3LWNA

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
181
structure length
181
Chain Sequence
b'SAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 61
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lwnA00
1FW6A 3OHMA 1BOFA 1SVLA 1KTVA 5DGXA 3QVVA 5UKDA 5EE0A 3ADKA 1P2UA 1OH8A 1IY1A 2IYXA 3TNFA 2PLFA 1WDTA 4BRUA 4Q9HA 1JR3A 2GVZC 5AUPB 1E1QD 3X1XA 3T1QA 1R5OA 4M1YA 2B7CA 2GK7A 1Z0KA 2P67A 4YMUA 3QXXA 2YZ2A 3LBNA 1NIJA 1T8TA 3BGWA 4QBFA 2ODBA 4BLOA 5HPYB 3R8CA 2BJWA 4OQXA 1KKMA 2VO1A 1WCV1 3VAAA 4M9XA 4DB4A 1DARA 4TZ6A 3NDBB 1GAJA 1J99A 1WMSA 1Q57A 1ZM4A 3DM9B 4CEHB 2ZRGA 1R0WA 1X8LA 2HF8A 4X8HA 5LBIA 1WXQA 1FL9A 4JVLA 4ZDJA 2QMEA 3IEUA 1NSFA 3RWOA 1E32A 2WWGA 5B64A 3KZ1E 4C30A 3AF3A 4PPQA 4D0GA 5AJXA 5JI2E 5B2ZA 4TLAA 4G1UC 1Z0IA 1G21E 2OFOA 2QEQA 3BXZA 1F5NA 3FVQA 4HB3A 3SJBA 3OF5A 4FIDA 4KLNA 3M4YA 1K5GA 3X1ZA 1UJ2A 1WB9A 1U8ZA 3CNLA 1IXSB 1XTKA 1U0LA 3CF2A 2WJHA 5BYJA 3PR1A 4ABYA 3EPLA 2HJVA 2CHGA 3QXSA 3T5DA 1ZIOA 4O0MA 1TUIA 2BMEA 4C2TA 1IN5A 4FW9A 1QHSA 2G88A 2Z4RA 5CLQA 1J8YF 1FTNA 2ZSBA 2ZU0C 2JJ1D 4TL6A 3RDPA 1AQYA 3MJRA 4CF7A 5EXXA 2ZI6A 4EPXA 3VKGA 1OYYA 1MV5A 3L82B 3PENA 5FPTA 1A5TA 1NP6A 3EWAA 2O0KA 4DUGA 5KHOC 4IVQA 2OBLA 2QGZA 4LRWA 1O87A 3K0CC 5H1YA 2OXCA 4K8OA 1Z0AA 2RAPA 3NEJA 1H8HD 3B82A 3HJNA 3GLFE 4ZIRA 1JECA 1KJWA 4NCJA 5CB8A 4IEIA 1FNMA 2JAQA 1Z6YA 4OI2A 5GJVC 3THOA 4TTQA 5H8WA 2J3EA 2QSYA 2FX3A 1XDBA 4O2LA 1LFDB 2H7VA 3SR0A 3IBYA 1RIFA 5FTMA 4HZUB 4A9AA 2ZQ5A 1RKBA 2IYTA 2WJIA 2WKRA 4RZXA 4A4DA 1P4SA 1L2TA 4QJ4A 2ORIA 4PHGA 2Q3FA 2FPKA 3UMRA 3MWYW 2ZRBA 4US0R 3RHFA 1A1VA 4LGMA 2P6RA 3EZ9A 4RCYA 1LF0A 1E1RD 1FP6A 1KJZA 2ZI4A 4PR0A 1OW3B 3NDPA 4YXWA 3W6NA 3U6BA 3FDIA 1YZLA 1GZSA 4Z8YA 1A2KC 4C2UA 2NPIA 2FDCA 5C4GB 3A36A 1XPUA 3PFIA 3U7GA 4NL4H 2OLKA 1D9XA 1CF4A 5EP4A 1G17A 3QG5A 3QF7A 2RGBA 3NBFA 2CEAA 3ZVNA 3W90A 2XOKD 1G4UR 1IHUA 4W5HA 1KHTA 3MD0A 2DHRA 4DLYA 5SZIA 3U4QA 1DVRA 1X1RA 1VCNA 4CEJB 4RFSA 5BWMA 1QHNA 1XTIA 2ZRIA 3SE0A 4AY2A 3AEZA 4GBMA 1XEWX 1G19A 3RS3A 2H5EA 5D3MB 5FTLA 2O8CA 2ZJ2A 1DAMA 2JATA 2V8OA 4FMDF 2B92A 1GUAA 1GL6A 2GZAA 3W9YA 1P2SA 3LO5A 3OAAD 1E2NA 2V1UA 1G5TA 1U9IC 2J7PD 3MWKA 2JLYA 1R0ZA 1FPMA 4ZIRB 2NO1A 1YR9A 4E07A 3MFYA 1AZTA 3SFVA 1PVOA 1JR3E 3OE7A 4JJKA 4TLBA 4A15A 3FHTA 5KOYA 4NYMR 1MO4A 2P5SA 3B5JA 2ATVA 4JJZA 4D82A 5FBLB 4LPKA 3VNVA 3CR8A 4I1UA 1ZIPA 2R2AA 1OXUA 3MSXA 4LJ6A 1Z0DA 3FMOB 3BH7A 4URVR 2D7DA 2XNDA 4EJSC 2YYZA 4JLDA 5KO2A 1UPTA 4HDCA 4LJ8A 2XB2A 3FPAA 4JMPA 4PXAA 5JCPA 1HEIA 1JXOA 2ORWA 3IO5A 4D6PA 2GF0A 4PPNA 2X2FA 3K0FA 2IK8A 4M1OA 3U44A 3AVQA 4QNRA 1SULA 1M74A 1KI6B 3QEJA 1RPZA 2OZEA 1XTQA 2O8DB 1UBFA 3OFNA 2ZXUA 1NLYA 1CRQA 3EZ7A 3RC8A 4E22A 1G4AE 4OQNA 4R9UC 2AK2A 4W5JA 2Z4SA 3DMDA 1RC8A 4NYJR 2N42A 4NYMQ 1XWIA 4TYPA 1ZNXA 1QHIA 2HUPA 3P1JA 4A0FA 3TR5A 821PA 2VF8A 1HQYE 4KFRA 4Q02A 2NO7A 4AWXA 2JLWA 1E9FA 4C7OA 2ZSAA 2ZUCA 2A78A 1S9DA 5HKKA 4DCSA 1Q1EA 1MRSA 2G3YA 2HCBA 4NE2A 421PA 1YQTA 2JJ8A 2C78A 4TMXA 2CDNA 4QXAA 2GJ9A 2VP9A 1AGPA 1Z47A 1ELOA 2ZE5A 3CO5A 4D4KA 1R8SA 4EKDA 2GJ8A 2RGXA 3QEOA 3RSOA 4HUQA 4KBFA 1G291 3EG5A 4LDJA 1VG0B 4NYJQ 1JQLB 3S1AA 4ZCIA 2ZRHA 3FHCB 3RS5A 4CW7A 1OB2A 4DIEA 1TF2A 3L0IB 3LWNA 5CM8B 4PQYA 1RJ9A 3K53A 3K9LA 1D5CA 3RYTC 5JWHA 3HU1A 4HZIA 4QBGB 1NI3A 1X3SA 1KOFA 2W6IA 4U00A 2O8BB 1M6NA 2GKSA 4RKFA 2IA5A 2ZS9A 5KNCA 1XNJA 1MOZA 2EFCB 2RCNA 1JQJC 2CL0X 3X1DA 4LV6A 4DLUA 2WWWA 1E6CA 5LB2A 3PEWA 3RABA 4GNKA 5DSZA 5FR2A 3GPLA 1W1WA 3CRQA 4NH0A 1JAHA 3SHFA 1VYUA 4B3GA 1QG2A 4KFSA 5AUNB 1LS6A 1WA5A 4MYUA 4Q1AA 3VU9A 1SXJC 2QP9X 2ZRDA 4N0EA 2I3BA 3PUZA 3CPEA 3NIBA 1Q3HA 4GFDA 1T5IA 1UAAA 5DE3A 2R62A 4R2IA 1E69A 4N0DA 1VG9B 2PT5A 3EIEA 4XTRA 2YWFA 4DEXA 1BO6A 3MMPA 4KODA 4BECA 4ZCLA 2RGEA 3ASYA 2GVDC 1A7JA 1UEJA 2W2TA 2OUKA 1XD2B 2V7QA 1IM2A 5GJBA 3LX8A 4GPTA 5E4FA 2OG2A 4EPVA 2NO0A 2GA8A 2XTMA 4FCVA 2OBNA 3W34A 2Z5FA 1XCPA 5HE8A 2AXPA 1XTRA 1ZC4A 1T4GA 4CIDA 5BN3A 3WNBA 4PHFA 1S3GA 3REGA 2IS2A 5AUOB 5DN6A 2XTNA 3S1AB 2O0JA 4Q03A 3X2SA 3B9PA 3FMFA 1M7HA 5FBVB 3A6PC 1DBSA 1DOAA 4Q18A 1TAGA 3AVTA 3FB4A 3NWJA 2PL3A 3SJAA 3N70A 3OEEA 4NCHA 5DYGA 3QKRA 2CCGA 5IF9A 5LB4A 3AUYA 5CB6A 3VX3A 5C46F 4POAA 1FX0A 1NVWQ 1G6HA 3SZRA 4R71A 3BB1A 5CIQA 3A1VA 1E9RA 5AK0A 1NVXQ 2QPAA 3REFA 2GAOA 4PZLA 3ICQB 1T5LA 3WYAA 4QHSA 2HXSA 3A4MA 4EQ6B 4CEIB 3AF2A 4YDHB 4LI0A 5M04A 3GP8A 2FZLA 3F5FA 4G0NA 2IC5A 2ZR9A 3BFKA 3SYNA 4KITB 1SQ5A 2J0UB 2DBYA 2ZI9A 3AKYA 2GXUA 1EFHA 2VF7A 4GSYA 3RVBA 5K8UA 3U5ZB 2QTFA 2ZJ8A 2IXFA 1F60A 5KTYA 4WOPA 1T91A 1N6OA 3I92A 2IYUA 4NPHA 5EP1A 1US8B 1T0JB 2GBLC 2VHCA 3DPUA 4IDPA 4YQFA 4GOKA 3ZDQA 2GNOA 3LW7A 4MITA 1DO2A 3QKSB 3NTUA 2RHMA 1W0JA 4PPFA 1R8QA 4JBYA 2IUUA 2VHQA 1R0XA 2ERXA 1XU4A 3EPHA 1G1MA 1W4AA 3QIAA 3EA0A 1AS0A 4D4LA 5JS8A 4TYYA 1JJ7A 3E5HA 1DAKA 3U7EB 3FWYA 3IKJA 3Q7QA 4HAVA 2ZRJA 4Q4LA 5TXGA 3UG7A 3ZYCA 3TSOA 1E9SA 4AKHA 2IHBA 3CB4A 3WRYC 1IY2A 3TW4A 1EGAA 2VRWA 1XJCA 3BWDD 2VIIA 1BMFD 4P3YA 1ONBA 4BFXA 4HEJA 4F38A 4BGDA 1EFCA 3LX5A 4PZZA 4TSFA 3HR7A 1G3QA 3FTQA 2NTYC 2Z0MA 4HUTA 2RGNC 4RD3A 1Q1BA 4B3FX 3KX2A 2Q21A 2YV5A 1PLJA 1G3IA 4IEEA 1NG9A 2VP6A 3D7MA 4TT3A 2J0SA 4I99A 3LLMA 2GRJA 3IQXA 1BYUA 2B21A 2N1BA 1SGWA 1VCOA 2VP4A 1TQ4A 3RRMA 2ZTSA 1AZSC 4M1TA 4XVRA 5FTKA 3L0PA 4IOKA 2QL6A 4BLTA 1SZPA 3AP3A 3KKOA 5CITA 3OIUA 3C5CA 5FPSA 2ZJOA 3AUXA 5JHHB 1KDOA 1NJGA 3I72A 3LBHA 1U90A 2E9SA 1KK2A 1NLFA 2XAUA 4PO1A 4ACAA 3TRFA 1G7RA 5TDHA 2HLDA 3GCGA 2G9NA 1HE1C 2BBWA 4IFEA 2GEDA 3K1JA 4NKRA 1CTQA 1OKKA 1KI3A 1VIYA 2R44A 3T34A 1KNXA 1OXXK 2CLSA 4DHEA 1KGDA 2AWOA 2VSOA 2QMOA 5CK4A 3JVUA 4GI7A 5AUQA 4JBXA 2JLZA 4XWOA 2A5FA 3PIRA 3AQ4A 1XFAA 2RMKA 2IYZA 1TU4A 5B58C 3W5JA 1JR6A 3ZVLA 1SXJB 1Y63A 5HR5A 2QY9A 5JHGB 1BKDR 1QG4A 1T9HA 3HYTA 4RD0A 5JJLA 2OM2A 1P72A 1R5NA 1Z29A 2CXXA 3WMEA 2ZRAA 2FE4A 1XPOA 4X8LA 2XZLA 1GNQA 5IRCD 1E3MA 1XCMA 3QUSA 3RSLA 3CR7A 1XXHB 1JXMA 2BV3A 2N46A 2ZRCA 3A1WA 3KJEA 3LXRA 1DO0A 2JASA 3KQHA 1GWNA 3CRVA 4UXHA 4LHYA 3MWJA 2QORA 1E2DA 2ODNA 1OFIA 3ZVMA 2A7QA 4P4SB 3LVRE 1FOEB 4M9ZA 1NBMD 1P9RA 5GVSA 1Q22A 3K8YA 3NC0C 5AJZA 1H8ED 2RKOA 4RFVA 1EWRA 1M1YE 1MO3A 1TU3A 4BUJA 2IHYA 4P31A 4BRWA 2VP2A 3X1YA 1YHNA 5CM9C 4L4UA 4Q4JA 3W3ZB 4A8JA 2UZ3A 2D2EA 4KI0A 3SI7A 2HYDA 3R9XA 2QTHA 4QHYA 2BMFA 4LK2A 4TN1A 3N2EA 2R6DA 2VHUA 2SHKA 4JYBA 2QA5A 1G6OA 2IX3A 1IJFA 5FBWB 4AYTA 3GLGE 2QQEA 4G5RA 5DYIA 1W36C 2OEPA 2EFHB 2EYQA 3UKDA 2B7BA 2C9YA 3ADDA 4K46A 4B43A 2E87A 1N5LA 4ILEA 3AVUA 3PVSA 4YMVA 4MKHA 3LDAA 4TLCA 4DUGD 1ZCAA 4DLTA 4YLGA 4JKIA 3B8HA 2X19A 3QI2A 5FOTA 3SJCA 4RY2A 2IEYA 3BB3A 3DL0A 1EXMA 1E0SA 3KL4A 5DI3B 2QGNA 5GADl 4TYWA 1FMLA 2JA1A 3U3KA 4ZDKA 1D8TA 2WBLC 1U81A 1VYTA 1Q0UA 3KXKA 1DAEA 4BFSA 5J4KA 4DT1A 2ZI7A 4Q19A 3ZZTA 1Z08A 2GEVA 4PC7A 5D3QA 1L4YA 2EWWA 1NMYA 2ZE8A 4B47A 5JRJA 2CMKA 1OH6A 4OHVA 3CRMA 3WP1B 4ZI3A 2VBCA 1VDZA 2BCGY 2O8EA 4JL8A 2LCFA 4H9GA 2ZUDA 1E9EA 4OJKA 4B75A 4TYNA 1ZYUA 1NVUQ 1ZNWA 3KJIA 4DLXA 1SVIA 4E09A 2ZREA 1FTSA 3NH6A 5JECA 2KI5A 1P6XA 4LPSA 2YWGA 4BLQA 4U5XA 1OJLA 3U2QA 2QM7A 3ICEA 4URUR 4DC9A 4B3DA 1E96A 3T61A 3KQUA 2C9OA 2OFXA 2VYFA 2BMDA 2ODWA 3CM0A 1E2IA 2JLUA 5E7JA 2XZPA 2IYQA 1NL3A 3GLIB 5LD2C 3GJ7A 5DISB 4V0NA 4LV8B 1KI8A 2FGKA 4ON9A 1JEDA 4GOJA 4H1UA 4LJ9A 4ARZA 1YZQA 2Y8EA 2WKQA 4BLPA 1MH1A 2JDID 4D0NA 1GKUB 3SEAA 2CBZA 4LUCA 1Z0FA 3NXSA 2AL7A 4C0KA 5LDDC 2GXAA 4OYHA 3FE2A 2XSZA 4EFLA 4TTRA 3DEFA 1GM5A 4MRNA 2OFWA 5BW8A 2C99A 3GJ0A 4PHTA 1OT3A 4EFMA 2FV8A 3I3SR 4X8OA 3KKQA 2ZEJA 3RRZA 1R0YA 4QBIA 1G8GA 5E7MA 2V1XA 2D3WA 2ZRLA 5EQTA 2W6JA 1K8RA 5L3SA 1XEXB 1XTSA 4W7SA 1GL7A 5K8IA 2FFAA 2AR7A 2RGCA 1IN7A 1NMXA 1AKYA 1K5DA 4G5QA 4NTZA 1ZD8A 3CPHA 4UXIA 4BWYA 2QBYA 1KSHA 5FPYA 4F4CA 2HT1A 3GLFB 3R8FA 2O0HA 2C04A 4M1WA 1UKZA 5AJYA 1NY5A 1D2EA 4BFUA 2V6JA 3OFND 1CJTC 2FGJA 4KHZA 4LJ4A 4GDFA 2F9MA 2HJGA 4V02A 2PX3A 1KMQA 2NZJA 4RZUA 1I2MA 1H65A 3U60B 1QHHA 1GNRA 2OV2A 3AP2A 1E9AA 1L7VC 2QE7D 3NBXX 3O8DA 3RRYA 3RS7A 3LV8A 3H84A 1J7KA 4LOAA 1XMJA 4M8NE 3VR5A 4A92A 3A1SA 2WKPA 1QHYA 1W46A 5FOUA 1GP2A 4URWR 1G18A 2I1QA 1FUKA 2JGNA 3QBVA 4EPWA 5JFGA 3KUDA 4C9BA 1OFHA 5HKKD 3L8YA 2VL7A 4IJMA 3NHBA 1PUJA 4Q4HA 4Q1BA 1XZPA 2ZS8A 3Q8XB 5FL7A 4EPTA 2IS4A 1CR4A 4AG5A 4URXR 2WSSD 1G3RA 4D4JA 3U7FB 2OLJA 4JIMA 1OFTA 2BC9A 5G3ZA 1C1YA 1I4TD 2WPDA 4IVRA 1XTJA 4QNMA 4B2PA 5F9FA 1W36B 4MRVA 2F43B 4B3BA 2F9LA 2Q0HA 1JJVA 4B76A 1RRGA 1XMIA 4PX9A 4MQBA 1OXVA 2FU5C 2JLVA 1HYQA 1MR3F 4KAXA 5L3SB 3D6TB 2NPFA 1WRBA 2ERYA 2GCPA 1GKYA 2J46A 2P3SA 1OE0A 2PMDA 1XCGB 1XJ0A 4I1OA 4M22A 4OL0A 621PA 2GESA 5DIFA 3GJ4A 3L0SA 4Q1FA 1NJFA 2W6ID 4Q5IA 3QXCA 2PZGA 5FI0B 1KNQA 1D6JA 3UATA 4XWAA 4IDOA 5EE9A 1QDEA 2FH5B 1SVWA 4ZO4A 4LX0A 1KJYA 1HT1E 1LB1B 1W4CA 3O47A 4LHZA 2BKEA 3CWQA 1QZXA 3QNUA 5C4MA 3RAPR 1TQ2A 4XVQA 521PA 2ONKA 1NF3A 1DELA 1VMAA 4Y0AA 3Q5EA 1UEIA 1AGRA 5JEEA 2YHSA 1LW7A 1Q21A 4OQMA 4DDUA 3BK7A 2WSMA 1E99A 4KFTA 2VSXA 5J5CA 1NRJB 1N6PA 1AQUA 1NG1A 1IN6A 2WZQA 1FQJA 4Q4HB 4JVMA 3UANA 3SYLA 3UK6A 4V0LA 1DS6A 2CJWA 1G41A 2IWRA 3QSYA 3WMGA 4QHTA 2QZ4A 5H68A 2MMCA 4JS0A 3I61A 1OHHA 1SVOA 3BERA 4CVNA 4OHZA 3AVPA 4DKXA 1Z2CA 4UNPA 5DN6D 1WE2A 2CNWA 4KFUA 3BB4A 4FCWA 3IBGA 1IQPA 4N3NA 5LD2B 4KO8A 5IK2A 5JI3E 3U7HB 2LKDA 1A4RA 4LBVA 1GOTA 4DLWA 1I2DA 1KAOA 1MABA 3QY0A 2QUZA 4TZ0A 3TMKA 2G83A 4BLRA 2J45A 5FI1B 1F2TA 5AJVB 2ANCA 4YMWA 4G01B 1S0UA 1E2FA 4PSVA 2IXGA 3E1SA 4E03A 3HPRA 1GFIA 2IT1A 3IDQA 4TTPA 4B6EA 3I5XA 4Q1EA 2CK3D 3TQFA 4QM7A 2IS6A 4DRZA 3FHOA 3GJ5A 4FI3C 3P4YA 4QGAA 4BQSA 4PHHA 5J4YA 1J8MF 3Q72A 3U6KA 2EVWX 4II7A 5HTKA 2NZ8A 2X2EA 3DO6A 1II0A 3F8TA 1N2CE 4C0JA 2FFBA 4G5OA 3T5GA 1FMJA 1OH7A 1JB1A 3TUIC 1N3BA 5CYOA 3BFXA 2FPMA 2WICA 2GCOA 1Z6TA 3D8BA 4LBWA 4URYR 4FINA 2NO9A 1VTKA 1N6KA 3PQCA 4ZKDA 3AF1A 1KI2A 1R2QA 3PEVA 5B30A 1X8KA 2ZR0A 5FUXA 5GJCA 1G20E 1P9WA 3W3AA 3P20A 2VP5A 4JBWA 1OXTA 1OPXA 3Q3JB 4LBZA 4ZKEA 2E1RA 2ZJYA 1SXJD 4FWIB 2GAAA 4AIIA 1TQ6A 1JBKA 1HTWA 4UKDA 5FL3A 1Z6AA 2ASEA 3A1TA 4GT1A 1PV4A 3B1VA 1UADA 3E2IA 4JLNA 3PXGA 1KY3A 3SU8A 4DB2A 3QF4A 2VPPA 5G40A 1MABB 5EP3A 4TSFD 1GITA 2UZIR 1CJVC 1TMKA 4ZCMA 2C98A 4NP6A 1F2TB 4DLSA 4A36A 1GRNA 1LTQA 3KXLA 3CX8A 2A5JA 4E5UA 1UM8A 1ZRHA 1P60A 3U4QB 4RFSB 3SBDA 3TSZA 2R6GA 3FOZA 1YZKA 1QHGA 2GJAA 2FFHA 5P21A 5G41A 4C0QC 1N0UA 2AN9A 2O8CB 1E2PA 2PLRA 3P4XA 3ZVRA 4GMDA 1M2OB 1P9NA 4HATA 1NKSA 1OV4A 3OEHD 4L5BA 2ANBA 2XX3A 2YJTD 2HLDD 4R7ZA 4XSHA 2IYSA 3LXXA 5FUYA 2GCOB 4QBHA 1E1QA 4AKIA 3BFVA 2GF9A 3MG9A 3ZD6A 2ZANA 3THXA 5DH9A 2WVJA 4QRHA 2GXQA 5H70A 2BEKA 4YMSA 3QQ5A 4OQFA 4AK9A 1F2UA 4V0OA 4PSKA 2G6BA 2X1VA 4CZ2A 1KZ7B 4MKGA 4ZI2A 1YJ5A 2FMXA 4LJAA 3VR3A 3U3RA 2HV8A 1DG3A 4WAUA 4V0ME 2FSFA 2ZETA 3IO3A 4X8MA 5KNDA 2NQ2C 4HAUA 3C14C 4A2PA 1ZVQA 3GQBA 3IIMA 5DNYB 1F3OA 2IF0A 4NHOA 4WXRA 4QGGA 3B1XA 2V4ZA 3TAHA 3K0FB 4LC0A 4Y0VA 3U44B 1QVRA 3AKDA 4W5WA 1U99A 4MYCA 1E9CA 4LZZA 1SKQA 3L43A 3CWZA 4HAZA 2HF9A 5DLQC 2AD5A 2OCYC 3GLHA 1IXRC 4IXNA 4B71A 1DPFA 4HDQB 5GVRA 3P27A 1EFRA 4HLCA 5JSZA 1Q1QA 2G0NA 5FR1A 5E3HA 5ELXA 2PBRA 2A5DA 5KSOA 3W6PA 1WP9A 2A9KA 1YVDA 5G3YA 4Q7JB 1XEWY 2GK6A 1TADA 1RYHA 1N5JA 4BFWA 4C0SA 3K70C 2F3TA 4C7OB 1Q20A 1YRBA 3PV0A 2R8RA 4HYYA 2XEXA 4ZPXA 3FFBA 3ZIAA 3SQWA 4NONA 3WNCA 4A1FA 4ESHA 5BYKA 2O8FA 2JJ1A 4DSUA 4AKGA 3VR4A 5KUTA 1GDDA 2F7SA 1ZC3A 4YDSA 1CJUC 4B44A 4JL6A 3L8ZA 1RE0A 3SJZA 3KXIA 1G3UA 2ZRMA 3TIFA 5FUWA 2GXSA 3KUCA 4HUQB 3WYGA 1II8A 3G0HA 2YC4C 2ZRFA 1HE8B 3TBKA 1HA3A 4CGZA 3AVOA 1F6BA 3UPUA 1CR0A 3THWA 4Z51A 3B2EA 2HDNB 1RJ9B 2KSQA 2QG6A 1W0KD 3B1ZA 3CUEF 2JJ2A 4XJXA 1N0VC 4Q7MB 2EFDB 1KMHA 2CE7A 1W47A 1OSNA 2BKUA 2ZJZA 4FMBB 4GZLA 2P65A 1ZUNB 3IEVA 3WBKA 2MSCB 1P2VA 1OYWA 1D2MA 4OBEA 3DKVA 4ITRC 4PO8A 5L3VA 2OCPA 3AH8A 5HZHA 3RNLA 5BN4A 2YOGA 3ZQJA 3DM5A 3EIHA 4U7DA 1VKJA 3VU9B 2OSBA 3FYHA 5L3QA 1N5KA 2J7KA 1Z22A 2WJYA 3FKSA 4BE7B 3GLGA 1EFUA 4BEBA 5HE9A 5BQ5A 4B3CA 2XB4A 4DEYA 1YR8A 2ZIAA 4P32A 1ZUIA 1BYIA 1U0HC 2XOKA 2H1LA 3KQNA 3ZZ0A 3FMIA 3U3OA 3DDCA 1AIPA 1HY3A 4A2WA 3EX7C 4EFNA 4M53A 4LC1A 2QNRA 2ZYTX 3K0AA 3SQXA 4BEJA 5K8LA 2MMGA 3KQKA 1X86B 2REXB 2ZE6A 4XOIA 1AKEA 1SKYE 1ZM2A 3OAAA 2OAQ1 2J7PA 1NVVR 3MUFA 3L2OB 4MH0R 4U02A 2P6NA 4A8JC 4LWZA 4ASUD 1U0JA 4B32A 2GTPA 4N1AA 2C77A 1KSGA 2A5YB 5AJWA 2JLQA 3GEHA 4DBLC 3CH5A 1K6MA 2J87A 4D25A 3QKRB 4NMMA 1FX0B 4F4JA 2EQBA 3CW2A 1OIXA 1GG2A 2QRZA 1XJQA 3B1YA 4C3ZA 2DYKA 5FUVA 4MYTA 1E4VA 2BMJA 2IXEA 2C95A 3N5CA 2YNMA 2QMUA 4I81A 1C9KA 3OZXA 3UIEA 5BN5A 2BVNA 1S1CA 3R9WA 5FOWA 2A2ZA 3EWSA 4XD7A 3W8RA 3J81k 1W36D 3RWMB 5F3WB 4O3MA 1DTSA 4XVUA 4HB0A 3GLGB 5JWOA 1G8PA 4M21A 5F98A 1NVVQ 1N6NA 1COWD 1O3YA 1TUEA 3GLHE 3HU3A 4DCVA 4MGKR 3K0SA 1W44A 1CRPA 2IBMA 6Q21A 8OHMA 3L0OA 1JALA 2BEJA 4R98A 2W0SA 4UJ5A 1W5TA 3T12A 2BCJQ 5A0FA 1PLLA 2EYUA 1E98A 1T3LA 3KTAA 1ZU5A 4PFSA 2IS1A 1M7GA 4KV9A 4B48A 3I5YA 2D4HA 3CH4B 1UBCA 2IWHA 5FTJA 1Z07A 3RS0A 3BIFA 1CXZA 2ODEA 1JR3D 1XEFA 2IYRA 4F91B 3I8XA 1KK1A 2F1HA 3GMTA 4NZYA 1E2MA 2P5TB 1P62B 2QAJA 3EPJA 3T06B 2GJSA 1FFHA 4QKQA 1SVKA 4IVPA 2OESA 3K70B 5JZVA 2R6CA 4B2LA 4KYIB 3B78A 3T1OA 2ORVA 1VIAA 5KNBA 1E0AA 1XMVA 3GJ6A 4EUNA 1N6LA 3KJGA 4RKEA 4P4UA 4WIAA 1KK0A 5FL7D 1MT0A 4MRSA 2VTKA 1YZNA 3NEYA 5HZKA 1E2QA 5FH9A 2W83A 3G5UA 4US2R 4ZDWA 1MRNA 5IT5A 4Z8XA 1G7SA 2FSGA 2QAGA 2QQ0A 2J59A 4DLZA 1XP8A 1WBDA 2J0VA 1QRAA 4JLJA 2BM0A 1E4YA 2YOFA 4XH9B 1RRCA 2WIAA 2D74A 4HB2A 1DAHA 3SYKA 5JJKA 3I32A 1GIAA 1NY6A 2XZOA 3IPXA 4JT4A 1Q1ZA 2D7CA 1UBGA 2XXAA 2IYVA 2A30A 3GEEA 4JSTA 3VMFA 2WWFA 3AKEA 2YWHA 3C41J 2FSHA 4GOXA 4D81A 4QC2A 5SZJA 4IOJA 1XBTA 4IDQA 1S8FA 2C9CA 5TB5A 4QM6A 5F9HA 2F3RA 5JRZA 4Q66C 4QOSA 5TV2A 4AC9A 1HURA 2OCBA 4R2HA 3RS2A 2NO6A 1MKYA 2YINC 5HCIA 2ZI5A 3IUYA 4OK3A 3EPKA 2FFQA 4MGZR 2IEZA 2BM1A 1XD9A 1D9ZA 3TJZA 1J70A 1YE8A 3EZFA 3CZQA 3DOEA 3KKPA 4JZKA 4TMWA 3RRNA 4F7WA 5EUQB 1JNYA 4OQLA 4FMCB 2JLXA 3ZGXA 2OT3B 1W2GA 2J9RA 3MJHA 3KQLA 4IW3B 3WHKA 2CCKA 2OE2A 2WOJA 2AFIE 5AWFC 4Q00A 2WWHA 2PH1A 2ZPTX 1N6IA 2FSIA 1KI1A 4Z54A 1GILA 2UVQA 1HQCA 4LCBA 2QAGB 4PQRA 1RW4A 2NG1A 1OHHD 4TMVA 4WA7A 2FZ4A 2QP4A 2HT6A 5BXQC 4IDHA 4Q4JB 4A8JB 1G7TA 2YC2C 2ZSFA 2CHQA 4YXWD 5C18A 5IK2D 4KXFB 2BHRA 3R7WA 1RYFA 4LHWA 2XNSA 1KY2A 2HEIA 4RD6A 3WRXC 3B6EA 1ZJ6A 3GJ3A 1VCIA 1ZINA 1VG8A 2CCJA 3LW8A 2RGDA 4F92B 3CLVA 3VKHA 1XXHE 2EW1A 3QPUA 1XPRA 1QVAA 2I4IA 3HU2A 4LV5B 3BAFA 3LQQA 4S2EA 4LYAA 1WF3A 3K9GA 4HAXA 1DG1G 3PEUA 5CDFA 1QHXA 1EX7A 1L4UA 1LV7A 1NNEA 2V54A 1C4OA 3UWKA 1NMZA 2Q6TA 5SZHB 3VR1A 1DAFA 1E2GA 4QGFA 4RD1A 1OH5A 1IJEA 5IDVA 1B0UA 3BE4A 2QU8A 2WM9B 2EU8A 2H92A 4Q7KA 3VTKA 2OO7A 1XX6A 3C5HA 2WAYA 3OE7D 4B6FA 1V43A 4M9SA 1X8JA 5ANRB 4DDWA 4S35A 1T3SA 2PEZA 3DKPA 3NHAA 1Z5ZA 2W2VA 5JCZA 2IYWA 2VLIA 2ZAMA 4FD2A 1BMFA 1YU9A 4P0TA 1XZQA 4DT1B 2R6AA 4H1VA 221PA 2FWRA 3LVQE 4UNNA 2GETA 4FXPA 4RSGA 5EXSA 1AM4D 2ZE7A 1U94A 1P7CA 2XNDD 2O8EB 3SDZA 1DADA 2ZR7A 4GP7A 2B8WA 1CJKC 1KDPA 4GP6A 5KU1A 3ZQ6A 1KO8A 4AD8A 2DY1A 2PT7A 4PTLA 4CEHA 5A5GA 2JIZA 2VQSA 5EXPA 3TR0A 1RRPA 3Q5DA 1SVSA 2EFEB 3B7GA 3QG1A 2XJ9A 1DEKA 4HI0E 4TLDA 3LQRA 4BFYA 4TQUS 3ECCA 1LVGA 2OXRA 3R20A 3WNDA 2IUTA 3A37A 1CR1A 3I1FA 2GWHA 2QPTA 3CKLA 1TTTA 3BJIC 1Z0JA 1W5SA 4RJLA 3EAQA 3UWOA 1T6NA 4PAOA 1EESA 3G82C 2C2HA 5KSYA 5DHFA 4ARZB 3UMSA 5TMPA 4DVGA 2DWQA 1CULC 1V5WA 2X77A 2CVFA 4JLVA 2BOVA 2DFLA 3A8TA 2F1RA 3KFXA 5L3RA 3T1VA 1NN0A 3V4FA 4Q9JA 1AN0A 4TQ9A 1S1MA 1TF5A 2CLCX 1IOZA 5B57C 2V9PA 3MWLA 5F2EA 4DSOA 1BS1A 1W49A 4WVFA 4MYHA 4DZZA 4ZV4A 5KPJA 3PG5A 1U2RA 1S9HA 4DLRA 4BZXA 5JLJA 1W2HA 2FA9A 5FBRB 3WMFA 4B74A 2F1IA 1E94E 4DJTA 1Q3TA 1IXZA 3FMPB 2J41A 5LPNA 2F1JA 2HYIC 4AYXA 3PEYA 1ZAKA 3AVVA 5JWRA 3B1WA 2VHTA 3H4MA 1E2JA 2BBOA 4LJ7A 3HPQA 1G5RA 1GKIA 2ZS7A 2D06A 4TQAA 1NBMA 3A4NA 3R9IA 4HZUA 1N5IA 4JLPA 4JYCA 4B33A 2QBYB 1YKSA 2CVHA 1H8EA 3GLIE 1QBKC 1X6VA 2GHIA 3TK1A 3BBPA 1DE0A 3DHWC 2AD1A 3QPWA 1EFRD 2RHDA 3UXMA 4MRRA 4LJYA 2RGAA 1QHHB 3N2IA 3HWSA 3CIOA 3D31A 4HAWA 4KBGA 2XTZA 4A0GA 4DWJA 3SFZA 4V0KA 2W2XA 4HLUA 1KZGB 3EZ6A 4C0LA 3ZD7A 4MUBA 3DVLA 2Q9AA 4C4PA 4V0MA 4DCUA 2QT1A 1Z83A 3NG1A 3LRPA 2P2LA 3UG6A 3ZIAD 4A6PA 1KO4A 2REBA 2ZI3A 4KJZA 2AFHE 3PCRB 2V7QD 3QKTA 1E2HA 1Z3IX 1G8HA 4CEJA 3K09A 3MCAA 2LKCA 3T15A 1M7BA 4DDTA 3TVTA 1JI0A 5D3MA 5CDFE 1CR2A 3LA6A 2Z6VA 3TW8B 2ZROA 1XF9A 3AGPA 4M9QA 3WHLA 1HV8A 2DFNA 3M0EA 2F6RA 3QPVA 2RH5A 2G77B 4QJ5A 2KJQA 2ZRPA 3VKWA 1Y3AA 2JJ2D 4OHXA 4RCZA 4LYHA 3OEED 1YZGA 3AVWA 4PC3A 4D2IA 4OI4A 3RANA 1G16A 4DIDA 4Z1MA 3ZS8A 2BBTA 1JPJA 1R4AA 4L8GA 4MRPA 3BOSA 1OFUX 2AWNA 1GRRA 5HCNA 4DXAA 4JKYA 1XB2A 4M2LA 4A0HA 3EXAA 3OESA 5J47A 2WWYA 3FKSD 5FBQB 1KIMA 4B34A 1E79A 1EX6A 1UKEA 4NCNA 4NDZA 2ATXA 4TMTA 1KI6A 5FPHA 3X1WA 3ZH9B 1UBEA 2O8DA 4M4SA 3EA5A 3NVAA 2Q3MA 2QMHA 4L15A 1ZD9A 4KLZA 1G8YA 4AURA 4IOLA 3W5IA 4J0QA 4C0AC 5J4HA 1GRQA 2CJWB 4I1VA 1W0JD 1NSTA 2QROA 1WBBA 4Q1CA 3KKMA 2KBFA 1R6BX 5CYPA 4W9MC 4JLOA 4WZAE 2VP0A 5GJWC 5JJIA 2JDIA 2DFKB 4OJQA 2YKGA 4XWKA 3KJHA 4AI6A 2D62A 4US1R 1LNZA 1TPZA 3RLFA 3LLUA 1Q12A 1AK2A 2ZSDA 1VHTA 1T0HB 1AS3A 5DHAA 4Q21A 3HP1A 4KSBA 5KDDA 3MRSA 3K70D 3DMNA 4RZ3A 3BD9A 4ERNA 1M8PA 4LY6A 5JBQA 1A82A 2V55B 1TX4B 1FUUA 1QF9A 2WJGA 4HLQB 1ZU4A 3CX6A 5A4JA 4M1SA 3K9NA 1JAIA 4TL9A 5KSZA 3TH5A 4OI0A 3HR8A 2QSZA 4TT3D 1Z6GA 4Q9IA 2O52A 1Q44A 1JEEA 1DAIA 1FP7A 3K0CA 4XD7D 4TLEA 2IUSA 2G1KA 4FCTA 4B2IA 3AVXA 4PZYA 2ZRNA 2O8BA 2WTUA 5KDLA 4GL2A 1NBME 2KE5A 2PCLA 4UJ3A 3H86A 2NOAA 3TQCA 3Q9LA 3KKNA 2WWIA 1L8QA 4WW0A 2BJVA 4M1MA 2ZJ5A 3LAWA 1RZ3A 4MGIR 2OCAA 1Z6XA 2EFGA 1OKKD 3QOFA 2Z43A 1KAGA 1IN8A 2QE7A 4PAMA 4BFZA 3U61B 3C4JA 3EC2A 2CL6X 4IRUB 3AF0A 3IQWA 4PO9A 3QBTA 2OHFA 3WYFA 3V4RA 1WQ1R 3IPYA 4UXJA 3VQTA 2QI9C 2CLDX 4CT5A 2JCSA 5FOSA 2G0TA 2QRNA 1IY0A 2FF7A 3CPJB 5J4LA 4DCNA 5CJPA 2QP3A 2VSFA 2ZVQX 4D80A 4JVSB 4IOMA 1XD2A 3C7KA 1VPLA 3JZAA 4HDOB 4IHQA 2WSSA 5FOVA 2ONJA 5EE5B 2H16A 3VR2A 4EPRA 1UDWA 4HB4A 3I8SA 3JZMA 4GMXA 3QF4B 4OI1A 4IDNA 2ZYVX 4M0LA 1RFLA 4L16A 1KSFX 2AKYA 2AHOA 1YR7A 4GRAA 4KVAA 3ND8A 1CP2A 1R10A 4TL8A 1IAQA 1OF1A 4QGHA 2ZM5A 1G5PA 5TVKA 1E2LA 1P73A 2ZUBA 4EAQA 1KYIA 3JVVA 1A2BA 3LBIA 3A4LA 1G3MA 3QXJA 4L9WA 4ACBA 1U9IA 2B8TA 3AF4A 3DZDA 2YWEA 1SKYB 2MSEB 4BASA 4FN5A 4I1SA 2OAP1 1FQKA 1N0WA 3IHLA 5G53C 2O5VA 4FMCF 4D26A 1FZQA 2FOLA 5E7IA 4JLAA 4NCIA 2IF2A 4DCTA 2H8KA 4C0HA 2HCJB 1ZM9A 2QPOA 4OK5A 4EQ6A 4CEIA 2ZRKA 1D2NA 3KB2A 2P6UA 3LNCA 5EZ6B 2ZYUX 3FKQA 3VFDA 3CNOA 2J0UA 1LS1A 1YZUA 3I4LA 5CLLA 3SS8A 3THXB 3EASA 3DZ8A 4AKEA 4EJSA 1F2UB 1H8HA 3F3YA 5EXTA 1ZP6A 4UNSA 1ODFA 5J40A 1US8A 1G9XA 1TNDA 4JT2A 1UF9A 3NKVA 1E2EA 3THYA 1BIFA 3QKSA 3VHLB 3HYRA 2GZHA 2LWIA 2VA8A 1J2JA 1RRFA 2AX4A 4NCKA 3SBEA 1Z63A 4WZ6A 1TL7C 5DO9A 2NIPA 5FTNA 1GL9B 4Q4AA 1VYVA 1ETUA 3GFOA 3GLHB 1T8UA 1ZBDA 4RVCA 2PEYA 3KFVA 1HUQA 5JSZB 3CX7A 3RS4A 4M1KA 1E1RA 1PLKA 2GEUA 4OK6A 1ZD1A 4OHWA 1KO7A 2K5UA 2B6HA 1TF7A 4QL3A 1EK0A 2F55A 2BWJA 1ZNZA 1NKTA 1ESNA 1G8FA 1CEEA 1CU1A 2FJUA 1BH2A 1ZCBA 1MO5A 4NYIR 4O25A 4RD2A 1LF5A 1E0KA 1OLOA 4I4LA 3IGFA 4HAYA 1ANKA 2O8FB 2CK3A 1B23P 2YVUA 4LJ5A 4Q1DA 3TVDA 3AV0B 4UNQA 1VCMA 4EPYA 2WMNB 1TQDA 4QJ3A 2RGGA 1XMSA 3DOFA 2QAGC 2CHVA 3QKUA 4EJSB 3B60A 1P2TA 1II8B 3IILA 4CT4B 1P75A 4C0BA 4JSYA 4RD4A 4MUAA 1VG1A 2ZU6A 1ESMA 2C03A 3EZ2A 2ZITA 3C8UA 3E70C 3PUYA 4Q48A 1P3JA 4TL7A 3THWB 1F48A 2NMVA 2IW3A 1CBUA 1AS2A 1HT2E 3ADBA 3THYB 3AM1A 2H57A 1KI4A 4HLDA 5C2JB 5IHPA 4NYIQ 1KMHB 3LD9A 1W7AA 1N6RA 4OHYA 3ASZA 4XTCS 4Q4AB 5KSPA 1NN3A 2ECKA 1OB5A 1P5ZB 1SXJA 2XSZD 1U8YA 3W6OA 1UDXA 3CBQA 3QVUA 1KSJA 5TARA 4TMKA 4CDGA 2Q9BA 3C15C 3QE0A 4Q9LA 1KO1A 2QENA 5L3QB 5EUMA 2QTVB 4MGYR 4FMDB 4Q01A 1SVMA 2AK3A 3P32A 1Z2AA 1XRJA 4MDFA 4JLBA 1XXHA 5E95A 3NH9A 2J1LA 2W6JD 4HSEA 2FG5A 4G3XA 4URZR 4YONB 3BORA 2A3RA 3TGPA 1FNNA 3D3QA 2GZDA 4EIWA 3GEIA 1ZM3A 4P4SA 4B3XA 3U3JA 1NIPA 2IYYA 2MSDB 3ZZUA 2JIZD 1GTVA 1HH4A 3LFUA 2TMKA 3OIYA 4LHXA 2L0XA 2GJKA 2J5XA 3CRW1 1Z28A 4Q9KA 1N6HA 3U3MA 3K0AB 3HDTA 2XJ4A 3LY5A 4JL5A 2QM8A 2DWPA 4LBYA 3PITA 2PCJA 2RB4A 3OEHA 2CE2X 2X8AA 4G5SA 4MDEA 4YC7A 3TAUA 3B85A 3ZLJA 2WIBA 3CNNA 5FOXA 4PAQA 1ZUHA 2PJZA 1CS4C 2C5LA 3MAAC 1OIVA 5EJEA 3BRWD 2WV9A 2V3CC 3IIJA 4KSCA 3A58B 1EFTA 1YR6A 4BLSA 4DSNA 3TKLA 4BFTA 3KB1A 3TE6A 2NGRA 4BPBA 2WOOA 1PZNA 1AA9A 1E9BA 3ADCA 1S2MA 5EE1A 5SZKB 3TUZC 3B13B 1AJEA 1ZMXA 2WPDD 1KI9A 3ND9A 5EZ5A 2H18A 2FEOA 1P61B 4IXMA 4L9SA 4WZBE 121PA 2WWXA 3FGNA 2R65A 2KBEA 3WP0A 1YRAA 1E2KA 1TEXA 1XD8A 3BH0A 2GDJA 3NBYC 1N25A 3H1TA 4PC2A 3V00A 2WAXA 2GBLA 4O2RA 3O8CA 3UMFA 4F4IA 4WXPA 5DI3A 1GSIA 4DDVA 3CONA 2VEDA 1Z8FA 1YZTA 3V9PA 1SHKA 3W8NA 3Q85A 4Q7LA 5EE3A 1TEVA 2WMOB 1I4LD 2V6IA 3PUWA 3SOPA 4MKFA 2BIFA 2FN4A 3KTAB 2ZYWX 3RC3A 5C1BA 3VR6A 1NLZA 2QN6A 3FFAA 3GJXC 4LYJA 2BDTA 4CRWB 2R9VA 2P0EA 3CZPA 3WXMA 5K8TA 2BBSA 4EDHA 1KO5A 1II9A 3IIKA 4IKEA 3K0EA 1OIWA 1OXSC 2AXNA 3ETLA 4KYUA 1EWQA 3Q7PA 1W4BA 1Z06A 5AR1A 4GZMA 3MLEA 1LY1A 3M6AA 4B35A 2Z83A 4DSTA 1E9DA 3LH5A 5DI9A 1EG7A 4RZ2A 4ZDIA 1IONA 1MO6A 4BZQA 1IN4A 1GNPA 5FFMA 5KPDA 2W00A 3GFTA 3CRRA 5CIWA 1I4DD 3EW9A 1CJMA 3AGQA 3NBZC 3EARA 2RGNA 3IHWA 3ONWA 1KKLA 1ZW6A 3SNHA 2PX0A 4AG6A 3F0TA 3VNUA 2KB0A 5KYKA 2UKDA 4K81B 3TSWA 4CYMA 1VECA 1KI7A 3OIVA 1KDRA 3P26A 2GILA 3AVYA 1R5BA 3PUXA 1G64A 2AKAB 3GFPA 3EC1A 3QJYA 1S3SA 1W0KA 3GLIA 4P4TA 4MA4A 3WBJA 3TLXA 2Q9CA 5JEDA 2PZFA 2DFTA 3M1IA 4MKIA 3SC3A 2FNAA 2WJJA 4PC1A 1G7CA 4WBSA 4TMZA 4B73A 2REOA 1U8AA 2OBMA 4AYWA 2ZSEA 2CNWD 2ZJAA 4BZPA 1IBRA 3T35A 2IYLD 2Q3HA 2DB3A 5JS7A 3O8BA 4PQFA 3H0KA 3SN6A 1UFQA 1CLUA 2XXAB 3AB3A 2XITA 1SXJE 3BH6A 2ZAOA 4ESVA 3CF0A 1UKVY 4PC6A 3AKCA 1KDTA 4A2QA 1GVNB 4NU0A 4UNRA 2VHJA 2JEOA 5EP2A 3K9HA 4Z1MD 2JLRA 1W48A 2H17A 5J4VA 2XGJA 1CKEA 1J90A 4A82A 1KK3A 1T3HA 1JPNA 2PZEA 1XEXA 2KWIA 3KDSE 2DR3A 3BS4A 4KCGA 4DLVA 1ZM7A 5CK5A 1DAGA 2W58A 1VHLA 2GCNA 2QT0A 4XIGS 1X1SA 4G5GA 2JLSA 4KU4A 1E79D 2G1JA 2HXYA 4IFBA 2D2FA 2FEMA 3NC1C 3GLFA 1S4QA 3BC1A 721PA 3A1UA 2WJVA 1M34E 3OIWA 1R7RA 3GD7A 4XSGA 4F93B 3T1TA 1NN1A 1SHZA 4BFVA 2DWOA 2OILA 3MGCA 2PMKA 1S96A 4NBSA 1PUIA 4QG7A 5JMTA 4ASUA 4LSGA 4P33A 2EWVA 4V03A 3O8RA 4D0LB 4FWTA 2I1VB 4LYFA 4QFMA 4TWZA 4HLUC 3C16C 3WY9A 3H2YA 2ZJBA 3PUVA 3QXHA 3ZJYA 1CIPA 3GJ8A 3QENA 4PPGA 3I73A 5CJ2A 4PANA 3TUJC 2WHXA 2IL1A 4KVGA 2VH5R 2YOHA 3AP1A 5FPKA 2W0MA 4LHVA 3R7WB 5TY0A 1U98A 4A6XA 3K09C 2ZVPX 2F43A 3ZS9A 4D4MA 2C96A 4OKSA 5L8VA 1E0JA 2R6FA 3VX4A 3PJRA 3I62A 4JLMA 1NN5A 4UQOA 3SHWA 4Q47A 1W4RA 1PJRA 4TYQA 2PJRA 2J0QA 4PSAA 1ZNYA 1COWA 2C8VA 3CF6R 5KDOA 4JVNA 4JLKA 3VHXA 1UKYA 4A0RA 1RVDA 2A5GA 2FPLA 3EIQA 2DCUA 2DPXA 4YMTA 2CL7X 3B9QA
chains in the Genus database with same CATH superfamily
2Z56A 1RS0A 1PFQA 3OHMA 5CB4F 1V35A 1WU7A 4EF6A 3SS9X 4F4FA 5UKDA 4V3CA 1P2UA 1IY1A 1EA5A 3RO7A 2PYDA 3LT5A 4PLVA 2PLFA 1SUSA 1ISPA 2EOAA 1JR3A 4EHIA 2Y6VA 4E33A 1E7QA 3ECAA 3NHUA 1E1QD 1UP6A 3KQMA 3PC2A 5H82A 3T1QA 1AT1A 5CFLA 4ND8A 2NZ2A 4B3XA 5JARA 2YZ2A 1X92A 3LOQA 3RAGA 3LBNA 1F8UA 1MXFA 4QBFA 1I3LA 1XIVA 2B34A 2OZPA 4KDCA 1IMOA 4BLOA 4FILA 5K0SA 1ODJA 2AW5A 1JSXA 1KKMA 2RJOA 2VO1A 2R1UA 2XQJA 3B2NA 1WCV1 3GV0A 2B1RA 4LKRA 3VAAA 5B3JA 1SC6A 4M9XA 5REQB 2X0IA 4BS9A 4JVOA 3AYZB 3VMMA 1WMSA 2CWDA 1LZKA 3DM9B 1NBAA 1Z4QA 5LBIA 4QICA 1WXQA 1DTWA 5DWQA 3K6SB 1RFGE 3K1YA 3A27A 3KR0A 1J39A 2Q8NA 1NRWA 1VJTA 1UZUA 2WWGA 3H75A 5B64A 1OLUA 2H1HA 2VYQA 3TI7A 3EXFA 3KZ1E 1L7MA 3DQPA 4KIUA 4C30A 3WL3A 2ZGVA 5AJXA 2GA9A 4NEGA 3DDZX 4TLAA 5B2ZA 1Z0IA 5TEWA 3SWWA 3N2NA 2B1GA 2OFOA 1TC1A 3BXZA 4X45A 3X1ZA 5JD4A 4PRYA 2AI3A 1HTTA 2I3DA 5D3ZA 2GK3A 1XTKA 5ALTA 1ZZEA 2FSSA 2A1UA 3C2QA 3EJ6A 4DQDA 3I42A 2CYCA 2WJHA 2ZPAA 3JW8A 4PYKA 4ABYA 4RPJA 4B3JA 4G1CA 1CQIA 2GPAA 2OV3A 2VF4X 4LGVA 1OILA 1VMIA 4CMGA 2PN1A 3QXSA 3A9WA 2P2YA 3IYLW 4NFLA 3NJ4A 4O0MA 2BMEA 4UM8B 4FW9A 5KCMA 4YRSA 2Z4RA 1FTNA 1DQZA 3IVRA 2ZU0C 2JJ1D 3I0NA 4TL6A 5ALNA 2UUAB 3MJRA 5HF6A 4PIVA 3EBOA 1J6UA 1JHXA 1M6EX 2P2GA 1C2YA 1OYYA 2OXFA 2P9TA 3OM9A 4X64B 5HM8A 3MCVA 1A5TA 1E6KA 3EWAA 4R41A 4CKWB 4KR2A 4IVQA 4C4SA 2BEUA 4BOYA 4ZALA 2VJPA 2OBLA 3QFHA 1MTZA 3R40A 4HN4B 3C70A 4K8OA 4W7HA 5IXSA 2HK9A 3B82A 1C7EA 1BU5A 1ZGCA 1ZSNA 2HDWA 1DXHA 1KRXA 1CDEA 4HH0A 1IBKB 3E5NA 1JECA 1K6IA 1KJWA 1UPBA 3ABIA 3BIJA 4KJXA 4BQFA 1WCWA 2O5RA 4I3GA 2H9IA 2JAQA 1C30B 5IC6A 2WVGA 5GJVC 5C8YA 2AEEA 2I7TA 4TTQA 1HO3A 3AJDA 1EXVA 2D00A 2QSYA 1THTA 2FX3A 4AW9A 4EX7A 2H7VA 3SR0A 3IBYA 4GM4A 1JBEA 1GAWA 1FA9A 3RGGA 2OQIA 1YVEI 2WJIA 2WKRA 2VDWB 3UNXA 5HIAA 4OSPA 2I7DA 1IUNA 5I01A 5IG2A 1I2BA 1RPJA 4QJ4A 4PHGA 3RM3A 3EZNA 1OLSB 3D4BA 5CTAA 2YHBA 3OJCA 5E8JA 4AUEA 2ZRBA 5FPPA 4KC0A 4S1PA 3ZQKA 3SQOA 2GD2A 4YAKA 4N5IX 3ZD6A 2JIQA 1T13A 1PL6A 5COQA 1KERA 2JD1A 1RBMA 1SVUA 3U6BA 1IXKA 2C54A 1GZSA 4G2TA 4CTKA 4JT8A 3WDKA 4BHTA 1JKXA 2Z9DA 5AOAA 1X77A 3ZBUA 2JBAB 3PKJA 2BP7A 3HDVA 2P5UA 5SYMA 4Y7CA 3LGAA 1YTUA 3QG5A 4IQ0A 3R7DA 2RGBA 2ZIVB 3NBFA 2CEAA 1G42A 4S12A 4PFJA 3I6MA 2PE5A 1IHUA 1JIVA 1P2FA 1LBQA 1V8ZA 2V45A 4RLHA 4KO3S 2WUEA 2OB1A 4RFSA 2I7VA 4U5QA 1YQGA 2BFEA 1PNQA 4U3JB 3EZYA 3WLFA 5BWMA 3CVJA 4PQEA 5DTJA 2YN0A 3IT3A 3OZ7A 3PXCX 1CRLA 3OHSX 4FHFA 4GBMA 1W75A 1EB9A 2H5EA 3W8FA 5ITVA 2HV9A 1WXGA 1QQAA 2NQTA 2B92A 1TLTA 3D8SA 4I2NA 4O4JA 5ADHA 1R8XA 1G59A 5DYYA 1GL6A 3W9YA 2WHPB 4TLLB 3LO5A 3OAAD 1G5TA 4BN0A 3MWKA 1E7RA 3BHMA 4ZIRB 1PZXA 4QYSA 2EFYA 4CQMB 4OMFG 3MJTA 4TLBA 2VDMB 5K51A 3TPFA 4D45A 1H66A 2Q28A 2BFNA 3IHKA 1F06A 4MARA 2P5SA 3DFKA 3B5JA 4P2BA 4D82A 5ITZA 4MUHA 4RACA 5FBLB 3RC9A 5ALFA 3RS3A 3PQ5A 1CY0A 1W5EA 1S2GA 4OY3A 5KVVA 1OXUA 3CX4A 3MSXA 2RGRA 3NAGA 3BH7A 4K2HA 2NAFA 2YYZA 4FUQA 4ZYXA 4Z4GA 2YNMD 5CEFA 2FMUA 3Q7QA 4QRIA 5ISMA 4HDCA 2HRBA 2P2ZA 3G13A 5A3JA 1FTWA 5JCPA 4QD3A 2DUUA 4G9EA 3IO5A 3ODPA 4G5XA 4GPBA 3T7JA 3ABSB 4ZHQF 1RWXA 3OPYA 1FRZA 4FZVA 4OU5A 2IW1A 3GHHA 3AVQA 4M0FA 4EF4A 4JV5B 3T7DA 1M74A 1PG0A 2QHXA 5T3YA 1RPZA 3OZSA 1IZ7A 1O89A 4X90A 4U2DA 2XBUA 3TLZA 4FGSA 3A7EA 4D7AA 2O8DB 1MP0A 4RTSA 1NLYA 3EZ7A 1SIUA 2QPLA 4E22A 4JY7A 1H2BA 5EJ7A 4OQNA 4R9UC 5KWJA 1G0NA 2Z4SA 4QASA 3S27A 3UMMA 4NYJR 2DJ5A 1I14A 3KAJA 4B5KA 2QQGA 4LRSB 2Q8QA 1L5HB 2W4IA 3GPDG 4C7VA 3ADPA 3AUFA 3TR5A 4FQ8A 4CM4B 3MOIA 5DTQA 5CCXA 2BGGA 4IH1A 4NS1A 4C7OA 2ZSAA 5HQ3A 3GC6A 2P2NA 4GI2A 1T9GR 5JR3A 4N7RA 2A78A 5A5VA 2G9ZA 3S2ZA 4X1KB 3U39A 4N3GA 1MRSA 2HMTA 1X9HA 4YR9A 5K8VA 3R7AA 3H87A 4R0NA 1NR5A 2C78A 4TMXA 3TEMA 2FOIA 1GSHA 3FCCA 2GZ2A 2D1TA 3HUTA 5CD1A 3IA7A 4LX8A 4EF5A 4GVLA 3CO5A 3W1VA 4D4KA 1JIIA 3W2GA 4POOA 1DMSA 1Y4ZA 5DLYA 2RGXA 3QEOA 1ADFA 4KBFA 1ZKMA 5KNBD 4JMLA 4BO6A 2AV6A 4MWBA 1ODTC 3EG5A 3QMPA 4C5AA 3DFUA 3V4ZA 3W04A 4XXHA 1OWNA 3R0QA 4FFLA 1JQLB 3TKYA 2WK1A 2ZRHA 1XVIA 1PO7A 4QAQA 4DIEA 1TF2A 1A9XB 1QS0A 3P9ZA 4N6GA 1X7HA 3NBUA 4PQYA 4IX9A 3HHEA 3ZX4A 1D5CA 4HJRA 4WJZA 3LCJA 3RYTC 3ACDA 1AXRA 4TS9A 4TV9A 4DQ0A 4HZIA 4QBGB 1NI3A 3HA3A 5IVPA 3JYQA 2O8BB 3DV0B 3LF2A 4HPWA 1XNJA 4R40A 2RCNA 5D84A 1PDOA 3X1DA 3ZU2A 1KP3A 1O4VA 3EEFA 4DLUA 2WWWA 3FN4A 3EK2A 1DMRA 3KKEA 5LB2A 3W2EA 2I0FA 3RABA 3KPVA 4YRBA 1W1WA 4NH0A 3SHFA 1JAHA 2FEPA 2Q7OE 4WOJA 9MHTA 4YFVA 4WUVA 5AUNB 4PSUA 1MCZA 3IXMA 1J0EA 2XUGA 4MMXB 1T1SA 4A0QA 1EVYA 4AN1A 1W2WB 3DAGA 2ZRDA 4KE6A 2I3BA 1LQUA 1OXBB 4JOBA 3W78A 3CPEA 4X94A 3NIBA 2ZKLA 4WKCA 4RZSA 1Z15A 1U0TA 1ZVKA 5DE3A 2R62A 3AJAA 3V1LA 1DL5A 3W7VA 1T6XA 2AOTA 4E1AA 4ZCRA 3CLUC 2YWFA 5ADWA 5JCOC 5JY1A 1WQ4A 2WINI 3RU2A 4BECA 1IJKA 2WG2A 2OLEA 7REQA 4IV8A 2NSHA 1SUWA 2GVDC 4AL4A 1A7JA 5BOSA 4EGSA 1P45A 1HXHA 2OUKA 2ZWIA 2G67A 1IM2A 1K7CA 1A5BB 5K0BA 1TE2A 4GXTA 4WKNA 4HGNA 4EPVA 3E7XA 4DG9A 2NO0A 1QPZA 1GLGA 2GX6A 4ZOAA 1ZK4A 1WLYA 4M8SA 1XTRA 1Q0QA 2EW2A 3COVA 1L5WA 1WB4A 3ABOB 5CNIA 4CIDA 5BN3A 1H0HA 1A2OA 4OLFA 4PHFA 2IXAA 4L4YA 1UFRA 2EJUA 5CLJA 3HMKA 4UM9B 2IS2A 3FRIA 1M8KA 4U7JA 4ZVRA 1R74A 2XTNA 3R24A 4Q03A 4R0MA 1W34A 4LNHA 1LX6A 1HDEA 1ML3A 4QODA 1GGHA 5LVAA 2YVAA 3AESA 1M7HA 1NATA 3N7UA 1IDN1 3A6PC 1DBSA 3R0XA 4Q18A 3QU2A 3AR5A 1PKXA 5FI5A 3REQB 1U9CA 4TLMB 3R7FA 1OBFO 4HY3A 4N49A 4OP3A 2PL3A 4X20B 3M3DA 2AJ8A 2UZ1A 1PBNA 1T2AA 2CCGA 3AUYA 5LWQA 4RA6A 4YLYA 4LY9A 3ZI0A 1T8YA 4B3SB 3EH2A 1I3MA 1NPYA 3FSGD 2LV8A 4HFJA 5EPUA 5DM60 4UATA 2PMBA 1D2AA 4PZLA 1WTAA 2GO1A 4QHSA 1OZFA 2J6HA 3OLQA 4X9XA 5IX8A 2FMKA 4HX9A 4MPJA 1PRYA 2V7XA 5KYXA 1PI3A 3J7AC 3GNQA 1QP7A 1U5AA 2ZR9A 1QTNA 1H9BA 2J0UB 4UQLA 3IPLA 3QA3E 2W2NA 5K8UA 2PK3A 4K6HA 3V2UA 1F60A 4I6GA 2QSJA 3PHGA 5L3ZA 2R8YA 3JV7A 5BORA 4O4IA 4A26A 4WGGA 5EP1A 2AQ8A 3GEPA 4NPHA 1E1CB 1KMMA 1SCUA 1LTKA 1BD3A 1T0JB 2VHCA 3E27A 4NESA 4EVRA 4LE2A 4MITA 1GR1A 5TGTA 5LP1A 2RHMA 4O33A 4PPFA 1R8QA 2DUWA 5T6MA 3HCEA 4C6TA 3ZU3A 1R0XA 5I9LA 4NVRA 1XU4A 2X3YA 5GOZA 3H5NA 1O6BA 3I30X 3EPHA 4ZVNA 3QIAA 5BMVB 3EA0A 4C1BA 4E5SA 4I5EA 3UKJA 3V1TC 5JS8A 5HWSA 1GFZA 1DAKA 1GPMA 3MS2A 3FWYA 3NKFA 3SSMA 3P71T 5C7IO 3ZCVA 1DIBA 3DV2A 1E9SA 2IHBA 3AV3A 3HJHA 2W5UA 3MIIA 3BWDD 1RAFA 2VIIA 1BMFD 4P3YA 1VE3A 2M6LA 2H1SA 4MROA 5A9SB 2XQVA 4WY5A 2EZ4A 4TSFA 2C7OA 1G3QA 3IJEB 3B6JA 5JQGB 1FFGA 5KYWB 2JFBA 4PV7A 3QPDA 1V41E 2CHEA 4RPKA 4E32A 3RYCA 2G7ZA 5DCWA 5AVOA 4U9HS 4NRDA 3CLRC 2Q21A 4TTJA 1PLJA 1S2OA 4YIKA 2J0SA 3D7MA 1NASA 1Z2DA 1FJHA 5A3VA 1WCYA 2GRJA 3LLMA 1Y1PA 1BW9B 1SGWA 3DFZA 2A0YA 2JJMA 1XFDA 3R3HA 2IDZA 1VDMA 5JZSA 2F64A 3SEFA 4XUGB 4E2ZA 3AP3A 2G06A 4YBZA 2P6PA 1SUCA 2A84A 5JANA 3OIUA 2E21A 4WLVA 1L5GB 1P3Y1 4BQRA 1C7JA 5I7EA 1KDOA 3D64A 3S0JA 1Z5OA 1U90A 5H02A 4E5VA 3HB5X 5A71A 1GRVA 3E84A 3OZIA 1G7RA 3V1KA 1QO0D 5TDHA 1BHSA 5CLIA 4RHFA 1FUIA 2BBWA 3U4IA 3L18A 4IFEA 1MAVA 5DULA 3K1JA 1IBCA 4D0RA 5ILQA 1F0NA 4JB8A 3UQZA 2H85A 5AW4A 1B41A 1KNXA 1OXXK 3MTBA 1NU6A 1T5SA 5EUCA 4BX0A 1RADA 1MIOB 3P9YA 4MUMA 3N2ZB 4O3FA 1KYQA 4DR6B 3LBYA 3BSYA 4E7OA 5LQAA 1MW9X 3JQAB 4XWOA 2O07A 3M3HA 3A25A 2IYZA 2X40A 3NOXA 4Z4EA 4P4NA 1M1XB 4OQ4A 1E3TA 2RONA 3GX1A 2V6MA 1SXJB 1Y63A 5HR5A 3D3JA 1QIDA 1H5QA 1QG4A 3PIDA 4HDRB 5FLYA 3WA6A 1USVA 4AN0A 3I2JA 5FQNA 3U62A 3O21A 1AKTA 1P72A 1Z8HA 2ZRAA 4DNXA 3GMDA 3HCDA 4X8LA 1GNQA 2OO5A 2VUIB 3F6CA 4EB6A 3RNOA 4R8RA 4YEDA 2FSUA 3CR7A 1SIWA 1BN6A 2I62A 1HQDA 2N46A 2V65A 3A1WA 3H5WA 1DO0A 3LXRA 3W34A 3OZDA 3NTXA 4DJ5X 5CFZA 3H6GA 1IM8A 3COWA 3HYNA 1C9DB 4C4YA 2HRQA 2QORA 5TR9A 5A6SA 3TR6A 3FD8A 4Y8VA 2ODNA 1OFIA 3H2HA 1W94A 2IEDA 4TWJA 2NVUB 3WNZA 4LVUA 3ZY5A 4LJKA 4EYEA 1WP4A 3EIUA 1Q22A 3IULA 3K8YA 4DS3A 3H5TA 3AHJA 3NC0C 4HQ6A 2K6GA 4WMLA 1H8ED 2X6QA 4CMEA 1CE8A 1MB3A 1SBHA 5K3SA 5A04A 4Y6PA 3X1YA 1YHNA 1AURA 1G5FA 4C03A 1AV7A 3R7LA 2PUVA 4Q39A 1U6IA 3O1IC 4Q3DA 5A4IS 4CG2A 5K0GA 2VDRB 1XZEA 1RCTE 1Y8QA 3MS7A 1Z2OX 5FLEX 1E8DA 3EVBA 1Q0LA 1F8FA 5JUWA 3MWEB 2O2XA 3PUJA 5DXFA 2G1UA 3LFHA 3HB9A 5BV1A 2R6DA 5KTRA 3Q9SA 2QA5A 1M76A 4MUFA 2IX3A 1NKVA 4MS4B 5IM4F 3GLGE 4F0JA 1N32B 1MDFA 2V7WA 1X9GA 1W36C 3IAS6 3F78A 3LRTA 1YS9A 2EFHB 5ERYA 5AOCA 3GAZA 10MHA 1IPHA 2EYQA 3LM8A 1H0KA 3EH1A 1ZK3A 5U1PA 3SF8A 3ZWXA 1UMDB 5KVAA 4L0MA 1RHMA 4ZXFA 1IN1A 3QX9A 1WB5A 2CFTA 5JZBA 3C6MA 4K9RA 2Y2VA 1RLMA 4J16C 2EATA 3ZGNA 4XR4A 2PAFA 1XA4A 4C4TA 1BVHA 1EX9A 1WDKA 2B69A 4LF8B 3SSAA 4MHSA 2VJLA 1JAYA 3UJBA 3HQ4O 4YRGA 1RRKA 2FAXA 3SGLA 1E60A 2YMLA 1YB7A 3PLNA 3JQFA 3SJCA 5EKTA 3DEHA 1EXMA 2JW5A 2IVZA 3BSWA 3KL4A 2W2PA 3WJ7A 4TZKA 4D02A 4G0WA 2QGNA 5GADl 2ZIGA 13PKA 2NPOA 1RJFA 2AZ4A 5CPFA 5I7UA 4WJKB 3HBMA 2H51A 2I6GA 2V0CA 3R5SA 3U3KA 3VPHA 3FUWA 4EI8A 4ZDKA 1QLHA 1U81A 4Z9YA 1VYTA 3KXKA 5LKRA 4DV2B 3HCCA 1YRWA 5A4KA 5GGYA 5B6IA 1OQAA 3KWLA 4Q19A 4NC9A 2GEVA 2Q4TA 1LPSA 3OLCX 3OLZA 1NMYA 3K73O 3OPMA 5EAIA 1TI7A 2H2HA 3ID6C 4DQUA 1I7QB 1OH6A 3WP1B 5HKLA 1A4UA 2FMFA 2O8EA 1O57A 3N0WA 3R3UA 2YJGA 3UCXA 4OSEA 4HVTA 1A9OA 1XRQA 4J0HA 1E9EA 3TLCA 3GZNB 4O4LF 1ZYUA 1WV0A 2VZLA 1NVUQ 1SIBE 2HCRA 4R1LA 1SVIA 5CFRA 4E09A 4AVYA 1BMDA 5IPFA 3BICA 4FS3A 5B2FA 3NH6A 1U8CB 2KI5A 3MFQA 1Z0UA 4I2VA 4G4IA 4BLQA 2ADFA 1PBTA 1IU9A 3ZEAA 1OJLA 5H83A 3TNYA 1IY9A 4DC9A 1O7JA 3UXHA 4HN2A 4OHUA 4ECEA 4WBNB 2C9OA 2XVYA 3ZWBA 1L4FA 2ODWA 1CDOA 1PJ4A 4YAWA 3CM0A 5FP0A 4DKJA 3A0RB 2LUOA 1AK1A 1QE5A 2XZPA 1MC1A 2VUTA 3PCTA 1FUYB 4AMZA 1T9BA 3UQYS 4YUYA 4ZGWA 1MTOA 3QVTA 4YUWA 3C3YA 1NL3A 4WLNA 2B9VA 1QWOA 5EJAA 3WIOA 2CXSA 3FNFA 3GJ7A 3ORFA 5EQDA 4FJ1A 1DAOA 4MWGA 3OZTA 3WGOA 4ON9A 4IJ6A 4EY6A 4CMHA 4GOJA 1BQ3A 1J0AA 1YZQA 1LW6E 2Y8EA 3V1UA 2FRVA 4GKBA 1GKUB 4UTZA 1PR9A 2GFQA 3UUGA 4FNMA 2FF5A 4FFPA 2XHEA 2BGMA 1PG5A 3WRWA 3UK7A 3UWSA 3L1KA 3RVJA 3DULA 4RE5A 5K03A 3HS3A 3DEFA 4D3YA 2KS6A 1GM5A 2VXOA 3KWJA 3V6MA 3UV6A 5BW8A 3GJ0A 3ZWAA 1R6AA 1Y0BA 4NQRA 2QLFA 4EFMA 3GR6A 2IP1A 1P39A 4IUYA 3QITA 2Y1FA 3EA4A 3H9JA 2OGWA 2VPZA 4QBIA 1G8GA 3UEOA 2V1XA 4MA0A 2D3WA 4XSVA 1E5LA 2AI2A 2FXVA 4X1IA 2YQ4A 2FQ1A 5EQTA 1QOQB 1ZL0A 4HNAA 1JDZA 2HEGA 5CFOA 1N2JA 4TV8A 4FE3A 2FFAA 1HEYA 3RIGA 1SB8A 1KJ8A 2BGJA 1B42A 4P8RA 1AA6A 4AS1A 4XIYA 4F5YA 4IIEA 3VDMA 3NHMA 1QORA 5M5BA 3ULKA 4MZXA 1HYHA 3STUA 2VBFA 3QTLA 2G7MC 3OFND 1CJTC 2FGJA 4KHZA 3RADC 1UMBB 2F9MA 3A04A 3DCJA 2IHNA 3WGTA 2C0PA 2PX3A 2WAAA 3O82A 1KMQA 5EKDA 2MIIA 3PA8A 2JFUA 4KMOA 1E3WB 5GONB 2OV2A 3AP2A 1NJ2A 3NDJA 2I4MA 2QE7D 5G1PA 3H84A 5BR7A 2XGSA 2SBTA 3BRWA 1GRCA 3GU3A 4A92A 4DLNA 3A1SA 1KAEA 2OXEA 4JJ4A 3WVNA 3BHIA 1G18A 1NXPA 2I1QA 2IUFA 3TB6A 2YFKA 4EPWA 2VVTA 4MUEA 3KUDA 4IGEA 4NOLA 5TT1A 2HR1A 4P98A 3KRTA 2C0CA 2XADA 3L8YA 5AQEA 3HM9A 2VPTA 4GI3A 1JHAA 3E8MA 4IUBS 3RRJA 2WA2A 5BUZA 2AN4A 1NBWB 1PAUA 1R16A 2MHCA 1DCMA 3EDRA 5FL7A 1CIJA 4MVJE 1CR4A 2IS4A 3SC4A 2HC9A 1G3RA 2WSSD 5FWAA 5AHKA 3EF1A 1D2GA 4AY3A 1OFTA 2BC9A 5G3ZA 4DCOA 5J23A 3WRXA 1N0HA 2OQRA 3OOJA 3NUZA 2YZ7A 3ZHRA 2H4XA 2RHGB 1I1OA 3P19A 3FNRA 3IESA 2F43B 3GRFA 4MQEB 2BKLA 4YCDA 1JJVA 4U7PB 4ZXPA 5KAMA 1HDXA 3TW8A 4UD2A 1VA5A 1PV2A 4B76A 4CLEA 1ZN9A 1LPAB 5BP7A 1KVQA 3OJWA 4LF9B 1JKFA 4MQBA 2DLDA 2YASA 3ZI7A 1U0RA 2FN7A 5G0WA 4YGXB 4C2BA 1UQRA 4GZ3A 5E6SA 3OP1A 3AUJB 3D6TB 1DXYA 2Y1EA 3BCSA 3VHXB 1GKYA 2ST1A 4IRXA 5DASA 3OU6A 2P3SA 3RV3A 3GVHA 2W70A 2XCTB 1N1GA 4AJIA 1Q5PA 1ISRA 621PA 3ZDZB 5DIFA 2VTVA 2EF0A 2GJ4A 2Q2VA 3AXSA 4UUNA 4O4HB 4Z6KA 3B5IA 4NX2A 4Q5IA 5FI0B 3PZRA 2PBZA 3A28A 4HTFA 3UATA 1QDEA 3EEQA 3ISVA 1KJYA 4JC8A 4LX0A 4EI9A 3DBVO 3WAKA 1ODKA 3LPMA 1SQ0A 5I4BA 4BYMA 2C3OA 4UTNA 4ZA2A 1AGYA 1NQ5A 1EGHA 3KWMA 1PKEA 3Q5EA 4K0RA 1UEIA 4WK6A 2NX2A 1AGRA 5CW2A 4CU2A 4F84A 1LW7A 1Q21A 1CNEA 4OQMA 5EA2A 4DDUA 2HM7A 3D8TA 1NXXA 1VI5A 1GQRA 2PH5A 2QSUA 1E99A 2PWBA 3D5QA 3OM1A 4KFTA 3U19A 4QGSA 4O2AB 1J0DA 3K6JA 1YC2A 1AQUA 5I9IA 2P9FA 4MV3A 3FNGA 4REMA 2QZ9A 3UK6A 3ZXXA 1G5QA 1G41A 2LIVA 2WWRA 3PL1A 1U7UA 1W73A 1VHJA 1RLOA 2ATIA 2XAAA 1ZITA 4QSMA 5SY4A 5ALRA 3U7QB 2MMCA 1AMUA 3IP7A 4HNRA 1R9GA 1KJNA 2B8EA 2O19A 3FH0A 1N9GB 3AU8A 3KU1A 4KMMA 1MENA 2M6KA 4L6AA 1I94B 4YREA 1DIHA 5EJ8A 1BU8A 1NE2A 3KJQA 2WYIA 4FCWA 1IQPA 1BE8A 1F5SA 3DWIA 4N3NA 2EBHX 1UC4B 4I36A 4GKAA 5ERGB 2M32A 1NI4A 3MPOA 2LTAA 3O91A 2EL7A 2XQIA 2E4WA 5DSTA 5KIAA 1GOTA 2A9PA 1I2DA 5MN5A 5FBHA 3KE8A 3ISTA 3FYSA 4ZT7A 2QUZA 5JAZA 4PZ0A 5A5DA 5FI1B 1F2TA 1O77A 3N59A 1XDUA 1LPMA 3VSDA 4YMWA 1S0UA 3D4IA 5A7FA 3E23A 3BHNA 3ZV4A 1Y4SA 4MA5A 3IDQA 1QGED 4TTPA 4B6EA 1J5EB 2PDAA 4Q1EA 2CK3D 3TQFA 1LDEA 1MOPA 3BXXA 1KEZA 1ULSA 4QGAA 3UJCA 4BQSA 2C59A 1J8MF 5FXMA 1EBBA 1P18A 3KPWA 3WWDA 3U6KA 2JGFA 1K8QA 2IRWA 2B7LA 2YIDA 3WGYA 1CC1S 5HTKA 1BAPA 3BMNB 2X2EA 3DO6A 1QYIA 2ZBVA 3PK0A 4X41A 3IT2A 2AYZA 2GERA 2NQ8A 2YV4A 3C8MA 4LSZA 4N65A 3KQSA 4CKCA 6LDHA 4CTMA 3NBAA 2FPMA 4N12A 3DEIA 5LOVA 3D8BA 3TQOA 1UIRA 2BTQA 2UYGA 1PCXA 2NO9A 3E3MA 1AHNA 3IVXA 4RK5A 1N6KA 1TJ5A 2QLJA 4YJFB 1KI2A 3SXUA 4YP9A 2GN0A 3P9QA 4ZEXA 4BJ5A 5B30A 5C7YA 5FUXA 4I9UA 3AM3A 3UAWA 4XYMA 4RL4A 5GJCA 1FC0A 3UUWA 1KR5A 4W63A 1H3FA 3JQAD 3P20A 1OPXA 1H22A 3LC1O 2CJYA 4XE5A 4BWVA 1SXJD 3R0VA 4FWIB 1ZJWA 3P9NA 4N0MA 2Q1XA 4AIIA 3ZW9A 4TZTA 1B4DA 2QJOA 2Z9BA 1Z6AA 4MAFA 4CT0A 2JFQA 5CB4A 4QYIB 3LOPA 1TZKA 1HYBA 4ZQIA 3S2EA 2BE9A 1WZEA 2VQ6A 1KY3A 3EGDA 3D0OA 4HBZA 4W6QA 1OR8A 4C3OB 2ILTA 3O2JA 2DLNA 4PGAA 5G40A 1MABB 1UK8A 5EP3A 5K0CA 2DAPA 3M1YA 1ICIA 2C98A 5IVKA 3QLTA 2EC5A 4NP6A 1U3FA 5JTUA 1U7HA 1W1IA 4L7QA 4PGHA 4ZV9A 3ZCRA 9LDTA 4J03A 1LTQA 2FP4A 2YWXA 4UFNA 1NHGA 2BM9A 4Z53A 1Q74A 2EF1A 3CF4G 4NOJA 4MIOA 5G0TA 1E5XA 3FOZA 3N8NA 3ILYA 1O08A 4MVJI 1ZIYA 1NQAO 1CUWA 3L02A 2I9KA 2PJUA 3PQ6A 2NSDA 2AN9A 1YB6A 3R3XA 3K4HA 3V7FA 5K4AA 1M2OB 4RELA 2G40A 1PK8A 3PF8A 4RVDA 1OV4A 2AE2A 2VQDA 2XX3A 1NU8A 3FOEC 2HLDD 4P3KA 3UMJA 1CUUA 5FUYA 2Q5EA 1I6LA 4WOBA 1JFSA 3GUHA 1NNUA 1IL0A 2GF9A 2P4EA 1EDBA 1JLLB 1E7WA 3A6KA 3THXA 1GQ2A 1U7WA 2IV3A 2HNKA 1SOMA 3UUFA 2HQSA 1TRKA 2PPLA 4AK9A 3I52A 1C7FA 4E7PA 2IZ5A 4V0OA 4QUAA 2I65A 4PSKA 1IWBB 1HETA 4CZ2A 3ITEA 3PZBA 3VR3A 2FMXA 3B9RA 1CZLA 2H11A 3O8OB 1DG3A 3LUKA 2Q49A 4GPZA 2NQ2C 2QUJA 5FOQA 3KZCA 4I9NA 3PHLA 3GQBA 3IIMA 1F1BA 2N0SA 3ND6A 1XVTA 4MWCA 2DETA 2QLNA 1P8JA 3CUTA 3B1XA 5LIRA 1D7AA 1GT6A 1NMQA 4LC0A 2GLXA 1W5AA 3TD9A 1FBTA 1JBQA 1WZIA 2INGX 2J85A 2XWBF 3BE8A 4FZRA 1YNOA 1E9CA 4LZZA 4PF1A 4CF3A 5AI9A 3O73A 4EUEA 3OZVA 5AXAA 2CSXA 3MNFA 1YQWA 2BEWB 1H4QA 4BVJA 2NO5A 4MUKA 3CS3A 3OQOA 1YFLA 4KTVE 3RVLA 1KARA 1QQTA 2K4MA 1GZ3A 4HDQB 5ALGA 1FSGA 4HLCA 5GZ6A 5JSZA 2XD4A 2DQ4A 3H2IA 5FO1A 4JFRA 2A5DA 4E51A 3T6KA 1UBTS 2XUOA 4F96A 2A9KA 4RPGA 3WK9A 1C5KA 3FYUB 1B1AA 2GEFA 3NS7A 1Y6QA 2HA3A 3EEIA 2QRMA 1TM5E 3GT3A 1N5JA 1NYQA 5CPBA 5T4EA 2WY2D 1URPA 3SSOA 4C0SA 3K70C 3OWOA 3PQ8A 4Y67A 4DNPA 1P1RA 2E3JA 1MJGM 1P5RA 2GT1A 3PV0A 3SC2A 1I7SB 4ZPXA 2XEXA 4RM3A 4Z3KA 2GAIA 2LNDA 3SQWA 5ESRA 4I1IA 1EXWA 3OKFA 1EFVB 3DBRA 3VO1A 5HZGA 1Q0SA 2FJPA 3TZQA 3MUOA 5EHIA 4AKGA 3PWSA 5KUTA 4I55F 1Y6FA 2F7SA 3A6GA 4UHKA 1CJUC 4YDSA 4Q4CA 3SJZA 4X71A 3BJEA 3P9PA 1E6MA 1EI9A 4LQCA 5LP6B 2AXEA 2CKDA 2ZRMA 4RK7A 2XNKA 2DX7A 3H3FA 2CUNA 4HUQB 4S24A 1JAZA 5T4HA 4NZMA 2ISQA 4BJHB 3STXA 1ZRMA 4ZTZB 4X6LA 1H6AA 4IHJB 4MVYA 1U2PA 4IXDA 1F6BA 1GEGA 3IPRA 5HDBB 2HDNB 2KSQA 4G4GA 1FE8A 1NE7A 3BX1A 3HNPA 3AEXA 4FOOA 5GMOA 1COZA 1PR6A 4UPEA 2HPVA 4AY4A 1XZMA 1NV8A 4Q7MB 4WERA 2XKAA 1T1RA 3RSQA 4BNTA 5I45A 5HP4A 5J2UB 3RUAA 4BP1A 1H1LB 2E5LB 1Z6PA 2C61A 1ZUNB 3UAZA 4ZTUB 1L3IA 5FUQA 4UDXX 1D2MA 3UJ9A 4ITRC 3P94A 5TGZA 4JJ8A 4ZRNA 3RKSA 3SX2A 3ZQJA 2I67A 4RZQA 3RROA 2VDVE 3WKCA 1TW3A 2VTBA 2PSFA 2R0QC 1JFTA 1T1JA 1U2GC 2B4RO 5AVXA 2AZDA 4I4TB 3FYHA 1ZVJA 2ZIXA 4L85A 1Q0PA 1J0CA 2H07A 2HN9A 4BE7B 5FX2A 4LZPA 1EFUA 4B46A 4OA5A 1NXWA 5HE9A 2Y2UA 4OMUA 1DEAA 1TTQB 3GDGA 3MTJA 1M5RA 5AM2A 3C7AA 4DEYA 1YR8A 4OKIA 1FVOA 2VA9A 6REQB 4RVFA 2COEA 3ZUPA 1BYIA 1U0HC 3L4JA 4UEWA 2R60A 1ITZA 3DDWA 3U3OA 1GQOA 1AIPA 1UBOS 4ADSG 4A2WA 4R0VA 4MI9A 2I4LA 1ECPA 4EFNA 2UXCB 4M53A 3JVEA 2O2SA 5IBRA 3P2IA 3TZKA 1IEXA 2FUNB 1HDZA 1L4EA 1ZR4A 5JG7A 1B3BA 3DTVB 2C2KA 1FMTA 2QNRA 1T9ZA 2ZYTX 3R5XA 3IBCA 4NABA 1T35A 5K8LA 1X86B 5HW0A 1WXWA 2EQAA 1KYVA 2JK0A 4BP3A 2LD4A 4G07A 4KN8A 4ZARA 2O20A 1ZM2A 5CFNA 2CNBA 1WABA 1WUYA 1FDWA 1M0WA 4K2AA 4YMLA 1BE1A 2ZB3A 4MUGA 3FHLA 3QI7A 4A8JC 3VPAA 4U6NA 3W5HA 5K0ZA 2ZUVA 1DT5A 3I01M 4JOCA 5EXDA 1KSGA 5K4HA 2Z6UA 1AKRA 2QX8A 4UUPA 1T5BA 4R8SA 4DLBA 3K9FC 3O3NB 3REOA 3G2PA 3QKRB 4ZI7B 4FT2A 2VFAA 4CIWA 1FX0B 4EW2A 2EQBA 4F4JA 5IYZF 3RC7A 1GG2A 2QRZA 3EQZA 5CA1F 2FCAA 2R96A 3G0DA 4MYTA 2WIDA 1E4VA 3DMFA 3N5CA 4HRXA 4WN3A 1T4CA 1L4MA 3B38A 3B2QA 2Q3LA 3FYDA 1AQJA 5BN4B 5C81A 3N28A 4B45A 1MB4A 4OO3A 1SUDA 2E5WA 3E9CA 4XD7A 5ALQA 1BROA 2H1OA 1Y8CA 1NXSA 4ND3A 1JG4A 3DVSX 5F3WB 2DGDA 1QQBA 1H23A 3D6NB 4XVUA 4HB0A 4UREA 5JWOA 3GLGB 1G8PA 4B7CA 3CUYA 1UDAA 2A0UA 2B35A 4KR3A 2O23A 3GARA 3TLBA 2EIHA 4YAGA 1ZCJA 3OZWA 5F98A 2NV6A 1X7ZB 3ETDA 2B5VA 3VGPA 1LA2A 3JQBA 1QO9A 1O3YA 1TUEA 3W0LB 1LI4A 4M0MA 1DEHA 1WEHA 2BFBB 4MGKR 4DCVA 2P4HX 1EVQA 1CRPA 4M76B 1B93A 2A35A 2J31A 2YY5A 3BXGA 4X91A 3VSAA 3FZGA 7GPBA 5KJCA 4NE9A 4FDMA 4EG8A 2PVCA 5AVUA 1PLLA 2HA6A 4CL3A 2HQOA 4CTJA 3KTAA 1NQUA 1ZU5A 1KEEB 2Z1NA 1W9MA 1M7GA 1CZNA 4I8DA 4UFPA 4R69A 2WU0A 1UBCA 5JNSA 4Z3DA 4NU5A 3BIFA 3NHPA 1MAAA 1OX4B 2CKMA 2J9GA 2O2EA 3H5OA 2IYRA 4F91B 3TVYA 4RXUA 1KK1A 2Z8YA 3GMTA 3LOUA 4NZYA 4Y6LA 2VJKA 1P62B 4AX8A 3EPJA 3N6VA 2Y0CA 1Z5PA 2XDQA 3P0FA 5J9FA 1SVKA 5K6AC 1TIBA 1QCDA 2QW8A 3OUUA 4BNWA 3EUAA 2M9MA 2EZ8A 1EEHA 1ORVA 3JRWA 3OG9A 1IWOA 5TT0A 1XMVA 4HSGA 1AE1A 1M1NA 2XVAA 4P36A 4RJ2A 3LYAA 4YUVA 4P80A 1Y5LA 2XZTA 2YS7A 2XYRA 4XDYA 1QIMA 1O6FA 2OBXA 1ORDA 1CJSA 3C3DA 4GYJA 3WL4A 5K09A 1MT0A 2PRYA 3GNSA 3BJZA 3OQPA 2ATEA 4QGBA 4P0PB 2M1ZA 1ZD3A 1YV9A 3PWKA 2F67A 2JGIA 1O9GA 3E0QA 3HKBB 1DDOA 4G0XA 1KIFA 5E6RA 4ZDWA 1M0EA 1SQFA