2A9QA

Low resolution structure rr02-rec on bef3 bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
112
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator
publication title Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site.
rcsb
source organism Streptococcus pneumoniae
total genus 38
structure length 112
sequence length 117
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a9qA00
1M2EA 4KK3A 4XASA 2JVJA 2JBAA 4N03A 3CRNA 4RY8A 1VPWA 3F73A 1DZ3A 2JVIA 5HQJA 4D74A 4RY0A 2AYXA 3MM4A 2FKAA 5EWLA 2F8TA 1MIHA 3JVIA 1E6MA 2LIVA 5CNKA 4YLEA 6CHYA 4ETNA 5FWYA 4G0XA 1U2QA 4MS4B 2IYNA 5EWMA 3JS5A 2W42A 4ZYLA 4WXMA 4F8JA 1TJYA 3MQ4A 3CZCA 5TE9A 4MLCA 1FFGA 4EYOA 3H5IA 4Z4IA 2MSKA 3BRSA 1IIBA 3URMA 3KG2A 4W5NA 4Z4FA 3Q9SA 2E4UA 3EODA 4MS1B 5BRJA 5CHYA 1GLGA 4XFKA 4XLTA 1VRVA 2HJ9A 1KMIY 4PYRA 4L4UA 4OBBA 4IMJB 1ZVVA 1JF8A 3JPWA 3SNKA 2FLWA 5CNMA 4N41A 3HM9A 4YO7A 4L85A 2PJUA 3LUDA 3N0RA 1BA2A 2X7XA 1ZESA 4IF4A 3DZDA 3FFWA 4YRZA 4YV7A 1Z25A 3GA5A 3KTOA 3O1JC 2ZAYA 3GYBA 4MR9B 5TQJA 4Z4CA 2ID9A 4YR7A 4YGXB 5JS1A 2PUDA 3G85A 1YMUA 1JHZA 1RPJA 4S05A 2VUHB 2L2QA 4MQEA 1Z13A 3T38A 4F12A 1NXSA 1USKA 4IILA 2QVGA 3KJXA 1JFSA 3LUKA 5TQ2B 2JK1A 1SXGA 3GWGA 1KRWA 3OO1A 2IOYA 1LBHA 2PL9A 1VKRA 4TMYA 3CTPA 2FTKE 1ZN2A 4Q6WA 4F11A 1KGSA 3TO5A 5PNTA 1NATA 1D5WA 4Z9AA 5T3YA 3G1WA 2QU7A 5IEJA 4O1HA 5FWXA 1MAVA 3HVRA 2IPAB 4NCBA 2F8SA 5BQ3A 3I09A 1EWKA 3H75A 3OQOA 2FMIA 2MSLA 1USGA 2FLKA 3MYYA 4H3HB 2NZUG 3GBVA 4RKRA 3L6UA 1BAPA 2NZVG 4RV5A 4EUKA 1BDIA 4CBVA 1DBQA 4QPJC 5DLEA 2PAFA 5GQSA 3QK7A 1DCFA 4NICA 4QYWA 1U0SY 2R25B 1DBPA 3HXMA 2YHBA 5F64A 1KRXA 3GRCA 2BGGA 5KQLA 4RK7A 3E3MA 1URPA 3HDGA 4RXUA 3NNNA 5JNVA 2AYZA 4PEVA 4MRMB 1U8TA 3ILYA 5TPWB 1YTUA 2FEWB 1OXKB 4ZPJA 1JDPA 3I45A 4MR8A 2PMCA 4WZZA 3LMKA 3N0WA 4DADA 1YS7A 1YS6A 2QXYA 1LJLA 5CNIA 5KI6A 1CYEA 4P98A 5E3JA 4OATA 1YIOA 1E2BA 5C5EA 4MS3B 3BBLA 3RVKA 4YP9A 4MS4A 2LPMA 4MPTA 3LFTA 1P6QA 4KPYA 1C0EA 3IP6A 3LOPA 4UHKA 2NUBA 3OQNA 1EFAA 2FMHA 4ETIA 1U04A 3OM1A 4EY3A 1BVHA 3BILA 5DCLA 2JCGA 2KYRA 3CG4A 2ZWMA 3UKJA 3QLVC 4JB0A 5JNTA 2J48A 4NV3A 2JVKA 5GOTA 4MS1A 5BR1A 9ABPA 3O2SB 2B4AA 4Y9TA 2WRZA 3RVJA 5HM6A 3LUGA 4KRFA 3QX9A 3H6HA 3QELB 3EULA 2CD7A 1P6UA 1RNLA 5ABPA 4RDCA 1RZRD 4RY9A 1FQWA 1ABFA 4W5OA 1SRRA 4RXMA 2FN9A 3DLBA 3LKBA 2E4VA 2A9RA 5HSGA 5TPZD 1Z2DA 2LBPA 1M2FA 3DBIA 2R47A 4G0QA 3KYIB 3OLVA 1BDHA 4JAVC 4JB2A 3C3WA 3H1EA 4RK4A 1AB6A 1ISSA 4TN5A 4Q7EA 3QX8A 4EYGA 3OMXA 4KFCA 3Q7RA 3UK0A 4FE7A 1TMYA 3O1HB 4IGAA 2FQWA 2GI4A 3KHTA 4TLLB 5IX8A 1GCGA 5JNWA 3HJFA 1F51E 1RXEA 1YMVA 3M9XA 4Z4HA 4WXEA 2QZJA 3N0XA 3NBMA 1QQBA 5TQ2A 3OO0A 2FMKA 3FMVA 3NNSA 1EAYA 3LUHA 4UHJA 3N53A 1E6KA 3HV2A 2H3HA 4HNRA 3S99A 1FFSA 5HKOA 3EJWA 2GKGA 3JTEA 2LUOA 5TQ0B 2HQRA 4RKQA 1EHCA 3ILHA 3SY8A 3JY6A 3RVPA 1JFVA 1HEYA 3HUUA 3Q15C 2A9QA 2IPMA 5IUNC 3TMYA 2WJAA 4N0PA 2IKSA 1QMPA 5JNUA 3SM9A 1VLZA 1TLFA 3H5VA 4O5AA 1NY5A 1Z17A 1P2FA 4WWHA 2PE5A 3L49A 2FSPA 4JOQA 5JNSA 4N47A 1GUBA 4D6XA 5KQGA 2WY2D 3A0RB 3MMNA 4OLAA 2A9PA 1PNRA 1MB3A 4QICA 3OQMA 4EYQA 1APBA 3D02A 1JBEA 3O21A 4MRMA 1PHRA 3KCNA 2PUEA 2VUIB 5TPWA 4LE1A 4RSMA 3RVRA 2VK2A 1NXWA 1YK0A 2FXIA 2M98A 3LUJA 3N6VA 3NHMA 3FFTA 3IPAA 4LE0A 4MAAA 3SAJA 3LUCA 3D8UA 4EVQA 3A3KA 3QLTA 1PUXA 2TMYA 4KQCA 5IUJC 1XHEA 3GBPA 1Y1LA 4PICA 1H9CA 3EDCA 1LK0A 2CWDA 1ZAYA 4MS3A 4OTZA 1CEYA 1ZGGA 2DRIA 3OM0A 3CZ5A 2OENG 3QEMB 2FQXA 2MYTA 3KYJB 4HNSA 1Z12A 2WJWA 3CFYA 1JH9A 4KMRA 3LTEA 3CLKA 1EWVA 1JL3A 3SG0A 1JYFA 2CHFA 4O1IA 5DKFA 1QP4A 4Z4GA 3KLOA 1FFWA 4RU1A 3HDVA 3CU5A 3GT7A 2R48A 3K4HA 3CNBA 4W5RA 2FMFA 2O20A 4LX8A 4OG2A 3A10A 1JFTA 4MQFB 2MYPA 1DCKA 3N8IA 2E4WA 3OLYA 3QELA 4H60A 1YK1A 4G0ZA 2QW1A 2VYCA 3KLNA 4IMIB 5EWJB 4KZKA 1R8JA 2RGYA 3HS3A 3F6CA 4JA2A 1NXVA 8ABPA 4RWEA 1JWLA 3IP7A 1XHFA 4EVSA 4G0OA 5IC5A 4RZSA 3DLHA 3MIZA 3HCWA 4KNYA 4Z4EA 1DC8A 3HZHA 4MGEA 5IUKC 4GPAA 2HQOA 1A04A 2FN8A 3GV0A 4P1ZA 5IULC 1QPZA 1QKKA 4MR7B 2IPNA 3ROFA 3IP9A 1MB0A 4KK4A 1QP7A 3QEKA 4MLDA 1Z26A 3RVLA 4DQDA 1USIA 4ZMRA 3OMWA 3H5LA 3I42A 3Q41A 4NQRA 1DCMA 4ZMSA 3EAFA 3RVQA 2HPHA 3HK2A 1ZDMA 3OLZA 1JDNA 3H5WA 3H5OA 1QO0D 3RQIA 2IPLA 3FGZA 1J56A 3O2QB 4G0MA 1A2OA 1BDJA 1E6LA 4G86A 2M1ZA 3FFXA 3BRQA 4XXHA 3DGFC 2V0NA 1ZHHA 4MR9A 5TQ0A 1CHNA 1FSPA 1SD5A 4QYMA 3IDOA 1ZGZA 3CS3A 3RVSA 4WT7A 4IRXA 3RVOA 4HYEA 3RVNA 1M5UA 1U2PA 1JX6A 4G97A 1XWWA 3F6PA 2A9OA 4XARA 3QLUC 3TD9A 1SXHA 4E7PA 2QV0A 1M5TA 1Z16A 3H1FA 5KC8A 1OXBB 3A0UA 2FQYA 4RXTA 2FEPA 2I6FA 2PLNA 3I5AA 7ABPA 5I4CA 3HSYA 1B00A 5CNJA 3GL9A 1T34A 4YWHA 3H1GA 3N75A 2PUCA 3OLWA 1ABEA 4M88A 3TX6A 4S04A 1W25A 2L19A 3DGEC 1A0OA 4EGSA 3O74A 4LDZA 1LBIA 3B2NA 1LJUA 4PZ0A 4Q6BA 1NTRA 2QVCA 2JBAB 3C97A 1ZH2A 5D2CA 3TB6A 4DN6A 5T7BA 4ETMA 5JNRA 5EWLB 3NNDA 3LKVA 3HUTA 1NXOA 3QLVA 3IP5A 4KV7A 5KC9A 1D1PA 5FWYB 3UUGA 5C5CA 5EWMB 4Z99A 2N9UA 3RVMA 2QR3A 3Q7TA 1ZH4A 3CKMA 5KQMA 1PEYA 2P4UA 2MYNA 1DRKA 2FVYA 3KSMA 2B1JA 2JB9A 3H5TA 2WB4A 2P9HA 5DTEA 3QEMA 4JASB 3OLXA 5B3JC 4RK5A 3F7NA 4XAQA 2PUBA 1DRJA 2L17A 4B09A 5ED4A 3EGCA 2NT4A 3Q7SA 3M9WA 5JS2A 2WWVD 3LUFA 2FEKA 1JYEA 2L18A 2WMYA 3O75A 5IEBA 4KREA 2E4XA 2E4YA 1P8AA 4MQFA 4RK0A 2E4ZA 3KS9A 2QSJA 1ZY2A 2RJOA 1K66A 4LE2A 1PEAA 3NHZA 3QLUA 4LDAA 5EWJA 2PUAA 3O1IC 2YHAA 1D1QA 3EQ2A 6ABPA 4G0YA 4NCAA 4G0PA 2RJNA 3W9SA 3T6KA 2PKXA 1GCAA 1NXXA 1EWTA 2GX6A 2IDMA 4LRQA 4W5QA 1ISRA 1Z18A 2XDYA 3MF4A 3BREA 3K9CA 1D2AA 4KVFA 4KQ9A 4Z9BA 4MYRA 1DJMA 4MQEB 1PNTA 1SXIA 1K68A 1S8NA 4MR7A 5IBQA 4JP1A 5BRAA 3JPYA 3CG0A 3ROTA 1ZITA 3O2JA 3P9YA 4OLBA 4EVRA 2GBPA 4YS6A 2MSWA 1C4WA 4TLMB 3CHYA 5KWSA 2MYUA 1QNLA 3M6MD 4D6YA 1RXIA 1NXPA 4FB4A 3T8YA 1WETA 4LZLA 5KQPA 3EQZA 4ML3A 4N0QA 4F3TA 4FE4A 4WUTA 4EYKA 3SQNA 4HNQA 1JLKA 4GNRA 5FWXB 1AB5A 4Z0NA 1GUDA 1D4ZA 2PUFA 1MVOA 3VNBA 3IPCA 3R0JA 3RH0A 2FW0A 4W5TA 1TVMA 4N76A 3HEBA 2R4QA 2RDMA 3LUAA 5FBKA 1TM2A 4ZJPA 2Q5CA 5B3JA 3HO1A 1QQAA 4PE5B 3E61A 3C3MA 4F06A 3MA0A 4RK6A 1QP0A 3FDFA 5DGCA 1RZRA 1QO0A 2OQRA 4RK1A 1DBWA 3C3KA 1DC7A 3VNAA 1F4VA 4RS3A 4YCSA 5FBHA 2ID7A 1UDRA 1YVUA 2HQBA 2JRLA 3JVDA 3H6GA 5TPZA 2GWRA 2CHEA 1DG9A 1NXTA 3KKEA 2PUGA 1I3CA 2HSGA 3C6QA 1Z15A 2H0AA 2NT3A 1W9HA 4H3KB 2PL1A 1L5YA 3T95A 1DP4A 1Z2EA 4E7OA 4MR8B 1L5ZA 2LP4Y
chains in the Genus database with same CATH superfamily
1M2EA 4PG4A 4QOGA 3VGJA 1R0YA 1FTQA 2OEPA 4FYKA 1H42A 1XRQA 2CJXA 3QNWA 4KGVA 2I3BA 3VXKA 2FFAA 1A4IA 1NPTO 5KAPA 5HQJA 4F60A 1OXXK 4G65A 1Y8CA 4KODA 1P2BA 2AYXA 4ZTBA 5IASA 4HQ6A 5IBRA 4M1KA 4C03A 1AJEA 2FUNB 5CNKA 2WTEA 1U2RA 2O14A 2WUFA 1Q91A 2ZSFA 4NCHA 5JU6A 2OP0A 1ZD4A 1T1RA 1DBIA 4BN0A 4CV1A 4WZAE 1PV2A 1WEHA 3LVRE 5AJVB 1TJYA 1N0HA 4J49A 3V8EA 1ECBA 2VWHA 4GSLA 4X7MA 1D0SA 5ED0A 2FCRA 3Q7IA 5JSZA 3MJCA 1PAUA 1LBSA 4LBWA 1DEXA 4AJEA 4XZ3A 5KVCA 2EZ9A 2IU4A 4I9FA 5A06A 4LV8B 1T0PA 3DFZA 4EJSB 1L4EA 2E4UA 5AXBA 1WY5A 4QVIA 4EH1A 2H85A 3FSEA 4XLTA 2PX5A 4DRZA 3AYXB 4CLDA 1KMIY 1JEEA 3QPCA 2NUPB 2YL2A 3WB9A 2BGUA 5A5VA 2G0TA 3F6EX 1SPXA 4G84A 4ROTA 2XOEA 3KYBA 1QHIA 1E2FA 4K1LA 2OHHA 1GN9A 5CNMA 4NCJA 3TTWA 1MAAA 4CMCA 3FLAA 4ALKA 3AONB 5JPDA 1GARA 3NKLA 1EDOA 1N1EA 2O2XA 2QL7A 3ITEA 4HGRA 2GLTA 4BO0A 4R7GA 2IS2A 1P4GA 2FW1A 3D8HA 2F64A 3LT4A 4WCFC 4XVUA 1YFJA 4YR7A 1RJDA 4FX5A 1NE7A 1V26A 3O8CA 2EX1A 2PLWA 4ZJYA 1RLIA 1KOLA 3EF0A 1F7VA 2FE1A 2LDBA 4PO3X 4XM2A 3ZU6A 1RPJA 3SHQA 1P75A 4URVR 1IB0A 2XTAA 3OECA 3IXMA 1R8SA 3CZPA 4EA9A 5F5XA 1I1HA 3T1VA 5BN4A 1TYZA 1MEOA 1N2ZA 3A26A 3DD5A 3CF2A 1FLNA 4Y6LA 2B2NA 1CUUA 1IBSA 1SXGA 2JK1A 2P5SA 5JJCA 1W94A 3VU0A 4BLWA 1QH9A 1E2EA 4C7MA 5BWMA 2QS9A 3MHPA 1LDNA 3Q3CA 1TYAE 4U2EA 4BB0A 1XC7A 2HMTA 3GJTA 3W5CA 4LDNA 5FPQA 3FHLA 3RUEA 2Q4TA 2ZVDA 1X92A 2VP2A 3PA8A 1TM5E 4HTFA 4ZC8A 5K01A 2GJ9A 1AE1A 3W8FA 3DT8A 3LCVB 4E5VA 4H7PA 5IEJA 4J1TA 5KINB 1GL9B 3I6QA 2PSEA 2AFRA 2WFMA 3AVPA 3FR8A 5IT9A 3WGUA 1MB2A 3GZNA 1YR1A 1USGA 1OWLA 3CB4A 4HAXA 3JASB 4R3UC 3ZNOA 1FNDA 1ZD5A 3PRJA 4AU1A 1BAPA 1DARA 1MAWA 3IBTA 4EPXA 5TJHA 3UV7A 5IHPA 3EUWA 3AX6A 3PEUA 4HQRA 1CNFA 2IU6A 3AY3A 3JYNA 5BWCA 3DMHA 1SCBA 1JHAA 1UEJA 3V4RA 3S2IA 1P0PA 2VP3A 3PUZA 4IDOA 4P82A 4D9GA 4RJJA 1OFTA 1P2UA 2IHYA 5LA6A 3UMJA 1S2NA 4N48A 2DCMA 5ALGA 5DTQA 4FINA 2DP4E 5FV4A 4ZGWA 3IMFA 2J3KA 1KAMA 5JIBA 2DBRA 4FHGA 2JH8A 2YWFA 3IP8A 2WIDA 1FP4B 3TLAA 5L95A 4KUHA 1UDWA 4LHEA 2FUCA 3TFQA 4Y2JA 7REQA 1YTUA 3U62A 2D5LA 3LMKA 3B8EA 1PL6A 1OH7A 4BASA 4XUEA 4ZVLA 3S2EA 4DG9A 2I8AA 4A8TA 1N5JA 3PI7A 4ACAA 1JIUA 5HKKD 3IQGX 4YR9A 3WNZA 2GUGA 1OFIA 1BHJA 3RVKA 4MS4A 1KEWA 4CIYA 3E5MA 3LPLA 1V9SA 3AJRA 2B1GA 1DDOA 3D64A 3OQNA 5HQTA 2QMOA 3TZQA 2QRNA 2IEZA 3WGIA 2CDBA 2ZWMA 3V5NA 2ZDHA 1TF2A 4NV3A 4P92A 3DWIA 3BMNB 3KT0A 3CUYA 3D4OA 5JRDS 3RBXA 1B41A 1E96A 2IYTA 1JQKA 1XQWA 2B99A 3EIHA 4FI3F 1SUEA 4Y98A 2BTEA 5DW3A 3QOXA 3B1WA 3LLUA 5CLHA 4H7EA 3QF7A 3EZFA 4FNMA 5ALRA 1DC3A 3E70C 2EFHB 4XSVA 2IHKA 3GUYA 3GJQA 3ICCA 1KSGA 4I9HA 2FN9A 3ND7A 1DT3A 2X8WA 4ISCA 4M37A 3B12A 4V39A 4O4IA 3HWSA 1GVHA 2W2VA 4MQMA 1NOJA 2I2AA 3W3AA 5D3MB 5GJWC 2AG6A 2EVWX 2W6PA 3K0EA 1M8JA 1E58A 1RW4A 4UBOA 1F9AA 1HT1E 3Q7RA 4MIEA 4N8SA 3BJEA 1TF5A 1UWVA 2HF8A 3ZD7A 4BCDA 2XVZA 5TC4A 1YA8A 1U6IA 2OZLB 1K08A 2JHAA 1F8FA 3F5SA 2VJMA 4M1YA 3NBMA 4OJNA 1ZCAA 1QQBA 3RS8A 2I5PO 3H2GA 4YRQA 1T9GR 3NNSA 1EG2A 4P3XA 4C1BA 2QY6A 4EY6A 2QIPA 1FXWA 3ZHUA 4H1UA 2Q1SA 1KIAA 1FS4A 5HUQA 1QWOA 4IINA 2VWQA 5DNYB 1YVPA 3RO7A 3MT9A 3KB8A 3WA6A 1Y8AA 4QATA 4K5QA 4MW7A 5KDLA 2X77A 4TYQA 2NPFA 3ISVA 3ZLJA 2JAWA 4G09A 1VCIA 5A6VA 3TEFA 1SA0B 3MCWA 2XNCA 1WY7A 3ILHA 3O8QA 1ZM4A 3EFBA 4ICIA 3OZCA 5BURA 3AM5A 2OCLA 2R6R1 3UKOA 1D2NA 4QGFA 5CVVA 1ZUHA 3PNSA 4ZU1X 5BUCA 1RBYA 2BH9A 1Z4MA 1E0SA 4DQLA 5FL3A 4LXTA 3KXPA 3QOFA 5BYJA 4BPRA 4CF7A 1XNQB 2ZLBA 3JU3A 2KS6A 1ID8A 1E98A 5IN5A 2PE5A 3GUHA 4K9DA 4MROA 1W36C 1NWCA 1GZVA 4GG1A 1H0RA 1MQAA 5KYNA 1I1OA 2NZ8A 1ODLA 1X7YA 5IP5A 3VAZA 2P7IA 4QICA 3W0LB 1GTSA 1F48A 3B6JA 3HWX1 3MFYA 4TKVA 1IPFA 4BNKA 1FS6A 3G13A 3O21A 2VUIB 3O8OB 2VJQA 4OJKA 2QRVB 3H5AA 5FPPA 1TCBA 2VC2B 3R7AA 1Z6QA 1WDKA 3ZWBA 4NBSA 3H65A 4QECA 1GHTA 2WV9A 3SVLA 3KQKA 3C39A 3IAM6 3PCXA 5MDHA 3DWFA 5K8VA 3AHFA 2JCYA 1QK3A 5E6RB 3OEED 3GLIB 5P8WA 4DDUA 3OHPA 4AJOA 3MTJA 3RF6A 3PDJA 3GLFA 4RZIA 5LMNB 1DPFA 1Z0JA 2XDQB 2AOUA 4QPCA 1T3GA 1Y34E 3KYJB 3LOQA 4CKEB 1Z12A 2XV1A 3CFYA 1JR2A 3N9IA 3RIEA 4GOMD 1NW3A 3BXZA 3SG0A 3P96A 2Z08A 1AG9A 1A82A 2JBHA 3MMPA 4TTSA 4XGRA 2HXYA 4M0CA 3V7YA 1CHDA 1DB3A 4D81A 4BQPA 1AT1A 5GMOA 2B7CA 1C8KA 3C5EA 3ZWCA 4DG5A 1Q3KA 2QTHA 4BP1A 5JDCA 1HOXA 2N0SA 2VA8A 1FP2A 3MLEA 2CJYA 3OG9A 4FT2A 5B6IA 2PX6A 4YGYA 1Y6JA 1R37A 4IHJA 3SEFA 1ZK2A 2EG5A 3EVAA 1RAFA 3LRTA 2VYCA 2C8JA 5C31A 1K9VF 4JLWA 4NXNB 1ATIA 6AT1A 1V6CA 4UW9A 5CLQA 4FWBA 3RR2A 3QXJA 1T5DX 1JILA 1W5SA 1MFPA 1KZGB 3MQ2A 3JYOA 3PFNA 3R3HA 4KIJA 5GONA 4RZSA 3S5UA 3T9BA 1NLUA 2HI0A 2A9JA 2FSSA 1VG1A 1GADO 3MIZA 1DOHA 2X19A 4G5OA 4LQCA 4PSKA 3WK7A 1O8BA 2HQOA 1U80A 1NAHA 1ZICA 5C4MA 2DYKA 2SHKA 4NMMA 4MGHA 3MERA 1OWPA 1SC1A 1USIA 2QX9A 3NYWA 1MORA 3P9NA 4OKNA 3FM9A 5FP0A 2NTNA 2AI2A 3REFA 3SXUA 4DY4A 1I4WA 3QWFA 3OLZA 3GFTA 4ILEA 4YJGA 1X7WA 1T26A 1VHWA 2PV7A 3EXG1 4KE8A 3UO8B 1CY7A 1J56A 2B5VA 2GZAA 3DFFA 1IQPA 1A9YA 4Z1OA 4JQOA 1PR3A 1GL3A 1YRBA 4XXHA 3TEJA 1SY7A 2Z6UA 4MGYR 1P45A 3TD2A 3I5XA 2OPHA 5KTKA 2V03A 4JI5B 1KFEB 4EABA 5LZ4A 2V9CA 3Q11A 4DPLA 2PT5A 4AJJA 3RS4A 3RU2A 4UAUA 5TB5A 2J9GA 3A4VA 5I6DA 1IYZA 2A9OA 3PG5A 4WBNA 1XELA 2EBFX 4W5WA 1M5TA 3AR5A 4E6PA 4J91A 4QWMA 3HN6A 3KAKA 5DNAA 1SXJC 4P54A 1ZJ6A 3HE3A 4TLDA 4U7TB 1P19A 1G2IA 1RQRA 2B1RA 2AFIE 4NEQA 4BNUA 2GZMA 4MHTA 1U5BA 3A6LA 5ALSA 5CNJA 4J1TC 4GLJA 3LKZA 3NDPA 4WDQA 4WKNA 2EFCB 4M88A 1ABEA 2EATA 5DCYA 1ZQ9A 1ZNZA 5E6UA 4IV0A 3VR4H 4RHFA 1QONA 3CZ4A 4JLNA 4LBZA 1E1DA 1KI7A 4F4UA 2AD1A 1WDMA 1O5IA 2PD3A 2CJWA 1Z0IA 5E2AA 3E5RA 5KBYA 1HDRA 5KNCA 2ACKA 1CR6A 1VBKA 2VK1A 1ODFA 3AFNA 4FMDB 1E4YA 5E1OA 5FUBA 3SBXA 5L3VA 3LQ1A 5C4IA 1GTG1 1NU6A 3WNCA 1XTPA 1DADA 4LRSB 1OJ7A 3S8MA 2DH6A 3FNGA 3NNDA 2JZOA 1I3OA 4KV7A 2VOEA 4K9NA 1C4XA 5LBTA 2WA1A 4BEVA 1TDJA 1WUIS 5L3QA 3QKRB 2UYYA 3NDRA 4QFDA 3DHWC 1AV6A 1KVQA 1WHSB 4OHWA 1I13A 4CM4A 4O2RA 1G6OA 2B7LA 2WC1A 3HGTA 5HK9A 2C7VA 4MEAA 1SC9A 1YJCA 4BUCA 1GRQA 3CNNA 4I9NA 4JQZA 5DTEA 3L7JA 3GJSA 2D4AA 4UXJA 4YIKA 4R40A 3WOVA 5JE8A 1ZCZA 3RSOA 1W0CA 4CEIA 1TNDA 5FYQA 3WQBA 4PBRA 2I9KA 5H3CA 3DF9A 3M9WA 3G23A 2NQ2C 1DAHA 3RFTA 3VYUB 5TT1A 1YKFA 3BTVA 1T2UA 4KLAA 3GZTB 4OKIA 5T4BA 1MC4A 3CC8A 1RPZA 2VBFA 3LPNA 3NRBA 3UW3A 2C7QA 4I4NA 4JJFA 5EHZA 3AOEA 1HQKA 3D2BA 1HT2E 2WIBA 3AGQA 3N70A 3NHZA 4HF7A 1GVNB 2OKCA 4HEA6 4Q9HA 2OXEA 1A5ZA 1Z2NX 3TNDA 4HDRB 1WUHS 5LB2A 4FDVA 1XQXA 3T6KA 3WBKA 2O5RA 2R85A 1S3IA 2JLQA 1CJUC 1J99A 2GASA 2QYSA 1XL0A 3GAZA 3KOZA 1DI0A 1ZOPA 4QU9A 3VZBA 1KEEB 1Q16A 1Z4NA 4J94A 5I7WA 1Z18A 4YFYA 1R00A 1KBOA 4ANFA 1DJLA 4KVFA 3QWAA 1IG3A 4R81A 1HFEL 4Y2UA 5DCUA 1YTLA 1XVTA 4AO8A 5DEIA 3VI3B 1ODKA 1ZW6A 2V4ZA 4WZ6A 4YMWA 2QRUA 4PRZA 3BQMB 4KXQA 4WEOA 4B73A 5L51A 1RYZA 3GRVA 2NU6A 2C2BA 4I4TB 5KX5A 5CIYA 2HYIC 4KLNA 4NBRA 2B30A 3KUXA 4IUYA 1Q83A 1SHLA 2QW0X 1J9EA 1X9GA 1ST2A 3L18A 3R0XA 5BWNA 1P81A 5BMVF 4CFZA 3TCNA 1AB5A 2KHZA 4UXHA 1CEEA 3HCBA 2B7BA 3MTBA 4MKGA 3M82A 1MVOA 1FC0A 1UCFA 2HNAA 5BQPA 1RIIA 4LX0A 2Y9PB 4YRRA 5NLLA 3RH0A 1TVMA 2I3DA 3AJEA 3VPHA 2C0QA 3OF5A 2DSNA 1J90A 3LUAA 3O3OB 2JH9A 5CVUA 5DULA 2W70A 5JALA 4C7OB 2CV1A 1VI2A 2C8VA 2Q2OA 1U0EA 3DT6A 3E9QA 3PC2A 4JYZA 1ODCA 3I9JA 5AW5A 3VZQA 4XDZA 5JYDA 3KAPA 1C8LA 1Y9JA 3B5IA 3C3KA 1FFXB 5L8VA 3ZX4A 1AN0A 2F6RA 2QDXA 1EB8A 1M8GA 2JGFA 4IQFA 3EIFA 3ZDZB 3EZNA 3UIEA 1EG7A 4UTOA 1EM6A 1JG6A 4WN3A 4TXHA 1D9ZA 2YS6A 5EERA 5F21A 2VYQA 5L45A 1J23A 1U4OA 2BZSA 3Q85A 4Q03A 3WKDA 1DUIA 3VZPA 1JT9A 1XBTA 2NXCA 3IH5A 4CV0A 3OESA 3ZVMA 5DBFA 3NEYA 4AMGA 3DVQX 4JIMA 1VPWA 2R6HA 3V6LA 3R3SA 1N36B 3SR0A 1JDZA 1O3YA 2OXFA 5EWLA 2F8TA 5T8KA 1A9PA 4YJ2F 1MV5A 4B6OA 5DN6D 2GJAA 5KWJA 5FO1A 3O3CA 1U65A 1M6NA 2BHRA 2NU8A 1ELOA 1Y7LA 2ZIUB 5EWMA 4UFOA 1PK8A 5E2IA 4DQ0A 4ZYLA 1NLZA 1P1CA 4POAA 2DXIA 1RKUA 5FPKA 5HXAA 1FFGA 4EARA 2P2ZA 4QGAA 5IYZF 4AF6A 2RHRA 3HMKA 3CH7A 1SUDA 5KTMA 1NBHA 1B8NA 1EGVB 2WD7A 3KEOA 3PUKA 3QYAA 4W5NA 2RC6A 2DY0A 2VAWA 3I2JA 4ZARA 1ONBA 1NL3A 4MS1B 4C7BA 3ZE0B 1O9BA 4J4BA 4XCXA 3FOFC 1EX6A 3RV4A 3GPBA 5EYPA 2EOAA 2ROQA 1XZGA 3C85A 4LF8B 4LJKA 2CLHB 4NG5A 4X6XA 2QTVB 4BNFA 1Y1KE 3GGGA 3BHNA 2V4UA 1FRNA 2HZ7A 1P0IA 5IH3A 5AHWA 4KPGA 2BR5A 4HAYA 1HR0B 4OIMA 1F8UA 1Y6RA 3RSFA 1F2TB 4Q47A 4ZVKA 1NT4A 2D2XA 2ZUCA 3A2MA 3VR6H 4UTPA 2NO1A 1B4DA 4ECAA 2EERA 2JGMA 2JATA 2CVQA 2XTNA 3AETB 3E9YA 2EP7A 4KC0A 5JDCC 1KE1A 4ZN6A 4LF9B 5KS2A 3ROMA 4OU5A 2YWRA 5DGIA 1K7YA 4EVIA 1TRKA 1F12A 4CMJA 2PUDA 4YAKA 4JI7B 1IWOA 2VH2A 1NJ5A 1CUBA 1R0SA 3CPSA 3E8SA 1GNQA 3JQFA 3KELA 4XWTA 5HRAA 2XOKD 1J8FA 2DKOA 4WKGA 3ZYZA 4P5DA 1T1SA 4CU2A 1JFFB 1XMOB 2DUWA 3TKLA 4HZIA 1Z83A 2IYXA 2XCLA 4E31A 3OO1A 4Y6SA 3NG1A 2YWBA 2FGJA 4O2BB 5LL6P 2CK3D 3EHDA 5HCIA 4PGGA 4YRIA 2Q3FA 4LFAB 3NZEA 4Q02A 4HNUA 3QEAZ 1XX6A 1N2CE 2I2XB 1X2EA 3A31A 4MDFA 1ZC4A 1NATA 5FUYA 4Q66C 2JIDA 5BSGA 3O38A 3FOEC 5KTYA 3P0FA 3R7NA 3OE1A 1M7GA 2CT8A 2F8SA 3WQQA 3VBEA 3O90A 4K46A 1UODA 1R0WA 3E84A 3TI9A 1FQKA 2JI7A 4AYWA 4BWGA 3LBNA 4MPPA 1QHHA 3SD7A 2DR3A 4WLOA 4BLVA 5AHKA 1V47A 2C5BA 2WV7A 3TECE 2ZIVB 4DCSA 5C80A 4PZZA 4OX9B 4KI7A 4D56A 4AY6A 4QJ3A 3GLHA 1PZXA 1DXHA 4HY3A 4LRTB 3A1UA 4A8JB 4DT1B 1Y3DE 4DLRA 3N0VA 4GO1A 4JL5A 3WGMA 3I05A 3KUKA 3ZY6A 1U0RA 2W6OA 5CYFA 1MQSA 1NRJB 2D5AA 1EZZA 1HLPA 2VS1A 1JHPA 3ETGA 1P9WA 3P2JA 4L5IA 2R0QC 1CZOA 2AYZA 3ZEIA 4DMHA 5HQ3A 5TPWB 3WMGA 4NNOA 3FRHA 5K0ZA 5CCBA 2H7XA 3H4MA 2XKJE 1H8ED 3A6ZA 3GD7A 1BXRA 4G5GA 1ICEA 3PR1A 2VFAA 2IA5A 4LI3X 3VH1A 3AVTA 3KVVA 3ZH2A 4TTIA 4DADA 3EN0A 4D96A 3TQOA 1H3NA 4PFSA 1Z2CA 4QM6A 3KXIA 3T99A 2B25A 3VC2A 1ZVJA 3NOOA 4FN4A 3ZHSA 4BN5A 4B0PA 4ED9A 1MZVA 3MGKA 2V7VA 4P32A 4QXQA 2NZ2A 3PTZA 4CV2A 5COBA 5BYBA 1JXAA 5FV7A 1E2BA 2XUAA 3FPAA 1TU4A 1M6VB 3GVXA 1E2UA 3IAS6 3LO8A 3QLEA 4RVOA 5IHXA 1KJNA 4TTAA 2B83A 4XTRA 4PYMA 5HS6A 3OAAD 1G7TA 3GEBA 4CEHB 2TRSB 2W71A 3AR4A 5HTKA 2OXTA 3LOPA 2BGWA 1BQ4A 1O89A 4ETIA 4FR2A 1Z5OA 4J3FA 3BILA 1YZGA 4Q5IA 2WWRA 1T6BY 4YMTA 1CS4C 5DI9A 4BHTA 4C4XA 4HWGA 1SOAA 3NGLA 2O5EA 2E3JA 2JIZA 2OGSA 4PS0A 5J23A 2OY0A 1WRBA 3LNCA 5DLPA 4C6TA 4RMIA 3SF8B 5BN3B 2HBQA 3RVJA 2GN6A 3QELB 1EVKA 2VLIA 3TIXB 5FWXB 2GTPA 5EIOA 4RZQA 4OHBA 4U39A 2D1FA 4RY9A 4TVKA 2OZKA 3DBRA 5HMMA 4EJ2A 4JZYA 1Q21A 4ESHA 1NFFA 3DLBA 2IOHA 4ZZ2A 1ADCA 4BP9A 4DVGA 1WD5A 1GUYA 2Q7XA 2FEMA 1A8IA 3RBAA 3AP1A 1HF3A 1PT7A 3NBXX 3OQIB 1BVHA 4WOJA 1QLHA 3AH8A 4KXNA 4DOMA 2ZIZA 3HA2A 2Q9UA 4NZ9A 3B60A 3AOEC 4QOJA 2GYWA 1L1EA 2P0AA 1LQ2A 4HI0E 1D9XA 3IVRA 1EH5A 4ZVQA 2CCKA 2HHHB 3TL2A 1FQJA 3I0ZA 4WJKB 1E66A 3MCVA 4F86A 1WOMA 2G9ZA 1KE2A 2ZJZA 4GYWA 3DL7A 3N0XA 4NL4H 3PCTA 5IJ9A 2WM8A 2O8FB 3RC3A 3KOOA 4JLVA 1TGYA 3OVMA 3PWTA 2O8CB 2AX3A 3T52A 3GBSA 5LBIA 3E1KA 4TTPA 1QAQA 4XWYA 3RAGA 4BLSA 3TOCA 4E2WA 2EC5A 1VB3A 3FGPA 1XKXA 5K0SA 4HQKA 5IPFA 4QHTA 3OIYA 3NT4A 4KO8A 4MVCA 2GO7A 4Q1BA 2IUSA 4F91B 5D01A 4R9RA 2JJQA 4BOYA 1N5MA 1Z45A 1H2XA 2FG7C 2P90A 3I28A 2ZJFA 4GLLA 3G8AA 2BJWA 2NO5A 2ISQA 4K6FA 4KYIB 1IFXA 2A9QA 2AF3C 2VNJA 1TJNA 1VSUA 4RLHA 3VPSA 1R8XA 1CK4A 5AQ1A 3L7KA 4O4HB 3K72B 2GARA 4ARCA 2AZTA 1CVLA 2HDHA 3EFOA 4RX1A 2JFPA 5HRUA 4YAEA 2HIAA 2AB0A 1XXHB 3I1IA 1QE0A 4GP7A 2XEDA 4JOQA 3CRRA 3WQHA 2HCTA 2Q49A 2GRUA 3T5TA 4OLAA 1A69A 2GOYA 5M5BA 4FXOA 4H7KA 4PCVA 2AWOA 1QFMA 2O6LA 1H9BA 5BUSA 4GDMA 1N2EA 4ZKEA 1Y4SA 2RK4A 2VYVD 3KCNA 1UDCA 2VYND 4IEFB 5TEVA 3NUZA 4TL7A 5LB4A 4ESVA 1P2DA 2FP4B 4QTUB 2HWWA 2NYRA 4BYGA 3RGGA 1YK0A 3HM2A 3KAQA 4RPJA 1QV6A 3NAQA 4XWOA 3FFTA 4R9NA 3O8LA 3UJAA 3DAGA 1KDZA 4IO0A 4LWPA 3FYHA 3OF3A 1Y1LA 4EOGA 3ND5A 3SMQA 3UJ6A 4EHBA 2NSLA 2EKPA 2PZKA 3QMVA 2W8BB 4ZT3A 5BN5B 5HX7A 1SBQA 3AG5A 5JV5A 3M89A 5T41A 4COOA 2D2FA 1LV7A 3CLRC 1B15A 4FLFA 2BHSA 3G2IA 4H7JA 1SOVA 4MWOA 3WSTA 3KQUA 1SXJD 2X4IA 3QG5A 3LTEA 1JR3E 1EWVA 4EHJA 5U1PA 4REOA 2ECQA 5EIEA 5DMHA 5KYGA 4KBFA 4MAFA 4UUOA 3M5DA 3UEOA 4R8MA 1MW9X 1N2IA 3FSJX 5T8KC 4NOJA 2WT9A 2ZI3A 1BWPA 3EIQA 1X13A 3RTBA 3IR6A 3U26A 4YUWA 3CNBA 1JAXA 2ADOA 3HVIA 2IUFA 1KQ3A 3T1TA 1NI5A 2PBZA 1SHZA 2HDOA 3VKVA 2O50A 1IJKA 2YX1A 5FO0A 3HNOA 2VJOA 1D6SA 3F5QA 1CUCA 2VP5A 2C61A 2XMCA 4DFDA 5FL7A 3UKDA 2Q0XA 1RHUA 2FZ4A 4Q7MB 4YMUA 4CMKA 1XZIA 2A0KA 3L1KA 3PEEA 4RNCA 3S7TA 4LJAA 4F8YA 2BP7A 1SOUA 3SZLA 1JWLA 3Q10A 1NI4A 3C6KA 8ADHA 4QDOA 3L4EA 1T8TA 5AICA 2XUZA 3TE7A 4R71A 3GEHA 1G8GA 1S1CA 2EW8A 1XEWY 2ZT8A 1UJMA 4DYHA 1Y4ZA 3DXXA 3H9JA 4GPAA 1GZ5A 3DVAB 5ENZA 5A3JA 3ROKA 4LY6A 2IPNA 3TZKA 1SC4A 2FSUA 1MB9A 3SLRA 1DHTA 1UQTA 3OTIA 1UIRA 2HLPA 2W48A 1B23P 2J9FA 3TDMA 4JYAB 4P08A 4BLUA 1J0DA 3UGJA 1SUWA 2EJCA 4MCAA 4RKYA 5L4LA 3FCEA 1WUYA 5EE5B 3NIDB 3DA8A 1D7AA 3B9PA 3T7KA 4RPLA 3DO5A 3F4LA 1BXGB 1IBLB 3ANMA 5EJ7A 5FUXA 3IUNA 2ASEA 5LYJF 3HP1A 1A2OA 1MV8A 4BNLA 2J3JA 1A88A 1DZIA 2CXSA 1UM9B 4L8WB 1NF9A 4MVJH 5IVIA 1QHSA 3RRJA 3SYLA 3DB1A 4EEKA 3ZDDA 3CR7A 3PGXA 4J0DA 1GGFA 4R8VA 1P9LA 2WWWA 3JQAA 2BLNA 4MQ5A 5SY9A 4WFJA 4AY2A 4R1SA 3GFRA 4RKEA 1JX6A 3BWEA 1M2HA 3QLUC 1UINA 1PJZA 3EFEA 3A0UA 3FPSA 2HRQA 1N25A 3PPVA 4IJKA 4EPTA 2DTEA 2JAHA 7ABPA 1M10A 5P21A 4O0MA 5A3VA 4ZYYA 3RC2A 4BRUA 2HWYA 3DEAA 3G2MA 4B2IA 1AS2A 1Z6PA 3OLWA 4PAOA 2NU9A 4PQEA 5LQSA 421PA 3BZBA 2D1TA 4TXNA 3ZWVA 1IQRA 3C16C 3LH5A 5AP9A 4YRNA 1T3HA 1RXUA 2I29A 4MQ4A 3QHPA 5HZKA 3W3AD 3AR8A 4CQLB 1MDFA 4FHDA 2E6KA 3EXG2 5HGXA 2HLHA 2C97A 4X97A 1SQ6A 4TROA 3AUFA 2CLEB 1ECLA 1HTTA 1X1QA 3C3BA 2VHUA 3QXHA 3ACCA 1FMTA 4FYXA 2D7JA 2XB2A 2COEA 2G70A 3HUTA 4YJHB 1AGPA 1W1WA 3OU7A 2NMVA 4XDHA 2EV9A 4FEEA 2AK3A 4Q3CA 2C5EA 2AC4A 1VKZA 2Q9BA 4Q1EA 5CA1A 2PX0A 3HWRA 3K8OE 3TW8A 3K71B 1O95C 4IRUB 3HCCA 5CFPA 1PQUA 3KB6A 1P6XA 4HTAA 2DECA 5CBKA 1UWKA 3PQ8A 5IKOA 4ZU3A 1AM4D 4JBYA 1XZQA 4C7VA 3LUBA 5FI0B 4LN1A 3ET5A 3M6WA 5BV1A 1Z22A 4Q7KA 5JEDA 5KOJA 2UZIR 1JQJC 3AEUB 2VQSA 2XUDA 1JHUA 3P9ZA 5KUTA 3E7FA 4J1QA 4OXKA 2SCUA 4HZGA 2CUZA 4ZVTA 2HCRA 3OQHA 1KY3A 4PSUA 3WV4A 4MQLA 3O75A 4HFRA 3N07A 4HB0A 4H17A 3HJRA 4TWRA 5HDQA 1KVTA 2VUTA 3D1LA 4QBIA 3DZ8A 3O4RA 4UTRA 4EBFA 1KI1A 1ZXLA 2P1ZA 3WKBA 3NS7A 4D92A 2NZYA 3REQB 3ZV5A 3OQPA 4L73A 1DAMA 1TMOA 4MW0A 3DO8A 5EFZA 2PUAA 1N57A 2BFAA 4EM6A 2JJ2D 2ATIA 1R4ZA 4TV9A 2GEJA 1CY0A 2QMUA 3W79A 3EQ2A 2IL1A 1OU4A 1HDEA 2J9XB 4KQIA 1ZI8A 4F9EA 4X66B 4FLEA 2QA5A 4W5QA 1LLUA 1FB5A 4KBYA 4JYMA 4DC9A 3DM9B 4Q1FA 3LGAA 5KOIA 1J70A 4UVGA 4K3UA 5BUQA 1QZXA 3CX4A 4R83A 2RH8A 3KPYA 1IBMB 3KV1A 3WWOA 3UAOA 2FW9A 3ESQA 4KIGA 5H68A 3WRXC 5JLAA 4QO7A 1T3SA 2GPYA 2VP9A 4EJ0A 3B52X 2ZAMA 5BW4A 5J5AA 1R6UA 2PWZA 3SYKA 3CCFA 4G81A 1JEJA 1YRAA 5CEFA 4FE3A 4I1RA 4GOND 5CD1A 1HRDA 1KO8A 3Q4GA 1OREA 2AJBA 2PRSA 4YPFA 1ZINA 4L72A 3ZD8A 2M1XA 2QT0A 1H5NA 1Y5MA 2EYUA 4HNQA 5BR8B 4K81B 4X92A 1W48A 1E6CA 1UT5A 3K70B 2XXAA 5BXQC 4Z2YA 4IQ8A 4ZI7B 1E1QA 1QKIA 3QJ5A 4U7DA 4HDQB 4HSEA 5LWHA 1PD1A 2O2DA 2VT2A 2QQFA 4UASA 2JIBA 2FPRA 2YR0A 4UE3S 5M7EA 3D5EA 1N6KA 1LWOA 3HEBA 2P68A 4DLUA 3LDAA 1UMDB 2RDMA 4JUCA 2H59A 4B40A 1W0JA 4EA8A 5FEUA 1K4MA 4F0JA 4CLRB 4A0GA 1K7XB 2W6JD 3IDZA 4OUDB 3FVQA 2ODQA 2GPJA 4XPIB 3ZIUA 3AUSA 1QQ7A 3C8MA 3A58B 3G5TA 3PVCA 3PXBA 1Q17A 1WXWA 4MTCA 4RL4A 5GONF 3O9ZA 3B7WA 1X80A 2QPAA 3R5FA 4LSWA 4C0BA 3L7DA 1KQGA 2J31A 4R0VA 4G0VA 3G0HA 1GGKA 5DGTA 4IUBS 4OHYA 3G1TA 3QLJA 3UAXA 2OBLA 1MMFB 1NN0A 4N6GA 1Y7TA 2OKGA 2PUJA 3DC2A 3ELBA 1HM5A 4J2TA 2C1ZA 4U7FA 4CN9A 3LIPA 1KJWA 4P22A 3LT5A 1V6SA 4OK3A 2J46A 4JOCA 4TRNA 2FOLA 3T9FA 1Z2EA 4NRDA 4MR8B 4PZAA 3UJHA 1GYPA 2DETA 2OHIA 1U0HC 2GPAA 2PJRA 4XW2A 3NXSA 4ZAGA 1E18A 2CLOB 5B7PA 1IHYA 1C29B 2RKOA 4CI0B 1YVEI 2IIVA 1JU4A 1X94A 2R8RA 4TWIA 5K4GA 2O8EB 2QG9A 2FKAA 1RD4A 3BIWA 3THXB 3D3EA 3SS8A 1Q6YA 4TZTA 3UM9A 4MVJM 4PZEA 4EDFA 1G20E 2IP4A 4G8BA 2MU1A 3LDHA 4LSZA 1N92A 4HMQA 1Y1QA 2ZRIA 521PA 2WSYB 3RU9A 4MV9A 1WKCA 3F98A 4IFTA 1WJGA 1CCWA 3KSZO 1BCRA 1A7UA 1V4VA 3DV0B 3B7PA 3JQGB 4MW6A 4RDHA 1QX3A 2QTNA 3BGWA 2QORA 3V8VA 1OR8A 5IZCA 4M7OA 3V2GA 2A84A 2ZWIA 3JWPA 4P84A 1HL7A 4D25A 3BWYA 3DE3X 2ZT7A 4O02B 3CRMA 2BDTA 4GR5A 1DIHA 5LD2C 2IFTA 2WIAA 3JPWA 1V25A 3N2KB 1V37A 3NHUA 2FLWA 1BGXT 4HAUA 4R3NA 5EGNA 2C9MA 1EXDA 1H6BA 2I7CA 1SVNA 4BVLA 1SBIA 2B1QA 5JY1A 5CX4A 3DB2A 4NCIA 3AVXA 1PGNA 4ER0A 1RJWA 2QM3A 4PLHA 1ILWA 4DJJA 2PCLA 2WP0A 2R00C 1ZJ5A 1QYWA 4RCYA 1WHTA 3G5LA 1T8RA 1GKIA 2ZAYA 1GXSB 1MX3A 1Q0QA 3D9QX 4NQZA 2G9NA 1QIEA 1AKRA 2GNOA 2C7GA 1UMBA 2REOA 2X5OA 2YC4C 2ZANA 5EJMA 3UT5A 4BO7A 5F9HA 2CV2A 1CSEE 1KNXA 1NIPA 1KMQA 3KZ1E 3R76A 2OILA 1XT6A 1QIKA 2PQ0A 3ANTA 3L7BA 4OHRA 4YJFB 3C6MA 4E2XA 2X0NA 1Y3IA 3DCIA 5TQ2B 1W85A 2R7NA 3EZ6A 2PL9A 4DR4B 5G41A 3I6IA 1VKRA 3JAKB 1L4UA 1PSWA 3T4EA 4DV0B 1E92A 9ATCA 3N2GB 2AZXA 4HUQB 5HF5A 2GM3A 1NFRA 1UXIA 2XMBA 5LQAA 2PXXA 4NHEA 2MCFA 3SIXA 1KJ9A 3EZGA 3INRA 3G1WA 3R24A 4WVLA 4YAOA 5D8DA 1ZJZA 3A28A 5FWXA 1PR2A 5JECA 2ZUFA 5CAEA 1EJBA 1ZCBA 1JEYA 3NVAA 3OQOA 3NKVA 1AKMA 1DC6A 4TT8A 2C78A 2K87A 5KVVA 2FSIA 8GPBA 1BWRA 1DXOA 2Y1OA 4NR0A 4WNYA 3G2NA 1JZTA 3QSGA 4K05A 4QPJC 5KTOA 1N5KA 2OE2A 4R5MA 3Q98A 2E18A 4KACA 1PJ2A 1VBNA 2REQA 3DYBA 3DW3X 4JJ8A 1K5HA 4IDCA 2OCKA 5F64A 3SX4A 3V8BA 5CA0B 1Y6QA 2R11A 3GRAA 3HXLA 4WESB 3DMTA 1NGSA 1W44A 3H3JA 1U94A 1XCGB 2NZXA 3U3MA 1RYYA 4I81A 4AUNA 4KKXB 4PXAA 1YCGA 3Q12A 1F0KA 2JZCA 4AP9A 5KX5F 2CSXA 4Y2PA 1WF3A 1YQGA 1UBNA 2PMCA 3X43A 1YUBA 4N5NA 5ITZA 5B30A 4NENB 1XAHA 4JELA 1XV5A 4EO4A 2UVPA 3MRSA 2ODAA 3OCJA 1QF9A 3HSKA 3C4JA 3HVJA 1DWOA 1SBTA 5K09A 3RFVA 2JFYA 2Q2VA 3FBWA 5BV2P 2HV9A 4PRLA 1RM0A 3T7RA 3V3TA 2G1UA 3E0XA 5K0JA 3QITA 1GV1A 1RXYA 2WMDA 5ALNA 3L0ZA 4HPJB 3THYA 2HO5A 3RHFA 3UWKA 1GSOA 3CPJB 3ETCA 3GRYA 3MILA 4S1OA 3AI3A 1AGRA 1Z34A 4Q4DA 3ZHBA 3EA4A 1N2GA 3JD2A 4YCMA 3O2SB 3H4IA 4LHVA 2PMKA 1AQUA 1H6DA 1S96A 5CJ2A 1FJGB 4KRFA 1E3WB 4J7AA 1MGOA 3EWNA 4B2PA 2Q1TA 3D4PA 2AGVA 4HBZA 3P9PA 4N5DA 3UK7A 3H2HA 2UYHA 1J9GA 1OTXA 1VE3A 1S2IA 2I7DA 5JZBA 1SIBE 3G2OA 4YREA 3DE0X 3LIIA 1PR0A 2QTBA 4UHCA 3IHTA 4UVIA 3BTUA 3F6SA 4YQYA 2BUCA 4WECA 3AV3A 1C1DB 2OB1A 4XSGA 2R47A 4WZAB 4PSDA 3OJLA 3OC6A 3FAZA 4F9TA 2C92A 2ZKIA 2RHJA 2WE7A 1Y7HA 2ZIXB 3QYJA 1AB6A 4GIBA 4ZEXA 3IDFA 4B6SA 4Q7EA 5AUPB 1U3UA 3OMXA 4OQDA 4R8RA 5KHLB 4TYWA 4FDTA 1VCNA 3JQ7A 4JWTA 3BE6A 1LRKA 3B1FA 1B93A 3SP1A 2J0QA 5ECDA 4EELA 3NHKA 4CFYA 1W52X 4RPGA 1H6AA 1VMAA 3DV9A 3W5HA 2Y8EA 2QUIA 2XUGA 4DBLC 1R4NA 3HCRA 2PD4A 1EBFA 2NO4A 3E15A 5F1YA 4Q9JA 4CLOA 1H93A 3IVAA 3LI2A 1N9KA 2OK8A 5JVDA 5ER6A 2AN5A 2CLDX 1D09A 1K6MA 4HNRA 3U4CA 1XZHA 1JDSA 3GLGA 1CZLA 1QH1A 1RBQA 1L9KA 1XEXA 1EX7A 2E0IA 1FFEA 4XGQA 3GGOA 4JQYA 5EAIA 1Z28A 3I1FA 3R6DA 3DOOA 3WK8A 4EYSA 5KNBH 1XMVA 4HRYA 1AIPA 4BU1A 2Z8YM 1JFVA 3FY4A 3L7OA 4IG4A 5LOVF 4FBMA 4KL8S 1KY2A 1CDDA 2XCOA 3ZJUA 5JNUA 4JJIA 4N12A 1YI0A 2OTCA 2NUAB 4DIFA 1R0LA 5MHTA 1TKAA 2D2VA 2PR7A 4A2PA 2SKDA 2B4YA 3H5VA 4ZAZA 5IMSA 5ALIA 3LQ2A 2NXNA 1J0BA 3MFQA 2J45A 3UOGA 3ROGA 4HLDA 4DA7A 4EZEA 3T5AA 1TT7A 1GZ6A 1MEJA 4EYKA 1G19A 1KHHA 1J0EA 1T5SA 3FZQA 3CLUC 5JNSA 5AVKA 3CVVA 4RYLA 3LPAA 4CEJA 4DXAA 1E9EA 2GEFA 2EX0A 4UU7A 2F7SA 3QKSB 3MAJA 1NUSA 3A9CA 3DKIA 4PN3A 1IN1A 2HBRA 4GX2A 4KNWA 3M33A 3CMMA 1J8MF 4QUGA 3PLRA 1PHRA 3BQNB 2X1VA 4ZFNA 4G0WA 1JE0A 1GA4A 1XTQA 3TOZA 3PTAA 4FFSA 1OPRA 4DDHA 1XNHA 3W6UA 4OBEA 4H7HA 2R62A 3AR6A 2G0NA 2JLZA 5EJ8A 3ENWA 1KBZA 2EFYA 2RK6A 5E0OA 4CI9A 1X1CA 3W5BA 2D00A 2G5GX 2XNKA 1OIWA 3JVEA 3NTUA 2ZT5A 3EB9A 3P2EA 3R7SA 2G8LA 1BEUB 4DS3A 2D1RA 4K6MA 5G1PA 2QQ0A 3WHPA 1QXSA 2PLRA 1W5FA 3DG9A 4CM3A 3E23A 4OTZA 1B6RA 1GL7A 2IE8A 1ZGGA 2DT8A 4U4AA 2Q3DA 1IHOA 4H6WA 1BW9B 4YI3A 4JLAA 2HDWA 3L1JA 4UVDA 3LBYA 1NW4A 1EFPB 1U9YA 1O6BA 1W4RA 1A9SA 3CZMA 3G7UA 4JJZA 3UCFA 2GEDA 4I0WB 3IT3A 2CWWA 3C3DA 5COAA 3N8HA 1HZZA 2CHFA 5DKFA 4X3OA 1FFWA 4B34A 2JAUA 3MTEA 3SI7A 4AY4A 1DIBA 1HRKA 2IYEA 5C53B 4C0XA 3I9NA 3HPQA 1M3SA 1KYTA 5AIBA 2OBXA 3QF4A 4M49A 4JI2B 1JFTA 3M1YA 2EJBA 2MYPA 5KYTA 2XB4A 2EP5A 2Z5LA 5LQDA 2O3UA 1AMUA 4GMKA 4KWTA 2X4GA 2MINA 1XWIA 2FFQA 5IZCC 5JD3A 1NXVA 4AKGA 4DPKA 5AK3A 2ZYHA 1I7DA 1SC6A 4BMYA 1MXHA 3MNFA 2H7VA 1Z5WA 2IIPA 3OLQA 4D3YA 1YIAA 3JRXA 5EPEA 3VDRA 4A8PA 1ZXBA 3V8RA 1SUAA 2W4MA 3PE4A 1O95D 1R4AA 2VHJA 1DLIA 3NHAA 2FSVA 2ORVA 3BWMA 5FWNA 4PWZA 4JKOA 5CX1B 1W8IA 4QBFA 3PI6A 5G2OA 4DQDA 1KARA 3HQ4O 3OIUA 2ONCA 4MVJG 2FPPB 2XMQA 3JATA 2PZGA 1SZPA 1I9GA 2ZB8A 2IS6A 1WKBA 1P8JA 2ZBUA 5TGTA 2ZRCA 3H97A 5H70A 3KL4A 4DGQA 4CTOA 3HLTA 5EVCA 2RAFA 2ZETA 4OHVA 2YHSA 3MAGA 2EP8A 4J0FA 4Q3NA 4DJAA 4MP8A 3ZS8A 4AIRA 5KZMB 4QYIA 1DU4A 5IZ4A 4BX8A 4B81A 4GWLA 2WVGA 3PDUA 4AZ0A 3ZEAA 4B48A 1IY9A 4DLYA 4W82A 3LG2A 5EUCA 2HYDA 3IVGA 4CLXA 2C7RA 3TD9A 1R10A 2AKAB 1T4DA 4UPDA 2QV0A 2WJGA 1XZFA 3DHVA 4CQJA 3T0IA 2A92A 1BQEA 2JW5A 3TOVA 5D85A 1W4LA 5BSMA 1Z6AA 4QEKA 1CJVC 1SVSA 2WUVA 3B1JA 1DIAA 2IXGA 1XMSA 1K0UA 1SU7A 5KNLA 1QH8B 2I1WA 4Q34A 4DZTA 7GPBA 4U9UA 1LBIA 3WJAA 5CCXA 2B98A 1DMRA 3VR2A 2TS1A 3C1UA 1P77A 5B55A 4QYSA 1XJCA 4Z7OB 1K2WA 3PDWA 2AOTB 1Q0LA 3GJ4A 1Y3FE 2WU3A 5HUJA 2QV7A 4JI6B 4ZXFA 4Y6QA 3QPWA 1HE3A 3K1AA 4QWWA 3HDTA 2G3YA 4KH0A 3H8JA 4X85A 3LX6A 4QOEA 1MG0A 3CBGA 3OKFA 4CUZA 5ES4B 2J67A 3GPCA 3ZUPA 4Y9UA 2RGCA 2A0UA 2JPDA 3CNLA 3MS2A 4MWCA 1AZLA 4E22A 6YASA 1Z56C 2HA5A 3TM4A 5DASA 3ES9A 1JQ5A 4F4CA 2L17A 1A1VA 2CZQA 4D0SA 2WF6A 2PWBA 1T6XA 2ZSUA 2WU0A 5AYVA 3OM9A 2ZAGA 1ESCA 4LYHA 4BVFA 2GPNA 2Y67A 3CIFA 1BEEA 2I2WA 5AI4A 2FPIA 3B48A 1T1GA 2BMEA 4NDAA 2DF8A 1KOGA 3BYZA 1Y80A 2ANBA 4UHHA 1W8DA 4FD2A 1EUZA 3FX2A 4X1YB 5GGXA 3HLKA 4HDNA 4BU0A 2RJOA 1K66A 3UH1A 1ONNA 2QUAA 3FCAA 4PANA 3A3PA 2ZPTX 4O4LB 1D1QA 4RA6B 3SS9X 4DSUA 4JBNA 2CYAA 3G2JA 2O57A 1O97D 4A6DA 3BXFA 1CUEA 2B4QA 5EPOA 1SVWA 1OB2A 1X42A 1ZD8A 4ZVRA 1DAOA 2FG6C 4OQNA 1CVRA 4XJTA 4GX0A 5AJUA 3EOAI 2WTAA 3DXFA 3EAQA 4MYRA 3NP7A 3QU4A 3NTXA 3AB3A 4ENTA 4RULA 4XOIA 1K63A 3ROTA 1T15A 3O2JA 1B8VA 4HGPA 3ZWXA 4TV8A 1Y8RB 4W9MC 2XZOA 1E3JA 5CFRA 1N0IA 3UUFA 1EYZA 1YDFA 4OHZA 3NJ4A 2G09A 1O0SA 2K2WA 1WG8A 1E3LA 1X1AA 2IYWA 3I83A 2MJLA 1EHYA 2FGKA 2A30A 4CM6A 1NQ5A 1W49A 5AVOA 1YR3A 5CLIA 3IEIA 2FUG6 3AZPA 3H1TA 5E6SA 2JL1A 2P2SA 1XMPA 1DIOB 5LZ9A 3B36A 3PXDA 3CGWA 3U7IA 1YRYE 3B3QA 5MGNA 5L6LB 1LNSA 3ESAA 3PF9A 2A1TR 3ST7A 3U80A 3SU8A 2PMWB 3OPYA 4X6YA 4AFNA 4W5TA 1GQSA 5SZHB 5LBUA 4K6CA 2PXAA 4MLZA 4CT0A 2EX4A 3MOIA 3CUUA 2AJ8A 1JU3A 2OGWA 4PC6A 1AUQA 1U8CB 4NZPA 4ZOLA 5KNDA 2I03A 3S2ZA 4U02A 1YS2X 4Y2QA 4ALLA 4G1MB 1KDPA 4RK1A 4C06A 4GBGA 3RGWS 2ASVA 2F17A 1S2OA 1T2AA 2XQFA 4YASA 4D8YA 3RPEA 4DDMA 3K6SB 1WCYA 2ID7A 2QZPA 1DO0A 1VFPA 3GPLA 1P3Y1 1YVUA 4MVYA 5F5LA 1A1SA 1FTYA 1EUYA 2ZBVA 5ELMA 4AECA 5J5VA 4C43A 1Z5ZA 2D5IA 3KKEA 3ROQA 1AGYA 2PFSA 4EPRA 4M1QA 1KF0A 3L46A 5HIJA 3TWOA 5MN5A 1M8FA 2I4RA 2X1HA 1P4SA 1ZGHA 4NF2A 1O1YA 4P3NA 3HMQA 3CJQA 2F1IA 1GD1O 1OFGA 3EXAA 1B0ZA 3KJFA 3SXJA 4KK3A 4D8WA 1VG0B 4KYTA 3KQSA 2NN3C 4US0R 1M2OB 4K9RA 1A2QA 5E3HA 3FHTA 1JW9B 2QLTA 3V46A 3U7QA 3I64A 4BL5A 4PX3A 2VDJA 1MIHA 1V11B 1CJTC 1NDQA 2R4TA 3E81A 1VDZA 1DTWA 3AVQA 2OVFA 4NJEB 5HKLA 1G0OA 3FPFA 4Q9NA 2R1ZA 1FRFS 2ZI4A 2XJ4A 3BICA 3MQ4A 3R7FA 1AO0A 3I6BA 1QP8A 4NE2A 5DXAA 3RU7A 1L7NA 3R2JA 2AW3A 2WUGA 4UNSA 1KK3A 1SCKA 3T3PB 1EK6A 4KNVA 4L8FA 1H2EA 4KJZA 5I7RA 4Q4HA 2BTQB 4BJ6A 4C9BA 2PNJA 2DSTA 2O0MA 1K2VN 4QJ4A 2H8KA 2VK4A 1GGNA 3DC7A 3JQAD 2EQ5A 2GA9A 5GZ6A 5FQNA 3A1DA 4J0QA 5GV7A 1D2MA 1SVKA 2RG1A 3A1EA 3IO5A 4J9UE 3U9SA 5JXHA 1FSSA 4R1OA 4L85A 3WGLA 1J2EA 3JYHA 2YVUA 1F1JA 1XPRA 4OJTA 4LXIA 4JJEA 1O96A 2QGFA 2X2EA 1L4YA 2XUHA 5BSTA 3V7UA 1HZZC 3G6KA 1LQUA 4KIFA 2PT9A 3U9LA 1C3XA 1TKCA 5AWFC 1G6HA 3GUZA 4JIGA 1SD2A 4JLUA 1YJAA 4UAGA 5J5CA 1TEZA 3BAFA 1ZIPA 2DEUA 2WZCA 3UMVA 4PW0A 3IAFA 3L82B 1Z38A 1GV0A 3DKRA 5EIBC 2F4VB 3FPJA 2AE2A 1CBUA 2R65A 2V96A 3H2JA 2DBZA 4NECA 1IAQA 1W1IA 1QOZA 2CNNA 2NXEA 3CYFA 3DO6A 1E9CA 1TC2A 2ERXA 3I6ZA 3KYCB 3LXMA 4UXIA 4MARA 5JCJA 1I7PA 5TSDA 4D9BA 3U81A 3B1VA 2F1JA 3PCRB 4ZDJA 5JLJA 4Y0AA 1XU7A 4E33A 2AV6A 4RIGA 4Y2SA 1ES9A 4IBOA 4YH1A 3VR3A 5A0VA 3COSA 3L6DA 3CTPA 3Q40A 3SQOA 1V8DA 4J16A 4OFZA 3G59A 3NLLA 3RD5A 5I9SA 2RAUA 4C0AC 3I34X 1U1GA 2NACA 1T5IA 2FSVC 5T3YA 2FPGA 2BZ1A 2ILVA 3A9UA 4LV5B 3HVRA 3PD0A 3L01A 2PRZA 2Y92A 4ND7A 4B6QA 2A3NA 4V3CA 3QPAA 1RWKA 4NONA 2RCNA 1HK7A 3GFGA 3NH6A 4GM0A 3N7AA 4JYBA 2GD0A 4BFCA 4YMHA 3MYYA 3TLGA 2W6QA 1FXSA 1ODTC 4CCYB 1U7TA 2G4CA 4F7DA 1POXA 3EDMA 4IIFA 2QMQA 2HK9A 4MVJI 4QAJA 3X1YA 2HGSA 2OBFA 2WPDA 5C51B 2J9YB 1E1CB 2PAFA 3PIIA 4PYNA 1ZZEA 3GVCA 4EW6A 3THWA 5DHTA 1EX1A 4EHHA 3T9AA 2DQZA 4MVWA 3RS3A 2VATA 1P0FA 4M1MA 4PZDA 1NW7A 2R6ZA 3LBAA 3G0OA 5FPYA 3ZJTA 3IEKA 3GFFA 1VC2A 2BRUA 3KT8A 1EXMA 1DO2A 3AF6A 5A1TA 3NNNA 4XX1A 5JNVA 1LF5A 4PGHA 3T4XA 5HA5A 4C7XA 1L8AA 1VJGA 2FEWB 1IAVA 5IS2A 4WTOA 4Y0NA 4DMRA 1LTQA 4FIZA 1N7IA 3I9OA 1NUTA 4B9AA 3K30A 3ON5A 3R1IA 5JJBA 4DV7B 1NYQA 4U2GA 1V1RB 4KMSA 4X0EA 2FP3A 4LCJA 3GXBA 4CM7A 1YS6A 1E5XA 1CETA 3QFTA 5LXTF 3T34A 4ZPXA 3V7FA 2JD1A 3DMRA 2NVWA 3PICA 4AYTA 3SDSA 1DV2A 3BBLA 7MHTA 1G4AE 1TYEB 1AKVA 3I8OA 4F1JA 1HYBA 1DAPA 2YXDA 1PZMA 2YY6A 1QV7A 1KYZA 2BISA 1BHQ1 1QGZA 1AGXA 3AY0A 4MRSA 2ZAOA 5EZQA 1TPZA 1TM4E 1JIIA 4ZMBA 4XGNA 4JBHA 2YOFA 2FPSA 2CMKA 3BRWD 4RF5A 5FCDA 1BWSA 4O4JA 4XQ9A 3CLUD 4MKHA 4D4HA 2B4AA 4Y9TA 3A1SA 1C9KA 1PFVA 2QRJA 2N42A 3LHFA 3GYGA 2BBTA 2F62A 1AXRA 4FDUA 4I8DA 4QT0A 2VIIA 3CRW1 3JWHA 1XF1A 2AOXA 4RDCA 3W4IA 3MTGA 4DA9A 2YCBA 4RIEA 5J40A 4E3ZA 1ZUNA 3TLYA 1Q12A 5F33A 1WCXA 1CB0A 3HH8A 2PH1A 3DUFA 5J2TB 1A95A 1F1BA 1Q7BA 3L92A 1LDGA 1UFRA 4BO4A 3FDJA 2A9RA 2R7MA 3EUFA 4KR3A 4KRXA 1GU1A 4QFBA 3ZK9A 2UV8A 1BH6A 4JSTA 3BSWA 2ZB2A 2IEAA 3PHJA 2IVFA 2R6AA 5CU7A 3VI4B 2UXBB 2YHIA 3QX8A 4B82A 1CRZA 4EYGA 4XUCA 4QEDA 3EG9A 4IGAA 3RYFB 2CSUA 1GG5A 4MWDA 3GH3A 4DILA 3WQRA 4O63O 4KOEC 2QUJA 4H18A 4NP6A 3WXMA 4KXMA 5EE3A 3K1TA 4IIJB 5CDFE 4IGFA 3S55A 3FYDA 3CA8A 3TXXA 1KKLA 3PHHA 2CVFA 1LF0A 2B2CA 3KEMA 1FRQA 3RYCB 3N53A 4NBWA 3RU3A 3ZZTA 4CN8A 1HZJA 5AK5A 5ITVA 2PPVA 4CKCA 4NBTA 3HACA 3TAXA 2GO1A 2RCYA 3TLKA 3NTVA 3AF5A 3TSWA 2JFOA 4HRAA 1BE1A 4RKQA 5FNVA 1L1RA 4PN7A 3WRWA 2VDNB 1SKAA 3PB3A 1C1XA 2AMFA 1LWNA 3NANA 1M8PA 3BFKA 2IPMA 3A3YA 1B8OA 3PA6A 3TIFA 4BNVA 1RIFA 1T4GA 3BWXA 4BV3A 2NAPA 3CX8A 3T15A 4F85A 1BH2A 3IPXA 2QYTA 1XZNA 1U0JA 1MABA 3JQBC 1NY5A 1M2VA 1EVJA 3NGXA 4L0CA 4UUQA 3UN1A 3DOJA 3MCZA 3QA9A 2FDCA 4QUIA 1AK9A 3FCXA 1SELA 3L49A 4DMUB 3FMOB 1KO4A 4UPVA 3WB1A 1Z8NA 1ZIOA 1G38A 4C4RA 4ENVA 3CXUA 5IU6A 5ALMA 5EIAA 1XRNA 3DULA 2QN2A 3KXLA 4Y2RA 4CM1A 4M55A 1N2CB 1R0CA 3QKWA 4AP5A 5BNZA 1JHDA 4C30A 4ES6A 3T1YB 1DQZA 4KQWA 3WAKA 1DE0A 3RHZA 2F9FA 4YCDA 5FI1B 3FMPB 4MYCA 3ODPA 1OGIA 1E9BA 3ESCA 3ZBUA 3I53A 4ABTA 1EWRA 3PTLA 3A6PC 2BCJQ 1E2PA 3LUCA 2ZR9A 4DSOA 4MYSA 5CB4B 4DR5B 4EI9A 3D7MA 2W98A 2V7EA 3VYTB 1CV2A 3OZXA 1LK0A 2EIXA 3L93A 5CEEA 4G1EB 3H9GA 4MYUA 3W77A 3EWAA 3AQ4A 2IH5A 1A97A 1CRPA 1S2DA 3PVZA 1EHIA 2XNDA 3V55A 2QAGA 3P71T 1UPUA 4JROA 1E7WA 1Q3HA 2VPWA 3M3HA 1GSIA 4BFTA 5EP1A 3DE4X 1M0TA 2P2YA 4FGKA 3WIEA 5FFFA 4HH3C 2X0FA 2PM8A 2ZYSA 4AN4A 1J20A 2YVAA 3L1IA 4FHEA 4AZWA 4CMHA 4IH4A 2IHBA 1WA5A 4OH1A 2ZK7A 4C07A 3LPDA 9MHTA 3RODA 1WMFA 1S4MA 3D6UA 4XYGA 3O93A 2R2GA 4QHSA 6REQA 1JG4A 1UBGA 2AJTA 1HQYE 4G0ZA 3VYRB 4IMIB 1XMQB 1K89A 4JH0A 4ZGBA 5MFZA 3NYQA 4L7VA 5EP2A 4DRYA 1T29A 1YZTA 2HCJB 4MQ6A 4YMGA 3Q3JB 4PXSA 1JDBB 4EGCB 1PJCA 2Z6VA 1NVDA 3IXQA 5JAMA 3IC5A 4NX2A 1FYVA 3HDJA 1RDFA 2C9CA 3VTFA 3H84A 4M6WA 1Q84A 4ZK6A 5LJLA 3ZE7A 1GUAA 5A7GA 1Z9BA 5AM2A 3ROFA 4I5IA 2O8BA 1V45E 3T4PA 4P2BA 3WMFA 5AVRA 2YBDA 3DXYA 1Z26A 3GEMA 3IT2A 1MFZA 1VCMA 1QZUA 1CY8A 1N6PA 1EM8A 1N8SA 3EAFA 2HMSA 1N3YA 1QV9A 3AR2A 3MWJA 1JDNA 2DZDA 2DMRA 3HRIA 3RQIA 1HT0A 4DMMA 1R27A 2BMWA 2PSHA 3TLZA 3AHEA 3OU2A 4O2AA 3RSGA 3GT0A 1PT9A 4LGMA 3RASA 3VX3A 1BDJA 1WUKS 5KCZA 2R1VB 2OORA 3MOSA 1U2TA 3FFXA 4F4FA 2OV1A 1T5BA 5HKAA 4D9KA 2OV2A 1Z4OA 1XJWA 5DOZA 4GE3A 1QE5A 5T4FA 1RP7A 4BLPA 1Z3CA 3GFVA 3QYPA 2PKWA 3JXEA 5FR1A 2YWXA 1J21A 5DJ5A 3R7BA 5BSEA 5FYDA 3A9RA 1TW2A 1B76A 2BEWB 4FJ2A 4OXQA 3THOA 1B26A 1R4MA 4J16C 1UJ2A 4MVJP 1ZCJA 2VDVE 3PNVA 3R4CA 5A5FA 2GCOA 1PS9A 1N8TA 2XF2A 3GEPA 3TL3A 4YALA 3U9TA 3P2MA 4E13A 1EFUA 1C3VA 2FEPA 2YZMA 2ZRAA 3I8XA 4PLZA 5BT9A 3WGHA 2V98A 4RCVA 3VNVA 2BKVA 3GL9A 3DEKA 4V24A 2JEYA 5BNTA 4HS4A 2GAOA 2Q62A 4Q48A 4EY8A 5KTNA 3GPIA 3NIFB 4PR3A 5BN1A 2XMPA 3AINA 3K9NA 1W4AA 3HCFA 2D7DA 3HY4A 2JAOA 4JC0A 1A0OA 3ZW9A 4DIKA 1J4AA 1RRPA 3NWEA 1LDEA 4PFJA 2P6MA 1T4CB 4MYHA 3D6AA 3KT3A 3T5PA 2VEOA 2OGTA 1NFQA 3DSRA 1Q11A 1CJMA 2OD7A 2PR2A 3HKCA 3OWXA 4J0IA 2DFKB 1QJ4A 2X3YA 5HHTA 1FDTA 3ZLUA 1N3IA 2EL7A 2QVLA 4D79A 3F96A 1GY8A 5IKPA 4P35A 2H4ZA 4QDJA 3SC2B 5JSQA 1C7IA 1K7CA 5J4HA 1J1IA 1PL0A 3IV9A 1T0UA 2FDRA 4C2AA 2BRUC 1YF3A 5DP1A 1Z2AA 5LSAA 1VOTA 2IU3A 3K0AB 1N3BA 3ICPA 4FFMA 4MICA 2VJBA 2N9UA 3H42B 5J4KA 3B1KA 1SUSA 4FMCB 4C0LA 1ORIA 4Z3OA 8OHMA 4MIYA 1U90A 4X41A 2ZYRA 4BO2A 4D82A 3C4QA 1NRIA 1QG4A 5KJ6A 3GPDG 1EK2A 1ZWLA 4FDAA 3RYIA 3IYLW 4B6PA 1GCOA 2VPQA 3C3JA 1W88B 4QL3A 5LPNA 5I4IA 3UPUA 1P7VA 3OJEA 4FGZA 5IVDA 4F96A 1JAHA 1GP2A 2W2QA 2D74A 3VPDA 3BN3A 2VPTA 4F5DA 4DR3B 3AM3A 1G8SA 4M38A 1Y1SA 2AXPA 2A88A 4BGEA 2BEVB 4RJKA 4JKIA 1W2GA 4EPVA 2WTNA 1E4EB 3KS9A 5LMCA 3OZRA 3DHYA 3FHJA 4PR0A 5DI3B 3CISA 4QDUA 3T1HB 6PFKA 3BJZA 1Y33E 3GAMA 1KEVA 1U0GA 1YH3A 1JKJB 4F2HA 2ORYA 2AG5A 4NPAA 3MVEA 5IF3A 2H4HA 1Y0BA 1TVEA 4I8XA 1NUPA 3B6KA 4DB2A 2TSYB 1QFSA 2Q8PA 1GRVA 1VJRA 3RT9A 3QFHA 3QBTA 3K9CA 5JDIA 5FHRA 4BX0A 3WGGA 2JLRA 2HTEA 1M6WA 3EMVA 2WOOA 3GMTA 1YKGA 2YYZA 4MR7A 4II7A 4X7BA 2CXQA 1WXGA 5EJGA 4FHCA 4D0NA 1JH8A 2QQ5A 4X93A 5A3QA 1OYOA 2O8DB 2NADA 3VPAA 3ZVLA 2FWBA 3FPHA 3FWKA 3HZOA 4B6FA 3UPTA 3AFIA 1MA3A 4IDGA 1S0UA 4UEKA 4BQIA 4HQFA 4ZGGA 1NQVA 3NO4A 4BZQA 1NRXA 4Z1MA 4N0QA 3BFXA 5KU1A 1JHMA 1NVVR 4A15A 1Z0ZA 2QKYA 3BJIC 3WNDA 4BS9A 4LF7B 3EF1A 4Z3KA 3A70A 3DW1X 2X9VA 5JWOA 2QTFA 2J0EA 3EQ9A 4N01A 5FD8A 3Q5DA 4O1MA 4BMPB 2P9QA 1DQSA 2XOXA 3IPCA 5JYCA 5K45A 3GK3A 3HA5A 4QNNA 3E58A 3W1WA 3JV7A 4R2WA 5B6JA 1VMEA 2YH2A 3ETDA 3W3ZB 4B3FX 4ND8A 1XTRA 5EP3A 3PR3A 4PE5B 5B3JA 3DZKA 1KQNA 2OFXA 1HQDA 2QG6A 2WSMA 4RK6A 4CGZA 3WHIA 5H4HA 1H6CA 1VZ2A 1T0HB 1P1KA 3VNAA 4F97A 1IEQA 3CX7A 4Z8YA 4RS3A 3RC9A 4MWSA 4Q4LA 3NXKA 2GD2A 2PIDA 3IT1A 4FOPA 4P4LA 3WL7A 1PSDA 4X45A 5D6NA 2ZJOA 3B5JA 5LIPA 3TS1A 3L41A 3I37X 2H0AA 4U6NA 1ZGJA 3BSFA 4YBRA 1NONA 3L1UA 2F9LA 3RT7A 2GZ2A 3S1AA 4YV7A 3PQ3A 3ZBPA 4Q3BA 3VRHA 4BBZA 2A9FA 3BK7A 3DWGA 4ON9A 1V5GA 4KR0A 4D8XA 2JBAA 3KTAB 1FDUA 2PWPA 3G0DA 2DJIA 4HN9A 4M87A 1YFLA 2IH4A 3KWMA 4BDSA 2WM2A 1DTEA 1KO5A 1FRZA 4Y7CA 1G1MA 3F73A 1QK4A 4K9OA 5E4YA 1WXIA 4V0LA 2Y77A 4HUJA 4YMIA 5KYXA 2Z8YA 4HDKB 3WLNA 4ETNA 2WUDA 3ID6C 4M1WA 1U2QA 3OQBA 4OHPA 4EW2A 3W4JA 1CLUA 4BNZA 1YR6A 4W1PA 3R5XA 1KA9H 4NBLA 1D4OA 5IM5A 1CZNA 4E70A 4BUZA 3K20A 4JSYA 1E3IA 4YVFA 3JARB 3DEFA 2XUIA 1KI2A 4Z9YA 3DR3A 4MW1A 1T35A 3L8MA 5JAZA 3N5CA 2FZEA 2VAPA 3LT2A 3W6ZA 4XGKA 1RABA 1J5EB 1GPLA 1Q1QA 1QO9A 2Y1XA 3F90A 3NWJA 5E1DA 1ZH6A 2VCEA 5C46F 3U6KA 2CGEA 1JMYA 1J8VA 2B21A 1MJGM 1DO8A 3GY0A 5A5DA 1SUIA 1NVUQ 1MJHA 2KI5A 3ANSA 3AY6A 3KCQA 4HL6A 4JJ4A 5A3RA 5EJEA 2XA9A 4IZIA 2BFWA 3B82A 3H2YA 3IV6A 4V0SA 3I1YA 4G4SP 2WZQA 1BA2A 2JEOA 2P30A 2YJTD 2NO6A 3DP7A 3U3DA 4DZZA 2NU7A 3QYFA 5IAEA 1T36B 5AT1A 2ZXUA 2H08A 3UGQA 4F84A 5HJ5A 2D1QA 2A4KA 4JITA 3W7AA 1YI8A 3NEJA 2PPLA 3ZZ1A 4TLAA 5SYNA 3EK2A 1G7CA 1OAOA 4K2AA 4BAGA 1UXJA 4P4TA 2XAUA 5EKUA 3PNPA 2PMEA 3TZCA 3W2TA 3WADA 4KR6A 1Q22A 2QX7A 4EG4A 1KAGA 3U3KA 4YDSA 3G9UA 4RDIA 1KWKA 4MQEA 2GXSA 2ODBA 5AKGA 3MLAA 1EFCA 1H2YA 3PFWO 1AKWA 1TAHA 1EUCA 2D0IA 3KJXA 1KRWA 1RE1A 1Y9EA 1FLDA 2PU5A 2XXJA 1X0XA 1ZQ1A 3EEIA 3L7CA 4LC1A 3INGA 4IJUA 4JYPA 4QDXA 4W63A 4E08A 3F8TA 5C81A 2WBLC 3KC2A 3R0ZA 4CDGA 5F98A 4TMTA 4HVAA 1MHPA 3ELDA 1E2DA 2CVOA 3UHFA 1CJSA 2IBSA 2VJLA 2IELA 1ZCFA 4ZAVA 5HIMA 2XB9A 2RGXA 2VDPB 4C5AA 5K03A 2AUNA 4R6XA 5K8UA 1MAVA 4OOEA 5DCWA 5HK8A 4Q3KA 3LM8A 1P0QA 3AJAA 4I4TF 1EWKA 1ULBA 2DWQA 5M04A 3NBAA 2WU4A 2Y05A 2FLKA 3OIGA 1MDBA 5JSUA 3EXFB 2RGUA 3P19A 3GBVA 3IEMA 4UUNA 1M9NA 3TSYA 4NJMA 2QQGA 3H11B 1Z29A 4W4TA 4B47A 5EUMA 1SRQA 2DPXA 3IKLA 1KRHA 2ZIEA 2OORC 3IVCA 4LMRA 2ZTSA 1QYXA 2YJGA 1TEHA 1G55A 5CM9C 1EE9A 1GZ7A 5E9QA 4JLSA 1Q1AA 1PYDA 1UBHS 4GWGA 4P4GA 2PJZA 1M1NB 4M2LA 2ZREA 5D5QA 4N5MA 4I55B 4K9MA 3CRVA 4LJ9A 2BFDA 3O7WA 5TGDA 1GPH1 3G17A 1CF4A 4FR0A 5I8ZA 4ARVA 3OX3A 1MB4A 2B37A 4BQEA 2ZB7A 4TSFA 5D7BA 1TI7A 2IYOA 1I6WA 2CJFA 2O8VA 4EX7A 1D4FA 3N0WA 3VC3A 1TQHA 4WCVA 2Q46A 4HDOB 2W4QA 3AW9A 3W5IA 5IJZA 1LJLA 3VISA 4XX0B 3GGPA 3LC0A 3UXYA 5LU8A 4EENA 1QS0A 2C5HA 4Q4CA 4F5ZA 4DBLE 4BEBA 3SLGA 1E0KA 5GIPE 4CV3A 3VU8A 5AXAA 1TT5B 1P1IA 1JUDA 1LW6E 4OOFA 4U9IS 2WKSA 3IX7A 1BCSA 1N6IA 1BMFA 4JJGA 2WE8A 5J4LA 3UG7A 2BFOA 3IP6A 3ZWQA 1B0AA 2G71A 1UJNA 5CXSA 4EB0A 2HC9A 3JR7A 2II6A 2FMHA 3NKFA 1T3ZA 1X3SA 2P77A 4TVSA 2JCGA 3DMPA 2BHTA 4QDZA 3UNXA 1R5OA 2HIHA 4II3A 1CZUA 1MR3F 4K9KA 1N2JA 1KI6A 2J48A 2OZVA 4L2IB 4QULA 4JI3B 2X14A 5BMVB 4ILKA 2VAXA 4M8SA 4FEGA 4DLAA 5HM6A 1BDMA 3EUAA 2PEZA 1J8DA 1Z88A 2KQUA 4ARSA 1VLLA 4D98A 2QLFA 1OILA 3EXEA 5ABPA 4WERA 4IMRA 1ABFA 4MA0A 2C8LA 2XGOA 3ETEA 4NFHA 4TZKA 3DAYA 5CK5A 3L06A 1XCMA 3OH8A 5SY4A 3RYHA 5IH7A 1FU4A 2RAPA 3PQDA 4C5CA 2HDNB 1G20B 3L9XA 5E9JA 1U8XX 5EXDA 5FNZA 4A23A 3OLVA 1E79D 1M8KA 4BJHB 5A5GA 3AKZA 1HLFA 4KIUA 3AIIA 3K4PA 3Q2KA 1QSGA 1PO7A 1QB7A 4O33A 3F3KA 5A1JA 3UK0A 4XEHA 4LF5B 1YR2A 2ZRQA 3IELA 4Q9DA 4BJ5A 2EJTA 1WB9A 3WWYA 3FSGA 1GAEO 1RXEA 3WTBA 4GVPA 2BIFA 3T9EA 4AMBA 3QE9Y 1DT5A 1YNOA 3R8XA 2QUHA 3ABSB 2HJWA 3B1YA 4DTCA 5C5DA 4DWVA 3ORHA 2FQQA 1ACJA 4B33A 4NS1A 1IQUA 2ETVA 5JDIC 1OV4A 4I50A 1M2WA 4GUAA 4OQMA 1NHGA 2VZLA 1T2VA 5G0WA 2Q3BA 5G3ZA 1CR1A 4E5UA 5JR3A 2Z4SA 1DGQA 4ZI2A 1YOBA 1MX9A 2OM2A 2XZDA 1I5OA 4YJ2B 3VUFA 5C8YB 1W29A 3L6CA 1G3IA 3T61A 2GK3A 1IOLA 3QOWA 2H1SA 2I6QA 3C8DA 5FOSA 1LA2A 5BOVA 2UUBB 4RH0A 1UZUA 1GITA 3WSVA 4EX6A 2ZXEA 2H63A 3U4QA 2DFPA 3ET4A 3NTQA 4Q1DA 1RLUA 4YYZA 3A4IA 3OI7A 5IXYA 2NTJA 3E3OA 4ZAFA 1E1NA 4AY5A 5F73A 1BO6A 1JAYA 1QGDA 1C41A 3FZEA 2A7QA 3N59A 4UKDA 2IWRA 3N86A 4Z9FA 3RSQA 2I99A 2XA2A 3LOUA 4EW3A 4R2JA 4ITRC 1M2GA 2V3WA 1V6AA 3AU8A 5BSWA 4U2FA 1XD2B 3UC5A 3WYCA 2QT1A 3RAJA 3S2FA 5DXFA 4OHUA 5EQJB 1XQ1A 5CYGA 1PVVA 3UATA 4DM4A 3GW8A 2FWIA 3WGVA 4JP8A 4WKPA 5JSYA 1B74A 5KIAA 3C98A 1P7ZA 3O6VA 2XADA 3LXXA 2ISCA 3UJPA 3VPFA 4EKIA 2PA3A 4AJHA 1RQPA 3OSUA 4ND2A 1MJ5A 4LRYA 4P4UA 2QB5A 1MNAA 2V9ZA 1LLDA 4EVQA 5CDUA 4RF3A 3VKWA 2FWRA 3D8UA 1T1JA 3A3KA 1JXQA