2A9QA

Low resolution structure rr02-rec on bef3 bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
112
Chain Sequence
b'KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
molecule tags Signaling protein
source organism Streptococcus pneumoniae
publication title Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site.
rcsb
total genus 38
structure length 112
sequence length 117
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a9qA00
2CWDA 4WXMA 9ABPA 3ROFA 3LMKA 2WMYA 4OATA 4G0QA 3GRCA 3ROTA 5I4CA 1LBHA 1L5YA 2A9OA 3RVOA 3F6CA 1JF8A 2E4YA 1NATA 4G97A 1B00A 5JNUA 5DCLA 1TJYA 4MYRA 1SD5A 1ZH2A 2H0AA 2JVJA 5KC9A 3H1EA 5PNTA 4OTZA 3H1FA 3O75A 4YLEA 1FFSA 3S99A 2FMHA 3NNNA 4Z4CA 3C97A 1CYEA 2WJWA 2A9RA 5TPWB 3KCNA 2Q5CA 2GI4A 4NICA 5EWJA 3CFYA 1XHFA 2TMYA 4ETMA 1VLZA 3NNDA 3QLUA 4YGXB 1NXSA 5DLEA 1PEYA 1JDNA 4LZLA 3C6QA 2WY2D 2L19A 1LJLA 3HS3A 1PHRA 3BRQA 1U04A 2MSLA 4N03A 4FE7A 4RSMA 4HNSA 3RVSA 4RXUA 1APBA 1IIBA 2GWRA 2LPMA 3SM9A 2PUCA 1Z25A 3LTEA 4IF4A 5JNTA 1NXPA 1YS6A 4EY3A 3MMNA 3OQNA 3IP7A 4D6YA 1PEAA 3H75A 3N53A 4MR9A 1YK0A 3IPCA 2JB9A 4MS1A 3T8YA 2PUEA 1SXHA 4B09A 1VPWA 3L6UA 3Q7RA 4Y9TA 4P98A 4MLDA 1ZDMA 5EWLA 2GKGA 3OM0A 4EYOA 1I3CA 2PUBA 1JHZA 1ZGZA 4KRFA 3KHTA 3G1WA 1AB6A 2P9HA 1ABFA 3IP9A 2KYRA 3OO1A 4XASA 3D02A 5IC5A 1K68A 3QLVC 4LX8A 3LUDA 1MAVA 1ZESA 4ZMRA 3EQ2A 4XARA 1QNLA 2FN8A 1EWVA 2JK1A 3UUGA 3Q41A 4RXTA 5HQJA 4O1HA 2RJNA 1ISSA 1JYFA 2FKAA 2QW1A 5FBHA 3QX8A 3H5TA 3GBVA 2DRIA 3T38A 4FE4A 3HK2A 2WB4A 4O1IA 1QMPA 1Z18A 3JVIA 5C5CA 4Z4HA 1ZN2A 3IDOA 4ZYLA 2GX6A 5TQ2A 1P6QA 4XXHA 5KQGA 3CKMA 3KYJB 1DG9A 4ML3A 2AYXA 3I09A 3O1IC 3QEMB 2PUDA 1QO0A 4F11A 2IPMA 1LBIA 3F73A 3C3WA 3N0RA 4MS1B 4NQRA 4TMYA 3RVJA 4HNRA 4XLTA 2HQOA 1S8NA 3CTPA 5KQPA 1ZAYA 4QYMA 1VRVA 3RQIA 1Z2EA 5IX8A 4MR7A 1NXXA 5EWLB 3DBIA 4TN5A 1E6LA 2L17A 1ZHHA 3H5IA 1CHNA 1M2FA 4RZSA 2PL1A 4RU1A 2IOYA 3MM4A 3I5AA 4MRMB 3TO5A 3GL9A 5FWXA 4ZJPA 3HVRA 1DJMA 2ID9A 3OM1A 4LRQA 4IRXA 3DGEC 2H3HA 3QLTA 3P9YA 4Z0NA 1U2QA 4IMIB 1YMVA 2FMKA 3HEBA 4MPTA 5ABPA 1NXOA 3OMWA 3TMYA 3QLUC 3JTEA 3ILHA 3EULA 3Q15C 2O20A 3NHZA 3HZHA 1FSPA 4F3TA 1BDIA 3EODA 4YR7A 2PKXA 4UHKA 1E2BA 4QPJC 1NTRA 5BRAA 4GNRA 1JFVA 1SRRA 1BDJA 1MIHA 3H1GA 2R47A 2W42A 1KRWA 1GCAA 1A0OA 3BBLA 3CZCA 3Q7TA 4XAQA 1JLKA 3EDCA 2F8SA 2FEKA 3LKBA 5KQMA 3HJFA 1YS7A 4L4UA 2QXYA 3Q7SA 2PL9A 1YVUA 3A10A 1OXKB 3KKEA 2L2QA 3SAJA 2QSJA 4G0MA 2FEWB 4YO7A 1UDRA 1DCMA 3URMA 4QYWA 1P6UA 2YHAA 4QICA 1XWWA 2IDMA 8ABPA 4OG2A 4NCBA 5HKOA 4RY8A 4ETNA 2PMCA 2FMFA 2FQXA 3OMXA 4N0PA 4N41A 3HDVA 3CU5A 4TLLB 1NXVA 2NUBA 1QO0D 2N9UA 3O2JA 4CBVA 1DBWA 2QV0A 4RK1A 3IP6A 2CD7A 5BR1A 4YCSA 1DC8A 2FSPA 4P1ZA 2E4XA 3OQMA 2IPAB 2A9QA 2OENG 4GPAA 4ZPJA 2BGGA 1Z13A 4RK7A 3O21A 4JB2A 5BRJA 2M98A 4OLBA 2WWVD 3LOPA 1JWLA 3HXMA 3SY8A 3O1HB 1URPA 1EFAA 4IMJB 5IUKC 4EYGA 5E3JA 3H5LA 6ABPA 2B4AA 4MS3A 1NXTA 1C4WA 2QZJA 3N0XA 3H5OA 4KREA 3Q9SA 3RVPA 2FLKA 2J48A 3N75A 4YP9A 5JS2A 3TX6A 1T34A 3FFTA 1DRJA 2CHEA 2PUFA 2QU7A 3IPAA 3A3KA 3KSMA 3T95A 3RVMA 4D74A 4G0ZA 5CNIA 4RDCA 4Z99A 1E6KA 4TLMB 4H60A 3H6HA 4KPYA 3OLWA 3K4HA 3GV0A 3N0WA 4MQEB 2VUIB 4WZZA 5KQLA 2HSGA 4LDZA 3SQNA 1GUDA 3KG2A 4KK4A 4KVFA 1P2FA 3MIZA 4EVSA 3K9CA 2IYNA 4MQFA 5B3JA 1Z17A 5IUNC 3T6KA 2FN9A 3LFTA 1KMIY 5F64A 3R0JA 4G0XA 1JBEA 1DBPA 4RY9A 4NCAA 3JS5A 3CZ5A 2LIVA 2E4WA 1YTUA 4S05A 4MS4B 4Q7EA 3RVLA 4W5OA 3LUJA 1TVMA 4G0YA 5TQ0A 4RK5A 3W9SA 1QP7A 4RKRA 3CS3A 3LUHA 3TB6A 1F51E 3KJXA 3JY6A 2QR3A 3KLNA 5T3YA 4MRMA 1YIOA 6CHYA 1JYEA 3RVQA 3NNSA 1DP4A 3HSYA 4RK6A 3TD9A 1AB5A 2X7XA 3NBMA 3EAFA 3I42A 4EVRA 1EHCA 1YMUA 4WWHA 4S04A 3RVNA 3A0UA 2JBAB 5JNVA 1Z12A 5DTEA 2NT4A 5TPWA 5DKFA 3DLHA 2JVIA 4LE1A 5EWMB 1L5ZA 1JH9A 1E6MA 1Z15A 3HV2A 3OLVA 2MYUA 4MLCA 3O74A 2R4QA 2RDMA 3EQZA 3NHMA 2RJOA 4PE5B 4EYKA 3CG4A 3CG0A 4KMRA 3IP5A 4IGAA 1ZH4A 3GBPA 2MSKA 4F12A 1D2AA 1NY5A 4KQ9A 1JFTA 1ISRA 2E4ZA 2PUGA 4RKQA 3CNBA 1H9CA 2VUHB 2VK2A 4PYRA 4Q6BA 4Q6WA 2M1ZA 4LE0A 5IBQA 3SG0A 4G86A 4ZMSA 4KFCA 4W5NA 1OXBB 3LUAA 1U8TA 3M9WA 1BDHA 2RGYA 1USIA 4LDAA 2FLWA 2MYPA 3M6MD 5B3JC 2PLNA 2GBPA 4KV7A 1U0SY 4MQFB 1D5WA 2JCGA 2MSWA 1NXWA 1TLFA 4Z4GA 1F4VA 1BVHA 3QEMA 1JL3A 1M5UA 4M88A 2FQWA 3ILYA 3F6PA 3GWGA 1MB3A 1JDPA 2HQBA 3QEKA 5T7BA 4L85A 4MS4A 4RXMA 4EVQA 4OBBA 3HCWA 4JOQA 4Z4FA 3BILA 5JS1A 3GT7A 3OQOA 3QK7A 4JP1A 2HPHA 1Z2DA 1RNLA 3E3MA 1DBQA 2F8TA 3HO1A 3F7NA 1MB0A 3LUGA 4PZ0A 3RH0A 3QLVA 4FB4A 1RZRA 1KRXA 1D1QA 3UKJA 1J56A 4H3KB 1DZ3A 2FTKE 4Z9AA 4D6XA 1VKRA 3E61A 2FXIA 1GUBA 1DC7A 1EWKA 2HJ9A 4KZKA 3CLKA 1PUXA 1TMYA 4MR8B 1QKKA 3O1JC 4H3HB 1U2PA 4PEVA 4WUTA 3C3KA 3LUFA 1FFGA 3FMVA 1K66A 4W5TA 4UHJA 3UK0A 2ID7A 2NZVG 2IKSA 2QVGA 3D8UA 4N76A 2XDYA 3GYBA 2QVCA 2AYZA 4YWHA 3GA5A 3RVKA 2I6FA 5TPZA 4F06A 4EUKA 5CNJA 4Z4EA 3HM9A 1D1PA 3L49A 2E4VA 3KYIB 1P8AA 2A9PA 4JASB 5FWYA 1QQAA 4RS3A 5IULC 3DLBA 3KS9A 4ETIA 3OO0A 5HM6A 2FVYA 5IUJC 5JNRA 1LJUA 4HYEA 3EJWA 4MR9B 1C0EA 4EGSA 4OLAA 4MS3B 1MVOA 3QELA 2HQRA 1USGA 5TQ2B 4W5QA 3MYYA 5KWSA 1A04A 4N0QA 3RVRA 4O5AA 2PJUA 3MF4A 1Y1LA 5JNSA 3A0RB 4WT7A 3HDGA 1DCKA 2YHBA 4E7OA 4RK4A 3HUUA 2JRLA 3FFWA 4N47A 2MYTA 3CRNA 1WETA 5KC8A 5TQJA 4RK0A 4LE2A 1LK0A 5IEBA 1SXIA 2WRZA 4Z4IA 4MQEA 2FEPA 4WXEA 1ZITA 4MR8A 5FBKA 3B2NA 4MGEA 2PUAA 3VNAA 3N6VA 2JBAA 2V0NA 4EYQA 4JB0A 1Z26A 1W9HA 3DZDA 1ZGGA 3H6GA 3JVDA 1PNTA 3O2QB 4PICA 4RWEA 3O2SB 5GQSA 5JNWA 1DCFA 2FQYA 3LUKA 2NT3A 5ED4A 3HUTA 1ABEA 4E7PA 2R48A 3DGFC 2OQRA 5TQ0B 2MYNA 2ZAYA 1A2OA 3N8IA 5DGCA 1RXEA 1RXIA 3KLOA 5KI6A 3EGCA 4RY0A 1FQWA 3KTOA 4JA2A 5EWJB 4DN6A 3M9XA 1YK1A 5CNMA 5CNKA 3H5WA 3OLXA 2LP4Y 1D4ZA 3OLYA 3VNBA 4YRZA 4W5RA 4YS6A 3MA0A 2IPNA 3CHYA 1SXGA 5D2CA 1JX6A 3G85A 4KQCA 1M2EA 3BREA 4XFKA 2LUOA 1QQBA 2R25B 1KGSA 1RPJA 3H5VA 2WJAA 3C3MA 3LKVA 2NZUG 4NV3A 3MQ4A 1GLGA 1Z16A 1RZRD 3JPYA 4G0OA 1BAPA 3FFXA 1R8JA 1JFSA 5GOTA 5C5EA 2PE5A 4DADA 1PNRA 4Z9BA 1EWTA 2L18A 1QPZA 4G0PA 4MAAA 1M5TA 4F8JA 5HSGA 3JPWA 5BQ3A 4KNYA 4JAVC 1FFWA 1XHEA 3OLZA 4MR7B 1W25A 1GCGA 3BRSA 1HEYA 1DRKA 4IILA 4KK3A 1QP0A 4HNQA 1ZVVA 3FGZA 3QELB 2FMIA 1EAYA 2VYCA 5CHYA 5TE9A 2JVKA 4DQDA 2LBPA 2FW0A 1TM2A 2IPLA 5FWXB 2B1JA 3LUCA 4RV5A 4YV7A 3FDFA 5IEJA 3I45A 2ZWMA 1BA2A 2E4UA 2PAFA 3QX9A 1CEYA 2CHFA 5EWMA 1ZY2A 5TPZD 7ABPA 1USKA 2P4UA 1QP4A 5FWYB 3SNKA
chains in the Genus database with same CATH superfamily
4U9HS 1MABB 2QLFA 1J25A 1PR2A 1U8CB 1AZLA 2J3HA 3AR3A 2OQIA 3LMKA 1FMTA 2WMYA 5GONA 5A7HA 1UBEA 4AJ2A 3ROTA 3VV2A 3GP8A 4DR3B 4YK7A 4JIMA 1SPBS 1Z8DA 3F6CA 4MAFA 1A1VA 2QP4A 1BKSB 2JKZA 2BKUA 3JALB 4V39A 3R75A 1CK4A 3NC4A 2XOXA 3EAQA 2C1XA 4HDRB 4MYRA 3VNVA 4EG7A 1UKZA 3DDOA 5LWQA 1IHOA 1LS6A 2BONA 2BH9A 2UVDA 5TV2A 1GU7A 1FFSA 1NA5A 5C35A 5ISMA 2ZUUA 1Z07A 4LBWA 2AN3A 1U4OA 2HSDA 5E6UB 5JT1A 3VPXA 2CUNA 3ETEA 1QE5A 4PCVA 3ODPA 5EFZA 3BH0A 4LFAB 1LBSA 1EP2B 4OHFA 2V0CA 3FPHA 4GMFA 2GCNA 3LFUA 3NNDA 4U7FA 2WTNA 4PAWA 4YGXB 4YRDA 5K2MA 4ZK6A 5DGIA 1U11A 2H2DA 2VO1A 5BMOA 1ADYA 1NBWB 4E33A 4P0QB 1H94A 2P2NA 1M34B 4MCAA 3U56A 1VDZA 4KJZA 1GQ2A 1NX9A 3GJ5A 1OVGA 2B3DA 3L0YA 5SY6A 1M2VA 3RUDA 4RLFA 1GPWB 4IEEA 3HO6A 3O8NA 4X7MA 4ZKEA 1A7KA 2CDCA 4BDSA 2PK3A 3GFRA 5L3ZA 1T5SA 1DC6A 1Z28A 2DQZA 3WNQA 4C9BA 4FYIA 4JQSA 3IESA 4MYCA 3W3AH 3PQ6A 4PONA 2HPAA 2P68A 3ZGNA 5A4AA 1ORRA 3CUYA 2AUNA 3R9XB 1SIWA 2X22A 4CYMA 2RHCA 2ZR8A 3KKPA 3P1JA 4HGOA 2XB4A 1HDCA 5CT4A 3PXUA 1XT6A 1RJ9B 4EL5A 1QMGA 2YWDA 1G55A 1TAGA 4U2CA 2OXTA 4KXFB 1Y5IA 8OHMA 5AI0A 2KMLA 1Y37A 2QJFA 1I24A 2YYAA 4Q37A 5ADHA 5AM5A 1I4EB 3GJTA 2K7ZA 5JUWA 1JZTA 2O23A 3DBHA 2DB3A 1MEJA 4YRBA 4NNJA 4UCWA 2M6KA 1WUTA 2BEJA 4HWOA 4I4IA 4LC1A 1QH0A 4TLEA 3DMPA 4LXYA 5DM0A 3FSJX 5JO9A 3STUA 2WYUA 4A4DA 3RS3A 2VHJA 3TLCA 1F2UB 1Y4AE 4RXTA 1QGAA 2R7MA 1QQ7A 3JQ6A 4HVTA 5BOVA 1E99A 4L4YA 3RRXA 5K6AA 3UXYA 3K9NA 2BCEA 2C00A 3CZMA 1S2NA 2LCFA 3IUPA 3ADPA 2QN7A 1KDVA 1BX3A 3L8GA 5GAJA 3WQQA 3G2NA 3O83A 3GJYA 3CLUC 4TL9A 4FE4A 5G40A 2X40A 4MWSA 3S5JA 1OKKD 5I51A 4HZIA 5ELXA 2LRHA 1WBDA 3MOIA 1W75A 3ZJUA 1PV4A 2R6CA 2RB4A 1H3EA 4X93A 3PQ7A 5JI3E 2BZGA 3WV5A 3I61A 2OZVA 4F11A 3OPYI 4I1PA 3NLLA 2ZRIA 3OPQA 4LEIA 4O4JB 3IBSA 3MJSA 2YNMD 3C48A 1RW4A 2EX4A 1GVNB 1T0HB 2DG2A 2GPWA 3A2NA 3UHPA 5EWLB 4D6PA 2ZS7A 1A1SA 2G40A 1WVGA 2OXRA 4NBRA 1KYYA 2O1XA 2VTKA 3VR3D 4ZZ2A 4FPXA 1B8NA 5KNBH 3ZZUA 2ZPAA 2QMZA 4OKNA 4TXHA 1WB9A 1C7EA 2JLUA 4OUDB 5EIBC 5JCJA 1DJMA 2A84A 3FTPA 3DBLA 1NMQA 3R0XA 4XJVA 4RENA 2FHSA 3I05A 1O54A 1U2QA 4D9BA 1YMVA 2O0KA 4FFLA 2Y27A 3E8XA 3N2KA 4QXQA 4F4IA 5DNDA 5EUBA 5EZYA 1IXZA 3JTEA 2C2KA 1IB0A 4GGMX 4PSCA 1WW8A 2NU6A 2O20A 2Z9CA 1HDYA 3CVOA 3IT1A 4QGAA 4BFVA 4CU5A 2WPDD 1PZNA 4CCYA 5CXQA 1E2QA 3BB3A 5ITVA 4ZYYA 5HNKA 3KKKA 3WBJA 1M1NB 4BNKA 3BWVA 2IHTA 2XCOA 3R3HA 2QN1A 5JC1A 5K8IA 4X5OA 1DO8A 2F8SA 5E3HA 5KJ1A 1ZA1A 4OIMA 4U6NA 5KQMA 1GPAA 5BSWA 5E6RA 3G68A 1I2BA 4LVCA 1YVUA 1D0VA 2PBFA 4IX1A 1VJ1A 3KJQA 3DULA 3DWGA 2XB8A 3GMSA 4RF3A 4D9EA 1L5RA 1ZINA 4IUYA 1N6HA 3EZ7A 1ZWLA 4BRSA 1U5BB 1YHZA 1FU4A 2CDAA 4H4EA 1IUPA 3ESQA 4UARA 2WV7A 3O94A 4DWJA 4Z54A 1YB6A 3NEAA 2ST1A 2IUEA 1KIAA 4MDYA 3KKLA 2J0SA 1Z2CA 4QBGB 4F7DA 3DVLA 3ROGA 2I9KA 3LBIA 1E60A 3R9KA 5I4IA 5LJIA 2ODBA 5IBPA 2WM3A 2JAPA 1BDMA 1X7DA 4OHYA 5F1YA 1HO3A 4MDFA 3PHGA 4UHBA 3FPCA 5LP1A 2QAIA 2PRYA 1CETA 1RI3A 3ND8A 5AKHA 1PJCA 1XKTA 4RLHA 1L0BA 3BT7A 5F35A 1RLIA 4FMDF 3LWBA 4X1YB 1JSZA 1WXFA 5AM0A 1OXVA 1FDOA 4MOWA 5C51B 1F0YA 3DKVA 3DMTC 1YJQA 2OK7A 4G56A 4JB2A 5BRJA 3CONA 1M7HA 1T9AA 1MO6A 4EMUA 3AUSA 2GARA 1C0PA 3JQBA 4UBNA 4CUJA 3HXMA 1JU3A 4PYJA 2HMWA 1UK6A 4TL7A 4I0WB 3JQAD 5E3IA 3REFA 1X92A 1ZD3A 2QX7A 4XGQA 1CUDA 4RM2A 2J48A 2D0PB 1F4LA 2G0NA 5HMMA 2ONKA 1KZ1A 5ER9A 4UEKA 3IKMB 1KO8A 4U5QA 1K6XA 5EJFA 4JI1B 2EYUA 3OX2A 1W35A 2XUAA 2HLPA 2ILVA 2MR6A 2WYHA 3CN9A 2DETA 5LC1A 4Q47A 4BBZA 4D74A 1VP3A 3IP8A 3GLQA 4DCPA 1E6KA 1K2WA 3V1NA 1R66A 2W2LD 2V4MA 3UANA 4O02B 2BC9A 1VMEA 4RCZA 2GPBA 3WI7A 3N0WA 1K27A 2R8YA 3SQNA 1O0SA 3PCXA 1IJEA 3WIUA 4XB1A 4EB3A 4NPAA 5AW9A 3MMSA 3JQ7A 1XNJA 2R1VA 1LSOA 1YR7A 3H42B 2O2HA 3C7DB 4LQDA 2AEJA 4NCAA 3R5FA 1YE8A 3OLCX 5C3MA 1CUYA 2ZFUA 4C7OA 4GM4A 2Q3CA 4MUMA 1D2EA 4BGVA 1H0KA 4ESEA 1Z75A 5EE1A 5TQ0A 4K28A 3ZQKA 4ZYUA 3VBEA 4P0PB 4JBNA 3VAYA 1Y4DE 5EESA 1TW3A 4QXAA 3BDVA 4MRMA 3D7NA 4TKZA 3ILSA 5JSYA 2G77B 5EXXA 1J5EB 3TRDA 1WXIA 4FGKA 4Z9XA 2JL1A 2BEKA 2IYFA 1OZAA 2W37A 3EMDA 3R5KA 4REQA 2WU0A 1DXQA 3G5AA 3OEEA 4GMXA 4AMZA 2D2EA 3M6XA 4Z8XA 4J6EA 3NOQA 4WWHA 3DLAA 3SS9X 3N5CA 1C30A 2G06A 2P6PA 1SK9A 2GB4A 2W93A 4YMTA 1QSGA 2JVIA 2PX2A 1P0MA 1RIFA 1UIRA 3HRHA 5DK6A 2PBLA 4BNLA 1PTKA 2HXYA 2MYUA 3LVBA 4TLCA 4KO1S 2Q1SA 2O7VA 3RU7A 4Q4LA 2Q5IA 3TVDA 2WJ6A 3OAAA 4DR2B 4B1FA 1ZOOA 3VU0A 4JJ4A 4UU1A 1CUJA 4PG5A 5GV8A 5CM2Z 2Q62A 3I8XA 3FLMA 4GZMA 2PUGA 4DIBA 2GLXA 3DL0A 1WEKA 3S2EA 4QJ4A 1WZIA 1B6GA 1FNBA 3KLBA 3JARB 4L28A 2WINI 3M9WA 2R3SA 4CKBB 4V0ME 1HX7A 3ROMA 1GUFA 1I5OA 1PGNA 3MD9A 2BGLA 4NBKA 1XRQA 2P7HA 2FR8A 4NAVA 4YVFA 4ND5A 4BNTA 5KYWA 4BO3A 3E5NA 4P7FA 2QV7A 3WAGA 3P27A 4NMLA 1V11A 4HD8A 4US0R 4F6CA 3I73A 2JD0A 5JOQA 2W6CX 3IQHX 5IZCC 1A7UA 2FWIA 2EBUA 4W1SA 5BY2A 2GJ4A 4Z4FA 2A9JA 1QFYA 2X9QA 4JL6A 4E0BA 1OWLA 2EGGA 3UUEA 3KD3A 3I5UA 5DTMA 4IYJA 4KIGA 2ZVDA 4BQEA 1DUSA 3WLFA 1DBQA 4TV8A 3A9VA 3F7NA 5CFOA 2IRWA 3GCWA 2VPXA 3QLVA 1PR1A 3EISA 3CF6R 1ZM9A 3Q3JB 2ISQA 4FHGA 1NYRA 5EN4A 3Q5GA 5LYJA 3LYHA 3W7AA 3CRQA 1IDN1 1V4NA 1C9YA 2C9BA 1RCFA 4EGJA 4UVGA 4K9SA 4K9NA 2WAMA 3E05A 4UCFA 3QXCA 2DSTA 1NASA 5C18A 2H1SA 1LPPA 4MVJF 4RJIA 2ZT7A 4H3HB 1Y89A 2XNDA 4H31A 1B2RA 4E5NA 3AW9A 4BNFA 3QXSA 2C8JA 1FFAA 4BZQA 4WOBA 3OIDA 2X4LA 1CB0A 1MA3A 2ZYTX 4HN9A 3ZU2A 4DIFA 3VZPA 4K6KA 4J1TC 3RJZA 3JAWA 5CT8A 2IKSA 5EI5A 1UADA 1CY8A 2CXPA 3ZUGA 2GBLA 1WSBA 4I5DA 1ZI9A 4R5HA 3AESB 1WF6A 1M6VA 1RS0A 1ZBQA 2QRNA 5FNVF 1N3LA 1AGXA 2XUGA 4DFDA 1RXWA 13PKA 1G4UR 5HXAA 1A4RA 2QNBA 4EKNB 1SC4A 1D1PA 5FQOA 1PJ3A 1T5LA 3A6ZA 1PV1A 1ZRHA 1V16A 1B1AA 2H7XA 2WTAA 3PRJA 4IG9A 3WGNA 4ZHQA 1EUYA 4YB8A 3HXQA 1O9BA 3UMSA 1DWUA 2WSSD 5CLGA 4XWTA 3PC4A 5E1OA 4RTJA 4XB2A 5NLLA 3QEBZ 5KOHA 4V0RA 1LJUA 2EIHA 1ONNA 4ZJZA 3L0SA 2WYIA 5DWDA 3H2KA 4YAKA 1GCOA 1KVUA 3ECCA 2I6GA 2XDWA 3OY7A 2YJZA 1TEZA 2HQRA 4L15A 4TWRA 1Y9AA 4AYTA 3P0EA 5FBWB 3T3DA 1PYOA 1T1JA 1X8KA 4FD2A 3EVTA 1XVAA 3MILA 3NOVA 4QQNA 1LQUA 1ZSNA 3BWYA 3DP9A 1NQXA 3M4JA 3D3KA 3DZGA 3SXUA 5ITWA 4NYMQ 1H42A 1XLTC 1YKSA 2A3NA 1G1AA 4OK5A 3NIBA 5BW5A 3LYLA 2NTYC 2GEJA 1X0VA 4GOXA 2NACA 5JH7B 2VWQA 1SVWA 2HT6A 4UPVA 3BGIA 3T52A 1KOFA 2DCMA 2WDPA 5LP6F 2PUAA 2Q9UA 2GUWA 4X45A 4NHOA 3KPWA 3KU1A 1TM7E 3RJ5A 3VFDA 3BRWA 1Y6JA 1BHSA 3D8TA 4B76A 4YEDA 4R7ZA 1U3UA 3O2QB 1NRJB 4WRRA 4BNDA 3DUFA 1WVIA 1NBOA 1KY5A 3L7NA 2NYAA 4IDPA 5A9SA 1PIWA 3E9YA 4AS2A 4K9KA 1C1XA 4TZKA 1SK8A 1XFDA 3DZBA 1T9DA 2CT8A 4ZEXA 4W8HA 3G1UA 3N8IA 3SEQA 1V9CA 2QW8A 2V97A 4Q7QA 5IAEA 2E1PA 1L5HA 5C32A 4RY0A 2PDAA 1G8GA 2FF7A 3C3EA 4JA2A 4KGZA 4IHKA 3CEMA 3SKVA 4EAAA 3U7FB 2J31A 2K2QB 1HMYA 1GZUA 1FJGB 1P31A 4K6OA 1D1TA 3PHLA 2Z6VA 4BGDA 2MSNA 1EG7A 1MD9A 3LY5A 1Y7LA 2B4KA 3B6ZA 3ESRA 2F9MA 3KX2A 3ORFA 1D4ZA 4AO8A 3F3SA 4ZT2A 1ZUNA 4S1OA 1AKQA 4PBTA 4WZBE 1KEEA 5HCUA 1Z4MA 4JU9A 5ECDA 3P5SA 4QECA 3ZCPA 3FD8A 2BM0A 3I2YX 2CEKA 5DNVA 2XZDA 4WVLA 4UBIA 4MI3A 3DW3X 3CW2A 3FUCA 4WFKA 2OBMA 3VR6D 3D4LA 1JDBB 4OQXA 4PSUA 3H19A 4IVRA 3MGAA 2IZ5A 3QKUA 1H65A 2F4NA 3QKRB 5EQFA 4EPRA 2H5LA 1GAJA 1GNQA 1UJMA 4G0OA 1ONOA 1OIXA 5GOTA 1CS4C 4BNNA 2DFTA 3DEFA 3D3WB 5HR5A 3P4YA 3AL0C 1Z22A 4HH4A 2P9YA 5BQ3A 3WP1B 1AN0A 2UXDB 3OLZA 3HU1A 2ZRQA 2DC1A 4QO8A 1NI3A 4KR7A 2B61A 3B85A 4BCDA 1R12A 1LU9A 2WUWE 3NATA 4X20B 3AJEA 3EGDB 1N2CB 5CHYA 3D43A 4BX3A 4I6EA 4YXFA 5ECWA 1Y5MA 2BLLA 5B4VA 4JI4B 2PCLA 1TTQB 1UAAA 4JJKA 4YRSA 3MTGA 1JQ5A 2W90A 4XCXA 4IWYA 1DXYA 1QZ3A 3AFOA 3D7MA 4IZ6A 3MFQA 1VJRA 3U9TA 2ZWPA 4JXJA 5G53C 5CFLA 5JNUA 1GVHA 3WXBA 5JZMA 9ABPA 3EWIA 3PUWA 4BFXA 2D6FA 5B7GA 1SZCA 3ZDAA 2I8AA 3M6VA 4ZVTA 3QOWA 4DKJA 1ULHA 2P79A 4C7OB 8MHTA 4YAOA 2CYBA 5HUQA 1E59A 4BLWA 2H2IA 3FSRA 2KBFA 5EP1A 5H5JA 5MHTA 2WYVA 1N2IA 2NO9A 2XMZA 1JZSA 3ZX4A 1KI9A 4BO2A 1ISMA 1VPVA 1WUIS 2Z5GA 4NENA 5PNTA 1R8QA 4DSAA 1KFBB 4LCJA 3RIXA 4Z4CA 1P2UA 1HQYE 2A9RA 1EVLA 1Z6PA 1IQPA 1N2GA 2WWRA 4IF6A 4HRAA 2AXEA 3FOWA 1CQJB 4L8WB 3DCJA 4NICA 2E5LB 2RGDA 4MVJG 4ROSA 1L5SA 2OL4A 1ISIA 3WGZA 3DVAA 2VAVA 3W77A 4D8TA 3UG7A 1U63A 3MIIA 3GLFA 4KBGA 1QQTA 1CIPA 3GQBA 1JDSA 1PJRA 3WDSA 1CY4A 4QARA 3AVTA 4N03A 3IMCA 2AFIB 4BHTA 5KWEA 3IVCA 1C80A 2P6UA 4WERA 4HCJA 1E6CA 5EZ6B 1KRHA 3ZE8A 2UUOA 2J0QA 1CUWA 1O95D 1H0HA 2F55A 1ZX1A 4GOOD 3UJPA 2ZS9A 2IDJA 2YS7A 2OM2A 3LPCA 1G5PA 1E7MA 3V6LA 2A0YA 5EHXA 1OW3B 5E9JA 3M8KA 1H1LB 4PFKA 5LVAA 4MS1A 1ECBA 3EQ6A 3DDSA 1AX9A 1CUZA 4CM6A 2ZUEA 1R8XA 2D8AA 2DQKA 2C78A 1YZUA 2WE8A 2G09A 4EO4A 4WFQA 3RYIA 4PRZA 3HV0A 3M3HA 2X23A 3QV1A 1NOJA 1VBKA 1XAJA 4F5ZA 3AP1A 4ARUA 1YI8A 3ZC3A 2C7QA 4B3RB 3PJFA 1K08A 3WRYA 1RWVA 2QLNA 4I7EA 4RD6A 3RTAA 2GMWA 2JIOA 1XRLA 4ZARA 5IYZB 2CVZA 4B3SB 3F90A 3JWEA 4PCAA 5H83A 2DFVA 3GGSA 2Q5FA 4TRRA 2XAUA 5EKUA 2AR0A 2BSQA 2QLLA 3JSXA 5C46F 1C0KA 1MBZA 2YWXA 1GGNA 1SCAA 2BFCB 1LZKA 4H3SA 3BUSA 3EHDA 2OC9A 3Q98A 1XZ8A 1YL5A 1MABA 1MRZA 1JFFA 4ZU3A 1V5FA 2FYTA 4GKJB 3DUWA 2F9FA 4O4JA 2JAQA 1NZDA 1JG3A 3OD1A 3EVZA 4QUKA 3AG6A 4ITVA 1U0OC 1JI3A 3SXPA 1P6QA 4YRIA 2P0EA 4WJZA 4Z3KA 3I09A 1PQWA 1PAUA 1T5HX 1Z8HA 2GXQA 2JZNA 3CT6A 1P74A 2VUUA 3FPKA 2VAPA 5D01A 2YMMA 3CX3A 3FOCA 3KJZA 1LQTA 1W0KA 3H2HA 4JMLA 4MS1B 2G0AA 3GU3A 4PLHA 4RBNA 4XLTA 1GADO 3H16A 1WV0A 1FB5A 2WD7B 1MOQA 5HOQA 2EFDB 4OJQA 5A5DA 4KOEC 1EU1A 5IZ4A 4LRTB 4Q19A 5JPIA 2PSHA 2OMEA 3KL4A 4X0EA 4EW1A 1NAIA 4B8WA 1T9GS 3K2IA 5HM8A 4MQLA 2Y93A 1A9PA 3HI6A 4B75A 3H8WA 1XZMA 1RJ9A 3CPEA 3KZ1E 4WE3A 4KRXA 3UH0A 3HYRA 2EKBA 4HDMA 3M4YA 4XRRA 1I3LA 5FWXA 3TO5A 3WLIA 4MXDA 1I13A 1S2DA 2GILA 2QGNA 2OLJA 2XE7A 3QLTA 3MCTA 1XTVA 4GXNA 3RYFB 5CA1B 5I7WA 3G5MA 2DWCA 3LLCA 1SUWA 3U4DA 2X8JB 1G21B 1MHPA 2Q49A 4PX3A 1PE0A 1X1DA 2RH5A 3GZ4A 4D4IA 5TB5A 4D9KA 3ILHA 4O4IF 2AVNA 3X2EA 1UBCA 5DXJA 2Z2KA 1YVDA 1WW2A 3CUUA 1KORA 1TXGA 1T8RA 4J03A 2CXUA 5L8VA 3HTXA 1UAYA 4TSFD 1NTOA 4UHKA 5JS7A 4IO0A 5FUWA 1OAOC 3ICQB 4C5CA 2CJWA 2WG0A 4GNRA 3RRYA 1JEYB 1XYYA 1NT4A 2R6R1 1DQNA 1NHWA 3HXPA 1M1ZA 4N0DA 4DSNA 2Y2VA 4B3TB 2GZ3A 1QTIA 2H4YA 1F9AA 2ZYUX 3N2KB 1TQ4A 2DYKA 3SXJA 1RVV1 4W7HA 2VWPA 2QBYB 2SHKA 4XE5A 2G71A 1M34A 3RSFA 1JQLB 4EFMA 1K9VF 2OCLA 3UBTA 1E2GA 5LOVA 1KS9A 2DGDA 4MPPA 1BYIA 4XQEA 5HGXA 5KHOC 2XXAB 1F2UA 3JQRA 4ARCA 1YA6A 2LWIA 2ODAA 3T9FA 4QGBA 3IUJA 2P9GA 3UA4A 1FDSA 1GU0A 2V03A 2QBYA 4RVDA 1X1RA 3C98A 3IMGA 2QXUA 1SKAA 3FYUA 2X2PA 3GG9A 5MN4A 2QAGA 4CTNA 3D8RA 2ORYA 4LOJA 4QBIA 3VC2A 3DKKA 4G09A 1EDOA 2ONZA 3NBQA 4JLNA 4MLPA 1PT9A 3HKCB 1RIIA 2IPXA 1UBTS 3PUYA 1IHXA 3FGPA 4BNMA 1E7WA 3QMVA 4KHPB 2E7ZA 4HVAA 4W5JA 1M2OB 1KSHA 4N12A 1LSUA 2ECFA 2M6SA 3DFUA 3BG5A 5B7QA 3DZKA 4PC6A 2NAFA 5FR1A 5M3BA 3F4KA 3KR2A 4IIHA 3DW1X 1MDFA 2A9QA 2H4XA 5CPFA 5DHQA 4WXPA 2XV1A 3O21A 3CLTC 1H3NA 1BJTA 3C8MA 1XQ1A 3OPNA 3AVVA 3M1YA 1NSFA 5BMVF 2EOAA 1YQQA 2K6GA 4M54A 4P0TA 1J2UA 2WZCA 5KYXB 3I2IA 3C7TA 1ZR4A 4LOHA 1ZG3A 3HWWA 2X6RA 4HHEA 2IY8A 3B13B 3WYAA 4B0OA 1VKHA 3PV0A 3TNYA 4C4TA 4ZZ3A 4OB8A 4KR2A 4YJKA 3LBAA 2CHEA 4R8LA 1S3SA 2XDAA 1FRVA 1UZUA 4XX0B 2CLKB 4JITA 2RCYA 5AW6A 1JG2A 1FP4B 4BB5A 2PJZA 3HA3A 1H2AS 2Z98A 2ZWAA 3RJMA 1PT5A 1U1FA 4XTRA 1T5DX 3OZXA 3D64A 2HT1A 4JGGA 1T4CA 2BHSA 4MW7A 5JMWA 3IUMA 2B5VA 2PSJA 3ZZ0A 1WG8A 1FVFA 2ORWA 2X0NA 4WY5A 3C14C 4CDRA 2AXPA 4XIYA 1A9XA 2K7FA 1JHDA 2VUIB 3D1JA 5JAIA 3OM9A 4HWTA 3WS7A 1WV1A 2O0MA 4BNHA 5B1EA 1P77A 5JW6A 1EA7A 4OOEA 5KTOA 3T3HA 1F6WA 4RVGA 1U7HA 4WK6A 1AMNA 2NP7A 4LYEA 1KU6A 1Y48E 2AX4A 1KHTA 1O94A 4PHHA 3W5VA 3VZQA 3U5ZB 1MN6A 5G4KA 1NBIA 1YI0A 1T9KA 2JHCA 3SLGA 1WCYA 4NFSA 3EYAA 4GFDA 4FGLA 2JRCA 4O25A 2QR5A 5C34B 4CMCA 4R7GA 1K7YA 4QLBA 3N59A 3OHPA 3UMFA 4WZAE 2HA7A 2OD7A 2QMHA 3RBVA 5CA1F 4IJ5A 3AF6A 3K9FC 1BE8A 4Q9LA 3SF8B 5DLPA 1B0ZA 2CSUA 2DUMA 1AB5A 4EKIA 3NBMA 1U0NA 2GEFA 2SNIE 4EF6A 4ZXFA 2WAXA 5DEOA 2I7DA 4MJLA 5BMVB 1XV5A 3ESCA 1KE1A 1NP6A 4QG3A 2I2DA 1H85A 4QLOA 3VVMA 1TQ2A 4PE5B 4FTWA 3RBAA 5COBA 2R4QA 2TMKA 3E58A 3EQZA 2P91A 1MLDA 4RX1A 4U2FA 2WTUA 2P6NA 2XNSA 5D84A 2YKGA 5C4MA 5FOQA 2WSSA 2JLZA 2ZPUA 1QVWA 5LKRA 4JXZA 3KXPA 1BNCA 1D2AA 2DPMA 2IF0A 3FUVA 4G1BA 4DLPA 4KU4A 2C1ZA 4H9GA 4GL2A 2BTEA 3CUTA 4KAXA 1XDGA 3G2JA 2HA3A 2VDOB 3MRXA 1E2EA 4ZQGA 5FBQB 3TSAA 1Q83A 4G0WA 1GGJA 1YZHA 4MWOA 1IRIA 4YQZA 3OH8A 1E5VA 1KNQA 1RD4A 4C14A 1D5WA 3PKJA 3MT0A 3DV9A 3R3UA 4UKDA 2CNWA 5J2UB 3ZHZA 5IDXA 4Z4GA 1RRGA 2VH2A 4Q3CA 2H1VA 2EIXA 1OXTA 2FF5A 2AX3A 1YS4A 3L84A 4LVOA 2BI7A 3SC3A 3TL3A 4C0QC 4CF4A 2ZYRA 2F00A 2C54A 5DNAA 5AI8A 4L57A 1SKMA 4YDRA 4PX9A 3LT2A 2J32A 3BWXA 3I58A 3E3MA 3D8HA 2R6GA 1JIQA 4V24A 3KHKA 4CL3A 1GGKA 1W2HA 2HU8A 4KN9S 3ZS9A 5JZSA 3GG2A 4B4UA 1LBEA 2Z2IA 4ATNA 3WLKX 3FNHA 1XTTA 5J47A 4FQ7A 1GSAA 1DHRA 2JFUA 3GFTA 4GI7A 4KDRA 5KTTA 4HEA6 2OPBA 2JARA 2C61A 2IHYA 2J5QA 4YRQA 1AU9A 3PDIB 4GDMA 4WFJA 3TOXA 3AUYA 1MB4A 1EFDN 1P72A 1T5TA 1QKKA 3CLSD 3KOWA 5FUQA 1E2PA 4GOND 3M33A 4C0WA 3KHSA 5C3UA 1AV7A 2PA3A 3LUFA 2CVFA 1XEWY 4TYQA 1MKYA 2A7XA 3W6ZA 3R9XA 1W49A 1V71A 2QTBA 3UK0A 2WBLC 2BI8A 1ESEA 2VH5R 4A36A 3R3YA 4LRXA 1KNXA 3EXG1 4EG8A 4B85A 1E2NA 1T36B 3IEXA 2GJKA 4K6FA 2RHMA 3TX2A 1XROA 4IVNA 4FJ1A 4TL8A 5ED0A 4MWTA 5AJXA 4UEOA 3U4AA 2HXSA 4BKUA 1GUYA 1DMRA 2RGBA 1XP8A 4FHCA 2NUTA 2C4MA 1ZM7A 2RD2A 1EQAA 2ZR0A 3KYIB 2CLIB 2PT6A 1QIJA 4PXSA 4W1QA 5J4VA 4M6WB 1MV8A 2CBZA 1YQWA 3DXFA 3TXXA 2HL6A 1U2DA 3IX7A 4HRVA 4HYEA 1BGWA 1XJCA 5C1PA 3K5IA 3OURA 4FT4A 3RT1A 2UZ4A 4K0KB 3DPSA 4FQ8A 3LLSA 3O7MA 4MS3B 4JI8B 3D8NA 3QELA 1C7JA 4GKVA 4MQBA 3KT0A 1NP7A 1VA5A 5E2AA 3UMBA 3ZJYA 1HDRA 3UJDA 4AJJA 4BO5A 3VXKA 2RH4A 3AUUA 4KVAA 4DG8A 3RYCB 2VDMB 1PFQA 4PLWA 4ZQEA 3COYA 1RE1A 2MT9A 1SCKA 2WG2A 3FFWA 1QZZA 4U8GA 1FFHA 2AFIA 5LD2C 3RHTA 3GO4A 3MSXA 1W2WB 3VPHA 2PRKA 5GONB 1XLWA 1NVTA 1U8UA 4Z4IA 4WXEA 3B1XA 2VPYA 4ASUD 3WZ2A 5AVRA 1JIXA 1E1LA 5C7IO 3TPZA 4N3CA 1QVVA 2AZTA 2RI0A 5DWQA 5FAXA 1RLMA 1BN7A 1LBQA 2V7WA 5ES3A 4JB0A 4ZZ1A 4ZA2A 2DLCX 2A9KA 3B9BA 3CV3A 3W0LB 5JARA 1PD0A 3CVVA 2RIPA 4FUTA 3DDHA 4KQ6A 3FKSA 4RMHA 3FTEA 1F8FA 5ED4A 2CDBA 4GHWA 1Q6ZA 3MQFA 3KWMA 3BJMA 1R64A 3TR0A 1DIRA 1SBIA 2PWYA 2ZETA 4AF8A 2PKQO 2V1UA 3TUZC 4YJ3A 3KQHA 2XKJE 4MVJH 5JV5A 1P18A 3H9BA 1CZKA 1XMJA 3GROA 1FQWA 4XW2A 5BV1A 2GM3A 2FPIA 3HDQA 4HAVA 3G59A 2G04A 3ND6A 4YO8A 4DLXA 3V7FA 2Y9MB 3D4NA 1Q0TA 5MDHA 2CKMA 5FADA 2FFAA 1KETA 2GZAA 3MHPA 5IT9A 3OUTA 3CZPA 1WBBA 3OLYA 4LXXA 1D9XA 2PUTA 2Q8PA 3BMOA 3MA0A 4PR3A 3MTJA 1LLQA 3IEKA 3VOTA 4R84A 4CTJA 5DW0A 2SKCA 3OEED 5A6VA 4PO3X 2JGMA 1P0PA 3TXAA 4Q9AA 4DC1A 1P1CA 3KQKA 4IOMA 1UC8A 3VR5A 5EHIA 1VE5A 4MVXA 1XEWX 3PQ2A 2I71A 2EEPA 4ON9A 5ALKA 4KW7A 5IM5A 2DT5A 2NPFA 3X1JA 3PLRA 1YQXA 3R7WB 1N2BA 5LXTF 4I19A 4CW7A 3CVWA 3JWPA 4JL5A 3MFYA 2EKDA 2SCUB 3FSGA 1X8JA 1C8VB 1IHPA 3N8NA 5TY0A 4RV9A 4GPEA 1J8FA 3NHAA 1JQKA 4AICA 2V4UA 4N7RA 4RC9A 2V59A 3ZN2A 4BOYA 4NCHA 2XDQA 3GJXC 4P22A 1LNSA 4HNQA 3EQ8A 3LWNA 2BEVB 2D1SA 3P9SA 4DA8A 4R9NA 1DFGA 1V3QE 2CFSA 4GC9A 1BN6A 2G28A 1DOZA 4TQ9A 1Y3BE 1ZJ6A 4I8XA 3U4CA 5HCIA 1AN9A 3ZLVA 5ITSA 1L1QA 5JWRA 3KEQA 5AHWA 4BGIA 2PAFA 5E2BA 1MFPA 1VFNA 2JEOA 5EWMA 2RK4A 2JA2A 2VR1A 4UTXA 3FCSB 2C5AA 5LLSA 1II8B 2OAEA 2YXDA 4PGMA 5IPFA 4A10A 3G0OA 5BXQC 5F5LA 3CPJB 1Y4UA 4RHFA 3BKXA 1KKUA 1T2DA 2RHLA 3BWCA 2UVQA 4QG7A 1KK1A 4V0MA 5AT1A 1B00A 1JXMA 1PLLA 1NE2A 3LBNA 1PJBA 2IUSA 5BN3A 4O0LA 2V7TA 2WPDA 3HCDA 5EJIA 2AB0A 3VO9A 4AXXA 1XPOA 5ES4B 3AU9A 3F1LA 1IN5A 1M2OA 3H1FA 4C87A 2HA4A 4P3OA 3R7WA 1R9NA 4FDVA 1X8XA 1TUGA 4F92B 1CYEA 1P33A 4QDXA 1WP4A 3KCNA 3MPUA 4D42A 4DIOA 3GUVA 3ABOB 4QDUA 3LH5A 2O7QA 2R8BA 2GF0A 3IIJA 2DFKB 4QDOA 3UT5B 4AY4A 4M1WA 1MGPA 3R3VA 4HPXB 3G5UA 2X0DA 1SUCA 2WJIA 2XUKA 4R6WA 3SCZA 4BUCA 1ZFNA 1MOPA 4COOA 1N3YA 1NUQA 5HKBA 4FE7A 3UWKA 3OPYB 5HPYB 2QMQA 4TKUB 3K30A 3VU9A 4EF5A 3S1AA 1PI3A 2MJLA 3CC8A 4L4ZA 2LPMA 3D6JA 3QU9A 2OHFA 3QY0A 1G63A 1OH6A 3L1IA 1WKBA 4EY3A 4FNMA 2WFZA 1PGQA 1IN4A 1PF7E 2R8OA 3C1OA 3EGXB 4KFTA 3ZDRA 1LH0A 2AZXA 1Z38A 3ZDQA 3H05A 1PZFA 4TYPA 4DMCA 5JAOA 1HV8A 3LVRE 2QYOA 3DKIA 4UDXX 5HKAA 3E0XA 3GRVA 3HQ4O 3RSLA 5IYZA 4GR4A 1I14A 1HFWA 3I6MA 5HFAA 3B1ZA 4EHBA 4IVPA 4MV5A 1C30B 1KJZA 2BRUC 4R8MA 5JBQA 3BKWA 1NQVA 3IE0A 2DFLA 1B42A 1G2IA 1ZM4A 3TGWA 1EZ4A 3KNZA 4BMYA 1D1SA 3A32A 3QLVC 1W6UA 1D03A 4UUNA 2ZZNA 4ZMRA 1XPRA 1FYWA 4WCVA 1BFUA 4P92A 4PGFA 3E9DA 2H11A 3QE0A 5J2TF 3EUAA 4C4PA 1OIVA 3O92A 3UGQA 4EI8A 4BO6A 1IBSA 1YHYA 1QGED 2PLFA 1LVUA 3FOBA 3S70A 3GVPA 3ZCTA 2LDXA 3E0QA 1DKUA 2I80A 1JEAA 3WG9A 3NX4A 4DA7A 4HYTA 4E13A 3LSYA 2ACEA 4Q3OA 1NAHA 2EWVA 5J58A 5JLJA 3PXCX 4DXHA 3IDOA 3ES9A 3K1ZA 5H9VA 4CG3A 3ZV3A 1OA1A 1NOKA 4F6RB 2WWFA 3CKMA 5F73A 4DYDA 2AHRA 4BPBA 3AERB 4HGZA 2DQ4A 3I23A 4OKIA 3WAKA 1LF0A 1RHUA 2PKEA 5F9FA 1XELA 2GN4A 4HEJA 4L16A 3Q8XB 5L9AA 1E2MA 2YN0A 5JJKA 4G5YA 1R2QA 1YDEA 5B3AA 1OT3A 1Z2EA 4N18A 4MR7A 3WK9A 5BSFA 5IT4A 3UMMA 4B40A 4Y0VA 4QEDA 3HMQA 5TVGA 2QTRA 5KWIA 3VC1A 1SUBA 1H6CA 2G5CA 2HHJA 4MVJD 2ZZMA 3H87A 4C3ZA 1XMSA 3OCVA 2V7QA 1V39A 3PRYA 4CMKA 1N9GA 2V65A 4GO1A 1N5MA 1Q7TA 4MSUA 4FD3A 4R7TA 2P9ZA 3EXFB 4RTLA 1AH2A 1XZBA 4JIGA 3LUBA 4GR5A 2H3HA 5CU7A 2OTCA 3JASB 4YJDA 4JI6B 3OCXA 2YNMC 4JT9A 7YASA 4DTIA 5JS8A 5YASA 1JT9A 1UEXC 5IM4A 1UPBA 1GKKA 4MVJM 3V2IA 1ZONA 3DEIA 3TMYA 1HDOA 3EDQA 3C6YA 3SICE 4RZHA 5IDYA 1JA1A 2YHUA 2FDCA 4DV2B 3KJHA 3EODA 5SICE 3ROEA 4MQUA 5K3OA 5MGNA 5A0TA 1E2BA 1WB5A 2J7PA 1WDWB 3C6BA 5KNDH 2M2IA 1WMBA 1QJCA 1TO1E 1TF7A 1DAMA 3H1GA 3N0TA 1LTQA 3IE2A 3QOYA 1TKRA 4YP0A 5B1IA 3TZCA 4YX9A 3JYPA 1TA9A 3R20A 1BOOA 4XAQA 3L8DA 3QVXA 2FP4A 3RC9A 1GIAA 1UP7A 1PD1A 1Y9ZA 2DH6A 4RQUA 1VIMA 2AOTB 2IX9A 3PFIA 3CH6A 4RHUA 4A82A 3K8YA 1O94D 2REQA 3L77A 3Q7SA 4L0QA 5KHAA 1CRPA 4UAJA 3Q9UA 4FEAA 1Q3TA 4Y7CA 2A0WA 1D2NA 4M83A 2XTJA 2FN4A 1Y1RA 3MB8A 4KIFA 1KKLA 2CK3A 4FKBA 3N74A 4TXNA 4IX9A 5A4IS 2QENA 1GG8A 4LVNA 3UOWA 3L7LA 2YWCA 3T3PB 3HB5X 3BFXA 2WUGA 3OFSA 4DA4A 4LTNA 1V25A 2E4AA 2PO5A 3ID6C 4FN5A 4ZDWA 4HV4A 5A4DA 3AM4A 5ILQA 3T1HB 2UDPA 4DCUA 4IZIA 4PYMA 3IPRA 4BWYA 1XTSA 1N0VC 3EGVA 4Q3EA 2VRWA 5A5VA 4M7WA 1A9RA 2XHZA 4EHAA 5KU7A 2VQSA 3F5MA 1M6VB 5M04A 3L4BA 4IAOA 4PLTA 4FR2A 4QGSA 1FNNA 5REQA 2AK2A 3DHWC 4ZALA 2BDUA 1L3IA 4Y6LA 1MC4A 2ZBRA 4BIIA 1X15A 2D5LA 1JQ3A 2NV0A 1YKFA 1I4OA 4NS4A 4YT2A 2PSDA 1QDUA 3W5BA 5H02A 4YT5A 3D0OA 2DHCA 1H66A 2NUAA 4M46A 4LRSB 2DUJA 1KDTA 3FRHA 3AF4A 4YTEA 1G4AE 3EDMA 2NVUB 1SC9A 2R87A 4GVLA 4P3NA 1WX1A 2C9OA 5DPMA 1P5ZB 1TAUA 2BM9A 4NQZA 1QONA 2YWEA 2XB9A 1MH1A 2WIKA 2ZVPX 1SULA 3C7CB 4PLGA 4V0KA 1NZFA 2IZ1A 4ZVVA 2YBEA 2PX4A 2P4QA 2D00A 1YB5A 2CNWD 3IULA 3TZKA 2IKQA 3E18A 3TNDA 3W9UA 3QIAA 4D3ZA 1KQ3A 1ZM3A 4A8HA 1EUDA 2VJOA 1CB7A 4GKBA 1GAXA 4JLAA 1FEZA 3EVDA 3FPSA 1JKJA 4MMYB 1A5ZA 3CR8A 4F5YA 3P71T 1UZAA 2P2DA 1FS5A 1LK5A 3FRIA 2AMLA 2V4ZA 4KACA 3W1WA 4NATA 2XITA 3UA3A 5JECA 1R0YA 1U7PA 2HV8A 2H4WA 2YYYA 3L18A 5KYWB 2QJRA 4HX2A 2QP3A 2Q4DA 3GEPA 4G01B 2B4YA 2B7CA 5J43A 4G9GA 3INRA 2NNLD 2JIZD 3QPVA 5DM4A 2DLNA 5F64A 1HF3A 4LN1A 4FMCF 3OOWA 2G5TA 1T2VA 5DN9A 2DBQA 2BCGY 4BWVA 4KPUB 4LCEA 1YQDA 3RAFC 3LUJA 1FNMA 1OYOA 3QVVA 1W0JD 3RASA 3UV3A 4ANFA 2HK9A 4AO7A 2TMDA 2NYRA 2WKPA 4HDKA 4TXJA 5JCJD 1GOTA 5JROA 3LK6A 3P9KA 3QKWA 2H1RA 4JEMA 4MKGA 4M7OA 3TRKA 4BJ6A 3L6OO 2QUHA 3NNSA 3O03A 4ZI7A 3HSYA 4BVLA 4BFZA 1EJ0A 1GA4A 10MHA 1K6JA 1W85B 1ACMA 3U40A 2DQSA 2RCNA 3S44A 2ATEA 1C0LA 2ZCVA 4FLFA 4KYVA 4U2EA 1T5OA 1EHCA 5ALSA 3RVNA 2G1KA 2VDPB 4M2LA 5DMXA 5ANRB 1DBSA 3LG2A 2Z2ZA 1D07A 1YSCA 5FTJA 4PG4A 1WCIB 1JEYA 2PD6A 4MLCA 1HEUA 5K0JA 4WLUA 2Z3VA 3NTRA 1CT9A 4L5BA 3ROXA 3WLPA 3AHCA 1NZJA 4BVJA 2OFXA 1VYHA 2VP0A 4PGHA 1JJIA 3GEDA 1AQNA 3U0BA 4RPCA 2YVUA 3EG9A 3IAM6 3AV3A 2V5VA 3QVKA 1VL6A 1GZSA 3KUUA 2AUTA 1YA4A 5B36A 1HNWB 1HKUA 4BNXA 1WXHA 3D6AA 4Q1FA 2Z58A 2C3YA 4PZPA 2PBRA 4ZCQA 3QNMA 4X3CA 5KAMA 4ZMSA 2XIQA 2EVWX 4Y2JA 4WX2B 3PR2B 1B6SA 3TLYA 2O8CA 4O4IA 3KKQA 4I5FA 3MJDA 4OQYA 4BFTA 1UBHS 4NYIR 2MSWA 1FS4A 2FUG1 5DT9A 3ONVA 4GECA 5K0FA 3LC1O 1GTSA 1N36B 2HI0A 1Z6TA 1H23A 3FR8A 4Q4HB 1UBMS 1Z47A 1U1EA 3F6PA 3O4HA 3RAEC 3GWGA 1JDPA 4MKFA 1J0DA 3PK0A 3UHFA 2EYQA 4DUPA 3JZAA 2GTPA 3F6RA 3PUHA 2IUTA 1FNCA 4DR4B 4JJGA 4PCUA 2WF7A 1U5AA 4N6NA 4AZVA 3BCUA 4II7A 1UMDB 1VP9A 1AHNA 4K0RA 2OYRA 4DPMA 3EIHA 3BXOA 2BFDB 1S1MA 3HB7A 2PLRA 3VKHA 3CJQA 2GVZC 5DOVA 3RH0A 4JLJA 2V5UA 3WYCA 5DP2A 1M6HA 1NW9B 2AJCA 3DD5A 3FOEC 4Y6OA 4UFOA 3ZVKA 1SHLA 4WDRA 1ZKMA 2PMKA 1U9IA 4H3KB 3ROPA 3C70A 3GVCA 4UUMA 1ZW6A 4A6DA 2QUAA 3CT4A 4YRAA 1VI6A 1PDVA 4ZO9A 6PFKA 4EUSA 4RHXA 1YAJA 4D4KA 1C9MA 3TLEA 4M86A 5F2KA 1GPMA 2VXYA 1YFKA 5ENZA 4F3YA 3WK7A 4F93B 5AP9A 3AOGA 3UYKA 5ER6A 2R4UA 3RKUA 1EFCA 2R8RA 2Z1MA 4Q3DA 5IN5A 4FYPA 4E31A 3T7AA 3AM5A 4TWJA 2ZE6A 3PQDA 3LOQA 5KSZA 1I3KA 4FW9A 4NXMB 2UYOA 2G82A 4J1QA 1XBTA 2B92A 3BXEA 4CLOB 3GYBA 4DM7A 4KITB 1MIOB 4F86A 4MICA 3IOCA 4ED9A 1QAQA 3C16C 1IEQA 1JLMA 3ABQB 4FZ3A 4N65A 5TRTA 4BNUA 4F06A 1SG9A 1ID8A 1NULA 2FKNA 3S1AB 4OGKA 2VKQA 3KP1A 3L49A 4NTZA 5JAQA 4DA9A 1K97A 4QRIA 4FYJA 1Q22A 4DTCA 1B93A 2E3JA 3NORA 4HQ0A 3TAUA 1EVZA 1RAHA 4LY3A 4AZTA 2LCQA 4MX8A 1GQYA 1IRXA 3EJWA 5JI2E 1QV6A 2HOQA 4B35A 1Y3CE 1OA0A 3IQWA 3ZLJA 1FXWF 1OAAA 3ANYB 1OFUA 2ERCA 4DUZB 1V9SA 4FDTA 4QU8A 1AQLA 3RUCA 2UKDA 721PA 1W5BA 4X60A 4PYLA 1W93A 1BXGA 3ORRA 3AHHA 1CQJA 1QRTA 5DLYA 2BFEA 3IA2A 2R84A 1QX3A 5BR7A 2BW0A 1T4BA 3HDTA 1DCKA 1CUHA 4DCTA 3DT9A 1NRXA 1QHIA 1SVUA 3ZXYA 2WUVA 3GJ8A 2V7GA 5FPTA 4DKXA 2QLBA 2WJVA 3CUEF 1H8ED 3G5LA 4QT0A 2I7TA 3A4IA 1JQAA 5BN5B 5ADUS 3T4UA 1YRAA 2G83A 1T6NA 5AI4A 4Q21A 5EMMA 2OCPA 4DDMA 4OH7A 1NV8A 4JEHA 3FNQA 3JYOA 3EGXA 3FVVA 2AV6A 4BTEA 1U2GC 4RSGA 3JWGA 3H6GA 2RG1A 3KJGA 4U6SA 4AYXA 1G9SA 4HGPA 3ZLTA 4IIJB 3OT5A 4DG9A 1PTJC 3F78A 4F4FA 2EKZA 3OKPA 4E7PA 4RADA 3ZY2A 2YY7A 1RAFA 5JSUA 1S9HA 2OAGA 4HVLA 1RMTA 1NW6A 5GPBA 4IJQA 4ER3A 2BGWA 2O6HA 5EJ2A 5F1KA 2M6RA 1JHQA 2F1RA 2XOKA 4HI0E 4CF7A 1XSEA 5J2TB 3GAAA 5KIAA 3IMFA 3USZA 3NT5A 4LY6A 2BFFA 4LZJA 3OKAA 5JD6A 1S1CA 5DCUA 5JVDB 3NBZC 1WPQA 3TQHA 3KOZA 1XRMA 3ANLA 5H0IA 4DAOA 1SXGA 1R18A 3ZE1B 1FU7A 3X43A 3NAQA 5HKLA 1WD7A 3TNFA 3U2QA 1R7RA 3FGOA 3HCEA 4ARZA 3B6EA 4MHSA 1IN1A 4G36A 2Q5QA 4CGZA 2WKWA 1JB9A 1WO8A 2GAJA 1S89A 4ILKA 5FL7A 4NBTA 2NUAB 5LSAA 1DOHA 1WL8A 2FZ5A 2J9XB 3IT2A 4M55A 1RYFA 1E2IA 4LJ5A 4MVYA 4QDZA 3JPYA 2HXGA 4ZV9A 3RS8A 1C7QA 2EJTA 3QUSA 1E0SA 3V5NA 5BSTA 5BN4B 1JSRA 2P9EA 3H4MA 4G0PA 1M5TA 4LNHA 1LV7A 3JPWA 5DHPA 5LZ5A 5KVQA 3VO2A 5IM4F 4KYTA 3W5DA 1GTJ1 2PWPA 3PBKA 3IOYA 1G0NA 2VNHA 3QBDA 4G26A 3TCXB 3W3ZB 2W9XA 1Q21A 2BTQB 3WKDA 4BYMA 4TM8A 2B36A 1HYQA 3EWAA 3FYUC 2F7SA 3KVNA 5TS2A 4B3CA 2CGEA 3N28A 5G0WA 3BFPA 1BCRA 3MSCA 1DMSA 4DUYB 3VKUA 2AR7A 3LPMA 4QODA 1T8UA 3I8OA 1IEVA 2EQ5A 2F1HA 2OORA 1V8ZA 3WZLA 3SE0A 3H2YA 1EK1A 1YBAA 4QOJA 1D6SA 1QLHA 1X1AA 1L5HB 3G0IA 2VJBA 3A6EA 1FNDA 2EJBA 2H5JA 5K8JB 1SQFA 3ROFA 1FIUA 1TLTA 2YH2A 5CDYA 2AMYA 1QRRA 2A9OA 3M1LA 3GT4A 3PFFA 4QSHA 4MINA 2GYYA 4AMBA 2IOHA 1KI2A 4D4GA 1T0UA 5DGHA 4BJ1A 4NKRA 2W6PA 4E4RA 1XDBA 5E4FA 1RQXA 1FXSA 1YR6A 3H13A 4NJOA 2FPSA 2JFWA 4WCFB 2ZJ3A 4ZYXA 2XECA 4AZWA 5JJIA 3ME5A 3L4KA 1WDLA 2YRXA 3UJ7A 1TZKA 1GKLA 4RTKA 1VMIA 3WTCA 2AEEA 1PK9A 1FJXA 5A2GA 1SELA 3PEVA 5JCOC 3QLUA 2GO1A 5DLEA 4NCJA 4H1TA 1HL3A 1KH2A 5A9TA 1YU9A 4OEHA 5CJJA 4I3FA 3TE6A 1W96A 2B83A 4B5KA 4YN3A 3F46A 3FTFA 2FSVA 2ZXEA 2ATXA 2JFFA 4AIRA 1M2JA 3D3EA 4RFVA 3SQMA 2EX0A 4Q48A 1P2TA 2QM8A 4CQNA 2BDTA 4JXXA 4HNUA 5CBKA 1C9JA 1O58A 2IYTA 4M9CA 3FMIA 3KC2A 1GV1A 1QKJA 3T61A 3OX4A 1PUJA 4OXYA 3HKBA 1M1UA 4R51A 3H75A 6GPBA 4ZQIA 4BVGA 1D6MA 5DYNA 4ENVA 3DKPA 1W88A 3AVXA 3K70B 3OCWA 2FPMA 1TYBE 2A33A 4O2AA 4Y1FA 5CB4F 5J4KA 2ZWVA 1XZFA 4LDRA 5BYJA 3CVUA 2EG5A 1AUOA 3NBKA 3ONFA 1DQRA 3F67A 4P81A 4J3NA 3OM0A 4FMCB 4CV2A 2G9ZA 4HNTA 2C7GA 3UPUA 1Z0IA 3NEYA 5IVDA 2PH5A 3R7DA 2O3RA 3B5IA 3QFSA 1X3LA 2Z9BA 3FPAA 2EGUA 4MIOA 1THZA 5DBEX 1C0IA 3KJNA 2AG5A 4YPFA 4B6PA 2WIDA 3IAUA 2I91A 3F49S 3AB3A 1IATA 4IGIA 1NUSA 1E63A 3L1VA 3D6HA 1RKXA 4RHTA 4OU4A 1QHGA 1XEXB 2LVBA 3M5DA 1GNSA 3GH1A 1QC5B 4NZMA 2P6RA 4FS3A 1KBZA 4BGEA 1LF5A 2HEIA 3A9WA 3C8UA 1Y7HA 1SWWA 3DFKA 3W4KA 5AKKA 5AYVA 2A86A 2HV9A 2CL0X 3OHMA 2WB4A 3JZIA 3T38A 3UAWA 3V7UA 5AK3A 2Z56A 3K35A 4HUQB 3ZD6A 1PDOA 1V7PC 1JMYA 4P34A 1Z6ZA 2IZZA 3O1IC 1NN3A 3VKWA 1O7JA 1TW2A 4F85A 1R4NA 2IPMA 4YI5A 1NI4B 5I5GA 1LBIA 3W04A 3JYQA 2BGKA 5LUBA 2HQOA 1PWYE 2QJWA 1Q0RA 1X7WA 3CTPA 4XR4A 3HKDB 4RKWA 2HJHA 3DQPA 5C8YF 2A6PA 2VHEA 3V9AA 1T3TA 5IX8A 4BEJA 3GVIA 4E6EA 3M89A 5J4YA 2DR0A 2GDZA 1MQ9A 1R0WA 3H7IA 2W8BA 2JGFA 5ENDA 3U1VA 4WBNB 1XXHA 4NU6A 4MVJP 1NPYA 3O91A 3EC2A 4JKYA 1R0SA 2X19A 3A1DA 4C76A 4MPRA 1XFAA 2OILA 3I1JA 3GFQA 2SICE 4L3OA 2YZKA 1PGJA 3BIFA 4J0GA 4EB0A 4CXMA 4L8GA 4BVEA 1KJWA 1QH1A 1E6WA 1LWOA 1SBZA 4LY9A 3QP9A 3DO8A 1M73E 5AVKA 5HE9A 3L8ZA 4HF7A 1MR3F 1PWEA 3U62A 4P5EA 4R2XA 4LSZA 1F6DA 2GFHA 3MOSA 2AJBA 3SDBA 4J0IA 3IB6A 1E3QA 1SKYE 3BL5A 3IEPA 4OMFG 4Y2PA 4WINA 1SC1A 2AW3A 2PV7A 1GCAA 1KYVA 1Z0JA 3EDCA 4UFPA 1X7HA 3QEOA 1DAEA 3K9GA 1ACLA 1YIDA 4IWXA 5AI6A 2WFMA 4DRYA 1I0IA 2ZRPA 1Q0LA 5K2OA 1EK5A 1JE1A 5CGQB 1UXHA 4HADA 5DTQA 3U5TA 1UF9A 4O4HB 1JHOA 4KFSA 3Q4GA 1DCMA 3GT0A 4ZT5A 3TNJA 4MJ3A 2BFAA 2VZEA 1GPNA 2X4GA 1VE1A 4HFRA 4DCJA 4KUEA 4ZOQI 4YFYA 4BUJA 1XWWA 2O50A 1SXJC 3DAFA 3NKVA 4ZGBA 4TWZA 1K92A 3A9UA 4F3CA 4JI0B 5GGXA 4F3RA 5HMLA 4NBVA 2W71A 4M1EA 1ECCA 2IHJA 1MO5A 1QJ4A 1NYLA 2BR3A 4Y1EA 3TG8A 3FE2A 2HFKA 1VKOA 2W98A 3GEIA 3ET4A 1GCIA 1HK7A 1MB9A 2GZDA 2IOFA 3HUEA 3KR0A 2FQ1A 3VMFA 3THWB 1RTTA 3W2GA 5D3MB 4EM6A 1HG0A 3OF2A 3B8EA 5JJBA 1EEXB 3IIKA 1P1HA 1ISFA 3LT4A 1IG0A 5F1OA 4NMHA 4G1VA 2Y0BA 4GPAA 3LE8A 3JSAA 2Z1NA 1O97C 1OLUA 3O8OA 4KXLA 3UICA 2LZ0A 2PEZA 1LLCA 3D0QA 4RMNA 4DV4B 4ARZB 2AEFA 1AGYA 2XCUA 5IKPA 2XPCA 5CT6A 3PJRA 5D86A 1B15A 2B4AA 3H5OA 3PX2A 5GVSA 3K8ZA 3Q9SA 5E38A 3H5NA 1JVBA 1L3CA 4OHZA 1QZTA 5C2JB 1Y8CA 3LOUA 5WRFA 1K75A 2MSDB 1O97D 1UM9B 3F8TA 3OESA 2WSYB 4XFJA 4AJ1A 3ZJTA 2VHQA 1I2CA 1Z6AA 2H51A 2XMCA 1SHJA 3C8ZA 3IPAA 2ERYA 2JI6A 2BBSA 3HA7A 4IOKA 4L22A 5IYZF 2P1RA 1IE3A 3OEHD 2O2GA 3OWOA 4FBMA 4IIGA 4OVKA 1ADJA 4YREA 4FGWA 3VYTB 4TLMB 4LJAA 4X8MA 3ER8A 5F77A 4BPRA 2XNHA 2GK7A 4UNRA 4NAUA 5AVOA 4GX1A 3CRVA 1QRAA 4HLNA 7REQB 5JJCA 2GXUA 1Y5RA 4A7PA 4GKKB 2V7EA 4CHGA 2PGOA 4P9NA 3K9CA 3NANA 4YONB 4MV9A 2B7BA 4RDXA 4ADSG 2J5BA 2DCUA 4O08A 4DV3B 5HX7A 1NC3A 2Z0MA 1NNEA 1WMDA 1A97A 1T6BY 3HH8A 3UPDA 2X5NA 4H4CA 4E08A 3GPCA 4YQFA 3K6RA 2H1OA 2X2OA 3OU6A 4LK2A 4B17A 3WYGA 1FPMA 4RVNA 5H4HA 4N82A 3UF0A 4IGEA 2QIOA 2ZUFA 4CM4B 5ALNA 3ONEA 4R2KA 1MEEA 4FDUA 4NSNA 3HBLA 4JELA 3N5KA 3FTDA 1C9KA 3ZVRA 4HDMB 5EPEA 6CHYA 4FJ0A 3GAMA 2XTMA 1WAMA 2ZROA 2DQYA 2GK6A 3BN3A 3IQIX 4FFRA 1BJRE 1OX6A 4FJ2A 3STHA 3V32A 4U7PB 1DARA 1OFUX 3I42A 2C3OA 4S04A 3WLOA 1J0EA 4BZPA 4OI2A 4J3FA 5AUOB 2C97A 1NLFA 2ZI5A 2XF2A 4MUEA 4ECAA 3I9OA 4FFPA 5JAPA 1UEIA 3TSWA 4BKQA 1L4UA 1OFIA 3SJAA 4C6TB 2F1OA 5GM1A 1L4BA 4FI3F 2O9JA 4TT8A 2MTBA 5EKDA 4IJMA 2VS1A 2VTDA 3HABA 3OSUA 4K9PA 4QAQA 3NIGB 3PQEA 3DXZA 2MSKA 3BE5A 1IOVA 2GM5A 3JR3A 1J33A 3KOYA 5EXPA 4XWKA 3DOFA 2CZCA 1N6PA 2I6XA 5KKNB 2ZXFA 3DAYA 1EFTA 4KXQA 1F8YA 4QTZA 3O3CA 1U3DA 3SFVA 2CV0A 3TRIA 5EMHA 1DTSA 4CJXA 4ZCTA 1SVNA 1Z2NX 1J00A 3IEMA 3FNBA 2X2FA 3WISA 2WJZB 1C2TA 1IEWA 4ZAVA 4JJ6A 4DWOA 2WAYA 1ZNXA 2B69A 2HDWA 2H16A 1FMCA 1RRVA 4H6WA 2QLMA 1Y4SA 4R31A 5LYYA 5M34A 1Z5WA 2ODPA 2WHEA 3PQ8A 4PYIA 1P4HA 2DULA 3AEYA 2OWEA 4RFSB 1EUDB 4I4LA 2O8EA 4R2HA 3I5XA 2D2VA 1QHFA 1SVLA 1F17A 1VG8A 1IG3A 1P39A 1VMAA 1DTEA 1QK3A 2FSGA 1FRFS 3D2CA 2XWPA 4X1KA 3TLGB 3ISVA 5DBGA 1C9DB 2GNAA 3B9RA 1MB0A 2HADA 2UZ0A 2H1LA 5E1BA 1C3OA 2CXHA 1EQUA 4UBJA 4KE7A 5T8KC 3UWSA 4OV6B 1HYEA 2ZE5A 1I6MA 1YNOA 1U2SA 3I3OA 4IOJA 5DI9A 2H18A 1ST2A 2YMLA 4E5MA 2VTBB 4XYEA 5DGTA 3STYA 2Q7OE 4ZQBA 4ZD6A 2WHQA 5CCDA 2CCKA 3TKAA 3M3DA 1E1NA 3L0BA 2BJWA 2AOXA 1DIHA 1V6CA 3E9CA 4F56A 3RIMA 3G9ZA 3ZV4A 2FRDA 1W94A 5FNVA 1SQGA 4PTZA 3SGLA 5BR4A 1I7SB 3H8JA 1Q14A 3AEUB 3UMYA 1XMOB 1Z3CA 1G5TA 2G1UA 3Q3VA 5EKSA 4BEVA 1ODTC 5KNBD 4KPGA 1U99A 3DV0B 5FUBA 2HFJA 3W8NA 4ZZ0A 3ZPXA 4PNPA 2D5AA 3L7OA 3NRBA 1Y9JA 2EFHB 5EMKA 2QVCA 3IR6A 4Q1CA 5JSZA 4WN3A 1KXJA 3PYMA 4JHXA 2RHGB 3DBRA 1BC5A 3DOUA 3ROZA 3SJZA 3SR0A 1UANA 1OX4A 2ZR9A 2Q50A 3OZCA 1EFHA 5H68A 2XA1A 3OZEA 2DTDA 3PCTA 3F5SA 5CUQA 4B3BA 4F7WA 1CJSA 4JBXA 3IEUA 4GRIA 3I6YA 5IJWA 3IJEB 1EWQA 1KJQA 3AHJA 5IULC 3KS9A 3UVEA 1OZGA 1MVLA 1RXCA 2GD6A 5AKEA 4OLAA 4NIMA 3H9JA 4W99A 4GU5A 1P81A 4I1UA 2PR7A 4DCCA 4BRWA 3AIMA 4BU1A 1OB5A 3SQDA 4JBWA 5EZYB 2OO3A 2G4VA 1GKUB 4LXIA 1YFLA 4MIYA 5KNLA 4R1LA 1RJEA 3BXXA 3HY6A 3PGKA 5E7QA 1PVDA 1BXRB 2QGFA 3KOMA 4CG2A 2WF6A 2EFEB 2OV4A 3CNEA 3EXIA 4GP6A 4YJ2F 1I6WA 1PJTA 4A0SA 4NXNB 1AA9A 2HQ1A 2YJ4A 3C5WP 4JP2A 4LGMA 4C7XA 4TKMA 1T2CA 3EPPA 3WMRA 3X1XA 2JAOA 4DF3A 4RL6A 1V8FA 1YFJA 4POOA 2CWWA 2GNOA 4L7QA 1IM5A 5KYUB 4UC0A 3T3EA 1NJ6A 2HHAA 2DKOA 3WNBA 1PRYA 3S5UA 1Y1KE 4KAJA 3ZDEA 4D43A 1TI7A 3EGOA 1TF2A 4DDHA 4Z5XA 4F1WA 1VCHA 2B35A 4JUAA 3RE1A 2QX6A 1CQZA 3CEPB 2NQ8A 1ND6A 5CYGA 3G79A 4GSLA 3NOOA 3L46A 5KOJB 1P0FA 4CR6A 1AJEA 3M34A 1TKCA 2QUZA 2NU9A 2ONCA 3HEMA 4D0NA 9MHTA 4NHEA 3EEFA 1ZA2A 2IYZA 1H9AA 2R48A 4EB6B 2O5RA 5EIAA 1RAIA 4PQYA 3K1TA 3ZS8A 2VSQA 3KTOA 3S8EA 4RVUA 3COWA 2O6LA 3IHWA 2QW0X 4E5YA 4LI0A 1PZXA 2C4HA 3G82C 4KMMA 3LX5A 1R3UA 2VDWA 2VHYA 4IIFA 5CGZA 2IHNA 1B23P 1HFJA 4H7JA 4IO1A 1M0EA 3BCRA 1N7IA 1UKAA 4BLSA 1AKRA 3SJCA 3QVWA 4QUEA 4WXRA 4EG3A 1JPNA 3FVRA 5HIAA 1LS1A 5I5EA 4EB8A 3PZRA 4FMPA 4G1UC 1RYHA 2QJOA 3AYXB 4QPZA 3BHMA 2VH1A 1XD2B 2GH1A 4QJBA 4EPWA 3QVMA 5JD3A 4IHJF 3UK1A 2PH3A 2AZDA 2JFBA 3CE9A 4FLEA 1V4BA 3ZDYB 1Z8FA 1RP1A 4WXYB 2F3PA 4ALMA 4CKWB 3KQMA 3DFIA 3UOAB 1G6OA 3KYDA 3PC3A 4JOBA 1N9KA 4M8LA 4N4AA 4N9QA 3ZCRA 5IWCA 4Z9BA 5EUQB 3U13A 3B5EA 3QMWA 5EE3A 5KOJA 1TIKA 1B6TA 2O2EA 4D81A 5K0CA 4WNIA 3KXLA 3MTAA 5I48A 5G41A 1C1YA 3DP7A 5DO9A 2JH3A 3NWBA 3KKZA 3EN0A 3PL1A 4N3NA 2P9TA 2E87A 2XEDA 3GGGA 4D9FA 1ZXBA 4Z53A 4AY2A 1T13A 3O3OB 1U2RA 2GVNA 3QELB 4NLLA 5G1PA 2TMGA 2FMIA 1EVEA 1LX6A 2OBFA 1COWD 3CKYA 1QB7A 4C0KA 3HB4X 3HBAA 1KJYA 1HT1E 4OJTA 3P9NA 2B1JA 2XNKA 3B8HA 2K4MA 2ZYGA 3HJGA 1BG6A 4RV5A 3TH5A 2IODA 4E1AA 2RE8A 4JNKA 1MXHA 2YTZA 3WADA 2EZUA 4KI0A 1QNFA 5CMLA 1MNQA 2IYQA 1H6BA 2OBLA 2P4UA 3JWIA 4J0DA 4XI9A 3T0FA 3FVQA 1T2AA 5DXAA 1ONPA 3NHBA 3QX3A 3ELWA 1B0UA 2ZSKA 1KBQA 2J9FA 3AH8A 3RVOA 3ZWWA 2CLHB 3S55A 4OGWA 4G97A 1CF9A 1TIBA 1YKGA 4BNVA 3EZ2A 5AVXA 3ZDBA 1O9GA 1GA6A 1F0PA 4R0MA 5GJVC 1BKYA 1VHQA 2AZMA 2ZJ1A 1IWOA 4FOLA 3VR1A 1GJRA 3TLKA 3C39A 1UWKA 2Q9BA 5MN5A 1M0WA 4NC9A 4CL2A 3VOAA 1JXQA 4D56A 5AOBA 4JBHA 3ZTWA 4ZODA 4I4TF 4TUYA 4EJ6A 4QM6A 5C7LO 1VL8A 3DNPA 2QGZA 3WHIA 1H2RS 2TMYA 4E22A 3TLAA 3UJBA 4DMUB 1HOTA 1U9CA 1MB2A 2MHCA 4I99A 4EJFA 3FZGA 1V47A 3L82B 3R9WA 1NVVQ 3MW8A 4YGYA 5G0TA 4D41A 2VG8A 1E0JA 3T3IA 4GWGA 3TLMA 1J0XO 1HTTA 3RVSA 3U4MA 2LKDA 1X9HA 3MT8A 1DFHA 1JIIA 2XMBA 1UDAA 3BFVA 3G0BA 1JQEA 4IQ4A 4JT2A 3RAGA 2XD9A 4DBLE 1DKQA 1HRDA 2GWRA 3GPDG 3L8MA 4P7KA 1G7SA 5ITZA 4B3MB 1ZH6A 2J5KA 1US8A 1J6UA 3PG5A 1N7GA 3KV1A 4B2PA 5EA2A 1LI7A 3A7DA 3KFVA 2A35A 2BMAA 3OPXA 4GICA 4MCHA 4R2IA 2ENUA 4WK4B 3RANA 4CKCA 1GL3A 3UJHA 4ZGWA 4J4TA 4ZVMA 3RK1A 1XL1A 4CEIB 3ZKAA 2BMWA 2UZ1B 2VJCA 3ICVA 2WWHA 4C7BA 4HXFB 2PUEA 3FDXA 4GMHA 3FWZA 3IH5A 1GEEA 1I9GA 2DT8A 1CSEE 4ZVPA 3RRZA 2I4MA 1JU9A 4EGFA 3GBSA 3HVUA 2ETXA 1M1XB 2GKGA 2MCFA 1ZL0A 2HGZA 3DR5A 2QT9A 2VSYA 4ZC8A 5JNLA 3GLGB 3WGOA 3WLNA 4UOZA 5EVCA 4I2NA 4ZYVA 1HRKA 3VPCA 4RY2A 1KDRA 4Y30A 4G4JA 2OVFA 1OI4A 1NPDA 1L7EA 1KOJA 1L8XA 2BD0A 2H29A 3HHEA 3LX6A 1S2GA 2GK3A 3LLVA 5FI0B 3VKVA 4Q7MB 3ZWXA 3OQBA 4JLVA 2AN1A 2RBKA 3AFMA 1TVKA 1K7XB 4IDNA 1XD8A 2GPSA 4M0UA 4TV8F 2EBHX 2OQVA 1JAIA 1CY0A 1YZ3A 2QAGB 2Y68A 2DRIA 1D09A 2FFJA 3AETB 4H4DA 2J59A 4NF2A 5KUTA 3R0VA 4HH3C 5MGBA 1U7TA 2QPTA 4OI0A 2FRVA 5ALTA 5AVJA 1G60A 1SCUB 1W1UA 1P73A 3ICCA 1ZN2A 1ZSYA 5ELMA 3WGGA 4J29A 1O08A 5IANA 3DCYA 3NWOA 4W8OA 2MSCB 4GWKA 1XTZA 1DG9A 1JAHA 1KYTA 3AESA 4WLNA 3MTBA 1QO0A 3BBPA 4R2LA 4JC5A 1W59A 3M6WA 2ACVA 3TB4A 4BO8A 1AS2A 1W5EA 1OFTA 2IELA 3UB3A 3WO0A 1UBUS 3H8SA 1QWSA 3DT6A 1NXXA 4P4GA 4HFJA 3K92A 4UREA 1YI1A 2JLAA 4CV3A 5JH7F 1H4QA 5K0LA 1F1JA 2PL1A 4RU1A 3QYJA 1TAQA 4TRJA 1A98A 4TKLA 5AW5A 2IYYA 4ZJPA 1P0QA 1QWOA 1SXJB 2ID9A 4IQ8A 5GOZA 1GSOA 1QHXA 3RFUA 4EBBA 5BV7A 1VIVA 2FR1A 3CM0A 1B7GO 3NHLA 4TTPA 4FC6A 2OESA 5TR9A 3ZWCA 3A05A 1IPHA 1N4DA 1NXOA 4GF5A 4MKRA 2PT9A 2GCGA 3UFBA 2H7YA 4DBZA 1K5GA 4Q4HA 3JAKB 3LP5A 3W90A 4DQXA 5KYVA 1V8DA 3OX3A 1Z0SA 3HJNA 5B1HA 2C5BA 1GTG1 3KAKA 3L6DA 2VDJA 3A1CA 3CLTD 4D1YA 4YR7A 4BN4A 2DPGA 4A8PA 1ZZEA 1P19A 3DBVO 4Q3AA 5CK4A 2W42A 4DNXA 5KEIA 1A0OA 3L7KA 2IS6A 2RKWA 1CUBA 4L08A 1ITZA 3PP8A 1BOFA 3TIIA 2JLXA 1DS6A 4YV1A 2GD2A 3ACCA 3UN1A 3T1YB 4JYZA 2R5FA 1JZQA 3A10A 3UJ9A 3QMPA 3DEHA 4JJIA 4AN4A 3M4XA 1OWOA 4XD7A 3U6KA 3ZW9A 3AEQA 5JQGF 1LSJA 1NX6A 1L6IA 3RT9A 4GZ6A 5AW2A 3IIMA 5AKGA 1KTVA 3T7EA 5BWOA 5LP6C 2YHAA 1N75A 2YCBA 4IV5A 4F9TA 4K81B 4MV1A 5EQTA 4ZI7F 2YC2C 4OLFA 2ZDGA 4DLZA 4IHJB 4RA6A 4ETNA 1J70A 4X41A 2EJCA 1CCWA 5A05A 1KO7A 2FG7C 3LY8A 4LNUA 4QTTB 4X97A 1IMJA 2JI9A 2D3WA 5HF9A 3RBZA 1OLUB 3O8OB 2YWRA 3L4SO 1VJDA 1E9SA 3K1YA 2P78A 3HYCA 4YCAA 2I7XA 2EP5A 2XCIA 3OOJA 4V3CA 3S6JA 4AW9A 3RUEA 3VKGA 1G6Q1 2OFWA 2QU8A 3QG5A 1KVQA 3U4QB 1V3VA 3BM5A 1ONBA 3DHNA 1IEXA 2YDYA 2ZUWA 4KI7A 3AWIA 1T4CB 5DHUA 5C1IA 3RSCA 1X6VA 5IXJA 3K70C 5JJLA 3FTNA 1TFUA 2QZJA 1XEXA 5CBPB 2HZ7A 5D3QA 1SFRA 2YXLA 1L7OA 2ZI9A 3BIXA 3CPHA 4E5VA 1T34A 2GWHA 4M21A 1XA0A 3EZLA 2FU5C 5F7OA 2KE5A 3CNHA 3JQFA 3NP7A 4EHNA 1J9ZA 3T7DA 3QF4B 3SI7A 3IUNA 3SEFA 5JQGB 3E70C 4Y9UA 3G02A 4JDUA 4MWZA 3ZI0A 1FQKA 3DD1A 5EMJA 3J7TA 1CC1S 4C4OA 5C80A 2G6TA 1XDDA 2BJVA 4JI3B 5C8YB 4JUCA 3K9WA 4QOIA 1MAWA 2PU7A 1SM4A 5EP4A 4DJ5X 1PYDA 5T67A 1MAUA 1Z17A 1AA6A 3OCZA 1ZYUA 1EWYA 2C4WA 3RSHA 5IUNC 4Z7OB 3OP4A 3N3AC 1ATIA 5CJPA 5F9HA 1UFQA 3T35A 2HYDA 4X00A 3JQEA 1SKUA 2ZG6A 1XF9A 2QD2A 1CUUA 1V1RB 5AR1A 6ADHA 2QVXX 1L4HA 2AQKA 2WD7A 5C31A 1J90A 4MS4B 3RVLA 2CLCX 1CR2A 2I65A 4PAMA 4F45A 4FFWA 1MIOA 1EZZA 2IIQA 4GMDA 5REQB 4LFCB 3W9SA 1N34B 1J5PA 1XK7A 4WK0B 4DGQA 3O4IA 1CQIB 4F1KA 3EEQA 3K9BA 3Q0EA 5LLDA 3OTIA 3RVQA 1JNYA 3GUUA 1KMHA 2XNJA 5TS3A 2Q4EA 3SX4A 4F3KA 3QWAA 2CXXA 2HYIC 5CFQA 2VF5X 2IY9A 4HYQA 2E18A 1XN1A 3T7RA 4EVRA 3CPSA 1O6FA 1VKJA 1NVEA 5TSDA 5EIWA 3JXEA 3JQFC 2Y1CA 4U2GA 4C3VA 2VPIA 3M5PA 1NUTA 2A1UB 3KFLA 4KQEA 4O2BB