2ZTUA

T190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
235
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRLLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
total genus 78
structure length 235
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztuA00
3FNFA 4P38A 3F46A 4NI5A 4HNGA 2PGLA 5BT9A 1NHGA 3VH2A 3QY9A 3FWZA 2FRDA 3CZRA 5MGBA 1TB4A 1VKOA 1PGOA 3PWZA 4FJ2A 2ZB3A 1BXGA 3ZHZA 2D5AA 3V1UA 2CNBA 2Q46A 4KWIA 2QG4A 3FRJA 2AG5A 3QA9A 3KRTA 1C14A 2V7PA 2WE8A 4YJGA 3WSVA 3C7AA 4LSWA 3IKTA 3PFFA 4BO3A 3V2HA 5AXCA 5I8ZA 5KIAA 4E31A 3DTTA 4J7XA 3T7EA 2G1UA 4YDRA 5KVQA 2FOIA 3DBLB 3ON5A 4F45A 1JN0A 1WLYA 4BO5A 2TMGA 5IFLA 1ZO8A 2GLXA 1VRWA 3PRJA 3UW3A 5KVCA 4YJFB 2CZCA 3WX0A 1U4OA 1TEHA 3ENKA 1M66A 3RFXA 3UOGA 2NVUA 1IB6A 1ZIDA 1I10A 3FBGA 4GWKA 4DTIA 5GZ1A 4FFLA 4XYEA 5IXYA 2AQ8A 5BNFA 3OA2A 4RF4A 3KYCA 1GFSA 4HP8A 1NQAO 4WOJA 3ZV5A 1PQPA 2FR0A 5A9SB 1FMCA 1LNQA 3BMQB 3ENNA 2PFGA 5JO0A 3SVTA 1ISJA 1BVRA 3SBOA 1MC5A 1GTMA 1KC1A 4JJGA 3AWDA 3H6KA 2I5PO 2P2SA 3F47A 4XGNA 1K0UA 4CQMB 5ICSA 4LSMA 2PZKA 1B7GO 1NWCA 2F1KA 4NJMB 3JQGA 5JAIA 1PSDA 5CDYA 4Q9NA 3K5PA 4IJWA 3GAFA 3IMFA 4CLRB 1D1TA 3DOJA 3INGA 3VPSA 2C2XA 4LRSB 3FI9A 1EK6A 1PS9A 1ZK0A 1ONOA 3DTYA 5L9AA 2H6EA 3PQDA 4NBWA 4UUNA 2Z5LA 1R15A 3GEGA 1GD1O 1LRJA 2ZTVA 4KOAA 2W90A 1E3SA 4R9SA 4HUJA 1MXHA 4I5FA 5TJ9A 3PJDA 2EKPA 3W4KA 4XA8A 4TSKA 1WPQA 3C85A 4LISA 5KCZA 3EZYA 4RZHA 4CODB 3CIFA 1GDHA 2Q49A 3GNQA 2DLDA 3ZU3A 4UVGA 5T8KC 1U3WA 3GHYA 5TGDA 3I9NA 3V8BA 2HKIA 3TFOA 1FJHA 1Z7EA 3I9MA 2WD8A 1NPTO 4FB5A 4YT8A 3ORFA 3QQPA 1EVIA 2ZQZA 2J8ZA 5HA5A 4DC0A 2OBNA 2D3TA 1XA0A 5A06A 5DCYA 3OECA 1LTHR 1P77A 4U0KA 1GYRA 4DLBA 5T64A 1JTVA 3QSGA 4MINA 3T4EA 1UH5A 5CG2A 2C29D 5EERA 5K0ZA 5ES3A 3RUHA 2CVOA 1Z74A 4TRJA 3ZH2A 5JE8A 3OBBA 4DQVA 5BNTA 3L6OO 3RI3A 3IUPA 1AHIA 2O3UA 3RJ5A 2PH3A 1DRVA 3I52A 4L75A 1GPJA 1YB5A 4GLOA 1A5ZA 4PLZA 5GZ3A 3FR8A 4YRDA 1PS8A 4RPGA 4IUYA 2B5WA 4FDAA 1DJQA 3MEQA 2Q3EA 3ZWBA 1HZZA 3EDMA 4O1MA 4PVDA 1HE2A 4W6ZA 1XU7A 4CV1A 3GC6A 2E48A 4BO1A 5JY1A 3LC1O 3GDOA 2VRCD 4N5LA 4XEHA 2PGDA 3T7CA 4DC1A 2B0JA 4CM6A 3AUAA 1B26A 4A0SA 3ONEA 5F21A 4B8ZA 1I33A 4IIVA 3CTMA 3ZHYA 1Y1PA 5EESA 1P1JA 4Y67A 5IZ4A 2EGGA 4EI2A 4PFJA 7ADHA 1ZXBA 2CDBA 1T26A 5TT1A 3WMWA 1XYGA 4BO7A 4CM4B 4JGBA 1U8FO 2PZJA 3OSUA 4OAQA 5HM8A 4AFNA 1ZUD1 1WDMA 3FN4A 5CP8A 5JCXA 1HF3A 3GQVA 3L77A 3V2UA 1H94A 5AVOA 3WIDA 5A3JA 4R1NA 2NUAA 4R51A 4P4NA 3W4JA 2O7SA 4N5NA 4PRKA 3GMDA 1MV8A 2Y0DA 3PHHA 1KVSA 2Y05A 3WMXA 2Y1CA 4O5OA 4Z9FA 4Q3AA 1YBMA 1I30A 3BHIA 2GERA 4M8SA 4CMAA 3ZGYA 2SCUA 3LT0A 3D4PA 4G5HA 3IP1A 4WK6A 2AE1A 4ZJUA 1N9GB 3VDQA 1LRKA 3VPGA 4FBGA 3CKYA 4RQTA 2WYUA 2X0JA 1H5QA 1YH3A 3ZWPA 4YAKA 1LJ8A 5T57A 2RH8A 1DAPA 4UUMA 1Y5RA 4ZQHA 4BB5A 1PJ2A 4NJOA 3BYZA 1ADGA 2W2KB 2Q1SA 4DUPA 4CJXA 3K2BA 2XPCA 4KTVE 5H82A 1LQTA 5I7FA 2Q50A 4D7AA 1E6WA 1B15A 3ETDA 2BI8A 3WICA 1PJ3A 2Y66A 4CMJA 2Y68A 1LU9A 3U49A 3S2GA 3VZPA 4FQ8A 5TIIA 4YA6A 1P0FA 4G2NA 4ONEA 3ZV4A 1HDZA 2XXBA 2I3AA 1EUZA 4KDFA 1DO8A 3U5TA 3D7LA 4UVEA 2FY8A 1UP7A 5FYDA 1DEHA 3HNPA 4K28A 4OO3A 4DL9A 1B2LA 5I9NA 3U4DA 2ZYAA 3UVEA 1T1SA 1P1IA 5C7IO 3RUIA 1HZJA 1ENZA 4L4SA 3E03A 2VNSA 4ZVVA 4I08A 5GMOA 1XG5A 1HSZA 4U6QA 2V6MA 3H9JA 3OICA 4HX5A 4J16A 1PS0A 2X9NA 3K96A 4L73A 2UV8A 3VC7A 5BSEA 2FZWA 3HFGA 4LN1A 3WWYA 4GI2A 1LDNA 1WP4A 3E5MA 3ONDA 3WG9A 2BH9A 3RU9A 5A03A 3U0BA 1UUFA 5L53A 1B8PA 4IS3A 4LVCA 3SXPA 1KEWA 1NAIA 3O8QA 3PZBA 9LDBA 2ZB4A 1XLTA 3RU7A 4PLHA 3VHRA 5JYEA 3AFMA 4XKJA 2VRCA 1FF9A 1E7SA 1Y7TA 1A9ZA 3TQHA 2ZYGA 1LC0A 4DIBA 4LK3A 2HUNA 2IE0A 4R69A 4RQUA 1UR5A 1OI7A 2V6BA 4B4WA 4TZTA 2PGJA 1IPEA 1MA0A 2E37A 3PGXA 4Y6PA 4BNFA 3VTZA 4BNYA 5JLAA 1IZ0A 5H81A 3KOUA 4ZU3A 3RVDA 2AQKA 1LSUA 3GPIA 3HQ4O 2X86A 4WLNA 3ZWNA 4CM7A 1XKQA 1PGJA 1R6DA 3OFSA 1ARZA 1YKFA 5C3MA 5A02A 2O3RA 2PV7A 3WTBA 3UF0A 2QIOA 3H9QA 4R4JA 3ZU5A 4MIOA 1PWXA 1B8VA 4TQGA 1CQIA 4NK4A 4PZCA 1JVSA 1HEUA 3DC2A 4JLWA 3ZU2A 5KJFA 1SMKA 2HDHA 2ZK7A 1C1DB 5DF1A 1PR9A 1ZK2A 1PJQA 4B8WA 2WD7B 3RUAA 1RYEA 5EL0A 4D79A 1EFLA 3DBRA 5JW6A 3W8EA 1GY8A 2G76A 2ZCVA 1Q7GA 3EMKA 4QT0A 3ICPA 4CM3A 2UVDA 1A7KA 2D2IA 2DAPA 3RC7A 2RCYA 3BMCA 1I3LA 1XQ1A 3QW2A 1K6XA 2PZLA 1X0XA 2YHIB 1SOVA 2FPIA 4BNMA 2EW8A 1WNTA 2B83A 2C7VA 3DBVO 1JWAB 2QX7A 1Z75A 2NNLD 4Z0PA 1OBFO 1LQUA 3D4OA 1NQ5A 1O0SA 2EJVA 4ND4A 5BSFA 3SEFA 2X23A 1YDWA 1PZGA 2YJZA 4J9UE 4QSMA 1J49A 2YHUA 2PKRA 1XCBA 4CQLA 3HFSA 3CZMA 4CLDA 1H6DA 3AY6A 4DBZA 4J4BA 1XIVA 1CEQA 3LT4A 1G6KA 4YPOA 1HTBA 4D3DA 3E8XA 3DZBA 5IG2A 2O4UX 1N2SA 2ZJ0A 1BGVA 2E49A 2CF6A 3QIVA 3QWHA 3VZRA 3UICA 4JBGA 2GASA 3GZNB 3INTA 3AUTA 3O26A 2DPHA 1YXMA 3DBHA 3C1OA 2R00C 1M75A 1NFFA 1ZSVA 3K2EA 1GQYA 1S6YA 4ALJA 3QLJA 1U5AA 8LDHA 2EW2A 1AXEA 4M87A 2GRAA 1DC4A 3OP4A 4ILKA 4D41A 2Y1FA 3EC7A 4XYMA 4I8XA 5G0WA 2JHFA 2OUIA 1M6HA 4B3IA 4YT2A 2NTJA 4J7UA 4A2CA 2PD6A 1KVTA 1W6UA 1DFHA 4UAGA 3PDJA 2J6IA 4E2XA 3HN2A 2FSSA 4E4YA 3PYXA 3AW9A 1N7GA 3LQFA 1NP3A 4R41A 1KVRA 1V0JA 1G1AA 3AI3A 1C1XB 3F5SA 5K6AA 4HKTA 1IZ9A 4PRLA 3DMTC 4YEDA 1E1KA 1YQXA 2NVWA 1ADBA 4XD2A 4M89A 4ESOA 2I99A 1OC4A 2NM0A 4E3ZA 3NDIA 2BMAA 2BRUA 4YJGB 4AJIA 1PGPA 5CEJA 1SAYA 4JCOA 4Q3DA 4KQWA 2BGKA 5U1PA 1HSOA 2DC1A 3G1TA 3OEYA 1XWFA 2YDXA 1R0SA 4JJIA 3MOIA 1HDYA 5EMHA 1VI2A 1WAMA 3LC2O 1ZEMA 4D0SA 3Q0EA 4HFMA 1LDMA 4WCFB 2EHDA 3CMMA 1PQWA 3JSAA 3OIGA 3FNHA 4CMKA 1D4FA 5C37A 3N74A 2GGSA 3ITDA 4OYRA 4OXYA 4OKNA 2EKLA 3TF5A 3MWDB 3BTOA 2Q1UA 3K92A 3WXBA 2BFAA 4LMPA 3IDSA 1HT0A 5TC4A 4FS3A 3IQDB 1B3BA 1KVQA 1SBYA 2J3HA 3RAJA 4DYDA 1JDJA 3I9OA 1VJ1A 4NFYA 4RPJA 4JQCA 2VYVD 1KC3A 4XQCA 3E9QA 2AEJA 4Y9DA 2JD2A 3Q3CA 3TJRA 2ZB7A 1GYPA 3MWEB 2POQX 1GCOA 3DEYX 2FWMX 1TI7A 1XSEA 3DOOA 1MUUA 5DT9A 1SEVA 5L3ZA 2O7QA 1PZHA 3ZV6A 1FDUA 1VL8A 3EHEA 4IZHA 4IZIA 4BNXA 5JNLA 1T1RA 1LSSA 1YDEA 3W4IA 4I5EA 2DPGA 5LCXA 3KVOA 1YJQA 4J0FA 3TZHA 3U62A 1T4DA 1UAGA 4FC6A 3JQ8B 3S8MA 4RDIA 4J1QA 3DR3A 3O4RA 3D5TA 3S2FA 3WWZA 3WGGA 2JFGA 4YT5A 4RF2A 3HSKA 4CMCA 4EBFA 3F3SA 4A73A 5HWSA 4BGUA 5HTOA 4D45A 2Y1EA 3VOSA 3GK3A 1I0ZA 4XQEA 3JQ8A 2DUWA 3LU1A 4J2OA 2VZ8A 4OH1A 4WCFA 1R4NB 3M6IA 5B4TA 2AW5A 4QQRA 8ADHA 4OJNA 1R4MB 2JFHA 2JHGA 2O3SA 4DIOA 3GDFA 4LCEA 4R1SA 3QWBA 2YUTA 1HDGO 2X8LA 4WEQA 4E5MA 4EUHA 3C1AA 3QWFA 2HO5A 2B37A 1NR1A 4XQ9A 4GBJA 3WFIA 3WFJA 3DHYA 3V2GA 4CMGA 2Q99A 3QVXA 3NDJA 1ORRA 3OF2A 2B4RO 5DNAA 3KB6A 3UFXA 4BO2A 3WGTA 4C7KA 4IXWA 1CWUA 4DQXA 3IS3A 5B4VA 4YRAA 2NLOA 2GD1O 4CV2A 5IJZA 3AU9A 1NNUA 4NU6A 4CL3A 4EJ0A 3JQCA 3KHUA 2G82A 1LBEA 1O6ZA 1D1SA 1GV1A 1PZEA 4OL9A 5THQA 2QYTA 4PVCA 5TLSA 4I9HA 3MJSA 1O8CA 4FFRA 1YGYA 2JCYA 1GL3A 5J23A 2WMDA 1SCUA 2BI7A 2EERA 3D3EA 1EEHA 4NBRA 1Y81A 2YFQA 3S2EA 5G0UA 1DIHA 1DSSG 1JKFA 1QKIA 3CE6A 1Y8QB 4PLPA 2QZZA 1A4IA 1GUFA 3LK7A 3JD3A 1C3VA 1DFIA 3C7DB 3P5SA 3ZWOA 4UUPA 2AEMA 3DXFA 4BMNA 5IF3A 5JMPA 1V6AA 2RH4A 3ADOA 1RM3A 3ROMA 4MPDA 2IDZA 3K31A 1LLCA 2HK8A 4FPXA 2X22A 3S2IA 2D4AA 2Z95A 3NTOA 3BMOA 3VPXA 4KUHA 1EK5A 5G4KA 1B14A 1MP0A 4IQ0A 3E9MA 2BGMA 4MO2A 4EEZA 4W99A 3L9XA 2AXQA 5A05A 4J91A 2V65A 3WIEA 4XR4A 1FDVA 1ULUA 5G0VA 1IOLA 2EKQA 4R16A 1R12A 2RHCA 3VPHA 4NIMA 5ENDA 1GEGA 3TN7A 1EDZA 3WJAA 2DFVA 2Q2WA 3P7MA 1RYDA 3ST7A 4YQYA 5B4UA 1R37A 1GV0A 1DLJA 3HWRA 4GL4A 5L4LA 3RC9A 4DWVA 3GVPA 3RWBA 2WJPA 3WQSB 5KVSA 2BELA 1T2AA 3HHPA 2WSBA 3VVCA 1X1EA 1P33A 1YQGA 2D1YA 1GYQA 3C1TA 4BNHA 4CLHA 1UZMA 1QYVA 2VOJA 4RPLA 1LA2A 1WZIA 1LC3A 4IXTA 3IC5A 5KKCA 2QQ5A 3PQFA 3F6YA 4CMIB 3NV9A 1WMBA 4KTTE 3WGOA 4M49A 3OHSX 3WYBA 3NEPX 2RHRA 1V9LA 2P91A 4U8GA 5JAQA 2Q45A 1AHHA 2Q4BA 1HYEA 3U09A 3G79A 3O03A 4QUKA 4BS9A 4CM1A 3PHJA 1KY5A 4OKIA 1UP6A 3KTDA 1V3UA 4MVJE 1SB9A 3G17A 2VWHA 3HG7A 2FR8A 1EMDA 1ENPA 5CPFA 5IDQA 3PWSA 2Q4EA 3PDUA 4BMSA 4IDBA 5FI3A 1BVUA 4XB1A 4XJSA 4CQMD 5JS6A 4DIFA 4BO0A 3KM0A 3C3XA 1SO8A 2XXJA 4Q3EA 2NWQA 3RUEA 4J9VA 2DTDA 4L8VA 2ZATA 4EDFA 3D64A 1UXKA 2WM3A 2DTEA 1HRDA 4D43A 4IDFA 5IN4A 4BO8A 5F1PA 4WKGA 2C07A 3PHGA 4YAGA 3AM3A 4TRMA 4L4XA 2FMUA 1E3WA 2OORA 1YONA 4QXMA 5CHEA 1JW9B 1WZEA 5FEUA 1DRUA 3P2YA 3WGQA 2Y93A 1I5RA 3SC4A 3MJEA 1Y8QA 4HFJA 2XOXA 1AE1A 1GQQA 4O6VA 2CUKA 1ML3A 1VLLA 3HDQA 4HXYA 4LW8A 3K9QO 4RJTA 1VL6A 2NTNA 3JQAA 3F4LA 4PG7A 1A27A 1P1RA 1LSOA 1M67A 2WYWA 4YJHA 2P5UA 4I5DA 2G17A 3DZIA 3OH8A 4IDDA 5A9RA 5CFZA 2UDPA 1U3TA 2ZB8A 1EDOA 4BMVA 5F5LA 2CY0A 4HY3A 5T67A 1GZ3A 1NVTA 2J3IA 5A5EA 3X2EA 3OJOA 1ENOA 4TMFA 5DZSA 1ZH8A 2PLAA 1DHTA 3UGKA 3I9KA 2VWGA 1VJ0A 4CLEA 4BV8A 5EIOA 3ULKA 5KTKA 4MOWA 4AJOA 4OIMA 3ROPA 1QYCA 3PJEA 3D1LA 3JQGB 3R3JA 1PJLA 4GPD1 3DZJA 3WR5A 4DLLA 4ROSA 1OMOA 2OHXA 1T2CA 2EWMA 1NVGA 4C7JA 1J4AA 3C7CB 2VHXA 1GPDG 2VHWA 1U2GA 4DQUA 2NACA 4ND2A 5G2OA 3TRIA 3DONA 5BSGA 3ZNOA 4U6SA 4GAEA 4IDEA 1T2EA 1BXZA 2A4KA 3PLRA 4R1TA 5HS6A 3WQQA 2D59A 3E6AA 2B69A 1V3TA 4B7XA 3KSDO 4GVLA 5AQ1A 5EPOA 3AK4A 4CM5A 4JNKA 1VJTA 1LUAA 3E9NA 4PCVA 4II3A 1E77A 3W1VA 3BHMA 2WWRA 2P4QA 3QWIA 4TRRA 5C5IA 2W2LD 1WDKA 4YJFA 4D46A 1EUDA 4CMHA 1IHXA 3WTCA 1E3IA 1ZFNA 1P0CA 5L51A 2UUOA 3CH6A 4YYZA 4RL6A 3WQRA 1Y9EA 3HN7A 1I2BA 2NTVA 3ZNPA 3OQ6A 4YJHB 4W82A 4CUKA 4YT4A 3PZRA 5KVVA 3MOGA 4BNTA 1VSVA 2OO5A 2GN4A 3JYNA 4RDHA 5EQFA 2VUUA 2IODA 3S1LA 1QXSA 3FD8A 4WOKA 2PD3A 1A4UA 4ZD6A 3ASUA 1B8UA 3H9UA 4BHTA 3NJ8A 3DO5A 4P4LA 2V6FA 2NU6A 2X9GA 4E2YA 4AJNA 1X7HA 1E3WB 4DRYA 4RVHA 1BMDA 2JCXA 4K9DA 3SLKA 3ANNA 1FDWA 3IIEA 1CJCA 1WMAA 1WDLA 1GZ4A 2GZ3A 4PLWA 1G0OA 1HE5A 1QLHA 5IXSA 3DB2A 2ZYDA 4IDCA 1EUCA 3PVZA 3R1IA 1J5PA 1R16A 3L4BA 2YW9A 3GHHA 5CG1A 3HB4X 1NASA 4DLAA 3QE3A 4XDZA 3M2PA 3VZQA 1U5CA 3LT2A 4FD3A 4J1SA 3RFTA 1JAYA 4IM7A 3JYLA 1ZSNA 2BD0A 4GKBA 3VDRA 4HADA 1KEVA 3W8FA 5L95A 1XELA 4BNVA 1BSVA 3PEFA 3I4FA 1H9BA 1U2DA 4H7PA 2HQ1A 5JXWA 5AXDA 5JCJD 3PWKA 3BZUA 3JD0A 4YTEA 3JQAB 3NKLA 1C1XA 4I1IA 2R00A 1P31A 3W6UA 1A72A 1YBVA 4G81A 1R4NA 3CPSA 4X54A 3LF2A 2YQ4A 3NTRA 2ZJ1A 2X5OA 4H3VA 1DHRA 3JYQA 3OEWA 2CVZA 1DC6A 4EW6A 4D3SA 4BNWA 4XGIA 5A3VA 2QRJA 4UVIA 4JN6B 3ANMA 3KYCB 4DGSA 5FFFA 2E4AA 2VQ3A 1ZK1A 3GY0A 4RVGA 5I9MA 1X13A 2ET6A 1MB4A 2P5YA 1GU7A 4UEKA 3ICCA 4CR6A 1PIWA 4DYVA 2C59A 5BR7A 3K8ZA 2Q2QA 2VTEA 3KYDB 2GN9A 4J7CA 1UXGA 4A10A 1EFKA 4TZKA 3JQDA 1C0PA 3H5NA 2VHZA 4Y8VA 4KP7A 3BXXA 4XYBA 4B3HA 3CXRA 3SX2A 1R0KA 3HADA 4N5MA 4D44A 1CF2O 1ZEJA 2D8AA 3GGOA 4W9NC 3Q2KA 4CMEC 4GKVA 4E12A 1Z7BA 1E0DA 3WB9A 1FK8A 3WNQA 4CQLB 4MP8A 2GR9A 3PTZA 1QYXA 1D7OA 3NDRA 4IIUA 4MP3A 1L1FA 1H2BA 4NPCA 4UREA 4RF5A 4R5HA 1JKJA 3AM5A 4Z3KA 3H2SA 2GYYA 4Z6KA 2IZ0A 2IZ1A 1BXGB 3JYOA 1SC6A 3TFQA 3JQ9C 3R6DA 4ZRMA 2I3GA 3ROKA 3B1JA 4IQGA 3RC1A 3GVHA 4YACA 3NTQA 4RZIA 1C0LA 4E5YA 3G0OA 3UH1A 3GMSA 2DU8A 3BMQA 3W8DA 4UVHA 1PR3A 3C24A 4H16A 1YO6A 1BTOA 4NNJA 1LLQA 3BA1A 1E3EA 3DBRB 4GX5A 4AJPA 3AJRA 1JWBB 1P44A 4GVXA 3TOZA 1P1KA 4HFNA 4OXNA 4TRNA 3ZNNA 1E7RA 3UAGA 1LEHA 3KSZO 5JY6A 1X0VA 3NUGA 4UUOA 4MIEA 2D5CA 4E13A 5B1YA 3QVWA 3NYWA 1U1IA 4O59O 3D3WA 3MJCA 2B4QA 3RD5A 5ER6A 3A28A 2HK7A 4FOOA 1KBZA 2DBVO 5G4KB 3Q9UA 4R54A 4J43A 3LZ6A 3SC6A 3H8VA 4Y98A 1XGKA 3V1YA 4WLVA 5L7TA 2I67A 3QV1A 3JD1A 3GG9A 2GUGA 3F1LA 1Z82A 5A9SA 4CR8A 3EYWA 5AXBA 3JD2A 3PHIA 1UDBA 4TROA 3GNTA 1KEUA 3EK2A 5IZCC 4Y6SA 4E2WA 3L4BC 5ENVA 1NVMB 2A9FA 2EG9A 3GRKA 2NSDA 2BFPA 1E6EA 3EUWA 1QMGA 1QV6A 4NBTA 3GN1A 2HMVA 3GUYA 4DMLA 3PPIA 4IY1A 2DVMA 2P9GA 3WNVA 1SZJG 1WVGA 2DBZA 1GQ2A 2P9EA 3BMNA 2HAEA 3GGPA 4C4OA 4CM9A 3HJAA 4E2ZA 4FW8A 4P22A 4ZA2A 1IULA 5IAAA 3GZ4A 1AGNA 2C20A 4WJZA 3KZVA 5AOVA 1UAYA 3Q1LA 1I3KA 1D8AA 3GRPA 3U4IA 4J2HA 2F00A 1CIVA 1PJTA 5KWEA 2HU2A 4UEJA 2VWPA 1HYHA 4IJUA 3MJTA 3FNEA 3IKVA 2Y1GA 1BW9B 5DOZA 3NGLA 4DBVO 1JVBA 1AUPA 2BF7A 3AUUA 2XAAA 3PIIA 3RUCA 2JD0A 1W0CA 1EE9A 1X1TA 5DOVA 2PY6A 4IDGA 3LLVA 3DWFA 3IOYA 1RPNA 4RORA 1IE3A 1H6AA 2I66A 3VH4A 4JBIA 2CF5A 2YHIA 3KSUA 4PLVA 3H4VA 3DMYA 1YL6A 3BMCB 4BNZA 5ILOA 2Y1OA 4BO6A 3BMNB 3JQEA 5L45A 3H9EO 1Q2XA 2FHSA 2WEKA 4Z9XA 3WGIA 1NBOA 2D0IA 4R9RA 2C82A 1J0XO 1CERA 3MJVA 1M6WA 2WD7A 4BO4A 1BDBA 1PQUA 4ZRNA 4BQPA 1I3MA 1XEAA 1E1LA 1N7HA 1Y8RA 4ND5A 5IZCA 4ZICA 5JMWA 1O94A 3HB5X 4BNGA 2GNAA 4YBZA 2NVUB 4RO0A 4S3MA 4IGFA 2C5AA 4Z0TA 2VHVA 5IDYA 3OQBA 3Q6IA 1GEEA 3GF4A 5T5QA 4NBUA 1I2CA 4L74A 3TZKA 5B37A 5A04A 4A26A 2GO1A 4ZQGA 2HJRA 3ADPA 3VAZA 4AG3A 2B36A 4NZ9A 3ZW9A 1DLIA 1VL0A 1LLDA 5TT0A 2O48X 3RUFA 4F46A 4ALKA 2BHLA 4TKLA 3UCEA 3LC7O 3WGYA 4MVJF 1RKXA 4BNNA 5DCUA 5IDWA 2FPGA 2H9IA 1ZJYA 1I01A 3ASVA 4IJVA 4YCAA 4BIIA 3AU8A 4XR9A 3ZWWA 2J3KA 3HDJA 1CRWG 5C7LO 2GZ1A 4L9RA 5EN4A 3L9WA 4BUCA 2X0RA 1DAOA 3I9LA 1PL6A 4MVJM 3RFVA 4R3NA 1U7HA 4QECA 4YVFA 4AJ2A 3CMCO 1NXQA 4FN4A 5COBA 4NG5A 2IZZA 3H3JA 4BGEA 1U28A 1EQUA 4M54A 4J0EA 1C0IA 3A4VA 3HDYA 2C7GA 1P3DA 1F06A 3DAPA 3PGJA 5I8WA 5JAMA 1ZJZA 1WXDA 2E6UX 1ISIA 1FDTA 1F8GA 5DP1A 2OFPA 2ZTUA 3WOHA 3I6QA 1Q1NA 5LDGA 3B1KA 3STHA 1MG0A 1AN9A 1W8DA 2O4CA 1PTJA 3A9WA 1KY4A 2O2SA 5DBFA 3PJFA 5COAA 2HMSA 3ZWVA 3AUSA 3NGXA 2DTXA 3DAGA 5C7OO 2GDZA 1T4BA 2AE2A 2HSDA 1NQOA 2VN8A 5JFOA 3PI7A 4MVJG 3BIOA 7MDHA 2QW8A 2X0NA 3DL2A 1IY8A 1LLUA 2J3JA 4FIZA 1KYQA 2EF1A 4PN3A 4EITA 3DOCA 3SJ7A 3OA0A 3G1UA 5GZ6A 2CD9A 4AJ4A 5G0TA 2Q1TA 3QVOA 1QYWA 2PD4A 1V3VA 4XDYA 2PA3A 2QZ9A 1LDEA 4IINA 1XQ6A 4RF3A 4FFPA 3MTGA 3LT1A 3WLEA 1R66A 3LF1A 2Y0EA 4ALNA 5DP2A 2PWZA 4GH5A 3EGOA 3TOXA 1HXHA 3GZNA 4PZEA 3I5MA 4MKRA 5LC1A 1ZW1A 4JX8A 1E92A 1B3RA 1UDAA 1R0LA 5I7SA 3EY4A 2PKQP 1T2FA 3OQ1A 4FJ1A 2YV1A 2NV6A 4BNJA 1T25A 4CV0A 1DIRA 5HRUA 4NR0A 4E5KA 4J6FA 3D0OA 1SPXA 3ZHXA 4A03A 3QP9A 4AJHA 1MXFA 1U4SA 3PFWO 4WNCA 3MTJA 5FWNA 2X9VA 1N1GA 5TS3A 1NYTA 4YXFA 2NQTA 4QTZA 1ZXLA 4WLFA 4P4GA 3ZZNA 2QHXA 1TLTA 4KWHA 2NQ8A 4BO9A 4AJLA 1XHLA 2CMDA 4GX2A 4HFRA 1PX0A 3RUDA 4O63O 1KERA 4OM8A 2VT3A 3TPCA 4I9UA 1QORA 4CM8A 1MX3A 2CDCA 3EAGA 2HJSA 2VTDA 4WGGA 4W7HA 1W73A 2VCYA 4MKXA 4XYGA 1EVZA 1P1FA 5HBRA 4CMIA 2H63A 1MC4A 1YL7A 1Q0HA 2I9PA 4CV3A 3I1JA 2FSVA 2P68A 4ZGWA 5AXAA 5L4SA 5K9ZA 4TKMA 2P9CA 4GGOA 4LRTB 4DVJA 4J4TA 2W2KA 4YAEA 1E7MA 1PGNA 1YB1A 3INRA 3TSCA 4QO7A 1E5LA 4BB6A 2FP4A 3WS7A 2FR1A 4BV9A 1ZVMA 1TT5B 3TWOA 3VZSA 4KUEA 2HLPA 4KZPA 4DREA 1LI4A 4Q3CA 4AJKA 2JL1A 1OOEA 4A27A 4LCJA 1RWBA 2Z1NA 4L76A 4CR7A 4PLFA 3AI2A 4NU5A 2VYVA 3RBVA 1PU2A 4XCVA 3IL2A 1HE4A 2YDYA 4F6CA 4G65A 3SLGA 3DBLA 2J5KA 1UDCA 2I65A 5DDIP 5CDSA 2WTBA 4D3FA 1YOVA 5IDXA 4PG5A 5JCJA 1YBAA 4BNUA 3GOHA 2R2GA 4JBHA 1DFGA 1BWSA 2JD1A 4OMUA 3KV3O 4NH4A 2IYOA 2OGUA 2X0IA 3IJRA 5JSFA 4RLHA 5B12A 3TZQA 1KOLA 3U4CA 1DOHA 5EINA 1P45A 4URFA 4J3FA 3A1NA 5THKA 2HCTA 4O0LA 2HRZA 4EUEA 4ZN6A 4Z9YA 4AJJA 3JV7A 5CAEA 4NQZA 4MP6A 5A1TA 4ZQBA 5JC8A 3BTVA 4AICA 5T6BA 2H5LA 3GT0A 4GSLA 1QRRA 1GUYA 1TT5A 5K6AC 4WCFC 3FTNA 3LSYA 4JP3A 4E33A 2YV2A 3GR6A 1V35A 2RIRA 4D42A 5GY7A 3RCBA 1YB4A 2Q1WA 3GN2A 3KUXA 3Q9NA 3LYLA 4J90A 3RIHA 4DMMA 2PTGA 1HDXA 4E5PA 2PR2A 2G0TA 1BRMA 5JC1A 3KBOA 4B4UA 3CEAA 4MVJA 3OJ0A 5ER9A 4IGEA 3WBBA 2P4HX 3E1KA 1NPYA 1HE3A 4FJ0A 4IMPA 1U9JA 4IQ8A 1Q7CA 1OFGA 2UAGA 1UP4A 3RBZA 1JA9A 5DN9A 5BQFA 3N58A 4INAA 4CQMA 2C2YA 1VC2A 1P74A 3GAZA 1HETA 3GVCA 4BGVA 2EEZA 5CDTA 4RPHA 1YWGO 4IMRA 1GZ6A 4E30A 3QRWA 1EBFA 1A9YA 4II2A 3ZNQA 1F12A 4BVAA 1ZMOA 2IEDA 4NHEA 3MJ4A 2O3TA 3PXXA 4FFOA 4MVJP 2YQ5A 3LLSA 4UULA 2AEFA 2EJWA 3RASA 2NU7A 1OZAA 3WJ7A 4EUFA 5JBIA 2E82A 4LMRA 1IUKA 2G5CA 1N9GA 4PGFA 1DDOA 4Z3DA 2J5QA 1GUZA 2IYPA 3TDKA 1IPFA 1K6JA 3QWAA 1QP8A 1ZNQO 3RJ9A 3R3SA 1SOWA 4JJFA 2W8ZA 4BOYA 1RM5A 1I8TA 5JYDA 2VHYA 1HDRA 1PJBA 2BLLA 1E7WA 4MVJD 3HE3A 5JAZA 3BHJA 2IEBA 4K6CA 4GWGA 4BNKA 2PH5A 1XU9A 1VE9A 3F5QA 1EZ4A 3K30A 5I9LA 3FSRA 3M2TA 4K1LA 3OM9A 1K2WA 3M1AA 4XZ3A 4PLCA 2DFDA 4MJLA 2ZCUA 3VH1A 4CLRA 1BDMA 4FC7A 4JP2A 4OSPA 4PLGA 2ZKLA 3GFBA 4Q39A 5TJHA 3EVTA 3HZZA 3FNGA 2VZ0A 1MG5A 2CFCA 3E5RA 1I3NA 3OIDA 2FPPA 1T24A 3DFZA 2OMEA 1LSJA 2AHRA 2OOSA 1A71A 1PJ4A 1AXGA 3V1TC 6ADHA 1VSUA 2QRLA 2V6GA 5F1OA 3ETGA 4PLTA 4NDNE 4CMBA 2OL4A 1DC5A 4GSKA 3PYLA 4LGVA 1ONNA 2O3JA 3AOEA 3FWNA 3ROQA 4BGIA 2BFMA 1D3AA 4KQXA 5L4NA 4AJ1A 9LDTA 3TL3A 1NR7A 2BFOA 3ZDFA 5TQVA 2PK3A 3RSHA 2ZIZA 3JQ9A 2I6TA 2PNFA 3OMLA 3SJUA 3MZ0A 3EVNA 4ZQFA 4BNIA 2X4GA 3M1LA 3ZW8A 2JKVA 4KDEA 3WLFA 3UUWA 1DIAA 2DBRA 2EIHA 2VWQA 3E18A 4RV9A 2X5JO 4R1UA 4OQZA 1NWHA 1I32A 4B4VA 3O9ZA 4GMGA 5A4DA 3I23A 1GR0A 4TWRA 2J5RA 3B1FA 2HMTA 3LVFO 3FR7A 1GCUA 3DZKA 3T4XA 1SB8A 3PIDA 3P2OA 2OBYA 1B16A 3DDNA 3W6ZA 1NQTA 2VNAA 4F3YA 3VTFA 4TVBA 1UXHA 4BQRA 4WLEA 1HYGA 1ZCJA 4XIYA 3COSA 4EZBA 1ISFA 1OAAA 3IUSA 3BTUA 1DB3A 3GVIA 3U3XA 2NVBA 4XRRA 1HDOA 1X7DA 5EJ2A 3IP3A 5EQDA 4J1TA 3PK0A 2ZTLA 4FSHA 1JKIA 2GZ2A 3FHLA 4IJKA 3IJPA 4R01A 4RVDA 1KEPA 4K6FA 3GA0A 2AA3A 2BGLA 1G0NA 1DC3A 2PZMA 2AG8A 4WASA 1DJNA 1N5DA 1YE3A 4OHUA 2EV9A 3ZI0A 5FF9A 2A94A 1CDOA 5U9CA 4JIGA 1I24A 3I3OA 1CYDA 3JQAD 3NT4A 3AI1A 3KEOA 3FF4A 5ILGA 1ZK3A 2LDBA 4OOFA 1YS4A 4BNLA 1H6CA 1M2WA 3B70A 4PG4A 1MGOA 4Z0HO 1NFQA 4I5GA 5DBGA 2VUTA 4YJDA 1V8BA 4MDHA 3KETA 2C54A 2EP5A 2C0CA 1VKNA 1NM5A 3D5QA 3VKVA 1R4MA 4QFDA 3Q11A 2DBQA 3UKOA 2JAHA 3JTMA 1QR6A 2X58A 3GUCA 3UN1A 1Z45A 5DBIA 2IXAA 1ZK4A 4GMFA 1U8XX 2DKNA 4JROA 5KOIA 3B20A 3RBXA 2Y1DA 2DT5A 4WLOA 4CUZA 1F17A 3PQEA 1TXGA 4XWYA 4YQZA 5F1KA 3L6DA 3FPLA 1UXJA 1U3UA 3DHEA 3AOGA 5ITVA 3NT2A 3D4NA 2XF8A 1TT7A 4RVFA 2Z1MA 3ZWYA 4WE3A 3B6ZA 2X5KO 1F14A 3ZWXA 3E48A 1H6BA 1ONPA 3BTSA 1DIBA 1A7AA 3PHLA 4L0QA 3PJGA 1I2ZA 3JD4A 4CLXA 4B7UA 2FN7A 5ADHA 4BKRA 1RM4A 1Y6JA 1RJWA 1IYZA 2Y0CA 3GG2A 3H5AA 4J1NA 3ZV3A 5ITWA 3AY7A 3H2ZA 4J49A 3H9GA 4CLOB 3H65A 4E21A 1Q0LA 1QLJA 5JDIC 1HL3A 3FTPA 1H2HA 1E6UA 1E3JA 4GGPA 4Q3NA 2O23A 2Y67A 3CUKA 5TSDA 4PZDA 1W4ZA 5F3RA 1J6UA 3ZHBA 2WE7A 3GVXA 4ITUA 3L07A 3I4CA 3DFUA 2PKQO 3KYBA 3TZ6A 1IL0A 4XQGA 4AL4A 4MIYA 1H0KA 1N1EA 1QSGA 3TL2A 1ISHA 1U3VA 4A7PA 1DRWA 1XR3A 2YY7A 1O95A 3OJLA 3DHNA 2NU9A 4WECA 1PEDA 5H83A 1LXCA 1PZFA 2CVQA 2OP1A 5MDHA 1JLLA 1X15A 1KETA 4IBOA 5BSHA 4FR5A 3VPFA 2HK9A 3GH3A 3L4SO 4E6PA 1NX6A 4U5QA 3GEDA 2DUUA 2AQHA 1PJSA 2AQIA 3DAFA 3JQFA 4OOEA 4MVJI 1KVUA 1TVEA 2Y99A 4QX6A 3CSDA 1T2DA 2TMDA 3JQBA 1SEPA 2YV3A 1CQJA 5KJEA 4W7IA 2BKAA 1Q7BA 3DZHA 4NJMA 2I76A 4GX0A 3R0IA 1LX6A 2NADA 5L7WA 1PL8A 4W4TA 4L4RA 3OJEA 2Q2VA 4FOSA 1UXIA 3QVSA 3ABIA 1QYDA 4PIVA 3RKUA 3WGZA 4WPGA 1DPGA 3H5RA 5CEEA 4EGFA 1EVJA 1ISMA 4AVYA 5TX7A 4BL5A 4ALIA 5G0SA 1NHWA 3UXYA 3DZGA 1JAXA 2GF2A 4DXHA 4N7RA 1LDBA 4NBVA 4CUJA 2A35A 2H1SA 2VUSA 3U9LA 4HNHA 1ADFA 1E1NA 4OSOA 4DA9A 3ANLA 2GSDA 1ZZEA 4E32A 3L6EA 2IRWA 4U7WA 4UEOA 1ID1A 2C5EA 3DBHB 5L40A 4IDAA 4I9NA 1Z6ZA 3GLQA 1N92A 4CM9D 1UJMA 3L0DA 1WW8A 1H9AA 1TA4A 5COQA 4JXKA 4XRGA 4DPKA 3P19A 1BHSA 3VVBA 4ND3A 3RROA 5BNIA 2VYND 4NFSA 3N7UA 4EJMA 4WLUA 3X2FA 1FXSA 4W9NA 4B79A 4DPLA 2ILTA 1NPDA 5CPBA 1LRLA 3A06A 5FI5A 1PGQA 1YOVB 3DMTA 4UVDA 1ZBQA 4FCCA 1RM0A 4JK3A 4MKZA 3O38A 1LDGA 4EYEA 3AFNA 3EW7A 1IHYA 3H3FA 4OXKA 4M86A 2WDZA 5L7YA 4ZHSA 1OC2A 3GEMA 4FGSA 2CDAA 2HRBA 4HWKA 3RKRA 4PLYA 4D0RA 4NFHA 4QFCA 2YYYA 3LDHA 4K26A 2JCVA 2HMWA 1VM6A 3E82A 3G49A 4YR9A 4GX1A 4YAJA 1LDYA 1ENYA 1ZMTA 1EQ2A 2GCGA 3BAZA 1K5HA 1H93A 3JQ7A 2VZ9A 5G4LA 4M55A 3I9JA 5KJ1A 1Y5MA 2GN6A 2O3QA 3NT5A 1NFRA 5ICMA 1C1DA 3KLPX 5T8KA 2WYVA 5KKAA 1EE2A 1FDSA 2A92A 4XYLA 1WWKA 4OGWA 4H15A 5KJCA 3NJ4A 4WUVA 4XJTA 4CM8B 2CSUA 2HMUA 1HLDA 3K73O 2NU8A 4KMSA 2W4QA 2VYNA 3ZWMA 3ZU4A 1UZLA 3AOEC 3IAHA 4WCDA 1E7QA 1K3TA 4CLOA 3PLNA 4U0JA 1PJCA 2RBEA 2W2LA 4RVUA 4QEDA 1NTOA 2VOEA 5KNLA 3Q2IA 1E5QA 3WGHA 1ULSA 2X6TA 3VKUA 3WSWA 2JJYA 3GNSA 1Z73A 3DZFA 1S7CA 5CEFA 1B0AA 2O2YA 3DQPA 1BG6A 2VT2A 3NAQA 4BKOA 4HV4A 4PG8A 1N8KA 3I6IA 3ITKA 2GPTA 3C8MA 1NAHA 2QYSA 4N54A 3G3EA 3D3WB 1HKUA 1YRLA 1QG6A 3BMOB 2JAPA 4NMHA 4S1VA 1K89A 1YL5A 3GFGA 4PG6A 5JPIA 5AYVA 1P9LA 1CETA 3KO8A 2DQ4A 4E5NA 1EBUA 3O8QB 4WEOA 1GAEO 1YJ8A 1SNYA 3UCFA 3VH3A 1U7TA 1JQBA 1EVYA 2YFHA 4IPTA 3RC2A 1VPDA 3HUDA 1Y8RB 2DM6A 4FFNA 4QO8A 2OP0A 4YWJA 1O89A 4EJ6A 3WYCA 4P8RA 3ZCXA 5F5NA 4CMEA 4ID9A 2X7HA 4RCVA 1DBVO 2LDXA 4RPKA 4RVSA 1HWYA 4XGKA 4F6LA 2IXBA 3JQFC 2EP7A 5KJ6A 1F8FA 2GN8A 2R6JA 4ZQEA 5TRTA 5A5FA 3TZCA 3ONFA 3WYEA 1X14A 3A14A 4EEXA 3I83A 3AY3A 2W98A 3S55A 3TNLA 2RAFA 1M76A 4YAIA 1PL7A 2B35A 4ALLA 4KUGA 4LVUA 3U4HA 1E7YA 4J4HA 2EGHA 3F4BA 3QJ5A 5U4QA 1BXKA 1ZKMA 1HLPA 3OETA 3OJFA 4GLLA 5DULA 2OXIA 2ZTMA 3PYMA 1BW9A 1HDCA 3MCVA 2FZEA 3GPDG 4XX0A 4A5OA 5CDGA 3UCXA 4FGWA 3KEQA 4TVOA 5IN5A 3ZN2A 1XDWA 1Q0QA 4MVJH 3EZLA 3CINA 3KYDA 2ZQYA 4ALMA 3PP8A 3AM4A 4CPDA 4AJEA 1MFPA 3JYPA 4R68A 1L7EA 1PWZA 5I7VA 2JFFA 3K6JA 3KXDA 1E1MA 3GDGA 2O50A 3WBFA 4E0BA 3ZWCA 1GADO 3JCZA 5TNXA 1Y9AA 3HDHA 2OZPA 3NX4A 2VRBA 4HBGA 4CL8A 1ZSYA 3RQSA 4B3JA 4BKQA 5HS4A 3FBTA 4Q3BA 1L7DA 1I36A 4FFMA 2EXXA 4RLSA 1MFZA 6LDHA 4YRBA 5A9TA 1E3LA 1ISGA 4Y6RA 3FCOA 3KLMX 3QHAA 5DCWA 2AMFA 5JDIA 1MLDA 3FPCA 4BKUA 1O9BA 2UYYA 1JU9A 3F1KA 4CM4A 4R5MA 5CDUA 4ND1A 4XB2A 4GQAA 3QVTA 4XIJA 4IS2A 3OIFA 3V5NA 1K6IA 2YZ7A 1KS9A 1YVEI 5JDCC 3F9IA 4BKPA 1KIFA 2X1HA 4B7CA 1UZNA 5JDCA 1C0KA 4N18A 1X7GA 1QV7A 2QRKA 3UHAA 1O5IA 1DXYA 2UUPA 3WDSA 4DPMA 5LDHA 3GGGA 4B4OA 5I7EA 2B5VA 4OQYA 4R3WA 3JQ7B 1DIGA 3JQBC 5TF4A 1F0YA 3ETEA 4YB8A 1ADCA 5JO9A 2B4TO 3H7AA 1YQDA 3NRCA 1P1HA 4NK5A 4WNIA 4M1QA 3ZWAA 4RGBA 3JQ6A
chains in the Genus database with same CATH superfamily
4ACBA 1U63A 2E21A 3K6RA 3PDIA 1YFJA 1A9RA 2FPPB 4LC0A 2HWKA 5AOBA 3F46A 1G38A 3LPDA 4KG7A 4HNGA 5BT9A 4CTNA 1JLSA 3VH2A 1GLNA 3NOQA 4B3FX 4JA2A 2VKQA 3CZRA 1E99A 1VKOA 1FMFA 6REQA 2GCIA 1ZY2A 1FRZA 2XVZA 2DKOA 4KN9S 1K08A 3PXEA 4Y2JA 1BXGA 1JZTA 2CUZA 5GJBA 2D5AA 2P4SA 4MHTA 4LE0A 2PUHA 1TYEB 2QG4A 1OW3B 2AG5A 2VBIA 4K1XA 2BMEA 2WHEA 2ZPTX 2KW5A 4P86A 1Y3DE 4WCVA 3WSVA 4LSWA 1VPWA 3LG2A 1K2VN 1VMIA 4UBLA 3ZIDA 5AW4A 4MRMA 4C3OB 4U7GA 4XPIB 5AJWA 2O1EA 3H11B 3S70A 2A9QA 5CXUA 2GLTA 2VZLA 3C3DA 2PZFA 3W2TA 3ANYB 3MJHA 3NIDB 1SBNE 1TKAA 2YL2A 1V1RB 2ZYIA 4TV8F 4ZODA 5KVQA 4F45A 1WLYA 2FWJA 5EJGA 1ZO8A 2QE7D 3GIDA 1VRWA 1DUVG 5AHWA 4RTOA 1JEYB 2NAFA 3UW3A 5KVCA 1RAEA 4BEVA 4LJRA 2B3DA 2CZCA 4BBJA 3W78A 4C4SA 3IH5A 1W4AA 2WWTA 1C7IA 2CL5A 1TEHA 2NXWA 2ASVA 3ENKA 3NBYC 1JEAA 1M66A 3RFXA 2NVUA 4BPRA 1O58A 1KYYA 2AI2A 2M1ZA 2VFAA 3FBGA 4GWKA 3TSWA 2HIMA 4DTIA 5GZ1A 4BAZA 4EG3A 1G8JA 3A9TA 3ADDA 4R84A 3ZG6A 2CCKA 1GFSA 1FYVA 4BUZA 3TNDA 1JDZA 3WLRA 4ZZ1A 5J2UF 2PWYA 1LNQA 2R97A 5AJHA 2PFGA 3LUGA 5JNRA 3G5LA 5JWHA 3ZUGA 1L4UA 3PNLA 4IWNA 4XX0B 5ICEA 5MN4A 1MMFB 3EY9A 3N2EA 4Y2VA 1UKYA 5FHQA 4JI1B 4JJGA 5EJ4A 1YVPA 5ELXA 2O8DB 3A7DA 1H4TA 2I5PO 2KHZA 1TIPA 3AEUB 3V8NA 5A4KA 3U7JA 3X1ZA 5KPDA 3F47A 3NTVA 4CQMB 3II6X 5ICSA 1B6RA 2PZKA 3EVAA 1GGNA 3M70A 3JQGA 3TBFA 4NF2A 1PSDA 4LV5B 3P4YA 4E51A 3HV2A 1X7XA 2G36A 2IEIA 2XOEA 3T1QA 3NYQA 1ECLA 4M22A 3A2KA 2XVAA 1SIOA 2HIGA 4Q3KA 3LFHA 1H3FA 3GAFA 5BYBA 2RGXA 3BH0A 2V0GA 3DOJA 4KE7A 3L7MA 3QX8A 5SZJA 2ZSBA 3VPSA 4F06A 2GPAA 2H9AA 3B52X 1M2JA 3CW9A 2Z09A 1EHIA 4PZLA 4F1KA 3KWJA 4TYNA 2H4WA 2WT9A 5CLGA 3K0SA 2Z5LA 1R15A 3GEGA 3TTTA 1GD1O 3ROZA 3IE1A 4BN5A 2F8SA 2W90A 3OX4A 4FI3F 2QTAA 2B5OA 2D0PB 2IY9A 2PEZA 1BEEA 4U2DA 4C0JA 4JODA 4MW1A 2BM9A 3GRRA 3V97A 2R8PA 1IBSA 2FQYA 1K7XB 3EQ6A 4GMKA 3QKTA 3VOBA 4PNZA 1D5WA 4AG5A 2B25A 5KTTA 4AQDA 1EFAA 3UUFA 5GWXA 2B1RA 2C3MA 1GDHA 1J8FA 1U0GA 1SG0A 2H5JA 1GM5A 2HMAA 3KVYA 3PUHA 4F5ZA 3ADKA 1ZBDA 2ZUCA 3R2JA 5TGDA 4ZVTA 3JPYA 1N2XA 2HKIA 4O4HF 3AKCA 3TFOA 1JX6A 2WD8A 1NPTO 4FB5A 3QQPA 5BMVA 1EVIA 4FK8A 2J8ZA 1JFRA 1MO5A 3QYAA 4E2FA 2JLCA 5KX5B 3WRVA 1XA0A 1XTUA 2BAGA 3U80A 3RSCA 3B3GA 3OECA 4JLDA 4U0KA 1GYRA 1XZEA 4MI9A 3T9AA 3TLMA 3UK1A 4GOLD 1DDIA 3IJ5A 3CZ9A 4DLBA 4Q03A 5K3FA 2YZNA 1NATA 3K0AA 4ZAZA 2FLWA 4YP7A 2XSZA 1KIMA 3NHPA 3T4EA 3TLEA 1UH5A 3HB1A 4LXHA 1WMEA 2C29D 5EERA 5ES3A 1YZUA 3ZH2A 4M38A 3TD9A 2ALJA 5BNTA 3DHVA 3L6OO 4G86A 3A6JA 3SEQA 4EK9A 1TIBA 2XYVA 1RYMA 4PO9A 2A1UB 1GPJA 4BWYA 4YMSA 1JR3D 4GLOA 5EJMA 1AZTA 3FR8A 3IMEA 3PKJA 5IWAB 1PS8A 2X14A 3V9PA 2B5WA 4QFBA 3PDIB 4XSHA 3RVJA 3UK6A 3BIJA 1HZZA 1E5TA 1U2SA 3NALA 1VPVA 5YASA 4FE4A 3GFSA 3QEJA 3X1DA 4CV1A 1N6IA 4HWOA 4OX9Y 4JBNA 2HQBA 3FHTA 2MDTA 3C5WP 5KCMA 5K8LA 1T8RA 3GC6A 4K9LA 4QUGA 3HKEA 4OHZA 7GPBA 3TUZC 1EJ2A 2QTZA 4LZLA 2DFPA 3MMZA 4N5LA 5TF0A 1UK9A 2DG2A 1Y4DE 4DC1A 5JPCA 5CVVA 1QH8A 2FQWA 3SZUA 5F21A 4HMQA 4EGSA 1D5CA 1DBRA 2BEWA 4S1NA 3RS4A 4BYMA 4HVCA 4M1TA 4RKFA 1I33A 4NCHA 5GPBA 4XIIA 2OYRA 4XSGA 5IZ4A 1CRPA 4EI2A 2CMFA 4NNOA 7ADHA 3EEYA 3U1BA 5FBWB 4JL6A 1T26A 2YJTD 2R7LA 3L49A 4LYEA 5AVUA 3CX6A 4TXHA 1G4UR 5IYZF 4Y6GB 1JJIA 4JGBA 1NXPA 1U8FO 2H1LA 2AUMA 1OXTA 2OAP1 2QDXA 1VJ5A 1WDMA 3FN4A 4RIFA 4H2DA 1YZGA 2X77A 1YCFA 3KUKA 1H94A 1RMTA 4R1NA 3I01M 2YYSA 3HCAA 3FLMA 2F67A 4N5NA 3W4JA 3IKMB 1MV8A 1ZD1A 1RKVA 1RDFA 2K7ZA 1I30A 3BHIA 4ZYLA 1DKQA 1A3CA 4LXUA 4BQOA 4JWTA 2AXNA 2OO5C 1N7JA 3HKDB 3QFTA 1WHSB 2ZIVB 4G5HA 3U31A 3IP1A 1F7UA 1UMBA 5B5SA 4QTUB 5TMDA 4DLVA 2R8RA 2ZREA 4LYYA 3CKYA 4RQTA 3LQ1A 3QE4A 1H5QA 4YMIA 1PT7A 4TLDA 4PV7A 3ZWPA 2PU5A 4YAKA 3UAZA 5A5GA 3MMNA 4W63A 2PX2A 2RHLA 1P6XA 2V4MA 4ESVA 1CUBA 3BK7A 3OOSA 1O95C 1OREA 1BJKA 4ZCLA 4HB0A 3K2BA 5I7FA 2YKGA 3AJ8A 4JLUA 4D7AA 3I2GA 4YRCA 4V0ME 3ETDA 1SR8A 5CCEA 4DW8A 4AWAA 4B1FA 3GLGB 2Y68A 1LU9A 2BCJQ 3EUEA 4ZQIA 3U49A 2O1WA 3VZPA 1SCNE 1AMNA 5KTYA 4YA6A 1GN9A 2QMHA 1P0FA 4D3XA 1N5JA 2VNJA 4YQFA 5E1BA 3A37A 4CT4B 2GN2A 3AYZB 3ETHA 4UVEA 1CEXA 1YVRA 5EOVA 3MCWA 1UP7A 2IDKA 3HA5A 2EFJA 4IVQA 4IX9A 1EGHA 2XRYA 5IS2A 2XZOA 3T3OA 5EFOA 5I9NA 521PA 3U4DA 5IT9A 3AL2A 1AK1A 5EYPA 2WC1A 3UVEA 5DNYB 4ZI5A 2C2ZA 3A6PC 2VNSA 1I9GA 4I08A 3GJZA 4OHXA 2P3QA 4DCVA 2JLVA 2BGRA 1N2CB 3O75A 3E0QA 4GC9A 2WSLA 1V16A 3DL4A 1T3ZA 3K96A 4HAIA 4PYKA 3RG8A 3WMGA 4MWSA 4LN1A 1E0KA 5CA0A 1LDNA 1Y3IA 2BH9A 5A03A 1G2IA 3U0BA 5H3CA 1W5FA 2HY7A 4AKIA 4A0HA 1QQTA 1Z2EA 5B7NA 4X3OA 2XMDA 4IS3A 3SXPA 4F9EA 1NAIA 1USWA 2B1QA 4E14A 2ZB4A 1E94E 1K3FA 3LUBA 2HCJB 2X5NA 4IV0A 5K9ZA 4I50A 3QKSB 5KC9A 1FF9A 2BGTA 5CT9A 3FYHA 4KO2S 3PA6A 4MX8A 2M32A 3H2GA 1Y7TA 4NDAA 3SDBA 3ZW7A 1KI2A 5C5EA 5JANA 4UOEA 1ZN8A 3U44B 4A15A 2DULA 4TQUS 1M73E 3VAAA 4C6TA 1S2NA 4G0VA 1MNAA 2XX3A 4R69A 4G0YA 3O8NA 2V6BA 1OI7A 1GUAA 3A32A 3AEXA 2PGJA 1IPEA 4TZTA 1V47A 2YCLA 4Y6PA 3TNYA 4BB0A 2JLZA 2KBFA 3HR8A 5FA6A 3FOFC 1EFHA 4YV7A 2XJ9A 4AJ9A 5HOQA 3N5CA 3PV0A 3RSZA 1L5MA 2NYAA 4IF6A 1NC3A 1LSUA 3GPIA 3HQ4O 2WVAA 4FLFA 5D3ZA 3REOA 3TSZA 5HZHA 4NXMB 1I6WA 2JBAA 3HUFA 1EESA 4FFDA 4PQRA 2WHPA 4Y1RA 2H3EA 1R6DA 1J06A 2A9PA 2AOVA 4HS4A 3I72A 2YXDA 4G4SO 2GHRA 3D7KA 2O3RA 3K6KA 5A02A 3KYIB 4A0QA 3DAOA 2ENUA 4FONA 2J9FB 3H9QA 1IBMB 2VPXA 3NB0A 4QDOA 4TQGA 4YCJA 3UO8B 5F5XA 2A1TR 4BDSA 4JLWA 2IHJA 1WEKA 1T5OA 3IDZA 4ZCQA 2CYAA 2GAAA 1H8HA 3BL8A 3LYHA 2YWRA 3LX4A 1E0SA 1RLJA 3EXEB 3K8QA 2WD7B 1WSWA 3RUAA 3W9BA 3LDUA 5EL0A 3DBRA 2XMQA 3IRUA 1UJ4A 1UPFA 2G76A 3JAKB 3KUCA 4KN8A 4MA5A 3W8EA 2JLWA 3EMKA 4HN4B 4MWTA 2I2BA 3R3UA 4CM3A 4QULA 2E2WA 3DEHA 2DAPA 3INNA 2WLSA 3OZ7A 3PC8A 4K81B 4PHGA 4RKWA 1U0SY 1I3LA 2CLEB 1K6XA 2PZLA 1MOQA 2HPHA 3C6MA 3HCWA 3M4YA 3VNVA 1SOVA 1MH9A 2OCPA 4BVFA 2XBMA 1UPXA 1OF1A 2FPIA 4J6EA 3TLYA 1X94A 2YHSA 4K3UA 2CNKA 2CK3A 2QVLA 4FW9A 4B47A 4MZDA 2RKOA 2ORVA 4DZTA 3A26A 3RV3A 1N3IA 1Z75A 2OVBA 2PX3A 1K8XB 5HIIA 1OBFO 3K15A 4DWWA 2OFFA 3B1YA 2YNMD 2GZHA 5SV2A 1EIWA 1O0SA 3LO5A 3SEFA 4J9UE 4CG0A 1CUWA 2XY4A 2WICA 3U7EB 2YHUA 2PKRA 1JBKA 3IAEA 3G0BA 5BSRA 3ZK8A 4JOCA 2HA0A 2W71A 3N8NA 4CQLA 3W79A 4CLDA 3DQQA 2PSHA 1GTVA 5LKAA 1RQ2A 5JMTA 3ZDYB 1PJAA 2NO4A 4DV5B 1G6KA 2CWWA 1MRZA 3K72B 1VBKA 3E8XA 3NBUA 2RARA 3OAAA 4UQLA 2TECE 3MWJA 2PEYA 1VRCA 4OXRA 1KPHA 5DEOA 3EASA 1FCJA 1UBMS 4JBGA 2GASA 4OVKA 3O26A 3CKMA 4IDPA 1E8NA 2DQKA 4B31A 1WXEA 3PFBA 3F73A 3QJYA 5E4JA 1ZSVA 3GUVA 3DTVA 3K2EA 4RA9A 1DTSA 2R44A 3KK0A 4WXPA 4MYRA 1LI5A 4Z3OA 3ZTTA 2ZPAA 3FLEA 3QLJA 3L7AA 1RAHA 3IALA 3QKIA 2Q2NA 3RAGA 4DABA 4IHJA 3SGLA 4CGZA 5GM1A 2JLXA 4F3KA 5J2TF 1DC4A 1NVFA 3I1YA 3OP4A 4ZO7A 4ARZA 1TQ2A 1VKRA 4I8XA 1Y6FA 4PSAA 5FR1A 1OWPA 3AR7A 3N7TA 4ECAA 4DUZB 2NTJA 4FMPA 5EXTA 4Y0NA 4A2CA 2PD6A 5IBCA 2WFLA 4GLJA 4UAGA 2PJUA 3HN2A 1PV1A 2Z04A 5CVCA 2N0SA 4BV2A 5DYTA 2RIPA 5CU7A 3M3DA 3AW9A 3LQFA 2E5LB 4YRTA 4B9AA 3FWHA 3NASA 1V0JA 4BV3A 4M83A 3U56A 4RETA 4R8MA 4IO0A 1QRTA 1CQJB 3EF0A 2VPTA 5C8YF 1UC8A 5T4EA 3RYHA 2FWAA 2DZDA 3PJRA 2IHZA 5E6UA 1SOAA 1ZD4A 4WBNF 2I99A 1SG9A 1XMQB 4JI2B 2AF4C 1OC4A 2NM0A 2C78A 5FNVB 5JNUA 4B3RB 5DM4A 1OH8A 2QV0A 2ONCA 2BMAA 2RFLA 3CT6A 5HCNA 4AJIA 3ZE1B 4RC9A 2O57A 4K6KA 2MSNA 2I6XA 3T3DA 1JG2A 4H3KB 1PLKA 4Q3DA 2VDQB 3M0EA 2BGKA 4RK5A 4F6RA 2O7RA 4WT7A 3CZ5A 1FUIA 2OG1A 4OYLA 4C4RA 1H2RS 5DGXA 1QHYA 2CXXA 4KRYA 2BM1A 3JWGA 1FNNA 1QH8B 3U9TA 2XXAA 4WCFB 2GAIA 5DHTA 1M8JA 1USIA 3DE1X 1PQWA 3EJWA 3JSAA 1FMJA 3OIGA 4P5PA 2PFKA 3HL4A 3G9QA 1D4FA 3ELBA 1PG0A 3KOYA 3N74A 2BT4A 5AKHA 3Q12A 1F6BA 1JXAA 1OV4A 3FDIA 3LXMA 4GHWA 4N01A 5I51A 4ZO9A 5BWMA 5K8VA 4QLAA 3HK2A 1JKJB 1PK8A 3K92A 1YJBA 3LCVB 3OEHA 3UMGA 1LPOA 5FTWA 5TC4A 5HIAA 2EQBA 3DAYA 1KVQA 1SBYA 2ZE7A 3CRNA 1RQLA 4Y0AA 1YI0A 4F6RB 4V3BA 4LPKA 1MOSA 3R3HA 5FR2A 1LLFA 1JXMA 2I87A 4G0MA 4G4JA 1IRXA 1I51A 4MYTA 3LLMA 1A7JA 2J4FA 3HSSA 1F1JA 4Y9DA 5DRTA 1HM5A 1RZRA 5H68A 1MN6A 1HPLA 1PFQA 4Q7MB 4FTWA 3DEYX 2FWMX 3ESXA 2H29A 2P9FA 3NW9A 4KQEA 4QUIA 1QYRA 4P33A 2RGDA 5L3ZA 9MHTA 3GJ7A 1FDUA 1VL8A 2AYXA 3EHEA 4ZARA 1ZJWA 1RI5A 5J40A 5JNLA 2PT6A 2C4UA 4OHWA 2ZXFA 4IMJB 2DPGA 4OGGA 3I61A 1ZG3A 3PFIA 1C3OA 3SFTA 2RHDA 1JSZA 3U62A 3HBMA 1T4DA 4DMKA 4FC6A 2FEOA 1MGPA 1G9SA 3KJNA 4RDIA 2H0RA 2OC4A 5EGSA 1RXYA 3GMTA 2QMEA 421PA 3O4RA 4BASA 4F4FA 4QVIA 1IN4A 3S2FA 3CH4B 3WZ2A 1RRMA 2PRSA 4YT5A 1YRBA 2GPJA 3HSKA 3IBFA 5JAUA 4ZAXA 1SHTX 1M7GA 2NV0A 2P11A 3VGPA 4D45A 2HTFA 3TW0A 4L08A 4XQEA 1OROA 4DV1B 2DUWA 3SF0A 2FA9A 2FCAA 4WCFA 1KWKA 4V0MA 2EYQA 1JDTA 4QQRA 4J0DA 3D1VA 1LK5A 4MQUA 4QQNA 2JHGA 1OHHA 1XVVA 1ILWA 2O3SA 1DXHA 3B1XA 2HU5A 3GDFA 4MJ7A 4U7FA 2YUTA 1KMCA 4WEQA 1DVRA 1IFXA 1PE0A 1Z17A 2XMBA 3GLVA 5ALWA 1JSXA 2V3WA 4Y0VA 1X1QA 4OG2A 5GOTA 4LF5B 1E0JA 2RGWA 3FFAA 5AOCA 1AKTA 2RHGB 4QOHA 4UJ5A 5J1SB 4P4SB 3V2GA 3ERCA 4CMGA 4K3VA 2JLAA 3NDJA 3QXCA 5E4TA 3OF2A 1K0FA 2B4RO 1CE8B 3EGCA 3GJQA 4R6XA 2PS9A 5FL7D 4CG3A 4DYHA 5ADUS 4BO2A 2NIPA 1CWUA 4ZHQF 1MNQA 1UMDA 4N5IX 1TZBA 1BN7A 8ATCA 4YRAA 3I0NA 4I6EA 2D6FA 2V4UA 2A5FA 3S2UA 1F0NA 3OZCA 4MAMA 2GD1O 4UE6A 4QYIA 2QQEA 3U4AA 4CHGA 1BMTA 2JFPA 4NU6A 3TCXB 2AFHE 3W3AA 4ZEOA 5K03A 2ZRBA 1MD9A 5DBHX 3ZOZA 2P9BA 3F9RA 1LBEA 1O6ZA 5AI6A 1KZ9A 3MGAA 2C61A 4PPNA 4BLSA 2BR5A 4PVCA 2XNCA 3F7NA 1FU7A 3UJ6A 1K9VF 2ANCA 1YGYA 2JCYA 2Y0PA 4QGAA 3TQFA 3HZRA 4WDRA 4DA7A 4AN1A 3QXGA 3A58B 2NO0A 1EEHA 1KMMA 1D09A 3DVRX 1DIHA 2QI9C 2AJ8A 1JKFA 1PK7A 1WJGA 3P71T 5AWFC 2QZZA 2W0MA 3UXMA 1FRFS 2V7TA 3JD3A 1OI2A 3IAAA 4TTRA 2FSIA 1KKUA 2JZNA 3C7DB 2AK3A 3ZWOA 2MCFA 1KEEB 1FP2A 1KMQA 4RTRA 1OBCA 5DYYA 3AF3A 4MS4B 1V6AA 3HEBA 2CLHB 1T9AA 3DMGA 3EQ8A 4RHUA 3TLJA 4D96A 1Z06A 3UC5A 3SDZA 1WZCA 2OECA 2OXCA 5CBPB 2GEKA 1PX2A 3VVLA 4MPDA 1CK4A 5C8XA 2GEDA 1EWRA 1FFXA 4YP6A 4D9JA 1V11A 4FPXA 2NXNA 3IDFA 5CLIA 1SHUX 3PEVA 2I34A 5E8RA 4DSNA 4D0NA 3BMOA 3VPXA 4KUHA 3B85A 1EEXB 1B14A 3PC2A 2C5HA 3E9MA 4F85A 1V1RA 4BX8A 2BGWA 1J2YA 1V71A 4JGGA 2AXQA 3WL8A 2JKYA 4XVHA 3OLXA 1M1YE 1IQUA 4FINA 4FMCB 4XR4A 1Q44A 3MLBA 1IOLA 1TD9A 2UZ1B 4R16A 1TKCA 2RHCA 1PDVA 3CEJA 4GYKA 3TX6A 2ERCA 3WJAA 1EDZA 1T6YA 2DFVA 3ZY3A 3VPAA 4UHKA 4E4RA 3NHLA 2RHBA 1DLJA 5CTAA 5HP4A 3HY6A 4LYJA 1BA2A 3D54D 2ZIUB 4MYSA 1ORIA 3HHPA 4I1YA 4P4UA 1P33A 1W47A 2VK8A 2D1YA 3OM0A 5E4YA 4WHMA 1X1CA 4BNHA 3HM2A 3B1ZA 4BIMA 2B4YA 5CVTA 3RTAA 1QYVA 2G28A 4NH0A 1SVMA 3SKXA 1D0VA 2YZ2A 1WZIA 1WF3A 4OEHA 4BMOB 2G0AA 5FB3A 5H7XA 1G6OA 5KKCA 2P3OA 2ODWA 3PQFA 3A6ZA 1WMBA 3IPRA 4DWJA 2GAJA 5JAQA 1W2HA 4Y2XA 2VSQA 3KQVA 2NSLA 2BISA 3QY0A 3U09A 3U7GA 1QHXA 1A8QA 3BQNB 1EFPB 4LBVA 1C80A 1T9DA 2G1JA 2EBFX 1SB9A 3BWXA 3G17A 3HG7A 3R9IA 5BWBA 2GK3A 2BGNA 2FR8A 3ZQJA 4W6QA 2ZBRA 1SBTA 1J00A 1XXHE 4Q9KA 3TOVA 3LBYA 4PN7A 1JHRA 4W8GA 3VYRB 1EAMA 5JS2A 4XB1A 2GM3A 2X9QA 1CE8A 3EA5A 3G6WA 1GCIA 4ER5A 5JS6A 1L4YA 3KM0A 4OBXA 4YUVA 1SO8A 1CY1A 1U8AA 3BE4A 3HDGA 1CZRA 4Q3EA 4OHPA 2H06A 2GILA 3RHTA 3W0LB 4H1WA 3HCRA 3X1XA 2DTDA 5E7QA 1OTXA 1XBTA 3O74A 4Z8XA 5JVDB 4A3SA 3EEQA 4MW9A 3EAQA 5PGMA 3TQSA 5HKBA 1BGXT 1JDBC 2BOVA 2G3YA 4P7FA 5EZ6B 2DTEA 3MUNA 4OFBA 3WGMA 4C0HA 3ZEAA 3LQ4A 3OIUA 5DLDA 2PUWA 1U9IC 1E64A 3FZNA 1B1CA 2BGIA 3CV3A 4FHZA 4OFZA 4OJYA 3AVPA 3FMPB 1KFCB 3HO6A 3DM5A 4X6UA 4BQIA 1XQYA 1PHPA 1YJXA 3UPDA 4E03A 3HKCA 4HZUA 4RHEA 1L5OA 2DQYA 4L4XA 1JIJA 4A6DA 4AO6A 1YONA 4UU1A 4Y2HA 3VYVA 3T4UA 1F4PA 3ET4A 2A30A 1SXJE 2H2FA 3AR6A 1XF1A 3ZXXA 3DFKA 2P6RA 5SYNA 5C8ZA 4KBYA 4O2BF 5L3VA 1JP7A 1NF8A 4KXFB 1F3LA 4MMXB 4UM9D 4DDVA 4ZCIA 3KSBC 3IQHX 4O6VA 1RFGE 1FU4A 2CUKA 3B2NA 4M6WB 5TMEA 4LW8A 1ZIOA 4RJTA 4ZZ3A 2ZUFA 3R4CA 3TD6A 3TS1A 3DV0A 4EJSA 5KBYA 4ZPJA 1H2AS 4YCNA 2GJKA 1NE2A 2XTJA 2WYWA 2QAGA 2IOQA 2P5UA 4HSGA 1ZNZA 4KQGA 4LA4A 4Q9IA 1IVYA 3DZIA 3VSDA 5T4BA 5A9RA 3ED5A 1G8KA 1U3TA 4RNCA 1T8WA 5JZOA 1ZAYA 1CLEA 3BPSA 1ODCA 4HY3A 1GZ3A 4GZ5A 3DJYA 4TMFA 4P53A 1DHTA 3I9KA 3JW8A 4YP1A 1V7ZA 4EB0A 4F8YA 3O8OB 2Z98A 2HXGA 2JRLA 4MOWA 1Z0UA 2OZLB 3SHTA 4JYAB 4JEUA 1QYCA 2ZRGA 3R3JA 3V3KA 1WKVA 1PHRA 1DQYA 2HWUA 1VSQA 4IVRA 2C8JA 3MRVA 3ZV7A 2ZQ5A 3I1IA 4PZPA 3CO5A 4I4LA 4LNUA 5DSZA 5L3RA 2WAMA 1SRRA 1U2GA 2VHWA 2WIJA 2DH6A 4D9IA 5EJ7A 5FLEX 2NACA 3ZDBA 1FIUA 1L1EA 5AMXA 3DWIA 5CXXA 4EGQA 1QIDA 5B1EA 3RGGA 1T2EA 3N2ZB 2G9UA 3PLRA 1LBQA 3WDKA 3COYA 3TLBA 2UZ3A 2B69A 5HW0A 1V8OA 3KXKA 3P32A 4R3UC 3E9NA 1M2KA 4UHHA 1L7BA 3E1GA 5AVSA 3ZJTA 3BHMA 3UT5B 1HA3A 3DEZA 3QWIA 4P84A 3RIXA 5FWXB 2VAMA 4YJFA 3ZKWA 4D46A 1EUDA 2XHZA 1IHXA 5JSKA 1F3OA 3WTCA 4DDKA 3M4ZA 4FZVA 1RYHA 1MPXA 5REQA 4Z86A 4FBLA 1ZOOA 1UXOA 2ZSEA 5L51A 3E9EA 1JVNA 1DOAA 3LO8A 1OR8A 5JCOC 2C4HA 1UQUA 4YREA 4Q47A 4YYZA 1ESZA 5IAOA 1Y9EA 1XZ8A 2A9KA 1LF5A 1Y4SA 1NDHA 4PGHA 4LTMA 1X8XA 2NTVA 1XQVA 5ISMA 3OQ6A 2Z8XA 4YJHB 3UJCA 2GM5A 4CUKA 4TMYA 4YT4A 1WDTA 3GLHB 3PZRA 2I54A 2YN4A 1FQOA 2QLTA 5F51A 4P3NA 3K0AB 3HSYA 2IODA 3S1LA 1HTTA 1QXSA 3O0TA 1AT1A 1J2RA 3A1UA 1XZDA 4WA8A 3NAZA 5D51S 3T52A 3UT5A 4UAJA 3ASUA 4JUAA 1L3IA 2AV6A 3KQYA 2IUEA 3HM9A 2P6MA 3PQCA 3K7EA 1CVIA 4QQ8A 3D4IA 4HDRA 3V4VB 3FI0A 2X9GA 2AKEA 3KEGA 5MN6A 4LXGA 4L72A 1E3MA 1P7VA 1U2TA 1UBFA 3F5DA 1IWPB 3HDTA 3OZEA 4RD4A 3RC8A 5BXYA 4QG3A 4L2IB 1E6KA 1TLLA 1GKKA 3ODPA 3UAXA 4U1RA 1I1OA 4ZO4A 2EZ9A 5LQMA 2VJQA 4DCPA 1B0UA 3DT8A 2GZ3A 3HS3A 3JYHA 5IJ9B 1G0OA 5IXSA 1FSFA 2L17A 3DB2A 4S04A 3ZVKA 2QL9A 3R1IA 4NV0A 4UOZA 1J5PA 3L4BA 2OZLA 5E3IA 4O4LF 2I3BA 2HHAA 3HB4X 4X92A 3UW1A 1FSPA 1DE0A 3AB7A 4GZ6A 1FPMA 1G5QA 3M2PA 1CUGA 4JC4A 3VZQA 2BP7B 3QVKA 4B2PA 5A6VA 1Y3CE 1Y80A 2E5FA 2V59A 4J1SA 1JAYA 1JR4A 1USUA 1J8QA 1KMNA 1F51E 2BFDA 1AS0A 5B3JC 4JMLA 4C7XA 3MUEA 1JHOA 3Q72A 3JR7A 4HADA 1HFEL 3PFCA 1VMEA 2AFHA 1UK6A 1XELA 1NQVA 3PEFA 2EFGA 1K9SA 2HQ1A 3AV3A 4KZKA 4MQ4A 5AXDA 4J3NA 2PUCA 3PWKA 2OHJA 2H07A 2REBA 2NPIA 3E3AA 3JQAB 2QD2A 1C1XA 2GVDC 5BT8A 1JPVA 1LX7A 1SUSA 4J16C 2O0MA 1E5XA 3LWNA 1Q14A 2UZ0A 4MQBA 5CURA 4KPYA 1ICEA 3A3PA 1N34B 1X7YA 1YS9A 3K8YA 1N5IA 4X1IB 2WFLB 3DF9A 3WGLA 1DHRA 3OEWA 1SUAA 4HEHA 4ZT2A 3EA4A 1FRNA 3Q1KA 1U5BA 1YQEA 2E1PA 1BQ4A 5HFJA 4HNAA 2C92A 4PHFA 1UBCA 4M7WA 2ADOA 2RGUA 1O94C 3SXUA 4AMVA 4ZT4A 5FFFA 3IVCA 2E4AA 3WKEA 1XTPA 2VQ3A 1RWOA 1TF5A 1U7PA 4AX4A 3GY0A 4OK5A 5IMBA 3SIXA 2ET6A 1KBQA 1JYEA 3Q7TA 5BQ5A 4WNYA 1GU7A 5I8PA 3TW4A 2CSXA 1RLOA 1PIWA 5D3QA 2C59A 2OQ2A 1SKYB 4G8BA 3PQ8A 4H7KA 3VR2A 4BN0A 5KYYB 3KYDB 1N2OA 5D1HA 2W42A 2GN9A 3BXZA 3IMCA 1E59A 3HBFA 4R8LA 1R5JA 1C7EA 2A78A 3MCUA 1FX0B 4RBNA 5HOEA 2YZKA 3ECSA 3GUHA 2ONZA 2MMCA 4N47A 4Y8VA 4BCCA 4B3HA 2BCGY 2QTTA 1G41A 1G3IA 1ZIXA 3EH2A 3N0XA 2M6RA 3VU3A 4D44A 3EGEA 3EVCA 2G09A 4E12A 1WSBA 1FYWA 1YZVA 1Z7BA 2A5GA 1KZHA 1YUNA 1A2OA 1XROA 3AG5A 3WNQA 3ZZUA 4A6PA 3WLHA 4TZ0A 4HLNA 2VP3A 1QYXA 2IXGA 2QOEA 3A6GA 1D7OA 3AF4A 4IIUA 1L1FA 5AFSA 1EXVA 4UREA 2WDPA 3FYDA 1KAOA 3TXXA 1FXWF 4R5HA 1MO6A 3AM5A 4H60A 3CYFA 3H2SA 2G7ZA 2JPDA 2DSNA 1EPUA 2XB9A 3FCUB 4P83A 4U2BA 1F2TB 1ZRSA 1MA3A 4ZRMA 2W6ID 3F6BX 3ROKA 4QGFA 4C1BA 4IQGA 1B43A 3EXFA 2V97A 4YACA 5B30A 3NTQA 2Q27A 3V4RA 4BLTA 4HAOA 1ZQ1A 1E5DA 2O8BB 3KLNA 2I55A 3GMSA 4KNVA 2DU8A 4RACA 4O2BA 4IOKA 1KZ6A 3ZQ6A 4X41A 4XARA 4N9QA 4UVHA 1JT9A 1T5SA 3VYUB 1GDTA 2WT4A 1PR3A 1SCUB 1JL3A 1B0ZA 2YMQA 2Q7DA 4NNJA 2F64A 4I99A 1C8BA 3MWLA 4I8DA 3D5EA 3QENA 1J1IA 3BA1A 2OCBA 1QGUA 4GX5A 5ESWA 1P44A 3JR3A 3P9RA 1S7GA 2I2AA 3P9IA 4TWZA 1DQRA 4RSRA 1E7RA 1XXHA 3ZXYA 1LEHA 2IYXA 5CM8B 5JY6A 2EJUA 4F8EA 1FQWA 5MFPA 2VATA 2NUPB 5L6MB 2O7NA 3KCQA 2FEPA 2D5CA 5CHYA 2BCEA 1U3GA 1M2VB 1KJZA 1XE3A 5LD2C 3K70D 5ER6A 4GXQA 4GECA 4PCLA 5C80A 1AHNA 4D25A 5B1IA 2AR0A 4K8OA 3IULA 4OIFA 1A2BA 3NTLA 5G4KB 2RGNC 4J43A 3SC2A 3SC6A 4HVTA 3Q7PA 1FX0A 3TVTA 1YZNA 3H5IA 3K9NA 3T5DA 2FSUA 2J9ZB 4Q02A 4WY5A 3RTEA 1MIHA 3MQ4A 3CFYA 3V9AA 2HGZA 3LKVA 1O54A 2QG6A 3IQEA 2CFTA 5BWNA 4JLMA 1J0CA 3GG9A 3L6CA 3UJ7A 3F1LA 5BUQA 3I8SA 1Z82A 1ZH4A 2AFRA 2W83A 1V43A 2SKDA 3AUKA 3DZCA 3OUUA 5CYOA 1FFEA 1UJCA 5AXBA 3MD9A 1X1AA 3JD2A 1IH8A 4TROA 4TWBA 4C0BA 4EZIA 5IVKA 5JQWA 5FOSA 2JAQA 4DIDA 4OM7A 1MEOA 4M60A 3L4BC 4Y6SA 4E2WA 2EG9A 4JITA 4R1LA 5C32A 5M04A 3ZI7A 5CFRA 3FBWA 3EUWA 1YDMA 4PY2A 1EDBA 4N7JA 3I12A 3GN1A 1H2XA 1WS6A 4FDLA 3TQTA 4DMLA 4LVOA 4QREA 4N8SA 2DVMA 5FLYA 2R7NA 3HB9A 4D8TA 3FSGD 3OSZA 2GEUA 3WYAA 3TB6A 5HTKA 4HDAA 4DT1A 1AB5A 3NIGB 1ZWLA 4KVFA 16PKA 2P5TB 3OBIA 4MKHA 3GJSA 1QNFA 3EIUA 1H85A 4Q4DA 4Q9AA 1ZIYA 1QJCA 1N3LA 1ZMRA 3UHOA 5HGXA 1A82A 3OPQA 5IAAA 1AGNA 3R9KA 3TBHA 3KZVA 4J2HA 3QLVC 1I3KA 4QYIB 3V55A 1IIRA 4X84A 2F00A 3OZXA 2R60A 3KXPA 1XTQA 2VWPA 1QWOA 3RRBA 3FNEA 5FUWA 3IKVA 1IEQA 4GFDA 4U02A 5JZVA 2Y1GA 3CWQA 4HEA1 1SPBS 5K3OA 2WTUA 3ONWA 4DBVO 1RBZA 4CGYA 1AUPA 4GG1A 3M6WA 1XL0A 2XAAA 2ZE6A 3PIIA 4L28A 3IIIA 2JD0A 4Y9TA 3M6UA 2PY6A 3LLVA 2VAXA 4HQLA 3T5CA 4H1TA 4RORA 2QN7A 1IE3A 2VR1A 2B9EA 1TDJA 3PQ4A 1K88A 3OPYA 5EG5A 1WU8A 4YUZA 1CEEA 1ZRMA 3P97A 4JBIA 1U0EA 3EISA 4Z54A 3R23A 2YHIA 1IMOA 3OE4A 5FBQB 3SP1A 2V9ZA 4MDEA 3VTKA 4BNZA 5EP3A 3R6TA 4MR7A 5ILOA 5FRDA 1ZU5A 2CHEA 1O77A 1XZFA 3TRJA 4BO6A 4PC3A 3T5MA 3H9EO 4K6OA 2FHSA 2GCNA 2C9CA 1NBOA 4QA9A 1ZJ5A 1ZNWA 3UJ9A 4B3TB 3GFRA 4HGPA 2XXAB 3VQTA 1Z63A 1PV2A 2H18A 2J09A 2WPNA 4BO4A 4BX0A 2IH5A 3V4SA 3G59A 1CY6A 4QAJA 1W1IA 1R0BA 1XTSA 2LBPA 13PKA 2Q4DA 3R6WA 5HKLA 4ZRNA 1BD4A 4DLSA 1RHQA 4OHKA 3TJZA 2AXPA 4ZICA 1V1MB 4ZC8A 1O94A 3L7CA 5EZQA 3TL6A 1FTGA 2WWXA 2EEPA 4RO0A 2C9OA 1NM5C 2QP9X 2Z5VA 4S3MA 4TTPA 3I2HA 5EEHA 2VHVA 4LDNA 4Z0TA 1GEEA 1UQRA 5T5QA 5JSQA 1SWVA 3IXLA 4NBUA 3EGXA 4LG1A 1JPUA 4L9AA 1X2EA 2NZ2A 1KOFA 5EGNA 3RREA 3V4OA 621PA 4KQ6A 3O4GA 2GO1A 4DSTA 3EGDA 3ME5A 5J4YA 1Y89A 2J08A 3CBQA 1UDXA 3ZW9A 4BFVA 1DLIA 3DO8A 4LEIA 4P7JA 4ZO6A 4ZAGA 4EI7A 1EVLA 5BVHB 3ACBA 1IQPA 2YXBA 4RY2A 3TAXA 4BFXA 4B80A 4F46A 1TMGE 3PPVA 2BHLA 1NP7A 1X7ZA 3N86A 3UCEA 3LC7O 1ZISA 4PQGA 1I7NA 1R1DA 5DCUA 5AKZA 3SAJA 3FSJX 2KX7A 3GUUA 2FPGA 2JIMA 1U80A 1Z8FA 1ZJYA 3V7YA 4IJVA 2YV5A 4U8HA 3E05A 3EBOA 3NEJA 2J3KA 3H2JA 5AK3A 3JVVA 5IH7A 3G9XA 1R6UA 1IJEA 1F4LA 3ES9A 4BUCA 2X0RA 1DAOA 4LFBB 4BP1A 3I9LA 1PL6A 2WHXA 4GD3Q 2QM3A 5C8VA 4MGZR 2H9YA 1XRNA 4EO9A 1X3SA 5KU1A 4R2MA 3VHLB 3AZPA 4HLCA 3E7FA 1UM9A 4GYJA 4NE7A 1SQ6A 1C0IA 4BE7B 3A4VA 3BD9A 1GNPA 3CGWA 1OIWA 1MX5A 1GCAA 1EJ6A 3PGJA 4ER3A 4MH0R 1YS7A 1WXDA 1CS0B 2F3TA 1F8GA 2FSFA 2PQ0A 4OGKA 3WWPA 2OFPA 2GS9A 2ZTUA 4KQFA 5LNK1 2ECQA 2B7LA 2B20A 1J2JA 2WYHA 3NHBA 1MO3A 2EW1A 3R0QA 4Z51A 1PKEA 1P2DA 3WHKA 4BJHB 2Q3CA 2YJ4A 1HMPA 1AN9A 1UFRA 3G8AA 4OMDA 4C76A 3A9WA 4HDNA 4IQ4A 1ELOA 2QZSA 5JSUA 3F3KA 5DBFA 2XCTB 1PZXA 3I42A 3TOCA 5COAA 4UZFA 4X90A 1AUOA 3AUSA 4HXGA 1U1FA 3NBMA 4JXZA 4NMMA 3EC2A 2GDZA 2AE2A 3KJFA 4TV9B 5EUBA 2VN8A 3UAVA 5JFOA 4MVJG 3BIOA 1ZL2A 1V1JA 3GD5A 3HBLA 3HHEA 5KTSA 2Y1LA 4A1OA 4FIZA 1KYQA 2A88A 3M9WA 3TTYA 3DOCA 4IF4A 3OA0A 2WU0A 2R8OA 5KSWB 2OPBA 2FAXA 4INZA 4IVNA 3LHDA 1J8MF 4NZMA 1MX9A 3B2EA 1XA4A 2AR7A 2LZ0A 5H9VA 3MTGA 5K2MA 4ZDKA 4AMGA 1SXIA 2D3WA 1T3GA 1DEOA 4S12A 3AESB 4LY6A 1JS1X 4ALNA 2R11A 1OH5A 3EGOA 2H1WA 5BV0A 1HXHA 3Q5EA 1Y5LA 4L5JA 4MKGA 4DR3B 2B34A 1ZN9A 4PFQA 2IU3A 1R0LA 1L4MA 4P9NA 5JZ9A 4DV4B 2PKQP 3G68A 5KHAA 1JG3A 3INYA 1AKEA 3UWOA 4L0DA 4NJEB 4WN3A 4DEXA 4E5KA 2C7PA 5EPEA 4LXXA 4B6EA 3D0OA 2AZ4A 3NXKA 3VVMA 3GEIA 4ZYUA 5IAKA 3VSBA 1U81A 2A9JA 3PFWO 4Q1DA 3ZHSA 4UCQA 5FWNA 4MAAA 3S8EA 1JH8A 5SICE 1CB7A 1ATZA 1CTQA 3DEJA 3NV7A 4V38A 3DBOB 1NXSA 3RSFA 2NQTA