1OFVA

Flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Refined structures of oxidized flavodoxin from Anacystis nidulans.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1992-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ofvA00
3N39C 1AHNA 4LTMA 4C76A 2QR2A 3LCMA 4Y9UA 4PTZA 3UXHA 2FDXA 3JSXA 3OVMA 5LBTA 3NHPA 1SG0A 2B3DA 3W78A 4GQIA 1RTTA 2OHJA 5LVAA 5FX2A 4LTNA 1FLAA 1I1OA 3D7NA 4QOFA 2AMJA 3FW1A 2X2OA 3NHKA 1VMEA 2FVXA 4Y7CA 3OJXA 3SVLA 2Z98A 3B6KA 1JA1A 3LT5A 4HS4A 5B3LA 4PU0A 1AKUA 3R6WA 2QMZA 2HPVA 3FVWA 1TLLA 4U7GA 4C14A 3P0RA 3UXEA 5EA2A 5NULA 4FX2A 1D4AA 1X77A 3W79A 4H2DA 3G5MA 3OWXA 3RPEA 2D5IA 2QX6A 5F51A 1J9EA 5EMNA 4FGKA 4J8PA 4YQEA 4ZVNA 4DILA 1FLVA 3QE2A 4NLLA 3FJOA 1OBVA 1FX1A 3OX3A 1CZOA 4QODA 1J9ZA 1DXOA 3GFRA 3KAPA 2FZ5A 3TZBA 1C7FA 3W77A 2GSWA 4LAFA 1B1CA 2BN4A 1FVXA 3TE7A 3L9XA 3GFQA 1AZLA 4R81A 4QOJA 3QFRA 2MWMA 1FLNA 1AKWA 4ZVKA 2FOXA 1YOBA 3U7RA 2QX4A 3OX2A 3F6RA 2F1OA 3N3AC 4C0WA 1V4BA 5FUQA 2BZSA 2V5UA 2R97A 4N65A 5A4KA 3HLYA 1CZNA 4DY4A 4Y9RA 2FZVA 4YAWA 1RCFA 1XT6A 4S24A 2A5LA 3TEMA 4H6PA 3NHRA 1KBOA 1YKGA 4QOHA 1TIKA 4LTDA 4U7HA 1CZRA 1H69A 3B6JA 1BU5A 1OBOA 4FGJA 1YCHA 5LJIA 4QOIA 1XYVA 3ESYA 1CZLA 1YCFA 1GG5A 3ESZA 3B6MA 6NULA 5LLDA 3W7AA 2FAXA 1AG9A 2XODA 2Z9CA 4XDHA 4ZVLA 2X2PA 3F6SA 1RLJA 3EDOA 4M0CA 4N82A 1DX9A 5BUCA 2FX2A 2BMVA 3O73A 3KEGA 5JROA 3F90A 4XDGA 1J9GA 1AKRA 2Z9BA 1AKTA 2Q9UA 3OX1A 1CZHA 4GR9A 2M6SA 1YRHA 1ZWLA 3OWHA 3ES9A 3FX2A 1D04A 1AKQA 2ARKA 3N3BC 1NNI1 3B6IA 4ICIA 2Z9DA 1FUEA 1C7EA 5LBUA 3S2YA 3U7IA 1XI2A 2OHHA 2WC1A 4OXXA 5NLLA 2XOEA 1AKVA 1OFVA 3NHLA 4F8YA 2R96A 3EYWA 4GI5A 4HEQA 1T0IA 1WSWA 2MT9A 4QOGA 5LJLA 3NFRA 3O2NA 1SQSA 2QX9A 3ESXA 4BMOB 4YAFA 4CETA 3NHFA 1JA0A 2MTBA 5EAIA 1QR2A 4ZVMA 2FCRA 2MOKA 4QOEA 2OYSA 1QHEA 3OJWA 2V5VA 4ESEA 3NHJA 2QX8A 3NHUA 4YAUA 1CZUA 3KLBA 1KBQA 1RLIA 1QBGA 3NHSA 4PTYA 1F4PA 5FA6A 1WSBA 3F2VA 1ZX1A 3K1YA 2BPOA 2N1MA 1QRDA 5F12A 1DXQA 1CZKA 2QWXA 3FNIA 2HNBA 4U7FA 2OHIA 1YDGA 3NHYA 1FLDA 2V9CA 3KAQA 2BF4A 1YCGA 1FTGA 4CF6A 2Q62A 1ZWKA 2KQUA 4N9QA 2QMYA 4D02A 2HNAA 1AMOA 3NLLA 3GFSA 1BVYF 2RG1A 3HR4A 5ULLA 1T5BA 1E5DA 2KLBA 3QFCA 4YAOA 4C0XA 1D03A 1H66A 2W5UA 4NULA 2FLVA 3NHWA 1XYYA 5LMCA 2ZKIA 2M6RA 5TGZA 5B3KA 4FGLA 3K20A 3L9WA 4BMPB 4DIKA 1J8QA 5F4BA 3GAMA 4YALA 3ZHOA 4LA4A 3HA2A
chains in the Genus database with same CATH superfamily
1P7VA 4HD8A 3F4BA 2B94A 3AR9A 1BVUA 1DG1G 4HGNA 4LZOA 1UJ6A 2DFLA 1BKSB 3JATB 2PX4A 4WJZA 3WLQA 1IN7A 3NTLA 4KWIA 4MW4A 3C3PA 3A14A 1XDUA 3LCMA 1XNJA 4FEEA 3E2PA 1XDWA 3II6X 3IVRA 4Q3LA 1ZVQA 4W5JA 4DUGD 1Y48E 1A9YA 1LC3A 3BWMA 4EW1A 2AFRA 2I9PA 3AI3A 3PRHA 1FQWA 3PR2B 1R9JA 3DWIA 1L4NA 3ZBUA 1GCIA 4FZ3A 2OZVA 4RFVA 4KXNA 3UWMA 3WI7A 1E9AA 1KFJB 2XCLA 3RRNA 5FJIA 3LWZA 3KWMA 1KS2A 3L41A 2DFTA 3S7TA 2ALJA 4TMZA 4I1PA 4JEIA 3DWEX 5FX2A 1R0WA 4YRBA 1N6KA 5CBPB 3UG7A 4G56A 1ONOA 3KCQA 2H85A 3FRHA 2JAOA 4QRDA 3W05A 2A1IA 2X2OA 3KQNA 5EPUA 1F8GA 3WGQA 3IQEA 4UARA 4N9WA 1JI0A 4AI6A 1DV2A 1Z5WA 2JANA 5IDWA 2PXHA 3F3YA 5K0ZA 3A6KA 1SUBA 2G36A 2A14A 4LOHA 1MF7A 1FXUA 3DBVO 2W8ZA 3LT5A 1XZFA 1ZGGA 2ZXEA 4K9OA 5ALDA 1TM5E 2P6UA 1E0SA 1O54A 1W46A 4JIGA 4Q12A 2WWTA 1L7QA 4NS4A 4V0RA 1VA4A 5E9WA 1N9ZA 1XZGA 4TS1A 5FUVA 2O3TA 3UAWA 1NNEA 2JBWA 1WKBA 2W8BB 2Z43A 3OF5A 1E8MA 2W6JD 1KNQA 1D3AA 4G5YA 4PY2A 5HG0A 3SF8A 2G1JA 3DTNA 1SJ9A 2RJNA 5FIUA 3DPSA 1UBMS 3NP9A 4RPJA 5BVHA 3TNJA 4R2MA 1S5PA 2YHAA 5E3IA 3GCDA 3RT1A 3C6MA 3EA0A 1H3EA 1JHUA 3ROMA 2RCNA 1VE3A 3KQPA 1GLVA 2O2SA 1KMCA 2NU9A 1G3MA 2CXQA 2OBLA 1YDWA 2QI9F 3G5MA 3CKKA 4PLCA 5AKZA 3RPEA 4QBIA 1N0IA 3T9FA 1UK8A 3ZHXA 4B46A 2D5IA 2GTHA 4H3VA 1GU7A 4G8CA 2P9YA 5F51A 2BHSA 1FTYA 1D6MA 4HWGA 3JRWA 4FSXA 5IAKA 2UXCB 2HI0A 1FFCA 1KWKA 4WESB 1NW9B 3N2NA 1KE1A 3WFZA 4R4JA 4NX2A 6LDHA 5L8VA 1E1QA 2D1YA 3TQQA 1E7RA 1W9MA 2HJRA 4UTZA 3CNBA 4ZHQF 2Q5CA 4MGHA 3KETA 2ZITA 4E5MA 2JZNA 3NIBA 4Y1FA 1P60A 1EEXB 3GNSA 2R1VB 3W6PA 1NVVR 2JIDA 2V59A 2P3LA 5B53A 5JISA 3SBEA 4OJMX 5IJZA 1YKFA 5IS2A 1OI4A 1TF7A 1XZEA 3SLRA 3V55A 5LIPA 3IEIA 3T5GA 3VOBA 1GOTA 2HDWA 1ECBA 1W6UA 2GEKA 1QB8A 3PFCA 2C9YA 4R05A 1EAMA 1SVKA 2RK4A 4IJQA 5HZMA 5BW5A 2V4MA 1NQVA 4MRAA 3AVTA 3QNUA 5JDCC 3AEYA 3WL4A 3K8QA 5AH0A 4EHJA 5C1BA 1SXHA 1UODA 3QELA 3W77A 3EH2A 2VBGA 2ISCA 3DVAA 3JW8A 4TSFD 1HYHA 2GLTA 3WMGA 2FUNB 5CFRA 5AUQA 2HDOA 2BN4A 2G5GX 1FVXA 4F4FA 1DDGA 4QTXA 3KJNA 3RNLA 3SZRA 3I3SR 3QTLA 4ED9A 4IOJA 3WWPA 3AR2A 1GKYA 1YZNA 2EX4A 3EXAA 1Z2OX 3FR8A 4M0FA 1AQJA 3TMAA 3KKLA 4JV5B 1Z17A 1E9CA 3GARA 4PANA 3OFNA 3U0BA 5B7GA 1CUJA 4YP5A 5FULA 2QMHA 1DMSA 3G8CA 1X3LA 3WLKX 3HA3A 1Z0DA 3EBLA 4MLPA 1US8B 2OB2A 3K9NA 2QV7A 4FGUA 3S0JA 4F93B 1CVRA 3U62A 3HYLA 1A5SB 3DCNA 3R3UA 4PIPA 4UREA 5EJMA 3T5DA 5J2TB 4CL3A 2VAPA 4O4IA 2YHIA 2HADA 5A02A 2PX2A 3MTQA 2WPNA 4PZDA 4H6VA 1VGQA 1JLLB 1VFNA 1XTRA 1ODKA 3VU9B 2GFQA 1T3GA 4ZYWA 4LMBA 1U7PA 4GOMD 5JZOA 1QNLA 2HHCA 2KYRA 1OKKA 2PSHA 5SY9A 4JA2A 3TIXB 1QLJA 3F78A 3TDNA 3L4SO 1T26A 3DD1A 4MLCA 1EVLA 1Z4QA 4D46A 1DTWB 1NWCA 4GO1A 3EEFA 2XUKA 4WY5A 4JL5A 2HMSA 2B25A 5DGHA 4BNIA 5AJZA 4W9RA 2YC2C 3AZQA 5JD4A 1TO6A 3I5XA 1UZUA 4Q3BA 3JQQA 2AFIA 1IXYA 2WD9A 1Q95A 3KJEA 3SD7A 5TXGA 4CF4A 4QYIB 3UH0A 4PFSA 1CQXA 1XCLA 4MV9A 5H68A 4PSDA 1F9AA 3G23A 1DBSA 1U04A 4ENVA 5EIXA 3QX8A 4DBZA 1G8SA 1NY5A 1PW5A 1U0OC 2B21A 5DNDA 4U2GA 4D9HA 2O05A 3ITKA 3BJEA 2NV2B 3ZZTA 1XAJA 1XVIA 1YKGA 3FPGA 1K6XA 1PJZA 1XNRB 1JLMA 1P7YA 3TGPA 5JNVA 1GRVA 4YRIA 1H69A 1F0PA 1EA5A 1F2DA 1XJQA 4H7PA 1Y3IA 5IBPA 5JCPA 5EI5A 5H3LA 5KNBD 1DKNA 3LECA 2FPIB 4OMFG 1OF1A 5LC1A 2P2ZA 3BYZA 4IXNA 4RTSA 4TRRA 4KH1A 4N5IX 1XDZA 5K6AC 3AVXA 4E32A 1ESMA 1I2MA 1I6KA 3LZCA 3E84A 1SAYA 3WGZA 1B6SA 3A1CA 3E3LA 4B76A 4NBVA 5FL7D 3HC7A 1DI0A 4V3BA 3VZCA 1G5TA 5FHRA 4R69A 3K3PA 3AHCA 1NF3A 2H63A 3KB2A 5B37A 4DB4A 3GQBA 5FAXA 1JSLA 2IEDA 2H8GA 4KW7A 1DLIA 4OFZA 4X45A 2PGDA 3RSOA 2PRIA 3A9TA 1C30A 2JAWA 3HDVA 3MG9A 4O4JF 1AXEA 1VYTA 2I1WA 3ILVA 4HLCA 3RIEA 4KXQA 2OQ2A 5K8JB 5L40A 2Z1MA 4UAJA 1N57A 5KTPA 1QP7A 2QTHA 3EC2A 4AC9A 4V0ME 5H59A 3ZZ1A 5GZ1A 4H3SA 4URZR 2W6ZA 3SJ7A 3LFUA 3OZGA 2VUSA 2Q5HA 5AXAA 1Q19A 3EQ9A 4BJ6A 2BEUA 4RIFA 3ZJ4A 2ISQA 1K6IA 3S5UA 4Y2YA 2AHOA 1JAIA 1E0DA 1EUCB 1T5HX 3NCHA 4JT8A 3VR6D 4M53A 2H4XA 5DX1A 3ZKWA 4TN5A 5IZCA 2FP3A 2FP4B 5DI3A 1QSGA 5K4GA 5KI6A 2IEAA 4BNNA 4Y2VA 4CM1A 5JS1A 4F1WA 3D3QA 5D51S 5BN4B 2ONCA 4KYTA 4L5BA 1OOEA 5M34A 2NZYA 1ZN8A 3OTIA 4LXUA 4PRZA 3ONFA 4G07A 4H7FA 2JIBA 4DVJA 5KKCA 2G88A 5K3AA 2O07A 1I7QB 1M1YE 4Q4HB 4CKWB 4NNOA 3LBAA 2BKLA 1T3ZA 4C0HA 1C0IA 2OLEA 5D5QA 4F2HA 1F7VA 1H2EA 1OZ0A 3ZS9A 3AEQA 6Q21A 3EVEA 3T7SA 4AS1A 4MRRA 2DFVA 1Z47A 2BWJA 1U3GA 1YHZA 2I8AA 1NBME 4F2PA 5B3JC 1S2OA 4R8KA 4ND8B 1JEJA 5ERYA 5IASA 2ZAOA 1H2XA 1X1EA 3ES9A 3F9IA 3TNLA 5FLXA 4YQZA 3OJEA 4J94A 3C1TA 2K2WA 5AKJA 4BFSA 1FPMA 1GRNA 2I5PO 4EVSA 3DHEA 3ZXSA 4MI3A 4TL9A 1OAOC 3ONNA 4XYEA 4EZIA 5HIKA 2ZWPA 1ABBA 3TOSA 2DM6A 3IJEB 2BFEB 3RU2A 5KC9A 5K3BA 4FE3A 4JBXA 5KHLB 1BXKA 2Q29A 3RYHB 5J4HA 1TTPB 2LR0A 2BFWA 3HMQA 3DTVA 4PVDA 1LWOA 4OAOA 5GM2A 1MORA 4HGRA 3SOPA 3QP9A 4UM9D 3E58A 1P77A 5ICGA 5LD2C 1Y0BA 2OXIA 1E2HA 1CRQA 2YY5A 4Q82A 3HKCB 5CFNA 1QDUA 5BQFA 3P0FA 4M88A 4QYWA 5IDYA 3IEMA 1SG9A 3W5AA 2XWBF 4XYBA 4YLGA 1JE0A 1XRNA 2H2HA 2JFPA 1YS7A 3BS4A 2F9LA 1DIOB 3GDHA 2G40A 3I39X 2NAPA 3WLJA 4ARIA 3EMKA 5AM5A 1UBOS 3MLAA 4KV7A 2XW6A 4D3FA 2VYVD 4G9BA 1JSRA 4BGDA 1MABB 3A3KA 1TEXA 1L7RA 2GEVA 1L7PA 4DEYA 1N32B 1XWFA 4TUYA 1NW7A 4CT5A 1ZVVA 2IF0A 3EZ2A 4NBNA 2JH3A 5TIIA 3GRFA 1OWNA 1P3DA 4K9KA 1FX0B 4FUTA 4AYWA 1NN0A 4K5QA 2CJXA 2D1SA 2KM1A 1D1TA 5JCZA 1QZ3A 2HIMA 3H75A 3UOGA 5A1JA 3H17A 4HFMA 1J0AA 4M8SA 4XJTA 3SXUA 3AGQA 1SVOA 3SYKA 3HCOA 5DWVA 1N6RA 1C7RA 1K6EA 3EOZA 1KDRA 1JDVA 1EYZA 2XEXA 3KVNA 4HEQA 4B2PA 3WIOA 4LZZA 1Q16A 4MQLA 5ALUA 4WOJA 2QRVB 4F38A 1U2PA 4JP1A 5A4IS 5C8YF 4TMWA 2DERA 2GXUA 2PWPA 1YE3A 1V8ZA 3Q9NA 2O8CA 1NAHA 3SJAA 3CLVA 4ENTA 1GUZA 2EWWA 4JT9A 4M7PA 1ADBA 3QBEA 3LLUA 3QVOA 1BG6A 5SYNA 5ES3A 1XD2A 4DCMA 4URXR 1ZH6A 2ZI3A 4MVWA 2I4TA 4UHEA 2JGDB 5E9QA 4D3DA 5H9WA 2C84A 3EWNA 2QX7A 3I30X 521PA 3EXIB 2R7KA 2O8NA 1I9GA 1USWA 2BTOA 4KE6A 2E5LB 2JLQA 4RVCA 1KYYA 1B2RA 4K6FA 3C48A 4XM1A 1V5IA 1I1QB 4YAFA 4CETA 2DQZA 4QQRA 6ABPA 5I7HA 5A5DA 1I80A 2FZEA 1CY8A 4CM6A 3QVMA 3MCAA 2ZYSA 3X1YA 4Q00A 1XMQB 4IVPA 3D8SA 4Q19A 4E5DA 2J9YB 4XVUA 1TJ4A 3JZIA 2VFAA 3U13A 3IRUA 1UZMA 3RGWS 1K8YB 2QDKA 3OQVA 4FT2A 5G3ZA 3DBHA 5KOIA 3A10A 3GVIA 3HXLA 3ILYA 4GNRA 2DHEA 3KAKA 4P3PA 4X62B 3U19A 3B1FA 5KCMA 4M1TA 2OPHA 3LT4A 1C80A 2WWFA 4TLAA 4UAUA 2XMZA 5BV1A 5F5LA 3DAPA 3S68A 1EFCA 2OV3A 4EAQA 3V5NA 2RBKA 2GZRA 4B6QA 3WZLA 1YQGA 1UOQA 2F59A 4GKAA 2DCMA 2VDOB 3GLFB 1KY3A 2YHBA 2REQA 1XQ1A 2FYTA 5IM5A 3I6MA 2B78A 4PG8A 1YQWA 2ID7A 3IRVA 4ATNA 3HXMA 1K97A 1F5SA 2J4FA 4UU8A 2ZRLA 3ZGLA 4Q16A 1GQ2A 5DIZA 2N1MA 1AGPA 2HU2A 3A9WA 3QYPA 821PA 4CDRA 1JMVA 2OXRA 1QGYA 1QOQB 2XOKA 3VJKA 4CM9D 1TKBA 3FFXA 1GCOA 3L7BA 3PKIA 3QF7A 3QVLA 3U9LA 1Z2CA 2C4KA 2FE1A 2ZB4A 1DO0A 4HDRB 5E2AA 4PXAA 3U7FB 2V0GA 3QUBA 1WBDA 1F14A 2ERXA 2Q3JA 2P9GA 3OD5A 3SFVA 2H3EA 3QVTA 3K30A 3NTOA 4MYHA 4BO7A 3JQGA 2AQKA 1VCNA 1ZIYA 3MWYW 3P2YA 5EXPA 2YBDA 3ODPA 4PR3A 1Y8AA 4WN9A 4FIDA 4IWXA 1I51A 1KWGA 4IH9A 1JLSA 4D5EA 1PNVA 1M76A 5AW3A 4BNGA 4I1UA 4QUDA 4F5YA 2B4QA 1C4WA 1BVYF 2PSDA 2EFEB 2PX6A 2IEIA 3GFSA 4LWQA 4PFJA 3UXYA 2DQYA 3VVBA 4L28A 1PL7A 1NBEA 3L7AA 4M9XA 3RVPA 3VNSA 1LTHR 2NUTB 3NH9A 1I5RA 1QXSA 4J03A 1Q1QA 1DJPA 1TJYA 1W6RA 1YIOA 3GFFA 1W0CA 3IDZA 4UZEA 3U3MA 4M22A 1DL5A 3QVXA 1LLQA 4X6UA 1NNUA 1H66A 2AR7A 3CH7A 1R3UA 5I4CA 3AHFA 3V1LA 1FTWA 1KJYA 3CW2A 2QVCA 3DDUA 5M5BA 4QREA 2XBMA 3PFNA 1IEXA 2H7XA 2HJWA 3CX4A 1Z63A 1UBFA 4W63A 1GNLA 3BN3A 4J4TA 3AG5A 1PG0A 3IE1A 1FS4A 4HMQA 5DGIA 4BLQA 4TXLA 4YRAA 1WSDA 2DUUA 3ORHA 3OA0A 1ORVA 2GSDA 1GEEA 1YUNA 3P2JA 1TVEA 2I54A 3HGMA 4HLUC 3HZRA 4U9IS 1GTG1 1B2LA 5EEGA 4ER3A 1BFDA 3SJBA 5FBKA 2ASVA 3ECCA 4AULA 2FTKE 1VSUA 3B6ZA 3P0HA 5CFMA 2IS4A 4EENA 2XV1A 2JFQA 5K8UA 3ICWA 1B3BA 3TLCA 3J7AC 1T8TA 3BXEA 1MA3A 1DV1A 2F3TA 3Q7EA 3D8RA 3W1WA 4OAQA 2V6GA 2BGKA 4XWOA 2DUWA 4I1SA 3NKFA 1DAIA 2DPLA 2PUVA 4RTJA 5JSUA 5FPHA 1JA9A 3UICA 4UVHA 3GJTA 1N33B 3UC5A 3A0RB 1MAVA 4G9EA 5EHNA 3HKEB 1AGYA 1SCUA 3BL6A 4QT0A 2FRVA 3JSXA 3AY6A 2XCOA 3IYLW 5LBTA 4RJJA 5AUNB 3NWOA 2WI8A 3JYNA 1CC1S 3SZUA 3DVQX 3WL3A 3VC1A 2QQGA 2K5UA 1V25A 1KZHA 1HNXB 3RK0A 5J5VA 1E6LA 1WY5A 2YMQA 5K51A 2AG0A 1YZFA 1NUTA 2VNJA 4PWZA 3U0VA 5K45A 3GRUA 3PPXA 1Z16A 3TM5A 2KE5A 1AXGA 1I1OA 2R3SA 2Z2JA 4CFZA 1MJGA 1TLTA 5A4AA 4YDQA 1EIZA 4IYJA 5EJAA 1BCRB 1IIBA 1WG8A 2XBUA 3O31A 3A31A 1DFHA 3B2NA 5KYGA 3KOZA 4ZDJA 5BUSA 4OK6A 4ZC1A 1QK5A 4M46A 3EW7A 1UZLA 3IBCA 5EJGA 5TSDA 2LKCA 1Z0AA 3FYTA 1JA1A 5IT9A 5L3QB 3GNTA 1LBHA 3G8AA 3NS7A 1SXPA 1NG1A 4Z2YA 4DA8A 5GPBA 1C8VB 1JQLB 2JIOA 2A8YA 1XJ0A 4IIJF 4DLKA 3VR5H 3EQ7A 5CDYA 2PUJA 3AUJB 3ZV6A 3CNQS 4MZDA 2IDJA 2UKDA 2VJYA 4LDRA 4AJKA 4BN5A 5LU8A 1LPAB 4OPMA 2WE7A 4OXRA 1M6HA 4YV2A 5FBRB 1X6VA 3ZY5A 3VPGA 4Q47A 4DLBA 5HNKA 1NZFA 5H7XA 2HJSA 1T5OA 3E1SA 5K6AA 1N8KA 1NSTA 1X77A 1P4HA 4HQLA 2N47A 5AW2A 4RZIA 2HU5A 1C9YA 4J0KA 2AHRA 2COEA 2FFQA 3G68A 3WJ2A 2H92A 2FJPA 2YQZA 1R5BA 2PLWA 3D6MA 4NAVA 3DMHA 2DTXA 1KZ9A 1E6MA 4MLDA 4TS9A 4PQFA 2JFFA 1UM9A 3LXXA 4OUDA 3KTFA 4PYIA 3KTDA 1N5RA 1XD8A 4BMSA 3W8DA 4P31A 4BIIA 3O9ZA 4FI3C 3CMMA 2BMEA 4C4PA 2EW1A 3WS7A 3HRKA 4R9UC 4D4HA 2E1RA 4L3VA 4DAEA 1H8EA 1P7PA 2PWBA 1H2RS 1UP7A 2AT1A 3PDJA 3S2UA 3LC0A 3UAXA 4CEJB 3AIKA 2OAQ1 3FJOA 3WK4A 4BATA 4D56A 1TQDA 1YR2A 4YUWA 1NFRA 3GR6A 1NYLA 2O1WA 2Q0SA 4I1VA 3NKLA 1RPNA 4FINA 4JHXA 4PBRA 4Y6PA 2P3OA 4ZDWA 5K3CA 1T0BA 3U3KA 1Q2UA 2FHPA 4XR4A 3V9PA 4BJHB 3KOOA 5A1TA 1WVMA 2O2GA 3GLGA 2O2YA 3AWIA 4N48A 3B82A 1CR2A 1JQ5A 4CIVA 1V45E 4HDKB 4CRWB 4OATA 4PX5A 1AUVA 1DVRA 3P9KA 5A3VA 4I4LA 5EJIA 4OQYA 2XHEA 2IS1A 1YJBA 1X7YA 1VOTA 1LDNA 1NXSA 2C8LA 5C8VA 1SXJB 3AI2A 3MWDB 1Q77A 3O8BA 4UEJA 3H13A 3EQ6A 1NP7A 3VHXB 3WDLA 5CMLA 1MB2A 1PI3A 3F5DA 1NXTA 1QF7A 4JNKA 4CTJA 1ANKA 2ACVA 3ND6A 1ZJJA 3UJNA 2XLBA 5AM1A 1WNFA 2JASA 4AUKA 5HBGA 1EFHA 1MDBA 3ED5A 2YJTD 3TMKA 1FL9A 2C31A 2FG6C 1I8TA 3O91A 1IN1A 3VYUB 3GRZA 3LA8A 4NCNA 3EPHA 2VHWA 3U7RA 5A5GA 2F4NA 3DUFB 3QI7A 3F6EX 1KMNA 1I36A 3GUHA 5LQJA 1SBZA 5FEMA 1RP7A 1DX6A 2BR4A 3BD6A 3BWBA 3PVCA 4MHOA 3RD5A 4DC1A 2W2KB 2A6PA 4O1MA 1DIRA 2WIAA 3KYIB 5C1DA 2RK6A 2VNKA 2O57A 2Y0DA 3DFIA 3OZCA 2P2DA 1Z62A 4KDFA 3ETCA 3GGGA 3OZWA 3B70A 5FWYA 2IWHA 3V1KA 3WRVA 3F6RA 1JHPA 5ELLA 3CG0A 3BGSA 3HY4A 4IBOA 3LY8A 4C6TA 1Y7LA 1FC0A 4DV5B 1G3IA 2G82A 3EDRA 3PE4A 5DM0A 4E5UA 3C16C 4EUEA 1ODIA 5BSFA 3IUPA 4NENB 4NBUA 5IUKC 3TLGA 2XGJA 4KH0A 2VTBA 4J43A 3EH1A 4XARA 4PZUA 4HH3C 3WMRA 1NXQA 3OF2A 4KREA 1C7QA 4K1XA 3FGOA 1YT5A 5IPFA 3K7EA 4GP7A 3ZEIA 3RYIA 1QTNA 4QEZA 4KWTA 4UCQA 4FFBA 3GPIA 5BW6B 2AN4A 3FNBA 4KQXA 2PWYA 3CEMA 5CGQB 4YAEA 3JARB 4NMWA 1DAPA 1FRQA 3FZQA 2QLMA 4U2DA 1FDIA 3TSYA 1DQZA 4FFLA 1GSAA 4Y6QA 1JDUA 10MHA 3K2BA 4HGQA 4AQDA 4E2YA 3RC8A 2PXCA 3AW8A 3FHJA 3CF4A 4TVKA 1FY2A 3HBFA 1SVSA 2GUWA 2HN9A 1M6YA 2MDTA 1QHHB 1IH8A 1TADA 3R09A 2C92A 2ZIGA 3R4CA 5IAJA 1B8PA 4BQOA 4CM7A 5CB4B 1U63A 4YRKA 4KNVA 3C39A 1LF0A 1W76A 1AD2A 1EK0A 2JA2A 2PGIA 3FLEA 3IAXA 1Y7HA 2ZYIA 3AF1A 1GGJA 4X3CA 3U3XA 2PJRA 2DT5A 3GFGA 2Q7XA 3NEPX 3N6RA 3SR0A 3PGJA 4EUKA 1U1IA 5EJEA 4UPVA 1YO6A 1Q5PA 1OX5A 4M9SA 1W1WA 1BQ4A 4MW7A 1TMOA 3ZV4A 2PS3A 3H9BA 4D4IA 2WSSA 4W7IA 4C6SA 4RJIA 4IILA 1DIBA 2AQIA 2OV1A 4QQNA 4JDPA 1GGHA 4ZEXA 2DKNA 3W3AH 4I3GA 1FNNA 4E5NA 1GPLA 3BE6A 4M7WA 5CNMA 4OF4A 3IQZA 4JP5A 1MO6A 1MPXA 1PTJC 1X19A 1QQBA 1V26A 5HGXA 1NF2A 3IDFA 5C0OE 3VVMA 3A6PC 4MCJA 4RZ2A 1S3SA 4PCAA 3IKLA 5CX1A 4CMGA 1M6VB 5B1IA 3ZWPA 3HVRA 2EBHX 4X20B 4XVHA 1EWQA 3ROEA 3LUPA 5BN5B 3W6ZA 2GCIA 3GFOA 1WPXA 1P4SA 4RFLA 4RA9A 4ZO4A 8AT1A 4ZYYA 4G4JA 3OKCA 1LDEA 4AECA 3TF5A 2ZSJA 1FJGB 1P9OA 4TKZA 5JO9A 4YP6A 3WHKA 5JWOA 5EWLB 1NE2A 3NHMA 3NC0C 2I1QA 2OXEA 2PKWA 3A70A 3FRIA 3MT8A 4KIUA 2F43A 2R1UA 2CXOA 3Q8WA 4TMYA 1ETHA 1JX6A 1E7YA 2BMVA 1H1DA 4MRMB 2CSXA 3LHKA 4DR6B 4TYWA 3H19A 3RR2A 2BMAA 3D1JA 3CR8A 5EWJA 5F21A 3UA3A 2OZEA 1NMYA 4FHCA 3ZCUA 2OZKA 3O93A 2VXOA 1JU4A 4NXMB 3MWEA 3QMVA 1TYBE 1WR8A 2XXBA 4JQSA 3U6BA 1Z7WA 2YINC 1Q0RA 1EMDA 2C59A 3OT1A 1NLZA 2Q4TA 3D02A 5GOZA 1XRQA 3O1LA 4PCLA 5I7AA 1GPMA 2QTGA 1NMXA 5E1MA 4IUDS 1H4SA 5A2QA 3PNOA 1Y89A 3GGJA 2HQRA 5I7RA 4AVYA 2IVFA 1GQSA 2PGOA 2WAXA 2XLCA 5BUQA 2FFBA 4BLRA 1VZ3A 2IDKA 4XH9B 4F7DA 4D57A 1NA5A 3EGXA 1LLFA 1PJ3A 1I0LA 2E87A 2FZGA 2HXSA 1YF3A 4CEIA 2QTFA 1KI9A 3QOXA 3EPJA 3KQHA 2QT9A 2JDID 3THXA 1QPZA 1V43A 1TC2A 5IP5A 5I4BA 1CU1A 3W5DA 5AIBA 3S1AA 2YRWA 5E7IA 4RPLA 4J16A 3U48A 4BPBA 4BE9A 1DPFA 1TM2A 4JKOA 4XVRA 4C78A 5K4AA 2ODTX 3HXKA 3HPQA 8LDHA 2ZBGA 1JIJA 2W6CX 4MDYA 3CKMA 4MW9A 2H9YA 5AJUA 1FYDA 2GJKA 3H5AA 3UFXA 2PKXA 3OZ7A 1X8JA 4HNAA 4BNFA 5IABA 4O02B 3TNYA 5I9NA 5JWRA 1CY1A 3NWPA 3F3SA 4UNNA 3G8DA 3DW1X 2W6OA 3V34A 1IMJA 1J24A 1BWQA 2HWWA 4J2OA 4R0NA 1CB7A 1X80A 4H0FA 1NJSA 2A92A 3IX7A 3BSSA 3I61A 3UGTA 4DIEA 4ZAXA 2C8JA 2P0EA 3RASA 1P2VA 1Z25A 2D4AA 2CLMB 4G1CA 5ECDA 4JJAA 3D54D 3ZE7A 1E3EA 1WXHA 2FMIA 5BNFA 4WCDA 4BMZA 5NLLA 3WGVA 1W0KD 3IBSA 3L04A 3LXUX 3ZJ5A 1Q0HA 5JSZB 5I5GA 4B09A 2ZRKA 3ZV7A 3JX9A 3CNHA 3DNFA 1C2YA 3TD9A 2AFIE 4TWRA 4EFDA 3U26A 2AW5A 3SIXA 1KIAA 1DS6A 5H16A 1BXRB 3UXMA 1DKRA 1N1GA 2P8JA 3T3OA 1L4FA 1TVKA 4LXXA 2ZT8A 3ZHZA 4K40A 3ZU4A 1BMDA 3ZWXA 1RJ9A 4ZVPA 4RHEA 3TI7A 4ABYA 4YT8A 5DGTA 4PGFA 3UMVA 2ZQZA 5FDFA 4CLOA 3W5VA 1I24A 3KBBA 5CLGA 3VTZA 3WO0A 4LCBA 1VTKA 2XDYA 2IPOA 5CEEA 4QXOA 2IBMA 1ZCFA 2JFNA 2OTCA 5EE3A 3MILA 3UCFA 1RC8A 3HRIA 4DZRA 3KB6A 1EFUA 3RIMA 4DCTA 3AQIA 3PQFA 1E3MA 2QNRA 4AT1A 1EP9A 2B37A 4LYAA 1X1AA 4DCCA 5CDFE 1KPGA 3AHGA 2C20A 4E5VA 1M2HA 3L8CA 3UB3A 3GBPA 1NTRA 2FZKA 4JLUA 4D0GA 3ASVA 1B15A 1A8HA 3SJCA 4CMCA 2MR5A 2YWEA 3F47A 1M0WA 2C42A 3GYGA 4IO0A 2AQHA 4AMYA 3FOCA 2OD2A 3RYCA 3NHUA 3EVGA 4MVJM 1KBQA 4F8JA 1SA0B 3KBOA 5EZQA 5EZSA 3NAQA 5JNLA 1GQFA 2R6AA 3OTGA 3KQOA 4YJKA 5E8JA 3ILXA 4O3MA 2RGGA 1M9NA 4V0QA 4X7BA 3SHFA 1P1BA 3D0QA 2FEMA 3LU1A 2P41A 6PFKA 4DW8A 1UK9A 3UC9A 2H1IA 2QIOA 3AP1A 3RSHA 1ETUA 4YA6A 4MV0A 1T0HB 2XYVA 4HK4A 1QBKC 3FPKA 1PT9A 4ETMA 2AKEA 2OP1A 5JAUA 4EJ6A 1GZ3A 4WFKA 4Q3EA 4EGJA 3BMOA 1A4XA 2C2MA 3MD0A 1RBQA 1UANA 1XRMA 3HR8A 4Y6LA 2HA0A 5CB0A 2R84A 3H2YA 3NUQA 5AQ1A 1C0EA 5F77A 2VCEA 3R0VA 5ADWA 3DT8A 3W2IA 4BP8A 2R1TA 2XGGA 4EY8A 4D2IA 2IS6A 1FYWA 3E8SA 1ZOLA 5C46F 3UK6A 2GBLC 3DLTA 4KP7A 3WLPA 2HKIA 2O7VA 4HY3A 1NZDA 4MDEA 4XQCA 4BQEA 4FW8A 3TRHA 3VV3A 1M7BA 3EJ6A 2P6PA 1QRTA 2AN3A 1JNYA 4G85A 1U28A 1QV6A 1WLYA 1DHRA 3LVRE 3MAJA 4ZOLB 5EGNA 2WYHA 5AOAA 4WOBA 5HMMA 2O7NA 5LP6A 4N6NA 2A0YA 3EVDA 3B9BA 2YXLA 3EVCA 3ENWA 2F1JA 1PUJA 4A8HA 1TUEA 4ZIRB 1JHYA 2RG1A 4QPJC 4I1OA 4FYYA 4U0KA 1Z4MA 3B1KA 5J2UB 4UHHA 1ENZA 5HZKA 1WZUA 4P82A 1OU4A 4BPRA 1LI5A 5CFLA 3L5KA 2FPKA 3NIGB 3SQNA 3BF7A 3R0QA 3JAKA 1XQYA 1OV4A 2KLBA 3HB4X 4EARA 3WSWA 3RKSA 3UAVA 1T6NA 4LDQA 1GL6A 4RTLA 2YFYA 3K05A 3NBMA 3TX2A 1HLPA 1EGMB 1XXHB 1N0WA 4XGKA 4Z4IA 5FP0A 4QQ8A 5BQOA 1EB8A 2PGNA 1HR0B 3IIKA 2GVNA 5F64A 2WDPA 3QY9A 1X1TA 4FFWA 1WMAA 2NSYA 4MYRA 3ESDA 4JLBA 5CM9C 1FUYB 2WUEA 4WBNA 3JZFA 3GHHA 4Y30A 5HJ7A 2CDNA 3O8CA 1AB6A 2QN7A 3PF9A 4ENWA 1VL1A 1PEKE 4V3CA 2MCFA 3K9FC 2I71A 1H5NA 3FMVA 1NVEA 2ZVPX 3VMMA 2UUCB 3VKGA 5EZ6B 1QC5B 1RWQA 4DQDA 1WUKS 3QMWA 1U8YA 5KVQA 3TUJC 1AQUA 2HWKA 4ILKA 3U7QB 2I3GA 4FK8A 2LIPA 3D7KA 4EG3A 5KTNA 1PNRA 5IXJA 2F64A 2MSEB 2NUAA 3EGDA 4FGLA 3H7AA 3C7CB 2Z5FA 3EVNA 3GZ4A 3D3WA 3FWKA 2J3QA 5HBRA 4RMHA 4DZTA 3B53X 4DM3A 4DRXA 1Y4ZA 2O6LA 2IXBA 3UWOA 3WIBA 3GLIA 4GOXA 4BFUA 4H7EA 5ICMA 2QB5A 3T1OA 1GYRA 4C3OB 1YZYA 1W73A 4Q3AA 1QGZA 2F3UA 1YZ3A 3L40A 4HNTA 2HGSA 2Z4TA 5IFKA 1LK5A 2Q21A 2WTXA 4WJKB 4BWYA 1OT3A 2DHDA 2QR2A 5T8KA 5KYTA 3KTAB 1REQA 2VHZA 4DCUA 3VVLA 5JQWA 5MN6A 3O5AA 3EZXA 3LUFA 4RD1A 4LKRA 4DN6A 2OMEA 3HJNA 4WXPA 5EQDA 4ME6A 3ZCPA 2EFGA 3HV2A 3PX2A 8OHMA 2GYUA 3LO8A 1H6CA 4JELA 3JYPA 5TVGA 4CIDA 2EDCA 1TZBA 1RC1A 5HA5A 2HREA 4RANA 5BR8B 3G5LA 3DLIA 5CPFA 4DLRA 4RGVA 3H6GA 1Z37A 5K8CA 3SDBA 2A0UA 4DA9A 2VPIA 5LVAA 2GRJA 5FLEX 4W1SA 2Q27A 3AJ9A 2XRMA 4ID9A 5IMSA 1YL6A 1JP7A 2D2VA 1I4TD 1RKBA 3LBNA 3LZ6A 4MJXA 3MMNA 1K8XB 3PHHA 2HU7A 4HDNA 3DYVA 3CUYA 2OHXA 3FHCB 4HWOA 2JFYA 1S3GA 1RYEA 3TO5A 2D5LA 4B7CA 1JBEA 2Z6QA 3V00A 1DE0A 2XUHA 4S1WA 1OA0A 3OCVA 2JAQA 4C08A 4YAKA 7AT1A 1D8TA 3ENQA 4RKQA 4MB6A 2LE0A 4C0SA 1U0EA 5IK2D 4XDYA 2R4QA 3GL9A 1FFBA 4BKRA 4YCJA 2XE4A 1U2SA 2YY7A 2IU3A 2XITA 3L0DA 3QSGA 4DLNA 4UNRA 1R4MA 4GMKA 5DTQA 4FNOA 1VJ0A 1Y5LA 1ZGZA 1MIOB 2A30A 3R0JA 1FRNA 1BD4A 4Q3OA 2IYTA 4UVEA 2H3HA 5ALYA 1KHTA 3CUKA 4PBSA 4KYVA 4DYVA 2IHVA 3VR4H 4FKMA 3M6MD 1R0ZA 5AW0A 5CNIA 5KX5F 3O4FA 4QJ4A 1C81A 4MNTA 5EWMA 4B7XA 4ZTBA 1SOUA 4YJ3A 4DJ5X 1U7HA 4OHUA 2CJFA 1OFTA 1V4NA 1OHHD 3OWXA 4X3PA 1QJ4A 5JRDS 1W25A 1C1DB 1PT6A 4RV9A 3C5HA 5DLYA 4UDNA 3N2GB 3UH1A 2YXDA 1GY8A 4OA8A 2M6KA 1Z6GA 3GO4A 4ZXFA 2XB2A 1J9EA 1ZVJA 4F8EA 1TZ2A 3M6AA 5BMOA 2ZFUA 3ZBPA 3BA6A 5F2KA 3I2HA 3AEXA 1IY8A 4QFCA 1ZL0A 3HU1A 3QPCA 3V8VA 2QJRA 1OC2A 4I4TF 3DMDA 4ZOBA 4LNAA 1R15A 4L57A 3U4DA 5F2NA 2MYNA 1KO8A 1TMKA 1T43A 3GZTB 1YQDA 3EIQA 2QW8A 2VSOA 3M5WA 3Q2OA 3WL6A 2ZCJA 5UKDA 1J0XO 4ZPXA 3AO0B 3AERA 4HG2A 5D8DA 1WB4A 1IBSA 2E6UX 5D3ZA 5J4VA 5KSYA 2J0UA 1L5FA 2AIRA 4I50A 3EARA 1QDLB 3G8YA 3SE7A 5ADHA 1YBFA 2ZPTX 2X4GA 4BRSA 4S12A 2GHTA 4BFYA 1KMMA 5IANA 4TTTS 4WH0A 2NV6A 3N0WA 4A82A 2VUUA 2YRXA 3I01M 4P92A 4E3WA 2I91A 2H18A 2C2ZA 1MQSA 1WU7A 1ZEMA 4DIDA 4Z1OA 2H16A 1A82A 3FNGA 4YLYA 1QONA 2W0SA 2IEYA 4BN4A 1IQPA 2JHCA 3RTDA 4BLSA 2E48A 3HABA 4D9CA 5HJEA 3TS1A 1ZI8A 2QRHA 3OOHA 4LQDA 3WLEA 3I6QA 2I6GA 3A36A 5FUYA 4Z0NA 1TT7A 3DZGA 4JI3B 3EWSA 4L2IB 2C7GA 4OBWA 4TTSA 3ZN2A 4BO9A 3Q72A 3FGZA 2V7UA 4JY7A 1QG6A 4GRAA 1L7XA 4MYDA 5CX4A 2JI8A 3OCZA 5AW5A 2VPQA 4R8MA 4V1CB 2EL9A 3HLTA 5K3OA 1LQUA 3D6JA 2G06A 2YIDA 2W2LD 4G37A 1V9SA 4GGOA 3WBJA 4RJTA 3WRXC 1LBEA 3X1KA 2WZCA 4AZTA 3NH6A 4FLMA 2C9MA 5B1SA 4QBFA 2QPTA 1RDFA 1S1MA 2RGDA 3IVXA 3TB6A 1IRIA 2XX3A 4B6OA 1IU9A 1IB6A 1TCBA 2XMDA 3D8UA 2CV1A 1OFHA 2RHLA 4LFAB 1U8ZA 3MYYA 3KC2A 2Z58A 1NZJA 4DFDA 1NQOA 4ER5A 1KVSA 3IXMA 1KIMA 1WF6A 2G76A 2W2OA 2G77B 4GT1A 5CD1A 4D98A 1I0IA 3VDQA 1PFUA 1LNSA 1ZOOA 4AKEA 3FNEA 4FBGA 3RIGA 2R97A 3AV3A 3OIFA 3K0HA 4NFYA 2A0FA 4DY4A 4KPUB 4QU8A 4WFIA 4NAHA 3A6HA 3AB8A 2IA5A 2RI1A 2XQFA 1VPWA 1A3CA 1NJ8A 5AJHA 3JWHA 4KZKA 1ISGA 4Q1CA 3L8FA 2JIRA 2XUJA 4FFRA 3SEZA 4XCQA 3FZYA 1CDEA 1K5PA 4MYCA 4OJNA 2DE0X 2QNBA 4PFQA 1LX7A 3NVKI 2GAJA 1KZGB 4QXMA 4HN2A 1MRNA 1KMQA 3BWVA 4KHPB 1KBOA 4CIBA 2O2XA 3LTEA 1BXZA 4OJKA 1D4OA 4RV5A 5H3CA 3KQQA 4U7HA 2GKGA 2I7XA 3HLKA 5HCUA 4HLNA 4DSZA 1UXHA 2BBTA 3WBKA 1FQKA 1ORWA 2NTEA 4EB3A 4EA7A 1JZSA 5CLLA 4BZZA 4UBMA 1YCHA 4K87A 3RT7A 2CLCX 5AK4A 5BV0A 3CRRA 4ZO7A 1SHJA 2QQFA 2J6HA 5A04A 4JJ6A 1RYFA 2PKRA 4H18A 2B4AA 4HZUB 3BGIA 1GT6A 4IDNA 4ZJZA 3URMA 5IKEA 3HCAA 3NMUF 1GG5A 1T3SA 1L2TA 3ESZA 5E9JA 5TNXA 1ZAKA 2V58A 4G0WA 4TLLB 4CMIB 1PN3A 1MX1A 2JL1A 4H1VA 4JVLA 2QE7A 4QAQA 4QU5A 4YXWA 3HDHA 5EP1A 3IV6A 2FAXA 4I14A 1R12A 1MENA 2H2IA 2IIQA 4DLWA 5HVNA 1YOVA 4KRGA 4PO8A 3JWGA 3B12A 2ZUDA 3U7EB 4RABA 4AG6A 1R4AA 1A72A 3DEYX 1K75A 1H2HA 5KWSA 4L8FA 4OD0A 1RE0A 1SUSA 5A6VA 4WESA 5J5AA 4LHWA 5ALOA 1BE6A 1SY7A 2YOFA 4RQUA 4R98A 3X2EA 3ZDZB 2ZZMA 1U0JA 4K9RA 3PHCA 3N07A 5AJTA 5CA0A 2WJIA 4KUGA 4U63A 2VP4A 4LI3X 5JPCA 1KRHA 4OHXA 5BRAA 2BF7A 1EGAA 2XB9A 3VNAA 1K66A 1UKZA 3A1DA 2C2KA 4WECA 5CDSA 1SUAA 3ZV3A 1RQPA 1VZ2A 3P9ZA 5TQ2A 2NG1A 3TQTA 4EBFA 3HDYA 3EQZA 4MWSA 4WLOA 2MMCA 1WV0A 3AHDA 4R3NA 2IZ6A 5DPMA 3U56A 2FZLA 1AKRA 4HBGA 5IEJA 3MMXA 4C43A 4OI0A 2ZSUA 1Y1QA 4B74A 1WXQA 1IHOA 2VRBA 1WUYA 3KPUA 5G3YA 4ASUD 2UXDB 2B6NA 4YP7A 1PWYE 4KN9S 4PLFA 4UBLA 2WWXA 4ZVTA 5DBFA 3ZCQA 2FWJA 2CK3A 4N0QA 4P58A 2VXBA 1D1QA 1UWVA 3BTSA 3CLSC 3FN4A 1I6WA 4M37A 3UKOA 4UJ3A 1SQ6A 2GD0A 2HIAA 4JFAA 4UE3S 5DGXA 3TTYA 3ZU5A 4EYGA 1UUFA 2AC2A 2QUHA 2UAGA 1NDQA 5CVVA 3BD7A 4PPYA 4LQCA 2R6JA 4C0LA 1AKQA 3Q0TA 4LZAA 4Q4JA 3OZXA 4IH4A 3L4BC 1RWMA 3LA6A 3M3PA 2JH8A 5K99A 2M9MA 4RH0A 3TAXA 1US8A 5ARBA 3HJHA 4IDBA 4RKFA 5EGSA 1J1UA 4JU8A 3OE7A 4TWAA 1TEZA 1GL7A 3T7CA 3ER9A 4JNCA 1OJ7A 3O3MB 5AI5A 5J2TA 3G02A 3ZWAA 1ZW6A 1RMYA 4RF3A 3GH3A 5ERGB 3DOJA 4X8OA 4DS3A 1DCKA 5I7UA 4GI1A 3VU9A 3R20A 3DE7X 1V1RA 2I2AA 2QJWA 3IVAA 2OVFA 1ZHOA 2RHTA 3KZKA 4Y98A 2F3QA 4LNUA 1DDIA 2IFTA 3P0IA 3I9KA 5DYWA 1MC5A 3IKJA 2Q6TA 1IG3A 3EASA 1QHYA 1SRQA 1SURA 2DBYA 3O8QB 2O7RA 1ZI6A 1N2IA 1K4YA 3HNRA 2XMCA 2OD7A 3PI6A 4W5HA 5TMBA 3SZ3A 3TB4A 4DPMA 2PCLA 3R8FA 1E3SA 2J4CA 2JCYA 1KY4A 1NP3A 2CEAA 3GI1A 1RQ2A 4RETA 1ENPA 4MV1A 4YJ3F 1LZLA 1GV0A 2J6IA 4QYIA 1QIGA 3TKYA 5BNTA 4JASB 4C29A 2NSHA 1IWBB 2W00A 1J00A 3M6UA 3PC7A 2XOEA 2RBGA 4NZPA 2PT6A 4RKRA 2X15A 3EOBI 4F8YA 2BR5A 2HMVA 2EJVA 2D5CA 1SEPA 2QVYX 3BXHA 1Y34E 4EO4A 3EGIA 1XZ8A 5DHFA 2NTNA 3X1DA 2CWDA 2ZK7A 2XEDA 1U65A 1J25A 3WL7A 4L9WA 4QYTA 2NO7A 3H1AA 1GZ7A 1EDBA 2LV8A 2X7JA 2I0FA 5EMKA 4LF9B 3AKCA 4YK7A 2C1EA 3P5SA 5L6LB 2ADOA 4OP2A 3OPNA 1LF5A 2ZZKA 2E3JA 2ZBPA 3B2QA 1WHSB 2KBEA 3FI0A 3TGLA 1MFZA 1NIJA 2RHHA 3PUKA 3T7TA 1JHZA 2FRDC 3M9LA 1TJ3A 3DB2A 4ZVRA 2A2ZA 1F2UB 5CT5A 3AR3A 4REOA 2HFKA 1EE1A 3IAS6 3H2BA 4HBZA 3A8TA 4X71A 1PV2A 2GCOA 3KL4A 2GS9A 1ZM4A 2HUPA 1Z6YA 1BVHA 1L4YA 2AZ4A 3ESBA 2EFDB 3TL2A 3QOYA 3VO8A 1A98A 2VJAA 4IDDA 4TMKA 2RARA 3S2FA 4DT1A 2I2DA 2FEXA 5DFAA 4CUKA 4WOPA 4QTYA 4LBWA 2H06A 4NCBA 3UCXA 1DAMA 1P4GA 1DSSG 3Q5EA 1T1EA 4Y1RB 1W9HA 1T4CB 2QTCA 1E1CB 3WNCA 3EULA 1ISIA 3CF0A 7YASA 2GJSA 3G0IA 4PAQA 4R1PA 1XVVA 1JIVA 1CPYA 1VMKA 2BFBA 3LVQE 4L1KA 1TMYA 3EF0A 1QO9A 3H3XA 1RBYA 4F96A 4ND2A 4M1ZA 1QRAA 3I42A 2JGLA 2DBQA 1ESNA 1GGFA 2XZLA 3BL5A 3O94A 1T35A 2HW8A 4OHCA 4DPLA 8ABPA 3THYA 5G1OA 1ZL2A 1UIRA 2FSVC 3L0IB 4H4CA 3UNXA 4S1OA 1KAOA 4RPGA 4PWYA 3V8MA 1A8UA 1O03A 1B41A 2C4VA 3N8HA 4KSCA 1YFKA 4QLOA 4U8HA 5G0TA 5FXMA 1DAHA 1KO4A 1WEKA 4U2FA 3WNBA 2PWAA 2C04A 2EFCB 1V96A 2JEZA 3CRZA 2G08A 3RBZA 3W4IA 2BBWA 1HDEA 1S2GA 3D5QA 4F5ZA 2FWNA 4DJTA 3MF4A 4E2FA 1ZIDA 1V8DA 3GD5A 2A1TR 3DL4A 3DLBA 4LISA 1O0CA 3QXJA 2WG1A 3DC7A 2BF4A 4PZZA 1YCGA 4HGOA 1U3VA 4YQYA 1A88A 4GKKB 4ANFA 1OB5A 3QIVA 3AVOA 1RJEA 3STHA 2WA1A 3BGVA 3PUIA 4L5YA 3COYA 5U4QA 2OESA 3ER8A 1U2DC 4MMXB 2Z2ZA 3UGQA 3O90A 5EKSA 4BY9E 3RC2A 2ODQA 4J2TA 1V7QA 4NH0A 2SNIE 4ZU6X 2AFHA 3RYHA 4I8IA 2ZBQA 3HXQA 1F6BA 1M2OB 1N3BA 1QX4A 1SFRA 3NLLA 3EDMA 4RVDA 2YXPX 1PWXA 4P98A 1FE8A 4J0FA 5GMOA 3TH5A 3JASB 3ZWKA 3EXHB 3G2IA 3SQDA 5FOTA 3H2KA 1YHNA 1T91A 1AUPA 2XXJA 2AA3A 2J32A 2ZPUA 2Z5GA 3A4LA 4KXFB 4S04A 2X9NA 3DKIA 3HKCA 4AUNA 2IPNA 3OPYA 1FB5A 1AZSC 3QX7A 3OZBA 4TLEA 1EQUA 4F3NA 2OYCA 3E9QA 4IJVA 1CUSA 4YJFA 3STVA 4CV1A 5KBYA 2YJNA 2X13A 3BXOA 2YHUA 3G9XA 1BIFA 3C3JA 4N0DA 4YRTA 1GVHA 4WZZA 4F5WA 3CQ9A 2Y68A 1N7HA 1PL0A 2VP0A 2ZJBA 3QF4B 4K46A 4I99A 4B4VA 3U31A 3DDNA 3WYBA 1BMTA 3O8NA 2H7YA 2XCTB 1E7WA 3E70C 3KB8A 1AT1A 1NOJA 3BUSA 1LBTA 1V0JA 2LRHA 2QPLA 3IHLA 4PNZA 1EFTA 1XYYA 2WSBA 3H7IA 5FPKA 3TUZC 2KBFA 4I55B 1ATZA 1N0UA 2RAVA 5HRAA 1V6AA 2C7PA 2ZIXB 2ZE7A 2JJ1A 3E82A 3H2IA 4MUBA 1L5RA 2WR8A 1N75A 3JQ8B 1KI7A 4FZ5A 4EBBA 5CFOA 1ADJA 3NCTA 4F91B 1BAPA 1Y8QB 3P0JA 4NOJA 3RIYA 5DTRA 3VSAA 4E31A 1L1RA 4UNIA 4KHZA 3GH1A 4MI1A 4H35A 2VQSA 2HA4A 3AILA 2IE0A 3EPRA 5H4GA 3PWZA 1CEYA 1KORA 4KDEA 3A0UA 4HTAA 4W7SA 1YXMA 4TTIA 3WYAA 1K2VN 3A1EA 3LWNA 1ONPA 3NKVA 3CX3A 2BZ1A 3LXRA 3VPDA 4I6GA 4IXDA 4AKTA 4IS3A 4E12A 3S2GA 1Y5MA 1IJEA 2HWYA 2XUIA 1VCIA 2EZ9A 4ZREA 5MFZA 3CUVA 4D25A 1RTTA 3DS8A 3WLNA 4PN7A 5EHZA 1RWPA 2BFCB 2OHJA 1T9DA 2JAUA 2FX5A 2QIPA 3IV9A 3LDFA 4CQMA 1NM5A 3K1ZA 1RRKA 2WB2A 2JLRA 4BXOB 2DJ5A 2VAVA 3GAFA 3N74A 2FZ4A 4JD5A 1ODFA 3TQSA 1XMOB 4A6PA 2BH9A 1DWUA 1JJIA 3BB1A 4Y1EA 3TZKA 1L7DA 2NXJA 1XZKA 2CXTA 4KO1S 5JCOA 1HEYA 3L02A 2PCJA 1DRWA 1X1QA 2CSUA 3LL4A 5HHTA 2X0KA 4MKHA 1PFWA 2XQGA 4XQ0A 5DYGA 1R8XA 1XA3A 2UZ1B 3KYDB 5FH9A 1FK8A 4I4IA 2D7CA 1XELA 1VI2A 2HA5A 5EE5B 3WKCA 5F9MA 3FVWA 1CF4A 5J2TF 1QHFA 2Q1WA 1MOQA 4ENSA 5HWSA 1IK4A 2QKYA 3LY9A 1A7AA 4TKLA 3UHAA 3TL6A 4PGGA 4MKFA 5JATA 1CXZA 4CODB 4ZANA 2JD1A 1YR7A 5K09A 3ICQB 4M8IA 2DGDA 5BT8A 3OCUA 5AOVA 3SG0A 2NU8B 1ZU4A 2V7WA 3B5IA 1Z39A 2Q2QA 1TYCA 4ND1A 3ACBA 4V02A 4PF1A 4HDRA 4EJSB 1CJMA 1DMRA 2ZYVX 3KSRA 1CQJB 1CY4A 1G5FA 4GFDA 3N8DA 3SMVA 4LV6A 5CFQA 1S3IA 2REOA 3SWWA 4X94A 4BAGA 4W9NA 3IUBA 4TYNA 3IEXA 4X7PA 2ECQA 1XQWA 1RPTA 1BX3A 4AD8A 4A36A 3RC9A 4IHJB 4R51A 1V35A 3DHWC 1Y8CA 4ZVUA 721PA 5ABPA 2WP8J 3QX3A 4Z1MD 4XEUA 2I4OA 2WUGA 4AM8A 3T5TA 4C4RA 4TLBA 3TG2A 4ZXPA 3RQIA 1GGMA 2GX6A 4HWRA 4M99A 4PLVA 1ZIOA 1FX1A 2CYBA 4EQ6B 4PYKA 1EH5A 1WQ1R 1X2EA 5AW9A 1CJTC 3L77A 1ECFA 3E48A 4QODA 1XMXA 3TW8A 1H65A 3L0OA 3DW3X 4HO1X 2Q41A 4MPTA 1T5DX 1VMIA 2ZIAA 3LHFA 4MPJA 4PINA 4ISCA 5DNVA 3OQOA 3I2YX 1VSQA 3CW9A 1XA0A 1ZNWA 4U7WA 1XTTA 3KAPA 4UULA 1QFSA 2FZ5A 1QYIA 3DKRA 3RQSA 2IH2A 2OCIA 1ZN9A 3KCNA 4ZZ1A 2EG5A 4RH3A 1TZKA 5CJJA 3TLEA 2DSTA 3WK6A 1K86A 1NPDA 1W48A 4O25A 4OL9A 3RU3A 3A06A 1CVLA 2FR8C 5C7LO 1YHYA 3EVZA 4ZCMA 5BSHA 3TE7A 4KR2A 2V7GA 1OWOA 4MMZB 2F1KA 2D59A 4PAMA 5DI9A 4OHRA 2PT7A 2O6HA 3AK4A 4MV5A 4DCJA 4WJLA 1VLMA 4Z0TA 3HEMA 2VRWA 2JBHA 1KQFA 2GAAA 3DMFA 3S28A 3SX2A 4DGQA 4PO3X 4IUBS 5JXGA 2DXIA 2A4KA 2JKZA 1GQOA 1LS6A 1MB3A 2UVQA 3I73A 2R47A 1NG9A 1FJXA 3EXG2 3FDIA 3VR5D 3UKJA 2YIVX 5FO1A 1W94A 1S2IA 4BNYA 1ZGAA 2P65A 5CVUA 1RXWA 4H6XA 3OE1A 2JK1A 5AXCA 3RS5A 4XDZA 3MUEA 1L8OA 4BRZA 5IYZB 4JP8A 4MPPA 1QOZA 4ZQCB 2L19A 4IM7A 3OEED 1SM4A 1QIDA 2FR1A 4HWSA 3GLIE 1SUDA 2XMSA 5D3KA 3HLYA 1QRUA 4QC2A 1U1CA 4IPTA 4MQ6A 1FRFS 3A1SA 1EGHA 4HAYA 4LBZA 1C3EA 4QRHA 3UJ7A 4B6RA 5MGNA 4LRXA 3SJZA 5BPHA 4FB4A 4OI4A 3CRQA 4INOA 3I5YA 4KUEA 4WTOA 3M4ZA 1PFVA 4DXAA 3HWX1 3LP8A 3OZVA 2YICA 1GFIA 2A5LA 3EVBA 3QBJA 4PC2A 4PLGA 4XIGS 1EIWA 4D9BA 3CUEF 3MS7A 3ZIUA 3MGGA 4C2BA 4ID3A 4KG7A 1Q14A 2EFHB 4M83A 1B6RA 4IW3B 4L5AA 4AO7A 3IO5A 4QJ3A 3LBHA 2PZLA 4OHFA 3CW8X 3TXAA 2ANCA 1JVBA 2CMFA 3DPIA 3KZXA 1P2GA 4RW0A 5C4MA 3E7PA 3OWOA 5L3QA 3PT9A 3RU9A 3PRKE 4GOOD 4WV3A 1IDN1 1Z2EA 3N0VA 3GLHB 1BROA 2EYQA 3DMTC 2LCFA 1PDOA 2X76A 4IX9A 4NDZA 1Z0IA 3BXZA 4TKVB 4YV7A 1TIPA 2Q2NA 2VDJA 1AN9A 1U8UA 3TZCA 3VH1A 5K0NA 5JO0A 4N41A 1UBJS 4NFLA 5AK0A 4N3CA 1M5TA 1HFEL 2GH1A 2DUMA 1E2EA 3DR3A 1PD0A 4MV4A 1Y9AA 3IODA 5J9FA 2V9PA 2P9EA 3T5MA 1XOIA 2Q46A 2ZSDA 3TINA 5DX8A 1GZUA 6NULA 2CWWA 2GZSA 4JC8A 5JAPA 4IS2A 4L7QA 4LXYA 4EAAA 4YN3A 1JB9A 1J0DA 1KFCB 2I80A 3H5IA 3M6IA 3IAS1 1HURA 3NJRA 4MWOA 2FRDA 3CLSD 1N2CB 4F5DA 4F3YA 1Z08A 3B9PA 2ZT5A 2JLBA 3CZ5A 2Z4SA 4MROA 2Q9AA 3ZLBA 3OEYA 4TPKA 3TIGA 2R00C 2YV4A 4RZUA 3V8RA 3IBTA 2D3TA 4DIBA 1UQTA 3HH8A 2WKQA 3FETA 3KLPX 4U3JB 3GMIA 3R3ZA 3V6LA 4ETIA 4ND7A 5DXJA 3AEUB 2BP7B 1E69A 4WW0A 4YMIA 1FSFA 3TRKA 3LQKA 2NWQA 4QUKA 3EDOA 2VUIB 4JFRA 1GPBA 4FOLA 3ANXA 2EKDA 2R5NA 1IATA 3G2NA 5IC5A 1ZHFA 2DLDA 1ZHHA 2JNWA 1CP3A 2YRFA 4PE5B 1RAHA 3VO1A 3RUEA 4JB2A 2Q2VA 1M2VB 2A33A 4CDGA 5F7JA 3KL2A 3MPUA 3HDGA 1N8TA 2ABWA 2X8AA 1T9BA 2H65A 3DE1X 1IZ9A 3PRJA 2P62A 1QAMA 3WKBA 2RGEA 2BGLA 4HDKA 4AJNA 3D6HA 1MLDA 1GPJA 3H8VA 1GQRA 3RWBA 3LBFA 3IESA 3NR2A 4JC4A 2XDQB 1AS0A 3M9XA 2ADMA 5I9IA 1SXJA 2FSVA 3AY0A 1B8UA 3B60A 3AR7A 2B8JA 4RMJA 5L9AA 1VHTA 2OCPA 2A59A 2BMDA 3E5NA 3FFAA 2N3ZA 5JJBA 2WT8A 5ALLA 4C87A 3O21A 1KH3A 4PZLA 4Q1BA 4B3DA 4C4SA 4EY4A 2IV2X 3RBVA 2OO5A 1SR8A 2Q6KA 3A9UA 4LN1A 4OQDA 1D04A 3KOUA 4QPCA 3AB7A 3JAMA 4IFIA 4KWHA 3SQLA 4RTMA 4GBJA 3X1ZA 4PXYA 4UTXA 1BMFD 1U8EA 3PLRA 4XQ9A 1FXWA 1UQRA 5DBOA 4L3WA 5BSMA 3U2QA 2X23A 3SQXA 1GSIA 2HYDA 3RYTC 1Y3DE 4B4KA 4LYHA 1E2JA 4NBRA 3U3RA 3R6DA 3IPRA 4MIOA 3GGSA 4X90A 4K8OA 5CCBA 1IUKA 2Y1CA 3HP4A 5LZ7A 3LDUA 3PNMA 3RU7A 2ZJ0A 1GDDA 1NN5A 3KFLA 1R5OA 1NR7A 1JDNA 4L5IA 4PLWA 1VL8A 4EO7A 5DK4A 1VPDA 2GEDA 2O3RA 2QW1A 4FYJA 4LECA 5IBQA 2PR7A 3SC3A 4O5AA 1YZGA 1U2QA 2ACKA 3W3AD 2C77A 1XALA 4IOKA 3L79A 1XR3A 4GM4A 4CN9A 3P96A 2ZRMA 1OVMA 5EIAA 1P8AA 5LM3A 1K68A 1DCTA 4IGIA 1Y63A 3KKMA 3M4JA 5EHQA 1OAKA 4PHFA 5KVVA 2ZIZA 1ESZA 3KJXA 1X1DA 1YZLA 5CJ2A 1CTQA 2P3QA 4OBXA 3VPXA 1E3WB 5A3JA 2PSEA 1UZAA 3HCNA 3T4UA 3Q7QA 4DPKA 4YNBA 4I9HA 3TSZA 2BCEA 1IM2A 1EJBA 4D4JA 3IERA 4LHEA 5AJYA 4LRQA 1CQIB 1XAIA 2XUPA 1Z12A 2JJMA 3DPUA 4F6RB 3U3JA 1YNOA 3O03A 4JAVC 3C4QA 1E0JA 1SIBE 2YDXA 4B84A 4L4XA 4ALIA 1I32A 4QOGA 1U5BB 4PZ9A 4O3FA 4XI9A 3PA8A 4QBHA 2F1HA 2G7ZA 1RYBA 1V16A 2ZB2A 3EAQA 1H5UA 2IYUA 3FOWA 2MSNA 1AVTA 1Z0JA 2E4VA 3H65A 4R0MA 2R65A 4NWIA 4V24A 2CV2A 3AVVA 2R44A 1ZIXA 4JYPA 2DPMA 2NV0A 3KT3A 1OC4A 2BRUA 4HGPA 5JVDB 3GWZA 4A73A 2GAIA 4KX5A 1FFYA 5TB5A 2OKCA 2VYCA 4TKMA 2H4ZA 4XAQA 5EAIA 1TYDE 2DKOA 3LCJA 1BDBA 4HUQA 1LA2A 1ZK4A 1QKKA 2FI1A 2XOXA 4UVDA 5AT1A 4ZT2A 3CPJB 4S3MA 3LSYA 4JSTA 3DXXA 3LGAA 2XAAA 3A04A 4GBED 1VKRA 4EO9A 2HJGA 3HGQA 3NDBB 1EBBA 4ZO6A 2NP6A 4F3CA 1TX4B 2Q3DA 1X9GA 3ADOA 4FMCB 4FPXA 5EQFA 4Q7QA 1OBHA 2CLLB 3V7YA 4JJIA 4MPRA 4HNQA 1M6VA 1BC5A 4LDPA 4UAGA 5D7BA 4UMEA 4M87A 2GQ0A 4MGIR 5LWHA 1MG0A 4LRSB 2OORC 4MVYA 5BN5A 1JDSA 3GIDA 4YMVA 1P81A 3DF9A 1C9EA 2GJ8A 4BQSA 4DGSA 4QFMA 2EZ8A 2NQ2C 2Z04A 5L7WA 5FB3A 5BOSA 5GY7A 5C1PA 1YVUA 1NW4A 4LVNA 4OV6B 1YJCA 5AWFC 4MRMA 3CGWA 4H7HA 3JCZA 2RBEA 4UZSA 1KE2A 1ZX1A 1FNCA 4J0CA 1OFGA 3SIRA 3AJDA 1VG1A 4DR3B 5AD1A 2IX3A 4Q66C 5FKJA 3RAGA 3CJTA 2ZWOA 4W1QA 3VXKA 4EL0A 2ONKA 1UPUA 4MUEA 4PG5A 4PS0A 3ACDA 4KK4A 2ZYDA 4PZPA 4H1WA 3B7WA 1XZDA 4ZEOA 1Z13A 1J2JA 1BGWA 3TQCA 3ZDDA 3WA7A 2C7QA 4J49A 1B8VA 3DM5A 3QOWA 2NUPB 3NHYA 2O54A 3H2HA 3ZWQA 2SBTA 2QZ4A 2R60A 4F5EA 1RYYA 3I05A 1FSZA 2W6IA 3L1KA 4E4RA 1U2EA 1Z5VA 5DHRA 3ER6A 2VWPA 2L69A 1U99A 2RGNA 3GCZA 4MS1B 3WWOA 3O4IA 4YCDA 1KMHA 5E6SA 4OHZA 4MP6A 2WYUA 1EXWA 5A5FA 2UYCA 3BIFA 2GHRA 1I3LA 2W58A 3PTAA 3CE6A 2Y99A 1JG2A 4BGIA 4PYRA 2F48A 3W7BA 2WJGA 5CYGA 3A2NA 3DCYA 1UXIA 4GOLD 2PRSA 2WJJA 2VK8A 3QLVC 1KYQA 2HB6A 3N86A 4PRLA 5SY6A 4KLZA 4RKEA 5FI3A 2J9FB 2WVGA 2YV3A 3FYCA 3ZGOA 4BO2A 4ROSA 3DZJA 4GKVA 3MNFA 1UPAA 1F38A 3G2LA 3H5TA 3IUNA 3O8OB 4D0SA 4IQFA 5L51A 3B51X 3R4VA 4R6WA 1JEYB 2EP8A 4YACA 2IPLA 2JCXA 2R8BA 5CT6A 1WV1A 4DQ0A 3AP2A 2VATA 3TLBA 4XPIB 1RLTA 2QAGC 3LRXA 5BNWA 4G65A 4PTLA 2EYUA 4FQ7A 1S01A 5KO2A 1QIHA 2IOHA 3CBQA 2GEFA 2P5YA 1XL0A 1F20A 5EMHA 3ZGZA 3TAUA 3WNDA 2IJGX 2BSXA 3HJFA 1SC4A 3K9BA 3PQ4A 3WL5A 4RCZA 2W98A 2LVBA 2X8LA 1JAHA 4NRDA 4LV5B 3QI2A 2CDRA 2M6RA 1KOJA 4D6YA 1NVAA 4R1UA 4CV3A 4DXDA 2I8LA 2G1KA 3MJSA 4K6KA 3H1GA 5DSXA 2YH2A 5EYPB 4UTOA 4ZQGA 2VN8A 4OG2A 4TWBA 5DSZA 5JT1A 3J81k 1XN1A 1XU4A 4HPXB 3W4KA 2NSDA 4UVGA 1GAEO 3DE3X 4TVBA 4B45A 1N7JA 5EXDA 1N5JA 2NO4A 3MJTA 2ZBFA 4LXIA 1JIIA 4FOSA 4LTMA 3G3EA 1FQOA 3DDSA 4EM6A 4BUJA 2ZTHA 1ACJA 1BNCA 2CEKA 4YCSA 4M0DA 2ZW9A 4M0PA 2FDXA 5G0SA 4AP5A 1IBRA 3Q5DA 4DKJA 4QGFA 3RVMA 1NQWA 1SG0A 3W2HA 1S02A 3GQVA 1JR3D 1OH8A 4CJXA 4PC3A 3QFTA 3RE1A 2FSPA 4UBIA 5DYNA 4M0UA 1PBTA 1YR6A 2PTHA 2VBIA 3G5AA 2C5AA 2CFTA 2YXNA 5KJCA 3T34A 4QO8A 1AGXA 1QAOA 1QVRA 2UUOA 2ZRBA 1O3YA 1HT2E 1V6SA 2X5XA 4M1WA 1I0ZA 3NTRA 1CJKC 4EPWA 2ZTLA 2PL9A 2WPDD 3Q4GA 4FZVA 1PFQA 3NHKA 5DM2A 3CRVA 3FFTA 5P8WA 3HCCA 4ZKDA 4WZAA 1E6KA 3AZOA 4M1EA 1RI4A 1GP2A 1H9AA 3GRAA 4QDJA 1JKIA 1I7NA 4Q03A 1IAVA 4S1NA 4WNCA 3SY8A 3CM0A 5I7SA 2Q5QA 1FXWF 1JKFA 2C8KA 3MEQA 3ACCA 4KTTE 3WFIA 3WV5A 5FYQA 4ZN6A 5KYWB 2ZUVA 3K09A 3T9CA 1N9KA 1FIUA 3KZMA 5CCDA 1AKUA 1C4XA 2YN4A 2YNMC 3U4IA 3MTJA 3FMIA 5A9SB 3EGCA 1YL5A 2JIZD 4YMHA 3PGKA 3O4HA 1JH8A 1KJIA 2Q8QA 2VDRB 4P2GA 1P5JA 3HNOA 2EP7A 1I6LA 3NPAA 1D0IA 2AUMA 3RW9A 4TZKA 4E6PA 4EELA 3PDCA 4JUFA 1L5HB 4A5OA 4ZJPA 1KDVA 3RDPA 3UXEA 2VXCA 1R10A 4FMPA 4XKJA 4U2BA 5JD6A 3GPDG 2Q4DA 1EVIA 5ALGA 1SVMA 1TPZA 4CCYB 2IDMA 2R1ZA 1USKA 5A9TA 4PFKA 1UL1X 2P9BA 2C4HA 1GA6A 3CF4G 4C2TA 1SU4A 2G72A 4RNCA 4WQMA 3E3AA 3FKQA 4EX6A 2ZJOA 1EE2A 3WKDA 1ZJWA 3H1EA 3AI7A 2QSUA 1SHZA 3KVYA 3E22B 2XMRA 2XGSA 3UO8B 3TIFA 1TAHA 2P68A 4ZIRA 4G1FA 3GWGA 2Z30A 3M33A 1CQPA 4E2ZA 2WWIA 2TMYA 5DMHA 1OBVA 3CSUA 4R7ZA 3T54A 3WTBA 5CB4F 2XF8A 1RJFA 2NNWB 2VS1A 1CZOA 1O4VA 3E9NA 4CLRB 2OENG 5BR7A 4X93A 3PD1A 1JU3A 5G1PA 2PFSA 4HVCA 1G1MA 1E8NA 7REQA 1NRJB 2AFHE 4S2UA 4M8NE 4P86A 1N77A 3W5HA 1GPNA 3D3JA 1XXHA 5B5SA 1CYDA 2ZYGA 1XC7A 1BGXT 1NW5A 1PIWA 3CFYA 2IV3A 3VU0A 1EFVB 5A9SA 5KNCA 2E5FA 1OI7A 2CCJA 3C3DA 3OP4A 4B81A 3OLCX 3TTSA 1GKLA 1RFLA 1Z73A 2NLOA 5IX8A 3P9XA 5FWXA 1G0OA 4URHA 1E6CA 2HF8A 3K0SA 2XMGA 5T4EA 5LB2A 1UFQA 4IWNA 4N7RA 1P0MA 4BNVA 1E1RA 1FNBA 3DBRA 3KSZO 3TZEA 4ER6A 1YJ8A 4AS3A 1FTNA 2V5AA 4YRQA 3PENA 1KY5A 4ZMBA 4A0SA 2RI0A 3RHTA 2GPYA 4O1HA 3LUBA 4F6LA 3GA7A 1OGJA 3CPSA 1DUSA 3Q40A 4O2LA 3ZUPA 3FTDA 3HKDB 4XYMA 4E94A 4FHDA 1YRLA 3DJYA 3L5OA 2GPBA 1GT91 1EFRD 3QKSB 2GPWA 3EFOB 1KTVA 1MO4A 3VHQA 3VR4D 3LRPA 2BOVA 2Y66A 3HBAA 2EF1A 1PS0A 5FI1B 3Q7TA 1BX1A 4BQQA 5G0WA 2V5UA 1PR4A 1LJLA 1ST2A 4IG4A 4LQ4A 4EMTA 4MDHA 4MUJA 4Q01A 2XDAA 2AJBA 4E46A 1RCTE 3PEEA 3HQ4O 4C07A 3BIJA 4WFQA 3BT7A 3AL0C 3HB5X 3TIIA 2J3MA 5BV7A 3BEDA 2NO0A 4AUMA 1P5HA 2H08A 3C8UA 5JALA 1WOYA 2FPPA 3DKPA 3FZEA 4RY8A 2X0DA 3IURA 1UC4B 2V45A 3HBNA 2WSMA 2HSEA 1PUXA 2ATIA 1L5MA 3O3NB 1UFOA 4QUJA 1U6IA 1K5GA 2AC4A 3JD3A 4TMFA 4UZFA 4BDTA 5CP8A 5ENVA 2RHWA 2DAPA 1DINA 5E4JA 1RI3A 1CJCA 4FHZA 4C05A 3T3EA 1F4VA 1O89A 5B4TA 3JQAD 4NBWA 5JXWA 5J4KA 4Z2AA 1DEAA 1U4NA 3MT7A 4B31A 4P4TA 4C7MA 4WBSA 3WQSB 4MO2A 1DTSA 1FBNA 1KVUA 4KQWA 1QIMA 1XTJA 1RM4A 1H6BA 1Y5NA 5DKFA 5AI0A 3HADA 1T4GA 4ARAA 5K3SA 4HX5A 1MIOA 4QOIA 1XYVA 1I9CA 1YTLA 2LIVA 1QIJA 1MIHA 3JQFC 3VGJA 4YWHA 1CZLA 3V7FA 4DNFA 5JZSA 5K6RA 3O7MA 3T52A 2FN3A 1QO0D 1Q7BA 1T9HA 3IV7A 4ZPJA 4MR7B 1QTQA 4FFMA 3M4YA 3ADBA 1SOVA 4N0MA 1QU3A 4OXNA 5CNJA 1NUHA 3PNVA 4ZAGA 5FFNA 2RMKA 1GPUA 2EIXA 5DHAA 3N2GA 4WKBA 3KALA 3P9RA 2LD4A 5C35A 1S3FA 5C7IO 1QGED 4ZKEA 1KJJA 1C9DB 4U5QA 3FB1A 1E89A 3CZPA 1NV9A 1CFZA 4FFSA 4MIEA 2FLWA 4BNLA 3UAZA 3NBFA 5KDOA 3QYJA 5GVSA 4GOJA 2FV8A 1RAGA 1DEXA 2J4DA 4YCMA 3E35A 4RMNA 3H3FA 1GU1A 4E70A 1UP4A 3IUMA 1NUSA 4N82A 4ZV4A 1C3LA 2AN1A 4LZNA 1FSGA 3CZRA 5A2GA 3OZRA 5B30A 2GM4A 2VLIA 2YHSA 2DHQA 2FPGA 1VDZA 1ML4A 4GLBA 4UASA 1H6AA 4L5CA 1QR6A 1H0SA 3NNNA 1Y4AE 3DXFA 1XDGA 4LE0A 1O97C 4QRIA 5IT4A 5JROA 1M34B 3UMYA 1QMGA 4FLFA 1COWD 5G53C 2Z9BA 3FHLA 2AF4C 2BDEA 1YRYE 3WZMA 2JFXA 1SUCA 2WHXA 4D8TA 1VHQA 3OH8A 1OQAA 1U2GC 2I4LA 3ZHVA 1WW2A 5EL0A 4JJFA 4MEBA 4A2CA 4R2JA 3JQAB 1GO2A 3TAHA 1VSTA 3ZIAA 4S0ZA 1QHSA 4JI7B 4L2IA 5DNWA 4A1FA 2ZM5A 2CD7A 3R2JA 3B7PA 2CHUA 1YBAA 3OJ0A 4JP2A 4TWZA 4WAUA 4Z86A 1DCMA 1QGUB 1R6XA 2HLDD 3AIOA 5FI0B 5KNDH 3RUPA 1Q0ZA 4V1CA 2B5VA 1N2BA 2E1PA 2XECA 2ZYRA 5D1HA 1UC8A 4MW1A 2PYIA 3LNTA 1IBMB 4LJ8A 3GBVA 5AVKA 1GZSA 4D5GA 4J0HA 3QKRB 3U1BA 4S1VA 2G07A 1WS6A 1Y6QA 4YV0A 2JPDA 1A50B 2YJZA 4AO6A 4ARZB 1RD4A 1YNSA 4LOAA 2BZGA 3IPXA 2H29A 4RELA 3IA2A 1WDWB 2XUQA 4E2WA 4OAPA 4ICIA 4IMIB 1TECE 4G89A 3ZDQA 2NSJA 3L49A 2YL2A 3FLMA 1RYMA 1KU6A 3ZE9A 1IG0A 2OZLB 3FOZA 2W90A 2CZCA 3FMGA 1OLUB 4KPUA 2G5TA 2AOWA 1YVDA 2JGRA 2QU8A 2RC5A 4OQEA 5K8LA 2OHOA 2OUKA 1SVUA 1MNQA 2K7ZA 3HM9A 3OTHA 3ONWA 4TSRA 1X7ZB 4K6GA 6AT1A 2QM8A 1HT0A 3HI6A 2IY9A 2J7KA 2R7LA 1KYVA 1MCZA 2HFJA 2HBRA 2UZAA 3Q3GE 2BD0A 4JYZA 4LHYA 2R96A 3TE6A 2XGOA 3U17A 1OE0A 2PD4A 2XBLA 3WYFA 4BQRA 2QL7A 1APBA 2F6RA 4Y2JA 4DSUA 4GIBA 1RQLA 2BKUA 1WXIA 4LGYA 3VISA 2ON6A 3IQWA 3QMMA 5LQUA 2ZR9A 5JIBA 3C3WA 1P1JA 2IU6A 2I6FA 2YR0A 4WASA 4NG5A 3PNSA 1RACA 3PX3A 1MZPA 3KR2A 5CXUA 3GEPA 4ZZ3A 1PK7A 4UDYX 2FUG6 3F6YA 1MBZA 3LYLA 4CNQA 5LYJA 3T4EA 5J2UF 2GK7A 5ICFA 1TZJA 1F1JA 3NGLA 1DC6A 2P4UA 3NWEA 1YA6A 4UUMA 1V3VA 2JFBA 4EG7A 5JTUA 1H8HD 3Q7IA 4OQLA 1A8QA 4P36A 4UHCA 3A1NA 5JY6A 2CJWB 4AYXA 3UGKA 1QR2A 4ZAWA 2WM8A 1WDKA 1DQSA 3QV2A 2ASEA 5FQOA 5LA6A 3UJAA 3NM6B 1T9ZA 4D92A 1GTVA 1RXEA 3AFOA 4HDSB 5CYOA 2ZDHA 4O4HA 1PHPA 3NRJA 4L08A 4ESEA 4TTJA 2JFHA 3DONA 4R3WA 1LLUA 3TK1A 4YAUA 5ISMA 1KF0A 1B14A 1RXIA 2R5WA 3IIEA 3EY9A 4P4SB 3UB4A 4LMPA 4BOYA 4ARUA 1STOA 5KYYA 2VYNA 3K1TA 2LKDA 3HL4A 5B36A 2IIBA 1SKYE 3K9GA 1RPAA 3QEAZ 1PFGA 4LRWA 2PG3A 4NYJR 4RL6A 4K9LA 3N8KA 1DC3A 2G7MC 1F4PA 3H5NA 3R5HA 4IY1A 4P5PA 4WI1A 2ETXA 4J7CA 4FN4A 1DJQA 5HCIA 4AF7A 3FTEA 1VDMA 4MMYB 4QD3A 3K9CA 3F2VA 3T5BA 2IRWA 3HYSA 1AQ6A 1M0EA 3ZCRA 3OIGA 3COSA 2YN2A 1RW4A 1PR2A 1H3NA 3EEOA 1RSZA 4DSAA 2WJ6A 2FPSA 2IXEA 4IJUA 2D5BA 5GJBA 2ZEJA 4DR5B 3AESB 1AX9A 3RG2A 1LK0A 1LB1B 3E23A 5BWOA 1U3TA 2C94A 3B78A 4REQB 2KB0A 1G9XA 4IHAA 2BONA 4KCGA 1RC0A 5HJ2A 5LDHA 4CMEC 1YZUA 4YONB 5JE8A 3HJTA 2AI1A 2C2OA 4D4MA 4NEHB 3A6FA 5AJXA 2QLNA 3B5EA 5C8ZA 2GGSA 3M3DA 2HCFA 4RMGA 2OGZA 4TVSA 2G83A 3IO3A 2L0XA 2GD2A 3PEFA 4GWLA 1G21B 2R4TA 1RPZA 2I6XA 4Z3DA 2B2CA 5I8ZA 1YMQA 2C96A 5IJ9A 4DNQA 4ZA2A 1R50A 4EHHA 3EFHA 5I3CA 4C89A 3UJ3X 2VZLA 2H2WA 4P38A 3CLRC 3BGOS 3T6KA 3ZHTA 3M6WA 3QEOA 3ZTTA 4G1EB 5I7FA 3A3YA 2PYDA 1W59A 3AUUA 4MQFA 4IR7A 3WGUA 5IH7A 3FD8A 1X1CA 4B6PA 1RI2A 3HR4A 5FA8A 2GYYA 4W82A 4ZQEA 2QD3A 1UEJA 5L4NA 2PMKA 3BE4A 3K6KA 3MAGA 5CR9A 4E15A 1WULS 2P4SA 4L16A 1H2AS 4QPDA 3AL3A 4BZQA 1Q1BA 2GZAA 2AK3A 4Q4CA 4ZK6A 1YDEA 4BCDA 4ZGGA 4NSNA 1PD1A 1QP8A 3GFPA 1NONA 3IMKA 3N7TA 1PFYA 5J4YA 3RFXA 4DLTA 2FLVA 1U0NA 3JAWA 2PMDA 3P2OA 1N5MA 1ULZA 1O96A 1LWNA 1SWVA 1HQDA 1YS2X 3GVXA 4NZYA 5BRNA 3TFWA 3TYXA 4ZYUA 3HWSA 2I22A 1S2MA 5CLQA 3ADDA 4DMKA 3UJCA 1MVLA 3Q8MA 3FVTA 5B57C 3DOFA 1MO3A 5EJ8A 2SICE 4RBNA 3MM4A 4FSDA 4LKOA 1C3JA 2VAWA 1R8SA 3GMTA 2FQYA 4RQBA 2RHBA 3BZUA 5TGZA 4P81A 3G6WA 3WLIA 4YJ2A 3IDQA 1QLHA 3AFGA 5EVJA 5JXJA 1KJWA 3W8EA 2PQMA 1GD1O 2NPIA 4R2KA 3RVJA 3FPEA 4GPZA 3TX6A 2FW7A 1JMKC 3LQFA 4P2BA 4PX2A 3RI3A 2Z5LA 4Q4AB 2QRPA 1ULTA 3BRCA 4YUYA 3KD3A 3PGXA 4LA4A 4F11A 1ZZEA 2YNMD 1AS3A 3R5SA 4V03A 5IF9A 3C8ZA 1WHSA 1J56A 4J1QA 3Q10A 4OH7A 5F3WB 1F2UA 3VNRA 4PTZA 1C9MA 3EFBA 4Q37A 4CKEB 1QYVA 5JMTA 2VSXA 1JIQA 1A5BB 1YUBA 1W4LA 4IJKA 3ZX5A 5DHPA 4LMRA 3OQNA 2ZQYA 2GDZA 9MHTA 1TFUA 2NN3C 2AOUA 4AXBA 1YB5A 2NZVG 3AM3A 1UKVY 3IPCA 5B6PA 1BHSA 3EUFA 2OOKA 3I2KA 3LUCA 4QLBA 4LTNA 2JLWA 4BQIA 4FFOA 3MMPA 4MQUA 3WL8A 3WP0A 5KUTA 2XDWA 3I62A 4UUQA 1T4CA 2JI7A 3WGOA 3MVEA 1YKSA 4OHBA 3ZJVA 3UYLA 1OGYA 4UM5A 4EZEA 2IY7A 4PYMA 5AJVB 4ZU3A 3AC0A 1SD5A 2V7QA 1WW8A 1BHO1 4LSZA 1E1LA 3UFBA 3W8RA 2H5JA 2OV6A 5K2OA 1O87A 5CXQA 1NRXA 4KB5A 2G9ZA 3UHOA 2HAEA 4LE2A 5HKKA 3C1UA 4MIYA 1IHYA 2JA1A 1R0SA 3ADPA 3GVCA 2ET6A 2OLKA 5SZHB 3LX5A 5U4XA 1O77A 3G7NA 3IOCA 1XB2