1OFVA

Flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Refined structures of oxidized flavodoxin from Anacystis nidulans.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1992-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ofvA00
2A5LA 1AG9A 1F4PA 3ESZA 3K20A 2B3DA 3OWHA 3ESXA 2OHJA 1AKTA 1AKQA 2XOEA 3G5MA 2HPVA 2R96A 3GFSA 1CZLA 3KEGA 1AZLA 2BZSA 2M6SA 3ES9A 4GR9A 2OYSA 1V4BA 4QODA 2MTBA 1CZRA 4YAOA 5F4BA 1D04A 3F6SA 4DIKA 3QFRA 4ZVNA 5NLLA 2BF4A 2FVXA 1AKWA 2FDXA 4C0WA 1FVXA 1YCHA 4XDGA 5LBUA 5B3LA 2Z9DA 3HR4A 3NHWA 4ICIA 4PU0A 4YAWA 5EAIA 1D4AA 2MOKA 4ZVKA 5FA6A 1WSBA 2R97A 4XDHA 2FZVA 1H66A 4GI5A 3N39C 3NHPA 4FGKA 1KBQA 3OJWA 3NHFA 4H2DA 3W78A 4LTNA 3KLBA 3N3AC 1B1CA 2Z9CA 1FTGA 3K1YA 1J8QA 1SQSA 1I1OA 2FAXA 1C7FA 2BMVA 1ZX1A 1CZNA 1T0IA 1FLAA 3P0RA 2FX2A 1X77A 4HEQA 2V9CA 5NULA 3O2NA 1XYVA 4PTZA 2QX4A 2F1OA 1YCGA 1YRHA 3FVWA 3B6JA 4OXXA 3B6MA 1VMEA 3F6RA 3F90A 1TLLA 1YDGA 3NHYA 4U7HA 4BMOB 3U7RA 5LMCA 1QR2A 4D02A 5FUQA 3LCMA 2ZKIA 1FUEA 4YALA 2Q9UA 4N65A 1OBVA 4CF6A 4QOEA 2FZ5A 3GAMA 3ZHOA 3QE2A 4GQIA 3O73A 5FX2A 1DXOA 5JROA 1T5BA 1YCFA 4YQEA 2Z9BA 1YOBA 3KAQA 1J9ZA 1KBOA 3TZBA 4U7FA 4FGLA 3NHJA 2BPOA 2X2OA 1QBGA 1CZHA 1QRDA 2QR2A 4QOFA 4ESEA 1RTTA 1CZUA 4CETA 3F2VA 3OJXA 4QOIA 2AMJA 3GFRA 2QMZA 1DX9A 5EA2A 4PTYA 4FX2A 1FLVA 2HNAA 1DXQA 3JSXA 3L9WA 1OFVA 3EYWA 3OWXA 3LT5A 1RLJA 3NHUA 4C14A 1JA0A 1CZKA 5EMNA 4F8YA 4QOGA 4ZVMA 1QHEA 4M0CA 1GG5A 3W7AA 4NULA 1E5DA 4QOJA 5F12A 2V5VA 1FLDA 3B6KA 3R6WA 3L9XA 4YAFA 3NHRA 1FX1A 3NLLA 2D5IA 2MWMA 5B3KA 4H6PA 3S2YA 1WSWA 3W77A 3N3BC 2HNBA 3GFQA 3NFRA 2OHHA 1ZWLA 1RLIA 4LA4A 4Y9UA 1BU5A 3OX1A 1BVYF 4LTDA 5BUCA 3UXEA 3TE7A 3SVLA 1AKUA 2WC1A 2Z98A 1OBOA 3OX3A 4YAUA 3TEMA 3U7IA 4ZVLA 3UXHA 1TIKA 1J9GA 1NNI1 2Q62A 4J8PA 1CZOA 2FOXA 3EDOA 4U7GA 4R81A 2N1MA 4FGJA 1AKRA 5F51A 3NHKA 4HS4A 1XT6A 3NHSA 5TGZA 5LJIA 2M6RA 3FX2A 2QWXA 2QX6A 2V5UA 1H69A 1AMOA 2W5UA 3OX2A 1ZWKA 1J9EA 3FW1A 5LLDA 2XODA 1C7EA 2MT9A 2QX9A 3KAPA 4NLLA 2GSWA 3W79A 2ARKA 1AHNA 1RCFA 3RPEA 3FJOA 1JA1A 3NHLA 5LJLA 4C0XA 3HA2A 2X2PA 1SG0A 2QMYA 1XI2A 5LBTA 4QOHA 5ULLA 6NULA 2KLBA 2OHIA 2BN4A 3FNIA 1AKVA 1FLNA 3D7NA 2RG1A 4N82A 4S24A 3HLYA 4LTMA 5A4KA 4DY4A 1XYYA 3OVMA 2FLVA 4DILA 1YKGA 3QFCA 4Y9RA 2FCRA 4Y7CA 3B6IA 4N9QA 2QX8A 1D03A 4LAFA 5LVAA 3ESYA 4C76A 4BMPB 2KQUA
chains in the Genus database with same CATH superfamily
2JHPA 1DG1G 2WT4A 2Q3CA 4CUJA 1G1MA 2O7VA 3PF8A 4C5AA 2W2PA 3C5VA 1G2QA 4XRRA 4LQ4A 4D0LB 4HGOA 1VZ3A 1BCRA 1AHPA 3QIVA 4AFNA 2V6BA 4J76A 2P77A 3U3JA 1IXSB 1AKTA 5ENZA 1CSEE 1GAWA 4AJOA 4WNAA 4DR2B 4BO7A 3G5MA 5J4LA 2EX4A 1IZ7A 2I3DA 4JJ8A 1TUBA 1T0UA 3GFSA 3GZJA 4ZYYA 4AKGA 1RRCA 4R2IA 3PVSA 2F4NA 1RKVA 3EW7A 2AQ8A 3KJZA 2Q4RA 4YJFA 2YQZA 1GNSA 3GX1A 1PJ3A 5LNK6 3AETA 2OO5C 5IZ4A 1T2FA 5TJ9A 4BNDB 4L0DA 1E98A 1U2ZA 2M6SA 3O7MA 3VBCA 1E7SA 3H0EA 4NECA 1CY8A 3R7WB 1COWA 3FCEA 5CRIA 3VKHA 1FNDA 2XYVA 3A6ZA 1KPHA 5K2MA 2D13A 3RJZA 1ZCFA 3QNWA 1NJ6A 1BS2A 4A7PA 3DVLA 4AK9A 4OJTA 1D04A 5DNWA 3ANXA 1NLMA 3FTCA 3F3YA 3WTCA 3F6SA 4X85A 2H7VA 4R01A 1Z2OX 1MC1A 3WWPA 1IFXA 2V59A 5CNMA 4EPWA 4AQ7A 3PWKA 2R7NA 3M2PA 4CI9A 4Q7KA 3GT0A 2B99A 4OXIA 4ZYUA 1SVWA 4Z8XA 4UNRA 1A76A 1JJAA 1YQDA 4HVAA 1Z6PA 1EDOA 2A9RA 4XDGA 3VO1A 3EGIA 4AUNA 2VPZA 1W5AA 4EJ6A 1BN7A 1P33A 1IN8A 4BZXA 1RIIA 2AOXA 4P22A 1Y82A 5KYUA 3FZQA 3DO8A 3DFZA 2QIOA 4N8EA 3G1TA 2X42A 3OURA 3U80A 1QH1A 1GZHB 1RYEA 4MUGA 4IIDA 5IDYA 5HTOA 3K9GA 1S9DA 2P9QA 2ZAYA 4L9SA 4XASA 4YAWA 1BMTA 1PWZA 1XCLA 3H2IA 3JALA 3IRVA 4PLWA 1LSJA 2WPDD 4B7CA 3FSRA 4H0NA 2OUIA 2Q41A 3HV2A 1SQ0A 4BBAA 1P9LA 2WW8A 3BGDA 2UZ1B 2W6MA 3HH8A 2IHVA 5KJ1A 1EYZA 3X3HA 4FNMA 3NHAA 4O2AF 1ECPA 1U8TA 1C7QA 1MEEA 1MVLA 2PSSA 1L1FA 2O8DA 4QJ3A 1XXLA 4C6SA 2NTJA 1CD5A 1O94C 1QHXA 2XYQA 3DC7A 2I87A 4GG1A 4I14A 2XEXA 4BKUA 1TAHA 1HLFA 2RI1A 2HRRA 4YRIA 3K8QA 3LYHA 2FJ0A 4KITB 1FSZA 4K81B 4RU1A 1REQA 3OJWA 4ES6A 2P4HX 5J2TF 1DT3A 2N3ZA 2WJGA 3LW7A 1MV5A 1XNGA 4NU6A 3ZU4A 5K6AC 1DXHA 2IYXA 1E3DA 1X9IA 3DPIA 2HLDD 1KJNA 3KLBA 1QVVA 3HN2A 1JF8A 3EFEA 1XAJA 1T8YA 3LD9A 3K1YA 4RSMA 2WK1A 5DYGA 3ZUPA 1H05A 1W34A 1XLVA 2JIQA 3DV9A 3WJ1A 4KIGA 3ETNA 4LDZA 4UVEA 1SOAA 1UBUS 4F04A 5CBPA 2ZREA 3NT4A 3TDKA 2EARA 1K4KA 2C42A 3FSEA 3VTKA 4DV7B 5GTDA 1FLAA 4O4HF 2QDXA 1WMBA 1XYGA 1AKMA 2J3IA 2VT7A 3FJ1A 4FHDA 3TLCA 1G8MA 1ZSYA 4H35A 4YPVA 1AA9A 3F5FA 3P9PA 3FKSA 1C1YA 2ZTSA 2D2VA 2PM8A 3E3MA 3EK2A 3AVPA 2A1TS 2OC4A 2ZE8A 4AG5A 4ZODA 1H2HA 4HQNA 2F8SA 4IEIA 3W5HA 2QR5A 4JB3A 1PZEA 3L41A 1AQIA 4NCHA 3E4CA 2CBXA 4YV2A 3GLIE 3NV7A 1NURA 3OI7A 5HCIA 3Q7TA 1KE2A 2ANBA 2NX2A 4MYSA 4BE7B 2CNLA 1VCHA 4NYIQ 4FSHA 4X8LA 2LV8A 1V35A 1I0IA 3ZJUA 2J6HA 3DEAA 3PNSA 3U3RA 2ZITA 5U1PA 4ALJA 4EY8A 2GKSA 5AJWA 3LHIA 1VMEA 3FBGA 3KQKA 3TGLA 1JKJB 1I2AA 5K0ZA 1L7MA 2HMVA 2NTNA 1FSSA 2HRDA 4MS3A 4EFLA 2AG1A 4COOA 5CEEA 4YXWD 4IHKA 1QHNA 2E49A 5E2IA 5LMCA 2RHWA 5D7BA 3PYXA 3I76A 2RB5A 1NLUA 1YIAA 3LECA 3LCMA 2QN7A 4Y2SA 2WAAA 4CCYA 1RYBA 3W5BA 2REOA 3ZG6A 2WV7A 2P1RA 5C35A 2VP2A 3L77A 2Z8ZA 3F3SA 3EGVA 1R0LA 1AGRA 1DTWB 4LJ6A 4OXRA 2XLCA 4QLAA 2CCKA 3UT6A 3GO4A 1VBFA 4IG9A 2JIZD 3VAYA 2W2NA 3MUNA 3BCUA 3MCVA 1PT8A 1T8SA 3E6AA 4LX8A 1WXHA 3AMVA 5LWHA 3UB2A 3O73A 1DXOA 4P7KA 1THGA 4IIHA 2D2FA 2B5WA 2ONKA 2R6DA 1EDDA 4F3KA 1XMIA 2HPHA 4GXNA 1O5OA 1SVOA 4WLOA 5B5SA 1BDHA 2HU5A 4WLEA 3GI1A 3OE5A 4H4DA 4AX8A 1J9ZA 1Q0UA 2J4FA 1EP3B 1O54A 1E92A 3JVDA 4FDUA 2QD5A 4IDCA 4DR5B 1XR3A 3AFGA 2JFUA 3ME5A 5T8KA 1QP7A 4S12A 1L4NA 2MINB 5LYJA 1U7HA 1J1UA 4RPCA 4BLSA 4LXTA 4WY5A 3HUTA 3BDIA 3IQXA 1TNDA 5T8KC 5THQA 4DABA 2W6JD 5CB0A 1GKUB 1MPTA 1X1QA 2NAPA 2OCAA 4RZQA 1AS0A 1M1ZA 2H85A 4QT0A 5ILOA 4C3UA 2VAMA 2FFHA 1V5EA 4AUMA 1DSSG 2ZVQX 5TVGA 2DRIA 5DB4A 2IV7A 4DGQA 4BASA 5WRFA 1IHUA 2AFHA 5T6MA 1DBIA 1VPLA 4ZI7B 3DM5A 1J56A 4JFAA 2JRCA 5C1BA 4K86A 4JKYA 5CNJA 2DT8A 3RVBA 2RCYA 1CJTC 3KKKA 3I8SA 3E7DA 1XP5A 1ONOA 2CXQA 4P4SA 4MGEA 2D06A 4TL9A 1AU9A 3C8ZA 4I46A 3M82A 4ECEA 4HNVA 3OTGA 2XKKA 1HDZA 1N7JA 1W2WB 4LRUA 4QUAA 4Z4QA 2ZJ4A 1N2EA 2DMRA 2WZBA 3JTEA 4ZGGA 2YS7A 3F9IA 5TARA 3KTOA 2IPMA 2WUVA 3S2UA 1Z75A 3IKJA 3JSXA 3L9WA 1LFAA 5FO0A 4BMVA 2XB8A 5KNBH 1DBSA 4TMZA 3E58A 5KVQA 2O8FB 1MJFA 1HA3A 2QZ9A 3OQ6A 4I4IA 4X7BA 5EKTA 2E7ZA 3PDUA 1YFKA 4JJAA 5G1PA 3TLJA 3VTFA 3RLFA 4FMCB 4MYRA 3MLBA 2YXDA 1DX4A 1VHTA 3AUTA 1IYZA 2XNSA 3IMGA 1WW3A 5LWQA 3BMOB 4ZPJA 5AOAA 5DGTA 3ZYCA 3GAFA 3UMRA 3VPFA 5KNLA 3CCBA 1E66A 1UXHA 3WGMA 1WXWA 2M1ZA 5DCUA 2PE5A 2A92A 1OW3B 4HLCA 5IZCC 2VUHB 1DMSA 1I33A 1RYHA 4QO7A 1R5JA 2DX7A 4U5QA 4KQWA 3H5VA 5HJ2A 3UJDA 4G8BA 4FB4A 4K5QA 2V7VA 3KSUA 3OX4A 1DELA 1XDSA 3U3MA 4XWOA 4GBMA 4IINA 1WB5A 4Q9DA 3WHKA 4ZOLF 4E21A 4EJSC 7YASA 2IEDA 4WT7A 4XUGB 4CKEB 3K6SB 4HNHA 5BWCA 3EN0A 4UULA 2YR0A 4QSMA 3E5RA 4FT4A 2HAEA 4C7BA 3IHTA 2WY2D 4OHRA 5I3CA 5JAMA 5JT1A 5IK2D 2EZ9A 4JKOA 4F86A 3EULA 1EVQA 1LDNA 1XCMA 2C82A 2Z2YA 4DQVA 2O8BB 1ZRMA 1TL7C 4I9FA 1E9CA 1OXMA 1KMIY 1ZJJA 3EAFA 4Q66C 3AY6A 2GLXA 1HE3A 2D0PB 2RC5A 3GDOA 1CUUA 1QIIA 3NLLA 4HDOB 4OBEA 4U0JA 4HTFB 4DDKA 2DBRA 1PUJA 2V65A 1JR4A 4XB6B 3VYSB 3N7UA 4J0HA 1N2GA 3I9JA 3KZCA 3OZXA 5JE8A 1QHGA 2BKAA 1C8LA 1UJ2A 3G9UA 2PJRA 1DPGA 5FPSA 3WIVA 5E2BA 4EFNA 1XVIA 4TXJA 1M8PA 3IEIA 4ND8A 1E0SA 3H2BA 2WMYA 2V1XA 2X6TA 3AR2A 3BOSA 3DCJA 5BN1A 3IH5A 5F9HA 1DQNA 4OOEA 3T0GA 2QNRA 1R6VA 5TT1A 3THXB 4PZCA 1Q6YA 2A9FA 3ZE8A 3HTXA 2YHAA 4BCBA 1E59A 2FDRA 1UK8A 1QWOA 3DUFB 5EHIA 4AYTA 4D0SA 4OI4A 4HY3A 2P5SA 2H63A 3EZLA 1P44A 1Z35A 1C4KA 1PFGA 2NUTB 2VLIA 3FCAA 4HEHA 4MUAA 4LHYA 1DOHA 4J94A 2B8WA 2N1BA 5AW3A 1YJQA 4YO8A 1KYQA 2VXBA 1E0JA 3P8ZA 4OU4A 4OEHA 3L7YA 4EF4A 1E9VA 1VBNA 2QVGA 3OD5A 4UE3S 3M6WA 5IP5A 1TZMA 4US0R 1PHPA 1QO0D 4BQSA 3ABZA 2FU5C 1MDBA 3C3EA 1XZNA 3CM0A 4YRTA 3JS5A 1I14A 4WX2B 2I7DA 2LDBA 3RIYA 5JDIA 1UBSB 2N47A 5BQXA 1UJNA 1PFYA 1TEXA 2JKYA 4V0KA 5TIIA 1U1FA 3OOJA 2V7UA 3UJPA 4HH1A 2O48X 3DFUA 3DEZA 3LCRA 1ZO8A 1EWTA 2IYNA 4J0JA 5J4VA 1T4MA 3OOHA 2JIMA 1QC5B 1MNQA 1B2LA 2EVWX 4G4JA 1A9YA 2NQ2C 1CY4A 1C9EA 5F7ZA 4B84A 4FX5A 1GU0A 4KH1A 5A0FA 2KE5A 1CIJA 3RV3A 3ZS8A 1JZSA 4B2PA 4GPD1 1T5DX 2C78A 3CSDA 4RTJA 4U7GA 1JG6A 3W5SA 3FMPB 1SO8A 2B78A 1ZH4A 4M0PA 2R6CA 1RI2A 1NT4A 5TPZA 1E6LA 5DYTA 1Y98A 1QVAA 4PINA 5T6BA 4F0JA 2JHFA 2CLHB 1ODIA 5C4GB 4FMDB 3F7TA 1JB1A 4CF4A 5F7XA 5HJEA 3I23A 4QG7A 3CO0S 4RH1A 5CTAA 1QVWA 2DQ4A 3HCOA 5JRJA 5KOHA 3BXGA 3U62A 2RGNA 3PB3A 2X2FA 1P60A 1T3TA 3OQNA 1FW6A 4NBWA 1FDUA 3A0RB 2ZE7A 5EXXA 3C7KA 4F4UA 1XZEA 5LLDA 3RFVA 1UEIA 1A5TA 3L8MA 3PGJA 5DSTA 5LP6F 2RK4A 4M0UA 4M1ZA 4B3MB 3KLOA 4K2AA 4RKYA 4WK4B 4RUKA 1OLXB 1ZM9A 4L07A 4RAOA 3G5TA 4TV9A 1OILA 3W79A 1SU4A 1OFHA 1TKAA 1HFJA 1H1LB 5D2CA 1MBZA 2BR5A 4M1KA 3Q88A 5G02A 1G8YA 3BGVA 1QFYA 4IWYA 5CYOA 3IAS6 1K75A 2I54A 3QIAA 1U1IA 3QXCA 4HBGA 4Z1MA 5JYDA 3CX4A 2CF6A 1J7KA 3EGDA 1V8DA 1Y5IA 5SY6A 1EMDA 3T3DA 3MCAA 5HIKA 2NZ8A 3QHAA 2V4MA 4Y2RA 1FSFA 3EPRA 3PDJA 1NRXA 5AHOA 4WESB 4OXQA 2BP7A 4UU0A 3V6MA 2JFFA 1U1GA 2XMGA 3ZDBA 2R86A 2Q0XA 1N2IA 3ZZNA 1UIMA 3U37A 4GPBA 5EP2A 3VVMA 1T9HA 4BQQA 4YAIA 4AZ3A 2O6LA 3TD9A 3VYWA 4NYJR 4XPZA 4Z8YA 1N5KA 3LHSA 2AQIA 2H7CA 3PKZA 4DFDA 4UDYX 2CHVA 5AI9A 3WWDA 3ZD8A 3NBQA 2X8LA 3OUUA 2FZGA 5JH7A 5JMTA 3H8JA 1D9XA 1MPXA 3QKTA 3QBEA 5AJTA 4CTKA 4C04A 5HGXA 5JSQA 3KZOA 1O6GA 3A25A 2EKLA 3AM1A 5KJ6A 2VDLB 1DDGA 4LDJA 1NULA 2ZYDA 3TKLA 4K6CA 4X64B 1NDHA 3DDNA 3VZBA 1FX0A 3E7FA 3KQHA 1HUQA 4QOSA 2RMKA 5L4NA 2PXAA 1HLPA 3KZ1E 2WU8A 3HGMA 4IPTA 4TTAA 5B1DA 4BEVA 3HB4X 2J0UA 5CDYA 1KFBB 3ZI0A 3CKKA 2NTYC 3E53A 4QICA 2O07A 4HDKA 1NF8A 2WVHA 3AB3A 4RFLA 2BHRA 4CV0A 5LM3A 3N0TA 3ELYA 1Z37A 4J4BA 2GF0A 4BLOA 4YJGB 1G7SA 4GLBA 3O4IA 4TUYB 3WZLA 1XFDA 3JVIA 1SXIA 4MPTA 4MDYA 1P4JA 1Z5ZA 1YJAA 5SYNA 3LY8A 4Y1RA 2R0QC 3M1LA 3PUWA 1SRRA 2FEOA 1U2DC 4ARVA 3TSAA 1BWSA 5F5NA 5JD3A 1VIYA 1VE1A 3K31A 5EXEA 5TQ2B 3Q9SA 1RXWA 3QPUA 4NZZA 3A4IA 1YOVB 4EDFA 4LJSA 4EVRA 3OJ0A 4KX5A 4OA5A 2PMFA 3S70A 5C7OO 2D7JA 5G40A 2AGVA 5AVZA 1TM2A 2O3JA 3A2LA 2PRYA 4EJMA 4H1UA 3RVOA 3VSBA 4DJJA 1HMYA 2KQUA 2ZBDA 4KK3A 3SC3A 1IU9A 1U0GA 1PNVA 3GWZA 2VF7A 1ZISA 1KSHA 1DC3A 1HG1A 3IGFA 3LBAA 3U4HA 3RAFC 1UP4A 4W4TA 3SJAA 2REQA 2DGDA 4YPFA 3M81A 1GR1A 1KOJA 5GJCA 1FNSA 2YWFA 4DADA 3QEBZ 1UFOA 1ZDMA 1U2SA 4BX0A 4JXZA 4D97A 4FGSA 2BGUA 3GUHA 2XA1A 1TAGA 2OHJA 4PR0A 4WXHA 2BSQA 3VU9B 1FSGA 2AFIB 4I8IA 2GYWA 2KWIA 4PLCA 1UZLA 3DL4A 5H1YA 3T9DA 5K99A 2Z5VA 1QDEA 4FGWA 4IICA 4MVJE 1J07A 3L0ZA 2IDZA 4OL0A 2PKYX 1TA9A 3WNCA 4E31A 2J5RA 2GZMA 3NANA 4YRFA 5F1KA 5AHRA 3WGTA 1V71A 1Z6ZA 1CZLA 1TIBA 4NL4H 5KHLB 5ITZA 4C2UA 1JEAA 4GE3A 3KEGA 1RKUA 1AZSC 3OFKA 5CYPA 3QMWA 3U4MA 3JAMA 1G5TA 2M2IA 1K9VF 2JLSA 2ZK7A 1N9GA 4WXYB 4YWHA 4MW7A 2BLNA 4R84A 1MX9A 1A69A 1I7LA 1CT9A 1TEZA 2OYSA 1EHYA 3GD5A 4PG8A 3IEKA 4ATNA 1NJ1A 5D87A 4RCYA 3CT4A 3PTAA 2M6LA 1SZPA 1ZVQA 2VUIB 4HGZA 4EGFA 2WSYB 4JLSA 1WR8A 1GUAA 3D8SA 5F4BA 3TQOA 4N7MA 4A0RA 1A77A 1QH0A 1RYMA 2AHRA 2PBLA 2PUTA 2XY4A 2FZCA 3RSHA 2BM8A 3WK8A 2QTVA 3IP9A 4DWJA 1YBHA 4B3CA 5M34A 3DDWA 3RU9A 1Q77A 3DOUA 3W5UA 1JQAA 3ILSA 5B7NA 1DLIA 5BNTA 4G0UA 3OPMA 2W48A 1WCIA 2ENUA 1RR6A 1UM9B 2AUMA 3DWFA 1TUIA 4L7VA 4REMA 2P90A 5FJJA 4IQ0A 3UTDA 3ODPA 2VOEA 1NJSA 1HQCA 4ZHQA 4RY9A 1SBTA 1IG0A 2ECFA 2PL9A 4HDMB 1N5OX 4ZCMA 1KZ1A 2FP3A 3CXUA 3P27A 4DCTA 3IUBA 4TRJA 3ZIDA 3N86A 4MCIA 4KWHA 1YI8A 4I1VA 4UVGA 4EUKA 5MGBA 1HR0B 2PT6A 1JG7A 1ADCA 3NVKI 4HNQA 2AWOA 3DBOB 4JP5A 1CP2A 2RHHA 3JV7A 4TTPA 4NY1A 3T1QA 4R2KA 3W05A 3ZHBA 4D9CA 1I3LA 1AE1A 1I2MA 4JJ7A 3SJCA 1LJ8A 1QE3A 4HWOA 3VHXA 4BLQA 3MTBA 2QTGA 4RQAA 3HCCA 4BP9A 3TM5A 2R1ZA 2Z1DA 4KN9S 3EEYA 2GMWA 2OD2A 1E1QA 4QXAA 3T5TA 2QY6A 2VHCA 1S6YA 4UC0A 4I5EA 1OFUX 4RPGA 3MMPA 1NRWA 1RQ2A 2QP3A 4EHFA 2AXPA 4L4ZA 1EGVB 1VI2A 1YONA 1H4VB 1YA6A 2RKOA 3E9NA 1OPRA 2FPGA 3F71A 3IMCA 3KYCB 5E0OA 2A7QA 1QRUA 1M8GA 4I4CA 3OM8A 4UHJA 3I1FA 4CKZA 2E4XA 4TSRA 4ZO4A 4OQFA 2QHXA 4AJEA 4KQ6A 4L95C 2OEPA 3TKYA 3T0IA 3JYHA 3Q1LA 2ZRGA 3F5QA 1P1FA 3ND6A 3FNHA 4M3NA 5HKLA 5GPBA 5A4AA 3CONA 2M9MA 2HCJB 5D7NA 3JD0A 2H48A 3C6QA 3ZE1B 3T1OA 4DV1B 1SKMA 1O94D 2Q6OA 1W36D 1Q7EA 1XEAA 2YH2A 2ZDQA 1PR5A 3ZJTA 3SICE 3FBWA 5IVHA 2FW8A 4B6QA 3I2KA 4OHUA 3JU3A 4KQMA 4PSVA 3ND7A 1WETA 3V1LA 1ECJA 4BNJA 1EWQA 4JEMA 4BEWA 1LSSA 2J0EA 2QGFA 5KYWA 1VECA 3SSOA 1BS1A 2GPTA 2VAWA 4FYMA 4MYTA 3W04A 4F4FA 4FQ8A 2RHMA 2DJIA 1ZA2A 1X7ZA 4JBNA 4S1NA 3ZY3A 1T25A 2EU8A 1TI7A 1V16B 1WX1A 2QQGA 2ZB2A 1XIVA 3ZQKA 3LWNA 5KQLA 3A9SA 4XQ0A 3JQ9C 4O2AB 3HU2A 5DO9A 5LPNA 2WVAA 3HZOA 1JHZA 1FY2A 1ZGAA 2QX4A 1UFVA 1QYCA 2ZR8A 4IS2A 3ZCTA 4CHGA 1KQ3A 1M3SA 4HUQB 3M9LA 1PX0A 3L92A 4JBYA 2OXRA 3HJTA 4LCBA 4KX3A 5T4EA 3RYIB 1XC7A 4YP1A 2RHJA 2WTMA 2VCEA 1IXKA 4OXXA 4W6ZA 2O8EB 4L0CA 2GN0A 2MSCB 1GPJA 3HCWA 4O2BB 3C7AA 3MFYA 4ODIA 4H18A 3LLCA 1EXVA 3EDRA 4IYJA 3QHPA 5KYYB 1WZCA 4WKBA 3K71B 1RADA 4HFJA 3IVGA 1Z0AA 4GMXA 3FB1A 4ON9A 4BNYA 3KAJA 1ML4A 4YRMA 5HS4A 4XYMA 3FPKA 4CMEA 1GARA 5JDCA 3W2FA 3L0SA 1EX6A 3CF0A 4OQEA 4Y1GA 3Q6NA 1PQWA 3A3OA 3OU6A 3RTAA 4RD6A 1VLMA 4WBXC 2OQVA 5REQB 2QVLA 4P4LA 1DUSA 3QVMA 1XA0A 5C18A 4CF7A 1XTUA 3F46A 4CMEC 1V5FA 2BZGA 3REFA 5IWCA 1RJ9B 4KACA 1PK7A 2CGEA 3IOEA 1M2OA 4N4AA 3ZWAA 3COJA 4P0QB 1KTVA 4CR8A 2D74A 1WSAA 3MRSA 1OH7A 1JIUA 1TJYA 4IZOA 4LGCA 4UCQA 2Q1TA 1J0AA 3DMTC 5CVUA 2TECE 1QJ4A 3G5LA 1ZBQA 4UEWA 3UG6A 5AFSA 5J5CA 3SZOA 4FYYA 4MI6A 3ZHZA 1NY6A 2PU5A 1C0IA 2Z6AA 3LBNA 3BIFA 1EK6A 3H11A 1XZBA 2BMAA 4RKWA 1J4AA 1TVEA 1XQVA 2A9OA 2GD6A 1JVNA 3AH8A 5DTJA 1MU0A 4MDHA 4G5RA 3ASYA 3Q7PA 4LHWA 5L4SA 1C3VA 4Q00A 4ZVVA 1L5OA 3RW9A 2FSVC 3L0DA 3W90A 2E4AA 4KPUB 3DCIA 2NUPA 3WY9A 2ESRA 2IX9A 1R9GA 5AKGA 4C4AA 2H08A 1JSRA 1SBHA 1NVVQ 3G82C 4IDPA 4F91B 1ZKDA 1ZRHA 4D9HA 3BAZA 2G0AA 2NTEA 2UZ4A 1ABBA 4DSOA 1SEPA 1KJJA 2CDBA 2EDCA 1IH8A 4PAQA 4QD3A 1KVRA 1PL8A 4NJEB 5JQGA 5BYAA 2COUA 1OXKB 1IOVA 1LU9A 1ST3A 2J5QA 2PSDA 2X7XA 4YR9A 1K8ZB 4LI3X 2XNDD 1JDTA 4INOA 2KYRA 4L50A 3HJGA 4JEIA 1E6WA 1XRSB 2OZLB 2ZJ3A 1IUPA 2OCPA 3IDOA 4FEEA 4DT1B 2P9TA 2AN4A 2BMFA 2QN3A 2FEPA 1RSZA 4MUJA 2MYUA 2HWXA 4JL5A 3WDMA 1BHJA 2C7BA 1G42A 3RQIA 4XWTA 2CDAA 4TQ9A 2OR3A 3TG8A 3PDHA 3ZR4B 3JWGA 3WWYA 1CJMA 2E6KA 2PS0A 5AHWA 3T3NA 4K3UA 4DVGA 3NO4A 1QH8B 1Z22A 1EX1A 3FETA 4J0GA 1P0QA 4MLCA 1RXVA 1A9ZA 4EYSA 1YFLA 3DOJA 1F2DA 3LY7A 1OFVA 2EFCB 2IZ1A 4G23A 4R68A 4E5PA 2IYVA 3BGIA 4UHDA 5A9SB 1DBVO 1KEEB 3H4IA 5EPEA 6LDHA 4LF6B 5EESA 3RFFA 1UOEA 2W6CX 1IONA 2X9NA 1OKKA 4RHUA 2J3QA 5IPFA 3ZC3A 1UBFA 2GAFA 3OIDA 2GBGA 4KUEA 4Y6GB 3DMGA 4MPPA 3UGJA 2IOFK 1YSCA 3H9BA 5D8DA 4S1PA 1EFAA 1QUFA 3GGCA 4BRWA 1GKYA 4F8YA 1SCJA 1SVUA 2BGRA 1TMOA 1FDSA 1G6HA 5KX5A 3DZJA 4ZKDA 1NYQA 2HBZA 3SBXA 2OHOA 3KR2A 4G0VA 1SG9A 2XMDA 1MZPA 3W7AA 2P75A 5BMVF 2NYRA 3QI7A 4LXHA 5JANA 4YHBA 1HYEA 2B8NA 3SEFA 1TM4E 1Z07A 1TJ4A 3F49S 3ZZUA 3AM3A 1A8UA 2ZVJA 4HG2A 1CUEA 2F3TA 1TLTA 1FE8A 3AUAA 3QWHA 4ZJZA 1Z7WA 2WR8A 1GPWB 3DTVA 4MH0R 5HILA 3RAPR 4AZSA 2Z1NA 1BDBA 5BRNA 4XD7A 4EUFA 4K6GA 2VTDA 3I4LA 4FGUA 3LZCA 3NIBA 5F9MA 2D5IA 4WOPA 4D8WA 2C4NA 4XA8A 4EJSB 2WF5A 1MDFA 4B47A 4DW8A 3EG5A 4WZBA 2IT1A 2QU8A 2CKMA 4H6WA 3AY3A 4U9HS 1NBWB 2ACEA 2BZ1A 2QD1A 2YFHA 2R84A 4DCVA 1GA1A 2FN3A 3A9RA 3L6BA 3OT1A 3CY6A 1I1QB 1KKLA 1G0NA 1STOA 3B9QA 3IVXA 4R7GA 3TLEA 4CMBA 4EHNA 1KAHA 3SS9X 2Q7DA 5L40A 2OFPA 1NQOA 2Q3EA 4HLQB 2RB4A 4B3FX 3FPEA 3PNYA 1M6WA 1CIVA 1HBJA 1SOMA 4Y8VA 3QOYA 4H9GA 3AJAA 4DV5B 5IABA 1H9AA 4ZOLB 1E2DA 4LSGA 1VRCA 2IYWA 1P9NA 1TZJA 3MWGA 4IGIA 3ZBPA 2GXQA 5E0KB 1VGVA 3QF4A 3FR7A 3TX2A 3D54D 1WXEA 5ALTA 4KQXA 1T8WA 1LTQA 4W7IA 3KLNA 1ZOOA 2D7CA 3MQ4A 1NWCA 1WS6A 5CH5A 1MFZA 1JZTA 3C74A 5ESDA 5K3SA 2H2HA 5CFLA 3D9QX 4PLTA 3PXAA 2YWRA 4Q02A 1ZGCA 4RGQA 3RSSA 5HOEA 1UK7A 1EWKA 3LFHA 4IIUA 1Q3TA 4LOIA 4TWBA 5DISB 5H02A 3CUUA 4D80A 2HA0A 4TV8F 1Z6TA 1VXOA 1W19A 1P4SA 3M0EA 4LRTB 1G21A 1POXA 4FCCA 4H08A 4S1TA 4YACA 4RTPA 2I3GA 1QZ3A 1V4NA 4IRMA 1WRBA 3PGXA 1Z36A 5J40A 1J21A 1EJ2A 5HOQA 1R7RA 2C88A 3MWKA 1K89A 1XHLA 3R9IA 5KNDH 2G8NA 1ICIA 1Q44A 1RHRA 2I4TA 2BMJA 1NFQA 4MMXB 3IMKA 3A11A 1QFJA 4M6WB 4F3YA 3HZHA 4NQRA 6ABPA 1BCSB 3BJEA 4N6OA 5EIBD 1ZN7A 3GP8A 3DW3X 4LWZA 3PA6A 1KRWA 3CNLA 3LC0A 1OYYA 4E07A 3QLVC 3D0KA 2GQ0A 1NNEA 1T6XA 5BSFA 1BJKA 3J7TA 2FF7A 3EY9A 2TS1A 4ZRDA 1KC3A 5CDSA 2D2EA 5JZSA 1VLLA 4TPKA 3F67A 3W8RA 2YNMA 3A1VA 3STHA 4HUJA 2GUWA 1QSGA 2VVTA 2B9VA 4INJA 3ZJ5A 2G9NA 5LDHA 5EJIA 1BHQ1 5F3WB 1FMJA 3LM8A 1WLSA 2OV2A 3LXXA 2CFCA 1X0VA 4KQKA 1HORA 1RCFA 4P32A 4KLCA 1QRSA 3WRYC 1TE2A 1JR2A 1TYEB 4QXOA 2YNMC 2IS4A 3FGNA 4QHTA 1K8YB 4ARZB 5C5IA 3HPRA 4MRPA 1PR3A 2CXHA 3X1KA 5HJ5A 2X23A 1PJQA 4L9WA 1DINA 1ZVKA 3LE8A 4QYSA 1ZHHA 4HMPA 4MV0A 3ZGXA 4DA6A 2JFXA 5LFAA 2A9PA 4AM8A 3KPWA 2HDOA 4RHCA 4N3BA 1DHTA 3E9ZA 5AK5A 4I50F 4LHSA 2XYGA 5EGSA 1CLEA 1J06A 2X5OA 2YJ3A 4B83A 4TKVA 1XQYA 2ZZMA 1TT5B 3ZY5A 4CRWB 1DBWA 3BCSA 2AZMA 4QLOA 3WBKA 4BGEA 4RGBA 1RMQA 4A8PA 3AGPA 4H4CA 1G64A 2Y1EA 3R8XA 3H97A 1B7GO 4JXJA 4X3PA 1ECGA 2JFPA 5JWOA 5KU7A 3DNMA 1P2UA 3HRKA 3NOQA 2OVBA 5BSHA 4OGLA 1AGXA 3UIEA 3FPFA 5JYCA 9ATCA 1WPRA 2CNOA 2AJTA 4TRRA 4CG2A 2JCYA 1YC5A 2KLBA 4HV4A 3EXG2 2OHIA 1KEVA 2XOXA 3WX0A 4ZCIA 1PTJC 2JI7A 4JUDX 4UMVA 1R0CA 5IDWA 2AF3C 1R4MB 1B93A 4I4TA 4P81A 1JQJC 3V2UA 1BHO1 2O50A 3KQPA 4AJ9A 5LP6B 3KQVA 3OZVA 5CPBA 3WKEA 1VG0B 4U00A 3REOA 4AKSA 2R1TA 4REQA 1MC4A 3R3JA 1NPDA 1R5BA 1P62B 1X1SA 2E1PA 2EYQA 3AIKA 3K73O 1B42A 4QU8A 2WFLB 2I03A 4HZUA 5KKCA 3LKVA 3AX6A 4GOMD 4IIJF 4BV8A 1S2IA 1RXIA 1DI0A 1JLRA 3GEDA 4FD2A 5EHQA 4HAWA 1LK0A 4M9RA 1WZNA 2NO6A 1EX9A 4PXSA 2X7HA 3CRMA 1A7KA 2E4WA 1JSCA 1G9XA 3TOCA 3SC2A 4I1OA 5LQSA 2QVCA 3Q1KA 3QSYA 4NBKA 3B2QA 3LO8A 2PANA 5CU7A 2AKEA 2ZBUA 3I5UA 2BY4A 2FG5A 2VJOA 3UQYS 3IKMB 1V25A 2ZUCA 3DVQX 4Y0NA 4CDRA 1MX1A 5AKXA 1ULAA 4GAEA 2WP0A 4M99A 1WF3A 1QQTA 3OQOA 4L8WB 3KUCA 3WL8A 5C80A 4J49A 4Y6OA 3TNDA 1KI7A 1KKMA 2NQ8A 2Q1YA 2X76A 2Q21A 3FVQA 4J91A 4YH1A 1P7CA 3QE0A 1IAVA 4RIGA 2L0XA 4YP5A 4LKRA 4ZYXA 2J8ZA 4JR2A 4Z86A 3ZY6A 2G17A 3E9QA 4ZAVA 3OCVA 1H5NA 5ALGA 4XCVA 1JHDA 2V7TA 4DWOA 3QNUA 4PRLA 4KWTA 4OL9A 1KI2A 2FUKA 1IEXA 1V96A 1XRQA 2IOHA 5ALWA 3O8CA 1SN7A 2SICE 1COZA 2G08A 3VR5A 1AZTA 4C7JA 2PMCA 4QJIA 1M2NA 3OZWA 1U8FO 5JADA 1AUVA 3CCCA 1B6SA 1EAMA 3L82B 3TOZA 3B9RA 1AKQA 3UWKA 2XOEA 1UWCA 4Q7QA 3NVAA 1D5WA 2AJLI 1E62A 2ZZNA 1K5DA 3LFTA 3R77A 4GECA 1RQXA 2B30A 4GQAA 4YCMA 2WUDA 1DKOA 4L0MA 3T7KA 3SYKA 4C5BA 4CV2A 4OUDA 2B92A 1WOMA 2F43A 2ZI7A 5B30A 3OCJA 3WLTA 1U99A 2D5LA 3GLGB 4R41A 1IOWA 3IIKA 1P8AA 5AYVA 4KLRA 3DAYA 3MTGA 3SQOA 2FFBA 1ZSNA 2B61A 3L7MA 4QODA 5CM9C 3ECCA 3RDPA 2BEUA 2MTBA 2H06A 2PZFA 4GHWA 5JH7F 2A0YA 4LQLA 4W1SA 4H3SA 3EDMA 3BRWD 1GD1O 4AG3A 2CFRA 4DXAA 4RTRA 1N6HA 3UJ8A 3AF2A 4OUKX 3F6CA 5JCPA 1Y1LA 4KO8A 4ZVNA 1ODKA 3CGWA 1OLOA 1RE0A 2CUTA 4JBGA 2DUWA 4OYRA 2J3DA 3RC8A 2HF2A 1P2VA 1E4EB 1T1IA 1Y8QB 3D7SA 3BGOS 4GE0A 4RKEA 5AOBA 1KMCA 3KFXA 3L01A 3O3MB 4EKGA 4S04A 4KP7A 4DCSA 3QVKA 4JT9A 4URZR 4PBRA 1XE3A 3TEFA 2QPTA 1ILWA 2QN1A 5LBUA 1Q15A 5LD2C 4IV8A 3P7MA 4K9SA 4JASB 1G21E 1ATIA 3LP8A 3DB2A 1M7GA 3G5AA 3HSSA 1JA9A 2PNFA 2L19A 3ACCA 3C3YA 1J0DA 5HZGA 3WMEA 2R79A 3HB1A 2HCFA 1GOTA 4PU0A 3F74A 4Q3NA 4IKPA 4N9WA 4L02A 4B6FA 1P29A 2XH8A 4PLFA 5HQ3A 4G1VA 2FPMA 3ZDCA 1PT6A 4L5YA 1GJRA 4JVSB 5U4XA 10MHA 1U0TA 2IPAB 3T7JA 3TQRA 1PT9A 3C45A 4MB6A 3G17A 4PGFA 2H8KA 1OI3A 2AJBA 3DO5A 1CY7A 3UMBA 5A6SB 2FZVA 1F6DA 2G36A 3NNDA 4M21A 5KJFA 1JPNA 5LSAA 2GPSA 3ADBA 1FYXA 1U80A 5A2QA 1MIOB 4C08A 4DC0A 3L6RA 4YFVA 3TH5A 1Q7RA 3WO1A 1ULUA 2YDXA 2F59A 4C0HA 3MWYW 1P0MA 4V1CB 4C2TA 5H70A 4BFZA 1C1XA 4FGKA 5JHGB 1XKQA 4UFNA 1FNCA 4HEA1 2DULA 4CU2A 4P34A 3BXEA 3C8HA 4FN5A 3FCUB 1M2VA 2CDCA 3U4QA 2XNJA 1QIFA 7GPBA 2ADOA 4G4SP 1UWLA 4Y2QA 2XV1A 3ROZA 3VR6D 1POWA 4ZAXA 3SQMA 4D45A 2XADA 4CLOA 2GAJA 2G1UA 3K05A 1GTMA 2KB0A 2CJXA 3MRXA 4DL9A 4JOCA 4QEZA 2DSNA 2WOJA 2BF7A 3ECAA 3MT9A 4J1NA 4BNLA 1B2RA 3F4KA 3JD1A 1TTHA 4IDBA 4NNPA 1ESZA 5ANRB 5FBKA 4ZMRA 2FX2A 5JXWA 4URVR 4RGYA 3BDAA 5M7EA 5EXDA 3SD7A 2MCFA 2V9CA 4O0MA 2NO7A 4KXNA 5I4IA 1O5TA 1MZVA 3O1IC 1VHJA 3X1ZA 1XYVA 4N3AA 1ZEMA 4ZKEA 5B3JC 1YTUA 3PRJA 1WP9A 5DW3A 4E4TA 3JQAD 2VJAA 2FZKA 3IKLA 4QBTA 3B82A 4QEDA 1Q1GA 5FB3A 4BFXA 3WO0A 3FRHA 3IP5A 3A9VA 1Z4KA 3CKMA 3GDWA 3QHQA 4MW9A 4UQLA 4BVFA 2DSTA 1OE0A 2PA3A 1BJTA 4KK4A 4BMNA 4K1XA 3DE7X 1F2UA 3QVSA 4LMAA 2C00A 1D2AA 4PZEA 4UDNA 2A5JA 5AXAA 4JBXA 2ODWA 3WGLA 2JLAA 3O95A 4E6EA 5HUQA 2PXCA 3H5IA 4M1YA 4Q4JA 3F6RA 1FU7A 2PH3A 1AQJA 2G04A 1EXMA 4OLFA 4D46A 1AMNA 3OKPA 3QMPA 3LIPA 1EVJA 3IPLA 4UM9D 2C31A 3N0XA 4HBZA 4KGZA 3P2KA 4PO9A 4TKZA 1I1NA 3E4DA 3MMNA 4CM5A 4DG8A 1CPYA 2VOJA 4HB2A 3SNHA 1KNXA 1N0WA 5BRJA 2ZE6A 1QGUA 2FZ5A 4NZPA 4NCBA 3T7AA 2FPIB 3QV1A 5DBHX 3W0LB 2Z2XA 2FI1A 4JC4A 3GJ8A 4C3OB 5BUSA 2VTBA 1QNLA 3L93A 4YAJA 1GZUA 3QE2A 3P5BA 3H7IA 4C22A 4FB5A 5K4AA 1OQAA 3O38A 1FP1D 1EBBA 1ORTA 3GBPA 3RABA 4AN4A 2HRQA 3O6VA 1E9SA 1JHYA 4PS1A 1EZ4A 3JZMA 4YJ3A 1HT0A 1VTKA 3KAQA 3QE3A 2C5LA 2P9JA 3C3CA 4YQYA 1QYVA 4BIMA 4DIEA 5LU9A 2VZ9A 3ELDA 2A0XA 3NCHA 1KDTA 5EZSA 2VRBA 2BISA 5DLPA 3JCZA 4LYFA 1ZXLA 3IEVA 5FWXA 1DCKA 3D1JA 3T5MA 3CRW1 4TS1A 3RRBA 5JXJA 4B9EA 1CF9A 3V1MA 3QKUA 5A7GA 5JJBA 2F55A 2Z1MA 2HMAA 2OUKA 3G79A 4TMXA 1EI9A 5JNTA 1F7UA 3RREA 2HH9A 2WKQA 2HA3A 1IIBA 1HDCA 1RVV1 2IDKA 2XPCA 4KRGA 1JDZA 3WVNA 3D2CA 5FDFA 2W9XA 2AN1A 1H3FA 3NIWA 3V4PB 1IOLA 2GRJA 2VYNA 4FW9A 2Q8NA 2I33A 4FYWA 4WUTA 2PS9A 3OLVA 3UK2A 3ORFA 2XRYA 4BBPA 3ED5A 2D1TA 2QE7D 1Z0IA 3MS2A 3R6LA 4N6GA 5JS2A 1GZ6A 2C58A 3UC9A 2D00A 1I6LA 2VDPB 1YH3A 2V3VA 3K9CA 4BRUA 2FMHA 3O93A 4KXQA 4W5QA 3DMNA 5C8ZA 1K7XB 3Q8WA 4B7UA 5I4CA 2A33A 2WJPA 3IJRA 1S3SA 1GRQA 2J5XA 4B80A 1JZQA 1Y3IA 3D7LA 5HM6A 1NMEA 2C29D 5HMLA 3AVUA 1WMEA 2ZJZA 3A6JA 5EHXA 3V1YA 3NW9A 4YUAA 2WTBA 4OAOA 2ATXA 2HNAA 2ZI5A 1KFJB 5AW9A 4CLXA 4BXOB 2ZWMA 3D6HA 4QPNA 3S40A 4EQZA 1AGNA 2HD4A 1XHEA 1RW4A 2B2CA 1NR1A 1MNAA 3B5IA 3EXFA 3FE2A 1RP1A 4E46A 3KDAA 1ZEJA 4HGRA 4LPSA 4TLCA 5AJZA 1IVSA 2PR2A 3GUZA 5FOXA 1P45A 1YU9A 5IEJA 3EGOA 2GFHA 2O2HA 1YQ9A 2DQYA 4Y18A 2BM9A 5EMNA 2AFRA 3KEQA 2HIGA 4YFYA 3OEHD 4LG1A 2R60A 4P35A 4TYWA 3H04A 4ER5A 4Q93A 2PZJA 3NFYA 4L85A 4R2JA 1I7NA 5HF6A 3VVBA 3UW3A 3U4CA 3A1DA 4B9AA 3FOBA 2OXCA 2J7PD 1R37A 3O31A 3JSAA 1IL0A 2EIHA 2ZQ5A 3HCBA 2Y4NA 3OFJA 1A27A 1F5NA 1YE8A 2BOVA 4G24A 3HY4A 1V45E 3ASVA 3A6GA 3MN1A 3RHFA 4FM9A 1PNOA 2KLHA 4G6ZA 1DPFA 2ZFUA 3Q7SA 4GWGA 5FBVB 5LZ4A 4C6RA 3BWBA 1SELA 2P6OA 2VS1A 3H3XA 3U3XA 4AZTA 2QTTA 5KTTA 3FVTA 1B41A 4HNSA 1P4HA 3TSWA 4MS1A 5IXYA 3DL2A 2YIJA 2F64A 3WYCA 1LQ2A 3OPXA 1Q84A 2CJYA 4V0QA 3CFYA 3R2JA 3VR4A 2C1EA 3GZNA 5F1PA 1G0OA 1KDOA 1NSFA 3FFXA 2DF8A 4XIGS 5CJPA 3SOPA 2GJSA 3TECE 1V2GA 1MT3A 4KTVE 4KO2S 1HO3A 3I6MA 4U02A 3OBIA 3BWDD 5A0VA 3IAHA 2C99A 3AR3A 1E99A 3GJYA 4FBLA 1KDPA 4RD4A 4XARA 4JQYA 4H6PA 4HMQA 5CT9A 5FV4A 1SBCA 3WKCA 5FFNA 2P9CA 3VI4B 4PM4A 4B32A 1IZ9A 2Y9PB 4BATA 4PN3A 1D2EA 1I32A 5JI3E 1FNBA 3LUHA 2QL7A 3BE5A 1YZYA 4UTNA 3H5RA 3S3TA 2DP4E 5E6SA 4BNUA 3CNHA 3ZV7A 1BU5A 3GLSA 5CLHA 1UXKA 3O0TA 5J9FA 5LDGA 2JA2A 4ZO8A 5ENVA 4A1FA 1NE7A 1XD2B 1NM5A 1T8RA 2Z0MA 5HVNA 1PWXA 2IGTA 1X1TA 1Y1SA 1SD2A 4QHYA 2VF8A 5JZVA 5C4MA 2C2ZA 5FBWB 1OI7A 2Q5IA 5G0VA 4ZC8A 3HCPA 4WOCA 1KQOA 5BMVB 5BUCA 3MHPA 3AUFA 4J1TA 1GSHA 1VP3A 2ORIA 3ZLTA 3UKOA 1P5JA 3ZWYA 1YVDA 3UG7A 2YINC 2G9ZA 5SYAA 1YZGA 4PQGA 4LRQA 4ENVA 1BDJA 2CHGA 2C8JA 3KU1A 2W2OA 4DM3A 2ZJ0A 3CB4A 4J1TC 1NY5A 1JAIA 1BW9B 2HSDA 3ICOA 4S2UA 1JUDA 2SKEA 4WOJA 2AW3A 5DWDA 5PGMA 4YXFA 2YMQA 3QXHA 4EFDA 3IPYA 4NFHA 3MJ4A 1KP3A 1P8JA 4DLWA 4KXXA 3DE4X 3BQNB 1T5TA 4XFDA 2H1CA 4JP2A 2P4QA 5HK8A 5IJ9B 3C1TA 1H5QA 2HTFA 2JVIA 1F8YA 4UU8A 5HIIA 2GO1A 1IATA 1RWKA 2GN4A 5ICMA 4D7AA 3Q5DA 4QC2A 1FMFA 3AB8A 1X13A 4JLAA 1GAQA 1F2TA 2W2KB 3KHKA 4RW0A 4QVIA 1QV7A 4HO1X 2X77A 3WWCA 2OBFA 3SM9A 1OYWA 2GFIA 4FT2A 1GXSA 2O59A 3UAYA 4IDQA 3W1WA 2FZ4A 2FUG1 3NZEA 4HAIA 5E6UB 1Z4NA 1RAEA 1ECCA 3JRNA 3PX2A 3BB1A 1TMGE 2AHOA 2C8VA 2PZLA 3S8YA 3FN4A 1G9TA 2H18A 2CLKB 4ALIA 2IHYA 1EUYA 2FUEA 3HMQA 4RPJA 1EUZA 3JRWA 1EK1A 3FMFA 1BMQA 2Q3DA 4Z4HA 2C4UA 2FMUA 3AJEA 1H23A 3P5SA 1CX9B 1ZS9A 1VE5A 2ADMA 3OESA 3OUTA 4F8JA 4AW9A 2HNKA 3IESA 2PG3A 4CL3A 2IHZA 2Q7OE 3KUKA 1NTRA 3LMKA 3VGPA 2Y8EA 3ANMA 5LUAA 2GCPA 2R751 1U8UA 2JZCA 1HOTA 1OIWA 3MJVA 4IUBS 4RTLA 5DT2A 5I48A 5J2UF 4WAUA 1OBHA 1K08A 3U1BA 1G59A 4ENWA 2ATVA 2BFMA 3D81A 3UAGA 4Z2AA 1R8YA 3HKEA 2HO4A 3C6ZA 2JIDA 2AG5A 3DE5X 3DZDA 4TV8B 5HEKA 4IDDA 5HIMA 2H4YA 1X7HA 3QXXA 1ABFA 2ZIVB 1W6UA 4G1BA 2X2PA 2X41A 1GU7A 1NKTA 1UFRA 3CG4A 3L1HA 3RSGA 4C0BA 4B4WA 2XYRA 3WRXC 3AL2A 5BSUA 4W1PA 3P20A 4FNOA 4JJIA 3KZXA 2VDWA 2BEVA 1Z7GA 3MB5A 4XCXA 1OAKA 1DMRA 4D4JA 1DB3A 4L73A 2L42A 1NVMB 3THWA 2QRJA 3HBJA 2JCXA 2X9QA 2WUFA 3GELA 4E94A 1W88A 2AIRA 3TZHA 1GKLA 2SKDA 1Y4DE 1C1DA 3O3OB 3L1UA 3WL7A 4YONB 6NULA 4HGNA 4JT4A 1NE2A 1XMVA 1ZD9A 3BB3A 4MXDA 1CDOA 2IOQA 4IJVA 4J0IA 3ZV4A 3E15A 4EJFA 5KSZA 4QM7A 1SFRA 1T1JA 5CLQA 5TMDA 3N8HA 3UPDA 2VQSA 2XYPA 3CLVA 1Y33E 3QOWA 4J16C 3TAXA 5CEFA 1UKCA 3H4TA 3RJ5A 2XCTB 4ND2A 1P1CA 3X1MA 3BHJA 1SC4A 4IHQA 3NH9A 3FSJX 4LDAA 1VJCA 1XCOA 2B94A 2OYRA 1RJFA 3ZZ1A 2CLSA 7ADHA 4G41A 5JIBA 1HTWA 1XVUA 1E3LA 2YBDA 3EZXA 5DXJA 5EJ9A 4GBJA 5JCOC 2ZSDA 1A97A 5H5JA 3ZJ4A 2ZIUB 3PHGA 4EECA 1QFZA 4U3JB 4X60A 4PC2A 1E3SA 3SXUA 2TMDA 2P5YA 2OGZA 2X19A 4B2IA 4PG4A 3LUFA 2GN2A 3SXPA 4I50B 2IW1A 2AOVA 1I3CA 3E9CA 4HXFB 4JMLA 4UU1A 2B8JA 4UDOA 4BAUA 3NKLA 2YHBA 1YQUA 3B9PA 4PXAA 1ODCA 4Y7CA 3X44A 2UYOA 5I9LA 5BUQA 1USIA 3F7OA 4ZAFA 1YDFA 3T4PA 4ZA2A 4LDRA 1FQOA 3K9NA 1U8EA 4YYEA 4IF6A 1ENZA 5GOZA 1I6WA 3U3OA 2YV5A 5F64A 4C76A 3FTDA 2C9OA 3KK0A 5AW4A 5D86A 5IF3A 4N41A 1RLUA 2VK2A 2OCKA 2Q5QA 2W0MA 3E3NA 3I6BA 4FI3F 4HAUA 4DPLA 4V39A 4RS3A 1E0AA 4KMMA 3M4XA 4F38A 1FP2A 2JGDB 4R8MA 2FRDC 4QTYA 3G23A 4AO8A 4YMIA 3FBTA 4OP3A 4AS3A 2WWXA 1D4OA 4ECAA 3LPLA 2EV9A 3EGXB 2BSXA 1WNFA 2NO0A 2ZXEA 4RANA 1PYDA 2FX5A 4JYBA 3MBKA 3I2FA 3E9MA 4DCJA 2FKAA 1YKSA 3MWDB 4XZ3A 1WVIA 2ZPUA 4IXNA 1L7DA 4IIJB 1M34B 4MGKR 3S1AB 1Q57A 2IY9A 3D3WB 5DSZA 1D6JA 2PJDA 2FYTA 1UOOA 1L8OA 5JFTA 3FY4A 2R96A 2X5NA 3EXIB 1W0JA 2WJWA 3IYLW 3VYUB 2IVZA 4AJLA 1FPQA 2Q6KA 2RJOA 4K9MA 1B4DA 2AR9A 5LZ8A 1E2LA 2BDUA 5T67A 2LZ0A 3DHEA 1QANA 5E38A 2BZSA 5GY7A 1GZDA 2BAGA 3ROKA 3DLBA 1ORWA 4FFBA 2GK4A 4B3TB 4OX9B 4MUXA 1BE1A 3HE3A 1THZA 2QRGA 2JCVA 4EARA 4EB3A 5M3BA 3E1GA 4RPKA 1P81A 2OWEA 4PFQA 3K6JA 4NMHA 2PKQP 1BG6A 1SVNA 2QZ4A 4Q12A 5TEWA 5AUOB 4YAOA 1W1WA 2DFVA 2MSEB 2VBFA 1EA5A 3MK31 3KJIA 2RHRA 3HI6A 3MJDA 4DCMA 4YRNA 2WHYA 4KI7A 4BFYA 4X20B 4DIKA 3IVCA 2B36A 1U8AA 5FLKA 4TZ0A 1JT9A 5DCYA 4IDFA 1F8UA 1C7RA 3HWSA 4NDNE 3P71T 3RSLA 4MVCA 3NWOA 1PZFA 4WLVA 5LMUB 3K2BA 3X2EA 3I52A 2HZ7A 1UJ6A 4EA6A 2ZIFA 3K9LA 3BFVA 4ZDKA 3Q9UA 2PLWA 3AVVA 2P35A 5DNAA 4DQKA 5BW4A 2X8JA 3L6UA 3AVWA 5A1JA 5H4GA 4BEBA 4XFJA 5CR9A 1TEHA 5TDHA 5E8RA 4PC3A 4K28A 1ZQ1A 5EUQB 4RVOA 4WJKB 2R25B 3ZV5A 5D3QA 5C7LO 5LOVB 1RCTE 3UWMA 5LUBA 1UBGA 4I1YA 3A1FA 4DDUA 2GM4A 2ORYA 1UJBA 2BUAA 4LF4B 3KKNA 4G26A 3CF4A 4PLVA 4Y3UA 2VDQB 3I04M 5IC5A 2GCOB 2GZSA 3COPA 2BLLA 2WVJA 2HK7A 4QEKA 4QELA 3H2HA 2EF1A 1IZ0A 4JC5A 4XIYA 5AW5A 1WSBA 2I1QA 4O8ZA 2R9VA 1GPKA 4G86A 2JAUA 5AXDA 4YYZA 1SC3A 1SCIA 3TZCA 5E4JA 1PQYA 2SKCA 4MWGA 4YCJA 4P93A 1PSDA 1TF5A 5COAA 1KERA 5JMOA 2O14A 3D3NA 3DS8A 4RXTA 5NLLA 4QBGB 2HQ1A 1H66A 3MRVA 1G6KA 1Y80A 2TMKA 3QWFA 4W9MC 3I2YX 1V43A 5GGYA 3S6JA 2PLRA 4OJQA 1VRVA 1V4VA 5LQJA 2E5FA 3GC6A 4A16A 4WDRA 1NJ5A 4R1LA 2PUCA 4C6TA 1PSZA 5I7AA 1WHTB 3QOXA 4R5MA 3N05A 2ZCVA 5DTRA 3AKYA 4LN1A 3GH3A 5BNZA 3HV0A 5KC9A 3ITNA 1XTBA 4NR0A 1J8QA 4H7IA 2EL9A 2O6HA 4HUTA 2H4FA 1XGKA 4JLWA 3EVZA 3JR7A 4B85A 3QY0A 1TU3A 4D8VA 3FYUA 1R64A 3CW8X 3LY9A 4HYQA 2C9ZA 2VXOA 4OREX 5CITA 3HN7A 5HF9A 3HWX1 3GLHB 3V8VA 2MSKA 4OPMA 1H93A 1NX6A 4BVLA 2HADA 1JH9A 1ZCZA 1K8QA 5EKUA 2FQWA 1RHJA 2O3QA 3LV8A 4PHGA 2CZQA 2NSLA 2ZBVA 3LYAA 3HC7A 1TFRA 3MZ0A 4KWEA 3WGOA 1VDZA 1U5BB 4U9UA 3P2YA 2NV2B 4YJHA 3RE1A 1RM0A 5BW5A 4R8RA 3R44A 1CUHA 1YCDA 4MQBA 2VDVE 2WIDA 3H5OA 1TQ8A 3G9QA 4KXLA 3UB4A 3VNUA 1NJ8A 2VIIA 1JDPA 1L2TA 5E7MA 2VA8A 3BBLA 4JI4B 1K3UB 2GTPA 3HJAA 4R7TA 3UMFA 3LDGA 4F9EA 4IR7A 4L16A 1FOEB 1HH4A 4Q3CA 4YRRA 1VKZA 1UWKA 2BHSA 1BVUA 3CS3A 3LVBA 4X7RA 4O33A 3Q15C 1BX1A 2EFHB 1LVGA 1NBHA 3V1KA 2HR1A 1AO3A 4HZGA 4RSHA 1VCIA 4KO1S 4F5ZA 5GZ3A 2HQBA 3BZUA 1DWPA 1ZYUA 2XB4A 1QLHA 1OJLA 2XZPA 4EH1A 2Q9BA 1SH7A 2FZWA 3M9WA 1NN5A 4DAEA 2B4RO 2Y1FA 1VPEA 3UZUA 2ZSBA 3WLFA 4PGGA 4X54A 3SHVA 5BN4B 2HHLA 1UXOA 2GKOA 3LKZA 1P91A 4BZZA 4XWWA 1RWBA 2D6FA 2V4UA 4RELA 4ZAWA 3EPJA 1SKYE 4LS3A 5GINE 1X7WB 5HFAA 2XXAA 3GRFA 4AURA 1YHNA 3OQ1A 1J0EA 4P58A 5IM4F 1KK3A 3DL0A 4BNDA 1ISIA 2BGJA 2ON6A 1ZR2A 3MGKA 1AQYA 1M0TA 2OG1A 1AT1A 3LLSA 4KJZA 4MVJI 1XQXA 4JSTA 1A2QA 2GEBA 4MGIR 4WJZA 5CVCA 4XYEA 2VEOA 1TD1A 2E9SA 4W8GA 1SUEA 1I13A 1YOBA 1B0UA 1GUZA 4KXUA 1YS4A 1SKUA 1XZIA 2UVQA 3DTNA 4LOJA 1ZK0A 2O2IA 4EY4A 2X9LA 2IH2A 1T9KA 1AO0A 5EERA 1Y9AA 3WGNA 4D9GA 4DM7A 2XTJA 3QEJA 2YV4A 3M34A 3ZWKA 1NVGA 3D02A 1HT2E 3AJ8A 4G67A 4CE6A 4CLRB 3CNBA 4OBBA 2L69A 1O6BA 1RDFA 1M6VB 1NP6A 3P2IA 1BGVA 5DHUA 5F5LA 4K9QA 2XMQA 2HXSA 4BFTA 1XTKA 3C7DB 1EFPB 1ZD1A 2DE0X 5CA0A 4LBVA 3NJRA 4NAUA 3T99A 3VTAA 4YMVA 5A03A 3HCAA 5LMNB 1HNXB 3GQBA 3GP3A 1QIDA 2D1YA 1QFXA 1EGHA 2B6HA 3QKSB 1Q2XA 1XZFA 5A4DA 2F2TA 4PZ9A 1MJHA 3RC9A 3ZX4A 3RYHA 4KN5A 4ZXPA 1AF7A 1FFGA 5CD9A 4CTNA 1KR5A 2UYYA 2EG5A 4D4LA 5EJ5A 4KQJA 2UZ1A 4FMPA 4PYNA 1KP9A 4OTZA 3HQ4O 4IJ6A 5HKBA 1T2AA 3L79A 3OZEA 4KOAA 4H31A 1IRXA 2P4EA 3T3IA 2AS0A 4Z51A 4MW5A 2W6NA 3V7YA 5KUTA 1ECFA 4WBSA 3I9V6 5DGXA 1MH1A 2D0OB 3MJSA 3TZKA 1YZNA 2V96A 2PTGA 1Y9EA 4EW2A 2EFJA 4KR7A 2CYCA 1ZINA 2QZPA 1QHSA 4K03A 3U2QA 3ZW8A 3DH0A 5ECGC 2DETA 3HJNA 3D6MA 4RZUA 2R8YA 5HIAA 2AMLA 4C14A 1C4OA 3JQBA 5EJAA 3YASA 4BGIA 5AI0A 3G2OA 2PH7A 4DE5A 5JNLA 1CS0B 3B7GA 4FUTA 5GONA 3A6HA 3SJUA 1L6IA 2PWBA 5GIOE 4MMYB 2WYHA 1QQ7A 4EHKA 5EIXA 1KOFA 2UZAA 2XI4A 3JQBC 4IEEA 1W29A 2A0KA 1YQWA 1AHHA 2ODPA 4FGZA 5KAMA 1XWIA 4B4UA 3VH4A 2EHJA 2VRWA 1YB1A 4JSYA 3NOXA 1FFCA 4IIYA 3X43A 1QGOA 3UUWA 4C1NA 4DLSA 3FHCB 3KJEA 4GYKA 2VSNA 3C8MA 3ISVA 3WLEA 5CCXA 5KJCA 2IYZA 3PENA 3BRSA 5K09A 2AI3A 2OFOA 4ND3A 1W2GA 4RCVA 2PUFA 2OKGA 1SHKA 1UC4B 3PJGA 4J75A 4ZVPA 2ICAA 2HT6A 4BB9A 2RAFA 1KEKA 4KREA 1V47A 5F3RA 2IU3A 1Z34A 4KLZA 4OLJA 5BN3B 4BU0A 3F6EX 5TS3A 2YFYA 2ZULA 2XWBF 5CK4A 2IP1A 5B3KA 4BZQA 4YT8A 3G0CA 4L8VA 1WXGA 2O2DA 2Q07A 5DLEA 1JKJA 1U2GA 4GKBA 1SHJA 1QMGA 1NQWA 5HG0A 3V46A 1F6WA 1IZYA 1RLIA 3E35A 4CZ2A 4D74A 4LFAB 1XLTC 1KYVA 5DOZA 3HA5A 5TR9A 3R7FA 2WIFA 1VCOA 1AK1A 4BLUA 2WIJA 4UASA 2CEAA 1E61A 1KR2A 1Q74A 3C15C 3OX1A 3PPWA 5KTMA 3GLFB 2YXLA 3DEJA 4UHCA 4EB8A 4CKWA 4FU0A 1DTWA 3STVA 1F06A 4B79A 2UYHA 4EABA 4JC0A 3ROPA 3ZD6A 4P33A 3PNKA 1MOPA 3BK7A 1ZI8A 1GITA 4OI1A 1KU0A 2ODTX 1U0LA 3HB7A 3MYYA 4OX9Y 2OD9A 2AC4A 5AI6A 1C0KA 4H6XA 2Z98A 1OBOA 1XTJA 4R16A 3U1VA 1W25A 5EIWA 2O52A 1GO2A 1JIVA 4BFCA 1SZJG 4U2DA 3PF9A 4UHFA 2XRZA 2WAXA 4UTVA 3KPUA 4IOJA 1NV9A 2NU6B 3O92A 1OI4A 2EGHA 3NM5A 3EUAA 1A95A 5B55A 4UUPA 3T3HA 1O97C 2VDJA 3V1UA 1W96A 4NPHA 1XPOA 3UJAA 3IEPA 1D1QA 1OAOC 2NLOA 2WDZA 3KKZA 5C1PA 1C0PA 2IFTA 2ASVA 5ITWA 2C61A 3VYTB 4ZV9A 5KNCA 3OTQA 2N1MA 1BXZA 4KV7A 3O4HA 3OG9A 3P32A 5DEOA 2P1ZA 3Q72A 5LB4A 1TD9A 1WKBA 1ZPDA 1FRQA 3OKAA 4FR5A 4PVDA 3RM3A 2JFVA 3QELA 5EZ6B 4RDIA 1JBEA 2XB9A 1N36B 2H9AA 2QBYA 1WCV1 3B9BA 4TT8A 1QF9A 3FTQA 2V9ZA 3ETEA 4JLMA 2Q29A 4H60A 4XWYA 1NQAO 2C77A 1IQRA 4L8YA 5I9NA 3RS2A 2QWXA 2V6IA 4OB7A 3W2HA 1AUOA 1ODJA 3CUTA 2E48A 3P26A 4G1CA 4WKCA 3S7TA 5KKNB 1EUQA 1XRJA 1TA4A 1QP0A 4Q1EA 2WTAA 1II0A 1IM2A 1R4AA 3EVGA 5KCMA 2H1SA 2H7YA 2Z95A 3WLJA 2QMQA 3AVXA 3VR6A 2MMGA 1ZGJA 1IJBA 4AZWA 4ZK6A 1ZCJA 2HI0A 2IITA 1D2CA 2YJ5A 3QPBA 1GQFA 4JP1A 3UPTA 3PXDA 4D3YA 3T41A 1Y8ZA 2LVBA 3RPEA 3F6PA 2WU3A 4TMFA 4AC9A 1X7XA 4Q16A 5HQTA 1UR5A 2GA8A 3CVUA 4B3GA 3IVAA 1R8XA 4OMDA 3R8CA 1J24A 4RVDA 5G2OA 1R6UA 1KA9H 5FUBA 1OA0A 3G0BA 4LX0A 5KOJB 1AM4D 1CS4C 2KX7A 1YZVA 3PUJA 3O47A 1RPAA 3LXMA 2GRUA 4A23A 4BDTA 4L15A 5FOQA 2TSYB 1PW5A 2LR0A 3KVRA 4WCFC 3C43A 1ZU4A 4CODB 2VPWA 4FBGA 4HH0A 1GWNA 3G8DA 2Q49A 5AVJA 4ED9A 1Z25A 3T5GA 1LF5A 4EBFA 4EDHA 1JR3A 3CF4G 4GM0A 2IYUA 4JB2A 1GU1A 1UPBA 3ZWXA 4DDMA 2O20A 1U0EA 3O8BA 3FI9A 1PT7A 2RIRA 1P2GA 3MMSA 3QX9A 2GHRA 4JI0B 3RC2A 3DE0X 2PV7A 3HS3A 5D3KA 2NXNA 2I65A 4WNYA 4GLFA 1K1EA 4CKEA 1MO5A 1X19A 5CLGA 4DSNA 3N8NA 1FUYB 3L4BC 5E9QA 3DA8A 3P9KA 1QB7A 4ZMBA 3CMMA 3LCJA 4JBHA 4OMUA 3UUFA 3J7AC 1RT9A 4MTCA 5FPKA 5CUQA 5JLAA 2B1QA 4N5LA 4WZAB 1RCUA 2J9YB 2O8BA 1TQHA 1PDVA 4GP9A 3L7AA 3RK0A 3WJAA 2NO9A 1B73A 4BNKA 1K97A 5A4FS 1HYGA 5J2UB 4LZNA 3NBXX 2JCBA 2ZAGA 4FHEA 4LTMA 3H2JA 4TKUB 1MB2A 4INZA 3B3AA 1J00A 1ORDA 3F3KA 4AULA 1WOYA 3D5QA 4Z4EA 4GVLA 4BB6A 1XMQB 1G3IA 4J0QA 3H4MA 1CEXA 4FS3A 3ELBA 2PQMA 4MRMA 4XVRA 5EIEA 3PKJA 4M1OA 1E6EA 4MR9B 5D85A 2XVAA 2R8XA 3BMCB 2DFDA 4NV1A 1C8BA 2VJMA 4E5NA 1JHUA 3DEHA 1Z2AA 3KXKA 2J30A 3DL7A 3UM9A 2H52A 2X0KA 2X86A 1HI9A 1PV2A 1Y3DE 3LU1A 2AK2A 3DAFA 3QUCA 5GVRA 4X24A 2BFNA 5ERXA 3ABOB 1Y1TA 4N0QA 4RMHA 3Q5GA 2NUTA 3ST7A 1C3LA 5K45A 3WYEA 1WVGA 3KYJB 4YJDA 1NI4B 1T2EA 3ANSA 1C81A 3RIXA 3SBEA 3U3KA 2VTVA 3E48A 2NU9A 1YULA 4K6MA 4AZ0B 3LX5A 1HDXA 3NIDB 3B2NA 4HJRA 4K9KA 3IQDB 1Z39A 1WDTA 5F3DA 1X9GA 2BMDA 1Z6YA 4DUZB 1C3XA 1F4PA 1TW2A 1JLLB 1L4UA 1CUCA 5CHEA 1M0SA 3P52A 1V8OA 1YRWA 2BGKA 4PG7A 2H29A 2IOYA 3RTDA 5I8PA 4ZP1A 1E1RD 1U1CA 2C4MA 4AKHA 2JLWA 3PDIB 3HVUA 1C9JA 1QC5A 1VG1A 1KYIA 1FS4A 2HU7A 1DDIA 3EGWA 3J80A 1JHQA 5JCZA 1BKSB 1E9DA 2FQQA 3OPNA 4HYEA 2OT3B 4FWBA 4BAGA 4TSFD 3SOZA 1N0IA 2IUUA 4CT5A 3GRZA 5J4YA 1OGIA 5GVSA 3CVJA 2HWYA 3LCVB 2Q3LA 3O4VA 4UQOA 2QMHA 1UL1X 2NIPA 4NBRA 3ROEA 3T4UA 1F8GA 1DZIA 1N3YA 1RE1A 2VHUA 4GP7A 4DSUA 4FFRA 1OH6A 3ENZA 2BHNA 1B74A 1FYFA 4HDSA 1USWA 2P2YA 1CZRA 3E81A 3GGJA 5EEHA 1F20A 5F52A 1G19A 4YRGA 1CBUA 3INYA 4Q5IA 1H8HD 5CXXA 4A3SA 1GN9A 2EG9A 5HSGA 4Q1CA 2ZIXB 4QDXA 2ZU0C 3FCOA 3FMGA 3EXHB 2BF4A 2XSZA 3OEHA 4G1FA 1EEHA 2CE2X 4M2LA 1OLXA 1U7PA 2B7BA 5ED0A 3EE6A 1RTKA 1E69A 2XRMA 3GXBA 3LS2A 1YZHA 1H1LA 4NI5A 1VL8A 4BVGA 1JILA 5DNEA 5K3EA 2QDKA 3EUFA 2AOUB 3MB8A 1U31A 4C0LA 4OQYA 5CGQB 1IN1A 4LNUB 3OE4A 3HR4A 1M73E 2X9GA 2BJWA 3UXYA 4WESA 1L5FA 5AM5A 1GCAA 3U1TA 1Z6QA 2PUGA 1XRNA 3T7SA 3AERB 1O58A 1H2YA 3A7EA 3PEUA 2X15A 4IMRA 1QIGA 4KE7A 4BGVA 4QXMA 5IU6A 5DHQA 3TSCA 2IX3A 1MUUA 4A0SA 5CD1A 1V5WA 4RWEA 4X90A 3G0HA 3VKUA 1F8XA 2NTVA 3KD2A 3ORSA 5HDQA 2R7MA 5IASA 2IC5A 2WHPB 4DJ5X 1CY2A 2YHUA 5SZJA 4ESOA 2PUJA 1NONA 5AM3A 4Q3AA 3PXCX 2X6QA 3HACA 2V8BA 1D0IA 2QPOA 5EVJA 3W2IA 3K70B 2C03A 1W0KA 3N39C 1Z5PA 2QR3A 1NF3A 4AMVA 3OPYI 3TJRA 4UU7A 5I7RA 2PN1A 3E7PA 4DQXA 3MLAA 1NU8A 3ESCA 1KSGA 3TFOA 2JVJA 2FQXA 1TAQA 1BYUA 3NT5A 3QY9A 5B7PA 1PEYA 2PBZA 5C4IA 1GSIA 5G1OA 3RRNA 3A4VA 1B1CA 3F6BX 3MJTA 1UC8A 2VBIA 3NG1A 2YHSA 4IQ4A 4QG3A 1EE1A 2F1JA 5A5EA 2C5AA 1ZX1A 1PR1A 2GBPA 4M9QA 4ZOAA 5B12A 1NRJB 5HS6A 4YJGA 3DBIA 4TUYA 4FFPA 1YVPA 2PLFA 3U16A 5EJGA 2EZUA 4GI3A 5FEUA 1JR3E 1WDMA 3D7KA 3NBUA 2WOOA 3P0HA 4P7BA 5I7SA 4BVJA 3CX6A 3U3ZA 2ZUWA 4CU5A 1KJ9A 4YRLA 1ESDA 4CLHA 4RHEA 1JQ5A 1SEVA 5TQ2A 3HJHA 5D5PA 3NYIA 1YOVA 1DHRA 3GVIA 4YCDA 5JTTA 1MABA 2DU8A 2GBLC 2QXYA 2WUGA 1BDMA 3DE1X 5F73A 3UKDA 4HDAA 4EG1A 2QK4A 4R05A 2H5LA 3KKLA 1NW6A 3PC4A 3TFWA 1ISFA 1QCDA 3LCUA 4I8XA 2Y2VA 1VP9A 3CO5A 3W4KA 4B4DA 1NQXA 4RVNA 5LQCA 3Q85A 3VVCA 1JJIA 3NKVA 3IXLA 1QE0A 2ZEJA 2VL7A 4RTQA 2SCUB 1L5YA 3V4SA 4Z9FA 4G63A 2FSUA 2A0FA 2CSUA 2ZJFA 4TLLB 1NUHA 5H16A 3HXTA 1XMJA 4Q3BA 3ZDQA 2IW3A 4OIMA 5KVVA 2AFIA 5FUQA 3GRKA 3WQQA 4KNYA 2J3KA 3HYNA 1CF4A 4EY3A 1HEIA 2VRCA 2X4LA 3MSCA 2DPLA 2HJGA 2YYZA 3HO8A 5FIUA 1M5RA 1IBLB 3WB0A 3L02A 1F0KA 4YGXB 1CJCA 2HIMA 2WSLA 4GR4A 5AO9A 4IZ6A 5K8JB 3PQFA 2JJ8A 5IX8A 2GVZC 3ENQA 2H2FA 1EJ0A 4IWNA 4I2VA 3CEAA 4IIGA 4GQIA 3NBFA 3QVTA 5G0SA 3VPGA 3K8ZA 2WF6A 4C78A 4O3MA 1E89A 3IP8A 5JROA 3WZMA 2BGGA 1T5BA 3O2QB 3WL4A 1S2OA 4FEYA 2ILVA 2IQ5A 3SHTA 2LCIA 5AH0A 3SP1A 3SYTA 5C51B 2GCEA 3L7DA 3A8TA 2ZYUX 4EY5A 4CMIB 1GG9A 2BFEB 3CKYA 3RAEC 1IZZA 4FNAA 3RYTC 4PIVA 2WF7A 3D2AA 3GRVA 2AV6A 1M1YB 1KZHA 3N2GB 2XQGA 3JVEA 4CQMD 3DXZA 3EPPA 4W5HA 5IDXA 1X38A 4ESVA 3TFQA 2WILA 3EPLA 2P67A 1UM9A 4OHCA 1F14A 4QECA 3T9AA 2CZGA 2WSSD 1V6SA 2R4UA 5CG1A 3TNFA 4AMBA 5HM8A 3TW6A 1UOPA 3T4EA 5E9AA 4D2IA 3CT6A 1MAVA 1X86B 3LA8A 2A1UB 1GLGA 4L4XA 4RD1A 1WCYA 3PD7A 3MHTA 5DNCA 1CZHA 3H9EO 3AHFA 3LPNA 2QR2A 2W6PA 3UAOA 1PU2A 3MTIA 4PR3A 2GEKA 1YHZA 3N2NA 4K9DA 1S5PA 2RGGA 4II3A 2JFYA 1UDBA 2PKWA 4BN0A 2Y6VA 3GMIA 4HWRA 4CETA 1WUIS 2OOSA 4M0LA 4XE5A 5ADVA 1U0FA 1O95D 4K88A 1WF6A 4FC7A 1GGHA 4G9EA 1D0VA 1A9OA 1DEXA 1AOXA 1O08A 2GJ8A 5EGNA 1M8FA 2ISSD 3MQFA 3DP7A 3E05A 5TMBA 4GKAA 3FVRA 2XQFA 2ECKA 4XVQA 4M8KA 2ECOA 5BUZA 4WRRA 1YHYA 4BO4A 5LL6P 2FV8A 2D1SA 3KYCA 2CWDA 2I22A 2BI7A 5GMOA 3S2ZA 2XLBA 4TL8A 2W6IA 5AT1A 4BQPA 4ZQCB 3QNMA 4DDHA 4TN1A 3V4RA 5GV7A 1D2NA 1QZZA 3TCKA 2QB5A 3VDMA 3DXFA 2KBFA 1X87A 2BELA 2H00A 4Y2GA 1MJNA 3GFOA 4M1TA 1E2PA 5DRYA 3M49A 3PDCA 3AP3A 1BH6A 2NYUA 3DBHB 4I5IA 1K3TA 1VGQA 4M9SA 4KE6A 2K7ZA 3MERA 2JCGA 1GRCA 4L78A 2QZJA 2JF0A 3L5OA 3FD8A 4JJFA 1IM8A 1CUDA 3FGPA 221PA 4H7JA 3SJBA 1TXGA 3ZQUA 1MENA 1H1DA 3CJQA 1GFSA 5IT0A 1Y3BE 1SK8A 3IXQA 3LX8A 2CSXA 4I5FA 1JHPA 1I36A 4N7BA 1A4RA 3UMVA 2HSEA 4NAVA 1Y6FA 2XNCA 5LP1A 1V16A 1ZH2A 3FKQA 4C4PA 1GUBA 1QK5A 4AJKA 1U7TA 1AIPA 5BW8A 4YV7A 4QGGA 2ZBGA 4RMNA 3C3XA 3E84A 1GAJA 1FF9A 2CJWA 3I72A 5E7IA 3ZHVA 4DJFC 3M1IA 3ZK8A 2FUCA 4PNHA 2V7BA 2EFEB 1VRWA 3L9XA 4BIIA 4EQ6B 1V48A 4EUNA 2OBBA 5BQPA 3AKDA 3GT4A 5CX4A 5C52B 5C32A 2I4OA 1Z4LA 3VNRA 3RYIA 4RVGA 4Q6WA 3MMZA 1K6XA 4B3JA 1SZDA 5EZQA 2O8EA 3JATB 3I8OA 4DRZA 4IIBA 4JOSA 1NHWA 4RABA 1SXJB 1CU1A 3AYZB 1GTVA 1UZNA 4O2BA 4PHCA 5CAEB 4UTXA 1LW6E 3HVKA 5KYYA 3BN3A 4GOJA 3C3PA 3VV2A 3TBHA 4PCVA 3S5UA 2VPIA 4LA4A 2W98A 1TQ2A 2B1GA 3AU8A 4OFXA 3L7BA 4A92A 3AUUA 1PK8A 1P0PA 4RA9A 4RMGA 5JI2E 4B31A 5GAJA 3BRCA 2J87A 1E2IA 4JL8A 5REQA 4X1IB 3OAAD 4V0SA 1CY1A 2Y3IA 2FETA 5BWOA 4KBYA 2NNWB 2ZQYA 3T4XA 3UXEA 3G88A 2AJ8A 1LC0A 1R8SA 4M86A 4I36A 4QT4A 1TC1A 2H5JA 3GARA 3D1VA 3U7HB 4PZAA 1XQ6A 3EJ6A 3FZGA 1QH9A 4PLGA 2VF2A 4YRPA 1EWYA 1U98A 3MTQA 4B0OA 1QRAA 3HADA 3BIWA 3PZBA 4MGZR 1B15A 8AT1A 4ISBA 3I6ZA 5IYZF 4QULA 3TEMA 2RARA 2PPVA 3ND5A 5HIJA 3HNPA 2PXXA 3LJKA 2QAGA 1XFAA 5BWBA 3U31A 1T0BA 5SV2A 4F2GA 1RYFA 1D2GA 3GLKA 1P1JA 4NENB 4CF5A 1F51E 4KE9A 4NH4A 5ICCA 3N9IA 3O4JA 1E96A 4ZZ1A 5EP3A 2H0AA 2O8NA 3QBDA 3MJEA 4WCVA 4C6HA 2AFIE 1CY6A 2FOXA 5DP2A 4J0FA 3ETHA 3N76A 4PQYA 5FI1B 3UHPA 4DCOA 4DWWA 4D25A 3I37X 4MSUA 1U7ZA 2V7XA 3LQ1A 3AOGA 2O0MA 2YYAA 4MINA 4MS4B 3GH1A 5G4KB 3NHKA 3BUSA 2PO7A 4NJEA 3CR7A 4E11A 4F71A 5FR2A 1O97D 1XUOA 3EVAA 2XGOA 4IXTA 1JFRA 2QLFA 4MQUA 3MCUA 3CH4B 1M1NB 3KYDA 3Q3HA 4NONA 1Q21A 1RBQA 2M6RA 4KU4A 4BKQA 2VQ6A 3FWNA 2KS6A 2V5UA 1WA5A 3QVJA 4ZMSA 4D8XA 5IAOA 4DR3B 2JLVA 1UBJS 1ZWKA 2QN2A 1SZCA 3ETJA 5J5VA 3GW8A 5C1IA 3KWFA 3TW8B 5A3JA 4C21A 3ICQB 4XCQA 4FI3C 3OJCA 3I2GA 1C7EA 1TW3A 2A35A 4IGAA 3HP1A 5JSKA 3W5JA 2JJ1D 3HEMA 4IRUB 1DKQA 7AT1A 3SF8B 3SIRA 3RUIA 4ZOCA 1IEWA 2VH5R 4PNPA 5A9SA 3RSZA 3AKZA 1I5RA 1XDBA 3VO9A 1E9FA 2H17A 3KELA 4B6GA 3ZTYA 3ON5A 2CVQA 3WJ2A 5MF6A 4C4RA 1TAUA 3QX8A 2QTRA 1PZXA 1QGAA 2F3QA 4ASUA 4DARA 4MVJM 2W4QA 4JI8B 2EWMA 1JW9B 2J9GA 3ZNOA 1Y6RA 1ZHFA 3CC8A 3NKFA 2J59A 3UK0A 3KX2A 1AV6A 2Q8QA 2P7IA 3RVPA 3V32A 2GAOA 1GT91 3BXFA 5CIYA 1MO2A 1GCOA 1IHPA 1C9NA 1DE0A 3LL7A 2C1XA 1PI3A 1QO7A 5AKYA 3URKA 1CJKC 3DULA 5JJCA 3H84A 1TO6A 4BO8A 1IJFA 1HEYA 4HH4A 3BH6A 3H1TA 3MXOA 6PFKA 2FEKA 3DWIA 2IU6A 4BFLA 4ZQIA 2I29A 4LV5B 3JQCA 5B6PA 4JXXA 3JW8A 3EBLA 5LA6F 4YRKA 3EMVA 3U09A 1KPGA 3GLTA 1ACLA 1SBNE 1QOZA 4FFDA 3PRYA 5IN5A 1Q95A 3R20A 3VU0A 3BT7A 5LYYA 3BA6A 2A4MA 3QVWA 1CQPA 3AIMA 4ZANA 5F98A 1FU8A 3WSVA 3IAEA 3MBOA 1R0KA 3WLQA 2Q5JA 1ULTA 3C5CA 3L8CA 3QYJA 5DEIA 3TG2A 3BULA 2C7OA 1GTRA 3L46A 2V6JA 3M5CA 1Z5VA 4EJSA 4IDGA 3U4AA 2VSXA 5ALUA 2WHXA 3FSGA 4KG7A 2ZJ8A 4KUHA 2FLVA 3PE3A 4I6GA 5C5DA 4S1WA 1A96A 4D9KA 1UBRS 3RARA 2W4MA 4KMSA 1VKJA 2D3TA 4TN5A 4ZQHA 4WZ6A 2NYVA 5CDGA 1E3QA 4KXVA 1FZTA 2ZXUA 1W36C 1AQLA 5LMZA 3IQWA 2QG9A 3LL4A 3OEWA 2VJKA 2F17A 3PEWA 4X7MA 3B8HA 3P9YA 4BMPB 1J22A 2C2KA 1W7AA 5MN4A 1LPOA 3UYKA 3VV3A 1R0WA 2Q27A 1TVMA 2PYDA 5EYPB 1DEKA 4CN9A 1XRPA 2QSYA 4Q7JB 1Z6AA 2J3HA 4FYXA 1ZXXA 3ETGA 4Y2V