2ZTUA

T190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
235
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRLLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
total genus 78
structure length 235
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztuA00
2LDXA 1GDHA 3CPSA 3GVCA 3D3EA 3I83A 2B37A 2PKQP 2BLLA 4K1LA 1B3RA 3TZ6A 4II3A 4BO2A 3PJEA 3TZKA 5G4LA 1Z7BA 3E82A 1R4MA 4L4RA 1BSVA 2PNFA 1EZ4A 3H5RA 2QRJA 3PJGA 4XQCA 2CMDA 4HXYA 4WLUA 4TRNA 2Y1CA 1LQUA 1I2CA 1U8FO 2Q1UA 4B8ZA 4OKNA 5C7LO 1ZUD1 2X0RA 3A9WA 3KSDO 4GMGA 3PGJA 2P9EA 4CODB 2X8LA 3W4KA 1PZEA 1K5HA 2PFGA 3I4FA 2FOIA 2NU9A 3RIHA 3INGA 1ENZA 3ORFA 2CVQA 4MINA 1ENYA 4J1QA 3IJPA 1J4AA 3FD8A 5GZ6A 3KSZO 2PKQO 4R01A 1P1HA 3OIFA 4RF2A 3HHPA 4BKOA 2D5CA 2O48X 2VT2A 2AW5A 3BMOB 3UW3A 3BTSA 4IDCA 3DZJA 3I6IA 1MGOA 1ZVMA 1OC2A 1K89A 3WWYA 4L4XA 2OORA 1MLDA 1E1KA 1HEUA 1M76A 4OJNA 2EEZA 4EGFA 2VYNA 4WCFB 2GD1O 8LDHA 1NP3A 5JY1A 4B4UA 4BNYA 4EJ0A 5CEJA 3D5TA 1N9GA 5MDHA 3JQBC 1GTMA 1LSUA 4RPJA 4W4TA 5L7WA 5EINA 4URFA 4GLLA 5CG2A 1QYDA 1PJQA 3QWBA 1DFGA 2DFDA 4WLNA 4HKTA 1T4DA 3TF5A 1YH3A 2EV9A 3UCXA 2O3QA 1SPXA 3DHNA 2G5CA 3S2IA 1KC1A 3GVXA 4W6ZA 1YBAA 5A5EA 4DQUA 4DPMA 2Y1DA 1NYTA 3K6JA 4W82A 1D4FA 3ROMA 5KOIA 3VH1A 4G5HA 3QWIA 5GY7A 3L9XA 4RDHA 5TGDA 2GUGA 4B3HA 1Y8RA 1T1SA 3PWZA 5KJ6A 2ZTLA 4GWKA 2FR8A 3DHEA 3VZSA 4IMPA 4PGFA 1LSSA 3FBGA 4KWIA 4ND5A 1K0UA 1UXGA 1I01A 3JQBA 5AXBA 4N5LA 1U7TA 2TMDA 3DZIA 4ALLA 2DVMA 1ULSA 2EGGA 2P68A 3L6EA 1LRJA 4IDGA 4GSKA 4OQZA 2DBVO 4DLLA 4MP3A 4D3DA 2ZQYA 2FPGA 2VYND 3I23A 1EVJA 1BXZA 3PLRA 4XCVA 2WE7A 2WSBA 4FC6A 1PZFA 3BXXA 4QSMA 4R9RA 5TNXA 2JL1A 1NTOA 2W2KB 3VHRA 3FTPA 1E5LA 5CAEA 4YJGA 2I3GA 5JBIA 1PR3A 1JAYA 3BHJA 3LSYA 4TKLA 1H6CA 1Y81A 3WTBA 4UREA 3OP4A 3L6DA 4GX1A 3WQQA 5KCZA 2AEJA 4XQ9A 2B0JA 1R0KA 3N58A 2Q4BA 5BNIA 3OM9A 4WCDA 3R6DA 3ZNQA 4B8WA 1Z75A 4ZA2A 1LI4A 4PCVA 4JGBA 5KJ1A 4NJMB 4ZRNA 4YAEA 2YHIB 5EMHA 4MIYA 3CMMA 3WGHA 2Y1GA 3NYWA 1X0VA 3KXDA 1M6HA 1C0IA 3K2BA 1MC4A 1Z7EA 2O3UA 1A71A 2Q2QA 3E6AA 1CETA 3JD3A 4MVJH 1L7DA 2FZWA 2AA3A 1E6UA 3WX0A 1P74A 3QQPA 4MO2A 2W2LA 1E3LA 3IUSA 4I5GA 4RVSA 4ALJA 1LLCA 4HNGA 2ZJ1A 3U9LA 4NG5A 3IL2A 1R0LA 4PZEA 3AFNA 2BI7A 4YAJA 4BNMA 3DR3A 1ORRA 5G4KA 3S55A 4BMNA 1PR9A 3RBXA 2IDZA 4UEOA 3RU7A 1DIRA 2VZ0A 1I30A 2QRKA 5G0UA 1EE2A 1VLLA 2EJWA 3I6QA 3ROPA 1HKUA 4CLOA 1T26A 1PZHA 4I9NA 1KBZA 3D4OA 4A03A 4JP3A 5HWSA 4E2WA 3VVCA 4WASA 5JAMA 4ZICA 4CM8A 1RM3A 1JA9A 1SB9A 1EFLA 5IDXA 3PWKA 2GZ1A 2DQ4A 1UXKA 2EKQA 3FCOA 1H5QA 4UVEA 1QMGA 2BH9A 4E5MA 1EVZA 4TZKA 3CXRA 4BMSA 1XG5A 4GWGA 1NPYA 1LC3A 3GAFA 5JLAA 4NBUA 5KJFA 4E33A 1WDLA 4NBTA 4E30A 3JYPA 2X58A 4JNKA 3DBHA 3MJSA 1QP8A 3VZPA 5BR7A 4EJ6A 3ZH2A 3D3WA 1XELA 4YJFB 2EXXA 1NVGA 1ZSVA 4MPDA 4PZDA 1X14A 1YONA 2I6TA 2NVUB 1PL7A 4FFNA 4A5OA 3Q2IA 5BQFA 2DTXA 1KY4A 4Q3DA 2H9IA 3CE6A 3I52A 3PI7A 3SJUA 4MKXA 2HU2A 4BNKA 2HMTA 3ZU3A 1ZSYA 1T2DA 4OQYA 5CDTA 3H9QA 4KUGA 2E48A 2GR9A 4Q3CA 1AN9A 1B0AA 1DFHA 4RCVA 4DLBA 2P4HX 5JYEA 1DHRA 3CZRA 3LT1A 2CZCA 2P2SA 1LUAA 1U3UA 4U6SA 1F0YA 2PZKA 3KM0A 4HBGA 3RD5A 3GNSA 4NZ9A 1GV1A 3R3JA 4LSMA 3HZZA 5KWEA 1NHWA 3ICPA 1ZEJA 4PLPA 1YXMA 4EI2A 4BO1A 3PWSA 4YVFA 2P5UA 4CMGA 3G0OA 1KC3A 4BNJA 4HFJA 1X15A 3GPIA 1C14A 4EUFA 4OYRA 4L9RA 3BTOA 2D0IA 5A05A 1HDRA 2I76A 1EUDA 1Y8QB 1GZ3A 3H65A 5A9SB 4CQLB 1VJ1A 3F9IA 4XB1A 3HDYA 4XB2A 4EITA 2ZIZA 4A7PA 1MV8A 1T2AA 4CUZA 3ANMA 1DB3A 1HDYA 1GCUA 4PVDA 4E3ZA 1O5IA 4J16A 2EG9A 4EZBA 3OBBA 1OI7A 1B14A 4NFSA 3AU9A 4U5QA 5L9AA 3JYOA 4JK3A 3E18A 5CFZA 3F1KA 3AUTA 4BO9A 2Q4EA 3KYDA 5EIOA 4ZQEA 3CZMA 1NM5A 3NGXA 3WTCA 4KUEA 1UP7A 4GX0A 1J0XO 4NMHA 3H5AA 5I7SA 1WZEA 4CLXA 3GAZA 3JQ9C 1GAEO 4A26A 5A4DA 2P5YA 2GN9A 4M87A 1KVQA 1J6UA 2Y1FA 3C7CB 3P19A 2E82A 4RV9A 3DBLB 2A9FA 1R66A 3QLJA 2ET6A 4I9HA 1MXFA 3AU8A 3ZU4A 3ROQA 5FI3A 4A0SA 1QORA 1WNTA 3ICCA 3AM5A 1OFGA 4LN1A 5BNTA 1N92A 1HLPA 4CUJA 3GT0A 1R37A 3RC7A 2HKIA 4KZPA 1H9BA 2AQKA 1E0DA 3GMSA 4MDHA 2J8ZA 3L07A 3W4IA 1GYRA 1OBFO 1RPNA 1E5QA 3D4PA 4P38A 3HWRA 1QRRA 5DP1A 5I8WA 5F1KA 2PY6A 1BTOA 4Z0PA 3OIDA 2VWGA 4ZN6A 2HJSA 4O59O 4CQMA 2CSUA 1NQ5A 3H9UA 4D7AA 2OO5A 3GHHA 1XQ1A 3HDHA 3JQ9A 4J1NA 5HM8A 1UAGA 2EF1A 4LVUA 5JC8A 1ZNQO 1JU9A 4BO7A 4D79A 3B6ZA 4B79A 3T7EA 4XR9A 3NDJA 2FHSA 3H3FA 1ZK1A 3WDSA 2D8AA 2BFAA 4BB6A 3ZWYA 4B4VA 4FDAA 1SAYA 4ZGWA 1TVEA 1DO8A 4K9DA 1N1GA 2I5PO 4OSOA 2UV8A 5LDGA 2UUOA 3GVHA 4YYZA 2PD6A 2O3TA 3ASVA 4YJDA 2ZB8A 3UFXA 3EZYA 1NAIA 2IEDA 2IYOA 4IIVA 2ZYAA 3BHIA 3UICA 3ENKA 2GN6A 3FPCA 2NACA 1NFRA 4DYDA 3WLEA 4ZQBA 3S2EA 2Y1EA 3RC9A 4DREA 2J5QA 4R4JA 5TT0A 3BMQB 4NIMA 1AGNA 1PTJA 4RQUA 1LRLA 1EQ2A 2FR1A 2WD7B 3GUYA 9LDTA 1LRKA 1YOVB 5FEUA 3FNGA 4ONEA 1YQDA 4J4BA 4XYLA 4K28A 3JQDA 3CINA 1W4ZA 4CR6A 4OH1A 1LLUA 1W0CA 4NK5A 2JFFA 5TF4A 3N74A 3QE3A 1E3EA 2BFPA 2FRDA 4Q39A 3E5RA 1LJ8A 1ZK0A 3V1TC 5KVSA 1ISJA 4NBWA 5F3RA 2Q99A 3HNPA 4PLYA 4AVYA 5CP8A 3NJ8A 2FPIA 2O50A 3ZHZA 2HSDA 2ZK7A 4LMPA 4YT2A 5B12A 4YDRA 2ZQZA 3WMWA 1XSEA 1B2LA 1KERA 2Y66A 3GN2A 3KOUA 5H83A 4M8SA 4FOOA 1O94A 5JAIA 5IDWA 4E5PA 3DBVO 1HYHA 4Q3AA 3ZWVA 2OGUA 3F1LA 1GUFA 2Y99A 3AK4A 3AM3A 4ND3A 3AUAA 1R16A 5FI5A 3PJFA 1HDCA 5IXSA 3H7AA 3E1KA 3PQEA 1GYPA 3TFQA 3PGXA 3JQGB 3L6OO 3HE3A 4IY1A 4BNZA 1YRLA 1RKXA 2GZ2A 5DCYA 5TT1A 3DTTA 1Y6JA 4DMLA 4W9NC 2R2GA 2IXBA 3NV9A 4IJVA 1U7HA 4R68A 1DRWA 1T4BA 1Y9EA 5BSGA 1PU2A 1ISFA 1HRDA 1HE2A 2AE1A 2OXIA 3HG7A 4FFOA 1CJCA 4H3VA 3RUEA 4IXTA 1U5AA 5JO9A 2R6JA 5A1TA 1D1SA 2JKVA 4TQGA 2VZ9A 4AJEA 5CDYA 2PGLA 1PGQA 3M6IA 3I4CA 3UXYA 1FMCA 1E3JA 2J3HA 2Q1WA 4U6QA 5I7EA 4L4SA 2V6FA 3PYMA 4NFHA 4AJJA 2VOEA 3WICA 3EY4A 4RGBA 2Q1TA 3AOGA 4XR4A 4BO6A 4Y8VA 4D0SA 4CLDA 5JC1A 4BNFA 3WIEA 2V7PA 1X1EA 3E8XA 3E03A 5H82A 1LEHA 3PHJA 4NU6A 4YRDA 1IZ9A 3C1TA 3Q2KA 4W9NA 1ISIA 2X23A 4BL5A 1ID1A 1H2BA 2EKLA 3WNQA 1P77A 3X2EA 1HDOA 3DOJA 3LT4A 1JVBA 4B3IA 2EW2A 2VHYA 5JDIC 2DKNA 1P44A 2FR0A 4TRJA 2QIOA 2OBYA 3HB5X 1ZK4A 3F3SA 4MKZA 4R1TA 1LTHR 1BWSA 1T2EA 3JQ8B 2VHWA 3AY3A 3R0IA 4HWKA 4PRKA 1QXSA 4IBOA 2H1SA 2B36A 4WCFC 3K30A 4FGSA 1SEPA 3ADOA 2ZATA 1T25A 3TJRA 1X7HA 2DC1A 2PV7A 4BO8A 2GZ3A 2HMVA 1E7SA 1P31A 2I65A 4PG5A 3QVOA 3KTDA 1PGNA 1XA0A 4BQRA 1Y1PA 5K6AC 3DTYA 2NADA 2JD2A 4MKRA 2HUNA 3PEFA 1TA4A 1C3VA 4UEJA 2HO5A 4FFLA 1X0XA 3OH8A 4H15A 3M1LA 4J49A 4KDEA 4AL4A 5IG2A 2EIHA 2YFHA 3O26A 1SO8A 3G17A 2Y0DA 2YV2A 1N2SA 2DAPA 2PWZA 4TVBA 3C85A 2HDHA 3BMOA 3NT5A 4BVAA 5JDIA 1XLTA 1YGYA 5MGBA 5HTOA 1XKQA 4YT4A 1PQUA 5BT9A 4YEDA 4DGSA 1AE1A 3FHLA 4WCFA 3KYBA 4CMKA 5IXYA 2AE2A 1QYXA 2OP0A 4ZRMA 4NK4A 1J49A 4QXMA 4PLTA 3GNTA 3HSKA 2DT5A 1CQJA 5IF3A 4DC0A 1CYDA 1WW8A 3UCEA 2C5EA 2PGJA 4F6LA 5K6AA 2NVWA 5T8KC 4KOAA 4GBJA 1IPFA 1GQYA 1ZZEA 2WYUA 3EHEA 4J3FA 4I08A 1N5DA 3V2UA 1K2WA 3EK2A 5IFLA 1UAYA 3MZ0A 4J2HA 3TSCA 4A27A 3KUXA 3PDJA 1GUZA 5C37A 1S7CA 1Z74A 2QX7A 1CQIA 4U0JA 2DTDA 3TDKA 4U7WA 2JHFA 3GFGA 3VH2A 1PEDA 4I9UA 2PH5A 2IEBA 5JW6A 1MFPA 1O8CA 2YY7A 2FZEA 4ZQHA 1VKOA 3GRKA 4O0LA 4WOJA 1IUKA 4BIIA 5BSHA 3JQ7B 1LDYA 3CH6A 3PDUA 3D0OA 3FR8A 3MOGA 3O38A 3OECA 4J4HA 4NBVA 5G0WA 1KVTA 2ILTA 3HADA 3BMNB 1BRMA 1DC5A 1HZZA 3U5TA 1KYQA 1ZSNA 4Q9NA 2ZTVA 3OEWA 2A92A 2ZYDA 3DZGA 3ZGYA 1WXDA 5T8KA 4CM5A 1BMDA 4H7PA 3RWBA 3E9QA 4XIJA 2Z5LA 3U4IA 3IMFA 5CDSA 2AEFA 1GY8A 3UN1A 1K3TA 4W7HA 3KYCB 4EUHA 1JTVA 4JBHA 1IPEA 1MC5A 4RORA 2QYTA 3CUKA 3RUIA 3JD2A 1YDWA 4Q3BA 1A7KA 1V35A 1N7GA 2Y0CA 3GEDA 4IINA 4RF5A 5TJHA 1UR5A 2W2KA 2AHRA 2D2IA 4XGNA 1F14A 3ENNA 2C29D 3DZBA 4DVJA 2EWMA 4WKGA 4A73A 4OXNA 3HJAA 1ZEMA 5BSEA 1ENPA 3LF1A 2DBQA 4OGWA 4GAEA 1EMDA 3PHGA 4WPGA 1Q0QA 1XDWA 1MG5A 5GZ3A 1R4NB 1GR0A 3OIGA 3RU9A 1UJMA 2UVDA 1DPGA 1EFKA 5KVVA 3IAHA 4JN6B 4N5NA 5JAZA 3KZVA 3LLVA 4BMVA 4MVJA 2ZTMA 5DCUA 4NJMA 3I1JA 4NHEA 4EW6A 2YHIA 1SOWA 4MVJG 2VZ8A 4GKVA 3ANLA 2DBZA 4D41A 2C0CA 4CLRB 4D3SA 4J7XA 3D4NA 1PJCA 2PLAA 3HUDA 3R1IA 4BKRA 1E7QA 2CFCA 1GU7A 3L0DA 3GGPA 3RUAA 3W8FA 2ZCVA 5KKAA 2CVOA 3B1KA 2GPTA 3JTMA 4R1UA 4CL8A 1O6ZA 3O8QB 1N7HA 2XAAA 3UOGA 2JCYA 1G1AA 2YJZA 4IGEA 4RPGA 1VSUA 3UVEA 4E2YA 1HZJA 4JCOA 1ZK2A 3GGGA 3ZW8A 4YT5A 1O9BA 1UZMA 5AYVA 1Q2XA 2WEKA 2GNAA 2O4CA 2JCXA 2NTVA 4MIEA 3RKUA 4QO7A 5A5FA 4TRRA 2VUUA 1P1KA 1GZ6A 3A28A 5I9MA 3LT0A 2H63A 4GGPA 2B35A 5G0VA 1L1FA 2I3AA 3TNLA 2VUSA 4JXKA 3MOIA 4FS3A 2JHGA 1I3MA 3EGOA 4J7UA 1YQGA 5DN9A 4L0QA 3PIIA 4UULA 2Y67A 4XZ3A 3PJDA 4E12A 3DMYA 3VDQA 4OAQA 1X13A 5CEEA 2HRBA 4Y6RA 1RM5A 4YXFA 2X1HA 3WB9A 5A06A 1Q0HA 3QIVA 2VHZA 4CR8A 1SB8A 2PR2A 3OJLA 4BB5A 1EVYA 1GZ4A 4MVJD 1CF2O 4AICA 4BO3A 1JKIA 3PYLA 3I9JA 4MVJI 5DP2A 1BDBA 4UEKA 1HSZA 1NHGA 2EP7A 4J4TA 2Q49A 2YQ5A 2YV1A 1HDXA 4YJFA 5A9RA 1JW9B 3NT2A 1F8FA 3QY9A 2GERA 1NBOA 2J6IA 5JS6A 2QG4A 1DC6A 2WWRA 1PGPA 3UH1A 3GVPA 2NVUA 2AQIA 3GQVA 2BFMA 4BQPA 4G81A 4ESOA 1H94A 1DRVA 2PGDA 1UP4A 4XYEA 3TL3A 4YQYA 3STHA 1MFZA 1GEGA 4M55A 3V1YA 3VKVA 1OAAA 1XCBA 1UXIA 4QO8A 3IS3A 2PKRA 4J90A 1E7YA 1X7GA 4RVGA 4GMFA 3V1UA 3WJAA 5CEFA 2EGHA 1ADCA 1HSOA 4WLEA 4Y98A 1TI7A 3GGOA 4ITUA 1U3VA 1JVSA 4KWHA 2RCYA 4TVOA 3ZHBA 4KTVE 4OMUA 3TN7A 3QWAA 5DBIA 4DL9A 4R54A 3H6KA 4N5MA 1WDMA 4BGVA 4CPDA 2GYYA 1LDGA 3KVOA 1D3AA 4UVIA 4R1SA 5L95A 4IJKA 2XXJA 4HUJA 3QWFA 2PZLA 4N54A 1B8UA 2JCVA 3IP1A 4F6CA 1DAPA 4GH5A 3N7UA 3ZWMA 1TLTA 1NQAO 4CV3A 4WE3A 4IJWA 4XRGA 4PG8A 3OJEA 3DB2A 1JLLA 1GEEA 1HTBA 1Y8QA 5A9SA 3WGTA 3I5MA 3NTRA 2Q3EA 4RZIA 4CQLA 1XU9A 1UDAA 1P1FA 1JQBA 4EYEA 3RQSA 1M67A 2J3KA 3DONA 2POQX 3FTNA 2P9GA 4GX5A 3H8VA 1LNQA 4UUOA 1C1XB 4TKMA 1YL6A 4ND2A 3ZN2A 4CMHA 1KVUA 1ONOA 2Y1OA 3A14A 3NKLA 2X6TA 4ID9A 4J0EA 4DQVA 4ZJUA 3HN7A 1UDCA 4LCJA 4GGOA 3PVZA 3RFTA 4QUKA 2UYYA 3RBVA 1CEQA 4W7IA 3P7MA 1LSJA 2EP5A 2UAGA 3GN1A 1DBVO 1BW9B 2VOJA 3DAGA 3JV7A 3MCVA 3E9MA 4QFDA 4NQZA 1HDGO 2OL4A 3WQSB 5CDGA 2O4UX 3QW2A 3IIEA 2C59A 5AVOA 3F5QA 4JX8A 1ONNA 4FIZA 1HDZA 3ASUA 3DBLA 3M1AA 4D45A 1F06A 1OOEA 3WSWA 4PLZA 3GF4A 1EDOA 2GLXA 2X4GA 4H16A 2VHVA 5I9NA 4PLGA 4Q3NA 2WM3A 1DAOA 1MP0A 2E37A 1X1TA 1R6DA 5THQA 4CV0A 5TJ9A 1SC6A 4S1VA 4Z0HO 2FSVA 3A1NA 4HADA 4OOFA 1TT5B 2G82A 4IIUA 3JD1A 4BNVA 4AJHA 1G0NA 1O0SA 3CEAA 4Y67A 1IE3A 2VTDA 3I9NA 3VZRA 1SZJG 1HL3A 1VI2A 3D5QA 1VE9A 1SEVA 3ONEA 4DPKA 2YW9A 4C7KA 4FOSA 3IKVA 4RVDA 1CDOA 1UH5A 1WLYA 3WR5A 1YE3A 4PN3A 5DULA 1XYGA 3WGQA 1LXCA 5DCWA 4WLVA 3GH3A 1MG0A 1HF3A 3NDRA 3PFWO 2JAPA 2VWQA 2C20A 3AI1A 3RCBA 1EE9A 4XYGA 4PLFA 2C7VA 3JQFC 2X5KO 1MUUA 4K6CA 3TQHA 2AQHA 5IAAA 1Q7GA 3GPDG 2BGLA 4D0RA 1YB5A 2X7HA 1GUYA 3RC1A 3OF2A 4QEDA 1G0OA 3IOYA 5DDIP 2HQ1A 2NLOA 4F45A 3I3OA 5L7TA 2NUAA 1NR7A 3DXFA 4RPHA 3OJFA 2GRAA 1DOHA 2JFHA 1SNYA 1LQTA 2CD9A 1V3VA 4CM7A 5KVCA 2WYWA 5ITWA 3AW9A 1FDTA 4CM1A 2OUIA 3G1TA 4N18A 2VNAA 3GUCA 5KTKA 2BI8A 1NFFA 2QRLA 1BXGB 3DAFA 3C1AA 2V65A 5A3JA 1NX6A 3GNQA 4R1NA 3DFUA 5L4LA 3BMQA 3JQFA 4LVCA 5JCXA 2AG5A 1W8DA 4MIOA 2WD7A 2GASA 3K31A 3U0BA 1Q7CA 1YOVA 3I9KA 5GZ1A 1FK8A 3DOCA 5TIIA 1VM6A 4OKIA 1XQ6A 1D7OA 3H2ZA 4RZHA 2B4TO 4DMMA 3TFOA 1A72A 3WMXA 4K6FA 4FSHA 1I24A 1CWUA 1BVUA 3OQBA 1P0FA 3PIDA 4CM9A 5COQA 1E6EA 4LISA 1YKFA 3WFIA 3FF4A 1K6IA 4LW8A 2C5AA 3W8EA 4XJSA 3ZWAA 4CL3A 4BKQA 3COSA 3G3EA 5IZCC 1Q0LA 1Z45A 1W73A 2E49A 3NTOA 2AMFA 4DBZA 1Y5MA 4RJTA 4E5KA 1LU9A 5HRUA 1XU7A 2NM0A 4P4LA 4BV8A 1I33A 4JJFA 4ZHSA 5H81A 1P1JA 3C7AA 1E92A 3BMCB 4YRBA 5EQDA 4J9UE 2X22A 1ADGA 3JQGA 4MP6A 2ZKLA 4QT0A 2O2SA 3ANNA 1E6WA 3QWHA 3QRWA 4M49A 1PGOA 4Z0TA 3PHLA 4ZQFA 2Q2WA 5AXDA 3HQ4O 1PJ2A 2E4AA 1QYVA 3RROA 2AXQA 1NNUA 4QECA 5IN5A 3D7LA 4UVHA 3LC7O 4R3NA 1EUZA 5A04A 5IZCA 3SVTA 2BGKA 2D3TA 4OSPA 4EEZA 1T2CA 4IQ0A 1LBEA 4XYMA 1KEWA 3VTFA 4LGVA 3RJ5A 3KEOA 5HS4A 4XQGA 1EVIA 4CM9D 1I8TA 3AJRA 4X54A 4YR9A 3LYLA 3PYXA 3GEGA 3WFJA 3DBRB 4ILKA 2DUWA 3VAZA 1R0SA 1I10A 5EPOA 1HE4A 4BNIA 3GZNB 2VQ3A 2VRCD 3KO8A 4JLWA 2G76A 2ZJ0A 4FQ8A 1P45A 1A4UA 1ZMOA 3INTA 2DFVA 1D8AA 5DOZA 3T7CA 4BNNA 2YHUA 3DQPA 1V6AA 3LK7A 1UXHA 4HV4A 4HFRA 5KKCA 3PTZA 1B26A 1WDKA 2HMSA 4U0KA 3EDMA 4CV1A 3ITDA 1U2GA 3RVDA 2NU8A 2BD0A 4GLOA 1RM4A 4NPCA 3JQ8A 3OHSX 5ICSA 1AHIA 4BNHA 4TMFA 3RUHA 1CERA 4YRAA 4E4YA 5I7VA 5JMWA 1VJTA 1ZFNA 4NI5A 3ZWBA 2OZPA 2Q46A 1YJQA 3FI9A 3GC6A 4KP7A 3U4HA 1ZMTA 1Z73A 1NVTA 4HNHA 3WOHA 1V3UA 3C24A 4YACA 3C1OA 2VYVD 4O5OA 4PLVA 2EJVA 2HAEA 3W6UA 2R00C 1FDUA 5K0ZA 1MA0A 3MJVA 2GN8A 4XIYA 2NV6A 5JY6A 1Y5RA 3WNVA 5EL0A 5A3VA 1PJSA 5AXAA 1C1DB 4QTZA 4J2OA 1GADO 1UXJA 4FJ2A 1XGKA 4FPXA 3ZHXA 4ALMA 5IDYA 4AJIA 2YQ4A 3W8DA 3LC1O 2RHRA 4CR7A 4TRMA 1CIVA 1DC4A 4CMEC 2HK9A 5JXWA 2XF8A 3TWOA 3JYLA 5U9CA 3K73O 3ZV5A 4HP8A 3JD0A 2I9PA 4R16A 1OC4A 4TROA 4C4OA 4BNUA 3WBBA 2XPCA 3NUGA 3BYZA 3SXPA 1B7GO 4TWRA 2NVBA 1IB6A 2J3IA 1UP6A 3B1JA 4A10A 3ABIA 4J1SA 2PZJA 3ZWPA 4OHUA 3KETA 3E5MA 4L74A 3VZQA 2R00A 1B16A 1U9JA 2JD1A 2BGMA 4OM8A 1YO6A 3MTJA 4WECA 4CMJA 4AJ4A 4R9SA 5IJZA 3IDSA 3OICA 1IY8A 4IZHA 3U49A 2BRUA 1EEHA 3ETDA 3BA1A 4R69A 4L76A 1KEUA 4XYBA 5LCXA 4Z9XA 1IHXA 3W1VA 4D44A 3QP9A 1DIHA 4CMEA 3AY7A 4P22A 4OO3A 3JQEA 5F1OA 2OP1A 3HFSA 1KEPA 4R51A 3PPIA 1YVEI 1U8XX 3NTQA 3D64A 2FMUA 3ZWOA 3JQ7A 5AOVA 4E21A 1GFSA 3PQFA 5L45A 5DT9A 5JMPA 1VL6A 3TZHA 3H2SA 4R5MA 4Z9YA 3BMNA 4NFYA 4NJOA 3HDQA 3IKTA 3UCFA 4QFCA 4MOWA 4RQTA 4P8RA 1JKFA 3T4XA 5A02A 4DWVA 1DXYA 5T6BA 3BHMA 1WPQA 4FFPA 3PZRA 6ADHA 4JBIA 5ILOA 2PD4A 1U3WA 2Y68A 3JD4A 4U8GA 3KYCA 4J1TA 4JJGA 3WSVA 4FJ0A 1P1IA 1AXGA 4BNLA 3OQ1A 5DZSA 2CF5A 1I2BA 4XX0A 2NQTA 4GQAA 5A9TA 3CKYA 3ROKA 2YYYA 4YAGA 2W8ZA 1E1LA 1DSSG 4UUNA 5CPFA 4OOEA 3A4VA 3ZNNA 5JYDA 3JQCA 5G0TA 2C2YA 4IDFA 3OETA 1DIGA 1M75A 1NFQA 4J0FA 3VDRA 1JN0A 4PRLA 1R4NA 4CMIB 3RAJA 2OFPA 3RASA 3K92A 1M6WA 1M66A 3SBOA 1EBUA 1FDSA 2WD8A 3PXXA 4B3JA 2Z95A 3IC5A 1VPDA 4UAGA 2IXAA 3UAGA 1NAHA 3MWDB 1XIVA 2I67A 4RVUA 4CLRA 2PK3A 4KTTE 3ZWWA 1DIAA 4GPD1 4E6PA 3S2GA 1IL0A 1FDWA 4DTIA 3KRTA 1E3IA 1DJQA 3O8QA 2NU6A 3V8BA 1KY5A 4P4GA 4YA6A 2A4KA 1TEHA 3UF0A 4UUPA 2D59A 2IODA 5C3MA 4HFMA 2IYPA 3NX4A 1SMKA 1Y7TA 4PLHA 5F1PA 1PX0A 1HXHA 1A4IA 1PIWA 3JQAD 3LLSA 3MEQA 2DUUA 2YDYA 4YJHB 1BXKA 3ZZNA 2WE8A 5KVQA 1UDBA 5L3ZA 3ETGA 4WNCA 3GVIA 1BVRA 3VPFA 4FN4A 1QR6A 3U62A 2J5RA 5TS3A 3VPSA 3PFFA 4GVXA 4RL6A 3VOSA 2Q2VA 3B70A 3GRPA 2CNBA 4XDZA 1QLHA 1WAMA 1ZCJA 4P4NA 5KNLA 1U4OA 4GKBA 4WNIA 2GSDA 4TZTA 3ON5A 5DOVA 3P2OA 1E3WB 4RVHA 3SJ7A 2FN7A 5ER9A 2X0NA 1GV0A 1PQWA 1T24A 1VL0A 5T57A 4BKUA 3OFSA 2B4QA 2W90A 1GD1O 1LX6A 1VC2A 3HB4X 3C3XA 2B5VA 4CMBA 1N1EA 1YDEA 4LRTB 3DAPA 3F5SA 2QW8A 1WVGA 4IQGA 5HA5A 2ZTUA 4XDYA 2O3RA 2WJPA 4L8VA 3Q0EA 1VSVA 3WQRA 3JQAB 2QYSA 4AJKA 4RF4A 2DPHA 4IPTA 3C8MA 4XQEA 1PS9A 2VTEA 5K9ZA 2OOSA 3H9JA 4DIFA 3PLNA 3RUDA 3L4BC 4ND4A 1XEAA 2FWMX 3LU1A 4E5NA 1I2ZA 2YDXA 3ZU2A 1ZJYA 4D3FA 1V9LA 3RI3A 3GG9A 2VCYA 3EAGA 2IZ0A 3FNFA 1AXEA 5JCJD 3V2GA 1L7EA 4IGFA 1PQPA 4M54A 2VUTA 3DZKA 3MJTA 2J3JA 4EJMA 2NQ8A 4XGIA 1YB4A 3ST7A 2P9CA 3Q9UA 3TPCA 3AY6A 1JDJA 4JBGA 4J91A 4XRRA 5FF9A 5A03A 3KB6A 5AQ1A 3RUCA 2DPGA 2HK8A 1UUFA 2PTGA 4CM3A 5KJCA 3IJRA 2O23A 1E7RA 3LF2A 2BHLA 4XKJA 3WJ7A 3JYNA 7MDHA 3C7DB 5J23A 1E1NA 3CIFA 4KQXA 3DZHA 4F3YA 4CM4B 1DIBA 5COAA 4ZD6A 5JPIA 3AUUA 3L4BA 4E0BA 2AG8A 1GL3A 2OMEA 4XGKA 1B8PA 2H6EA 2E6UX 2OHXA 4GI2A 4DC1A 1RJWA 5JO0A 1C0LA 4J43A 1DEHA 3UHAA 2QHXA 2WDZA 1ZO8A 4BNGA 2PH3A 2X5OA 2JAHA 3EVNA 1A9YA 4M86A 4YWJA 3WGGA 3Q11A 5ER6A 1BGVA 1C1XA 1O89A 2B4RO 3O9ZA 1NXQA 4B7UA 2C07A 1KIFA 1YWGO 4E2XA 3IP3A 3EUWA 5DNAA 4FBGA 4ZQGA 3VPHA 4JP2A 4EBFA 1SCUA 1U2DA 1KVRA 1KVSA 3L4SO 1PJ3A 4Q3EA 2P4QA 1BW9A 1U4SA 2BFOA 4BGIA 2UDPA 1E3SA 4KUHA 4DYVA 3ZNPA 4Y9DA 3OJOA 2X0JA 3K8ZA 4FC7A 1ONPA 4IS2A 1GYQA 3PQDA 3WWZA 1K6XA 1VRWA 3DC2A 2RBEA 4O63O 5ENDA 1R4MB 1PL6A 2G0TA 2FSSA 1GCOA 2HLPA 4GVLA 6LDHA 3O4RA 2D1YA 3GLQA 2V6BA 3ZU5A 1WWKA 4NU5A 5JDCC 3FWNA 4E13A 3ZV6A 1HLDA 1QG6A 4KQWA 2HJRA 1DLJA 3GHYA 2EERA 4W99A 3F46A 1TT5A 3S2FA 3FNHA 4PG4A 1W6UA 1WZIA 1QYCA 1T2FA 2EW8A 4Z6KA 1AHHA 3GFBA 3JSAA 7ADHA 1YJ8A 3ZWXA 1ARZA 1JAXA 2IZZA 3CMCO 3AUSA 1LC0A 3OSUA 4LCEA 1R12A 3ONFA 4FFRA 1HE5A 2RAFA 1EUCA 2Y93A 1LDBA 2XXBA 1LDEA 1I36A 2RHCA 5G0SA 4NNJA 4BO5A 3FBTA 1C0KA 4FR5A 5ADHA 4YPOA 3H4VA 1T1RA 4G2NA 5C7IO 5IDQA 3JQ6A 2NU7A 2YFQA 5B4VA 4AJNA 5JDCA 4DUPA 3SC4A 4EDFA 2EHDA 1BHSA 1ULUA 3NAQA 3TRIA 3WGIA 3Q3CA 1GQ2A 2O7QA 3CTMA 3H5NA 2H5LA 2Z1MA 1N9GB 1PSDA 3MJ4A 5C7OO 3QV1A 4Y6PA 3A06A 1U28A 1ADFA 1ZK3A 2V6GA 5B37A 1QKIA 2YV3A 1X7DA 1EK5A 3IUPA 1VL8A 3U09A 1ISHA 1LLDA 3V5NA 4LSWA 4LRSB 3AOEC 4B4WA 2GF2A 2Q1SA 5COBA 1BXGA 2HCTA 1E7WA 4RVFA 3U4DA 3WYCA 1F17A 2IE0A 4YAIA 1ISGA 5JFOA 1PS0A 4JROA 1V8BA 3MJCA 4YAKA 1IYZA 3VC7A 3QJ5A 3ADPA 2IRWA 4I5FA 4AJPA 3BZUA 3BIOA 2AEMA 3FR7A 3TZCA 1VJ0A 5ICMA 1Y8RB 4ALKA 3ZWCA 5DF1A 5BNFA 2Z1NA 5ES3A 2FY8A 3GK3A 1XR3A 2CDAA 4C7JA 3SEFA 2DTEA 1FXSA 8ADHA 3IQDB 1WP4A 3FNEA 3WXBA 1F8GA 2QQ5A 2GO1A 3GOHA 5L51A 2VNSA 4D43A 1NPDA 3UKOA 4NR0A 1I32A 3GY0A 1DFIA 5TSDA 3EMKA 1V0JA 4M1QA 3WG9A 3AOEA 3NJ4A 1PJLA 3F6YA 3HFGA 3DOOA 4IDAA 4CUKA 1QYWA 3B1FA 1I3LA 4JJIA 4OIMA 2O3SA 3I9MA 4PG7A 2NSDA 1BG6A 1U1IA 4RPKA 3MWEB 3BMCA 1IOLA 1P1RA 5KJEA 2NWQA 4M89A 1XWFA 5EJ2A 3RJ9A 2W2LD 4I1IA 3W6ZA 4I5EA 2I66A 1PJ4A 3Q1LA 4YJGB 4IDDA 4BO4A 1GPJA 1H9AA 1JWAB 5U1PA 1RWBA 2GN4A 3OA0A 3QVSA 4R41A 3OMLA 3WGYA 1UZNA 1YB1A 4D46A 3R3SA 2B83A 4FCCA 4NDNE 5FYDA 3OA2A 4RF3A 4BNXA 1E77A 5L4SA 3E9NA 3HDJA 1R15A 2QZ9A 4WLFA 4FD3A 3TOXA 4UVGA 1DDOA 2DM6A 3RBZA 4BO0A 3ZNOA 3Q6IA 4BUCA 5B4UA 3U3XA 1NVMB 2ZCUA 3L9WA 1A7AA 5GMOA 2C54A 3DBRA 3G49A 4WLOA 4IDEA 1XHLA 4MVJF 3M2PA 2TMGA 3WYEA 4F46A 3GZNA 1PWXA 9LDBA 4DBVO 3JCZA 2SCUA 3LDHA 3UGKA 1EBFA 3VPGA 5I7FA 4XJTA 1NWCA 4YTEA 5G4KB 3KSUA 1YL7A 3D1LA 2D4AA 4E2ZA 4CV2A 1HE3A 2LDBA 2GDZA 2RH8A 3RUFA 4D42A 1TXGA 4XD2A 4CLOB 5F5NA 3JYQA 5T67A 2X9NA 3P2YA 4PLWA 4BGEA 1PS8A 5TQVA 3SLGA 1EK6A 4MVJM 1DJNA 1QLJA 3S8MA 4AJLA 4AJOA 3AI3A 3V2HA 1H2HA 4GL4A 4CM8B 3L77A 3GG2A 2I99A 1H0KA 4PIVA 3ZI0A 4XA8A 5HS6A 1LDMA 3ULKA 3VTZA 4RPLA 1P0CA 4KMSA 2XOXA 2VRCA 5T5QA 4BGUA 4WOKA 4BKPA 2GCGA 1E1MA 2Y0EA 5JNLA 1C1DA 3DBHB 5G2OA 2HMUA 3W4JA 3X2FA 3DMTC 4UVDA 5EN4A 2G17A 1A9ZA 3D3WB 3G79A 1TB4A 4IMRA 2F00A 2BF7A 5U4QA 4NH4A 4XWYA 2X9VA 3RFVA 3QHAA 4Z3DA 2VWPA 3F47A 2ZB3A 3PHIA 3H3JA 4L75A 3FRJA 1H6DA 3ZV3A 4AJ2A 1I3NA 4EEXA 2BELA 1MX3A 1NPTO 1ZJZA 3ONDA 3QVWA 1C0PA 1OMOA 1ML3A 1HYGA 2VWHA 4QX6A 4Z9FA 3EW7A 1ADBA 3P5SA 1ZIDA 3ITKA 1P33A 2QZZA 2VYVA 1BDMA 1RYDA 5CPBA 3ZW9A 1DC3A 4FGWA 4PZCA 1AUPA 2O7SA 4ND1A 1LSOA 5CDUA 2X86A 5L4NA 2W4QA 1K6JA 3H9EO 3LZ6A 4L73A 1SOVA 3DMTA 3Q9NA 3BTVA 5DBFA 4YB8A 1B15A 4N7RA 4YQZA 3SX2A 5JE8A 4CM6A 4PG6A 3LVFO 2P91A 1Q1NA 2V6MA 4I8XA 5ILGA 5TRTA 2AQ8A 4B7CA 1ZH8A 4WEOA 1NWHA 3O03A 2PZMA 4ALIA 4WJZA 1UZLA 3OQ6A 4OL9A 3SC6A 4O1MA 1E7MA 4R5HA 1I0ZA 4GX2A 1QSGA 1JKJA 1YBMA 3DDNA 3K5PA 3CSDA 1LLQA 3MTGA 4HY3A 1RM0A 2EKPA 3I9OA 4LMRA 3PHHA 4MJLA 4BV9A 5I8ZA 4TSKA 2CDBA 3ZCXA 4DA9A 3RSHA 5EERA 1ISMA 1MXHA 3QVTA 4IDBA 3DO5A 4HX5A 1I5RA 1ZW1A 1Q7BA 1NQOA 2G1UA 3ZWNA 3GA0A 1P3DA 5CHEA 2JJYA 3GDGA 3NEPX 5AXCA 1FF9A 3KYDB 2WMDA 1VKNA 4BHTA 3WIDA 3UUWA 5F21A 1WMAA 4IM7A 3GDFA 5ENVA 4CQMD 3NGLA 5JAQA 2YUTA 4J6FA 3DL2A 3VVBA 1H6AA 2O3JA 4JIGA 4CMIA 5LDHA 4II2A 2ZB7A 3FPLA 2YZ7A 1PWZA 2C7GA 3WLFA 3KLMX 4DQXA 4FJ1A 3GEMA 3OEYA 4Y6SA 3RC2A 4OXYA 4FW8A 3GZ4A 3DZFA 3F4BA 3ZHYA 3PRJA 3AWDA 2VT3A 2B5WA 5L53A 1KOLA 3LC2O 5I9LA 2RIRA 3E48A 2CY0A 3RFXA 3ETEA 3KLPX 1KS9A 1B8VA 2D5AA 4WEQA 4IXWA 4J9VA 3SLKA 3K2EA 3VH4A 4DPLA 4BNWA 5THKA 3F4LA 2DBRA 4NBRA 2NTJA 1SBYA 4B7XA 2BMAA 4CQMB 4FB5A 3EYWA 4ZU3A 2RH4A 2DU8A 3HN2A 5FFFA 2HK7A 3WYBA 1QV7A 3BAZA 1Z82A 2CDCA 4ZVVA 3TOZA 3ZDFA 2JFGA 1MB4A 3EVTA 4YBZA 3NRCA 4OXKA 4YT8A 4GSLA 4IJUA 3AI2A 1GQQA 2HRZA 3DFZA 4DXHA 4MVJE 4BOYA 1ZXBA 1YBVA 3K9QO 4YJHA 3VPXA 2DLDA 1D1TA 3FWZA 4WGGA 1A27A 2C82A 1PJTA 4MVJP 2JD0A 1PGJA 3WS7A 5L7YA 3KHUA 4IQ8A 5TX7A 2A35A 3WGOA 3WGZA 2Q50A 4ALNA 1E3WA 4LK3A 4INAA 1HWYA 3FSRA 4FFMA 1LDNA 4YCAA 2WTBA 1U5CA 3TL2A 4O6VA 2PA3A 2HMWA 3RKRA 1RYEA 3FN4A 3NT4A 3T4EA 5JSFA 4AG3A 4B4OA 5L40A 3H9GA 4A2CA 4AFNA 4CJXA 1A5ZA 1TT7A 1IULA 1KEVA 2CF6A 3MJEA 4PVCA 1V3TA 1PJBA 1JWBB 4EUEA 1J5PA 3JQAA 3QSGA 1B3BA 3K96A 3M2TA 4ROSA 5B1YA 2VHXA 3QVXA 2X5JO 1FJHA 2PD3A 1CRWG 1FDVA 1Z6ZA 4CLHA 1QV6A 2CUKA 4BS9A 5B4TA 5C5IA 4DIBA 2Q45A 5KIAA 1S6YA 1OZAA 3B20A 1H93A 1F12A 1YQXA 3WBFA 4DIOA 2O2YA 4RLSA 1WMBA 4PLCA 1N8KA 1GPDG 3PZBA 4QQRA 4J7CA 3PP8A 4KDFA 5FWNA 3TZQA 2W98A 2NNLD 1ZBQA 1DHTA 3NDIA 1HT0A 3GMDA 4MP8A 4G65A 5TC4A 3KEQA 1O95A 5IZ4A 5LC1A 2NTNA 2X0IA 4WUVA 4IZIA 1ZXLA 2WYVA 3LT2A 3PK0A 4PFJA 4DRYA 1PZGA 3LQFA 3OJ0A 4Z3KA 3KV3O 3INRA 1ENOA 1DLIA 2IZ1A 3G1UA 4K26A 1HYEA 5ITVA 5HBRA 1NQTA 1HETA 1M2WA 4AJ1A 2VRBA 5CG1A 4CM4A 3BTUA 2ZYGA 3AM4A 4R3WA 1IHYA 3AFMA 5EESA 4WK6A 1NR1A 1ZKMA 4E5YA 4CMCA 3KBOA 4IS3A 5DBGA 3VH3A 2UUPA 4XEHA 3GDOA 5JCJA 4CMAA 2OBNA 4DLAA 1EDZA 4RO0A 3EZLA 5IN4A 1IZ0A 3ZV4A 3I9LA 1EQUA 2A94A 1H6BA 4BNTA 2F1KA 3GR6A 4S3MA 2VN8A 5EQFA 3DWFA 2GGSA 2ZB4A 4UUMA 4CLEA 1DRUA 2FPPA 5F5LA 4JQCA 1U3TA 3EC7A 4E31A 1G6KA 1I3KA 3QA9A 2B69A 4I5DA 3VKUA 5T64A 1NASA 2J5KA 2FP4A 1PL8A 4IUYA 1P9LA 4E32A 2C2XA 4RLHA 1YL5A 3U4CA 3S1LA 1Y9AA 1YS4A 2Y05A 3DHYA 2CVZA 2X9GA 3DEYX 5TLSA 4HFNA 2BKAA 5BSFA 4RDIA 1KETA 1LA2A
chains in the Genus database with same CATH superfamily
1VSQA 3GVCA 4O33A 3A9SA 3E7FA 4PZLA 4DARA 4CIWA 2WJVA 1R0YA 4II3A 1YZLA 3NVAA 5T4BA 4P08A 4GECA 2FP3A 5A7HA 2JDID 2OFOA 4MKGA 2LZ0A 3E82A 3DXXA 3QMWA 4L4RA 3U0VA 1T4CA 4QPNA 4F21A 5C81A 4C7OA 1JLSA 2QRJA 4KR2A 2VF4X 3MWLA 2D0OB 1NVKA 1QTIA 2Y1CA 3FCAA 3BH0A 4B8ZA 1KEEB 2QTZA 5LXTF 4Z7OB 1X80B 3A9WA 1X1DA 1JAZA 3KSDO 4GGMX 3OM8A 4G85A 4HC4A 4CUKA 3GP8A 3EF1A 4HLCA 4AP6A 4IMJB 3CV3A 4QNMA 3R74A 4J0DA 1JQEA 3BBPA 4QICA 2XJ4A 3FCUB 1K5HA 2P6PA 4WK2B 4ZIRB 3ET5A 2FOIA 4MR7B 4ZPXA 4MW5A 5F33A 3RIHA 3INGA 1T9GS 4P83A 4YONB 5JVDF 4UPDA 4MINA 5E6SA 3MA0A 4J1QA 5F73A 1J4AA 5EE0A 1EDBA 2ZXFA 1C1HA 4A8HA 3O2JA 3BH6A 3FDXA 3D8UA 3UOWA 1EGAA 2YMLA 3DKRA 3HJTA 4O2AB 1Z0AA 3FUTA 4R01A 2FQYA 2AKYA 3HHPA 2QI9F 1IEXA 2OBXA 3RPEA 2F55A 2D5CA 2O48X 2VT2A 4FEYA 1VG1A 1I6KA 2YJ3A 3BTSA 4G0OA 3I6IA 2V6JA 4KLCA 3R3UA 1OC2A 4BP3A 5ITSA 3G8CA 4FZRA 4L4XA 3ZIAA 5A7FA 2OORA 1MLDA 5JSZA 2VQDA 3VOTA 4MVXA 4EGFA 1SA0A 2VYNA 4UUQA 1R7RA 1NP3A 4CKXA 4BNYA 4EJ0A 5IX8A 1B6RA 4O4IA 5KYKA 3ESXA 1KRWA 3MWKA 5MDHA 4Z5XA 1DAHA 1DAIA 3R5JA 2HLDA 2PEZA 1TEVA 4JSYA 4LJSA 4RPJA 3RRYA 4AQDA 1MHPA 1Y7IA 4BZXA 1ZHOA 3ABZA 1UBMS 4GLLA 3UMVA 3P9RA 1PJQA 3BD8A 5EJ4A 3HVIA 4RA9B 4D98A 2ERXA 3AVOA 3F90A 2VBGA 3MINA 3ZHRA 5B5SA 2G9UA 1T4DA 3DEFA 1AZLA 4RD1A 4Q47A 3TI7A 4QJ3A 2Q5JA 1RRKA 2GUWA 5ALQA 2N0SA 1FUIA 5JYCA 3SMVA 3DHNA 3FNIA 3S2IA 1KC1A 1ZJJA 2NSLA 5HILA 4RDCA 4DQUA 3ZDXB 1QIGA 1UFQA 2CK3A 1RYZA 5I6DA 3QWIA 1T6YA 3PUKA 4EPYA 3K9CA 3L9XA 4XDGA 4B3HA 2GUGA 3DG9A 3KZCA 3LH5A 1Y8RA 4W1RA 1W7AA 3GH1A 2VTBA 1KP9A 4X6XA 2W6MA 1N8NA 1W1IA 3QG5A 5JH7F 3DMPA 4IMPA 2IBSA 5K20A 4KCGA 4KSBA 1Y1LA 1Q19A 1GOTA 2HIHA 1K0UA 3ROEA 2C98A 1FCJA 4FXOA 4N65A 3UAZA 2H00A 3KKZA 3JR3A 4N5LA 4PAWA 5FI1B 2TMDA 3PHBE 4EQZA 3C0KA 4ZVQA 3GRZA 4TYNA 1F8YA 4GSKA 1E9EA 1EP2B 2PL9A 3S27A 4DLLA 4D3DA 4OGFA 4LYEA 2ZQYA 2FPGA 2PMEA 4FDUA 2VYND 2UUBB 2J07A 2QAGA 2YJ4A 1BXZA 4NENB 1ZIXA 5JALA 1HUQA 4DV1B 4DABA 2GTHA 2AJDA 1RNLA 2J0VA 1UBNA 1AS0A 3H87A 2XMCA 2JH9A 4XCVA 4C0BA 2H4XA 2QF7A 3VM6A 1CVLA 3MWEA 3NNNA 2I2BA 2B1JA 2HLDD 3BXXA 5EFZA 5TNXA 1GARA 3VNAA 4ESHA 1TF7A 4KR6A 5EWJA 4JC5A 1E5LA 1EX7A 2RAPA 2AX3A 2YJNA 1KDOA 1JU3A 1SKYB 3BHJA 4DUGA 4M8KA 4C89A 1G8JA 1XAHA 2CHVA 3VR4H 1XTZA 2H3EA 1KI2A 4UREA 3U81A 2E2WA 5K3FA 5KYXB 5KCZA 4AQYB 2AEJA 2Z8ZA 5JT1A 3IHTA 3LIPA 1DIOB 1AGRA 3QZUA 2JI4A 3R6DA 2HLNA 4REQB 2AZTA 3H4MA 4B1FA 3L8MA 3EB9A 2W0MA 2GD2A 2ZRMA 4ZAZA 4B6OA 5KJ1A 4W5RA 4YAEA 2W11A 4RTPA 4L4UA 3SVZA 1JHUA 1N1MA 2CFSA 4Q37A 2X1LA 2Y1GA 3EGCA 3NYWA 2H06A 3WGHA 4HNVA 1M6HA 2IUFA 4P31A 4BRUA 1TUBA 3O8LA 3K2BA 4LJ4A 3KDPA 1MC4A 5JOQA 3PUVA 2D13A 2P1ZA 2YYZA 2ZRAA 3F7TA 3IQZA 2D00A 1N6IA 2FZWA 3NHSA 4JDPA 1VLJA 4XLZA 5ALWA 4BJ1A 4KNYA 1P74A 3IAXA 5EKDA 2W37A 1N32B 3CH4B 2AK3A 3GX1A 4JQYA 5DX8A 4LRXA 2ZE8A 1WCXA 1A04A 4C3VA 1Y7PA 4LX0A 1EHYA 1BGXT 1CUCA 4M0KA 3U9LA 2GESA 1GL6A 3B6MA 1S2MA 1VCHA 1ULZA 3EDOA 4PZEA 3AFNA 3N2YA 4JGIA 4ZTBA 4BNMA 4QPCA 1KP2A 1T8SA 1WZNA 3EZ2A 2IDZA 4LTNA 4Q1VA 1Q83A 4W5HA 3RU7A 2H51A 3TM4A 1AV6A 4E7OA 1N2IA 1E3MA 3AILA 5G0UA 1EE2A 1VLLA 4V0KA 1NY6A 1EVKA 4BVJA 3ROPA 1HKUA 1T6BY 2WMOB 3PT9A 2RGDA 1TM4E 1T26A 4CLOA 2R96A 3IV6A 4BE4A 4I9NA 4J0JA 3RYCB 1KBZA 3D4OA 3OZSA 4JP3A 4A03A 4DJEC 4C30A 1EGVB 4HB3A 1NDUA 3VVCA 5JAMA 2ZXEA 3DL4A 3FZEA 5FA8A 1PSZA 1YNOA 2XE7A 5KYNA 2GZ1A 1CZLA 4FW9A 3ZZ1A 1MJGA 1QH0A 3K05A 1H5QA 1F3LA 1QMGA 1W85A 1L9KA 1G8FA 2P90A 3MGAA 4K46A 4UVEA 3PL1A 2J0SA 2CDNA 4TZKA 4BMSA 4ZZ1A 1OXMA 5BWMA 3WRXC 3WNDA 2EBFX 3SYLA 2J67A 1V7PC 1YIAA 3O3MB 1LBHA 1LQ2A 2PGAA 1DEOA 1SG0A 2ZRIA 3P9XA 4E33A 1WDLA 3ELUA 2XT0A 4X7MA 2DUJA 5THXA 4E30A 3TKAA 5BR7A 1Z4QA 1NYRA 2CHFA 4XVQA 4LF6B 3JZMA 4R7GA 1XELA 4OMCA 1AKNA 2B3TA 4U4AA 1P7WA 3T7SA 2Y2VA 1ZSVA 3AF0A 2O6LA 1JB9A 3NVDA 3OM0A 4FMCB 1F2VA 3NV7A 1YONA 4MYHA 5BYJA 2HXYA 4FFNA 4MEJA 5EVJA 3GGSA 3Q2IA 4B45A 4BWVA 2DTXA 1KY4A 3BJMA 5LUBA 3SYRA 2XE8A 4MKXA 4BNKA 2HMTA 4X6YA 1JRLA 1O57A 4Q3OA 3JW8A 4ZI5A 1ORIA 3L2OB 2QMYA 2H1LA 4HDOB 4OQYA 5REQB 3RFUA 4UM5A 2PSEA 5BRJA 5JPDA 1ULHA 4JJAA 2MYTA 1FRVA 3GEBA 4KRXA 2FX3A 3DAHA 2A58A 2P40A 2ZUUA 4KYTA 4Q3CA 4LF9B 5JYEA 2IIBA 2XNCA 3AUYA 2NXNA 4DLBA 3LXMA 2VPZA 3NIFB 4B6PA 4NBKA 2P2SA 1ZMRA 4PYQA 1F0YA 3U3DA 4HBGA 3FWKA 1UBTS 4NZ9A 3OWXA 1CUEA 1M1ZA 1TGVA 2DHQA 3AEUB 4U7DA 1A9TA 3GCZA 3HZZA 4LSMA 1D2AA 1WL8A 2JPDA 2Q6OA 3ICPA 4YMTA 3B3FA 1YXMA 4PZYA 4JI6B 3I6BA 2CXPA 5DU2A 3SQDA 4BO1A 3NQ41 3HV2A 4YXFA 3WL3A 1M6VB 2P5UA 3EBOA 4LECA 4Y1FA 3ILYA 1HMPA 3KVNA 4KODA 5AJHA 4BU1A 3BQMB 4EF4A 1C7FA 4MGEA 3INNA 4HFJA 4I66A 3DPUA 1X15A 2YMMA 3EPLA 1V5EA 4W1QA 5LBIA 1DV1A 1PW5A 4Y9SA 4GI1A 3DLBA 1WEKA 3ZVKA 2MJLA 1BE0A 2HOQA 4OYRA 4LJ8A 3GFTA 2HBZA 3QV2A 4IFEA 5A05A 2R47A 1M2EA 2PNJA 1GZ3A 4EHBA 1M2VB 1XDDA 4EB0A 1A1VA 5KC8A 2VNJA 3F9IA 4MA0A 2G36A 3HDYA 4MR9B 4A7PA 4KR9A 4C03A 4AY6A 1THMA 2QXUA 1RWQA 2X15A 2Z3WA 1GCUA 5TB5A 3TYXA 1T35A 3R8XA 1RTTA 1QCDA 4O2RA 2R60A 4E3ZA 2BHSA 2EG9A 2PEYA 5ALEA 3UKDA 2XRZA 3B7PA 4Y0AA 1MH9A 2Q3LA 3UGTA 4CVNA 2ODAA 4NFSA 3U7QB 1QANA 3QLUA 5L9AA 2OEPA 4JK3A 3NHRA 3DE4X 5J5AA 4EBBA 4AY2A 1EEXB 1NVAA 1WKCA 2ZAMA 2XD9A 4NATA 3AHCA 4WKNA 4Y2PA 3FUCA 5IUNC 5DB4A 4NE7A 4GZ5A 3MJDA 5CB4F 4CI9A 8ABPA 4RLFA 2QTCA 3UMJA 5FXMA 4YX9A 3QE0A 4FT4A 3DE2X 1WUYA 2XSZD 2ZSFA 1UANA 3HXKA 3GWZA 5EMKA 3H5AA 5I7SA 3EPRA 3GZJA 4H7DA 1I4TD 1YHNA 1GAEO 4FYKA 1RCFA 1POXA 2FPSA 2P5YA 2WABA 4KQJA 4NRDA 5A4DA 4A36A 1WS6A 1NIJA 2AVNA 2Y1FA 4UDYX 4RV9A 1JHPA 3QLJA 3KR1A 3T9BA 4C4ZA 3FTDA 3EQ7A 1XC7A 4OQNA 3BD6A 3ROQA 2XXAA 2Q3BA 3CUYA 2C99A 4QEKA 3AM5A 1OFGA 4N41A 4HWSA 3ODPA 1P4JA 4C6TB 5C0OE 3OX1A 3VHXA 5HF5A 4D8YA 2AQKA 4OY3A 4TYPA 2C1ZA 2GK3A 3SKXA 1NJ5A 2CLEB 1CJUC 3TG8A 3K70D 5FTJA 3CQ9A 4IOJA 4BEWA 4MDHA 3T3HA 4EJSA 1N5MA 2RJOA 4N9WA 4OBEA 3VJMA 3I92A 4D56A 5BSWA 2AMJA 1E5XA 2C4NA 1E5QA 2G1KA 1L5FA 2O0KA 3ORHA 3QQ5A 3V55A 2IPXA 4FLMA 3W05A 2E0IA 3ZD7A 1AQJA 3D4PA 3R5TA 3S29A 3HWRA 2G0AA 1AMNA 1QRRA 5DP1A 3D6NB 1T5OA 1XRLA 4Z0PA 3S8YA 3RT9A 3UUEA 2HJSA 4O59O 4ZN6A 4QM6A 2DMRA 1Z0FA 3W8NA 4ECAA 3UMMA 5FEUA 5LP6A 4DCTA 2G8LA 3JQ9A 2NPOA 4J1NA 4UUBA 3I2HA 3BXOA 3HCWA 1QGUA 1E2MA 1FYXA 2JI6A 2GHQA 2IXTA 2VSFA 4D79A 2C4UA 1O97C 3KTAB 2AFVA 2Z57A 4L5CA 5EY5B 4XSVA 5GV8A 4L5IA 5B7NA 1JG1A 4KXQA 3ZWYA 4B4VA 3COWA 4XD7A 2OWDA 1V7CA 4FB4A 3ZK9A 3B7GA 1G5TA 3UW1A 5J4YA 3TLZA 4P0QB 1DAKA 2AOWA 3UMSA 4K9DA 2BHNA 3C6XA 4MK4A 4YRTA 4IXDA 4PZ9A 3TW8A 2UV8A 5BR4A 2BN4A 1SUSA 4YJ2A 2QLFA 2OPBA 3ASVA 1Z12A 1SCDA 2V9CA 2WWVD 3H84A 3EZYA 4UOQA 3ZIDA 1R4AA 4BFUA 2JFXA 3VKWA 1BQ3A 1LZKA 2J4CA 3ILVA 3R76A 3VNVA 2B5OA 3IQIX 1HT1E 1P75A 1PW7A 3NPMA 2K87A 4O4HA 3ZVRA 3GJSA 1E99A 2XR1A 3RJMA 4QG7A 3NWBA 2PQ2A 3RC9A 3S2EA 4EOGA 2J5QA 4R4JA 4HWGA 3EEYA 5TT0A 3BMQB 4KQ1A 1X1CA 3AVVA 9LDTA 3KJZA 3FNGA 5GM2A 1YQDA 2JATA 3FSJX 4JITA 1CR6A 3D7RA 3JQDA 5KTPA 1W96A 3HH8A 4OH1A 3SNKA 3WFZA 1VLHA 5JHHB 4V03A 1AKTA 5LKAA 2Z5VA 4WESB 3KOOA 1T8RA 3Q3HA 3ZY6A 1E3EA 1T36B 4WWHA 1RS0A 4ENPA 3HEMA 2GFHA 4JMPA 1GPMA 1ISJA 1L7AA 4NBWA 4DDMA 1CY1A 4PLYA 3EUFA 3WGLA 3O1JC 2FPIA 1MTZA 2W5UA 2BGRA 3ZHZA 2ZK7A 4KU4A 3UG6A 3NUQA 1R8SA 5ALRA 2E18A 3LCRA 4OV6B 1AMUA 2NO1A 4HAIA 2ZQZA 1E20A 2QTAA 3HCAA 4MQUA 3NM5A 3SFTA 3KOUA 2Y66A 1J23A 3UMCA 3WMWA 3MGGA 4ENQA 2YXBA 1YS2X 4M8SA 1O94A 4AN1A 4DG8A 2OQ2A 1Q0RA 3BXEA 5IDWA 2B21A 2RARA 4R8SA 3UOAB 2MHCA 2Y27A 4IQ4A 1Q20A 4Q3AA 3U4GA 3TAXA 1QVWA 1II0A 2BPOA 1GUFA 2OFWA 3T3GA 1XMXA 5CA0F 1R16A 2V1UA 4XI9A 2O1XA 3PJFA 2IYNA 5FI5A 3AVTA 5IXSA 3O9VA 4W6QA 4DLNA 2OV3A 1JDTA 2WT4A 2MINA 4AS2A 2YZKA 4GMDA 4JI8B 4IY1A 2AMVA 3R7DA 3FGPA 5DCYA 5TT1A 4OGGA 4YAUA 4K6GA 1RQRA 4W9NC 2IXBA 4NPAA 4QTTB 5FAKA 3VNUA 1MV5A 3J7AC 2O0HA 1P8JA 3FMGA 1CU1A 1AV7A 5BSKA 3EUEA 4IJVA 1NQXA 4JI1B 4R68A 4Q48A 1T4BA 1VLQA 1Y9EA 2GZMA 2O8FB 3K9WA 4BE7B 4XWAA 1HE2A 2FVYA 4J6EA 2CE2X 3FF1A 3HG7A 4NYJR 1CJCA 1OBOA 3DDHA 3W5AA 1M8GA 1PT8A 3RUEA 2HGZA 2R8XA 3PDWA 2LP4Y 1KJ9A 1WOYA 2YJGA 3K1AB 3DHVA 1SK8A 2VJOA 3ZE9A 4C7MA 1QUEA 2VATA 4D9IA 3PTLA 3T4PA 1KR2A 1O8BA 3M6IA 5HF6A 4C07A 4ETIA 5AHOA 3VYSB 4WXYB 3MYRA 1C2TA 1GZDA 3PYMA 2FUNB 2VOEA 2IW3A 3A1VA 3WICA 4BYGA 4MV1A 3LFTA 1QFMA 4EYOA 5SYMA 3E81A 5E2AA 1UKZA 3GYGA 2AG1A 4LHVA 3WIEA 4F4UA 4BN0A 5KPJA 1L4YA 4Q66C 4R2IA 1EG7A 2WF8A 4OHOA 5FH9A 1A5SB 4MPJA 1YS6A 1NVVQ 2REBA 3Q2KA 1RP7A 1Z0ZA 4ZVRA 5LXTB 4GL2A 1ID1A 4GBGA 3HZRA 2WT9A 4PO3X 4TM7A 4KE7A 2Q9CA 4KB5A 4J3NA 3G9UA 4LDJA 1E2BA 3KBBA 2FWNA 1JVBA 3V8NA 3W5BA 1ZGAA 4YQEA 2EW2A 3CWQA 4LY3A 2G9QA 5HFNA 1MO5A 2WPNA 3ROXA 3M1IA 1XLTC 4TRJA 2P3SA 4UQLA 5JVDB 4Z51A 2C2BA 1P2FA 4I50F 1VLZA 3HB5X 3LX4A 5ELMA 2IH5A 1A5AB 1BWSA 1E2QA 3HCEA 3R0IA 4L8FA 2CXNA 3OVMA 4B83A 4IBOA 3O94A 4X93A 2B36A 2ZJBA 3SZGA 5BN4B 4FGSA 4DRXA 4K2HA 4U39A 3V1NA 3ADOA 5DASA 2AH5A 3JALB 3TJRA 2HIGA 1BA2A 4PPFA 1DEXA 3EG5A 4AX4A 2HBQA 1W5FA 2BZSA 2ZOSA 2GZ3A 5J1TB 2HMVA 1G9TA 4QUAA 1XP8A 3IDFA 2OG2A 3FWHA 2WUDA 1G5RA 2RE8A 1T3SA 1WABA 3ZXYA 3F98A 1WB4A 4UEJA 2HO5A 4H15A 5ARCA 3OH8A 4CN9A 2HH9A 4MWEA 1QWOA 4L0DA 4AZ3B 5IG2A 3GU3A 2VHEA 1ESMA 3EGIA 5KYYB 1JX6A 2MOKA 2NPFA 2Y0DA 4R7ZA 3RSQA 2DAPA 4H35A 4F5DA 1Q2UA 3ZYZA 4ZMSA 2HU8A 3WHIA 1T5LA 1SOMA 3NHBA 4RH1A 4IV8A 5MN4A 4V3CA 2IOHA 5MGBA 5EPUA 3MLBA 4YT4A 3KSBC 4HDMB 2D7CA 1NZFA 2QNBA 3QU4A 4OBXA 1PR5A 1YVUA 3FHLA 3GGDA 4WCFA 2KX7A 4DGSA 3KYBA 2DUNA 4CMKA 4ZOBA 4NOLA 1DWOA 1V47A 2GVNA 4ZRMA 4PLTA 3ZCRA 2IDMA 4LJAA 1ABFA 2H0QA 4AY4A 4UHCA 4DC0A 1XZKA 4UTOA 1L8AA 1FS4A 1JV2B 2EHJA 2P3OA 3W5DA 1EQAA 1YDHA 3I12A 2JLRA 2KB0A 3PDIB 3N2IA 1IPFA 1GQYA 2FMFA 3D8HA 2Q7OE 4J3FA 3LLUA 4C4XA 2WU0A 3WWCA 4FKZA 1DP4A 1T0JB 3L8FA 4J2HA 4YUXA 4N0DA 2WQ7A 5JH7B 4Z4EA 2J46A 5DX0A 3MWJA 1GUZA 5C37A 1QYIA 1Z74A 2QQEA 2QX7A 3BM5A 3QELB 4X3CA 1CQIA 3TDKA 3WP0A 1XDSA 1WVIA 4NX2A 2JHFA 4OREX 3GCXA 4RK6A 1EFRA 2PH5A 1QHIA 4CNQA 3HU2A 3X1XA 2G7MC 2JEZA 4AS3A 3NBXX 2ZIGA 5ECWA 2WG1A 4AKIA 1PEKE 5TQ0B 3KUKA 4TV8B 1XDUA 1YZYA 3ZJYA 1FJGB 2ASEA 4LGMA 1RC8A 4V0ME 4LF7B 4EVQA 1JSLA 1UEXC 3OECA 1RWPA 1OA0A 4PXYA 1OXKB 1NNEA 3U5TA 4YMLA 2A33A 1PLLA 4L15A 1LZLA 5G1PA 3U37A 2ZTVA 1UBEA 2HV8A 2NZYA 4FMBB 2A92A 4KQGA 4TS9A 5BT8A 1LF5A 1X70A 3DZGA 1GTZA 1WXDA 2OLJA 5FWAA 4FE4A 5BRNA 3RWBA 1XKLA 3VPCA 2WT8A 4O08A 3JARA 5DK6A 3NVKI 2Z5LA 3H42B 3W9BA 4XUCA 4LY9A 4DY4A 1WR8A 1K3TA 1O2DA 2QZ4A 1W2WB 1X8LA 3C15C 3IEXA 3KYCB 3NKFA 4EUHA 1JTVA 2JJQA 4F9TA 2AS0A 2PUHA 5HE9A 3ZLTA 3GBSA 4RZXA 3UAXA 2RGBA 2PTHA 3C3MA 3IVMA 2R3SA 2DJ5A 1N6OA 4TUYA 5DSXA 2W2KA 4ARVA 5GTDA 3EVGA 3T94A 3OIWA 4NCIA 4XCXA 4DVJA 3OIVA 4ZU6X 4QBTA 3MQ4A 5TF0A 3ZG6A 1RHUA 4QT4A 3VQTA 3W1WA 4NVRA 4EFMA 4P53A 4O3MA 2IV7A 1PYGA 3G2KA 1DX4A 1OUMA 4WPGA 1IM5A 1XYVA 1C80A 1KHHA 4PU0A 2BM1A 3LNTA 5AM3A 1K7SN 3B1WA 1WTAA 2UXDB 2P9HA 3L1KA 2ONJA 2BONA 2ATIA 4G5SA 1YHZA 4Z2YA 1RBYA 5DHRA 4F12A 3R3XA 1CUAA 4MVJA 4E6EA 1I13A 2IZOA 4I5IA 4NHEA 3A0RB 2YHIA 1SOWA 2FB9A 4UNPA 4GKVA 4BUJA 4EW6A 4ZCRA 4K6HA 4D41A 3E4DA 2C4VA 3OURA 1A9RA 4J7XA 4JSTA 4URWR 3TQIA 2PLAA 1OT5A 3KD3A 3ZDZB 3AHGA 1E7QA 1ILWA 3FRHA 2IITA 1FP4A 3L0DA 3MJRA 2J32A 3W8FA 4X71A 3E9YA 2P30A 2ZB2A 2WV9A 2ZCVA 5DO9A 3JTMA 4DQLA 1BEZA 1BXRA 4R1UA 3AEQB 4CL8A 3UOGA 1N7HA 2VF7A 2JCYA 1R5OA 1UADA 1W4BA 2HDNB 3CLTD 1FP6A 4IGEA 1VSUA 3CUEF 3IE1A 1ZK2A 3W78A 3ZW8A 3AR2A 1JDSA 1V9SA 1ZD5A 1UZMA 1EFPA 1XTPA 2AXPA 2IEIA 2ZJ6A 4L02A 4UAUA 3CIOA 4TTVA 1GTSA 2QRGA 1LPMA 1I6WA 5A5FA 3STWA 3ZTYA 2QMUA 3A28A 1P2BA 2VAMA 1JALA 2QX8A 3FPEA 5DLDA 5KZMB 1M34B 1R9NA 1TKBA 5I9MA 1OU0A 1SQ6A 3GLIB 2I3AA 1HEYA 4MDEA 3MOIA 1RLOA 5T4HA 3VR1A 1Y1TA 2YN0A 3SQMA 2AMYA 1M83A 1YQGA 2A9OA 2GZRA 2R1TA 2RFLA 2AYYA 3NHPA 1M6NA 1SVOA 4JSRA 3WIOA 3PIIA 1W36D 3AVPA 2AL7A 3DBIA 1B0UA 2QE7A 1KKUA 1KL7A 1OWNA 3PJDA 3UFBA 1H42A 3DMYA 3HL4A 4AX8A 5BR8B 4G23A 3CVVA 2J6CA 1C81A 3GNLA 7AT1A 1JI3A 2P6OA 3H1BA 4IX9A 1K7XB 1P3Y1 3HVJA 4WERA 1TCVA 1Q0HA 2HA5A 4YRCA 3WB9A 2EWVA 1B0PA 4MRAA 4D9BA 4D6YA 1Q0ZA 4BB5A 4L72A 1J09A 2BFFB 1XCJA 4X00A 4MVJD 3EVFA 1TJPB 3O8NA 5G3ZA 3HBJA 4WZAA 3UJHA 2FMTA 3I9JA 1DOAA 4I3GA 2MDTA 1UXOA 1W2HA 2DH6A 5F7ZA 1GRRA 1TD9A 1HSZA 1YMUA 3KL4A 1E3TA 2Q49A 4NICA 2ZIEA 4I4TF 4Q4HA 4XWOA 2J9FA 1NG1A 1CZHA 1F8FA 4INOA 4TKZA 3QX3A 4WJKB 1JYEA 3PQ5A 4GEKA 3T9AA 4HVLA 2D5LA 3OG9A 5L3RA 2EJCA 2WWRA 1PGPA 3UH1A 4AZ0A 4UTRA 4AL4A 3D7SA 2RGNC 1T9DA 3KS9A 4ZZ3A 4DV3B 1LBIA 2BFMA 3HCNA 1WSDA 1H94A 1LI5A 1U9IC 3QVJA 3WYGA 1A9QA 4IXMA 2PGDA 4ZO9A 4CZ2A 4G8BA 3STHA 1M74A 3ISJA 1DJOA 4XUDA 3U4AA 1E9AA 3VKVA 2HZ7A 4QULA 1XCBA 1PZNA 3IS3A 2FVXA 4RVGA 5CEFA 5D1NA 2ZU0C 1ADCA 1PV2A 3DF9A 4WLEA 1FYFA 2GKOA 2Q7XA 4INPA 4R1LA 2YNMA 3G1WA 1P8AA 2IY7A 3GGOA 2NUPA 4ITUA 4KV7A 2YIDA 4RJJA 3N2GA 1LNZA 2CJXA 1YZ3A 4OGLA 3M6VA 4Y3UA 4EYKA 4AI6A 4HXFB 2ZXUA 2O20A 3IT1A 4ZVUA 3H6KA 4N5MA 4S1OA 5M34A 1I7PA 2GYYA 4LTDA 2D5BA 2F3QA 3KVOA 4A8JA 1I1NA 2XMBA 2VP0A 3A1CA 3NXKA 4HMQA 4R1SA 5KWJA 3FHTA 2ZR7A 3QWFA 4Z53A 1PTKA 3N5KA 2JLQA 1NF3A 4R1QA 3JWEA 1II9A 3MBIA 3NAMA 4BWFB 2RHTA 3SFZA 4CI0B 2NNWB 2G70A 3R5HA 5AJWA 3W5IA 4B3SB 4PG8A 4FONA 5DWQA 3VKFA 4B32A 2ECFA 1TVMA 1UFVA 1C3JA 1JHQA 1D0VA 2PFKA 1D6JA 4EAAA 4Q4JA 3RTDA 1W25A 3GOQA 4RZIA 1ORVA 1A2KC 2BGTA 2CBXA 1YZFA 3C5HA 3T7AA 1XEWY 1P1FA 4BNDB 1JQBA 1JHRA 4JI3B 4RFSB 1XA4A 1XZEA 4DEYA 1WB9A 2DR3A 5CB4B 1MQ8B 3TLGB 4CFYA 4GX5A 1P73A 3H8VA 3OF5A 1KOGA 4UUOA 1C1XB 4H1WA 4KGXA 3ESZA 3LP6A 1YL6A 1MA3A 2W6NA 3L84A 3NFRA 3E05A 4TKMA 3WYAA 3ZI7A 3ZN2A 4CMHA 4J0EA 1W581 1YVDA 3H18A 4YJ3F 4RK5A 4UU7A 1EA7A 1DAGA 4KJXA 4YJKA 4LCJA 4ME6A 1S89A 5AKZA 4AUMA 3CX6A 3RFTA 5AM0A 4FE7A 1AF4A 4I1PA 1SCUB 3KYJB 3B9RA 2NSJA 3KWFA 9GPBA 1XMPA 2G83A 3GN1A 4ZEMA 3C8UA 2Q2NA 3DAGA 4KIUA 4ER7A 2WQ6A 2DB3A 1U0TA 3ROFA 1YR7A 4RENA 1V8OA 3BE5A 5FHRA 4KLNA 1J7JA 2N3ZA 2MSKA 2V3CC 2JK0A 2X76A 2ZRHA 3QW2A 1IDOA 2C59A 2I6SA 1AKEA 4B2YA 4RD2A 3F5QA 3RT7A 1I4EB 4AF7A 4JX8A 4FIZA 5CNJA 1HDZA 2WFAA 4D45A 3TE7A 1Y8ZA 3WSWA 4PLZA 2PT5A 4U9IS 3EFHA 1CSEE 1EDOA 2GLXA 3DJFA 2VHVA 5C8XA 4U7GA 4Q3NA 4MW2A 2WM3A 1QAOA 2E37A 2VCEA 1X1TA 3HKEB 4JLSA 5FO1A 4WXEA 4CV0A 1QVZA 2C5SA 4Z0HO 2WI8A 3A3PA 3QEMA 4MS3B 4IOLA 1UJCA 2WLTA 3CCFA 4ND8A 4K6KA 4OOFA 4P4UA 1ZUWA 1PJAA 1YDGA 2YYAA 3B78A 4BNVA 4HR7A 3U80A 3WWDA 1ZOPA 2MSNA 1IE3A 3VZRA 1PI3A 4MQ4A 1VI2A 4QUGA 2BDUA 4YP0A 3W5JA 2EYQA 3RHZA 2IYWA 2YW9A 4FOSA 5DW3A 3WR5A 1WLYA 4ZO6A 1DJPA 1YE3A 3V8PA 5DULA 4PN3A 1UPXA 3NCHA 1XYGA 3GDWA 3CCBA 3RYFA 1LXCA 5DCWA 1QC5B 1S96A 4WLVA 4ZC1A 1FLNA 5I7WA 1BAPA 5DXFA 1G21B 4HI0E 3NWEA 4LBWA 4OQPA 1A2OA 2PDAA 1R00A 3RB8A 5JROA 3PFWO 3A9VA 5BOSA 1KQGA 3ZWQA 4NP6A 4PLFA 1XXHA 3S2YA 1SKQA 3RM3A 1CR4A 4C4TA 4D0RA 3Q4GA 5DV9A 5B1IA 1FQKA 1YB5A 2OV4A 3KC2A 1BDIA 1GUYA 2FPRA 5HGXA 2AT1A 2MIIA 2WWWA 1JDBB 4U7PB 4BCCA 3FUVA 4D26A 3RJTA 2XMPA 3VGJA 1CFZA 2JAXA 1JTEA 3USCS 4M83A 4LUCA 2NUAA 1GTG1 5L7TA 1NR7A 1ISPA 4ZOLF 2ONZA 1FX0A 4RPHA 2GRAA 3UHOA 5EXEA 1WX1A 4RMIA 1DTSA 3C3JA 1LQTA 2ODPA 4IO1A 3SHQA 1YRWA 4F72A 2CD9A 1LV7A 2Z4SA 2FUG1 4QJ4A 2HO4A 1E8NA 1QIKA 2PZ8A 2F17A 2C3PA 2OUIA 2WIGA 3AW9A 3D59A 3G0GA 5ETJA 5NLLA 1S2GA 3G1TA 4CFZA 1KJYA 2VNAA 4ACBA 4Y1GA 2IL1A 1U6JA 1NFFA 1LTKA 2WKRA 1BXGB 1UBKS 2IYUA 4FWBA 3ZZUA 3DAFA 1SXJE 3BXZA 3KQTA 1V39A 2F90A 2YOHA 3GXBA 1NX6A 2LKCA 2QDXA 1P7PA 2EYUA 4O4IF 1SCAA 3CUTA 4IFTA 3OQNA 3QBTA 4QXAA 1Q57A 1E62A 1KSJA 1ZGHA 2AG5A 4M0FA 3U0BA 3N53A 1BFKA 3S40A 1IN5A 1PLJA 2H08A 5TIIA 1BQEA 1SUDA 3EY9A 3G5MA 4MCAA 4IIFA 1SZCA 2QGFA 2M6SA 1A72A 1C9EA 2E89A 4HUQA 3AJEA 3IAM1 4YFYA 2J0QA 2JHPA 3CVWA 1P0FA 4W5QA 3FRIA 2VIIA 1YKFA 3G8BA 1KI3A 4EY6A 3QSYA 2IVFA 4LW8A 4N82A 3VZDA 2HWKA 2C5AA 3EWIA 3GJ3A 4CL3A 1IBSA 3ZTTA 3COSA 1GKLA 4F56A 3T99A 3HABA 1W0KD 1K7EB 3WDLA 4EMTA 3VPAA 4LF5B 3KVYA 2AMFA 1VMEA 5JADA 4OFZA 1RW4A 2JF0A 2ACWA 3VR0A 1N6PA 5IMSA 5HRUA 2XYVA 4P4LA 3MGCA 4JJFA 1MVLA 1GPKA 3DFMA 4F2DA 3F7OA 4C6SA 4Q7EA 4GUAA 1F0NA 1PWEA 2WIDA 1ADGA 3CZCA 5AKEA 2CXSA 4KE9A 4FCWA 1S02A 1A4RA 3NOXA 4MP6A 2NVOA 4R0VA 5DSTA 4M37A 1GLGA 2HA7A 2IS1A 2FXVA 3KLNA 3QPCA 1GCIA 1R5BA 3QRWA 1JMYA 1ZL0A 4FR2A 5BV2P 1SULA 2GHTA 4MCJA 1A8PA 4WOBA 1OROA 2GK7A 4YCCA 2C9MA 3GRVA 4Z7QB 1V2GA 3OO0A 1NNUA 2CXRA 1QQ5A 2AJCA 4QECA 4WGFA 5ERYA 3D7LA 4PZZA 1EXMA 1U2GC 3B6EA 4DAOA 1KTIA 1BRTA 3FLBA 4S1WA 1DL5A 2BGKA 3WZLA 2D3TA 2QJFA 3WGKA 1T2CA 1T5HX 4IQ0A 5BVGA 1ML4A 4BASA 1IXYA 4HTFA 4R0MA 5AFSA 4UOEA 5DM4A 4YV2A 5J4HA 3VTFA 5TV2A 3RJ5A 3MTDA 3Q5DA 1SCBA 5I7UA 4EJFA 4XPIB 1K88A 1VE1A 2QJTA 4C5CA 3OPYB 5A6VA 5HS4A 1AKMA 1EVIA 4LGCA 2QI9C 2FJPA 2FYTA 3P0FA 4EG6A 3HJUA 4RL4A 2GM5A 2GN1A 2VHUA 1R9JA 3DBRB 1QIDA 3IRVA 3VAZA 2QW0X 3LRXA 1R0SA 1EFVA 1RHJA 3H11B 1HE4A 5EPOA 1VE7A 2IU4A 4I50B 5BN5B 1Y89A 3RVLA 3IDQA 4EF6A 2QAJA 2R6GA 5KTSA 2RGUA 4UQOA 2J59A 4JLWA 3UWMA 4FQ8A 2ZJ0A 1YFLA 3SCZA 2H5JA 1A4UA 3INTA 4LJYA 1BNCA 2G0NA 3L6RA 4BTLA 5B6JA 5CNMA 4AKTA 1PO7A 3ENQA 3UAYA 3QPDA 1GXSB 1D07A 3FYDA 3R3VA 2IYXA 1BN6A 2WTXA 4CIVA 4KQEA 2R9VA 3ITDA 4CV1A 5DFAA 2K6GA 3U7HB 4RWZA 1G66A 3RVDA 1GPUA 2EL9A 1N2ZA 1ODIA 4QTXA 2MYPA 4GLOA 2ZTSA 1RM4A 1NY5A 3JQ8A 4GNRA 4I9GA 4GMXA 2QVBA 2ZTHA 3KZ1E 4GZMA 2PXHA 2CDRA 4E4YA 2Q0SA 1RXCA 4DMFA 4RE6A 1GG5A 3B52X 2I8AA 4M8IA 4X3PA 4ZV9A 2GM3A 3ZWBA 2OZPA 3VSDA 4YV0A 1JAHA 2RHDA 2H1IA 2ANCA 2AN9A 5JJLA 4HNHA 1NVTA 3JWJA 3WOHA 1E0JA 4L6CA 4BYMA 1DBPA 1L4EA 1X38A 4XFJA 4HQNA 3HJRA 1MA0A 2GN8A 1Y5RA 3FCEA 2X0EA 1E9CA 4EPVA 5DH9A 1AT1A 4G1BA 4ZCIA 4I14A 4QJBA 1L6RA 5CTAA 3WVNA 4QTZA 4J2OA 1UXJA 4FJ2A 1L7PA 4JYPA 2PXAA 2Y0PA 4MQFB 1Y6RA 2QQGA 4W7SA 5IDYA 3U13A 1ZG3A 4AJIA 2FW9A 4J0QA 4Z99A 1S2OA 3W6OA 5IJAA 5IJWA 3A3OA 3A2KA 1F51E 1UBJS 2X1VA 3W5HA 5CJPA 3ZS9A 4CR7A 1U80A 3UK1A 3CKLA 4DR6B 2HK9A 1OZGA 2WJ6A 1EHIA 5JXWA 4HWPA 4FD2A 1ND5A 3KIPA 3JZDA 2IZ6A 1OJ7A 8OHMA 2QRUA 4XM1A 2C5LA 5AUPB 3THWB 3DJYA 2QV0A 1CT9A 1ODKA 1E3DA 1F2UA 4TROA 5KS2A 4BP9A 1NJSA 3SHVA 2D2XA 2WTMA 2C7PA 1HG1A 3N59A 4H18A 4L85A 2JIBA 2MSDB 3AI7A 4LY6A 1FNSA 2CLKB 2XUZA 3M4ZA 4TWRA 1GAXA 1IBCA 1Q1ZA 1QGYA 2J3IA 4A0QA 4S04A 4J1SA 5CB8A 4B0OA 1LK5A 4BRSA 1UAAA 4OHUA 1IAQA 1V4VA 2QRMA 5KCMA 3KETA 2XCRB 5EXSA 3VC2A 4RHFA 1FFGA 5IC6A 5HKKA 4GM0A 2CL7X 1YO6A 2DT8A 4WW0A 2G9VA 1SD1A 4HCJA 2TYSB 3THXA 4CF4A 4XIFA 1FVHA 2JKZA 1YJXA 2GFIA 4EGQA 4J94A 3FFXA 2W58A 4KO8A 2P0EA 3QA3E 2F2TA 2FAXA 1B8NA 2GWHA 4JLJA 1KEUA 4KIGA 4R69A 1W87A 3A4MA 2XCUA 2FFAA 3QP9A 3LE8A 4IIYA 5JSQA 4KQ2A 4UBOA 2G6BA 3GFVA 3ZPXA 5HUHA 3QKRB 1PFKA 4H6VA 4EARA 4P22A 3B6IA 1W5AA 2DWOA 3JQEA 4Y0NA 1JHZA 1GNPA 3BB1A 2I71A 3STVA 4GPZA 4WN9B 3ZX4A 1SIWA 3PIRA 3D64A 3ZWOA 4KGZA 4E21A 5L45A 2ZYRA 2Z08A 3TSZA 2FZ4A 4R5MA 4MW4A 1D5CA 1ITZA 2GJ9A 3BMNA 1JKXA 4QLBA 1TCCA 4NFYA 3MRVA 5EZ6B 1OPXA 2J4FA 3M5PA 5A02A 4KIJA 4DWVA 2I4OA 1NVXQ 1OAKA 2FEPA 4NV1A 4BLQA 5BMOA 1GZSA 4XGRA 1WPQA 3TIVA 1GUAA 3PZRA 2N47A 1LX7A 5FBHA 4DLSA 2L82A 1U3WA 2XF2A 2Y68A 3CEHA 5ALZA 5EIBD 1MNAA 1SUIA 3T34A 5KOHA 2JANA 3S3TA 3RAEC 1ABEA 4DR5B 4JJGA 4GIBA 1JA0A 2V7TA 5JZSA 2PSJA 2WIAA 5TY0A 3RODA 2J9YB 2CF5A 2OBFA 1XFAA 2QTMA 1NJ1A 4HGQA 1C7RA 5LQKA 3KQSA 2O8EB 4MX8A 1XZDA 1NW4A 5A9TA 1E69A 4H1UA 2YBEA 5EJIA 4Q4CA 5F35A 2H85A 4FYVA 1XYYA 2ZUCA 1ZH4A 3NC1C 5TE9A 3HXPA 3U9SA 4NEHB 5JSKA 4JBXA 1WRBA 4IDFA 4RYDA 1PG2A 4E07A 1M75A 1NFQA 1ZGZA 4J0FA 1TAHA 2JAWA 1Y4DE 1R4NA 1YFZA 1IBRA 3TG2A 2QLLA 1A9SA 4HF7A 4X20B 1IY1A 3RASA 2DQSA 3X1KA 4ZVKA