1OFVA

Flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Refined structures of oxidized flavodoxin from Anacystis nidulans.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1992-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ofvA00
5LJLA 3NHPA 1BVYF 1KBQA 2MTBA 2ARKA 3UXHA 1AMOA 1WSBA 3W77A 2FX2A 3R6WA 3ES9A 1YOBA 2BPOA 1XT6A 4ZVNA 4H2DA 2QX6A 1OBOA 1RTTA 3QE2A 1AKUA 3W79A 3N39C 1XYYA 3W7AA 1CZOA 3K1YA 2N1MA 4GR9A 5FA6A 3P0RA 4R81A 3TEMA 5LLDA 3U7IA 4FX2A 3GFQA 4LTMA 3KAPA 3NHKA 1YCFA 3OX3A 1FTGA 5NULA 3OVMA 3KEGA 3NHFA 5B3LA 1YCGA 1FUEA 4GQIA 3RPEA 1AKQA 3OJXA 3D7NA 2B3DA 1QHEA 5F12A 3FW1A 1CZUA 1FLDA 2X2OA 4FGLA 2QX8A 2W5UA 2QX4A 4ESEA 3S2YA 1CZHA 1OBVA 1T0IA 3LCMA 4OXXA 1VMEA 4C0WA 3O73A 2BF4A 3W78A 2Q62A 2BN4A 1YKGA 1SQSA 2FOXA 2GSWA 3ESXA 1TIKA 1H66A 4HEQA 2BZSA 1XYVA 1CZLA 4DILA 1JA1A 1ZWLA 2Z98A 1TLLA 4YAWA 2QMZA 3F6RA 2MT9A 2FCRA 4FGKA 4C0XA 4DY4A 3OWXA 3NHSA 3O2NA 2QMYA 4LAFA 3UXEA 2QX9A 3OX2A 1GG5A 1OFVA 3KAQA 1QRDA 5EA2A 4YQEA 3F2VA 1YDGA 5TGZA 1AG9A 3F90A 4XDHA 5F4BA 1AHNA 1AKVA 3EYWA 2HNAA 1NNI1 2XODA 4BMPB 1FVXA 3GAMA 4U7GA 1T5BA 2QR2A 3OX1A 1JA0A 4F8YA 1AKTA 4QOEA 6NULA 4QOJA 2OHJA 5LJIA 4LTDA 4N9QA 1DX9A 1FLNA 1J8QA 1DXOA 5BUCA 3NHWA 2MOKA 3FX2A 3JSXA 4QODA 3G5MA 3NHRA 3L9WA 1FLAA 5LBTA 3TE7A 1J9ZA 1CZNA 3GFRA 3L9XA 4N82A 4XDGA 2FAXA 2M6SA 1C7EA 2R96A 5A4KA 2OHHA 2D5IA 3FJOA 3B6JA 3B6KA 2A5LA 4CETA 1DXQA 4N65A 3OWHA 4QOGA 2FZVA 5F51A 1I1OA 1X77A 4C14A 1J9EA 4YALA 4ZVLA 4GI5A 1ZWKA 2Z9CA 2V5UA 3TZBA 4J8PA 3N3BC 2AMJA 3NHYA 1F4PA 1D03A 3NHLA 3FNIA 5LVAA 4YAOA 2XOEA 1D4AA 4YAFA 1FX1A 2R97A 1YRHA 2KLBA 4M0CA 2Q9UA 4NULA 3LT5A 1RLJA 5EMNA 4S24A 3B6MA 4D02A 4CF6A 1C7FA 1FLVA 2X2PA 3N3AC 4ZVKA 3ESZA 1BU5A 4PTZA 1CZRA 4Y9RA 3NHUA 1RLIA 3HA2A 5LBUA 4Y7CA 5FUQA 2FVXA 4BMOB 1V4BA 1XI2A 2OYSA 3NFRA 3KLBA 4YAUA 5EAIA 2V9CA 3HLYA 2BMVA 4Y9UA 1AKWA 1AKRA 5FX2A 4DIKA 4ZVMA 3F6SA 1QBGA 2F1OA 2OHIA 4LA4A 5ULLA 3B6IA 4H6PA 1H69A 1QR2A 4C76A 5LMCA 1WSWA 2M6RA 4PU0A 4ICIA 3NLLA 3FVWA 2Z9BA 3EDOA 1D04A 2WC1A 3SVLA 3QFRA 4QOIA 3HR4A 1J9GA 1KBOA 3NHJA 2HPVA 1E5DA 1ZX1A 2RG1A 4PTYA 4HS4A 2QWXA 2HNBA 5JROA 2FLVA 4U7FA 2V5VA 3U7RA 1RCFA 5NLLA 4QOHA 3ZHOA 1SG0A 2ZKIA 3QFCA 3GFSA 4NLLA 2KQUA 1B1CA 4QOFA 2FDXA 1YCHA 4U7HA 2MWMA 1AZLA 2Z9DA 3ESYA 1CZKA 4FGJA 5B3KA 2FZ5A 4LTNA 3OJWA 3K20A
chains in the Genus database with same CATH superfamily
5JNVA 3MD9A 3INYA 5DFAA 1PP4A 1DT3A 4BVJA 4GPZA 4U5QA 4BATA 3P4UA 3G0GA 4CV1A 4WACA 5KU1A 5LQCA 2AF3C 2YWCA 1O1YA 2FSUA 1XZDA 3KUUA 3NASA 4IP0A 4XIGS 4H4DA 4A6PA 4ADSG 1OKKA 1WXIA 4HN4B 1UT5A 2A4KA 1YZHA 3NGXA 2OK7A 2B4KA 4GGOA 4LXIA 4QBIA 3SHQA 3UW1A 4ND7A 3UG6A 3NPMA 3PU6A 1QYRA 4LIPD 2AXEA 1V41E 2VAWA 4DIEA 4GBJA 4F6RB 1Q1NA 2YINC 5ERGB 4ZDJA 3UKDA 3LI2A 1SAYA 3F3KA 4QQ8A 2ZJBA 1XF1A 1C50A 2O2GA 3B1ZA 1XX6A 1PT8A 2J3QA 2X42A 5KNBA 1BS9A 2PJRA 1MVNA 2HL6A 5E38A 3STXA 4ZAZA 3GUHA 3I64A 2ADMA 4JBYA 4EDFA 2R7AA 3IQIX 1C0LA 2A78A 2BEUA 3H5OA 4MQ6A 2XE8A 2A9FA 3KB1A 2P41A 1QCCA 2YCLA 3W1VA 5B58C 1IZYA 2C61A 3HACA 3I61A 4P3NA 3LUKA 1TKRA 2OMKA 4UUOA 3HZHA 4X93A 3T7KA 3WB2A 3EZYA 3PEUA 3SHTA 2IL1A 2GRJA 1XXHB 1VJTA 3LBYA 1JIJA 5F2EA 5FOUA 2CNNA 5JS7A 3KU4A 1D0VA 2WU8A 4P22A 3N70A 3GXBA 5HCIA 3ZS8A 5IM4A 4ZGBA 3WYCA 3HXQA 3GH3A 3Q87B 3RM3A 1TC1A 1W34A 3GDGA 1RZUA 4MQEB 4ZV7A 2XYPA 3WYGA 4L5AA 3WSTA 4L8WB 3LC2O 3JZFA 4G23A 1YJCA 3CNNA 4N7MA 3B20A 2AYXA 4Q1VA 1NW3A 3AI7A 3ERCA 3ANSA 4KDFA 1RJWA 5FJIA 2QJOA 3CH4B 2C3YA 1RWNA 2O19A 1VYTA 3FLAA 3LAWA 2C2XA 2PLFA 2IYYA 4IEEA 2FP4B 4NZNA 1AH2A 3PWZA 4QPZA 3QLVC 3VU0A 1E1KA 1E6KA 2ZT6A 3DONA 1BKSB 3DLCA 2N42A 2BGRA 4G9GA 1IXRC 4ZQFA 4D0LB 4J2TA 5G0TA 1WW3A 4YWHA 5CFPA 1BROA 1EFRA 4OQDA 1MRSA 3IT2A 1SUBA 3O21A 1YZ3A 4BWVA 5KWEA 3GEPA 1V43A 5LNK1 3W4JA 1ODTC 2OGUA 3R0JA 1C0EA 5IRCD 2WHPA 1P0CA 3FYUA 3HKBB 4HMPA 1OUMA 1NZJA 1G6KA 1W0JD 4E15A 2XITA 4EB6A 2C5GA 3LA8A 5C8XA 2A1TR 4ZOCA 4YV2A 2WKRA 1XPRA 4RZXA 3OOHA 3U31A 3DBIA 5E7QA 1JXMA 2FLKA 3TX2A 3I92A 1PAUA 1QLJA 2F90A 1G63A 2I1VB 2NXWA 4RD1A 5BW6B 2PGDA 4XTRA 4EL5A 3LX8A 4NR0A 3LC0A 2H4HA 4UU0A 2VSQA 5HF5A 4LVNA 5LQRA 2O05A 2WVGA 1L4LA 5CVEA 1E6WA 2D5AA 5A1TA 5JR3A 3HHEA 3WQHA 4YRBA 4R8LA 5FWNA 3H97A 3AK4A 2W6JA 3I1IA 2E48A 1O57A 1MX5A 1P8JA 1IXSB 1G8YA 2A58A 2A9JA 4LOLA 1VMEA 4M7WA 4WY5A 4IQ8A 3BX1A 2RCYA 2IYLD 3HJTA 4GQBA 4DM3A 2BF4A 5JSYA 4Q3OA 3FMPB 1BSVA 3GHYA 1TAGA 2JIZD 3P5SA 5DISB 5ALOA 2ZWPA 1VMIA 1BXGB 1AKNA 2B2CA 4PLTA 8AT1A 1KI3A 3JWIA 2V7PA 1RCUA 3GNSA 1FX0A 3C8MA 1VYVA 4K3VA 2NV6A 1FRFS 4PO3X 1DOHA 1SQSA 3B70A 4PZPA 3S3TA 3MLEA 1UWVA 4X45A 5JEEA 2Y8EA 3JQAB 3A3KA 3FPKA 4FHDA 2ZAYA 1Z37A 2ID4A 3OTQA 4UQPA 1PGJA 1XYVA 1EB8A 4Z51A 4M9UA 2C9ZA 2Q4DA 2W6NA 1IM5A 1FFXA 3VJMA 2P9QA 4GU5A 5TMDA 2BMWA 4DHWA 1CETA 3HJBA 4W9NA 2XUFA 1ZNXA 2J9XB 3TG8A 4HO1X 2QNBA 4C06A 1E3LA 3F7NA 3OCJA 5D3MB 1E2BA 4GI3A 4YAWA 3ADOA 8ADHA 1BXRA 3TQTA 5IZCC 4GNRA 1I2DA 5CBPA 5BNIA 1F48A 2V55B 2VNSA 2JIOA 2O5EA 1ZUWA 2QMZA 3DGEC 5K3BA 1P45A 2PMEA 1F9EA 3D64A 4BFSA 3K2EA 4X54A 4RGBA 3GYGA 3AKDA 3VSAA 1WKVA 4PFSA 4AURA 4D4LA 1KWGA 1E9RA 9LDTA 1WPRA 2XY4A 1W36D 4H7IA 4LKOA 1GTMA 4QXQA 3AF3A 1PL8A 4W1RA 2WQZA 3MF4A 4A6DA 4E5DA 1OT5A 3GAFA 4RPJA 3BXFA 4R1LA 2ZUSA 2R5WA 2IBMA 2I4RA 2AYZA 4K6MA 1PT9A 5FPQA 3VVLA 4YMUA 4CM4B 2QMYA 4DCUA 5COBA 5ALJA 1H8HA 3O8RA 1GRRA 2JZOA 3FPBA 4XKJA 2W2XA 3CVJA 4ZK2A 3K0AA 1NSYA 4PGAA 4C7OA 2FPIB 3BWMA 1CEYA 5FFFA 3AIKA 4ZYWA 3KLMX 2E4ZA 3VC7A 5TGZA 3ZCTA 1P73A 3P8ZA 2WKQA 3GW8A 3EY9A 1RZRD 5IXSA 4B09A 3MERA 3Q3VA 3UM9A 2FG6C 4XDHA 2D3WA 1NTRA 3M34A 3KS9A 4RK7A 3EXIB 1C80A 5CNJA 2W2OA 3BSYA 2YFHA 4HY3A 1ECCA 2CB9A 4RXTA 4C87A 4PSKA 1QNFA 3NT2A 4JLVA 1PJSA 3WGIA 2AW5A 1NR7A 4TT8A 3W8EA 2Y3IA 4EY7A 2VPQA 1C14A 1GR0A 2D4HA 2INGX 3QLUC 1FVXA 2JANA 4GP9A 1UC9A 4GWLA 2QZZA 4LMPA 2WYUA 2ZSKA 2WHRA 4Y1GA 2M9MA 2V0GA 1OVMA 3EDQA 1L4GA 4Q9HA 3WX0A 4DQ0A 1FXWF 1GZDA 3TNJA 1A9YA 2J3MA 3AVYA 4EO9A 3L18A 4QQFA 1U7XA 3EQ7A 5H83A 1E1QD 4QSHA 3FYCA 3V1YA 3B6ZA 2F59A 1TM5E 2JBWA 2YW9A 6NULA 1TIPA 2QT0A 2G0TA 4RA9A 1LFDB 2R8XA 3CO0S 4AG5A 2QM7A 1CPYA 5H02A 5C3MA 2ZQYA 3NTUA 5ERXA 1DCKA 4MKRA 4MWSA 4UNRA 3IUYA 3JSXA 3RC1A 3E9QA 4JLAA 5IKMA 4QODA 1QGYA 1KOGA 1II8B 4P4SA 3HB4X 1HT2E 2CHGA 4YCNA 3H1BA 4B2LA 4D74A 3T5AA 2X8JA 3QNWA 2WP0A 4Q24A 3JRNA 4Y7DA 3V00A 1O94D 2HA5A 1E7YA 1YA4A 4KGXA 1UP6A 2NZVG 2YBDA 3JTMA 2CHEA 3LHIA 3LU1A 1SZJG 4HFNA 3GLIA 2EW2A 3ML1A 1MO2A 1CUYA 2VT6A 1QYWA 4NARA 3PTZA 4P36A 1W52X 1E59A 1VE7A 5DWVA 1TM3E 4NCAA 4O2RA 4MCHA 1PR1A 2HJSA 4JP2A 4Q1FA 2D5IA 2HBRA 4GG1A 3VDRA 2WVAA 3QGMA 3JQ7B 3IDSA 2WNIA 1HE8B 4CI0B 1SXIA 2JAHA 1G42A 1NW6A 2AI2A 2GCOA 4NBLA 2FF7A 4ED9A 3HFGA 1XC7A 1X0VA 2BCGY 2X0IA 3U0BA 1YBMA 1Q1QA 4CF4A 2ZYVX 4DGSA 1PFWA 2F43B 4ZJZA 1HE1C 5CX1B 1GTRA 2EJBA 4UNPA 5DV9A 5AHKA 3H75A 3FOCA 1T6ZA 4GGPA 4IQFA 4X1IA 1UMCB 3D8SA 5M2QA 3PRHA 3UAYA 1QLHA 2VP9A 1XXLA 4LK2A 2O06A 3A0RB 3WRWA 3JD4A 2D54A 4ZU1X 4YP7A 5DP1A 3THWB 1QHHB 4BY9E 1JMKC 2AZXA 1Z6XA 2AEJA 4A36A 1VDZA 2D2FA 1T1IA 1NULA 3B3QA 2XT9A 3QBDA 1GPUA 5JQGB 2WJIA 3OECA 3O94A 2AVDA 4LXYA 2JFBA 5DB4A 3TJZA 2O3TA 4RAQA 2R00C 2IUEA 2JFPA 4I1OA 4RJLA 5AO9A 1MUUA 2ZBQA 1MJHA 5HR5A 1VLJA 2KLBA 4Z3OA 1CBUA 3CJQA 3R20A 3SHFA 1GNQA 1IZ9A 4TYQA 4ZVSA 2DM6A 5HF8A 2WM9B 4TKVB 2Z2YA 1MAWA 4E51A 4OP3A 4N0MA 1C7FA 1EVYA 2B36A 2YVUA 2DHRA 5ICGA 2GH1A 1ZM4A 4MAAA 5FA5A 3IYLW 1TDJA 1T8UA 3MS2A 3QYFA 4GR5A 3GBVA 1D9ZA 4PYNA 5I47A 4QBTA 3IUJA 4N9WA 1Y6JA 2PWPA 1KE2A 1Q0RA 4C2BA 3RSOA 5KPJA 6ABPA 3FGOA 1RC0A 3OF3A 1PT7A 1XQVA 3AJDA 2EFHB 4QNNA 1A2OA 4F04A 5AW0A 4NAVA 4AQDA 3NHUA 2ACWA 3CBGA 2PGAA 4KLNA 4QLOA 3SC6A 4C9BA 4JDUA 2C7BA 4LJSA 4LY6A 1QGOA 5EE1A 3T3HA 3L49A 3WGGA 4ZYUA 3UGJA 3M6WA 5KSWB 1A88A 3DC7A 3G5UA 1N9GB 3F8WA 1DAOA 2FWMX 3JPYA 4UMVA 3WIUA 4YRDA 1B41A 3P0FA 1UMDA 2VHZA 1MB9A 1E60A 2G36A 2IYQA 4MQ5A 3S2GA 4PQYA 1F6BA 1F2TA 2OZPA 3NU1A 2ST1A 3WNZA 3T7TA 2AQHA 1P72A 1TFRA 2EG9A 2RIRA 1VPDA 1QQ5A 1TEHA 2G9ZA 3P0EA 4DCPA 4EQ6A 3S55A 1KI4A 1GLNA 2OMEA 4O4HB 3SNKA 3ZTTA 2VQ6A 1YRWA 4A5OA 4UQOA 3C1UA 2HSDA 1AKRA 2C5BA 5FX2A 3W5AA 2BP7A 2RAFA 3L8HA 3X2FA 4OGFA 5A4IS 3IUNA 4MP3A 4X90A 1DTWA 4KPUA 1T8TA 5JWHA 1MEOA 3AVOA 1R6AA 2FW6A 3SYMA 4RM2A 4OB7A 5AD1A 4IUBS 3AUAA 3CZMA 1HDCA 1HDGO 2SKDA 3MMNA 2C84A 5ALTA 4DCVA 1T9KA 3GJ3A 2OO5A 1NC3A 1SVUA 3LNCA 4I81A 1MOQA 3TLYA 4H6PA 4WQMA 5G3YA 3K72B 2EGUA 4IJWA 4MR7B 2UUOA 1UUFA 3PB3A 1SBYA 4HVAA 4NF2A 2RMKA 1E9SA 4BVLA 1RBZA 2FUCA 3SIXA 4MRMB 4DKJA 1ENOA 4L5CA 3AUKA 4ZOAA 4U8HA 1KAEA 2SBTA 2HYDA 3ZNOA 4BVHA 3LL4A 3J7AC 5I7AA 4BNZA 4ISBA 1ZM3A 5AW1A 2Z58A 1SCQA 3RT9A 1F1BA 5L4SA 5A7FA 2XI4A 4O1HA 2WD7B 1E2DA 4C4ZA 4IJUA 5KVAA 1ULZA 2I7CA 4GQAA 4PZZA 5FAXA 3IHTA 1MH9A 3GFOA 5AW5A 4G97A 1EQAA 2WP8J 1N6KA 3NBMA 1T15A 3E7XA 4OMUA 4QFBA 2GN0A 3JZAA 1L4YA 1B16A 2WC1A 2WT4A 2HJHA 4R2IA 1TZBA 1QZUA 2BFFB 3ZWQA 3PCXA 3HVKA 4BE7B 1NBHA 4V0QA 2BR3A 1FNBA 1Z12A 4W8OA 2XKJE 3OC6A 2IEAA 3CBQA 5CVDA 1D1SA 3EQ6A 3HPQA 1RKBA 2AC2A 3LXMA 3VO9A 2O0HA 2HJGA 5BQ3A 2HXGA 3L6BA 1NM5C 5EQDA 4BLWA 4DDWA 3G2JA 3O93A 3WKDA 5LSAA 2KM1A 3H1GA 2VZLA 2GPAA 1G3UA 3PF8A 2PJUA 4YMWA 3X1KA 4HXGA 4UXHA 4JGBA 4A8JB 1HC7A 3VH2A 2VXBA 3PWKA 5K3DA 5K0EA 1I3LA 4AT1A 2Z6VA 3G0DA 3LL7A 2VNKA 4JT4A 5H1YA 3UWKA 3SFZA 1T34A 2YFQA 5KWSA 3UH1A 4ZCTA 4JSRA 3KQPA 3NWJA 1E2MA 5GY7A 2ATVA 1VSTA 2XA2A 3CG4A 1NXOA 3EJ6A 2VHJA 3OZEA 3PUWA 4GMXA 1U1IA 4NLLA 5A06A 2Q5QA 4FOOA 4QO8A 3HDVA 1QHSA 2B61A 4KN5A 5TS2A 2XVYA 3T0GA 4LI0A 5JH7A 1P44A 3IKTA 2B69A 5KVVA 4AY5A 1EWYA 4OU4A 3O74A 3C87A 2FG5A 3TZHA 1T3TA 1M5TA 1XQXA 1T4GA 4RTLA 2JIDA 1B8VA 4HXEB 2PZ8A 2XKKA 1PSDA 3AETB 3G0BA 3KT0A 3OZIA 1WMAA 2VPWA 4P83A 3TFOA 4TMVA 1L1EA 3H84A 5JJKA 4RMNA 4NZOA 3TSCA 1ZI8A 3L0IB 1CUJA 3VFDA 3RFXA 2WWWA 5IK2D 1TGYA 3CF2A 1PLJA 5CFQA 2DH5A 2FZKA 5AQ1A 1DFHA 3L7AA 3IAS1 4G1FA 4RK4A 1PR3A 3ICVA 3PG5A 4FLEA 1Y80A 4P58A 4DMCA 4EJ0A 3G59A 4IAOA 3OIYA 2J41A 3AM1A 4K9RA 5JI3E 3CW2A 3OLWA 3EPPA 2BFBA 3QENA 2PIAA 1D2RA 1RKVA 3PHGA 4Q3KA 5TXGA 1BVYF 3R7BA 2PMWB 1YR2A 3VU9B 1ZRMA 4RZQA 1GQFA 4X3CA 2EU8A 1XCLA 1YT5A 4BNKA 2Z5LA 1XDUA 4RW0A 4QGSA 1N2CB 1AMOA 3T52A 4RK6A 1WSBA 2J87A 3HLTA 1T36A 3I76A 2XKBA 4EG6A 4X64B 5F1PA 1GCAA 4QD3A 4F9TA 2CE7A 3G0IA 5JSQA 4MHTA 3DPSA 4QT0A 1I7NA 1ZQ9A 5ITVA 1NW4A 2BBWA 1G66A 5CB4A 2GPJA 3SQOA 2JCGA 1E3JA 3HL0A 4POAA 5AKXA 3UHAA 1YOBA 4YBRA 2BPOA 4FFSA 4B74A 1XWFA 5EWJA 2GEJA 3VR0A 2NZ2A 3QKRB 2EP8A 3OLYA 2BEJA 1IJEA 3PEEA 2BKVA 3QJYA 2ZJ5A 3O8DA 3M4ZA 5H16A 1SWVA 1V26A 3IQHX 1OLXA 3ZK9A 2WE8A 3MTJA 3SJZA 1YNOA 4PR3A 3PNLA 4ZZIA 2QM8A 3IEXA 1KQ3A 1B2RA 1G9TA 1IN4A 2DFDA 4DCOA 4F97A 2DHCA 2HMSA 3EEOA 2FVYA 2PL5A 2WG2A 3O92A 3VSEA 2REQA 4HSGA 3ZW7A 2R60A 2YY7A 3N0TA 3PPVA 4U02A 2G1AA 1DRKA 2V4ZA 3FGNA 3IBYA 3NHKA 5EZQA 3EJWA 1KDYA 3CX4A 3RSQA 2V3CC 2IVZA 3F3MA 2KX7A 5B1YA 3HWSA 3P9ZA 2IA5A 1CFZA 4PRKA 5DOVA 3WLEA 3OP4A 1DINA 2QTVB 2GYVA 1K7SN 2I2BA 4R9UC 4EZBA 1S2DA 3AY3A 1ODFA 4FHGA 4MZDA 4BNLA 2BV3A 1AV7A 3W5CA 3ZHTA 1YUBA 4UXJA 1RM0A 1IHXA 2DQ4A 3DB2A 4OFZA 3L4KA 5IDVA 1N6LA 3SSNA 4HNTA 2VQEB 5D1NA 2XCLA 3PS9A 2HCBA 2XHEA 2VC2B 3K1AB 5CFMA 1ZDMA 4HMQA 3ZI0A 1FRNA 1M67A 5CDSA 2BW0A 2X6TA 1JTFA 1QK5A 4FDMA 1VIYA 2OD2A 4FW9A 1JU9A 4OAQA 1CC1S 2CDNA 5HTKA 1IATA 1P4RA 1XZIA 3ZBTA 4AMBA 3A6EA 4DV2B 3GZTB 4ARUA 3HO6A 2GHTA 1EXWA 3E5RA 3RRNA 5IARA 3UUGA 2PPLA 1OROA 1PUJA 2QX4A 5REQA 4DSAA 1DEOA 1ZLXA 1G5TA 1WAMA 5AI9A 2ZYWX 4AWXA 5A4DA 3UT5B 5E9JA 3GA0A 1TZJA 1P1FA 3M5PA 1Y5IA 4EDHA 2AZTA 4UVDA 2HWWA 3RVMA 4NCBA 3KPUA 1LTKA 1Q1ZA 3KOMA 4NEGA 3V3KA 4WCFB 1HX7A 3R8XA 4Y3UA 1MJ5A 1NXXA 3HZZA 2EKDA 1SEPA 2JIQA 3Q9NA 5EZ6B 5IT9A 3DZBA 2H5JA 1CZHA 2VDVE 2FPMA 4NBRA 4QOSA 3ROGA 1BH6A 5J9FA 1J8YF 3S40A 2PANA 4X91A 4LRSB 3S2SA 1O8BA 2FMKA 5AHXA 5IDQA 1Z16A 4LVCA 4N6OA 2G1JA 2ERCA 2VXOA 2Y1OA 4PF1A 4R0VA 3RS0A 4M87A 3WQBA 3FKJA 2Y1WA 4W1QA 2GM5A 4D9IA 1YRLA 2ZYHA 1EK1A 2DWQA 3ZHBA 4G0VA 2C2YA 2C5FA 2QTGA 3GRZA 2XDYA 4P2BA 3MWYW 3U80A 1TECE 2JA2A 3IAHA 1SMKA 2YVAA 3WWPA 4G9EA 3I05A 4BX2A 2AMLA 2X0KA 4X3PA 4HEA1 1BDJA 2IUUA 4KDRA 2RJOA 2A5JA 3NBYC 5KPDA 2XIQA 3NM6B 1HEYA 4J6FA 2G67A 3OCUA 4BLQA 1A77A 2VPYA 1R64A 4BNHA 3BE4A 4WLNA 2OAQ1 4CF3A 2IS4A 4UAJA 3WJ2A 4DPLA 3CV3A 1OZGA 2VKQA 6REQB 1Z0KA 1FP2A 2R3SA 3GCGA 1TLLA 3PUKA 4HD8A 4I9FA 4X84A 2QBYA 2RHOA 3OFKA 5K03A 3KQYA 3QKSB 1A9SA 1P19A 4Z0TA 1F8UA 1IN8A 2P4UA 4K0KB 1VE5A 3TECE 1KZ7B 1CEXA 1UJ5A 1BQ3A 4ESHA 3PYXA 3RBAA 4BO3A 5DIFA 1CY2A 2B21A 5KB3A 3CPJB 2PU7A 1YR9A 1JAZA 4Q02A 2Q3LA 3KEOA 3C4JA 3PPXA 4L85A 3OZXA 3EZFA 5LA6A 1XEXB 1SVIA 3L0SA 1I3OA 2ZS8A 2WFZA 3E8MA 4C7MA 2QX9A 5DM4A 3OAAA 4ZEOA 3NO4A 1QR6A 3EFHA 3KAQA 4LOKA 3UJ6A 1GQOA 5HUQA 1YVRA 4J94A 1D8TA 4I1PA 2R86A 3PCTA 2CNKA 1PJCA 5U4QA 1VA4A 3VMMA 1X3SA 4BFTA 4IXWA 4LYFA 1XNRB 3KB6A 3OA0A 3D0OA 4PRLA 2ZM6B 1RAIA 2QLLA 2AUTA 4CDMA 1RWBA 1AG9A 1FU8A 3G79A 3F90A 1I0ZA 4BZWA 3CH7A 4I4TB 5LP1A 3PL5A 2ASEA 2IDMA 4IFBA 4GXQA 3ZWNA 3EQ2A 3LKVA 4M1KA 2J0UB 2MSKA 4Z0HO 3UG7A 1FMCA 2VHUA 1M9NA 4YEDA 4BMPB 3QA3E 4CMEC 3PICA 1E0DA 2GLXA 3MRTA 3PFHA 4IHAA 1ILWA 3QU2A 2AXNA 5G1PA 2E0IA 5IEBA 5LC1A 1XELA 3IMKA 3WLHA 3W2GA 3JARB 3JAWB 1ZKDA 2AHOA 3EXG2 4PYLA 4TL9A 3W7BA 4EW3A 2GA9A 4J7UA 3VV2A 2YXBA 4YP0A 4A91A 4V3CA 1S3IA 4ZKEA 1PZMA 4DXAA 1AKTA 1B1AA 3ELUA 3JASB 3LUGA 1G0NA 3CN7A 4JEHA 2AR9A 2RGNA 4KAFA 5ALZA 1THZA 4ZRMA 3RVSA 3UICA 3GLGA 1IG3A 2BDTA 2QRMA 1MPXA 2VDMB 4QOJA 4XYGA 3UANA 3ZWVA 1M3SA 1GG9A 3DOCA 4MUJA 4P31A 4BXOB 1T0HB 3IFSA 3DO5A 2C2GA 2R9VA 3KVVA 1JZTA 1Y1KE 5KMGB 1S2OA 2F55A 1Z5UA 1T2UA 1VI2A 1FJGB 1BCRA 2WF8A 2Y4OA 4IXDA 5CT4A 4LFBB 1SN7A 5E3JA 2FWJA 3M33A 4U0JA 5CA0B 3ECCA 4Q9IA 1EFRD 4HGNA 4RH3A 1R3DA 4M8NE 5F1OA 5EHIA 2PQ2A 4HPWA 1GG8A 4XUGB 4J29A 5J4VA 1JILA 3VNQA 1R0YA 4QYTA 1XIVA 2XCTB 2ZRNA 3DVSX 3GRAA 4N82A 3PR1A 3TBFA 2BR5A 1VL0A 3PZBA 5DH9A 2IXFA 5L45A 1Y7LA 4FI3C 3L7JA 4B3DA 3OLZA 3MGGA 2E82A 3C3MA 4JR2A 3AVUA 1N6IA 5IFLA 4CEHA 1R6UA 3HCNA 2EW1A 4MDEA 5E6SB 3OMLA 2GBLA 3CF4G 1CQJA 1J20A 5KC8A 2G4VA 2C7PA 3DEZA 4JK3A 5LLTA 1EJ0A 4JGIA 3TNYA 2FPSA 2GLTA 3IXMA 4YXWA 3QRWA 4LV5B 1E64A 4R8MA 3H2KA 1KI6A 2GN1A 3MM4A 4O2BF 1YHNA 2NTEA 3H5NA 1OQAA 3OOEA 1QO0A 5AI0A 1M2VB 1DEAA 3VDNB 3WDLA 5A4FS 1FQKA 3FNEA 3M3HA 3DBRA 2HPAA 5FFMA 2W6JD 3I52A 2E4XA 4ZFNA 2ZEJA 4UZFA 5GJCA 3CMMA 5GWXA 4NAHA 4HDSB 1W75A 3QVGB 4CWAA 3OO1A 4J0IA 4RZIA 3EVCA 2QG9A 4YAJA 3OCWA 2C4KA 5JV5A 3R9WA 2UVDA 5IMBA 1UQTA 3NS7A 5HDBB 4PRYA 2NTJA 2V7XA 3HLKA 4J1NA 2PBFA 3V4VB 4EB3A 3EG9A 1KA9H 4MSUA 1RAAA 4IZ6A 3WL6A 3HP4A 4F9EA 4KRYA 4P82A 3MWDB 1REQB 2QSUA 2AA3A 1F06A 4RTRA 2YN2A 4AJ4A 4TZ0A 3T9CA 1EM8B 1NATA 3MS4A 4YAFA 1N8SA 1P1CA 3PXAA 1HLFA 1OGIA 3RTEA 2Z5VA 4BZPA 2I9KA 2OORA 2IEDA 4FU0A 3KQNA 3I4CA 2XDQB 5AM4A 5IU6A 3JVVA 3EX7C 1K0FA 3RWBA 1EVIA 1TT7A 1E63A 1XQ6A 2IPAB 3T5PA 3RC7A 1XTJA 4KQXA 3T7CA 2WTNA 2A0WA 2NSJA 3Q85A 2YJ5A 3HBFA 2FHPA 1G2QA 3DZGA 1DO2A 4L57A 1H3FA 1WY7A 3IP8A 5AP9A 4W7SA 5EZ5A 3N6VA 2ZIGA 2LCQA 4B3MB 2FP3A 3Q3GE 5KYXA 4DMMA 1U2GA 3OPXA 4L76A 4ZOLB 3KYBA 2PGOA 3PD1A 2AMVA 4FJ0A 4UASA 1KQGA 3TINA 1JAXA 4BBAA 2ONKA 2JLYA 3HN2A 1BG6A 2GTPA 4M83A 5KVQA 1RXCA 2LV8A 1UBCA 2Y2UA 4IHJF 1O5IA 3MQ4A 3FFXA 4HFJA 2VG8A 4IO0A 2A1IA 2WWVD 3W5IA 2W2KA 3B7GA 3DKRA 1SVKA 2Y71A 1KJYA 4LJ6A 4PHGA 2GZDA 3O47A 5G0WA 3RADC 2O2YA 3I5XA 1W76A 1VYUA 4FEYA 4GUAA 3J7TA 5LDHA 3RRMA 3B13B 3L04A 5EIBD 1HE3A 4RH1A 2XB4A 3L79A 1Y0BA 1EIZA 4BIIA 4YHHB 1NP6A 3NAQA 1VCIA 3C74A 1JU4A 4X1OA 3RIHA 5LP6A 5SZKB 1N77A 1FZTA 4L2IA 4ACAA 3D7RA 4B4VA 1M33A 1UPBA 1GGMA 1KKMA 2CLOB 2H65A 3CLSD 3FWPA 4BFZA 1KAGA 4IBOA 2UYHA 3W3ZB 4U2CA 3IAFA 2JGLA 5I4CA 2PGXA 5CXQA 2ZI4A 4N5HX 1C0KA 4HNVA 4RZHA 2JI6A 2ERXA 3DM5A 3KD3A 4ZCLA 3T5MA 2YJ6A 3FLBA 4X66B 3E03A 2EKPA 2NYRA 5I4BA 16PKA 3RIYA 4DXHA 1KTIA 3ETNA 5CT9A 4S04A 1FY2A 4F1JA 3K0FA 3V8NA 2V54A 1TUBB 3OPMA 2OESA 4KBYA 4MEBA 4R54A 4LA4A 3VR5A 3MT9A 1SXGA 3KYIB 4CVNA 3TCKA 4Y98A 5KWVA 3WBFA 4FILA 2HF2A 4O4JA 2YC4C 1HLPA 3MTAA 4N49A 1M5UA 5DW0A 1AQYA 3KDAA 3HRHA 3Q88A 4YRAA 2PIDA 5TY0A 4YRNA 1BMFA 5FEMA 3K70D 3TRDA 3EK2A 4K7JA 1GRNA 1WSWA 3FFWA 1X87A 4DREA 2GZSA 5MHTA 3ABRB 4PU0A 3GO4A 1Y6GA 1QXSA 3LQRA 1YO6A 2JHAA 2GD1O 1TB4A 2VHWA 4EBFA 5KOJB 1VIAA 2R1TB 1GDHA 3YASA 1ID1A 3RU7A 3BB3A 3BEDA 1E4YA 3GX1A 3QLTA 4Q7KA 1JALA 2Q0QA 1A8QA 1WJGA 2ZW9A 5K4AA 2Q5IA 5BWLA 3I9V1 1YQEA 2A0KA 1X19A 3HN6A 4FDTA 2BGMA 2ON6A 1FUIA 2B0JA 4P32A 5DPMA 1L5GB 2HSEA 3FHLA 3ACBA 2OE2A 1GUAA 1DBSA 2RG1A 3S1SA 2H5EA 4Y6PA 4DJ5X 4X8LA 3VZPA 2A84A 4JI7B 2H17A 4BYMA 3MTGA 2QQGA 2SNIE 4K9NA 1L7NA 3NEJA 3ST7A 3T1VA 5FLYA 3OJ0A 3S2FA 1SUDA 1WV0A 2I0FA 3PQDA 2I71A 3C3YA 4A0GA 2OV1A 2VHEA 3U5TA 1W5TA 1X8XA 3PXBA 4OI4A 3ZHRA 1C9YA 1ULBA 4IVRA 4I1SA 2LD4A 4LJ7A 3ZU2A 1ZJWA 1BN7A 3BFVA 3EW9A 3M6VA 1O0CA 3K5IA 2BBOA 1I4DD 1TT5A 1NI4B 4LZOA 5TPZD 3TI7A 3HRIA 1IYZA 1EUDB 2Y1FA 4WNIA 5AMXA 1PBTA 2GZMA 2O7QA 3IIIA 4RX1A 4QWMA 5D01A 1SUAA 1V6CA 4RXMA 5HK8A 1YCHA 3I45A 1BHSA 1WUHS 3DT9A 5BMVA 2ZJ2A 1XLTA 5CRIA 1UJ2A 4DR5B 1ZK4A 2Y1EA 2BI8A 1O6ZA 3G85A 1HH4A 4RMGA 4Z54A 4C6RA 3ICPA 3P94A 3M4NA 3JD2A 1TMOA 1JHXA 5TE9A 2GK7A 4S35A 4UULA 1N1EA 1OH8A 1C9DB 3DE6X 1OWOA 3D3KA 4HK4A 4Q4HB 3FOEC 2IYVA 4PNHA 1FFWA 3AESA 2ZB4A 3U3KA 2G4LA 2X9NA 4DCSA 3TWOA 2IY7A 5L7YA 2VTDA 5AUQA 2G6BA 2CNLA 3BE6A 1QX4A 2AE1A 5FWDA 4DMKA 1GP2A 5I9LA 5KNCD 1BHO1 2I2CA 3DMNA 3TYXA 2PSDA 3STUA 3INGA 2PLAA 1CJKC 1PYOA 1VE3A 3BXPA 3PIIA 4G5OA 2CLCX 4N0DA 1TGVA 1RHUA 3PDWA 4TTSA 3MFQA 3BXZA 3O0DA 4XVUA 2GSDA 3AY7A 4E09A 3FJ1A 4KK4A 4P84A 5F5NA 5A5GA 3AF5A 1IZZA 4OFWA 3SR3A 3W6UA 1ES9A 3OUZA 3RVDA 3TO5A 3I5YA 4RIEA 1Q0UA 1KSFX 2B5VA 3PP8A 5H9WA 1L7BA 1XU7A 3WL5A 2Y0CA 4E5MA 2CLMB 3AINA 3IQFA 3CLTD 4BNVA 1AUVA 1I5EA 4RDIA 1H3NA 1NP7A 4DV7B 3M81A 4B3FX 3BMCA 1IU9A 4GX1A 3PQ4A 4PSCA 4YPVA 5EQTA 1AKUA 2Q5EA 3H3XA 2ZRGA 1UXJA 2P7HA 2WUWE 4KSYA 1SZCA 5HF9A 4A0SA 1T3GA 3ROKA 4D45A 2C8LA 3DL0A 2N1MA 3AVVA 2G71A 4KQFA 2YWBA 3BERA 2G9RA 3BL6A 4QTTB 3TIVA 3JAKB 2N47A 2P6PA 3JZMA 2R65A 4GRAA 2AFHB 2VH5R 4ILKA 3ZXYA 4D9BA 3E81A 4R81A 3KOOA 1QUEA 3U3MA 1V5GA 3P9YA 4BB6A 1RC1A 1U02A 1L8XA 2XNSA 3NM5A 3DHWC 4R69A 4X1YA 3TZQA 2QVGA 3SKYA 3BIJA 3IP1A 3CNEA 4LQLA 5I8ZA 1HV8A 3T3NA 4R3NA 3A2NA 4ESVA 2HMUA 4V2UA 3ZEAA 4ENQA 3D0RA 3X2SA 3DO8A 2VSOA 4KLZA 4PPQA 1OCEA 2PUBA 1VJGA 3HO8A 4MRNA 1XU9A 3KAJA 4AJ1A 2JGIA 1T4CB 3PQEA 3QE3A 1FTGA 4DBVO 4K9OA 2DFLA 4HQLA 4ZRDA 3EG5A 4UNQA 3V42A 4CQJA 5KJFA 1XTVA 4AIIA 3HGTA 2I29A 4CJXA 4DJAA 1FJ2A 4DR6B 2WPNA 3VXKA 1SK9A 1KFEB 3KU1A 1HEUA 4TRMA 5JC8A 1YJAA 4LSMA 1KYTA 1GEGA 4BVGA 1ZGBA 3EB9A 3NUQA 3IKJA 2XX3A 3X1JA 4JX8A 4F6RA 5A2QA 3U3ZA 1SXQA 2Z83A 1RJGA 2WAMA 2QUKA 2D2EA 4GVLA 4L0MA 2CKMA 4RACA 3STHA 3W2IA 3EBOA 4DLUA 3ZX5A 3HWRA 4GRIA 1R5NA 2WKPA 4JJIA 1TYCA 3TXYA 5AOVA 1IUNA 3KD2A 3NVKI 1KMHB 3MYRA 1MAUA 4FFPA 4FGLA 4PPGA 1DIHA 5EY5B 4BNMA 4OQZA 1RYHA 2CT8A 4AKIA 2D13A 4DCTA 3WNVA 3C3PA 3WB0A 1NRJB 1LBIA 2PFSA 3BH7A 3LYAA 3T12A 3MCZA 2BDUA 3L6UA 2Z08A 4I9HA 5J43A 3FWYA 2O8CB 1H2XA 1M75A 1JPNA 4MV3A 3FCSB 1Q7BA 2G0AA 3ZE2B 1XXHA 1OAOA 3IT3A 1I6KA 1VE9A 2QUIA 2JPDA 2EYUA 1XOIA 2GJ9A 2CC2A 3OJCA 4FJ2A 3T1NA 4EO4A 1KO8A 4GM0A 1AIPA 4IZHA 1R4AA 1KY4A 4Q82A 3SWWA 2CMGA 1U0HC 4QECA 1XRNA 1MPTA 4WGFA 5KVSA 2IXGA 2OP0A 1XTZA 4XRRA 2QT9A 5MDHA 2WI8A 4FMBB 3HUFA 1Q0ZA 4V3BA 4GICA 4FB4A 1RQGA 5BNZA 1NZDA 3BK7A 1PWXA 1YS1X 3F4BA 3I9MA 2NUAB 3O2QB 1XRMA 3GT7A 2PKEA 2FP4A 3LLSA 2DWOA 2B25A 5LUAA 1VL5A 4FKMA 1KI2A 4JDPA 4OQYA 3RD5A 3TOSA 2D2XA 5EMLA 4IL5A 4IW3B 1CUEA 1QJCA 4F21A 2C7QA 4U3JB 1R6XA 4N40A 1MC8A 4NP6A 4RU1A 3OP1A 1TEVA 3OQPA 4LCEA 4NVRA 4RQBA 4WKCA 3DOFA 4NJEB 1K6JA 5KOYA 4XVHA 4OXNA 4F85A 5AUPB 4IG9A 2NXJA 2R1UA 4Q05A 1RJDA 7GPBA 3G3EA 3HPRA 2LZ0A 2EWVA 1A4XA 1KP2A 3OM1A 3HKBA 2O8EB 4COOA 1PZFA 4FYJA 4WBNA 1PFKA 2W11A 4OHPA 4G5XA 4H18A 5TJHA 2HZBA 5IAJA 3REGA 4QBGB 1ZD2P 5BT9A 1J39A 4RYDA 2D06A 1VMKA 1M2GA 4KIUA 2W4MA 2H7XA 3HYCA 3CRNA 4H0FA 4IRXA 1NNLA 1M10A 4TN5A 2XD4A 1XMIA 3SU8A 4C0KA 5G1OA 1QG0A 1ZD5A 4G3XA 1D6JA 5E0KB 3ZH2A 1EFUA 1FU4A 2GESA 3F5DA 4KXUA 1U28C 1RRFA 3B36A 4TXJA 2ZJ8A 3S2EA 5JQGF 5JYBA 2P6RA 3AILA 1NSTA 4HVLA 1RPTA 4RY0A 2D4AA 2NU7A 1G5FA 4OK5A 1I4OA 1VYHA 1MZVA 3FSGA 5FBKA 3RV4A 3VJKA 4QVKA 4QUDA 4B81A 4OLBA 3G2QA 4HDNA 4LF6B 5HJ2A 1XDGA 3IDAA 1JJBA 1GG5A 3O4RA 3OHPA 3FCEA 2HT1A 2QQ0A 1QRDA 1R74A 1YACA 1BWRA 1D7AA 1ORDA 1QRRA 4FS8A 4O3FA 3ZYZA 1C8KA 2WJHA 3D4NA 5KOJA 2YZ2A 4ZI7A 5AVKA 4OLFA 3CSDA 5TF0A 1BXGA 1HFJA 2VPZA 3R3ZA 1P7ZA 3UAWA 5IP5A 3LVBA 2XXAB 4DC1A 1EFKA 3PUYA 2RC5A 1KEZA 4E5NA 3ZDAA 4UM9B 3ZWWA 2QAGC 5AI5A 4HZGA 4FYIA 4AUEA 2P91A 3JQAA 2JHCA 4Z5XA 1N0VC 1TM1E 2VAXA 5DRTA 3D8HA 1XALA 3G23A 4CLHA 1IEVA 1Q1BA 1G64A 2HGZA 2XOKA 3LFTA 2AOUB 3ND7A 4TM8A 2H1IA 1VE1A 2X3FA 5EJFA 1SIOA 5HG0A 4B82A 2COKA 2L17A 1U2ZA 1T0JB 4J43A 4BQFA 1XPUA 1ZMOA 3OZTA 1IIBA 1SZPA 1S01A 1NYQA 1T5BA 2I87A 1TQ8A 3H04A 1E3SA 2QMUA 1DJOA 5D3MA 4CUZA 4UXIA 1CUUA 4PC2A 1NLYA 1CY1A 3HYSA 4ZYLA 3W2TA 1JR4A 4MPTA 5JAOA 1ZHFA 2R11A 5HZHA 1GADO 2YQ4A 2ZVPX 3V1TC 3IEMA 2JJ2A 2DHQA 2PD4A 2QI9F 4MUEA 4GKVA 5GGYA 2PL9A 3PDUA 2GAIA 2PS1A 1RP7A 5A0FA 3U26A 1QYCA 3X44A 3TIXB 4CUKA 3OHSX 1JT2A 4XWYA 1BDIA 3JQDA 3NWPA 4IJ6A 4D4HA 5KWIA 4TQUS 5DEOA 1E1RD 4FLMA 2AN1A 1J8QA 4WZBB 4FINA 1RBMA 4OKNA 4V02A 4B6OA 4TRNA 2IHKA 1MO5A 4MB2A 3K09C 1SBQA 4UZEA 2X4GA 4OKSA 2J9GA 2R7KA 1JHRA 2CXSA 1KR5A 4JOCA 2C57A 2ZYIA 3GJRA 1RVDA 1HL7A 2WWTA 2V7TA 2POCA 1RXSA 4L9WA 2HMAA 3WJ1A 2FPIA 4MICA 1ZGHA 5D85A 1JPUA 5FTMA 1SB8A 5MN5A 3IT1A 4O59O 1SUEA 5LIRA 3GFRA 4PZEA 3C14C 3EC1A 3PEWA 1DAPA 3HJFA 2P35A 2XVMA 4ACBA 1OIVA 4YWJA 3ZXIA 4CTMA 3I5MA 3ZDBA 4MW4A 4ZALA 4CM9A 3G8AA 3BG5A 5BV2P 1VMDA 4I3FA 3ZQJA 3K15A 1BDHA 4S1WA 2WJ4A 3EXIA 1UZMA 5FPKA 1Q74A 2CB0A 3P19A 2R8BA 3B6JA 1ZQ1A 2CFRA 5CH5A 5DU2A 3QBTA 2C31A 1T6YA 3OI7A 2YWFA 3KJNA 5IABA 3JCZA 3A4MA 2C4UA 3MJSA 4EVIA 4PTLA 4UTZA 4B9AA 1VKRA 1H23A 3DW3X 1DKNA 4FFLA 5TT0A 1F7VA 4QOGA 1XA0A 1AKYA 1NOKA 5FPSA 1ZSNA 5B57C 3J80A 1IBSA 1QZ3A 5FTNA 2QR3A 1L4BA 3RUCA 3AEKA 2OK8A 3FCOA 3CKMA 1P74A 3LIPA 4LWPA 2ZGVA 5JZSA 4I4NA 4GKJB 2P2DA 3PQ5A 3FSRA 4NDZA 2CZCA 3DYIA 2Z1MA 4KWTA 4YNBA 3ABSB 2VF5X 2Q6IA 1QGUB 1Z07A 1CVLA 2Z9CA 2QENA 4WV3A 5AJWA 3UCXA 1OLSB 1R9NA 1R8QA 4HNAB 1LZKA 4ZT6A 3NH9A 3NTVA 1C7ZA 4U6NA 3VNRA 5ALLA 4CMAA 1I2MA 2HPHA 2WV9A 3H5TA 4D1YA 5KAMA 3FNIA 4MPPA 3HV0A 3LY9A 1N75A 1UOEA 5FOXA 4YAOA 1Q7EA 3QPAA 1Y1RA 3VR4H 1TYAE 3PC2A 1KL7A 1R0XA 4AY2A 1SC4A 3UXYA 4M0CA 4HAIA 1XMQB 3QJ5A 4K8RB 3WRVA 5TT1A 5LKAA 1U8YA 4I2NA 4XIFA 4FYPA 2Y4NA 1NJ6A 4XJVA 3WYFA 2IV2X 2V1XA 4IIYA 1Z82A 3NBUA 3N7AA 4IJQA 1CR0A 4B3CA 4F2WA 4YT5A 4F38A 3C41J 1E1NA 1SKUA 2HGSA 4HWTA 5ALIA 2JGNA 2JFFA 1W9MA 2HDNB 3JQ7A 2ONCA 5CVCA 2QYSA 4TQGA 4ML3A 3JVIA 5D5QA 2GDJA 4PYIA 5JE8A 1O3YA 3CWCA 3ZXXA 4BNWA 3PLRA 3DLHA 1E7QA 3B6EA 1I5OA 3FTNA 4ENTA 1JTVA 3R7WB 2F43A 5CX1A 2AQIA 2P4HX 4LJAA 2Z3WA 3QQ5A 4LXXA 3UUFA 4BV3A 1DUSA 2X77A 1UMCA 2E4UA 2Q5HA 2F9MA 2PUVA 4BBZA 4DQXA 4E6PA 5AKYA 1XJWA 5DXAA 2HV8A 3RV3A 1SHJA 4BJ5A 3BMNB 1JH8A 3GMIA 3BE8A 3CT6A 4YRFA 5EE0A 1XTKA 2R7NA 1C1XB 1T6NA 3DA8A 3TAXA 4BNJA 4LF5B 4X7BA 1KFCB 4CZ2A 4K9MA 3AHGA 4WXRA 3FNRA 1NQXA 3E15A 1WMBA 3IEUA 4FVTA 4PPFA 4X85A 4YCAA 3T7DA 4ZHQF 4BGDA 4EJFA 3TLEA 1IEQA 1L7RA 2HHCA 4NBWA 4C14A 3CNQS 4EFMA 5ANRB 5IJZA 4MUHA 3L8EA 4I7EA 1KAQA 2DFKB 3FZYA 4RTKA 3MBKA 4JX9A 1RQRA 2J6IA 2PVSA 4BMSA 4H6VA 4OL0A 3RYHB 4TKVA 3SBXA 5K0FA 2ZT5A 4RABA 3OX4A 2JF0A 1GKLA 5TGDA 1QF9A 4AMYA 4D9EA 1Q0SA 2VJQA 2Q29A 4MV7A 1NF8A 5IKOA 4K86A 1SBHA 4HLUA 3B60A 1J21A 4YCSA 3A9UA 2NTNA 4E30A 3AW9A 2AOVA 3WDMA 4EY3A 3B5IA 1HYQA 4IHKA 2QP9X 4DANA 1B0PA 3AFNA 1KAOA 3E9MA 4C1NA 1EXMA 3V6LA 3DMPA 1J8DA 1KJ9A 3PQ8A 1ISRA 2XUPA 4V24A 4A82A 821PA 2WICA 1E0AA 4NZZA 2Z9BA 5BUQA 1BQ4A 1MBZA 1PX0A 2VJKA 3E22A 5HKAA 1L4KA 2EEZA 3NT4A 1M76A 4HH1A 2AMFA 4MYTA 4M1WA 2K5UA 4L50A 1N9GA 2ZRMA 3B85A 3F5QA 2OBXA 1FFAA 4CTKA 5TMEA 4OX9B 3SVLA 1DQRA 4EPWA 4JWTA 3EGXB 4I6JA 3LGAA 4US0R 3ZV4A 3ABIA 2AT1A 3EVFA 5CT5A 3RFTA 4RQUA 4IDHA 4O4HA 1R9JA 1CQIB 2J7KA 2O0KA 5KDLA 2VF2A 5DBHX 2QMEA 2YN4A 2HX1A 2VZ0A 3NEPX 4CLDA 3LX6A 2RSLA 1H94A 5CPFA 5L9AA 4JVSB 4UQLA 2HNBA 3VZSA 1L5QA 5JAMA 4YP6A 4X9XA 4XYMA 3LJKA 3KV1A 3P9KA 4LBWA 4LQDA 3ZU4A 4N7RA 1EPUA 2O0JA 3MELA 1E3IA 3T3PB 1G5HA 1NXQA 4DLRA 2IEYA 3WGKA 4XD7D 4ZAGA 2H85A 4GMFA 5NLLA 4ZVQA 4QWWA 2QTRA 3C3DA 1PKXA 2NP7A 1CJCA 1W5EA 3PX3A 1BHJA 5IFKA 3QFCA 4KQJA 2H57A 1CS4C 2PS0A 2PX3A 4PS0A 3RAEC 4F1WA 4PLFA 1C7RA 2C03A 4MR7A 5BXYA 4Q1BA 4D0GA 1W96A 2DR0A 4I55B 4W7IA 2FDXA 3OCXA 4YY3B 1YB1A 3FRHA 4MRMA 1ZISA 4A5SA 2QPTA 1I2CA 2B4AA 3CIOA 3IPRA 3N87A 5T6BA 4YR9A 4KEAA 3DPIA 3VR6D 2RHJA 3BZBA 2M32A 2BUCA 2Z9DA 3GRRA 5D5PA 3G0OA 2O5VA 1F2VA 1XBTA 5LQNA 3I6IA 1VA5A 1LPOA 3KKZA 1AY0A 2XTAA 1HYHA 5DT9A 3TGWA 4ZCIA 4URHA 5JNLA 1KK2A 2WD7A 3QPWA 5H5JA 3BGVA 3AW8A 1U4OA 1V25A 3KL2A 3PENA 4LYEA 4CRWB 2MDTA 2VHQA 2VYFA 1F7UA 3UPUA 5L3SA 2ILTA 2LKDA 4BQOA 2AWNA 1DBPA 1UBGA 1QH1B 1K8XB 4KWCA 2BFFA 4B6PA 7REQA 4XGRA 3SG0A 3T4UA 4DQKA 4I5EA 1BMQA 4L4SA 1QWOA 3H6GA 1UDRA 3P2YA 1RWQA 5LLSA 1GYQA 4D97A 2PNFA 4HNRA 4JS0A 3UATA 1K27A 2C3UA 3W04A 3V4RA 3DMTC 3NXSA 1E6UA 1EDEA 1XGKA 2ODBA 2GYYA 3MILA 4EUHA 1C3LA 1JKFA 4Y6SA 2FOIA 2J6BA 3EEIA 3ZD9A 3I62A 4EA7A 1C2YA 3A36A 3BRWD 5JTUA 1JFSA 1LVUA 1ZICA 3NIDB 4B3TB 3T95A 4A8JA 5LIPA 3TVTA 6GPBA 4JU8A 1R6VA 2C1XA 4IOKA 1E2IA 4TZTA 3B8HA 1X2BA 3DDWA 3OU2A 1MW9X 3GJ5A 3OTGA 4KG7A 2I2XB 3VAZA 1J5EB 1E3DA 3F1KA 4G37A 3CR7A 1S9HA 1W4LA 1FFDA 4B44A 5BP7A 2O54A 1PFQA 3WIOA 3GG2A 3N28A 1OWLA 2QRPA 5JFOA 4Q3BA 5EJAA 1M2EA 1RTTA 2GJKA 2X5XA 3O2JA 4AWAA 3ZCUA 2EBUA 2PMKA 2BEKA 1SVMA 2ATCA 3RVPA 3SAJA 2WZDA 4U7PB 5KSOA 3ZIAA 3JWPA 2Z3VA 3T5DA 2RD2A 3ZLJA 3K9CA 3BGSA 3QPDA 1OWPA 5DGTA 5BSVA 4CEJB 4C6HA 5DCYA 4J0DA 3VYUB 1CS0B 1WETA 4OF4A 3ID6C 4NV0A 3GEGA 4FZRA 4YIHA 4JNCA 5LWQA 4AKSA 3NHAA 2J9FB 4BTVA 3VTKA 1QQTA 3EZLA 2EFYA 1K3UB 4M7PA 1BN6A 2V4UA 5BUSA 2IH2A 5EJ4A 2RGXA 2FSIA 3OQ1A 3OZGA 1HSOA 4P2GA 1F17A 1V35A 2DX7A 3U7IA 1YZTA 1UKVY 1YE5A 1XK6A 5IZCA 4M6WB 4J4TA 4CIVA 3GR6A 3Q3EA 3DZJA 3L7DA 3L1HA 2FEXA 1WCYA 2DVMA 4GPTA 2GWRA 3PEVA 3VU9A 1N5KA 2RHRA 1V4NA 3E9EA 1MFPA 1QS0B 1T43A 2ZP1A 3AONB 3A4LA 4BP3A 1D6NA 1K5HA 4D41A 5BVGB 5TDHA 8MHTA 3AUJB 2BM0A 1G59A 3CUYA 2AH5A 4HMOA 3BC1A 4JJKA 2QJRA 1T6XA 1Z7WA 1N2CA 1GRCA 3D8UA 3IOYA 3EISA 4GMKA 2AD5A 4I4TF 4AMZA 4MVJM 1IN6A 3DT8A 5B7PA 2IW3A 3IKLA 1E3MA 4LJKA 5JXHA 3WMWA 2ZZKA 3RAGA 4IRMA 1RLOA 4NFHA 1BMFD 2O0LA 3F4LA 1P5RA 3LPLA 4OBEA 2Q3EA 4D7AA 1FRQA 1R0RE 2MIIA 1RABA 1CR6A 2OGTA 3FUXA 3JD0A 3VU8A 4BGIA 5DM70 1LJUA 1NC1A 2AC4A 3KR1A 3EGWA 4MRRA 2DECA 2HB6A 3AV3A 3QKRA 1QQAA 3A26A 5G4KB 2Q0SA 2TRSB 2XSZD 3H9BA 1YMVA 2NO0A 3AKYA 4L9AA 2CV2A 3ZY5A 5HKBA 4GF5A 5KYGA 1M7BA 1UBUS 2QTZA 1LZLA 3CRQA 4LHWA 4ND5A 4TWJA 3HKCB 1T1RA 4JEUA 4MB6A 5ALGA 4DPMA 2F8SA 3AF0A 1XZKA 1GJRA 5BN3B 4J0KA 3DWGA 4DARA 2A9OA 3PEYA 1XTQA 5ECYA 3EUFA 4QNMA 3EPLA 1VHTA 1T9GR 2QKYA 4QJ4A 1GITA 5AXCA 1UIMA 4ZI2A 2ACKA 1BMTA 3G88A 3KR0A 4OHBA 4XQCA 4GL2A 3E9NA 5EEHA 1FE8A 4ZCQA 3V4FA 4DWOA 1QJ4A 1X1DA 4WNAB 3H13A 1E4VA 1XMPA 4TMWA 4ER6A 5AVQA 3MJCA 2HV9A 1ZRHA 2RHMA 3LCMA 2WNHA 1ESEA 1N6HA 1X7HA 3ZOZA 3WO0A 1QYXA 4C7KA 3IAAA 1RFLA 3SPXA 3P71T 3BD9A 2HIAA 3ZWBA 4DLVA 2BONA 3L7BA 1IN5A 1JP7A 2GI4A 2QTVA 2XT6A 3KZ1E 5E3IA 1EXNA 2W2MA 1Q7GA 2C4VA 1ONPA 3BH0A 2BTQA 3I5UA 2DP4E 1AGPA 2FSVC 3Q98A 4FLFA 5T64A 3KP1A 2ES4A 1DRWA 2O3QA 2WFAA 1QOQB 2P9HA 1W30A 2NTYC 3PKZA 1O03A 2G83A 4PZUA 3BWXA 3K1AA 3FUWA 3UB4A 4OFXA 4BLSA 4OM7A 3IRUA 2QS9A 4DQLA 3ZWKA 5IANA 3M4YA 4N8EA 2OPHA 5DI9A 1OPRA 5KKAA 4XUCA 4DT1B 4EJSB 1NE2A 5BR8B 4JQYA 1NQUA 3CX8A 3FCCA 3TJRA 3AIIA 1N36B 3RSSA 1G21B 4ZANA 3MG9A 1K86A 1M8PA 3QFSA 4HAZA 2IYNA 4Q48A 3RS3A 3SS7X 4YRMA 5C5IA 3DMYA 1E96A 5FFNA 4Y6RA 4ESOA 2Z56A 1V1MB 4BTLA 1MQAA 2YW2A 2XCIA 3IOMA 3HTXA 2VDOB 2P6NA 1H0SA 2DHEA 3GQBB 4ZVVA 4QYSA 3UT5A 5KQRA 4OJTA 3HH8A 3H9EO 2CLEB 4Q9AA 2N0SA 1FVOA 2ZJZA 4NYJR 1D3AA 4F45A 4JVLA 4K87A 4QDKA 4UARA 5T3YA 3BRSA 1AB5A 4N5DA 1K08A 2B37A 4ZT2A 3TTSA 5HOQA 2DY1A 1CVIA 4FHZA 4QYMA 4WESB 2X8AA 4UDXX 1ENPA 2ZJ4A 1EP9A 4KQKA 5ESWA 2VTKA 2H2FA 2ZPUA 3S0JA 3UXEA 1QMGA 1CRZA 5IUJC 4TV8B 5C80A 4UJ5A 7MDHA 5C32A 2H5LA 1S96A 4LJ8A 2KS6A 3BMOB 3TNLA 1AA6A 1UFKA 3DXZA 1Q92A 2V74B 3KALA 2QAJA 3D2BA 2WNSA 4KZPA 2RHDA 4CIYA 5EZYA 3C48A 1W88B 1K5DA 3E5NA 1KQOA 2R8PA 3BD8A 3R0XA 4K5QA 4ZAXA 1UWLA 4JEMA 4B46A 1TTQB 4DMFA 2XWSA 2RH5A 3ONEA 4EI7A 1YVDA 3UGTA 5JXJA 1CUCA 1BDMA 2R00A 3C6QA 4LBYA 4CDGA 2I3DA 3G13A 4PHHA 2PUGA 2FB9A 2QRLA 1XROA 3JAMA 3PXGA 1P2UA 1V45E 1ZD9A 3UMBA 3KWJA 1ZCJA 5BQOA 1PQWA 2H1HA 1M1YB 3OPYB 4WLVA 2I62A 4MVWA 5J5VA 3WS7A 5YASA 5LDDC 5HP4A 3T7IA 1PZXA 2VJNA 3F6PA 3HDHA 4XJTA 2WQ6A 5JANA 1ACLA 1N0HA 3MJHA 1EAYA 5CH8A 5DYYA 3OSZA 1KDPA 1O95D 3GXOA 1ICEA 3PGJA 3RHTA 3FWHA 3WKBA 4CL2A 4LCBA 3COYA 3EZGA 1JA0A 2FMUA 2HC9A 2XTZA 4OPMA 2JLAA 5BW5A 2E7ZA 1K7FB 3HFRA 3QKSA 1LS1A 1UANA 2Y6VA 5CYOA 3TW8B 3KZXA 1O6BA 4ON9A 4YRLA 1R6TA 3LP8A 3UJAA 4NEQA 4EJ6A 5BV1A 1IVNA 2Q3CA 1UK8A 5J63A 4Y2QA 3KZKA 1AO0A 2J32A 4NPHA 1IZ0A 4LTDA 1EIWA 3ABOB 2PH3A 1PTJC 5CHEA 3SYKA 2FEPA 2J67A 1XEXA 2D5BA 2ZE8A 2MOKA 3AHFA 3KSRA 3M1YA 4LRWA 4LF9B 5JNSA 4GXRA 3TLMA 4XLTA 4UPDA 1X74A 1ADFA 2WJZB 3NORA 5KHAA 3TW4A 5HRUA 2VPPA 4R05A 1DDIA 4Y9TA 4DLZA 1L1RA 3OFVA 2QD2A 3NBFA 3CLHA 1JG2A 3WGLA 2OCDA 2YXLA 1AS3A 3HN7A 3V9AA 4Z49A 4PPYA 1EFCA 3AI3A 4NYMR 4ALJA 3THRA 1U4NA 3QE0A 1O96B 1YFLA 4C08A 1KP9A 3EDRA 4BVBA 2CNDA 3LXRA 4I1IA 4NFSA 4RIIA 5DX0A 2CJXA 2D7JA 5HHTA 2OZKA 1NGSA 3FJOA 1XEWX 4I4TA 3SGLA 3WJAA 1TTTA 4NFLA 3WA7A 1K98A 3OF2A 4AYTA 2J0UA 2XH8A 4Q34A 1KJ8A 3ODGA 4EFDA 2ZTHA 3LFUA 3EA5A 4DADA 3MJVA 2EX1A 2PUCA 2P2SA 3WWCA 3X1ZA 2F2TA 1D5WA 3SMQA 2B2XA 4PBSA 3JARA 3JAWA 4MP6A 3ICOA 4WW0A 1CF9A 2I3AA 3LP6A 4XR4A 4GX2A 3AUXA 2B5OA 1QP0A 3V2GA 3NCTA 2BY4A 1KMNA 1CU1A 1DI0A 3JASA 1QAOA 1YBHA 1CEQA 3OMXA 4L3WA 2PUDA 4QNRA 2HRZA 3N8GA 4G1UC 2NU9B 3U37A 2WMOB 5C4GB 3N3BC 4BXOA 4G8BA 2AMJA 3ZE0B 4BFYA 3MRVA 4OI1A 3UNXA 3P9QA 1AMUA 3DMDA 4CTNA 5KMGA 4E94A 4F92B 1MU0A 1EEHA 2G4CA 2RGGA 2QPOA 2IHNA 2J7PD 3DDHA 1V9SA 3ND8A 4XM1A 4DNFA 2F6RA 1AVTA 2GERA 4PYJA 5JS6A 5CA0A 1Z18A 1SXJD 1XCJA 1UODA 4GS5A 1BW9B 3UJDA 3STVA 5J4LA 3WIEA 3AR6A 1CSEE 1BE1A 1B43A 1TX4B 2CVFA 3ED5A 3EOZA 4FTWA 4D44A 3LT5A 4IWXA 1JKMA 1WDWB 5C5EA 4DNOA 2RARA 4M7OA 3Q9UA 4OYHA 4S24A 4WN9B 3WLSA 4CQLA 5FWYA 2PX4A 1HURA 5GJBA 3UCFA 1N5MA 1G16A 4G63A 3QEAZ 4HB4A 4GDFA 2DTXA 2X2PA 4OMFG 3RR2A 1E2LA 3PTLA 2GOYA 3GVPA 3TOZA 5I4KA 3ONWA 1UC4B 4LG1A 1RI2A 2FK7A 1CDOA 2GN6A 3HJUA 3R6GA 4PTZA 3RBXA 3SNHA 4AROA 5JSZA 5H8WA 4JKYA 2P2GA 3BSWA 1JX6A 3L2OB 3M1IA 4HFRA 4OHZA 4FEAA 4CL3A 3ZWAA 3DG9A 4UUBA 3L1UA 2IITA 1AN9A 3KHSA 4HQ6A 4MYRA 4NAUA 5EUCA 1KH3A 4IYJA 1UC5B 2I2DA 1NURA 1YAJA 1A9XB 1M2VA 1WTAA 3EAQA 4MPDA 4TWIA 1MABA 1JFTA 3SLRA 4H4EA 4WZ6A 4Y67A 1TMGE 2R8ZA 4I46A 4PQGA 5LBUA 2WQ7A 5DT2A 1RPJA 4MLCA 4HDSA 3QVGA 1E18A 1XDBA 1ODIA 1FMFA 4GSKA 1IHPA 1M2KA 1JDSA 3GGCA 4YGXB 3U19A 1DG3A 2OCXA 4YJKA 4L75A 2PEYA 2QZSA 3KJIA 3HLYA 3SX0A 3MWDA 1U0BB 1REQA 1W44A 2QLTA 1GILA 2FSHA 5EIOA 4A26A 4P93A 1GUDA 4RPIA 1A9OA 1B0AA 1KEWA 1EM8A 2IODA 2YHIB 3H2HA 4UDOA 5SICE 3RFUA 4ER0A 1OFUX 1F2UB 3AJ8A 2NO1A 3W5SA 1NPDA 1WZUA 4ZZ2A 1ZCFA 2E89A 3AXTA 2W43A 4JB3A 3EXFB 4R2XA 2B4QA 4M0KA 1DBIA 3R5KA 3W06A 5JASA 5HYVA 1LQTA 2XDQA 2XOKD 1RE1A 1I3KA 2JLQA 1KK3A 1UAYA 3JQGB 4RZ3A 1QSGA 1RBYA 2Z6UA 2VPTA 5ALSA 2P2ZA 3QBJA 3B6IA 4JITA 1CE8B 5I9SA 4CQMA 1MA0A 4F4DA 2G9NA 4RJIA 1RE0A 5HZMA 3TH5A 1AK2A 2OHGA 3DXFA 4TS4A 4MCJA 3K0SA 1P17A 1FDOA 2JJ2D 3LWBA 2PSJA 4QDZA 5CD1A 3KQLA 1D2MA 1X1CA 4QDTA 1EK0A 1HMYA 2L2QA 4ZOLA 3CVYA 1Z68A 2QNIA 1ZCBA 5D87A 2M6RA 2JI8A 3W4IA 3CCFA 2O5CA 1ZH0A 2VHTA 4TVKA 2W2LA 5C1DA 2ZRJA 2X86A 5EIAA 1JKJB 3HGQA 3ZLTA 1LPPA 2JGJA 1DCTA 3ZE1B 4FONA 4KODA 4MGYR 3I2IA 4N3NA 3IIJA 2XYVA 1XMJA 2C99A 2ORVA 4PQRA 1FYFA 2DBQA 3U40A 3WFIA 3WK4A 2VQFB 2BCEA 3GELA 2G28A 2B8TA 2IYEA 4CQMB 4J76A 1Y9ZA 4NXNB 1ZD8A 2AR0A 4L4ZA 3HFJA 1JIIA 4KQEA 3O2SB 4QHSA 4HYTA 4M0DA 3CE6A 2ZOSA 4FFBB 2ODQA 4TMTA 5EJGA 3NKFA 3SBEA 5CYGA 4ETMA 2HXSA 3VZCA 1HTBA 1YS4A 2BF7A 2RGUA 1PL7A 4IO1A 4E5YA 4Z7NB 3ADBA 2WA1A 1SOUA 3G2MA 4CEIB 1VRWA 2PU5A 4Q7LA 1F8XA 3Q8KA 3HDYA 4J1QA 1I7LA 5KTSA 1H2RS 3RVLA 5FV4A 1CIJA 1TUBA 4K2HA 4HV4A 1UEIA 4MK4A 1MVLA 2MYNA 2YWGA 3LYUA 1UBOS 2GWHA 4WOKA 1XN1A 2VAMA 5E1OA 3RU3A 1RI1A 3ZBUA 3EULA 1J00A 3OE7D 1ISIA 2NQ2C 3HDTA 4DJDC 4OVKA 3A06A 4ZEMA 3WADA 3WGVA 1V9LA 5DNEA 4N0PA 2JLBA 3AR7A 5JVDB 2I8CA 1MW8X 4M49A 2WOJA 5DNVA 3U44B 5IJ9B 1WPGA 4PZLA 2Q3MA 3DWFA 5ELMA 3X1WA 1I4TD 2C4WA 5CG2A 1Y5MA 4XD2A 2EFJA 2JIMA 2P6MA 1XZ8A 1ZVVA 2Z04A 2FN3A 2R1TA 1HQDA 4B3SB 4RF2A 1FTSA 1JA9A 2FPKA 1W1IA 3D8BA 4JELA 1D4FA 3TOCA 4EGAA 3T1TA 2OUIA 2QL6A 3I9LA 2HWUA 3K20A 1YJQA 3IQWA 5TJ9A 4DRZA 5IBCA 4J2HA 3ER8A 1N3LA 3T61A 1LQUA 1OWMA 1KFKB 2HDOA 4JOSA 3HC7A 3WV4A 1FTYA 3U7HB 2LGJA 4UBMA 1O4WA 3HABA 3PFBA 4OSOA 4X3OA 1ZN7A 5HEKA 3U7QB 3ZJ4A 1C30B 4RVUA 2FWRA 2ECPA 1M6YA 4F4HA 3GVXA 1P9NA 2VP4A 5G3ZA 4MVJA 4DC9A 1XZBA 2IH4A 1MFZA 2FW8A 3EAFA 1YU6A 4LDJA 3DBLB 4D8VA 2FX2A 1W85B 4IDNA 2VK4A 3ES9A 3K0CC 2C7RA 1SKAA 3KYDB 4IFTA 4FC7A 2J45A 3NBXX 3NKLA 4KGVA 1C4OA 3GFBA 2FUG6 4JBNA 3V8PA 5F2NA 2B98A 3NX4A 4IGAA 4KFUA 5DJ5A 4YREA 1EUDA 3E0XA 3QNMA 4L74A 5AKKA 5KQSA 2P1ZA 4K6FA 1C9KA 3HE3A 1YR6A 4GEKA 1JWLA 3F7MA 1SVSA 1QANA 5JIBA 2FY8A 2RFLA 3FPJA 4OO3A 4E31A 3BGDA 3IJ5A 3SFTA 1GWNA 4KRFA 1UBNA 4RS4A 1CZOA 2HQRA 2QN1A 3A31A 3GROA 1E5LA 2PG3A 4ENPA 3HXMA 1XLVA 3FYUC 4YDSA 5EE5B 1P2TA 1PNQA 4V0MA 2R2AA 5FA6A 5CLGA 4TRRA 1Q0TA 3S8EA 2I22A 1ZAKA 4M1YA 4Q4HA 2BLLA 2Y2VA 1OXUA 2ISCA 2XMRA 1UT8A 5ALPA 5DXFA 2E9SA 4YYEA 5ISMA 3QFHA 4Z4QA 4KO4S 1TD9A 1U99A 4GSYA 4KUEA 4N8DA 4X71A 2VRWA 1TYBE 3QOFA 1P1BA 3A04A 3F47A 1YCFA 4PAGA 3I37X 2F8LA 1Q0HA 3REQB 2B20A 3PNMA 1X14A 1P62B 5DHAA 4HT3B 2DEUA 3K5HA 4FN4A 2O57A 2H9YA 1Z4JA 1C3OA 1TVKB 1XZCA 2AFIB 2LKCA 2ZQ5A 3OOSA 4IM7A 4MKGA 4Y0VA 4CM1A 4DM7A 1T9HA 3UC9A 4YRSA 2DETA 1SBCA 3HZOA 3ONNA 3PUIA 1DBWA 3G0CA 4HLQB 3SDBA 4UOQA 2OQRA 5T5QA 2GTIA 3MMSA 3KEGA 3AF4A 2OEPA 3EIFA 5DTMA 3L06A 5BN4B 4DBZA 1NAIA 2QQFA 3DGFC 4A27A 3HRKA 3ZK8A 1N2JA 4MINA 2Y0EA 3I8SA 4PVDA 5ECGC 3U2QA 2R5NA 3CNOA 2CYCA 5AI8A 1AKEA 4UHEA 3WK9A 1KNQA 1MV8A 5ALYA 1GL7A 4M38A 1ZIYA 1FLDA 1R12A 1WXFA 2AD1A 2JGDB 3FKQA 4DA8A 3THYB 4S1TA 2JAUA 1SCJA 3LUHA 4JUIA 2OXRA 2YJ4A 4A6XA 4E46A 1GA6A 2AKEA 4DCMA 5SZHB 1JR6A 3TL3A 1JI3A 4CN8A 4JL5A 3FVRA 4QUEA 1AQIA 1NTOA 2V5AA 4W9NC 3JAKA 1G8KA 1NLUA 1RKXA 2W2QA 3LCCA 3O9ZA 4V1CI 4U7TB 2AFHA 3QQPA 1T9ZA 4LDAA 4CMEA 4FDAA 4PSAA 1IRIA 1E9BA 2EC5A 4M3NA 5KU7A 5F3DA 4ND3A 3RVOA 1N32B 3UFXB 2XT0A 1ZIOA 5ENZA 1RXIA 4KE9A 3R5FA 4BC0A 1Y1PA 5KOHB 2JZNA 4BP8A 1QHFA 3WR5A 3KB2A 4HB3A 5A02A 2P40A 3P96A 1IQ0A 2MSCB 3JQPA 3P4YA 4TROA 3HA5A 3S1LA 1P0QA 1MG5A 1A96A 4ZYTA 3HB9A 3QVVA 5AT1A 1SUIA 4Q4DA 5T8KA 4PC1A 1T4CA 4YACA 3UK1A 4L5JA 1DHRA 1ZN8A 3NXKA 3UYKA 4IVNA 1GAQA 4GAEA 1KGSA 1SCAA 4OHXA 4CMHA 4R6XA 4NCIA 4NCJA 4R2JA 1OXMA 3X43A 4GWGA 4HQNA 10MHA 1ODCA 2EERA 1BWQA 3QOYA 1HOXA 4N7BA 2W6QA 4FNOA 3EIQA 4LMBA 1C3JA 1Z4LA 2RGDA 1Z25A 2J4DA 1CZLA 1FQJA 3C6BA 3M7IA 2YS6A 1Z26A 3OZUA 2VJOA 4N8SA 4F56A 3DZ8A 2J85A 4LHYA 3JQQA 4IFEA 4LMAA 5JCOA 2FTKE 3FWZA 4A2PA 3DAFA 4BFUA 4K28A 3Q10A 2KJQA 4JLUA 5GTDA 3EARA 4N54A 5ESXA 1HDRA 4FFOA 2GFQA 1PV4A 1KMHA 1Z0FA 2C3PA 1WY5A 4LC1A 1RWXA 3BMXA 3VPSA 1ZI6A 4L08A 2FWAA 4E21A 2C5AA 1CNEA 4WZZA 3IBSA 4JLJA 4R98A 3FPLA 3PHHA 2VSFA 5FT9A 5JECA 4D6XA 3GLUA 1QHGA 1E2FA 1TJNA 5JLJA 1RVV1 2NVOA 3LUJA 3WRYC 4UE3S 5A5DA 5IJWA 1N34B 2WE7A 1EVQA 5CK4A 5LZ2A 2CLDX 3B89A 3SZRA 3IEIA 3BRCA 4PCUA 4YGYA 1GTJ1 4UTXA 3DKPA 4B31A 4BNFA 4CV3A 2PUFA 1PBNA 3IKVA 4UUPA 3EHEA 3UAVA 5BSHA 4RSMA 4G07A 1JLMA 4J0CA 2QD5A 3E53A 2FCAA 3OX2A 5I7FA 1TADA 2Z4RA 4MROA 1VKHA 4TVOA 2HRQA 3AXSA 3UTCA 1G0OA 1PLKA 1VI6A 1YA6A 1L5SA 5F52A 1WR8A 2NUAA 2GJSA 2JW5A 3EXEB 3GFVA 3K3PA 3QM1A 4PC7A 5AWFC 4FK8A 4JLSA 4WA7A 2CBGA 4EJSA 4EHLA 4KN9S 3K6KA 3ESQA 4MEAA 3ZHVA 2OP1A 5AK6A 1WEKA 3EIHA 1ZD1A 4YJFB 3B51X 1W8DA 2IS2A 2V6IA 2P30A 3FH0A 1YJBA 3TXAA 4I6EA 3V8MA 4PN7A 3ZIAD 2GPYA 5GVSA 4NJEA 1KYXA 5ADVA 5FB3A 4LSWA 2Q7DA 1GL3A 3VNVA 3CSSA 2HCRA 5JUWA 3GDFA 4GOXA 2C5SA 4KLRA 1D0IA 3IQDB 4LVUA 2ZRCA 5IH7A 4X92A 2BUBA 4JJ6A 4KMMA 1WBDA 1TVCA 1WW8A 2A0FA 3OIUA 3R6LA 4TLEA 4ND6A 2QAIA 2YWRA 3OZRA 3KKMA 3KUKA 5D8DA 2CV1A 4XYLA 2YOGA 2GF9A 3R41A 5EPEA 4EFNA 3F49S 2AEFA 5A4AA 1FYXA 3DMGA 1RAEA 3RS2A 4I3HA 2QZ4A 3OZBA 4NY1A 3UT0A 4WJLA 5KSZA 2ZCUA 1UOOA 2OKGA 4X24A 4XFJA 5JMOA 2UUBB 1VL1A 4JB8A 2EDAA 4RTSA 3FIUA 3EDYA 3KELA 4QGAA 1FLNA 2FXIA 4AU1A 1F6DA 1S7CA 2OLEA 4AO6A 3KDSE 4TXLA 4YV1A 5LD2C 1EUZA 5AHRA 2H4WA 3O75A 1DXHA 1SRRA 2QJWA 5TF4A 2ZETA 2JARA 3V1UA 1QTIA 3OM9A 4CG0A 4V0OA 1YZFA 2BKLA 1NUHA 2C2MA 3IALA 4LF4B 1TU4A 1I10A 2ONZA 3U56A 3JQCA 2XQFA 2CHVA 3BCSA 4KYUA 4M9ZA 1HTTA 2WY2D 3V4SA 4Y6QA 1MD9A 2K87A 4G8JA 3C97A 1A2BA 2FMIA 3E61A 1NJSA 1BH2A 4E2YA 1SQ5A 3QH4A 2ZZMA 2V6FA 4MUBA 3PHBE 3OOJA 1KKUA 1TVEA 2YZ7A 4JEIA 4MARA 4AS2A 4DJTA 5A4KA 3BFXA 4ZVOA 1BZYA 2VO1A 1GZ6A 4M2LA 2FN4A 3GD7A 4QUJA 4OXQA 4HGYA 5COQA 1LPMA 3DAHA 3QTLA 4FE3A 5KWJA 2ZYGA 3SQDA 4DSTA 2ZUEA 4V39A 4YTEA 1Z2DA 1PNRA 2LP4Y 1S4QA 3L4BC 3ZBQA 3NFYA 2F3RA 1OWNA 2CMDA 1JJVA 1NVFA 7AT1A 1VRVA 1WW2A 1DDOA 2GCPA 2QGFA 1ZJYA 4RGYA 3HVRA 3FSJX 2OC4A 3NVMB 1H9CA 3DFIA 4D8YA 3LDAA 4Z6KA 4MI3A 4WZAB 3AP2A 2XYRA 1ZS9A 1F3LA 1CR1A 3ITEA 4I99A 1PJQA 1V1RB 3GGSA 1X15A 5LQDA 3CUVA 1POWA 4MV8A 1DFGA 1ZOPA 1EDOA 2W8BA 1V1JA 3KTAA 4N5IX 1EGQA 1NV9A 1D03A 3BKXA 3EVTA 3NNSA 1T3ZA 3HCWA 5HF6A 4MV6A 1L8AA 5E2AA 4RIGA 1DUVG 4EYKA 1KU6A 3ODPA 3PA6A 1XRJA 5CB6A 1DE0A 1FXSA 3KWMA 5I7SA 5JCXA 2QZJA 5AXBA 5BW4A 2J0VA 4PX2A 4KITB 1YRHA 4QEDA 2P8SA 2VRBA 3QY0A 3VQTA 3KQOA 1E5TA 2Q9UA 5J3JA 3ZCVA 5B30A 4KE6A 4U8GA 2NIPA 3NYIA 3FLEA 5DN9A 5FUXA 4KREA 4I55F 1Z08A 3ZG6A 3CINA 1JSRA 4J6EA 4KFTA 4M9RA 5FBLB 3R9KA 4Z7QB 4HGQA 3QVXA 4MR9B 5B6IA 4A15A 1COWA 2FFQA 4GX0A 3BHNA 4OG2A 2F3TA 3K6SB 3LUCA 3PD7A 4L9SA 1CD5A 1A4IA 4IFIA 3ZY2A 1DMRA 1HNNA 2FWNA 1PZGA 1P4JA 3V4OA 1FRZA 4KX3A 2YZGA 1YE3A 2OOKA 4KZKA 5K0CA 4JXXA 1EFVB 1T6BY 3P0HA 1XL1A 3SYLA 1JEJA 2E4VA 4KC0A 2QW1A 1G8FA 2OO5C 1J1ZA 1EUCB 2PX6A 1GA4A 2CCGA 2Q6KA 3PE3A 3AFHA 3I4LA 4X65B 1E6LA 1N5OX 4LY9A 4ZJUA 3MCTA 4DJEC 2BGIA 2YY5A 1NV8A 2C2ZA 2OCKA 1L5YA 3OG9A 3F6EX 1SO8A 5FL7A 1L8LA 1P0IA 4GOOD 1BD4A 4QGBA 4JJ4A 3V46A 1K8ZB 1IE3A 2I54A 1QGUA 1N7HA 2VYVA 3NR2A 3OQJA 4DR3B 3VPGA 4EARA 1RM4A 5BV0A 4HNAA 1OAAA 5DK6A 5LPNA 2CLHB 3RUEA 3LYLA 1UR5A 1ZN9A 2G3YA 4TVSA 3H0CA 5K8LA 4CQNA 1SQFA 2OV6A 2GILA 3L0ZA 2CUKA 2ZSAA 1VHWA 4P80A 4UW9A 1SOAA 2FEMA 3TAHA 1AX9A 2QMQA 3GUZA 3HNOA 2VDRB 3KB8A 3B82A 1UKZA 1BWPA 3FZQA 2JFHA 3DOEA 1OYYA 1JT9A 3A58B 1P1HA 2IOHA 2WJWA 4IGIA 5FR1A 2XBMA 2DR3A 3T4PA 1EFHA 4TSFD 4QXRA 1WCIA 3D5TA 5JJ5A 2W58A 5KDDA 5BNWA 1PJ8A 3MSXA 2TMDA 2DT8A 3TRKA 3PFIA 3LVRE 2HIHA 2VDNB 4DNPA 2PFGA 1GHTA 2A30A 1QIEA 5DM0A 1XVUA 2PXXA 4DCJA 1Z45A 2OD7A 3PQFA 1KEUA 1V5EA 1Y3CE 2AJBA 2NSYA 4FP9A 4CYMA 3THWA 3VTAA 2PV0A 4F6CA 5IWCA 3BDAA 3I04M 4GP6A 4MGHA 2P0AA 2BGLA 1H2WA 3MAGA 4XDYA 2RH4A 2AI3A 1RWOA 3R7WA 5ABPA 1NY5A 3V5NA 1FJXA 5HZGA 4BEWA 3NYWA 3AI2A 3KDPA 3JQBA 2IP4A 2Q4TA 1DTEA 1WB5A 2OD9A 2Q9AA 4M9SA 4O2AF 4C4TA 3RKSA 4KUGA 3TK1A 3O82A 4ZARA 4PCVA 1R15A 2WF9A 3VH4A 3JD3A 1U9YA 2VA8A 3BMNA 3QUCA 2B4YA 2NADA 5K6TA 3DAGA 2Q6LA 4G01B 3B3FA 4Z1MD 4G0PA 3WNQA 3OCZA 5EFZA 5JADA 1GCIA 1ADBA 2F1JA 4GL4A 4CMGA 2BKUA 2BGJA 2HXYA 4O8ZA 5DYWA 2QIPA 3D4BA 3A37A 1ULAA 2F8MA 5DLEA 3DEYX 1DPGA 1EZZA 1Z13A 4X8HA 1Z5PA 3QPCA 4XCXA 5FI3A 3C6YA 5H59A 1DFIA 3R76A 5LQJA 3LTNC 4RSGA 3TVDA 3EEQA 1IMOA 2YBEA 3H2YA 4WKNA 1UM9B 4ZT4A 1B4DA 3FPHA 3RYHA 3G8BA 4M86A 3ZWMA 3DFZA 2UVQA 3T5BA 1U8CB 4AQYB 3F4KA 4EKIA 2WYVA 4DR1B 1CNFA 5DE3A 1YV9A 1PL6A 1LLCA 1WOMA 2PMBA 4M88A 2AFHE 1KWKA 2VDWB 2P68A 5KZMB 2PRIA 4EELA 3MFYA 4JR0A 2ZITA 2V6MA 3LK6A 4NCHA 4O4IF 1Q77A 2GA8A 4D3ZA 4B6SA 2YWEA 5EPOA 2XQIA 3PCRB 4NDNE 2XPCA 3CZRA 4FSDA 3TDKA 2KYRA 3WTCA 2YWDA 2BKXA 2C77A 3K9GA 4NZ9A 3D6AA 3M49A 3O8OB 4A0RA 3TG2A 1ZM7A 3KLOA 2VNHA 3JWHA 4JL6A 2BFEB 1QH9A 2H7VA 3LBFA 4J2OA 9GPBA 4XB2A 3WP0A 2EWWA 3ASUA 4CV0A 1YZYA 2NACA 2MR5A 2O50A 5JAZA 5EOVA 1R1DA 3CMCO 5A6SB 4PZAA 4Y0AA 5AR1A 3M6XA 1EFDN 4LFAB 1U8TA 5FULA 1YQGA 3F3SA 3T35A 3UBMA 2CHQA 4MQMA 2NPFA 3OURA 1CQIA 1EVLA 4L0CA 1IONA 3O95A 2WJPA 4ZICA 1PDVA 3M5WA 4GEGA 2MHCA 1ST2A