA 4Q4JB 3V00A 1W7AA 1IY2A 1Q3HA 1ZNZA 2ZTSA 4G5SA 2OE2A 4HUQA 4V0NA 3WXMA 2WSMA 1UBEA 4LJ5A 3AUXA 4DIEA 1P9RA 1DPFA 1RJ9A 3VX3A 5HE9A 621PA 1F2UA 3KTAB 2ZUDA 1U8AA 1L4UA 2GEDA 4Z8XA 4M2LA 3V9PA 3BH6A 4CGZA 2O8EB 1IAQA 2WBLC 3T06B 3AVVA 2YOGA 1YKSA 2IYXA 2XAUA 1JR3E 2BCGY 2ZS8A 5TARA 2G77B 5E7JA 3PUWA 3DKPA 3AKCA 4P31A 2GA8A 5BQ5A 3CRRA 4MKGA 2WPDA 3J81k 1DAKA 2NPFA 1NMYA 2ORIA 2Q9CA 5HCNA 5P21A 2EFCB 4LJ8A 3QF4B 2G0NA 3U44A 1N5JA 3KQUA 2GTPA 3O8RA 3U7EB 1E0JA 2YC4C 3HU2A 3VHXA 3GEHA 3D6TB 2ZRHA 1W36B 2PT5A 5KDDA 3Q3JB 4Q19A 4EQ6A 3CNNA 3QBTA 4Q1CA 4N0EA 1G18A 2QM7A 2CL6X 1CJTC 2J9RA 2XXAB 1A4RA 4EJSB 4M21A 2FX3A 3BJIC 2JDIA 5G3ZA 2BEJA 3OIWA 4LRWA 3KL4A 4M8NE 2GXQA 2GESA 3UXMA 1NBMD 4TL7A 2QI9C 1UKVY 4Q9LA 4I1UA 2VH5R 4LYJA 4Q03A 2REBA 1P2VA 3A58B 4CEIB 3C14C 4KO8A 3NBZC 2UKDA 2VSXA 3E5HA 3UG6A 4R71A 5DYIA 1D8TA 1O3YA 5CM8B 4TYQA 1L2TA 1DBSA 2XJ9A 4MQBA 4XD7D 4B47A 2RGNA 3OE7A 2HCJB 4YQFA 4Q18A 1W49A 4LSGA 3U4QB 1KNQA 1GOTA 3AH8A 3T1OA 2VF8A 2FPKA 2O8FB 1FQKA 1UKZA 1G7CA 5B58C 2IS4A 4TSFA 2IXGA 3WNDA 3MCAA 1JALA 4BQSA 1EFCA 2WJYA 5F9HA 2F6RA 4OI0A 1QHXA 3LQRA 1H8ED 4OJQA 4TLAA 1E4YA 5JBQA 3PEVA 4ITRC 1Y63A 4TMVA 1Z0IA 1NL3A 2JJ8A 5B57C 3RC3A 2GDJA 1J99A 1E2QA 4JIMA 1KI2A 3NEYA 2WOJA 1DAIA 4B6EA 5FBLB 1VG0B 1ZIPA 3I32A 2WJHA 5J4HA 1S2MA 2FFHA 4D81A 2RH5A 1Q44A 3BOSA 2PEZA 1T0HB 1QHYA 3CR8A 4HLCA 3OEED 4Q4LA 4DT1A 3GJXC 4JBXA 1E1RD 2GJSA 5JS7A 1G3RA 4DLRA 4AURA 4CF7A 2BJVA 2O0HA 2OILA 1XPUA 3TLXA 4FMDB 1Y3AA 2C5LA 1OIXA 4KODA 5DLQC 3RABA 2YC2C 4JZKA 4QJ3A 3B13B 4ZIRB 3C5CA 2PMKA 4TMTA 4DCSA 2ZRBA 2R6FA 4E07A 3OIVA 1II8A 5F98A 2IEZA 4TQ9A 4YC7A 4Q21A 2G9NA 1Q12A 4O0MA 2MMGA 2QMHA 1EESA 1TF7A 1COWA 1AK2A 2ZJZA 2NQ2C 3MRSA 3PIRA 2R65A 2W6ID 3UPUA 2W0MA 2GAOA 4G5OA 1QDEA 4KYIB 2XSZD 1UPTA 4JKIA 2YHSA 2OSBA 2JLRA 2OFOA 3DZDA 4M4SA 4R2IA 4ZDWA 4ASUD 1YVDA 2TMKA 2GJAA 3PV0A 3BH0A 1BIFA 2JLVA 4NPHA 4C0HA 3BB1A 2PZFA 1KSHA 3HU3A 2H18A 1OXVA 3CWQA 4I1OA 1IHUA 1J70A 1VG1A 1N6LA 1XD2B 1N5IA 2EFDB 3ZVRA 4C7OB 4TLDA 1A2KC 4TZ0A 3IGFA 3THOA 4IVPA 2QTHA 5FBQB 3W90A 1AQYA 1N0VC 2H8KA 5TY0A 1AKYA 5CB6A 1BKDR 2L0XA 1KJYA 2IHYA 3AF0A 3BAFA 1R5BA 3IDQA 4JL6A 3T1TA 4LC0A 4AIIA 3RRMA 4BRWA 1G20E 2JLQA 1N25A 5BW8A 1VHTA 4TN1A 2BBWA 5KNCA 5EQTA 2OCAA 4B71A 3GJ7A 3GFPA 1VCMA 4Q4JA 4I81A 2O8DA 1NI3A 3ZYCA 4OHVA 2QTFA 1WQ1R 5ELXA 1WB9A 4B43A 3KZ1E 1WBDA 4U5XA 2AX4A 2ZRMA 3Q85A 3CRQA 3ZJYA 3HJNA 2ZE8A 3GPLA 4AG6A 1JXMA 2B21A 4L15A 2NMVA 4QGGA 1TEVA 1AN0A 1BYUA 2Q9BA 2ZPTX 3E70C 3LH5A 4P0TA 4Q48A 2HT1A 1E0SA 1GTVA 3G5UA 4PC6A 4ZKEA 1GFIA 1XWIA 3PFIA 4C0AC 2ZRDA 2YWFA 2LCFA 5FUYA 3KX2A 4EUNA 4LHXA 3H2YA 3DM9B 3ICQB 4B3CA 4EPXA 5JS8A 3K0AA 1PLJA 2IK8A 2WTUA 2W6IA 3B85A 1FPMA 1YZKA 4LBVA 3RWMB 5K8IA 3I62A 2IW3A 5L3QA 4LYAA 3R9XA 2ZRGA 3PR1A 1YR8A 2IYQA 3NDBB 1E79D 1OE0A 4AKIA 3NIBA 2ZYWX 4IOLA 1G3IA 3W8NA 1E2FA 4HDOB 3U44B 4MDEA 4XSGA 3RC8A 4XJXA 2G0TA 2XTNA 2ZYUX 4C4PA 3K9HA 4TMZA 4MKHA 1DTSA 5KDLA 5IT5A 1KHTA 1WBBA 4PZZA 4PSAA 1ZM9A 5AJVB 2ATXA 3I8SA 1KI8A 1HV8A 4D80A 2CBZA 2IYRA 2GCOB 5TMPA 2VBCA 1RFLA 3THYB 1KJZA 3H1TA 5JMTA 3CX8A 5EXPA 3C15C 4HATA 2IX3A 5BN3A 4XVQA 1KO8A 2E1RA 2HT6A 1II9A 1S3GA 1D9XA 5AUOB 5JHHB 1ZUNB 2MMCA 4QKQA 2QP4A 4TTRA 4C0QC 1ONBA 1OHHD 1VKJA 4OQNA 3AVYA 2AL7A 2W83A 1NLYA 4URXR 3B1ZA 3D7MA 5BXQC 1XZQA 5LBIA 3GFTA 3ZD7A 2HV8A 1Z0AA 3QE0A 4WBSA 4OK6A 1S8FA 5L3SB 4A92A 1E32A 3UMFA 4WAUA 3TRFA 4B32A 3ZVLA 3DKVA 3Q7PA 1E0AA 1DARA 4LHZA 1E9DA 2ZU0C 5EP1A 1NY5A 3LD9A 4YMTA 3OFND 4BFTA 4Z8YA 5GJCA 3UKDA 2Q3MA 2JAQA 3C5HA 2C9OA 3UMSA 1ZW6A 3NBYC 4A9AA 2BMJA 2ZUBA 4QBIA 3RLFA 2GEUA 1HY3A 3KJGA 3F8TA 3O8DA 5EE3A 4DWJA 3JZAA 4F4JA 1D9ZA 2XNDA 4KI0A 2CJWB 4BLRA 1G6HA 1XEXB 3UMRA 3ZZUA 4E5UA 4QGAA 3NBFA 4JYBA 2R6CA 3VKGA 1NF3A 1U81A 3AQ4A 3P32A 4DSUA 2GJKA 2AKAB 2VSOA 3D31A 1E2IA 1E3MA 2EU8A 4B44A 3TH5A 2R6GA 1X1SA 1Q21A 4LJ6A 3E2IA 3X2SA 1KIMA 1CR4A 1P4SA 3RS0A 4RD4A 1XTRA 4NCIA 4DKXA 2DWQA 3EA0A 1NY6A 2JLSA 3MG9A 4YMVA 3PENA 4DLWA 1U0HC 3S1AA 1AGRA 1DAFA 1MRSA 2QAGA 2N46A 3JVUA 3MWYW 4CEIA 1S9HA 3ND9A 3ZH9B 1N2CE 2RAPA 3CNLA 4GP6A 3CZPA 2CK3D 2QM8A 4V03A 3IEVA 4GOKA 2VIIA 3ZGXA 4W5JA 2QE7A 2IUUA 4KYUA 4W5WA 2ONJA 1W5SA 3QKUA 2GXUA 3KXLA 4HZUA 1Z22A 2V6IA 2A7QA 4O2RA 4DLZA 2O8BB 3TQCA 2NZ8A 4GSYA 4X8MA 1XZPA 1QHGA 3TR0A 2IF0A 1P9NA 3FTQA 2JEOA 5BN5A 3VR3A 1Z3IX 4TL8A 1OIVA 2XITA 3AKDA 1LS6A 2ZJAA 1KDRA 5HE8A 5HZKA 2YKGA 2DFKB 2EWWA 1UDWA 4HSEA 3ETLA 5FR1A 2CVFA 2F9LA 3T5GA 4TYWA 1HE1C 1AJEA 4C7OA 4D26A 2BEKA 1GNPA 1U98A 4FCTA 5CYPA 3RS5A 1AZSC 1E2KA 4EJSA 3GLFA 4NMMA 2OFWA 4EPWA 2FN4A 1W0JD 3F0TA 2I1VB 4YONB 3I5YA 2OCYC 1G41A 2NGRA 5DE3A 3LY5A 1Q1QA 4KBGA 1HUQA 3C7KA 1JPNA 1F3OA 5GADl 3KKMA 4RFVA 5GVSA 3LRPA 4JL5A 2PL3A 2RGBA 3RRZA 1GP2A 5DHAA 5JLJA 5KOYA 2C8VA 2WAXA 3CBQA 3ONWA 1KK2A 5AJWA 5JEDA 4LJYA 1N6OA 3WYAA 4V0KA 4ACAA 1KSJA 4TT3D 1ZC3A 2QPTA 2W2TA 2CLCX 5DO9A 2GEVA 1TU3A 4A2PA 1KDPA 3LBNA 5EXXA 4M1YA 3AGPA 5A0FA 1LTQA 5JCZA 2QMEA 1W4BA 3ZLJA 2A5DA 2CCKA 3BGWA 4M1SA 3CPEA 3QKRA 2DFLA 2ECKA 4TQUS 4WZ6A 4DLXA 2DY1A 4FD2A 4IDHA 1XCMA 2XSZA 1KO5A 1UDXA 3B82A 3CX6A 4L16A 3TBKA 4Z54A 1XPRA 3QXXA 2REOA 2HYDA 4TTQA 1KOFA 1X3SA 5SZKB 1NMZA 4ERNA 4M53A 2KBFA 4V0ME 2FFBA 1IJFA 1ZM3A 5HPYB 1OYWA 5GVRA 5LB4A 2A5GA 1GL9B 5FOSA 4TYPA 1XD8A 1C1YA 2IUSA 2FEOA 2KB0A 1RRCA 2OBNA 4JMPA 5D3QA 1UBGA 3A1WA 1GM5A 1V5WA 2EFGA 2WMNB 5AR1A 4D0GA 3NHAA 3TR5A 1TF2A 1DOAA 4Q7MB 1XP8A 2EFEB 2KJQA 4IXNA 4OQMA 5CK5A 1X6VA 3FMFA 4Y0AA 1E2MA 3AVTA 3TGPA 1RE0A 4GMDA 4Z51A 2GJ8A 1NG1A 3RHFA 4IFBA 2ZJOA 4DCTA 2V3CC 4QFMA 1DAGA 1FNNA 3LLMA 4MUAA 4MKIA 3L43A 1Z83A 5EE1A 1XNJA 3IO3A 1QHNA 3RAPR 1P9WA 1U99A 2FFQA 4Q00A 1ESNA 4B75A 3QKRB 4DSOA 1U94A 5A4JA 4D25A 1P6XA 1X8LA 3OHMA 2IA5A 3AVXA 1A5TA 4B74A 1KGDA 1A1VA 1SXJA 1W0JA 1G17A 5FL7D 4YMUA 2C78A 1XMVA 4B3GA 1FX0B 1Q1ZA 1X86B 2UZ3A 3ADBA 2ZIAA 1GSIA 4GZMA 3O8CA 1MO4A 3VR4A 4DUGD 1NVUQ 1WCV1 1B0UA 2P5TB 5JWHA 5C2JB 4RD6A 3AKYA 3X1DA 6Q21A 4IDNA 2QA5A 5FPHA 3ZIAA 3BS4A 2Z43A 5CJPA 4BLSA 1ZU5A 3EX7C 2QROA 4PC7A 2DFTA 4MITA 2C9CA 3KJIA 4W9MC 4TMKA 4R98A 1OB2A 4EAQA 1ZD9A 1PZNA 2EQBA 3RS4A 4F7WA 1ZVQA 1NIJA 1SXJD 1XB2A 3AP3A 1SVKA 1IBRA 1NMXA 3MJRA 2W0SA 1Q1EA 2VRWA 2V9PA 2ODWA 1II8B 4FIDA 3T61A 2OHFA 4HUTA 4NCNA 2CCJA 3L0OA 2RGXA 2W00A 1GKYA 5EUMA 2VQSA 5C18A 3AP2A 1SXJB 2BKEA 2IXFA 3T15A 4A0HA 2PJZA 2IT1A 4GZLA 1NRJB 2FMXA 3VKWA 4EFLA 1WMSA 2C03A 4L9WA 4NU0A 3PVSA 3R9WA 1G7TA 1E9RA 3IQXA 2P6NA 4PO8A 1WE2A 4B3XA 2AXPA 3NC1C 3A1UA 3K8YA 2P3SA 4JVMA 2JIZD 3K1JA 4PZYA 1E2JA 3EIQA 5ANRB 1FX0A 3QG1A 3KQNA 2BBOA 5FOTA 1XJ0A 2A2ZA 4LPKA 2NO6A 4NYIQ 5K8UA 4UNQA 4AC9A 1AA9A 4NCKA 5JZVA 4AWXA 4GNKA 4PPGA 1G4AE 1G8HA 3RS3A 2PX3A 2Q0HA 4OK5A 1R6BX 1EFRD 1KAOA 1P60A 2VP0A 3LW7A 4JBWA 4KLZA 3PEYA 2R8RA 3EW9A 2DHRA 1SHZA
chains in the Genus database with same CATH superfamily
1LBTA 1UCFA 4JLJA 2XVAA 4RVOA 4TSFD 4RZUA 1D5WA 2WPDD 4G37A 4INAA 4XR4A 5SY4A 1NLFA 4EUHA 1MTZA 3IDOA 3ZE9A 1MC4A 3M4NA 3LUPA 5JAIA 1BX0A 3UOWA 2HU5A 3AW8A 2L19A 3OWHA 2CFSA 3UHFA 1VDMA 1ZD5A 2ORED 4TZKA 5FPYA 3LLVA 4BLUA 2O4UX 1CVLA 3ORHA 2XOKD 4MRVA 3QJ5A 1MEOA 1QFJA 1H2WA 3RJMA 3A2LA 3WR5A 5GZ3A 1W76A 1KQ3A 2X5JO 4DLXA 1ZNQO 1UMKA 1SJ9A 3O4VA 3TVYA 5LXTA 4F2DA 4OM7A 2OHHA 3P9NA 4I55B 1WCXA 2I6XA 4Q1DA 3SDZA 2P3OA 4RKQA 3MYRA 5L7YA 3GWZA 3BPSA 3H1FA 2Q3BA 1RM5A 2WZQA 1M2VB 2DWPA 2BFBA 2Q8NA 1EFDN 5DGDA 1JA1A 2JH9A 5FBVB 1D2NA 3T35A 2R97A 3ADPA 3ND6A 3INGA 1ODJA 2BBTA 3CLKA 4BX2A 3P97A 2ZXFA 2ZE7A 3M7IA 3FOFC 1ZONA 1SURA 2R6DA 4KQ1A 4OA5A 1KZYC 4WSOA 1E2DA 5FRDA 4BU0A 1FBTA 3LAWA 3QF4A 2FW8A 5CK4A 3O84A 1HLPA 1UJBA 2Z5LA 3QU4A 3UUGA 2WFLB 1YRWA 4UZFA 4ZVPA 2XXAA 4W8GA 4QTTB 2YJGA 4GVLA 1MOPA 3BMNA 4NESA 4K88A 3SX0A 1XNGA 3B38A 4XJTA 1V26A 2ZI7A 2NP7A 1W5BA 2AKYA 3DW3X 2RH4A 2Y92A 4AO6A 1WB9A 2RGNC 1OAOA 3A1SA 2HXGA 4BKQA 5TT1A 1XFAA 2M1XA 3SN6A 1J0CA 1X7YB 3KQQA 4N3NA 2CNOA 1U3FA 3OPVA 2F62A 2FZ5A 2HK7A 4QLAA 4RHXA 2BYTA 1GZ7A 2QNBA 1C0EA 1YT5A 5LQJA 1UJ2A 2P1RA 3DTVB 4A15A 1TT5A 1HKHA 5JDIA 1F2UB 4RMJA 2C2XA 2GD2A 3SLRA 1VP3A 5C8YB 1M5TA 2POCA 3FYDA 5HA5A 5IN5A 4JI7B 3WWYA 2QMUA 4B6OA 3F9CA 4S2UA 4OSPA 1WF3A 1XCJA 3K5PA 4M98A 4E94A 4R9RA 5KTYA 1IHXA 1YBVA 2FN7A 4UQLA 2JPDA 4IHJF 4AUKA 2A5LA 2Y93A 4FYWA 4HDSB 3I2HA 1PR0A 4R9SA 1XXHA 4DAEA 3IUSA 3Q7QA 5EZ5A 4Q6WA 1CR6A 3V7WA 1X1QA 2WWFA 3DAHA 4IWNA 3D6FA 4MGKR 2ZU6A 1DMSA 2CMKA 4PLFA 2BUBA 3TDNA 1YQWA 2XYRA 3PSAA 4RHCA 2O8BA 3OF5A 3OE1A 4IIBA 3DMGA 1XMQB 2VO1A 3GRFA 4YJHB 3FCCA 2Q5CA 3ZW8A 2QTAA 4HTAA 1OBFO 1VPEA 3HPRA 4XPZA 3VNRA 1D6SA 1H69A 2Q6LA 3NOVA 3WOVA 3GN1A 3M4JA 4RJLA 2GVZC 4EI9A 3GBSA 5A5DA 1Z18A 2FSHA 3AW9A 5T4FA 3VGJA 1O5OA 3CSUA 3KSMA 1FFWA 2QYHA 5L3QB 1B3BA 2I1QA 2X8LA 1BCRA 3NUGA 1ECGA 3KIPA 3Q87B 4F85A 4HS4A 2CEAA 2C4NA 2KSQA 5JZ9A 4OXNA 4EB6B 3P9QA 1Y6RA 3DEHA 4MAFA 1JBEA 1HL3A 1LNZA 1WA5A 2CB0A 4HGYA 5DCLA 2JLZA 2JLUA 3M6UA 2OYCA 4X62B 1ZUIA 1Y5IA 1JFFB 3SHTA 3ET4A 3P20A 1T8RA 3WBJA 2MSWA 1Y8ZA 1E99A 2YWCA 3DFFA 4ZVMA 4EB8A 4UVEA 3DHEA 3I9OA 1Z4JA 3P0FA 3X2FA 2JJ2D 5JJKA 1I5RA 2A9VA 4MV0A 5I01A 1TGVA 4MRMA 2O1WA 3IBSA 4PSKA 3TUIC 1SC6A 2JFOA 1T8TA 3DEJA 2CHEA 5B1DA 3D5TA 2P9GA 2EFYA 2IE8A 2RB4A 3Q5EA 4LFAB 1OGIA 2FG7C 2GHQA 2QDKA 2C82A 3LGAA 4RCVA 4UUMA 1Z63A 2JI8A 3ZIUA 1V9LA 2IL1A 1T4DA 5HFJA 1S8OA 3IQZA 2FMTA 1QH8B 3LBFA 1U3UA 1XEAA 3SICE 2NSHA 1S1MA 4KQHA 2ZJYA 1WVGA 4NBTA 5KNCH 3FWNA 3NORA 5K05A 2YIVX 3EHEA 4RFSA 3EVDA 4KXYA 1CQJA 3UK6A 3WNCA 1C9DB 1Z12A 4LJ9A 4LV8B 4YRIA 3PI6A 3U31A 3E7XA 1KBOA 5JAUA 1FFYA 1E1QA 1E1KA 1FCJA 2ATVA 3KWJA 4D4KA 2Q45A 5K8JB 3GLGB 2NG1A 3UN1A 4CKWB 3MJCA 1UWLA 4RHYA 2V0GA 4WKGA 4GPEA 3D43A 5E1BA 2P2YA 1U1FA 2Q2VA 4FMCF 5KTRA 3SR0A 3Q2KA 4KFTA 4Q7JB 1MF7A 2GSWA 4I4NA 3ESYA 3H11B 3OQBA 3RVRA 5JC1A 4NOLA 4PYOA 5EZ6B 3WO0A 3D0RA 4XB2A 3UANA 3W9BA 4EX6A 3UGJA 2DUNA 1XMSA 2ISSD 5B30A 2OGTA 1NVEA 1SBZA 2GPNA 4BN0A 1H2FA 4AKTA 2PUJA 4I1VA 4CIDA 1DAHA 1KXZA 1N1EA 2I4NA 2V65A 1NAHA 4PC2A 4RLQA 4YDSA 1WMFA 5EJMA 2NM0A 3T3EA 4XUCA 1LD3A 2Z2IA 1OI7A 3AHEA 1FFCA 3AUKA 1PJ8A 3GFSA 2A0XA 4HV4A 1D5CA 5EMKA 1RI4A 3A4VA 5HQTA 4RWEA 1Y37A 2ZXUA 2LRHA 4MCHA 2ANCA 2WTAA 1PVOA 1PO7A 3L4BC 1UMCB 2Z1DA 4A0GA 3G8BA 4ZT2A 2I76A 2IDZA 3IAXA 3WP0A 1Y7TA 2OC4A 3IQDB 3U81A 1RQXA 3UV6A 4Z5XA 3ROZA 4L3WA 1WU7A 3JRNA 4WMLA 2QLJA 1GYRA 3BSFA 1XJ5A 3PQEA 1YFKA 4HF7A 1GZUA 1KTIA 1Q50A 2NUAB 3CVYA 4Y2SA 1G5HA 3EY9A 3HA5A 4AZVA 2ZB8A 3R6TA 4Z9AA 1Z35A 5JFGA 2ZWVA 3HKCB 2ZRCA 2ZJ5A 1Q0PA 3SU8A 5JXHA 2YFQA 4OHBA 4P58A 5EIWA 2O8CA 2AYXA 1U1EA 1K92A 1NT4A 1P7PA 4HTFB 3WX0A 4IG9A 4MQUA 1FSPA 1OX4B 1K66A 2G1AA 4S1NA 5DM1A 3QWHA 3SBEA 1AUOA 1AQIA 5EERA 2PIDA 1K98A 4KPEC 1O9HA 4G0NA 1XF9A 4QAQA 3C7CB 3ZNPA 1GQRA 2BEUA 3LQ1A 4LJ4A 1LZLA 2HQOA 2OXEA 4AJHA 3JZMA 5BRJA 4O2AB 3ILVA 3WV5A 4MQEB 2ZE5A 4OIMA 5A9SA 4TYNA 1ESCA 5CCXA 4V2IA 4DR7B 1YAJA 3LSTA 1BN6A 1GN9A 3X1KA 2FLVA 3EMDA 3ET5A 3UA4A 4EHDA 4JEMA 1EP2B 2ZYVX 1WXDA 3LYUA 1BS9A 4IOKA 2Z57A 2F8MA 2ZQ5A 1GG2A 1WRBA 3C2QA 5EQJB 2FMUA 5B3AA 3RK1A 3R23A 3PRHA 4ER3A 5BSFA 4OEHA 2BEWA 4RS4A 3G68A 4XCVA 4C01A 1P9OA 3DB1A 4UTOA 3EZ6A 2YY5A 1JPJA 4FUQA 4PHHA 1CRWG 3MINA 2D2FA 4AYTA 1ZYUA 2ZSKA 3HU1A 4BDTA 4UAGA 4OH7A 1OXUA 5TEVA 1K2VN 1F4PA 2VPZA 1ORHA 1OXMA 2VA9A 4AL4A 2HMTA 4JP2A 4RL4A 5AK3A 3GJZA 3A2NA 4TTPA 1JLKA 1W87A 2VNSA 3ROPA 3RSZA 2P4EA 2ZVQX 4C1NA 4YR7A 3RWOA 1Y5LA 3E03A 2JKYA 3CRNA 5DTJA 4WTOA 4DPLA 2K2QB 4YCJA 1AURA 4ZREA 5BV7A 5CCEA 3J7AC 3D6VA 3NTOA 4LYHA 3DTTA 5DSXA 1PRYA 3VHXB 1QVRA 3JAWB 3VDRA 3FIUA 4ISBA 1RWXA 2PUDA 3GT3A 1KY2A 3O93A 2FYTA 4G1BA 4LNHA 3BJEA 1LDYA 2ZSEA 4ZPJA 5HJ5A 1JJAA 2P62A 4IIYA 4N8DA 2V45A 2WJ4A 4MHTA 2MOKA 4DYDA 3KV3O 1GITA 3IOEA 3KQMA 5LKRA 4AF7A 4B85A 3V4ZA 2VWPA 2MSDB 4YFYA 3Q9SA 3OZAA 4BO8A 5IVHA 4A6PA 1MABA 5KS2A 4NXNB 2G36A 3G9UA 1H2RS 4JCCA 3PEUA 3L46A 5HTKA 3F78A 3IEXA 5IUNC 2ATCA 2Q1YA 3QELB 1Z4IA 1YULA 3G5TA 1JKJA 3DOEA 4RK6A 2XTAA 4ABYA 4O6VA 4GYYA 3U0BA 3ZDEA 2HRDA 2CXXA 2QN8A 3FSGD 4HB0A 5BYJA 2GQ0A 3IV7A 2ECPA 2ZI9A 1WQ4A 1JAZA 4HGNA 1UBFA 2YYAA 3PDCA 4KFSA 4OTZA 4DIKA 1BE8A 5HOEA 3C4QA 2RCYA 1R7RA 4TTTS 3EIEA 3PJRA 3SE7A 3RJZA 2UZ0A 1H2XA 2ERYA 4AZ0A 4XWGA 5J4KA 5EXTA 5CVUA 2CLSA 2GBLC 2YWGA 3UTDA 3WNZA 4QASA 3O6VA 3AEQA 4X3PA 3PQ7A 3V46A 1FYXA 3PWZA 4QRHA 4D82A 4OHZA 5C5CA 1KRWA 1YDMA 4MA5A 1S8AA 1P2BA 1LSUA 3OT1A 5DTQA 3R9KA 1KF0A 3SIPA 4Z3KA 3ADDA 2VNJA 2AN4A 3KTAA 5AM0A 5TRTA 1NYQA 4A8TA 1PHRA 4WOCA 5IDXA 5ECWA 5J59A 2NO5A 1AKMA 1S4MA 2X2FA 4ARVA 1RXYA 1SKMA 5F52A 1LX7A 1QH1B 1FUKA 3NS7A 1JGTA 1TD1A 3R3WA 4KHPB 4RULA 1L5SA 3CZRA 1ORIA 4CLOB 4AJPA 2IOYA 5HM6A 3OTIA 1BEZA 2DCUA 3L8MA 2VF4X 3FPCA 1SBIA 3C3BA 3LGSA 1NG9A 3VR6A 4AD8A 3AM1A 3GH3A 5ARBA 4ZYLA 1J21A 4PXSA 3WNBA 4GPZA 1D6MA 2Z3VA 3JQ9A 5DNWA 2V59A 2NAFA 4AKHA 5HS4A 2VPTA 2ZTMA 3H05A 2EBWA 5FOWA 1LF0A 1XVLA 3AP1A 1WXXA 1Z0FA 3KAJA 3LT0A 1YR2A 1C7QA 1I4EB 2OZVA 2XHEA 5LD2B 3VC7A 3WBBA 1YS7A 4PLPA 2PV0A 1HTTA 3ZWOA 1YZNA 1MH1A 2VJMB 3V4VB 2H1LA 3GGDA 1BSVA 5FWXB 1B8VA 1BHJA 1N5KA 4ER5A 1BU5A 5IKEA 1FVHA 1G291 2ALJA 1KFBB 1S2DA 3K0EA 3ISVA 1T3LA 1CUJA 2NTJA 2ODEA 2PUVA 4GUAA 1J2RA 1VB3A 3GRUA 5DLDA 5E1MA 5FUBA 5DK6A 1E1LA 2QW8A 3T3IA 1IU9A 1EB8A 1SZDA 2CGEA 3F2VA 3NGMA 2WSLA 2BW0A 2XVYA 5A02A 5H68A 2OG2A 3BE6A 2D7CA 3KD2A 3LUDA 4MH0R 4OQEA 1YGPA 2Y9PB 3PDJA 3SZLA 3WVNA 3T12A 3PJEA 2IWHA 3HI6A 1AQLA 3D4NA 3IQGX 5CJ2A 4RORA 4AG5A 4G24A 1R66A 4YXWD 3N2YA 4ZYYA 5AIBA 3W05A 4A0QA 1RWBA 4RPHA 1M2OB 3D0QA 3ZDYB 1FTWA 3A4LA 3BWCA 4IXMA 2IH5A 4J29A 3NO4A 3OUTA 4UQPA 2QX8A 3KU1A 3N2LA 3VU1A 4XLLA 4EGJA 4F4IA 1GPYA 4C87A 1HTWA 1X19A 1CEQA 1W4AA 3LJKA 2HMUA 2WYOA 1C3OA 3GGPA 3PVCA 2PFKA 5KWEA 5G41A 2Y1LA 3DE2X 1G21A 2P2LA 4MA4A 2HADA 2IH2A 4XDHA 3OVMA 1N3BA 4HQNA 4L5IA 4OJNA 3UJ8A 3I05A 2QXUA 1EVIA 5B53A 4YTEA 3AEZA 3IHWA 3DE0X 4CM4B 1TJ3A 3BEOA 4ZDIA 3DE4X 5J58A 1PJZA 2C4KA 1Y6QA 2AEEA 1B3RA 2QJRA 5THXA 3OTWA 1COWD 4C0KA 3PT9A 5TF4A 1RIFA 4F4CA 2OCDA 3RSGA 1IYZA 3V4LA 1WZNA 3CN7A 1M2EA 2AK3A 3GARA 5ENZA 3U5TA 1MGPA 5A9RA 2C2BA 1SVMA 3T5BA 3JW8A 2ZRFA 3S7ZA 4JBYA 4QJ4A 1GU0A 3H04A 3OPQA 4QREA 3O3NB 1LK5A 2NADA 2YFKA 3I83A 2ZWIA 1OFHA 3LUHA 2X15A 3MMPA 3OOWA 4PM4A 4U9UA 4ZQFA 5F5LA 3SDSA 1V2HE 4EHKA 1Z0JA 2LE0A 1OKKD 1F8UA 5DASA 1Q19A 5K1ZA 4TLMB 1ST2A 4Y0VA 9ABPA 4C22A 3OIDA 4RV9A 2QL5A 1CZUA 2CFOA 1O0BA 1Z26A 2UV8A 4NMWA 4DREA 3ESCA 4DR6B 4EEZA 3MF4A 1K5PA 3QA9A 1GUZA 1EZ4A 3RREA 2XDQB 3PEFA 4M8LA 4XWYA 4LRYA 1YIAA 4KXXA 1NQVA 1E3LA 3U26A 3T7KA 1IM5A 4QQKA 1OIWA 3DBHB 2QAIA 3BMOA 3G2JA 4FSXA 3ZI4A 2J46A 4NJOA 4PAQA 7GPBA 3GLIB 4I19A 4IDDA 4GXTA 1T4CA 3K9WA 1ZK1A 2P4SA 2WHXA 4J2HA 4QOSA 2ZANA 1JLRA 1L7EA 3UJ3X 5IM5A 2DE0X 3KB1A 3E4DA 3JAKB 3MNFA 3D2CA 5LCXA 2EVWX 3S27A 4DJAA 5CA0B 3PHGA 1PZGA 5L3ZA 2B8NA 2Z58A 1H5NA 3EG9A 2I2WA 3EOBI 4BHTA 1VDZA 3RFTA 4UW9A 1ISMA 1NSTA 2I4RA 3CVJA 1LU9A 1Z6YA 3LXUX 3PHCA 2H9YA 5KWIA 3FBTA 1Y1QA 1RYHA 2Q0SA 1DHTA 1G8MA 3JQDA 3MRXA 3TKLA 1ND6A 3FRJA 5AK0A 4JI1B 5IANA 4AKGA 1XZIA 2WD8A 3GJ5A 3WL4A 1IVYA 2HLPA 3E81A 4BUZA 3ZLUA 1OJLA 1EP9A 2EKLA 2AT1A 3GJTA 4UQOA 4PGMA 5AHXA 5DOZA 2OFXA 5T64A 2R8XA 3EA5A 1PU2A 2QQ5A 5KYUB 4H7IA 2QX7A 1TUEA 3LX4A 2V7EA 4BN4A 1L5VA 4FQ7A 2J0UA 1JILA 4XRGA 1AD2A 2G1JA 4LKRA 4UVIA 1R0LA 3U2QA 1VM6A 4B83A 5LOVA 2C00A 1V41E 2JDID 2WC1A 3M1AA 1XHEA 4CQNA 1BVYF 2QGNA 1X8JA 4F1KA 2W6JA 4LZLA 2NTNA 4U7JA 1GDDA 1V1RB 3MBKA 2C42A 1GG5A 4X8OA 3SD7A 3OCYA 3T7RA 2G09A 3V1NA 2A84A 1TB4A 2HF7A 4D0NA 2DC1A 1LFDB 3ZCVA 4Q1FA 1M1NB 4JJKA 4WK2B 2G9VA 3SFZA 1H8HD 1JP7A 1UPUA 2OGSA 4G5FA 1UAYA 2PNFA 1CPYA 1X87A 4GP7A 4JLSA 4OBEA 4UBIA 2MDTA 2C95A 2H0QA 3OPYI 4NEGA 3KR9A 5DVZA 1GDHA 1SHLA 3QFSA 4PNZA 2HR1A 1NN0A 4HVTA 2AJCA 1F0YA 4FSHA 2R751 3UJ7A 3DVAB 5KVVA 1PJTA 5BWOA 3U3KA 1NV9A 5DRYA 4MYSA 1VG8A 2I03A 2AFIB 1IH8A 1UFKA 3GRZA 4GL2A 2HJSA 3FSEA 4UVGA 2BM0A 4LMAA 5J1TB 4D9GA 4U7DA 1C8VB 3KVNA 2ROQA 4LJ7A 5FV7A 3IR5A 3CLRD 1DBPA 2FG6C 1KNXA 5A5FA 2ZWMA 2P5SA 1WZEA 4BNKA 4F6RB 4OX9Y 3B3GA 3HUTA 2GAFA 3QQPA 4HX9A 4DQKA 3C4VA 5H1YA 1A5AB 1OU0A 1PAUA 2OESA 2VYFA 4Z0PA 3X3HA 4F12A 3CX4A 4M76B 1MORA 1Z2OX 1FMFA 4R1NA 1RIIA 3M2PA 3TUJC 3FMPB 3H8SA 4K6FA 3HJFA 1GV0A 5FUMA 1EE9A 4ZHSA 2ZVDA 3DCJA 2KLBA 2OB1A 1TEXA 3DGEC 4CIBA 3K05A 2O59A 1P4JA 4RIFA 4LXXA 2XMDA 1DCTA 2W58A 2NO4A 2HPZA 4PNPA 2C1EA 2PS9A 3ZWMA 2CY0A 2EGUA 3P4YA 2P3QA 2EJTA 2BIFA 4WCFC 2ERCA 4M8SA 3LECA 2NO7A 4EW1A 3L4KA 3WYGA 1A7JA 3U13A 3PNBA 1DKQA 5A6SA 5KWVA 2ZT7A 1UJNA 4TLBA 4G0OA 2XTMA 3ZPXA 1NXQA 1P2SA 3IMEA 3MLAA 4P4SB 2IZ7A 1EZ1A 2RMKA 5SYNA 5CDHA 2DSNA 3KELA 3LYHA 5K51A 4AY4A 1DIAA 5TF0A 4LBWA 3GJ6A 1V6SA 1E77A 3R5SA 2D1FA 4JYMA 4MUMA 1Z2CA 4UM8B 5DW0A 2A30A 4URZR 2I9KA 1NKTA 3ZK9A 1ZJ5A 1GSAA 2IBSA 2BONA 4Q02A 2CLMB 2NYUA 4NQRA 4M0LA 3LQFA 4NVRA 3SVLA 5JZSA 3DEKA 4ESVA 3R2JA 1M6WA 3N2GB 5DHUA 1TADA 4UTXA 2XVMA 5HZHA 2ZKLA 3NBUA 3WTCA 1O77A 4OYRA 2XUIA 1JIVA 3R3HA 1J24A 2ODNA 1T35A 2GEKA 3G89A 5EJIA 3AMVA 4S12A 4HAVA 4R1LA 5BVHA 3ZKWB 2Y6VA 1J2EA 2GK3A 5E95A 4ZI5A 3WE7A 4R1PA 1Y3IA 3TJZA 1R4AA 1G5IA 3SDBA 1XE3A 1SG6A 1T5DX 2CN1A 3FKSD 4HRAA 2X4LA 3GCXA 1D7OA 2GYWA 2QVGA 5JJ5A 2O7RA 3BBLA 4YRLA 4RGBA 1N32B 1E3WB 3LQ2A 3QFTA 2BOVA 3GLHB 4QLOA 4V0SA 1UUFA 4D9FA 1U6IA 3FH0A 3V1LA 2XCRB 1BDIA 1PT9A 4U7WA 3HWSA 5GV8A 2OHJA 3L40A 2HXYA 2P4HX 2QOEA 1YE8A 1J2JA 5E38A 1OFVA 2HBZA 4EUFA 5JI3E 2X9QA 1O6FA 1T5TA 5B2EA 1L5QA 1Z5OA 2MHCA 3GLGE 4XWAA 1GTL1 5K45A 3CH7A 3QM1A 4ZAVA 3V32A 4EHBA 2FZLA 2IHTA 3ACCA 5CIWA 1CNMA 4MQLA 2IRWA 3I3SR 5C4GB 4KBYA 1LGYA 2QG9A 2VT3A 3BKWA 3T7TA 1H5UA 2QJFA 1CEEA 1I3NA 1FNBA 4ZI7A 5I7WA 5HF6A 2JCYA 5SYMA 1C30A 1BKSB 3HDQA 4M1TA 4MW0A 4WJKB 3ZIAD 4E2WA 2SBTA 3FLEA 4LN1A 2DHQA 4Z9BA 1I2BA 4LHYA 4OXXA 2MSLA 2GZAA 4OVKA 3PQ6A 3ZJTA 3JU3A 2GT1A 1RYFA 4AMVA 3CE6A 2R25B 3UBTA 2C2WA 4FOPA 4BMPB 5D86A 3VDNB 3EVTA 4I9NA 5IT9A 1N8KA 3DEYX 4OP1A 4EGQA 1D2HA 2IPXA 3QWBA 2DFNA 4ZYWA 4REQA 1R6VA 2I6GA 1GQFA 3N74A 3PSHA 4BRSA 4Y6RA 3WK8A 3OLCX 3GAFA 3RC7A 3LA6A 5TVKA 2V9ZA 2IKSA 1FLNA 1VB5A 2QQFA 4AUMA 1GRNA 2G83A 4XGNA 1AGXA 4XE5A 3BWYA 4RGVA 4EMBA 1ZJ6A 2Y77A 2GAAA 3A6HA 2G9RA 4DM4A 4NMLA 3DPUA 1E59A 1QOQB 3CCCA 1UJ4A 3M0EA 4Y2UA 4XTRA 3L5KA 4YO8A 2XEDA 3HQ4O 1V8ZA 3W5JA 3I2GA 4J4TA 5KCMA 4NYJR 2P0YA 5J23A 4CYMA 4PZ0A 4GQIA 4IHAA 3SCZA 3BCHA 5KSYA 1EHYA 2W2KB 2QU7A 4CUJA 1DOZA 1Y9JA 3IVRA 2ZJ6A 2OEPA 3E9CA 2CSXA 4BUJA 1RPZA 1E4EA 1QHHB 1QYXA 3PDIA 5IEBA 3L7DA 1GGEA 4MYRA 1DKMA 1VMAA 2A9FA 4W99A 1Q0RA 1C8KA 2CL5A 1AQUA 2FZEA 2HF9A 2Q1XA 4O2LA 3VSDA 5HKKD 2YRFA 4IFEA 4CEJB 3C87A 4MUFA 1I7LA 4M0UA 2GRJA 3MSXA 3LNCA 3FB4A 1RM3A 4ZVLA 3TTXA 3VMFA 3FGPA 3PGJA 5IK2A 4DBZA 5KEIA 1NNLA 3FCUB 5DI9A 2QM0A 3N7AA 1PQUA 2Z2YA 3CZ9A 1Y1LA 2BFWA 2QQEA 4JJGA 1XVAA 2D54A 3WMGA 1ENYA 3KZMA 5HX7A 4FM9A 4LHVA 3SSAA 4CF6A 5KPJA 1HFWA 1O1YA 1T1SA 2P2GA 1T0IA 4H1VA 2XBLA 5COQA 3GFFA 4H7FA 4HNAA 1FLAA 3IIIA 3W78A 3ZWDA 3LOPA 1DOHA 1SY7A 4HI0E 4LEIA 3ZX5A 3GOHA 2C4MA 1ORVA 5EYPA 2YWJA 2WHPB 3ZJ4A 4U7GA 4C7BA 4NU6A 3A70A 4DM7A 4ETMA 1Q0LA 4BZXA 1B00A 1BW9A 5DM60 3BGIA 1EUCA 1K8RA 4GUDA 4KP7A 4P7FA 2YVAA 3RODA 1OXKB 2WAYA 3ZD8A 1P17A 1IJEA 2CXOA 2PN1A 2OAQ1 1JTFA 4ZGWA 3QEJA 3REGA 2I6UA 2QYOA 1ZWKA 1RXUA 2J1LA 3ZQJA 2WA1A 1ISSA 3LCRA 4YREA 1T1GA 2I6QA 3C41J 3LKVA 3USCS 2WTNA 5I7HA 2AOVA 3G23A 5L3VA 1XPOA 2NUPB 1JQDA 1K8YB 1OYYA 2FZCA 2V1XA 1UR5A 3A1EA 3EASA 4DOMA 1SCIA 2YHBA 1G4UR 1Q7CA 3TLGA 3MJHA 4EARA 4XEUA 2R6HA 1IC6A 4BFZA 2GVDC 2ZK7A 2BFFA 3G2OA 3OM9A 4V38A 3DYBA 3PX3A 2FRVA 4F91B 3OQNA 4CEHA 4KMMA 3BA1A 4UCWA 2R62A 2OTCA 4AKSA 4M99A 5JAPA 2Z9BA 3B1FA 3HDTA 3B70A 1Z5GA 3E2PA 4G41A 3VAZA 4YDQA 5FORA 1V16B 5KNDD 1GAQA 5CYGA 4QXAA 2GHRA 3JQ8B 1ZCBA 4ENWA 4QATA 4B34A 4BX3A 4WUVA 5PGMA 3DONA 3OKAA 1N6NA 3Q7SA 4U1RA 3TFOA 5KYTA 2AVNA 3MUNA 3WGOA 2GF0A 1BDJA 3GCWA 5E7MA 3HR7A 3W3AA 3TIIA 1MAAA 3DO5A 3HL0A 4KXWA 4BCBA 1R0BA 2J59A 2Q4TA 4EFMA 4LYGA 3I1JA 1BROA 1F6BA 3A6LA 4TM8A 5EP4A 5BWNA 3GG2A 1R6UA 4HQFA 5B1HA 5C4MA 4R81A 4DIBA 2Q3EA 4UTNA 1EB9A 1VECA 3MTGA 1E1NA 1O03A 1HYGA 2AJBA 2C3MA 1HC7A 3D7LA 3KFXA 3LZCA 3QXGA 3TTTA 4RXTA 2B36A 3I6ZA 3ESZA 4YRTA 5H80A 3HEMA 1QDUA 4IH9A 2ON6A 1KRXA 4RA6A 3U6BA 1K3TA 3R7WB 3RBVA 1E64A 2W5UA 1TU0A 3L79A 3U09A 5ALGA 4XSHA 4YQZA 3OJOA 4MVWA 2CNWD 5ESRA 2ZYGA 5E3IA 1A9XB 3LBAA 4RCYA 4EO4A 3H8JA 1E3DA 5CVEA 3DR5A 1TM2A 3M49A 3P0HA 2JZNA 4CETA 1I80A 2ZI4A 3K0AB 5CURA 3TVDA 1QP7A 1ZVVA 3ZDBA 4ZC8A 1VJ5A 3CHYA 2V74B 4Y9RA 1QBKC 1TFRA 3KP1A 2ZW9A 2RGGA 4LMPA 4Q3BA 2B0CA 3HKBB 2CZCA 4LOIA 4N8EA 3KDSE 1E2GA 4JT9A 4K03A 3QNUA 2BZGA 3L8YA 1EG7A 1NF2A 2IU4A 1Q3TA 1NOKA 1JHYA 1J7KA 4ZQHA 4D1YA 2ETVA 3KXDA 4H4CA 3HG7A 3IO5A 5JARA 3HDJA 2VP3A 1CY6A 1YQTA 5A71A 2PPVA 3E5MA 3H19A 1QM5A 2LKDA 1TTQB 2LP4Y 3MQ2A 3PWSA 1XEXA 4IKEA 4J0CA 4CODB 1LZKA 3U7GA 4B3RB 2HDHA 3AM3A 4DBLC 4PXAA 3VX4A 1X7WB 4PYRA 3LCMA 4H3VA 4YCSA 1FZTA 1PVVA 2D2IA 2P7HA 2AD1A 3AVPA 1QRSA 1M34B 1ADYA 5J9FA 1TL7C 3SHWA 5C8ZA 3B9QA 4P0QB 3Q2IA 3ZH2A 2VNKA 3II6X 3Q7RA 5CYFA 1SQ0A 5AUPB 3GEDA 1H05A 4G25A 2H7CA 3TDKA 2C84A 2NSJA 4IH1A 3TX2A 4RDIA 221PA 5K4AA 2PD6A 2ZETA 1Y8CA 3DV0B 1DE0A 2WQZA 3HXLA 4TYYA 2BGLA 3EF3A 2HO4A 2BCEA 3HWX1 4I50F 2Z8XA 2IZ1A 3OPMA 4KCGA 1CUVA 1IN8A 2DUUA 2FOLA 3AM4A 5HCIA 3LWZA 3KEQA 3OKCA 5DW3A 1R5NA 3GVXA 3KT6A 1VLQA 3M6VA 4AS1A 1PFGA 3K30A 4C3OB 3NHBA 2VN8A 3PXCX 2HCRA 1IWBB 3WL5A 3LE8A 4BASA 3GJ0A 2WICA 1GYPA 3NM4A 4LYYA 1FVXA 4X00A 2I7DA 8OHMA 4RY2A 2A35A 3QNWA 4PZCA 2OWEA 3CF4G 3VM6A 1SCDA 1GPAA 1XD9A 2B2NA 2QN2A 1YF3A 1FP2A 1O4VA 2P7IA 1QGED 1V7CA 1MO5A 2PKWA 2Q6TA 4ON9A 4ZD6A 4CM4A 1PNQA 3GEBA 5E6UB 3UH0A 4HSGA 4BKRA 1XCOA 1R9MA 2Z5VA 1QZ3A 3AL2A 1I4DD 3ASYA 3CB4A 4G5GA 2G9UA 4HPWA 3TLGB 4TRMA 3FIJA 3ZI7A 1OLSA 2R8EA 4OU5A 1T1JA 1JVNA 4CV1A 3NHZA 3OT4A 2FAXA 1E5XA 1BMFD 1NATA 1Z5NA 3CB2A 4L0CA 1VLZA 3TAXA 3BGDA 3TLZA 3GJ4A 3IUMA 3ETEA 2WKRA 2XMQA 1NXPA 1BDMA 4J9VA 1QV7A 4KC0A 1U1IA 4P5DA 4NZOA 2W2NA 3RUDA 3SYTA 3GEEA 2YZKA 4Q9AA 3Q3VA 4YRKA 2NPOA 4CLXA 1P4GA 1WPGA 3GFQA 3M82A 5AKIA 5EZSA 3K15A 4DZTA 5B1IA 4IDOA 3KUUA 1EXMA 2ZSDA 1MC1A 3PUVA 4OK3A 2WZBA 2OOSA 4JMLA 4R2MA 3AR6A 3DT9A 3CS3A 3WMEA 4X90A 3WGVA 4OV6B 4QPNA 4UD6A 4D2IA 4RZXA 1N78A 1PG5A 4AZ3B 4QEDA 4DNXA 5KINB 4HZUB 4N6OA 4P33A 3LUKA 5L4NA 3OQVA 4M1OA 3L6OO 2N1BA 2Q27A 5CW2A 4D9EA 2VFAA 3ZV4A 4M7OA 3OTGA 4DLTA 1UJ6A 3GB9A 1WXEA 2PQ2A 1YXMA 1GKLA 2HA3A 3L8FA 3P9RA 2FY8A 3HKDA 4LF5B 2AYZA 2PAFA 3D7NA 5HK8A 2H3EA 2R00C 2VHYA 3WYBA 4GT1A 1LVHA 3QEMA 3OE4A 4IDEA 2FEMA 2YMMA 1CQZA 4JDUA 3HPQA 4AMYA 3IILA 3QU9A 5CH3A 4CEJA 2XUPA 2H9IA 4ZPXA 3EXHB 4I9HA 2XQGA 2E6KA 3QVVA 5DNUA 1JA9A 3TXYA 2ZRPA 4ACBA 2HDWA 2ST1A 2WTXA 4DQUA 5I7AA 3PJFA 2BM1A 4IV0A 1O0CA 1LUAA 3MGBA 4RK0A 5JZOA 3EOZA 4JEIA 2W2MA 1V71A 2BVNA 2JJMA 3I12A 4CM8A 2PR2A 3RE1A 3QOYA 1XVIA 4GOOD 2Z56A 2FP4A 4YIKA 2R6AA 4EI7A 1ODIA 2IFTA 1W46A 1F17A 2IVZA 3BSYA 3MTEA 1QPGA 2GTHA 1RKXA 2PYZA 3LY8A 4LYEA 4BIIA 4B4VA 4C7MA 4BGDA 3BE4A 3IJPA 3W5IA 3FVQA 1OWLA 3AEQB 2JHGA 3HN2A 3R5XA 4GWLA 3ZGNA 1HGXA 2JLYA 1KVSA 3M5PA 1UMDA 2H2DA 1WHSB 2Y4OA 5DV9A 4HB4A 2BI4A 2POQX 4BVJA 2VJDA 4B4DA 5BPHA 2C0PA 1KDVA 3O31A 4I1YA 4KQWA 1KI1A 4XB6B 4X5OA 1KKMA 2JGRA 2JCGA 4MUGA 1XTTA 2NUPA 3KB6A 2H5JA 3DV9A 3WB9A 4BRZA 2OK7A 3C8HA 1QIGA 4A23A 1TMYA 1ODCA 2A0YA 4UJ5A 3BK1A 4F96A 1DEXA 1KBQA 2PS1A 5TB5A 4M1MA 3NASA 2P75A 3TLAA 3B1JA 3NDPA 2HRQA 4PVDA 5A7HA 3URMA 1IZ7A 2BMDA 4D6PA 1OV4A 5I4CA 1SKBA 3GFVA 1YTUA 1F6DA 3COWA 1S9DA 2G76A 3MA0A 3R6GA 5EJ5A 1YR7A 4N39A 4KK4A 3VI3B 2NTYC 3I34X 4HDCA 4JN6B 1A8PA 1QR2A 2P9FA 3R7AA 4V0QA 4CI0B 1QYWA 1V9CA 4DCVA 3EK2A 1BZYA 3HZZA 5FADA 4NFHA 2HHHB 2R7KA 1FW6A 1LLCA 5JANA 1F9EA 3I4FA 4Q9JA 4JQCA 3IQWA 5JXJA 1TF5A 5JRDS 2JJ2A 3ABZA 3DO8A 4O25A 9GPBA 1YRBA 3DZGA 3GJ3A 3DOHA 4QECA 3RS9A 4UOEA 1EWRA 3CUYA 4P36A 5JCJA 3WQSB 3QOFA 1JE0A 4OFXA 4C7XA 3QHPA 2XUQA 1AZLA 1A2QA 1BTOA 4HBGA 1D1TA 2GAIA 3JTEA 1XU4A 3NM6B 4NU8X 4E5SA 1JSRA 2FP4B 4OQZA 4FW8A 1PDWA 1C9EA 3PUYA 1UFQA 4O1MA 4A8PA 1QVZA 2LIVA 2NV6A 1ZIYA 1SXQA 1EBFA 4JJEA 4LQDA 1NN1A 1HG0A 3QVKA 4Q7LA 4RUKA 1YI8A 3BCRA 3EPPA 1EFVB 1KEVA 3L6CA 1PWEA 3UXHA 4DJTA 1UFOA 1U0LA 1HEIA 5E4TA 3STHA 2C7BA 3W6OA 2Z4RA 3QYFA 3T4PA 3WIEA 1YRAA 3GCGA 3AEUA 3H3FA 3K9FC 1Z88A 2B4RO 4LJLA 3PR2B 4LBYA 4PFQA 4PONA 2J5KA 2GEJA 2VDMB 5L40A 2X8BA 1CJKC 3BFKA 1JXOA 4NDAA 5G0UA 4GVXA 2Y27A 3RRNA 1G2QA 2YHAA 2FV8A 3K20A 2LKCA 1F2VA 1LRLA 1SHUX 1UM8A 4O08A 5D51S 1U9IC 5GY7A 1KI7A 2ZYDA 4X9XA 3ZU6A 1NW7A 3DOIA 1YVEI 4R3NA 4C3ZA 1A8HA 1H4VB 4H16A 3VHRA 4AO8A 2FDXA 3QWFA 1OA0A 3EC2A 4JT4A 4RIHA 5CG2A 2I3AA 3L0SA 1G0NA 2IS6A 3RC1A 2QX9A 4D9BA 1N2CB 2RI0A 1DJNA 2ZLBA 4MW7A 3RV4A 2PUCA 4REMA 1S7GA 3O4JA 1T8SA 2ZJ8A 4P3NA 1MJGA 3L0ZA 4ZI2A 3QKSA 2FPMA 2XI4A 4A36A 4K8OA 3ZXSA 1VSVA