3LWNA

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
181
structure length
181
Chain Sequence
SAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/rhoa-binding protein
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lwnA00
1K6MA 1E2LA 3GJ6A 2Q3FA 4KSCA 1MRSA 4F4IA 2J7KA 3E70C 1R6BX 4BQSA 2QPOA 2ORIA 4P4UA 1U2RA 1GRQA 4LV8B 4NONA 1JR3D 3C5CA 3KXKA 1WBDA 5FL3A 1NP6A 5A0FA 3MAAC 1BKDR 4TTQA 5DO9A 3BE4A 1FQKA 2IUTA 1KI7A 1OW3B 2NOAA 2ODBA 3IO3A 4ZO4A 1XPUA 3B2EA 1II8B 4XOIA 4JVSB 1YU9A 3GQBA 4Q7JB 3U3OA 4BLPA 1E9DA 4EPXA 3QY0A 3U3MA 3TIFA 2PMDA 2XOKA 2ZSFA 3CWQA 1Q21A 2ZJAA 2GWHA 4LC0A 4Q4HB 1EXMA 2Y8EA 3ZIAD 2O8BA 2EYQA 2ZYTX 1KK1A 3CF6R 2GJ9A 3UG6A 3BXZA 1VCNA 4HEJA 4EFNA 3X1XA 1RFLA 3EZ9A 4HLUA 3A1WA 5FTLA 3THYA 2W6JD 1Z06A 5G40A 1E0JA 2ZR0A 2IS6A 1FX0A 2IEZA 4Q9JA 5C4MA 1UDXA 2CBZA 4BECA 4DLVA 2W2XA 3CR8A 4Q1CA 4R9UC 3BK7A 5EP3A 5J4KA 1XEWX 4A0GA 3SNHA 1SXJC 2OESA 3W9YA 2JJ2A 3VX4A 3H2YA 2G9NA 2BMDA 3D7MA 4QJ5A 4AC9A 3PUVA 3GLFE 3GLHE 2W58A 3SEAA 1B0UA 4V0NA 1LNZA 2ZSEA 4IDQA 3LA6A 3FHTA 1KI3A 4LC1A 2VHCA 4MQBA 1QG2A 5J40A 3UKDA 4M0LA 2VO1A 2QRZA 3I72A 1VYVA 1Z5ZA 4B73A 1G3QA 2C9CA 3QKSB 4EUNA 1BOFA 3O8CA 1P73A 1X1SA 4ZIRB 4WVFA 1XPOA 2A5GA 5C18A 2XZOA 4FXPA 1F60A 1P2UA 4JYBA 1XPRA 3NBXX 1VDZA 5TY0A 3ICQB 2H7VA 4I1UA 2C99A 3CUEF 4NYJR 2BC9A 2AK2A 1PJRA 3PITA 4NZYA 4B2LA 4TT3D 1AKEA 2IHYA 3RS2A 3B1YA 2J46A 3KJEA 5DH9A 3UPUA 2IXGA 2FFHA 2YNMA 3GFOA 3ZZUA 3ASZA 1E0SA 4M9QA 2BJWA 1P4SA 2C03A 3NH9A 4C7OA 4A92A 4C9BA 4EJSA 5DSZA 1A5TA 1YR9A 4L8GA 4EPRA 3Q8XB 1CULC 5FPSA 3QBTA 2AK3A 2QA5A 4JL8A 5FBQB 4MUBA 4HB0A 2WMNB 3R9WA 4IEIA 2BV3A 3ZH9B 2YJTD 4OI2A 4FCWA 4TYQA 4TMWA 4ESHA 3LRPA 2IYYA 4XTRA 5K8LA 4Q1EA 2GESA 2JATA 4KFSA 4Q7LA 5FOWA 1QZXA 3AF1A 1ZM3A 1XU4A 5DHAA 1YJ5A 4FMCB 1GKIA 2WHXA 1NL3A 4NCJA 2MSDB 8OHMA 5DE3A 5KO2A 3GLGB 4HDOB 3QXXA 1VIAA 4M9XA 3BAFA 3B78A 1NMZA 1YZKA 3PEUA 3WP1B 3TBKA 2P0EA 1KDRA 4B3CA 1Z83A 3H86A 1IXSB 3WYAA 4ZDKA 5FBVB 2NO6A 3S1AB 3W90A 2WIAA 3AP2A 4QBIA 3RDPA 4D6PA 4HAUA 4WZ6A 1COWD 1ZUNB 1S1MA 4CEJB 5TXGA 1U99A 4QOSA 3I8SA 5E7IA 4RJLA 3HYRA 3DZ8A 2QL6A 2WWWA 4P33A 3VR5A 1FW6A 4BFWA 2JA1A 4DLYA 2WV9A 1NRJB 4JVNA 2IWRA 1W44A 4DVGA 2N42A 3UMRA 4MYCA 1YVDA 4NU0A 1OH8A 4C2TA 3HJNA 3T1VA 1A4RA 1Q22A 1Z28A 4NP6A 1ZD8A 1CLUA 2NPIA 3K0AB 3TQFA 1HY3A 1VKJA 2ZAMA 3U6BA 4AKIA 5G3YA 2JIZD 5SZKB 4C2UA 3C5HA 3B1XA 4D0GA 3SI7A 1OH6A 2QPTA 1S3GA 5P21A 2ZRMA 1W7AA 1G5RA 2V1UA 2JLWA 5B57C 5H1YA 2IYSA 4GOJA 3CR7A 3RRYA 2QP3A 3Q7QA 4PPQA 3JVUA 2RGEA 2XNDD 1OHHA 1E1RA 2SHKA 4MGZR 4AWXA 2AX4A 3JZMA 5HKKA 1G16A 4MYHA 4WBSA 2BCJQ 5JWHA 2VHTA 3T5DA 4ESVA 2D3WA 3VKGA 1ZW6A 5IF9A 4WIAA 1OPXA 1T8UA 2YOGA 4BUJA 3OFNA 4DDUA 4PPFA 4MRPA 4DKXA 1KSJA 3V4RA 3R20A 3IBGA 2FSIA 4RZ2A 1P7CA 3JZAA 2GJSA 1E2PA 3ZZTA 4CRWB 3T1OA 3X2SA 1G5PA 2R6DA 3UWKA 2AD1A 1N6OA 5DI3A 1QHIA 4ABYA 4A2WA 4AYTA 3KQUA 1EFRD 1WP9A 2F43A 3RWOA 4WXRA 4PHFA 2C98A 2ERXA 2L0XA 3DKPA 1RPZA 5CYPA 4IFEA 3PUXA 1RYFA 3FMFA 1W5SA 1E1QD 2ATXA 2FPLA 3T61A 5CITA 4X8HA 5J47A 1OFIA 2JLYA 1J99A 3Q3JB 4KBFA 1Q1ZA 4DCNA 1OFHA 2VQSA 1PUJA 3LBHA 1G4UR 1CIPA 1N25A 2GXSA 3FKQA 4R71A 2WSSA 3BB4A 1DO0A 3FVQA 4KVAA 2RGDA 2PEYA 3PIRA 4MYTA 4PC1A 3VU9B 4DUGD 3ICEA 1WCV1 1Z0AA 3I1FA 4IOKA 1ZNYA 4Q66C 3NBYC 4V0LA 3B85A 2RGCA 4LBVA 3QF7A 3IILA 3RYTC 4KYIB 4Q4AB 2ZJYA 1MRNA 1LS6A 3BB3A 4KXFB 3K9GA 1AQUA 4OQLA 3PR1A 4QBHA 4XD7D 2FV8A 2XTNA 4H1UA 3SBEA 3VR1A 4ZI3A 4DT1B 4ZKDA 2R8RA 3EX7C 5JMTA 1AZSC 3CNLA 2WWHA 3NEYA 1G3RA 4FWIB 1BS1A 2D2EA 4XWKA 4AKGA 1RJ9B 1AIPA 1O87A 1KY3A 3LV8A 3LVQE 3MCAA 3CF0A 1VIYA 3SFZA 5J4YA 2IW3A 1FUKA 1UKYA 5KHOC 3KJIA 2QAJA 4JBXA 3LLUA 1Q1QA 4OK3A 3TVDA 3GLIB 1G7CA 4NKRA 1ZUIA 1ZM9A 2RHMA 1XTQA 1V43A 2A3RA 3K09A 4POAA 2ANCA 4XSGA 2WBLC 1FTNA 2FFAA 2Q9AA 1X3SA 3BERA 3U3JA 4F4JA 3GJ0A 4DCSA 1IN6A 2OO7A 2EW1A 2ZI9A 4RKEA 1RKBA 3FB4A 2PH1A 3QVUA 4OQXA 4UKDA 3SQXA 3EW9A 1S4QA 1YKSA 5FUYA 3TQCA 4PAQA 4ZIRA 3HPRA 1C1YA 4ERNA 3R7WB 3SJBA 3A1TA 1EX6A 2NZJA 4DBLC 2WJYA 5KNCA 2F1HA 3BFKA 1GDDA 3QIAA 3EARA 4URXR 2VHJA 3GEIA 5AUNB 3W5JA 3VAAA 4NYIQ 4BWYA 3R9IA 3CX8A 4HZIA 4TLCA 5CB8A 3KJGA 3HP1A 3LX8A 3RSLA 5JWRA 4OL0A 3C4JA 1RVDA 3TNFA 3P32A 4FD2A 2ZRJA 4LYHA 5CLLA 1SVWA 1OYYA 4RKFA 1S96A 3BH6A 1SKYB 4DSUA 4Z8XA 1KO4A 4U7DA 5FFMA 4IOJA 4M1YA 2E87A 2ZJBA 1KK0A 3EIHA 1W4BA 3H1TA 4TQ9A 2J0UB 3HU1A 1US8B 3U61B 4NE2A 4NYIR 2AN9A 721PA 2DWOA 4WOPA 2BMJA 1QBKC 1J8YF 1U9IC 1W46A 4PO8A 3Q72A 3C15C 3AKCA 1G8GA 1W0JA 4K46A 1ZM7A 4JSTA 4OQFA 2BBOA 4BFSA 1FUUA 2I1VB 1SQ5A 2ZU6A 4B43A 1LFDB 2DPXA 2P6NA 5KSYA 2F9LA 2FPKA 4GMXA 3B9PA 3GLGA 4OHYA 1DAMA 1TQ2A 1SVSA 1WMSA 4UNRA 2D74A 2C95A 1SVMA 1WF3A 2WPDA 2GA8A 4KODA 2QY9A 1W36D 2YWFA 2PCLA 3V4FA 2OV2A 2ZRNA 4B48A 1SXJE 4BEJA 5F9FA 4CEJA 2QUZA 1OXTA 4BZQA 2RB4A 1MABB 3GFTA 1CR1A 4A6XA 4QGFA 1OXVA 2BHRA 2GZDA 3B5JA 1SVIA 1YHNA 2ZETA 2DFNA 4RFSB 2OT3B 3T06B 4C0BA 4L9SA 4JLBA 5DISB 3BD9A 2VSFA 2RGBA 1ZNXA 2XEXA 3QXHA 4Q4LA 3FFAA 3OE7A 2OCYC 1U8AA 4O25A 4PZZA 2FG5A 4KITB 2IYTA 2XX3A 1IY1A 2CJWB 2Z4RA 4QXAA 3CB4A 2OLJA 4GOKA 1E79A 4FI3C 2QQ0A 3CRW1 2G1KA 1XJQA 2HCJB 4W5HA 4LRWA 4EKDA 3UIEA 1Z47A 2QROA 1GIAA 2CK3A 3BFXA 3AM1A 4L16A 1J7KA 1CS4C 2BVNA 2FNAA 1CJMA 2ODNA 3C16C 5JZVA 3CO5A 4DDVA 1QG4A 4QGHA 4UNQA 4O2LA 4LYJA 2WJHA 5AJZA 1TAGA 2B8WA 3WRXC 2XZLA 3RHFA 3FKSA 4RZ3A 2LKDA 1XD8A 2DWQA 1AZTA 1TU4A 1R8SA 1K5DA 2GZHA 4UXIA 3SHWA 3LFUA 1EFHA 2X2FA 5DYGA 5IHPA 1KI1A 4A2QA 5BYKA 1KI9A 4DSTA 2EYUA 2G77B 1UEIA 3OHMA 3CWZA 4TL9A 5BN5A 5KNBA 4FWTA 4XVRA 2OBLA 3BB1A 2RKOA 2GJKA 3H4MA 4MRNA 3U7HB 3SQWA 2ZI7A 1YQTA 3G5UA 4G5SA 5KSPA 2PT5A 4PR0A 2PX3A 1KZGB 3SJZA 5GADl 4A2PA 4Q1BA 5FH9A 4BFVA 1SXJD 1Q1BA 4I1SA 3U6KA 4XIGS 4YONB 5JWOA 1G4AE 5KSOA 1XEFA 3FYHA 2EFEB 2O8BB 1I4DD 4JBWA 5FL7D 1DPFA 3EIEA 2XGJA 4Q48A 2NG1A 3BWDD 4A0FA 2NMVA 1XD9A 3EZ2A 3GJXC 4RSGA 3NIBA 2MMCA 4IVPA 2QTVB 3MWLA 2JLZA 4GL2A 3UATA 1SHZA 2GEDA 3KUCA 4KV9A 3RS5A 3THYB 2W6ID 4IDPA 3CPEA 1JB1A 2IYZA 1FX0B 2HLDD 2IYQA 1JQLB 2ORWA 2ZROA 5CJ2A 1T91A 5FTKA 2GTPA 2D7DA 2V8OA 2TMKA 2HF8A 3B82A 1M7GA 3QJYA 3RSOA 2GCNA 1XEWY 2XAUA 3PUWA 4D4LA 5BN4A 2NPFA 2ORVA 1RJ9A 4QJ3A 4XH9B 1NY5A 2UZ3A 4BLSA 3NTUA 1G6HA 2ZI4A 4Q21A 2WZQA 1TUIA 1E9EA 1P2SA 2QPAA 2ZRAA 3KJHA 3MRSA 4IDOA 4UXHA 3GLIA 2IEYA 1H8HA 2JLSA 3SZRA 1X8JA 4UNSA 2CCJA 3THOA 3BOSA 5CB6A 4GDFA 2ZRIA 1JAHA 1KMQA 1Q20A 2CL7X 3KKNA 4TMXA 2QRNA 5AJYA 4DSOA 1XTKA 5CIQA 4AURA 3QI2A 4KYUA 4URUR 1ZRHA 3HR8A 2QI9C 2YINC 4TT3A 1AGRA 1U0HC 3ASYA 2VHQA 2CHQA 2QNRA 1NG9A 3TR0A 1NKTA 4NH0A 2BIFA 4MDEA 1S1CA 1KDTA 3RLFA 4P4SB 2DWPA 3DVLA 4HB4A 4OKSA 1TL7C 1G64A 3P4YA 3GFPA 1A82A 3PEWA 3FMIA 2F6RA 4IEEA 5JHHB 4C7OB 2FZLA 1I4LD 4W7SA 1JXOA 4TL6A 5JSZA 3X1WA 1S9DA 2B7CA 4D81A 2V4ZA 3F8TA 4LPKA 3ND8A 4NTZA 4KU4A 5KDDA 4JYCA 1R0WA 2CE7A 3MMPA 3MWYW 2ATVA 4Z51A 4M1WA 5M04A 3PCRB 2GDJA 2J0QA 3AGQA 2QZ4A 1Z29A 4YDSA 4HLUC 3IIKA 4M9SA 2J0UA 1P2VA 3C14C 1Z0IA 1COWA 1OIXA 1CRQA 2AD5A 5B30A 1WE2A 1E2QA 1JBKA 3NWJA 2ZRDA 1F2UB 1KDPA 3M0EA 1DADA 2REBA 1F2TB 1KY2A 2CNWD 3OEED 2PBRA 4GZLA 5B64A 4LBZA 3L0IB 5GJVC 2VA8A 1E2HA 1G6OA 4IRUB 3LNCA 5JS7A 4YC7A 4DLXA 1IXRC 4Q7KA 3TK1A 2IHBA 4XVQA 1SVKA 4Q01A 4ZKEA 3B60A 3TE6A 1AA9A 3SU8A 2ONJA 1G8HA 1MABA 1NJFA 5GJWC 1K5GA 4HAXA 3CPJB 2JJ1D 3QNUA 2XXAB 5DIFA 5FI0B 3W34A 1UEJA 2PCJA 1GL9B 4G5QA 4LBWA 5CK4A 4QBGB 4NCKA 4LYAA 1G1MA 1AS3A 5JBQA 1FFHA 2REXB 4QKQA 4D2IA 4DB4A 1NF3A 1OIVA 4HDQB 4IDHA 2KBFA 1Z6XA 1HH4A 2J45A 4B76A 2C8VA 2RGAA 1MO6A 4YMVA 3ZVRA 4WA7A 4DCTA 4EJSC 2FFBA 521PA 3P1JA 1Z6TA 4AI6A 2A5JA 1JNYA 3B1VA 3OIYA 1ZVQA 1I4TD 1DAEA 2FE4A 1R5OA 1XJCA 1KDOA 3IHLA 1R5BA 2CE2X 3BIFA 4U02A 1EFRA 1ZP6A 5SZIA 4C0JA 2C77A 2HUPA 1XCMA 2IS1A 2H57A 1UM8A 1GL7A 2AWOA 3QPUA 1NNEA 2J1LA 4A0RA 4JVMA 3GEEA 1SHKA 5DI3B 1VYUA 1TQ6A 2FX3A 2VYFA 1ZCAA 3T12A 2IYVA 2VTKA 3QEJA 4PXAA 2QGNA 1XMVA 2R9VA 1E2KA 2F43B 4QGAA 1OKKD 3K0EA 3OEHA 1E3MA 4TN1A 1OIWA 3ONWA 1G291 3CH5A 4U00A 2BKUA 3GCGA 3L43A 1ESMA 1AS0A 1W2GA 3OZXA 1JECA 1P6XA 5FPHA 3VNUA 2IC5A 2CCGA 2O8FB 1U8ZA 1R8QA 3LXRA 2C9YA 3I8XA 2BEJA 4OBEA 5C4GB 1D2MA 4HUQB 5C2JB 4B71A 3FDIA 3K0CA 3BC1A 5JCPA 5D3MA 1Z07A 6Q21A 1R0XA 1X8LA 1GG2A 4ON9A 4XD7A 4A36A 3FOZA 3L0SA 4LY6A 4PC7A 1U90A 2QM7A 2AL7A 4XTCS 1A7JA 1DAGA 3U2QA 2QTFA 3KKQA 1KI8A 3U3KA 2QP9X 1ANKA 3VHXA 2GXAA 3M6AA 4CEIA 1XXHB 1E4VA 3EA0A 1MOZA 3LLMA 1DG1G 2VHUA 3NHAA 4FMDF 1G41A 1ZAKA 5E4FA 1GFIA 2E9SA 3AVQA 2W00A 3QXSA 2EU8A 3P27A 1RC8A 4TL7A 1ONBA 2HYDA 3MSXA 4Z1MA 4G1UC 4ASUA 4HUTA 2GEUA 3NDPA 1GSIA 1OXUA 3VFDA 1P60A 2G0TA 4TSFD 4TLAA 3DEFA 4OHXA 1QHNA 3IBYA 2ZVQX 2PX0A 1DO2A 1ZC4A 2D4HA 3KDSE 2OEPA 4K81B 2IXFA 5DI9A 2IK8A 3KKPA 1KIMA 1VCIA 5E95A 1SKQA 1P75A 4X8MA 3O8DA 4J0QA 3I32A 2O0JA 2OLKA 2ZTSA 4Q1AA 5SZJA 2D2FA 1LF5A 3TR5A 2I1QA 2K5UA 2A7QA 2WSMA 5TMPA 2ZUBA 4PHTA 1OJLA 1SKYE 1CR2A 2EFGA 2QM8A 1NLYA 3P20A 1YE8A 1OV4A 2E1RA 1MV5A 2Z0MA 2ZRGA 2QGZA 1W4CA 3CRRA 5JRZA 1W47A 3ZLJA 4TYPA 1E98A 2IUSA 4URZR 5BW8A 1OB5A 1UBCA 2JLQA 2WWGA 4KSBA 4G5OA 4P4SA 2JLRA 3VQTA 2VF8A 2R62A 4TMZA 2YZ2A 1RRGA 4MGYR 4OI1A 2PEZA 4QFMA 4EIWA 4Q02A 3DKVA 4BE7B 1RRPA 3SR0A 4BLOA 2XB2A 3LDAA 3ZVMA 4BPBA 1TU3A 1E2DA 4TTPA 3IQXA 4Q7MB 2O8DA 4B3XA 4NHOA 5KPDA 4IW3B 1DELA 4DIDA 3ZJYA 4LSGA 2NZ8A 5KDLA 1JALA 2G0NA 4LZZA 4PTLA 4KLZA 2ZUDA 3HYTA 5FR1A 1VHTA 2IF2A 3KX2A 1E2IA 4Q19A 5GJCA 1E6CA 3SHFA 2FEOA 4IXNA 4B6FA 4US0R 1LW7A 1EG7A 5L3SA 3I92A 2PLRA 3D8BA 3LWNA 3N2IA 4HAVA 4LI0A 3VTKA 2V55B 2YC4C 1OH7A 5FOTA 2XTMA 3AGPA 3DO6A 4UNNA 2MMGA 3K9HA 4ARZA 2CHVA 3PJRA 2VP2A 1G8FA 2I4IA 2EQBA 3V9PA 1D2NA 1F2UA 1NN1A 3A36A 3K09C 4QM6A 4LOAA 2QE7A 1F2TA 1P9NA 2BBWA 4NCNA 5JJIA 1JPNA 2YC2C 1TNDA 2ERYA 4LHWA 1VCMA 1KK2A 1E9SA 3QKRA 2KSQA 4QHYA 5EZ6B 3EPLA 4TL8A 3QG1A 1N2CE 1ZIPA 2O0KA 4DEXA 1KI6B 4D25A 2NO1A 2J41A 1FPMA 2OBMA 3DHWC 3RWMB 1CF4A 2ZITA 1LS1A 2UVQA 1L8QA 4WZAE 2YOFA 2AKAB 2A2ZA 2V6IA 5EXPA 2GJAA 2IF0A 2XXAA 2XJ4A 2JDID 2R2AA 1Q44A 2HCBA 3CIOA 3IIJA 1E2MA 4YMWA 3A37A 1NMXA 3GJ7A 1GKYA 3N5CA 4AIIA 2OUKA 3N70A 1NIJA 3B9QA 1GTVA 2PT7A 5CYOA 4ZV4A 1MO5A 5FBWB 1DAKA 4JJKA 2KWIA 4JKIA 2DFTA 5F9HA 1E96A 3W6OA 3A58B 2QN6A 1Z0DA 3QKUA 1JJ7A 4DXAA 1HT1E 2BBTA 2GEVA 4ZDIA 1CP2A 4ZCMA 5DN6D 3O8RA 1Z08A 2QENA 3QUSA 5AWFC 4C0QC 2YWHA 4KO8A 4BLQA 2VL7A 1TF2A 1XJ0A 4YDHB 1IY0A 4A8JA 1VG9B 4H9GA 2ZYVX 1G3MA 3VR3A 1N5KA 4U5XA 2QMUA 3EIQA 1CKEA 1NKSA 5JJLA 5UKDA 2CLCX 1F48A 4IXMA 4QHSA 3NH6A 3THXA 2J3EA 2Z4SA 3E5HA 2WJJA 4LJ8A 1L4YA 3QXCA 1WRBA 1BH2A 4C0LA 2X77A 2RH5A 3A4MA 3KQNA 4Q4JA 3SE0A 2ZR9A 4F92B 1KYIA 3OIWA 2GK7A 3W3ZB 3FHCB 4C0SA 1E32A 1XTSA 1X1RA 3QEOA 4FW9A 4DCUA 1YR7A 2O8FA 2WOOA 5KPJA 4HUQA 5FUVA 4JLNA 5TARA 1FNNA 4QRHA 4KBGA 4ZDWA 2GILA 4JS0A 2KJQA 4MA4A 4MRRA 1FMLA 3CZQA 3HDTA 3PUZA 5CIWA 3AKEA 4LJ4A 1OXSC 4E09A 4M1OA 3ZD7A 2GCOA 1XEXA 1U8YA 1AM4D 3LXXA 4GBMA 3U5ZB 4E03A 2WKPA 2CVFA 1XXHA 2ZANA 4PFSA 5IK2A 3RVBA 1N0WA 5EE5B 1MR3F 3NXSA 1P72A 3AVYA 5KUTA 4UJ3A 1GZSA 1QHSA 1SVLA 3PEYA 3BJIC 4OI0A 5IDVA 2ZI3A 1YZLA 3X1YA 1FTSA 4M1SA 1JPJA 5K8UA 3SN6A 4S2EA 3GJ5A 4M8NE 1QHYA 1Z6GA 1JI0A 1IN8A 4LJ7A 2X19A 2FSHA 4GMDA 3KB2A 1M2OB 1CBUA 4N1AA 1HQCA 4WW0A 4AYWA 2KB0A 4P0TA 1B23P 5EE3A 4RCYA 2AHOA 1KSGA 2YV5A 5HR5A 1X8KA 2V54A 1ZM4A 4QNMA 1QVAA 1II9A 2O5VA 5G41A 2B6HA 5FTJA 1Z6YA 1ZYUA 3B13B 2V7QA 1U0LA 2YYZA 1NBME 3G0HA 2O52A 3AF3A 1Z2CA 1NVUQ 2QORA 3TSZA 3I61A 3KTAA 1XZQA 3LX5A 1M34E 4G3XA 4OHVA 4JBYA 2GETA 4II7A 1KGDA 3QF4B 2OAP1 5JSZB 1VG8A 1U81A 4KHZA 1KJWA 2JJ2D 4LUCA 1C9KA 4HB3A 1XP8A 1JEEA 3AH8A 1KO1A 5J5CA 2Q6TA 4OQNA 1IJEA 4A82A 2EWWA 4ZI2A 3AQ4A 1ZC3A 1XZPA 1NY6A 2EWVA 1CJTC 1OB2A 2BBSA 4PO9A 2ZE6A 1JEDA 2CXXA 2GXUA 4HLCA 1VTKA 1Q0UA 1E4YA 2BM1A 4L5BA 4Q1DA 1HTWA 2BEKA 3Q7PA 1LF0A 2RGGA 4RZXA 3GLFB 4FCVA 1P62B 4CVNA 4RD3A 3IPYA 3LW8A 5FR2A 2JGNA 3O8BA 2ZE8A 4BASA 2JLUA 2GK6A 1Z2AA 2H16A 3A4NA 3ADKA 4Q1FA 1Q12A 3T1TA 4TYYA 5L3VA 1R10A 1TX4B 1XBTA 2DYKA 3A1UA 3QVVA 5CDFA 1NN0A 1CRPA 2A9KA 2AR7A 3A4LA 2QSZA 3TW4A 1ZU5A 5G53C 4JZKA 5FI1B 2YKGA 1KO5A 1PV4A 2ZQ5A 1AGPA 4GFDA 1J2JA 3AKDA 3Q5EA 3UXMA 1VMAA 3R9XA 2JASA 2ZRHA 4GP7A 4Q9LA 4TYNA 2GVZC 3CM0A 3TGPA 4CT4B 1KI6A 1E2JA 3W5IA 1W0KA 3GPLA 5AUQA 1U94A 3JVVA 1NBMD 4JSYA 2VP9A 1UKZA 1E9AA 1MT0A 4O2RA 3PXGA 5AUPB 5AJXA 4DRZA 1VG1A 4B3GA 2FGJA 4TMKA 5BWMA 2FOLA 2F9MA 2BM0A 1IOZA 2ZSDA 4OK5A 3U44B 5HCNA 4PAMA 2QAGA 3LD9A 4GPTA 1UADA 4MYUA 3TMKA 5HPYB 5JJKA 2ZPTX 1GNRA 2V9PA 2MSEB 4LJYA 4ACAA 3A6PC 1KAOA 4BGDA 5AJVB 3I5YA 1G9XA 1UF9A 1UBGA 2RAPA 4YXWD 1T9HA 3TRFA 4NPHA 4ITRC 1N6KA 5JLJA 2J59A 4JLPA 2REOA 1NG1A 1XTJA 1QDEA 2ZRCA 4M1KA 1JR3A 3VNVA 4DC9A 2ODEA 5IRCD 3GJ3A 1LY1A 1KZ7B 2JEOA 3HR7A 4B34A 1GRRA 1YZQA 2ZI6A 2J7PD 4KLNA 4PC2A 4GT1A 1FQJA 4I81A 1X6VA 3NVAA 1ODFA 4RD4A 3HWSA 4NMMA 1ZM2A 1G5TA 4G5GA 2FDCA 4V0MA 1G3IA 3AP3A 1N0VC 3EXAA 4HZUA 4EFLA 1SGWA 4M53A 1A2BA 4N3NA 5D3MB 3ZIAA 2GRJA 1OHHD 4N0EA 5HKKD 3MFYA 4HATA 1L7VC 2FSGA 3TUIC 4IFBA 3RS3A 1KMHA 4GI7A 3AEZA 4JVLA 4Z8YA 1E9CA 3OFND 5FTNA 3TUZC 1YZTA 2BOVA 4B6EA 3F3YA 3H84A 3K70B 2W6JA 1OT3A 1GKUB 2WMOB 4CEIB 3ZVLA 1GRNA 1M8PA 1HE8B 5FPKA 4D26A 4LJ9A 3K53A 4TSFA 1AJEA 3ETLA 4GNKA 2XITA 3GMTA 2HV8A 1DAFA 3I3SR 2DHRA 3W8RA 3CNNA 3WY9A 1Y3AA 2FZ4A 2FN4A 2C9OA 1E2GA 1P2TA 5FOVA 1NLZA 3KXLA 2ZEJA 3KL4A 2FWRA 5KYKA 1KKLA 2OCBA 5HTKA 2JAQA 3PENA 3R8FA 3VR6A 5L3QB 5TB5A 5JEEA 3E1SA 3LQQA 3SDZA 3C8UA 4JT4A 4LDJA 4E07A 5EJEA 4Q18A 1E9RA 2V1XA 4X8OA 1S2MA 2FH5B 4MGKR 3QSYA 1EFTA 2WSSD 2UKDA 4NCIA 1OLOA 1TQ4A 4HAYA 2IS2A 4TWZA 1U9IA 2GVDC 2QMEA 2WAXA 1OFTA 5ANRB 4NDZA 2EFHB 2ZVPX 4L4UA 3H0KA 2OBNA 3MD0A 2WOJA 4PC3A 4B3FX 1T3SA 2RGNA 3P4XA 3ZQJA 1AKYA 1DEKA 4CT5A 2DBYA 121PA 1BYUA 2F1IA 2IL1A 4MKIA 2ZRFA 4JL6A 4PO1A 1RRCA 3NG1A 1Z0FA 1P61B 1ZINA 4LJ6A 2BDTA 3GLGE 1BYIA 1UKEA 4M22A 1N6IA 2IYRA 4JLDA 4PHHA 3FFBA 5BXQC 5CK5A 2O8DB 3QF4A 3ZDQA 1U0JA 1T5LA 1XF9A 1G7SA 3KZ1E 2Q0HA 1OYWA 2UZIR 3K70C 4JLMA 3K1JA 2WWFA 1N5IA 1LTQA 1GL6A 3F5FA 3PUYA 4KFRA 4A15A 1ESNA 1II0A 2ZS9A 3L0PA 2ZSBA 4FIDA 4FINA 1A2KC 1N5JA 1GM5A 5L3SB 2O8EB 1E0AA 2A5DA 4JLKA 4CDGA 3LBIA 4DHEA 2HDNB 3AVVA 3AVTA 1W36B 3MGCA 1MO4A 4P32A 1WA5A 5LDDC 2G3YA 4LHXA 3GLFA 4B47A 3GLHA 3PFIA 1NMYA 4CZ2A 4ARZB 1MKYA 4F93B 4A4DA 3CRQA 5HZHA 4Q9KA 3FMPB 1ZMXA 5JI2E 5FTMA 1KSHA 2VP0A 2A30A 5L8VA 3MLEA 1M6NA 1DS6A 3W3AA 3RS7A 4ZCIA 3UG7A 3U4QA 2GHIA 2VSXA 3DOEA 3QKRB 2IUUA 1K8RA 1FMJA 3SC3A 1ZCBA 3ZS9A 4FMCF 3UK6A 4KAXA 5H68A 1W4AA 4YMSA 2JDIA 2QP4A 2NGRA 1KKMA 5E7MA 1E94E 2AKYA 2BJVA 2JIZA 3B1ZA 4D4JA 4B3DA 2OCAA 3TLXA 1ETUA 2ZM5A 2W2TA 3ECCA 1WDTA 2ZIAA 4DEYA 2FA9A 2OM2A 4QG7A 3AF4A 3RNLA 3EASA 2XNDA 2ZE7A 2OXCA 3CPHA 3ADDA 2GXQA 3ZGXA 2R6GA 5F98A 4A6PA 1HYQA 1ZD1A 2QMOA 4XWOA 5EXXA 4PQRA 2ONKA 5HE8A 4JLJA 2D06A 5EXTA 1IN4A 3PG5A 2GZAA 3DPUA 1XCPA 3U44A 1E0KA 2OFOA 1G21E 3WHKA 2WPDD 2JCSA 2W2VA 1H8ED 3L82B 1LB1B 4PZLA 1S3SA 2H5EA 1E99A 2WM9B 3EZ7A 1D6JA 1J8MF 1XB2A 1PLJA 2HJVA 1QHXA 3OESA 1LV7A 1M1YE 4M21A 4A8JB 1CU1A 1XMIA 2ODWA 3Q9LA 2FFQA 4MRSA 3AF0A 4CW7A 5CM8B 4EAQA 3QQ5A 5BYJA 4LHZA 1OH5A 2Q9CA 3THXB 4P4TA 1RRFA 2ZS7A 4E22A 2XNSA 3NC1C 2BKEA 1E1QA 2WTUA 1N6HA 3OE7D 3IDQA 4TLBA 4BFXA 2C5LA 4TZ6A 4JL5A 3SYKA 3AVXA 4Q03A 4Q4JB 2PJRA 1DE0A 4M1TA 4DIEA 2GBLA 1Q1EA 2RCNA 1Q3TA 4URVR 1L2TA 3MWKA 4B35A 4EPVA 1E79D 2EFCB 2VP6A 2ZI5A 3MJRA 4DUGA 1CR4A 4OJKA 4LJAA 1HQYE 2F1JA 3QENA 2CDNA 4UXJA 3GD7A 3THWA 4XVUA 2JJ8A 3DZDA 2ZJ2A 3RRZA 1N0UA 1TF5A 3RRNA 5E3HA 3VKHA 2P5SA 2CK3D 4TLDA 1CXZA 2H17A 1DTSA 1OXXK 1KO8A 2PZFA 3AVOA 3GLIE 1WBBA 5EZ5A 4F38A 2WIBA 2GAAA 2GCOB 4KFTA 1XEXB 3P26A 3VMFA 4A9AA 4O3MA 2BCGY 4IOMA 3Q85A 4LHVA 1KTVA 1Z22A 2FMXA 2C96A 4CEHA 1UPTA 3CONA 3G82C 4NBSA 3FKSD 4P3YA 3UANA 3L2OB 1HV8A 4IVQA 4XWAA 5EUMA 1TPZA 5HZKA 5C46F 3I73A 2AFHE 2CL6X 4DSNA 1F6BA 3T35A 2F1RA 1MO3A 2DB3A 1D8TA 1TADA 4PZYA 4OI4A 2PJZA 3B6EA 4C0KA 3TJZA 5DNYB 3PVSA 3MWJA 1J70A 3TH5A 3WMEA 4MKFA 1N6LA 1QHHB 4PQFA 4LWZA 1W2HA 1YZNA 5L3QA 3HU3A 4DLTA 1FP6A 4W5JA 3BORA 4FMBB 3ADCA 2R44A 1ZNZA 1D9ZA 2YVUA 3SYLA 4A8JC 5JS8A 1N6RA 3RRMA 3IEVA 1GVNB 3AB3A 1D2EA 2CMKA 1Z63A 4HI0E 3OAAD 1W5TA 2P5TB 3CLVA 1DVRA 3TW8B 1E69A 2GNOA 4BZPA 5KSZA 4PANA 2V3CC 3CX6A 2WJVA 2Z6VA 3PEVA 2NQ2C 1WXQA 4RY2A 3KTAB 3D31A 4PSKA 3SJAA 3MUFA 4DLWA 3CX7A 3LVRE 1BMFD 3NC0C 5BN3A 1RYHA 1XD2A 3V00A 4NYJQ 2IYWA 1W1WA 2NTYC 4Q5IA 4D4MA 1NVWQ 4K8OA 5B2ZA 3WNCA 3QPWA 3UWOA 1E2NA 3GJ8A 3SOPA 4D80A 1XCGB 4R2HA 2ZYUX 3RS4A 3DMDA 3EWSA 1N6NA 2A78A 1H8HD 1IHUA 3CKLA 2PL3A 4MDFA 1N6PA 2P3SA 4RD1A 3CRVA 3REFA 5TVKA 1ZNWA 1CTQA 4EFMA 2GF0A 1UDWA 1XRJA 2ZU0C 3ZD6A 3FWYA 5EUQB 5KTYA 1JXMA 1YRAA 4FN5A 2WVJA 4KFUA 4RD0A 4LBYA 4I1OA 1CJUC 2ZYWX 3SFVA 4CIDA 2O8EA 1TF7A 3WNBA 1IAQA 3IEUA 2F55A 2PZEA 4EDHA 2R6CA 4JLAA 4TTRA 3WYGA 4EQ6A 2OAQ1 2ECKA 2BWJA 2OHFA 1BO6A 4YMUA 3AVWA 2XB4A 3CZPA 4BLTA 2CLSA 3EC2A 1GOTA 1T5IA 4TYWA 1JAIA 5EP4A 4OJQA 2JLXA 3LAWA 1EWQA 1KAGA 2HEIA 1TQDA 2VEDA 1C4OA 4UNPA 4MRVA 1ELOA 4UQOA 1NBMA 3NHBA 3Q5DA 2G88A 3RC3A 2CEAA 2HF9A 3K9NA 3UMSA 1S8FA 3SJCA 2O8CA 2PMKA 1G20E 4QGGA 1XTRA 3LY5A 4S35A 1FOEB 2H18A 3K0FA 5C1BA 1OSNA 2DR3A 2IYXA 2P6UA 2C04A 4LV5B 2QEQA 1H65A 3IQWA 4N0DA 3AVPA 2R6FA 5AR1A 3GP8A 3M4YA 1M74A 2QAGB 3AF2A 1ZU4A 4YXWA 1OF1A 1NVVQ 5LB2A 2WKQA 1FP7A 3J81k 5SZHB 2WJIA 3QE0A 1NSFA 4O0MA 4DLRA 1EESA 1D5CA 3AUXA 1AK2A 1OFUX 2Q9BA 3L0OA 5FUXA 2ANBA 1WB9A 2B8TA 1CEEA 4JT2A 4TMVA 2WWYA 2R65A 2ZJ5A 4HYYA 1KSFX 2XSZD 3IGFA 2J7PA 2F7SA 3U3RA 2VP4A 5HCIA 3T1QA 2BMFA 2LKCA 1L4UA 1JQJC 2HYIC 3TAHA 1G18A 2P65A 3DDCA 2NO7A 1NVVR 4H1VA 4AG5A 3A8TA 2ZJ8A 2WAYA 4AYXA 4B2IA 1UFQA 3KQLA 1KOFA 4RFVA 1XFAA 2B21A 1WQ1R 1UBFA 1EFUA 4YLGA 1KJYA 4XSHA 4TQAA 1SXJA 1XDBA 3QOFA 3T15A 4HZUB 2QBYA 2QTHA 3EC1A 5EE0A 1QHGA 1XTIA 5KOYA 5FBLB 1KK3A 2WWXA 2HXSA 5FL7A 5JEDA 5JI3E 5F3WB 2QG6A 4AD8A 1KMHB 4GSYA 2GKSA 2QQEA 4MKHA 4AG6A 1DBSA 2FGKA 3TSWA 4R7ZA 2CHGA 2OZEA 3IHWA 3VX3A 4WXPA 3WNDA 5LD2B 3WBJA 2V6JA 4RD2A 2W6IA 1EWRA 2MSCB 4ACBA 5DHFA 4BLRA 2ZAOA 2HLDA 5GVRA 5LB4A 3EZ6A 3NEJA 3OF5A 2ZUCA 3SYNA 3ZVNA 1LVGA 3FE2A 3I4LA 3X1DA 4YMTA 4JIMA 4CF7A 1FL9A 4W9MC 1Q3HA 4FMDB 1R7RA 3OEHD 2OG2A 4LJ5A 2QAGC 5D3QA 3ZS8A 3LO5A 1SULA 4E5UA 1R5NA 5LPNA 1II8A 2GF9A 1NI3A 2AFIE 1O3YA 1E2EA 3D6TB 2CLDX 3RAPR 1S9HA 4ZCLA 3U7GA 2GAOA 2N46A 2D62A 4Q4HA 3T34A 2J0VA 4WZBE 2OE2A 4B33A 4D0LB 1QHHA 2ZR7A 1NIPA 5FOSA 1DAHA 3KFVA 4DB2A 2VPPA 3RANA 1RE0A 4DZZA 3FMOB 3DM5A 2XOKD 2WJGA 3WMGA 5GJBA 1KI2A 3K70D 4D82A 1PVOA 4HB2A 3VR2A 2IXEA 3X1ZA 3ADBA 3ZZ0A 1Z0JA 2GJ8A 3KUDA 2QT0A 2RHDA 4QL3A 5JRJA 2IS4A 4M4SA 3REGA 1IN5A 2YWGA 1T0JB 3BH7A 2AXNA 4Z1MD 4ASUD 3K8YA 1EGAA 4B3BA 4JLOA 2XTZA 3K9LA 3AP1A 5AUOB 1Y63A 2J87A 4RD6A 3BGWA 5EP2A 3SS8A 3DOFA 5CLQA 3WXMA 1RZ3A 5H70A 2PZGA 1NN5A 4DDTA 5JCZA 2VIIA 5LD2C 4KI0A 4C4PA 4JLVA 5EE1A 3QKSA 4JKYA 2F3TA 1T0HB 3KQKA 1ZJ6A 3KXIA 2CL0X 3TUJC 1GNPA 2Q3MA 4GRAA 3EPHA 1HEIA 1VYTA 1ZBDA 5EQTA 4ZDJA 4TMTA 4BEBA 5AK0A 2EFDB 5LBIA 4QM7A 3GJ4A 1Q57A 2G6BA 5TV2A 1W49A 3R8CA 4AKEA 1I2MA 4V02A 3LW7A 1R0YA 1T4GA 2CNWA 2OFXA 2O0HA 3GLHB 1GILA 3NBZC 3OEEA 4IKEA 4EPYA 2ASEA 1NJGA 3KFXA 1IY2A 4C0HA 4Z54A 2N1BA 1NSTA 4AK9A 1ZUHA 2VRWA 3AUYA 1OE0A 4MITA 3PQCA 3D3QA 3TAUA 3U7EB 2DFKB 3U7FB 1IONA 2I3BA 2X1VA 1VHLA 3U4QB 3E2IA 3RC8A 1HT2E 2ZJZA 5L3RA 2YOHA 1V5WA 2JJ1A 5DYIA 4DWJA 3BS4A 3L8YA 4HDCA 2FSFA 4NL4H 4PPGA 3T5GA 1DARA 2OCPA 3TKLA 5DGXA 1F3OA 4JMPA 4Q9HA 4LCBA 1TEXA 1P9RA 2FPMA 1E9FA 3I5XA 2HT6A 4RZUA 4RVCA 421PA 1CJKC 4OYHA 5EXSA 5A5GA 4B2PA 1T6NA 2CVHA 2RGNC 1QF9A 2QU8A 2YWEA 3AV0B 4YQFA 2QT1A 1G7RA 1QVRA 1HUQA 2KI5A 1FZQA 1MH1A 1H8EA 4LYFA 2OFWA 2QSYA 3QKTA 4RCZA 4X8LA 1XMJA 3S1AA 4GP6A 4Q47A 1G17A 4PQYA 1EK0A 4PAOA 4KJZA 2J0SA 1D9XA 3HU2A 3IIMA 3B8HA 3ZQ6A 3B7GA 3WMFA 4C30A 4BRUA 5J4VA 2P67A 4LHYA 2QE7D 3A1SA 3VKWA 1DOAA 4OK6A 1M7BA 2IT1A 2OSBA 5F2EA 5K8TA 4CGZA 1EFCA 4M1MA 5FUWA 4EPWA 1OKKA 4L9WA 3LQRA 1IN7A 2OXRA 2KBEA 3K0AA 1R0ZA 1E9BA 2G1JA 3LBNA 3FGNA 2VLIA 1G7TA 4PX9A 1UBEA 2VH5R 1XNJA 4DCVA 4G5RA 2AXPA 5CM9C 5J4HA 1XXHE 5AJWA 1T8TA 2GCPA 2VP5A 1T3LA 3CH4B 3THWB 3EZFA 1GNQA 3RS0A 4QBFA 1G8YA 4D0NA 4G01B 4CYMA 5B58C 3KQHA 2ZRKA 2Q3HA 5HE9A 4F7WA 4M9ZA 3U60B 2P6RA 4URWR 3WYFA 1E1RD 5A4JA 2DY1A 2FU5C 4L15A 4B74A 1HA3A 1TMKA 4HAZA 4B75A 5JHGB 4D4KA 3K0SA 1XX6A 1YR8A 2ZRPA 4MKGA 1FNMA 5G3ZA 1IBRA 5KU1A 3F0TA 1G3UA 5JECA 4CEHB 1IJFA 3BFVA 2ZS8A 5CJPA 2JLVA 2IBMA 3CRMA 4HLDA 1Z8FA 1HE1C 221PA 2ZREA 3WBKA 4I4LA 3ND9A 2D7CA 2NIPA 4LPSA 1AQYA 1Z0KA 2Q21A 3MG9A 1F5NA 2F3RA 4Y0VA 1GWNA 2H1LA 4HSEA 4LX0A 3L8ZA 1A1VA 5IT5A 4R2IA 3QG5A 2IWHA 3VU9A 3OAAA 4QC2A 5J4LA 2BMEA 1R2QA 2IYLD 2ZRLA 3DMNA 3NBFA 1IM2A 4LK2A 2CCKA 5KDOA 4BFUA 1KI4A 1YR6A 4FCTA 4M2LA 4Q4AA 2VSOA 2XJ9A 3EA5A 3KB1A 4IOLA 4DDWA 2LCFA 1AS2A 1BMFA 4PSVA 2Z5FA 4Y0AA 1XWIA 2ZSAA 4DT1A 3C41J 5FPTA 1VECA 1X86B 1VPLA 4A1FA 2R6AA 1GAJA 3IO5A 4IDNA 4MUAA 4I1VA 1W4RA 2NO9A 3TVTA 2GBLC 2RGXA 1XD2B 1YRBA 4P31A 1PLLA 4DLUA 1SVOA 1QRAA 1P9WA 3OIVA 4IVRA 5IK2D 3C7KA 1P3JA 3HPQA 1UAAA 4TLEA 4AKHA 4KCGA 4C0AC 2IYUA 2C78A 3K0CC 4PSAA 3EPKA 3BBPA 2B92A 4A0HA 1W48A 5EP1A 5CDFE 5ELXA 1PLKA 1E2FA 4LV6A 3QPVA 4US2R 5FOUA 5GVSA 3DM9B 3DL0A 4GZMA 4BZXA 2NO0A 4GOXA 4PHGA 3N2EA 3B1WA 4PC6A 2H92A 2OILA 3CNOA 4LGMA 4DJTA 4QHTA 4I99A 2RMKA 1R4AA 621PA 1VG0B 5KNDA 3R7WA 4BFYA 1S0UA 3AVUA 2QMHA 4EJSB 3WHLA 4MGIR 4OQMA 4BFZA 1KJZA 2V7QD 3CBQA 4EQ6B 3EAQA 2WKRA 3BH0A 4V0OA 4V0KA 3SBDA 3W6NA 3VHLB 2C2HA 3AKYA 2HT1A 3BRWD 2H8KA 4MH0R 1EX7A 3WP0A 4KVGA 2FF7A 2Z83A 3QXJA 1I2DA 4NCHA 1XMSA 4QNRA 1NLFA 5JFGA 5E7JA 4Q00A 3A1VA 1G8PA 1T3HA 4TZ0A 1TTTA 5FBRB 4B32A 2ZJOA 3EPJA 1US8A 2VBCA 4W5WA 2B7BA 2O8CB 4NYMQ 3W6PA 3EWAA 3K0FB 2ZXUA 2ZRBA 1GITA 4BRWA 4DLSA 2P2LA 4B44A 2A5FA 1ZIOA 1IXZA 1N5LA 4TQUS 2DFLA 1JR3E 2W0MA 1AN0A 2EVWX 1YZUA 3PV0A 4JJZA 2IA5A 2VF7A 1CR0A 4XJXA 1W0JD 3VR4A 1PUIA 1NN3A 1SZPA 3NKVA 4V03A 4ZPXA 2XSZA 3FTQA 2FEMA 5FOXA 3I62A 4NYMR 3IKJA 5DN6A 2YHSA 1G19A 2LWIA 1U98A 1KNXA 2PLFA 3OIUA 1JR6A 2WICA 3W8NA 4UJ5A 3QBVA 4V0ME 821PA 3WRYC 1Z6AA 1ZD9A 2FJUA 5TDHA 4EPTA 4F4CA 1YZGA 4HLQB 3FHOA 1RW4A 1TUEA 3LH5A 2A5YB 2X2EA 3KKMA 4RFSA 5K8IA 1GP2A 4C3ZA 1CJVC 1JJVA 1UKVY 2HXYA 1KNQA 2G83A 3FPAA 1P5ZB 4Q9IA 2IX3A 1Z3IX 3MJHA 5FPYA 2Z43A 1KO7A 1TEVA 2W0SA 1N3BA 1RIFA 2J9RA 3KKOA 3M1IA 4IJMA 2J5XA 1BIFA 4WAUA 5EE9A 2CJWA 3NDBB 1W0KD 1W36C 4OHWA 1NVXQ 1VCOA 4R98A 3RABA 1SXJB 4BFTA 5DLQC 4AY2A 4ILEA 2QBYB 2HJGA 2X8AA 2KE5A 2W83A 2ZE5A 5BQ5A 4DLZA 4QJ4A 1J90A 4F91B 4OHZA 1M7HA 4US1R 4URYR 3IUYA 4HAWA 3GEHA 3ZYCA 1PZNA 1KHTA 4G0NA 5H8WA 1UJ2A 3EG5A 2WWIA 2AWNA 1DAIA 1IQPA 2XZPA 3CF2A 1GUAA 4PPNA 3CW2A 3UMFA 1DG3A 1HURA 3TSOA 2DCUA 3O47A 3IPXA 4IHQA
chains in the Genus database with same CATH superfamily
3RVNA 4GX5A 4YT4A 2XODA 3KLPX 4F4IA 4ETIA 2Y6UA 2QPOA 1ZRNA 4JROA 3UPDA 5AYVA 3V1KA 1U2RA 2E85A 3HGQA 4S24A 3WS7A 3ZCQA 4BIIA 3C5CA 1NU8A 4LYDA 4V2UA 4ZJUA 1FFCA 3DR5A 2XECA 5T67A 4ALIA 1M1NA 2IUTA 2ZAYA 1RWXA 4B40A 3MRVA 2ZWVA 3OJXA 4KR6A 5JRDS 3IO3A 1KHHA 3OT4A 3DBVO 5CVCA 3GPIA 5EYPB 2FPIA 4OQYA 1KXZA 1II8B 3IP8A 5TQ2B 3AERB 3GA5A 4XOIA 5A6VA 5FWNA 2XNCA 3NNNA 1N2OA 4JVSB 4XUCA 2ON6A 3OD5A 1Q6ZA 5BUQA 3GGSA 2EZ4A 4GE0A 4Q7JB 1E9DA 4EPXA 4J6FA 4EVRA 2Q2VA 2POQX 3G49A 2XOKA 4C88A 4MLDA 4LFCB 2EYQA 1OGYA 2ZYTX 3UG6A 2PS3A 2PL9A 4F45A 2D5BA 2HV9A 4PICA 3STVA 1WSDA 3I9V1 3EZ9A 4HLUA 3QW2A 1UM9A 1T2EA 2H48A 3ISJA 3O8QA 1F8GA 4ZICA 2MR6A 2IKSA 4MV4A 1Y6RA 4L72A 3MERA 5FTLA 5G40A 3FBTA 4E2WA 3OIDA 4HF7A 2OHIA 4BECA 4IUCS 3FG9A 4GHWA 3ZLUA 3LFHA 4L02A 1ULUA 4KKVA 5AI8A 1H22A 2H5LA 3O7WA 3ZHRA 2O57A 3DMYA 2BMDA 3D7MA 4QJ5A 2H7CA 3GLFE 4N01A 1JMKC 1SWVA 1I9GA 3AT1A 4WBNA 2VYCA 4UHCA 4M0MA 3SEAA 1LNZA 4IDQA 4TKZA 1CUAA 2P9GA 4OXQA 3A3PA 3RTAA 3FHTA 1ZD3A 3M34A 3UKDA 4J0CA 3Q8WA 3TX6A 1YWGO 1Y8ZA 1Q15A 1Z5ZA 1JHQA 4RKYA 5FXMA 4B73A 1YHZA 5DGHA 5HOEA 1BOOA 3KQVA 3V4LA 2FR0A 1BOFA 3ZU2A 1X1SA 4HPWA 4D56A 1J8FA 5CT4A 4K9LA 4DANA 2HEGA 3ZW9A 2A5GA 3D9QX 2BEVB 2HHCA 1VHDA 1N75A 2RK4A 3FCCA 4FXPA 1N9ZA 4JYBA 2V0GA 1ADFA 1S2DA 3HB1A 3NBXX 3O1IC 1PGJA 2GGSA 1ITZA 4KXYA 4NBRA 4QUJA 3TQHA 3CUEF 3M5PA 3WG9A 1ESCA 1RRKA 3N2GA 4YHBA 3TOZA 4YUZA 2AK2A 4IUDS 3L7IA 2O9JA 1H2FA 2IHYA 3DP7A 4KGDA 3B1YA 2J46A 3KJEA 1S2NA 1ZH8A 2QVXX 1C9NA 2FFHA 2IXGA 3PQ3A 3ZK7A 3DLPX 4MVWA 4RK1A 2BJWA 1P4SA 1NJ8A 1E6LA 2C4NA 4E6EA 4IXWA 4J3FA 1YOVB 2QL5A 3KYBA 1MJGA 5DSZA 5F77A 4C9BA 1CG6A 4EPRA 4HKTA 3Q8XB 2O19A 1Y6GA 2AK3A 1G5IA 4UAGA 3DE7X 5EMHA 3RQIA 2WJWA 4HB0A 3R9WA 4OLHA 4GVLA 4MOWA 5J59A 4OI2A 3QGMA 2WMDA 3PX2A 4TMWA 4WK4B 2X9VA 4XTRA 5K8LA 3BE5A 2Q99A 4Q1EA 3VO8A 2LR0A 4KFSA 1H3FA 2WU3A 3DUFA 3ZWOA 4DR5B 2NUTB 3RIYA 2BEUB 4KR0A 1CY1A 4O2BB 5DHAA 2YZNA 3FKJA 1BCRA 1GEGA 1EFLA 4NCJA 1XCLA 4XGKA 2MSDB 4LOKA 1OBHA 3LIIA 1M34A 3I58A 3SS9X 1JHZA 4U2CA 5IJAA 1EIWA 4ESOA 1H2YA 4ZXFA 3NV7A 4K0KB 3FPJA 2VDRB 3PK0A 2HD4A 3PEUA 4RY0A 2XWSA 2NU8A 3TBKA 4B3CA 3ZR4B 2V98A 1JH8A 1PR1A 1QWSA 1V5IA 2NO6A 2HDOA 2IVZA 3RREA 3BXGA 3VBEA 4BB5A 4HAUA 4D6PA 5F1YA 4C4TA 4IIGA 1S1MA 2HREA 3A1EA 3OPMA 3QI7A 2Y3IA 1AXGA 2NVBA 3D4IA 3DZ8A 3H2GA 3LUDA 4JWTA 5TNXA 3VR5A 3B3AA 1Y4SA 2XQKA 3LLCA 5T64A 1NRJB 4DLYA 3DE0X 5A2GA 5GMOA 2I0FA 3UMRA 5K0BA 4MYCA 3IOMA 3Q6NA 4N6GA 4NU8X 1T1SA 4UU8A 1GPH1 1WBJB 3T1VA 1OBFO 3D1JA 1CY7A 5EL0A 2O5EA 4FYKA 1FF9A 3RRJA 3N75A 1QUFA 2Z8YA 3E9RA 4HR7A 1JAZA 2J6IA 2IIQA 1GQ2A 3TQFA 1HY3A 4AKIA 2O7RA 1BU8A 4RHEA 2APJA 1U5CA 3C5HA 4AL4A 4CN9A 1T25A 3M4NA 4I6GA 4OB8A 3JWPA 5DM60 4L22A 3S4YA 1VP3A 3X43A 1W7AA 1NW3A 2JLWA 1U0FA 5B57C 5K45A 1Z4KA 2OCKA 4KWEA 1KS9A 4LQLA 1TTQB 2SHKA 3TN7A 1JG1A 1Y6FA 4AU1A 5JWHA 3T5DA 4WBSA 1QYWA 1D2AA 2VHTA 4L7VA 3WC4A 1QYIA 4F5WA 4C43A 1CY8A 1QG6A 4C76A 4RX1A 3R3SA 5ADUS 1C1XB 2VTVA 2G4VA 3TZHA 1C1DB 3CH7A 3IPLA 2ENUA 3IBGA 4JJFA 4N18A 2IY8A 1V9CA 3LUFA 4B7UA 1ZCFA 1P0FA 3JZAA 4BKRA 2XE7A 2XCIA 1DZIA 1E2PA 3VM6A 4CRWB 1Z2DA 4KRXA 4BNVA 1HTTA 3T1OA 3F71A 5ESWA 1OTHA 1ODIA 2R6DA 5DI3A 4D3ZA 2XUGA 5KYYA 5FNZA 5TIIA 1WM1A 5FF9A 4BX0A 2I2DA 3NASA 3WIEA 3G0OA 3EODA 2F43A 2F90A 4WOCA 3RWOA 4WXRA 1D1TA 3DKPA 3KLOA 5DZSA 1G21B 4H7EA 3V8BA 4PLVA 1DLIA 3PUXA 2VJPA 2G4LA 2AJLI 3ED1A 3OZVA 4IMPA 3NUZA 1GGKA 4CIBA 3NUGA 1RZRA 3L5KA 2ATXA 3UBTA 3EFOA 4KIWA 4X8HA 4J0FA 4ZYXA 5J47A 2ZT5A 3QVGA 4O0LA 2WVGA 4BC0A 2ZPUA 4DCNA 2VQSA 1FSSA 2RIPA 2FPGA 1PUJA 4D9CA 2CFTA 2L42A 4P82A 2GXSA 5AXCA 4EX6A 2HQRA 2F8TA 3RBZA 5E6UB 2JFXA 4CM8A 5JH7F 1QH1B 1WCV1 1Z0AA 5IZCC 1ZNYA 4AUKA 3GUCA 3URMA 3VZQA 4X93A 1QIEA 4D8UA 1DKOA 5T5QA 1BJTA 3GF4A 1LS6A 2GLTA 4EO4A 3IAUA 3EK2A 4XCVA 4EY5A 1TZ2A 3M6VA 3QVOA 4K2HA 3HQ4O 2GM3A 5KTRA 4EUHA 3MOSA 3PR1A 3DZHA 3K2IA 4HOYA 1VKHA 4XD7D 2OAGA 2X41A 3E9YA 4DT1B 4KR3A 3I6YA 2XMCA 6ABPA 1NF2A 3L7BA 4C4YA 2WWHA 1U2PA 2JLBA 4TZTA 4N0QA 4X95A 5HEKA 4FWIB 4XAQA 2D2EA 2I4LA 4FOOA 2RH4A 3R5XA 1RJ9B 4AKGA 2QZJA 3HUDA 1JMYA 3LV8A 3P2IA 3CF0A 5D86A 4CM4A 2JI6A 5KHOC 1TEZA 3O9VA 4NBVA 1M2JA 1VPTA 3LLUA 4JBXA 3V6LA 1WPQA 1G2QA 1XTPA 3LK6A 3KOOA 1I0IA 1X70A 4K1XA 1G7CA 4NKRA 3GLIB 4G0WA 3TSCA 1ULHA 1PUXA 1ZUIA 2G5TA 2RHMA 5ERGB 3WIBA 1K06A 1O95C 3GRYA 3K09A 4QOIA 5J9FA 3TLEA 1ZJ5A 4D57A 5DTIA 2E4UA 4BQRA 2WBLC 2H1HA 3IAM1 1FTNA 2FFAA 2WIGA 3EGXA 3ODGA 2R8BA 3HBNA 5CVEA 2BGMA 3J7AC 4BS9A 3S40A 4DCSA 2EW1A 2YVKA 3JATA 4RKEA 4U2DA 2C8KA 4G85A 3FB4A 3QVUA 4XPIB 3WQHA 3MWGA 3DEYX 1VBMA 4OQXA 3QRWA 3C1OA 4UKDA 3AZQA 3U31A 3SQXA 3ISTA 2ZTHA 3EW9A 5FUYA 1RNLA 1XA3A 3VTZA 3JQPA 1KERA 1C1YA 1WW2A 2B9EA 3B52X 3NM5A 3SJBA 1EX6A 1BHO1 2AW5A 4REQA 4J0HA 1QFMA 1GDDA 3AESB 4F3YA 2AUMA 3BRWA 3QIAA 2FW1A 5BNFA 4URXR 4HFNA 4RTPA 1QONA 4AJ4A 4NYIQ 5BO5A 4EGJA 3EGWA 3IMKA 4G26A 5DNAA 4JJ7A 2O2EA 3MYRA 3HP1A 1IE3A 3RSLA 5LQRA 3GIWA 3T3DA 4G36A 1DV1A 4EO9A 3O8OA 2DBRA 3VC7A 3TNFA 5L4LA 2FCRA 1AGNA 1TLLA 4FD2A 2QUIA 3AW8A 4Q1VA 5LP6B 1OYYA 1HOXA 4QQFA 5IULC 3OOEA 3EPPA 3NRJA 3E7WA 4Y2PA 4HJRA 4CETA 1KO4A 2Z9BA 1UDCA 3MFQA 5DYWA 1E5QA 4U7DA 4MW9A 2PKEA 1NVFA 3MWFA 3I0ZA 1QBKC 3C3BA 1W46A 2O20A 1W88B 3QVSA 1YTUA 5CBPB 3ZQUA 4ZTZB 3FPSA 5F9MA 3IUBA 1ZM7A 2OQVA 3OQMA 2WD7A 4BFSA 1G55A 5ESRA 1Z0UA 2I1VB 4WCFA 2PA3A 2DPXA 2P6NA 5KJ1A 1U7HA 1ZY2A 3ELUA 3H9GA 4Q3KA 4LWOA 4RQTA 6REQA 2QRGA 4MV1A 1TQ2A 3HB4X 1WJGA 4LMBA 2H1FA 2SNIE 3CRZA 4QASA 1NRIA 2D74A 2C95A 3TLBA 3U9SA 3GCWA 3UMYA 4E7PA 2NU9B 1W36D 1RC0A 5ECDA 3HHPA 2OV2A 2ZRNA 3EXFA 4FUTA 2VN8A 4HXFB 5CHYA 3DMFA 2WIFA 5DLPA 4BZQA 4EJ2A 1MABB 1L5HA 5IJ9A 3F74A 1CR1A 4A6XA 1GUFA 3AI1A 2R8XA 2Z2YA 3C3PA 2H2WA 3QHAA 3QU7A 4JI4B 3VPSA 1SVIA 1KEPA 4K9PA 3Q3GE 3LQKA 3KAQA 4KIFA 4JMLA 4JLBA 4M8KA 1W76A 3MIIA 1ZNXA 1L5YA 4MUJA 3GFFA 4AUMA 1LNSA 4Q4LA 3W2FA 3LY8A 2J9YB 3OE7A 3WJ2A 1U8AA 4O25A 4LSZA 3BJEA 2FG5A 5F35A 1GTG1 1P0CA 1P17A 5WRFA 3TPCA 4KITB 5HM8A 3LP5A 2IYTA 3JZIA 2XX3A 2FWAA 1FFSA 4MEBA 2CJWB 4BB6A 2PRYA 5CVUA 3CB4A 1KQNA 1DGQA 1BGWA 4UZEA 3A11A 5GONB 1Z39A 1JIQA 4D9BA 2GAIA 3JYHA 2QLBA 2R00A 4GBED 1FFDA 4J1TC 5TF4A 1JSRA 2CYCA 4IG4A 2QROA 4FYIA 3QLJA 4M89A 4AO6A 4K88A 4KO2S 4YJHB 5ER9A 2NZ2A 4BLWA 4L16A 5AKEA 2H4JA 3PQEA 3FWZA 2Y9MB 5BY2A 1Z4PX 3O31A 1UZUA 1JEJA 2ODNA 1BD3A 2JW5A 1QAOA 3AZPA 4FHFA 3ZC3A 3CO5A 3LUBA 2ONZA 3PCXA 4NV3A 2ZP1A 2CMHA 4QGHA 2B8NA 4UNQA 1T2AA 4LYJA 2A4KA 4FYYA 5AJZA 1TAGA 4P81A 2C5EA 5IVHA 1PFVA 5AXDA 1I13A 2PNJA 4RZ3A 4EKYA 2LKDA 3DXXA 5K0SA 1Q0SA 4TLLB 2IYOA 2GZHA 2PO7A 4KK4A 5T8KC 3SHWA 4AAYA 2DR2A 3N8NA 4KOAA 1QFZA 1XRPA 3LFUA 4WI1A 5DYGA 4IIJF 5CTJA 1RI4A 1KI1A 1N7IA 1CQJA 3C3CA 3R3YA 4N47A 4DSTA 4RGQA 3L6RA 2QGFA 5BN5A 4TL9A 5KNBA 1D07A 4PVCA 4W99A 5AW0A 4QOEA 5AKJA 4PYRA 4BNTA 3OOSA 3FNIA 3U7HB 3Q7TA 3IDAA 3HL0A 3PR2B 4G5SA 4Y7CA 2PT5A 5KSPA 1ZX1A 2C2OA 4P5EA 3SJZA 1FRNA 1Z16A 4RMHA 3AR9A 1VPWA 3TEMA 4L74A 4P4GA 4Q1BA 5CA1B 3GQBB 1ORRA 1HR0B 3WRWA 2GO1A 1NC1A 2VOEA 2H9YA 5J3JA 4YONB 2EP7A 4QVIA 2Q2OA 4DLKA 1XEFA 3QV1A 4H1WA 5KSOA 1JFTA 4JXJA 3LK7A 4QUIA 1O5IA 2P9JA 2O2GA 4XQCA 5FL7D 2JK0A 4Q48A 1ECPA 3BWDD 2CNLA 1MAVA 1XD9A 2BP7B 3EZ2A 4RSGA 4X6UA 4YO7A 4RK4A 3UATA 4PNEA 4MV3A 1SHZA 2G06A 1CX9B 3R6GA 4M37A 2NADA 3U7RA 2JCYA 5ITZA 3CPEA 4MCHA 4PWZA 2A0KA 3E2PA 1ZEMA 2VDMB 1FX0B 1I1OA 4KPGA 4YCNA 1U7DA 1JQLB 1T0PA 1LX6A 2A1TR 3R40A 2ORWA 1F38A 1MX1A 1TM5E 2ZROA 3O38A 3AY0A 5K3SA 2Y1FA 2G9QA 1V5GA 4E46A 1M6HA 2V8OA 4HAIA 4UASA 3V1UA 4BNLA 4CLOB 3TF5A 1DIOB 2GCNA 2CW5A 5G0VA 1DEOA 2XAUA 3DT9A 3GLSA 1I6WA 3QSGA 4BP3A 5ICMA 3VU0A 4MQEB 2CSXA 5AQEA 4OXIA 4F7DA 4RV9A 4UBIA 1ZGHA 2BAGA 5DBGA 4GGMX 1E0DA 4XH9B 1NY5A 1PGOA 4I6JA 3RHTA 1AV7A 1G6HA 3TIIA 1PNVA 1E9EA 2H1CA 4G67A 2QPAA 2ZRAA 3KJHA 4UXHA 5IP5A 5L4SA 5DLYA 2SCUB 4PYNA 2JLSA 2ZJ6A 1N4AA 4F6LA 5I4BA 3BOSA 5CB6A 5F51A 3IAHA 4QPNA 2CL7X 5AJYA 4BU0A 4TMXA 4DSOA 2R8PA 1IZ0A 1EZ1A 5CIQA 3BTVA 1O7JA 3K2EA 3QI2A 1ZRHA 2YQ4A 3FSGA 2I3GA 2QI9C 2O4CA 3IB6A 2VDKB 3TBFA 4LA4A 8MHTA 1Z7YA 3QE9Y 4WESA 3GHHA 4Q9DA 4QIHA 1XZDA 3UY4A 4Z49A 1FBTA 4CKYA 2BIFA 1U4OA 2Z2ZA 3L7DA 5E9AA 5FV4A 5KYNA 3DVLA 4GUDA 2F8SA 5KJEA 4DJFC 3OPVA 4CDMA 1L9KA 1L8OA 4PU0A 3FOFC 3GFPA 3LPDA 1UBHS 3FMIA 1L6RA 2NTEA 1S8NA 4PTYA 5JHHB 3LQYA 1YVUA 3AJAA 4E94A 3W5DA 1JA0A 4K8RB 1I4LD 4M9CA 2MTBA 4W7SA 4W63A 3E8MA 1S9DA 1JHRA 1MNAA 5A62A 1N1DA 1V41E 1Z12A 1GLNA 3ND8A 1ZVKA 3KJXA 4OD0A 1LSSA 4JYCA 4JDUA 4HV4A 3LX6A 5KZMB 1NBEA 2CE7A 3MMPA 4BN4A 2ATVA 4Z51A 2YR0A 1EHCA 3DWEX 2YWRA 1G8SA 2WAMA 2RK6A 3GLUA 3P2OA 4JP8A 4H7DA 4PGMA 1YK1A 5DM0A 4ZAFA 3HRIA 1AQNA 3IT3A 1N9KA 1W5FA 1KH3A 2RE8A 3RYHB 1U0GA 2J0UA 3LDFA 1FFEA 3EEYA 4MP6A 3WHPA 4BO5A 1YFJA 2OL4A 3TINA 3IIEA 1COWA 5LUBA 3O95A 2RHWA 1L1EA 3OJEA 4QUDA 4BQOA 1CRQA 4WWHA 5KB3A 4S0XA 3NUQA 1WE2A 2VOJA 3II6X 1VKNA 5ENZA 3QVLA 4NZ9A 1Z5GA 3M0EA 1R9MA 1V7ZA 1U1EA 3LCRA 1F2TB 1BDMA 1HKHA 3LLVA 2YL2A 1KY2A 1S2OA 1Y34E 3WKDA 3L1UA 1V3TA 2CNWD 4G5FA 2NYVA 1NW9B 4IHKA 4LBZA 3L06A 1HE4A 3TL6A 2M1ZA 2O2XA 3AWIA 5KYWB 1XAJA 3B6ZA 1XLTC 4FTWA 4LXUA 1SU7A 2DUWA 2WUWE 2JI9A 4DLAA 1X77A 5JBIA 3SHQA 4DLXA 3CG0A 2ESRA 4UMFA 1N7JA 5BQFA 1PGPA 1LNQA 1U1IA 1XLUA 5KVQA 1NQOA 4G8DA 5JJBA 1Z17A 1G8HA 4J8PA 3EGDA 3UB4A 5SYMA 3MC1A 2AZ4A 3DBRB 3PJFA 3QNUA 4WJZA 2A4MA 2XXAB 1LPPA 3RFUA 5ED0A 4ZEWA 3GEGA 2C5HA 2A8YA 2P2ZA 2QW1A 1OAAA 1MW8X 1IEQA 4D2IA 4FEAA 4R69A 1NF3A 1N2GA 1YDMA 4DB4A 1JHDA 4X94A 4QT4A 2C8VA 1SZCA 4U7HA 4XX0A 3DZFA 3L4EA 3H1FA 3JZDA 4NMLA 2HSEA 3ZVRA 3HKBA 3K92A 1T24A 2Y0DA 3N0XA 2UVDA 3SYTA 5JCJD 2WG1A 2A1IA 2AQIA 2A5JA 1TCCA 1NOIA 4DV6B 3B1VA 5CW1A 3NRBA 1ZVQA 3OIYA 2C1XA 2FE4A 4BTLA 4YIHA 4EGCB 3KYDB 3M70A 3AI3A 4UU0A 4GI3A 3HFRA 4U02A 1HMYA 1YGYA 1ZP6A 1EE9A 2RGYA 3H9CA 4HS4A 2OHVA 2Q4TA 5ALDA 2H57A 3AUTA 4PYJA 2AWOA 2Z30A 4KC0A 1USWA 4JVMA 1ZUD1 3N76A 3COZA 1M1XB 1PRYA 2FE1A 1TQ6A 5LOVF 1VL0A 2SICE 1Y48E 1BNCA 1ISFA 1C7IA 2IYVA 3ONFA 4DMMA 4QA9A 2ZTVA 3K0EA 4CMAA 1PZHA 5JSUA 3CGWA 3MILA 1WW3A 1E3MA 5TGDA 1G6Q1 3KQMA 1T1RA 1W6UA 3HC7A 4DE5A 4KXXA 3WJ7A 2BKUA 3BMCB 3L43A 3PHLA 1W2GA 1AS0A 1WZIA 4CKEB 5FX2A 2COUA 1P6XA 4P4LA 2OXEA 4D9GA 3JR7A 3DFUA 5CPFA 4RH3A 4H7IA 4OBEA 3WKEA 1HDOA 1JHAA 1O57A 3EF1A 1Y81A 2EEZA 3QITA 3BC1A 2WWVD 4H0CA 2YJ4A 3K9FC 2RG1A 5FBZA 1IL0A 1O4VA 3A9UA 5JQGB 1X8LA 3TGLA 3ESCA 4RMGA 3VOSA 3PDIA 5C8YB 1V1MA 3ESYA 4G2TA 3FOZA 3L0SA 3CC8A 1B0AA 1RYYA 1ZH0A 2ID9A 1K7FB 2AJCA 1H6BA 1QCYA 2AL7A 2Q8QA 2QM7A 4UEOA 5DBEX 1ZSVA 5ALPA 5CCDA 4OGKA 1D3AA 1RQNA 2YRFA 4XTCS 1DAGA 3U2QA 5JH7A 4O1MA 4AZSA 2G1AA 5DXJA 3IB3A 1TJYA 1QQTA 4JHLA 4RQBA 3OZIA 4GXQA 3I39X 1QV7A 2C1ZA 4V24A 5ALUA 3OC0A 1KEKA 5DXAA 3S2EA 4AP6A 4RF2A 4L1KA 3LLMA 1DG1G 2VHUA 2G17A 4FMDF 5E4FA 4ZVUA 4FFVA 3KZMA 5DHPA 3U6BA 3QXSA 3V7WA 2EU8A 3P27A 4YAWA 2D1FA 1WTAA 1U0TA 4I66A 4CR7A 5C80A 3STYA 3MJSA 3MSXA 3NX4A 4ZVPA 4XOUA 4XQ9A 2CC2A 4N6NA 3NDPA 3VFDA 1LDYA 1LTHR 4TSFD 2OC9A 4G63A 3LX4A 4HDSB 5DDIP 4TV9F 3IBYA 3NBKA 4DNXA 1DO2A 4A23A 2W2LD 4DQ0A 4IPTA 2XCOA 4PO3X 3VPBA 1SKQA 1P75A 2XBUA 2XI4A 2EV9A 2OLKA 4KIJA 3QMMA 1HORA 3W1EA 5THQA 3U4MA 3IUMA 3MT9A 3TI9A 3IVCA 3TR5A 3CVVA 1JQ5A 1F14A 3N2ZB 2K5UA 4ZAYA 3TM5A 1TZBA 3HCBA 4I3HA 2BGRA 4BE9A 2EC5A 2P9FA 3GR6A 1F17A 4OATA 5BSUA 2GPTA 4FLFA 5DTMA 1YR1A 4FGKA 3DBLB 4PHTA 2QQFA 2BKAA 2VAPA 1E1CB 4TM8A 3W9BA 3K6KA 2LCIA 1JEYB 1OV4A 5BYKA 2GZ1A 2QGZA 5BUSA 2Z4TA 3RIXA 2WJAA 1HSOA 1RYZA 4HGZA 3C45A 3ZLJA 1D2RA 3V8QA 4LNUB 4XARA 1YMQA 1YK0A 5BW4A 1UBCA 4PGGA 4NE7A 4RJ2A 2EEPA 5BNIA 3O0TA 3FWNA 4G5YA 2V0CA 2J3HA 2PUFA 1YVPA 3UOWA 4TMZA 5EJ4A 4S05A 5AHOA 4TXMA 2PEZA 4KUGA 2BFEA 1NZDA 1X14A 2BMAA 3FA2A 3BZWA 3OQIB 5JU6A 3MOIA 2E55A 2PJDA 2XB2A 3LDAA 1TU3A 1VB3A 2RG7A 3DZIA 4WZBA 1NNLA 4GXRA 2O8DA 2GUWA 2PUHA 3ANYB 3IA7A 5TQJA 3H2ZA 1MD9A 4O33A 3TTSA 4HVTA 4IW3B 2I22A 3RJ9A 2EKPA 3DVAA 4BKMA 4LSGA 3DKKA 2I6QA 2C61A 4PTLA 5FR1A 3VVBA 4A03A 1VHTA 3FXAA 5JOQA 2IF2A 3DTVB 2O6HA 1VJCA 2OP0A 3TTUA 5TT1A 1DCMA 4ZN6A 1K7CA 1R4MB 3V32A 1V9LA 3BZUA 1SXGA 5BQOA 1J2TA 2BZGA 2WABA 4BNMA 1Z38A 2PYZA 1C41A 1DHRA 2PLRA 4NR0A 3VVMA 1RPTA 2GSWA 3PDUA 1N1EA 1JBEA 2BSAA 4IJUA 1T10A 4WERA 3T99A 4F9GA 4ZVTA 5BNTA 1WMDA 1L1QA 2VDWB 4UNNA 4D8TA 3K6SB 3K9HA 4WY8A 1M1UA 2CHVA 4ENTA 5L6LB 1G8FA 2I4IA 4IJQA 5DB4A 1D2NA 2Q28A 1NN1A 3DEZA 3H6GA 3A36A 3HRHA 2BBWA 5CFLA 5C5IA 1J5PA 1JG7A 4B6SA 4CFZA 1JPNA 5B6IA 5FBHA 4RQUA 2PWBA 2ERYA 4UC0A 1KK2A 2ES4A 2DHCA 4QHYA 2KSQA 3WYEA 1QCDA 4MEJA 2O3TA 2O0KA 3ODPA 4FONA 3UJNA 3DHWC 4TSRA 2OYCA 3PNMA 1CF4A 2P8JA 2UVQA 4IHAA 2FJ0A 1GTMA 1A4IA 1AE1A 4UPVA 4JBNA 1QQ5A 1L5GB 1KYZA 2AKAB 3DB2A 3I9V6 3QY9A 3U0VA 2A2ZA 2HQOA 2V6IA 3OFKA 5KOIA 1M2VB 4GPAA 3H04A 3ZHXA 1IULA 3KYIB 2JDID 3RRXA 1LJLA 3TKYA 1Q44A 2H0QA 1RQLA 2YXDA 3NHJA 4KKXB 5I7OA 2HWUA 2GARA 3JYPA 1KEEA 2OBYA 4DUPA 4ALLA 2DGDA 1YA6A 1T36B 1SQ0A 3BWYA 4IHJF 3HCFA 1YHYA 4AIIA 1E3TA 1QZZA 3B9QA 3ZV3A 2HHHB 4ZV4A 3KQSA 1DTWB 2C1EA 1C0PA 1H2WA 2P3QA 4KQIA 4MPRA 2KWIA 4UM8B 4JKIA 1Z15A 2DFTA 3W6OA 5B3AA 3LUKA 3JXEA 3A58B 4NMHA 1P4GA 3ZHBA 4BQPA 2VDQB 3CLKA 2QN6A 3PTLA 1Y7LA 3MRTA 1HT1E 4AMYA 5DN6D 3O8RA 2ZT7A 2VR1A 1Z08A 3QUSA 2ZAGA 5BP7A 3G0IA 1B1CA 2NSDA 3IPAA 4WASA 1H2XA 2I80A 3GVCA 1RD4A 1XJ0A 2F4NA 4MEAA 4L8FA 3HI6A 3B6KA 4U39A 3UJ7A 4A8JA 3JQGB 4H9GA 3OQNA 1EIZA 1YB4A 2KM1A 2OV1A 1G3MA 3EEQA 3K2BA 5D7NA 5DNEA 3HB0A 1PSDA 2QMUA 3Q9SA 3KQYA 1XDUA 5JJLA 1RCFA 1IJKA 4XGIA 2CLCX 4GBJA 3RUHA 5IN4A 4FBLA 3BGOS 4IXMA 2UUCB 4QHSA 3NH6A 3THXA 4M1EA 2XDQA 4F2DA 1WRBA 3CLSD 1RKQA 4DGSA 3IR6A 4CIAA 5B37A 3E0XA 4CEHA 3HJHA 1XEAA 2I8LA 5JAOA 2A14A 4IIJA 4YMGA 2GD1O 1UR5A 3DPIA 5H4HA 3FHCB 3IOYA 3W3ZB 3WWZA 3BA1A 1L5NA 2ECFA 3E58A 4QUKA 2GB4A 3REQA 4CIXA 1GFWA 5FUVA 3WWYA 3BKWA 5E6RA 3U7IA 1G5QA 5HSGA 1QVVA 3KYCB 4JS0A 4QTZA 4V39A 4WUTA 3D0OA 5HTOA 3ZJ5A 1XTUA 3TW6A 1F0NA 1HFKA 2FXIA 4N5HX 3EDRA 4D3XA 2QN9A 3OURA 5G0WA 5A3SA 2Q27A 3AKEA 3V8VA 1OXSC 1QBGA 1OXKB 4XB6B 3SJ7A 3VI4B 4EYEA 1USKA 1Z2PX 1XEXA 3WK9A 1B6GA 1XYYA 4NPCA 4KX5A 4AFNA 1IIRA 1TUBB 3TS1A 4EHAA 3E53A 4QBTA 2AG5A 2VT2A 3A10A 1UDBA 2R25B 4KTVE 4UFOA 1FS5A 2WMYA 3QU5A 4GZ3A 4PFSA 1SD1A 2HWYA 5LBUA 2O3UA 3AVYA 2QTLA 4DCCA 3G5MA 5KUTA 4UJ3A 5BN4B 1QHSA 5IJZA 1DJLA 2CFRA 2CLMB 2ZI3A 3E3AA 2Y77A 2YX1A 2YWCA 1FTSA 5JNLA 4FYXA 4YUAA 4XW2A 1C9YA 4MXDA 2XV1A 4WLEA 3SN6A 4BX2A 4P5PA 3KP1A 3TOSA 1JI0A 4X5OA 1L5MA 3GLTA 1FSGA 3GEDA 3AIKA 3KB2A 4QULA 4UBKA 1GPYA 2KB0A 2ZIXB 4P0TA 2J6CA 2K7ZA 3Q98A 1B23P 4Z0HO 2Z98A 1W34A 2YV5A 4CBVA 5HR5A 1ZOLA 1ZM4A 4QNMA 1K5PA 4MULA 1II9A 3V9AA 4HDAA 4ND1A 5FTJA 3ZGOA 3G1UA 5AJUA 3TW8A 3RRBA 2ODAA 1BX1A 2O3QA 1U0LA 2YYZA 3JQ9A 2BF7A 4NH4A 1JZTA 1UPUA 3MQ2A 2PX5A 1NVUQ 2JIQA 4L27A 3H8WA 3L6OO 3KTAA 1XZQA 3BMQA 4G3XA 4OHVA 4JBYA 5K8VA 1OAOA 2H5JA 3VKHA 5B4UA 2HXGA 5GAJA 1KGDA 3SP1A 5JSZB 1FZTA 4YBRA 4OHOA 1KJWA 4NF2A 4B3SB 4LUCA 1FRVA 3RM3A 5ULLA 1KO1A 3CWCA 4X97A 4JP5A 3SYRA 3NIWA 4B6PA 3E7DA 3QEBZ 4HEQA 4OKNA 3SBOA 5KYKA 4CQNA 2VNAA 2ZCJA 1ZC3A 1XZPA 1NY6A 2LV8A 1E60A 1GARA 1JUDA 1NU6A 1MJ5A 2BBSA 1IZZA 3C3DA 4HN2A 1MENA 2BFCA 1OX4A 1S5PA 3MOGA 4IQ4A 3VRHA 1X7HA 1ECFA 5ISMA 3C24A 4Q1DA 1HTWA 1XQWA 2DCMA 4M8LA 2BEKA 2G70A 1LF0A 2Y93A 1YB1A 4QRDA 4RZXA 2EGUA 3VDXA 2H1RA 2F17A 1ETHA 2W98A 3OA0A 1SHLA 5HS6A 1SJ9A 1A95A 2GD6A 4V1CB 3H6KA 3NBMA 1XVIA 2VDVE 2H16A 3H4VA 3RHSA 4D79A 1E63A 1P0PA 4DJJA 1I6KA 1Q12A 4J03A 3T1TA 2CXHA 4TYYA 1A9PA 1OX5A 5FFFA 5BNWA 3FOBA 4PNPA 3N53A 3D2AA 5LWQA 4IO0A 4RTNA 1IOWA 3JSXA 2DYKA 1YA8A 5LN1A 3PQ8A 3VHQA 2QVLA 4BX8A 1U3WA 4F4FA 4PLHA 4EP1A 2YNMD 1D6NA 1ULTA 3CUYA 1ZVMA 2QSZA 3PNKA 1ZU5A 4JZKA 1ISGA 3E9DA 1AGPA 4NBKA 1XRNA 4M22A 1FMFA 2AVDA 4MVJE 4P93A 1I2BA 3W2TA 1REQA 3WK5A 2AG0A 3BXFA 2C2BA 1Y89A 3O73A 1EFAA 1FS6A 1NUPA 1VMAA 2WC1A 3RTDA 3MJ4A 3MMSA 5KKCA 2FAXA 3TGPA 3O3NB 4ITUA 4BY9E 1NR1A 3STWA 4BFLA 1Z2OX 4I9HA 1CY4A 4NFYA 2I65A 4IBOA 1ZSNA 3OM0A 4LY3A 4J07A 3BF8A 1KYYA 5H9WA 4A3SA 3PNLA 1GG5A 3A06A 1GZ4A 1UZLA 2HRZA 3I9FA 4MTLA 2F9MA 1IOZA 5AVSA 2ZSDA 3LBFA 4OK5A 5HCNA 5BSRA 2C4KA 2QAGA 1RJDA 1S2LA 4KZKA 5CNKA 3X2FA 1FP2A 2V74B 5HKLA 1UMBA 3LQ2A 2V9PA 3UEOA 2NWQA 1EX1A 2BFAA 2QLFA 2R1ZA 4DZRA 1B15A 1PJ2A 4BVHA 2VZEA 3K96A 3I5YA 3MHTA 1G9XA 1UF9A 3UMCA 4YXWD 1Q0HA 2E3JA 2XB6A 2ZG6A 3I04A 4NPHA 1RXIA 4P9NA 4M46A 1ZWLA 3PXBA 3ROQA 3VPCA 5JLJA 1NG1A 1SU8A 1WSAA 1XTJA 4RVGA 4UPEA 4JB2A 4FHEA 4MWDA 4ZVMA 1JR3A 1CJSA 1QGUB 1KZ7B 1NDHA 4B0OA 4OO3A 3O9MA 4IXDA 4Y2RA 1FJHA 3CUVA 4DYHA 3WOVA 1OLSB 4RIFA 1H5NA 1SOMA 2J7PD 3AHIA 2BE9A 3JASB 4EO7A 5A2QA 3KHUA 5LZ4A 5LOVA 1X6VA 3N28A 1J1ZA 4KRYA 3ZV7A 4UMEA 2FUG6 1YBAA 2IGBA 3HWSA 2EBHX 4Y9SA 1U3UA 3C6BA 1MV8A 3R24A 3HKCA 1XU7A 3DONA 1EFDN 4G5GA 4V0MA 4D44A 1WUYA 3AP3A 5IAOA 4M1ZA 2FDCA 2XQGA 2CKMA 5EKTA 5K0LA 2GN6A 1A2BA 5D3MB 1PJZA 3D4PA 1J4AA 2W11A 5JNUA 4N0EA 3NC4A 1F12A 4HATA 2GCGA 3ZOKA 3LM8A 2XZDA 1E6MA 3C6QA 3A1NA 1QE3A 1DP4A 1A7AA 5K51A 1P7WA 1TVKB 3OFND 4MCAA 1J49A 2BOVA 3S2UA 4TRJA 3F3YA 4GI5A 3PYLA 1A5BB 3ZGLA 2ORYA 2WMOB 1M8PA 5K0FA 3NT2A 1Y80A 4LJ9A 1WDKA 1JE0A 1R18A 2GLXA 2AHRA 3BAZA 4PX5A 3DYBA 4OXXA 1EWYA 2XMBA 4QUBA 4HNGA 3PLRA 4PRLA 1YAJA 2HV8A 5DPMA 1CVIA 1L7QA 1WLSA 2DHRA 2HADA 1UQUA 4MWZA 1QNFA 3QTTA 2FN4A 4MP3A 4EMUA 2C9OA 4GLJA 5FA5A 3EUAA 2NSHA 4HN4B 2Q07A 1HNXB 5IM4A 2WFMA 3CN7A 4CKCB 5HTKA 3PENA 3QYPA 2OXIA 3WICA 2YIMA 5TB5A 1EPUA 3E1SA 2ZULA 3WA7A 2A59A 2GEBA 1E6UA 2AMJA 3C8UA 1RP7A 2CB0A 1GPKA 2P35A 5EOVA 4DR7B 1R4ZA 4Y67A 4ZI5A 1WHTA 1DQNA 4X24A 5LQMA 4EJFA 2FH5B 1EUDB 2NUPB 2Q7XA 1EFTA 2WEKA 2WSSD 2X86A 3KJNA 4R01A 4DLPA 1FYDA 1NPYA 3A05A 1UDRA 3L8CA 3OD1A 4MMZB 3ZKWB 5CH3A 4EGSA 1U9IA 2VRCD 1WB5A 3FOAA 4RFLA 3R76A 3AU9A 4EY4A 3PX3A 1EINA 2DC1A 1C30A 4EB6B 1V5EA 4NFLA 1H69A 4X45A 1W1UA 1T6XA 4L4UA 3H0KA 1GPBA 1LPSA 4DARA 2PRZA 2E5LB 2B98A 3P4XA 3JWGA 1AKYA 2J3MA 3GCZA 2E4VA 2DBYA