2L19A

An arsenate reductase in the intermediate state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGSGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Arsenate reductase
publication title (1)H, (13)C and (15)N resonance assignments of the arsenate reductase from Synechocystis sp. strain PCC 6803
pubmed doi rcsb
source organism Synechocystis
total genus 41
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l19A00
4LZLA 3QLTA 3QLUC 4Z4FA 3CHYA 1TMYA 3IP9A 3RH0A 3UKJA 1W9HA 1C0EA 1IIBA 1USIA 3KCNA 5IUNC 3OLXA 1JFSA 1M2FA 2CD7A 3LMKA 5TPWA 4KFCA 3Q9SA 1ZGGA 2PL1A 4RXUA 4WXEA 1XHFA 1QPZA 1M5UA 1J56A 2B4AA 3ILYA 2RJNA 3UK0A 5JNVA 1NXVA 4CBVA 4P1ZA 1NXXA 1RXIA 3F6CA 4PYRA 3ROTA 4RDCA 1RZRD 3JS5A 1TVMA 5DKFA 4PEVA 4EUKA 5IEJA 1P6UA 4H3KB 4ETMA 1K66A 1QQAA 2NZVG 1DRJA 1Z15A 2FMFA 2QU7A 4RK4A 5JNRA 5IEBA 4RSMA 3S99A 4JP1A 4ML3A 3KKEA 1MB0A 4EY3A 1LJUA 1XWWA 3CS3A 1KRWA 4W5RA 2PUBA 4MLDA 2E4UA 5C5CA 5IC5A 1ZH2A 1GUDA 4G0XA 1XHEA 3KYIB 3OMXA 3EULA 3JTEA 4DQDA 4Z4HA 4JB0A 2CHEA 1EWKA 1BDIA 1P6QA 1DC7A 1U0SY 2JBAA 4IMIB 4MS1A 5KQLA 1Y1LA 3OO1A 4NV3A 3E61A 1QP4A 4FE4A 4RZSA 2IKSA 4N76A 4OATA 4TMYA 2MYTA 3H1GA 4NICA 2PUCA 1Z18A 1ZGZA 4EGSA 3H1FA 5HSGA 3LUDA 2ZAYA 4ZMRA 3MM4A 3OM1A 4MRMA 3QEKA 4ZMSA 3C6QA 2QR3A 2LBPA 1H9CA 1UDRA 1DCFA 2QV0A 4Z99A 1DRKA 2R25B 3Q41A 5TPZA 4JAVC 2GWRA 2WMYA 4W5QA 3A0UA 1PUXA 4B09A 1PNTA 3GA5A 3QLVC 4PICA 4XFKA 2FMIA 5DTEA 2PUGA 4RV5A 1DBPA 2JB9A 4MR7B 4XARA 5B3JA 1ZH4A 2FW0A 5TQ0B 4ZYLA 2FQYA 5JNSA 4Z4GA 1NATA 3OLVA 3I5AA 3T8YA 4F8JA 1ZITA 2QZJA 4MQFB 2FQWA 3LFTA 4WT7A 2MSLA 5TQ2B 1CEYA 3RVJA 4JA2A 4FE7A 4RK6A 2NUBA 2PLNA 5GOTA 4JB2A 3IP6A 2JVIA 4EVQA 3HDGA 2MYNA 4OTZA 3EQ2A 5IULC 4NCAA 5KC9A 2L17A 4WXMA 1JBEA 3CKMA 4KVFA 4H60A 3NNNA 3IP5A 3QX8A 4DN6A 3F6PA 1GUBA 4QYMA 4YGXB 2WWVD 3LUCA 2KYRA 4FB4A 4PZ0A 3Q7SA 4MPTA 4MQEB 1RZRA 3RVLA 3DZDA 1U2QA 2PAFA 3GT7A 5KWSA 2ZWMA 3D02A 1FSPA 5BR1A 1YMUA 2M1ZA 1BAPA 3ILHA 1T34A 6CHYA 1Z16A 2FMHA 2GI4A 4OG2A 4MS4A 5CNKA 5HQJA 3RVOA 5IX8A 3F7NA 2W42A 3EAFA 3EODA 3GL9A 3GWGA 3OQNA 1D2AA 1RXEA 3TO5A 2QXYA 5HKOA 1NXWA 3GBPA 4TLMB 3TB6A 5TPZD 1EWVA 2FQXA 1BDJA 3QEMB 1NXTA 1CHNA 2QSJA 8ABPA 1JWLA 1SXIA 2FTKE 2HQBA 1QO0D 1QNLA 2E4VA 5HM6A 4O1IA 3EQZA 3HM9A 2PJUA 3JPYA 2FN8A 4Q6BA 4RS3A 4N0QA 2M98A 1YMVA 2JVKA 2R47A 3KHTA 3LUHA 2A9OA 3H1EA 3LOPA 1ABEA 2YHAA 4KMRA 4Z4IA 4HNRA 1JHZA 3CZ5A 4PE5B 1Z2EA 2IPAB 1JFTA 3MMNA 4W5OA 3O1JC 2R4QA 1L5ZA 2L2QA 1PEYA 4N0PA 3FFTA 2E4YA 2HJ9A 3H75A 2QVGA 2FMKA 2VK2A 2IPLA 5FWXA 4TLLB 3CG0A 3HSYA 1ZN2A 2LIVA 4HNQA 4MAAA 1NXSA 4Z4EA 1YS6A 2HQOA 3MQ4A 4MR7A 4KK4A 2R48A 4MR9B 1ZY2A 4MYRA 3FGZA 3HZHA 3LUAA 1ABFA 3BREA 1GCGA 2P4UA 3QELB 5KQMA 1KMIY 5C5EA 1K68A 3I09A 4LE2A 3DGFC 3JY6A 4KNYA 4D6YA 3KG2A 4OBBA 4E7PA 4NQRA 5CNIA 2WRZA 3O75A 5EWJA 4OLAA 1A04A 4G0MA 1PNRA 4YWHA 2V0NA 3LUGA 3HVRA 3T38A 4E7OA 3RVPA 1OXKB 5PNTA 2FEWB 4QYWA 4EVSA 1YK0A 2P9HA 3H5TA 3QK7A 1CYEA 5E3JA 4KQCA 5I4CA 1D5WA 1LBHA 1URPA 7ABPA 4YCSA 3IDOA 4Q7EA 1W25A 4XXHA 4QPJC 1FFSA 3SQNA 2JCGA 1E6LA 4YLEA 1YK1A 4UHKA 5IUKC 2A9QA 5BRAA 1VRVA 1NY5A 3O2JA 2NZUG 4Y9TA 1QP7A 5TQJA 4KPYA 3OO0A 2B1JA 2IOYA 4LE0A 5BQ3A 4Z4CA 3CRNA 2IPMA 3SY8A 4ZJPA 3CLKA 3CU5A 1TM2A 4KZKA 1Z13A 2I6FA 2GX6A 3TD9A 4IRXA 1DZ3A 3RVRA 1RPJA 1F51E 4Z9AA 3JPWA 4ETIA 4LE1A 1JYFA 3GV0A 5EWLA 1QO0A 4MR8A 4N47A 4IILA 3G85A 3LTEA 2GBPA 2FN9A 3G1WA 1U04A 3O1IC 5BRJA 1WETA 4LX8A 4GPAA 4Q6WA 5DGCA 2AYZA 2MYUA 3H5LA 3K4HA 1ISSA 1EAYA 2IPNA 4N41A 1BA2A 2Q5CA 3HCWA 3RVKA 3HEBA 1AB6A 5DLEA 5JS1A 2O20A 3NHZA 1VKRA 1YIOA 3P9YA 3LKVA 5KQGA 4XASA 2PKXA 2L19A 5D2CA 1FFWA 1ZESA 3N53A 1Z25A 3LUJA 4XLTA 3A10A 4P98A 1JDNA 4WWHA 1ZAYA 3T95A 2RDMA 1DC8A 4S04A 4LDZA 1DP4A 1TLFA 2WB4A 5TE9A 4RY9A 1NTRA 4RKQA 5B3JC 3O2SB 5JNWA 2PUEA 3N0RA 3VNAA 3HXMA 3Q7RA 4G0QA 5CNJA 1SRRA 1JH9A 2PL9A 1SXGA 3N6VA 1ZHHA 3HO1A 1U8TA 2WJWA 4MGEA 1JX6A 2CHFA 3IP7A 3N75A 4G0ZA 3O74A 3QLUA 3H6GA 4M88A 3N8IA 3O1HB 2JBAB 4O5AA 4MLCA 3D8UA 3N0WA 1YS7A 3HJFA 4N03A 2A9RA 1L5YA 3FFXA 1OXBB 2HPHA 3DLHA 1NXPA 3CG4A 3HUTA 2X7XA 3M9XA 3RVQA 3BILA 3KLNA 4F06A 5GQSA 2LPMA 1LK0A 3SNKA 2BGGA 4W5NA 1F4VA 2ID9A 4KQ9A 1QQBA 4RY0A 4JASB 3RQIA 2FEKA 3LKBA 3GRCA 4DADA 3HV2A 2NT4A 3OQOA 3DLBA 1RNLA 9ABPA 1FQWA 2RJOA 3RVNA 3SG0A 2OQRA 1EHCA 1NXOA 2VYCA 1JLKA 1A0OA 1AB5A 2WJAA 3K9CA 3L49A 4YV7A 1C4WA 3EGCA 4YR7A 3C3MA 3H5OA 4NCBA 4F12A 3IPAA 5JS2A 4RXTA 3A3KA 2FVYA 5TQ0A 3NNSA 3RVSA 1FFGA 4G97A 4KRFA 1M2EA 3BBLA 3JVDA 4HYEA 4MQFA 1P2FA 4YS6A 1VPWA 2TMYA 4UHJA 1D1PA 5TQ2A 1QKKA 1SXHA 4HNSA 1DBWA 1USKA 1YTUA 4F3TA 1A2OA 3DBIA 3R0JA 5EWMB 5KC8A 1D1QA 1DCMA 2E4ZA 5F64A 4WZZA 3RVMA 2JK1A 3HUUA 3W9SA 5KQPA 3H5IA 2E4WA 1YVUA 5T7BA 2PE5A 4QICA 1KGSA 2FXIA 3DGEC 3H6HA 3C3WA 4IMJB 3TX6A 4XAQA 1GCAA 3CNBA 3CZCA 3KTOA 1E6MA 4MQEA 4YO7A 3Q7TA 4EYGA 5IUJC 1U2PA 3M9WA 1ISRA 3OLYA 1MVOA 5KI6A 4G86A 1LBIA 4MS4B 3H5WA 3M6MD 4Z0NA 2H0AA 5CNMA 2E4XA 3HK2A 1PEAA 2ID7A 3BRQA 5FWYB 1APBA 2FLKA 3QLVA 2L18A 3I45A 2OENG 4EYKA 2FEPA 2YHBA 1JL3A 3FDFA 1DCKA 1Z17A 2J48A 1BVHA 3QEMA 4MS3B 4G0YA 3KYJB 3FMVA 2LUOA 4RK5A 2IYNA 1ZVVA 1SD5A 3MA0A 1M5TA 2FSPA 3C3KA 3B2NA 3C97A 5JNUA 1TJYA 4TN5A 2LP4Y 1DBQA 1DG9A 3BRSA 3KLOA 1QMPA 3OLWA 4YRZA 4OLBA 2IDMA 4RKRA 5TPWB 3E3MA 5IBQA 3F73A 2WY2D 1GLGA 3KJXA 3CFYA 3T6KA 3I42A 2MSWA 4JOQA 4F11A 2DRIA 3EDCA 3HDVA 4RK7A 3KS9A 3HS3A 3Q15C 4L85A 4ETNA 5FWXB 4EYQA 3OQMA 3URMA 2F8SA 3OM0A 4W5TA 1HEYA 1B00A 2MYPA 2CWDA 1BDHA 2N9UA 3OLZA 1Z12A 4RXMA 3KSMA 4IGAA 4GNRA 4L4UA 5DCLA 4RWEA 5FBHA 3NBMA 3O2QB 4RK0A 2PUFA 4MR9A 3SAJA 1KRXA 1EWTA 1DJMA 4LRQA 5ED4A 3IPCA 3QELA 4G0PA 3MIZA 2HSGA 1EFAA 2QW1A 3N0XA 4EVRA 5FBKA 2JRLA 5EWJB 4IF4A 3MF4A 5CHYA 5EWMA 2FLWA 3SM9A 4O1HA 1ZDMA 3MYYA 4RK1A 2XDYA 3LUFA 1VLZA 4D74A 1MB3A 4MS1B 1QP0A 2RGYA 3OMWA 4KV7A 4RY8A 4YP9A 5T3YA 3UUGA 4D6XA 2PUAA 3NHMA 2NT3A 3GBVA 2VUIB 2AYXA 1E6KA 1Z2DA 3L6UA 3LUKA 3ROFA 4S05A 4EYOA 2F8TA 4KREA 3EJWA 2VUHB 1JDPA 3O21A 1JYEA 3TMYA 5ABPA 2HQRA 4ZPJA 1Z26A 4Z9BA 1LJLA 3NNDA 4MRMB 1I3CA 1P8AA 2PMCA 3A0RB 1R8JA 2MSKA 1S8NA 3GYBA 1USGA 1MIHA 1D4ZA 2JVJA 2FKAA 2QVCA 5FWYA 2H3HA 4RU1A 5JNTA 1JF8A 3FFWA 4WUTA 3JVIA 4H3HB 2A9PA 2GKGA 4G0OA 1JFVA 1PHRA 3CTPA 1MAVA 3VNBA 6ABPA 2PUDA 4MS3A 3H5VA 3QX9A 4KK3A 4LDAA 5EWLB 1E2BA 4MR8B
chains in the Genus database with same CATH superfamily
4HATA 2D2XA 1GZHB 1IUPA 3I2YX 4WFKA 1TAQA 2JEYA 3F3YA 1QLWA 1BG6A 5FOWA 4N4AA 3MB8A 4TL9A 4MVJE 4O2RA 4TZKA 2A88A 4G1EB 3BFPA 4LC9A 2A7XA 4ONEA 1C3OA 1FSGA 5AO9A 5HKAA 5HUQA 4IXTA 2X1MA 3IV7A 1P9OA 2AK2A 3N70A 3PEFA 4P3NA 1L9KA 3KZKA 4WNCA 3RUFA 4X64B 2UYYA 5FLXA 2J0QA 1E2LA 4G67A 4RMGA 4DXDA 4GPIB 1KI6B 1JAIA 2XAUA 3B5JA 3BGSA 3PGKA 4IF6A 3EOZA 3VGPA 2CNWA 3LCJA 3WLKX 1GOTA 3HB5X 3H19A 2A33A 1ZD2P 1S3GA 3NKVA 3HA5A 4IHJA 4TXMA 4TUYA 1T5OA 5CPFA 2C2HA 3IBYA 4LYDA 3K32A 1TMKA 4PYRA 2JFHA 4TM8A 2V58A 4XLLA 5BYJA 4U2FA 3TIXB 4B75A 1H5NA 3RAPR 4PLFA 3F96A 1JE1A 3CRQA 5JMTA 1T3TA 1P0FA 3Q3HA 2I4OA 1U0BB 3BGIA 4PG7A 1GLNA 2A9JA 3OPNA 3PDWA 3IJRA 3U7EB 4ETMA 1DRJA 1IY8A 4WXHA 2ZETA 2D8MA 2AN9A 4LQCA 3I8SA 1DKOA 4PONA 3PEWA 4M99A 4CKXA 1AQJA 2C2MA 2PX8A 1O03A 1V35A 5FOXA 1Q1NA 2BEUB 3IDFA 2R8YA 4P83A 4D44A 4E03A 4D8TA 5L95A 3GO4A 5LQUA 2X0RA 3P4UA 3T7IA 2O2HA 1SD1A 3UT5B 2FEAA 1GL3A 3HYTA 3Q6NA 3K6JA 4MVJF 1GUDA 2ZJ1A 3ZW9A 4CQLA 5L7TA 4RULA 2ZU6A 1KFCB 2HSJA 5E2AA 2HIAA 3LO8A 4QUGA 3A9WA 3Q7PA 1D6SA 4JB0A 4I5EA 4QO7A 5BSTA 1MMFB 2A1TS 3AV3A 2WWYA 2OBBA 4FOTA 1ZEMA 1MDBA 5DHSA 5BN5A 3H2GA 1QG6A 3Q40A 3WG9A 3OIWA 5K05A 4OJYA 4FKMA 3I0ZA 1LSJA 5G3ZA 4PYQA 1NFFA 2O19A 2OUKA 2QM8A 5L7YA 4XYLA 5C7IO 4Q01A 2JJ8A 2PJDA 4OXIA 2P5YA 2ZCUA 2GZ1A 4N49A 1XTKA 1EE1A 3WYNA 2G7MC 4AZSA 3A1DA 2VJYA 4EHBA 3Q9NA 1VFNA 5J2UB 3STTA 4UTZA 5TPZA 3VMFA 3C6MA 1TL7C 3TSZA 2BFOA 2VFAA 3ESQA 4YAEA 2ZULA 2B61A 2FMIA 4JENA 4RV5A 4BVGA 4E30A 9LDTA 2JB9A 1Y1KE 4MR7B 4O2BB 5EUQB 5IYZA 4G5SA 2Y6UA 4I1OA 2FW0A 2OYCA 4ZYLA 4AKIA 1E1CB 4K2HA 1MTOA 1VKHA 1G18A 3D6TB 2EG5A 1NR5A 2FQWA 2XZPA 2IL1A 1LLFA 1PZHA 3ANMA 5G53C 3IODA 4V1CI 4GVLA 1ECGA 4RK6A 1QHIA 4IKOA 2YVUA 3RYHB 3PGXA 4O4IF 4WOJA 4EUHA 2D2VA 5LQAA 5JS6A 1CR2A 3FAZA 5K3AA 3BWDD 4E70A 5EHGA 2X2OA 4A10A 2MYNA 1V9CA 4AMYA 5LR6A 4QYTA 2BAGA 3FMPB 4XPZA 3NDPA 4KXUA 1JBEA 4D82A 1QP8A 3GRPA 3NNNA 3KJFA 1VRWA 4M6WA 3D3WA 2QNBA 3O4HA 3RWOA 5I9IA 3NRBA 2ERXA 3OKFA 3HXPA 1CFZA 5IMBA 5KYWA 2YV4A 5J1TB 4MIOA 2QTHA 2QUZA 3RF7A 1YQ9A 4BFCA 3AY7A 2CJXA 4TKVB 4XM1A 2JI7A 4XYEA 5EJGA 3NUQA 3U39A 2OHGA 1FSPA 1XQ1A 4BIIA 1CUVA 3MRSA 4NFYA 4KO3S 4ILKA 4OXYA 2F9MA 3FVVA 5E9AA 2AJCA 3KWJA 3UJ9A 2O3JA 3PYXA 2LD4A 5TR9A 1I3OA 1D09A 3TTWA 3IIMA 5C9ZA 3WAGA 2ZBQA 3W7BA 3QUBA 3GL9A 3LC1O 1SVIA 3GGPA 4WSOA 3GG9A 3WLAA 5DM4A 1BFKA 5J5AA 3EQ6A 4HXFB 3U09A 1U7WA 3NHLA 4TMXA 1ZUHA 1RP1A 4EA6A 1ELOA 3UOAB 2B9EA 3UPTA 3PQ3A 2HQBA 2DFKB 2M6RA 3UCFA 2P90A 2BDUA 3A1TA 1A1SA 2OE2A 2G77B 4C30A 3U4GA 2VATA 3M3DA 5HM6A 2RB5A 2G8LA 2E49A 1Z5UA 4NBVA 4MGKR 4PQRA 5ALSA 1ZQ1A 2FN8A 4EG6A 2I1VB 2JNWA 1ADBA 1DC3A 3K4PA 3FRJA 3ZQ6A 3LOPA 2ZATA 3MCZA 4TVKA 2AW3A 2GBLC 2BEWA 2NV6A 3X1WA 3FDXA 5JTUA 5TEWA 4EHLA 3F71A 1I4OA 1JHZA 3AHCA 3ET4A 3B3GA 3NH9A 3O4GA 5FUQA 3RIYA 4EF5A 1A9PA 3ZCRA 4GYKA 1L5ZA 4NPHA 1KI9A 1II8A 1E20A 3ICCA 5ENZA 5FI1B 5F1PA 5FRDA 4AX4A 4CTMA 4MWZA 5IZCC 2H4XA 1CDEA 4DUGD 2FMKA 4NJEA 3SPXA 3OIGA 4B81A 1NVFA 4P4UA 2XT0A 2E6UX 1TJ5A 2CBGA 3DW3X 4EPVA 4H1VA 3C6KA 3ILSA 4MAAA 3C98A 3A4TA 3IP1A 4OK6A 3CGGA 1N75A 3PUJA 2ZBPA 2RHHA 1ZY2A 4V0ME 1UQTA 4EPRA 4O3FA 4EJ0A 4GLFA 2I55A 1NVAA 4B6RA 4EJSC 1B4DA 3DGFC 3U6BA 3M4YA 1K5GA 4LSWA 1XJ5A 4P53A 5AT1A 4XOUA 2VDRB 3N05A 4GSYA 4PGMA 3F6EX 4EUEA 3LDUA 1UDAA 3ORRA 1IYZA 3HJCA 2WVAA 1W35A 3QA9A 3W5UA 2AN3A 4QQ8A 4P82A 4F8YA 1OHHD 1Z47A 2GK3A 2WG1A 4DE5A 5HILA 4X7RA 3S7ZA 3BMNA 1QF6A 4MUNA 3FCUB 2DY0A 4FYPA 4Q47A 4KXVA 1KH2A 3VR5A 4ENUA 4EVSA 1U9ZA 3TJMA 4OHWA 2E89A 2C03A 1J0XO 2IZOA 2XD9A 4JC4A 3K8YA 4UVIA 5D51S 3F4LA 4IZ6A 3UTDA 4KFSA 3I76A 1UINA 1Y7PA 2ID8A 3WLRA 1U0NA 1MAHA 1MPXA 2IXGA 2NSJA 4QPJC 4YMWA 2JCGA 4PSDA 4X3OA 1HGXA 1RP7A 4NLLA 5BR7A 2CXNA 4V24A 3KJHA 1J7KA 4CR7A 1DKLA 1ENPA 2JFGA 5IUKC 3TLAA 3CTMA 2WEKA 4MVXA 5JD6A 1YZFA 2IZ1A 4CV3A 2H51A 5I9TA 4DYDA 2J0SA 1PQUA 3K31A 4HD8A 4P2BA 4M1TA 2EFHB 3ZY6A 4AC9A 2O4UX 1ST2A 5CVCA 3PFNA 1GDTA 3PCTA 2J07A 3KLPX 1YA8A 4HLNA 1X13A 3HB1A 1T8PA 5HTKA 5KNCA 2GPSA 2Q27A 2I71A 2GA9A 2FWAA 1LCIA 4AXBA 1TUGA 5A2QA 2AX4A 4Y30A 2QROA 1F8UA 1TYBE 2ZZNA 2NUAB 2X9QA 1HLGA 4GSLA 3OBBA 4EEKA 2NO9A 1RHUA 4FSXA 5IAEA 5IM4F 4TXHA 1NT2A 2P9FA 5K7SA 5GV7A 1TUEA 1ZXLA 5DGCA 1FFCA 3RD5A 1H85A 1RHJA 4DRXB 4TQUS 1UKVY 4BZPA 3GOQA 1T9HA 1U9JA 3RVKA 1NNUA 1EBUA 1Z82A 3AG5A 3YASA 5JSFA 1Z35A 2EXXA 3E4DA 2FPUA 4PO1A 5K01A 2JCBA 5JS1A 1KMHB 1VCMA 3HJGA 4JP8A 5TJHA 3WLOA 2X1VA 3W2FA 4CCYB 1UP6A 1SZPA 3AR9A 4JNKA 1FXSA 4U7JA 3RUIA 5IWAB 4RIGA 2W4QA 3TSWA 2MJLA 1F9AA 2F1IA 5LBIA 5L3ZA 2ADMA 4MWBA 3R6LA 2ISCA 4CU5A 3W78A 4E31A 3R74A 1CNEA 1M6WA 1NXQA 3M1IA 1QFSA 2C2ZA 3STWA 4E07A 2B8WA 5D86A 1UDCA 1IXKA 1QIJA 1OIWA 3RSHA 2PL5A 2PD6A 3JYHA 3N76A 1UEJA 1JDVA 3HLTA 4G0QA 4M38A 3R0IA 3KTAA 1HDYA 1UWKA 4U7TB 4J2TA 2JHFA 1G98A 4JYCA 4UJ5A 5FPTA 3WK5A 3IB6A 5JE8A 1D4AA 1ZHHA 4CFYA 5CCBA 1I2DA 2CVOA 1JSRA 5KTKA 2XOKD 1E32A 1R15A 2DHDA 1O4WA 1RAAA 4OXXA 4U2BA 2JGNA 1QYRA 2W2PA 5CXQA 3CVWA 3CWCA 3FNHA 2JIRA 3A4YA 4KXMA 4N03A 3IAHA 1ZOLA 1YQWA 4U6SA 1Y8QB 2KB0A 1HT0A 1NU8A 5GONA 2QRJA 3M70A 1KKMA 1V1RB 4NZ9A 3SHOA 1ECBA 3N0VA 4CEIA 1C1HA 1PGJA 1V71A 3R23A 2QE7A 1O94A 3I1FA 1L7AA 1U7ZA 3TAXA 2OAGA 3WNQA 3FIJA 3D3NA 5T4FA 4N5IX 3ZWCA 1Q0SA 4PO9A 3U3MA 3T0FA 3VSBA 4LHWA 2B8TA 5AQEA 1Q0QA 2PV7A 1R9JA 9ABPA 2YVAA 3NX4A 3I39X 4OQFA 4CKWA 4Y1RB 1FA9A 4NJMB 4RSHA 3KU4A 4HAZA 3GGJA 4MW0A 4XUEA 3SD7A 3SG0A 1NXOA 4K03A 1SEPA 2PA3A 4YCJA 1WBDA 1F4PA 1KI4A 3EGCA 3SVLA 2G0NA 4F3RA 1FDRA 2NG1A 2W48A 2GPJA 4IGEA 3QVOA 4FR0A 5TQ0A 4WKOA 4L7QA 3WVNA 4XRGA 3LXRA 1PVDA 1BEEA 1AS2A 1N7GA 2JEZA 3QWIA 3HWRA 4FFSA 4GZLA 3ZZTA 3RC9A 4CMIA 4L8GA 1NM5C 2EDAA 5AVXA 4TGLA 2QX6A 2JK0A 4J0DA 4YAJA 1KK3A 5EHNA 2AUNA 2N47A 4J07A 3QIAA 2C95A 4HAXA 2EKLA 5JSKA 3HBMA 1NX9A 4URYR 3RVMA 4J03A 2JH9A 3VPFA 4K88A 5CTJA 3H5IA 3R77A 3WWDA 3KZCA 4WADA 3HG7A 1JHPA 1C1XA 1F5NA 5JW6A 2PGLA 4IMJB 4WZBA 4QT0A 3LK6A 1CUGA 3G2KA 1OJLA 4M0EA 1OY1A 4BNJA 4FYJA 1MAAA 2FZCA 3ZHYA 1JU3A 3S2ZA 1W52X 4JCOA 3DXFA 3W9UA 3GLRA 3R4CA 2ZRPA 1ZG3A 1HOXA 3OLYA 5I3ZA 4UAGA 3JQGB 4ALMA 4AJ1A 1Q44A 2V7GA 4CQMD 5A7HA 3WLIA 4EW3A 1Q1EA 4X1KB 3RADC 3BRQA 1GAJA 3A3PA 1I1NA 3UEOA 2NO1A 4U6QA 4ZEOA 5FI5A 3BULA 1Z56C 3EEIA 3V4SA 5A6SA 2WPNA 4C04A 2EW1A 6REQA 3OIDA 1DXHA 1WM1A 3MUOA 3PFKA 4Q03A 3HY6A 4A6PA 5BNZA 1XQYA 1MEEA 1R5NA 4JUFA 1C7IA 1J0EA 1KMMA 2R65A 1XMVA 2Y1KA 3C97A 1T13A 4I1YA 2GTPA 4N1AA 5GV8A 1FS5A 3SR0A 3WWCA 2X22A 3MCAA 2V54A 2V3VA 4YRZA 1O4VA 5F77A 3GVHA 1XXHA 4US0R 2QD4A 3NW9A 1IY1A 4WKCA 4D4JA 4EKGA 5A9TA 1W76A 1TVKB 1EQ2A 1VE9A 2CVPA 3I8OA 4MP8A 2VDJA 3I62A 1CZKA 4DSTA 3I42A 2WHYA 4JOQA 4LS3A 5B1EA 1AV6A 5KTTA 2IYPA 3EDCA 3UAOA 3RHFA 2O6HA 4ETNA 2O5VA 4FBMA 4JIGA 2QT1A 3DZIA 1I9GA 4G8DA 3DV2A 1K9SA 3K1AB 3EW7A 3N7AA 4TXNA 3RARA 3D6UA 1DUIA 2Z1DA 3UOGA 1IBRA 2ZRBA 4GBJA 1XJCA 5CT6A 5DCLA 4URXR 3S27A 5AJUA 5LQRA 3AKZA 4K6HA 1TQDA 3PF9A 3K9WA 1TQ6A 3DBRA 3IHLA 3T7TA 4KBGA 4P36A 2HNBA 1JHMA 2N0SA 5KHAA 3RJZA 1DJMA 3FAKA 5JJCA 3ASVA 2X8JA 2YWCA 2DE0X 1YJQA 4BGDA 4EG8A 1QDLB 2Q99A 5JCOC 4IVNA 2QUIA 3BA6A 1X8XA 3C1AA 3N0XA 1PWZA 1XKQA 2X0EA 1EFAA 1MRSA 4HYQA 4HWOA 2FMUA 4RKEA 1DVRA 2FPIB 3I4CA 1F7VA 2NTYC 3AF4A 3U9LA 3RV4A 4C7KA 4LF8B 4GKJB 3CINA 1NKTA 1TFRA 2C77A 4ER5A 5ITVA 1XTQA 2HLNA 3LUFA 1VLZA 2AUTA 1V41E 2ZXEA 3MT0A 4I5DA 3B1JA 1UK9A 4ID3A 3SLKA 4CT0A 3AVTA 1DJOA 1B0PA 4F9FA 2PH1A 5K4GA 3NFYA 4LOJA 3ROFA 5KYXB 4RCZA 5BOVA 5LA6B 3Q7QA 1ENZA 1E5XA 5AJTA 1RLOA 3ZBUA 3UPDA 4F93B 3FPHA 1XAIA 3NBAA 3NNDA 4U2CA 1XHLA 5AH0A 5CA1F 3ZV7A 1JILA 3EPHA 1HY3A 1D03A 4J7AA 2C5EA 1B6TA 3ZI4A 4DLSA 4MLZA 2FFAA 4Z7QB 4REMA 4F2DA 5CEEA 2J0EA 2WF6A 4R1SA 4TN1A 5LN1A 2WM3A 3S1AB 6ABPA 1DB3A 3TW0A 2P27A 1NVMB 1A7AA 1DHTA 4MS3A 4HY3A 4RNDB 1XMIA 4OIFA 3TL6A 3NVAA 4Q39A 3PQFA 2OYRA 3QEJA 4MGIR 5EJFA 4F71A 5KJFA 1KRHA 5ILQA 4DDMA 1FJ2A 3PX3A 4DWWA 3TVDA 1S3FA 4DNQA 4O4JA 4D3ZA 4QUEA 5GJVC 3AWIA 1IIBA 3JX9A 4R1UA 4S1VA 3ZTWA 1AQNA 2HTFA 4KQGA 1WOMA 1Y82A 1BO6A 2WAMA 3Q9SA 4YWJA 4AY2A 1JZTA 1EP9A 4WOPA 3UWSA 1M8JA 1GNQA 1X94A 4C9BA 3DONA 2C7VA 1CZRA 1Z8DA 2J3IA 3A4VA 4G3XA 4UNPA 2R7LA 3ELDA 4B3DA 1K97A 1VJ1A 1D0IA 2AMFA 3M5PA 1EUDB 3V8MA 3VR6D 1NXVA 3U26A 4F85A 4M54A 5I5EA 1HG1A 1EZ4A 1OFUX 3HFSA 4NENA 3BRWA 3NM5A 1AKMA 1XQ9A 1ONSA 4ND4A 4V3BA 3ZGZA 1VIMA 5AJYA 3CWZA 2YXEA 1OU4A 3EW9A 4CG0A 2X19A 4BNLA 1P1KA 1P6UA 4W99A 4F56A 3CN9A 3NBXX 2CJWA 4V0QA 1SNYA 3AUTA 3IEVA 3NASA 3S99A 3O03A 3RBAA 1G8SA 1VE3A 2HK9A 3FYHA 4O63O 2C83A 1PBNA 1J9EA 1Z07A 3KTFA 3TB4A 2I7VA 1FDTA 2XUKA 1XD2B 4DWVA 2PUBA 4UXJA 3GA7A 4BZZA 2CF5A 3D64A 4R81A 1ZUNB 2GD0A 2EP8A 4EA8A 3VVMA 2IYLD 4KJZA 2JIDA 4LJ9A 4F45A 2WF5A 5TGTA 1U4SA 2B2XA 4CNBA 2CSUA 3EYWA 3OX4A 2VTDA 3PT9A 3QU4A 4OLHA 3EE6A 2VDPB 5ALTA 4AY6A 3KQTA 3TQQA 2Z83A 2O52A 1UBRS 4J0JA 3A6KA 5DYYA 3CVXA 2DETA 5DJ5A 4AKSA 3IKVA 3C8ZA 1F2DA 1VDZA 4QLOA 3GHHA 3FROA 4GWKA 4DMGA 1X8KA 4DV6B 1NVGA 1U0RA 5FL7A 1JECA 1J25A 2ZRFA 3IDAA 3RUDA 4NMLA 4GLBA 4EY5A 4EQZA 3DBHB 1KQ3A 3LUDA 3PNLA 2QY9A 4RPIA 5HF6A 3WK6A 4IQ8A 3AB7A 4X3PA 4KR7A 5DBOA 2AFVA 2CDBA 3LVQE 4WZAB 5C81A 5LXTB 3VU9A 1H9CA 2VQ6A 4WBXC 3HFGA 3F8TA 1Z5NA 3DEJA 1SG9A 3L07A 1DC4A 1DRKA 3FKJA 4OK5A 4ZI3A 1HDRA 5EJ7A 3KL2A 2Y4OA 2WWGA 1DJPA 4ZQBA 1FOEB 4I36A 2DFLA 5KDOA 1ZGBA 5HK8A 5LB2A 3ADDA 1P5FA 4H7HA 5AKZA 1E2EA 5H16A 4LYJA 2C2OA 3LH5A 5HK9A 4A6EA 1T1JA 2BH2A 1FUUA 1L4EA 1SOUA 3NYRA 3QVMA 1ECLA 1PR1A 2B3TA 2IYVA 1SKYE 2W6MA 4G0XA 2VDVE 3VAAA 1Z4LA 1IJBA 3CSSA 3H2HA 5HIAA 2CJYA 3IX7A 4KN8A 5A4DA 2OO5A 4TZ0A 5HPYB 4LGVA 2FFBA 5C1OA 1P44A 2OXCA 2IYRA 3I73A 4NF2A 4XB2A 1ZOSA 4ZN6A 3QF7A 3AGQA 3A9UA 3OT4A 1GP2A 1XD9A 1ODIA 3WFIA 5I6DA 3CUWA 4JI1B 5E9WA 3GLIB 2XR1A 2ZBRA 1Y3IA 2PYZA 3K9QO 3OTQA 4DN6A 2HV9A 4DDVA 4R1QA 1W7AA 2V7PA 3D7SA 4B17A 4W8GA 2YWJA 1XE3A 3AUSA 1KIAA 4IZHA 1OI4A 4QASA 3RS3A 2NZJA 5CG1A 4NZYA 5HEKA 5BW5A 3RVLA 4Z5XA 2EZ4A 2YX1A 4JI7B 3OF5A 1M2OA 4PO8A 4DIUA 4QG3A 2HWXA 5LMCA 2I7TA 2Q4BA 2UZIR 2CMHA 3HRIA 2OLJA 4IIBA 3UMGA 1DT3A 3FYTA 3OBIA 4US1R 2ZVPX 5AUNB 5IXJA 2ERCA 3SHWA 3SYKA 1UM9A 3BGOS 1XDZA 4FJ2A 4MCIA 3UJ8A 3V9AA 3CXUA 4YH1A 3K0EA 1F3LA 2GBIA 2KPOA 4DCVA 1U0OC 2TECE 2VJMA 2OXRA 1ZJYA 4MDHA 4NTZA 2H1WA 3IL2A 3LQ4A 2IODA 1GG8A 2NTVA 5J43A 3ZD6A 1TU0A 5KQSA 3EVCA 2ACWA 4PRZA 1UC8A 1EVZA 4LISA 2OGSA 5HG0A 1EWYA 2R6ZA 4MSUA 3PR1A 4FR5A 5JG7A 1T4CB 2BY4A 2G1PA 3NONA 5KNBD 5KTMA 5JBQA 2PX6A 3EC7A 3OD5A 1EWRA 1PU2A 5B53A 4ZO7A 3NHPA 2CUNA 2V5VA 1KJZA 1NOJA 1U8UA 3N2IA 2DCUA 3IR5A 3PIRA 4AJEA 4C0QC 4YV1A 5HZGA 1QKJA 2BI7A 2CLHB 3M9LA 3NBUA 2B5OA 5GVSA 5GMOA 2VBCA 2AFRA 5F98A 3WFJA 3CKKA 2DFPA 3W2GA 5FFNA 1QVRA 3SQDA 3C5VA 2GN6A 5LYYA 4KTTE 3MMNA 4W5OA 1FMLA 2Y1EA 4RA6A 4IIXA 3QE2A 3VR6H 4CM9D 3AOEA 2BFDB 3ONEA 3I9FA 3E27A 4JP2A 5FWXA 4FU0A 1XYYA 2IDKA 3D6NB 1VI6A 2ZVJA 4NSNA 3BMOA 4PRLA 5E1OA 1F7UA 3FTQA 3ML1A 4Z4EA 2ZWOA 1G5HA 5LU8A 1RQ7A 1JQBA 3OAAD 4M9XA 4YACA 4B4VA 3NEAA 4Z6KA 1ODKA 3RRJA 1C1DB 1NBAA 1QIKA 3ZI7A 1NQ5A 5AM5A 4EECA 2XWJI 2F3PA 3BB3A 1T2DA 3JASA 3ZUGA 1BCSA 3T3PB 1KMIY 3O2NA 1K68A 4YAOA 1SG0A 5C5EA 3KR9A 3TGPA 2Z8ZA 2OVBA 3JY6A 2QRVA 5H0IA 4ARZB 3CEMA 1K5DA 5C8YB 2X4LA 1JHXA 4NQRA 5I8PA 1E2PA 2EP5A 2Y27A 5JFGA 3F7TA 2JGEA 2FKNA 2YMQA 4YWHA 5H3LA 3T54A 2AD5A 2QZSA 1OFUA 4TM7A 3V4OA 1B3RA 1IOZA 4BBJA 5CXXA 1VMIA 2X7HA 5BO5A 1JR3D 1SOAA 1XXLA 2HYIC 1V5GA 3OF2A 2IKQA 5K0NA 3ZQ4A 4JGIA 3LOUA 1LVGA 5HJ2A 1TF2A 1KAMA 1T9ZA 1NI5A 5E0OA 2IU0A 3ZHOA 3QVTA 1CR6A 2R1VB 2XMDA 3IDOA 3LFUA 3DMFA 1IWPB 5G2OA 3SS9X 1A76A 1XKLA 2FR1A 2HN9A 2ACEA 1U0GA 1V8PA 2BCGY 1QFZA 1U6KA 1T0BA 5BN4A 3COSA 4LZWA 2A9QA 4Y9TA 3GLHE 5HIMA 1E1DA 2P3QA 2DKOA 5BVGB 4GLOA 1YR3A 3WOHA 1IBCA 1DQZA 3QKWA 2SKDA 3OZAA 3IQHX 4DV2B 4GWLA 4LSZA 2H63A 1IXRC 8ADHA 3K9GA 2AE2A 4AS1A 2GJ9A 4FWBA 1JDTA 5A0FA 4LDNA 7REQA 4WCVA 1V0JA 5AOBA 1B7GO 1SUCA 2FF7A 3E3OA 1M1NB 1N0UA 1SUDA 3NDRA 3SWWA 2ZGVA 4IILA 4NAVA 5K3FB 1OH6A 3T61A 5EIBD 1C7FA 1T2VA 5B1HA 5CA0B 2XB6A 1D9ZA 3C6YA 1WUJS 2BTOA 3BWEA 4HDOB 4HH4A 4N7MA 3TDKA 5E3HA 1N2CA 3H42B 3HHPA 3HU5A 1OZ0A 3K4HA 1BU5A 1GRCA 1Z0UA 1C5KA 2BEVA 4PFKA 3VYTB 1PWXA 2WSMA 2DCMA 1SOVA 4F7WA 4MJLA 4JMLA 3PJFA 4RFSA 3QXJA 3B6JA 1N9ZA 2O8DA 1E5QA 1L4MA 1AV7A 3D8NA 2OZVA 2DFNA 4E5SA 1W0JD 3N87A 1N4DA 2KJQA 4H7FA 1I7PA 5B57C 3UH0A 5JSUA 1U3WA 1Z7YA 2JFZA 3D81A 3I2GA 4ZVNA 5E1BA 2QVLA 4N9QA 4MW5A 4KQFA 2RJ3A 2O14A 3P45A 2PKCA 4LKOA 1JDUA 4I4TA 5EHZA 4QVKA 4CM4B 1FJXA 1AGNA 3WI7A 3BHJA 3GX1A 3ABZA 3K5WA 4LDZA 4B6EA 3ROEA 1AHHA 1OCEA 2P0AA 3Q2IA 7AT1A 4IPTA 1SBYA 1QV7A 2R6R1 3UV6A 1IN4A 1O54A 3IPLA 5DRTA 2PMKA 3D8RA 4ZOCA 1KQOA 1TT7A 2QEQA 3NCHA 4JVMA 1BS9A 4LQ4A 3I2KA 3Q98A 2JGIA 1V25A 2WJWA 3HN7A 2LXNA 1DHRA 2PWPA 2QN8A 3B3QA 3PNKA 1BN7A 4M88A 5E8JA 5FL3A 1N6KA 2X8AA 3IA7A 2EZ8A 3EH1A 3F90A 3I6YA 4ND3A 5EIAA 5CFOA 4FGZA 4LRTB 5KNBH 2H3EA 1CY7A 2KMLA 1L5YA 3H5AA 2OD2A 3DKKA 4F3CA 2DAPA 4JU8A 4CKEB 2ZT8A 1UJCA 5P8WA 3F8SA 1W59A 3RVQA 1H5UA 1ZD5A 2AMYA 4GX0A 2QD3A 3SK0A 4ALIA 4BO5A 3LX8A 4F06A 5GINE 5IWCA 3EC1A 1JQDA 1Y3DE 3IUBA 2JHCA 1EA5A 3L8MA 2WNSA 2UZAA 3IVGA 3L01A 2V4MA 1BHSA 1OYYA 2DTEA 2H2WA 4O5OA 3L8ZA 1NC1A 4JASB 2IW1A 2C7RA 2Z3VA 1CUDA 1AY0A 2JW5A 2LKDA 2GAOA 4F4IA 4Q7MB 4II7A 4DADA 3CPJB 4KVAA 5FR2A 4UPVA 3AB8A 1NKSA 1VE6A 1GJRA 1NUSA 1Q0UA 5KKNB 4H3VA 4OHMA 4K6KA 4P7FA 4TL6A 2XDQA 2VYCA 5DX0A 4DVJA 1KYYA 1FP1D 2YMLA 1R6DA 3PE4A 3S2SA 4P84A 5CXUA 4J91A 4MYDA 2WFLA 1LH0A 2N3ZA 4IJMA 2WAOA 2CBZA 3A1UA 3HCDA 3O8CA 1ZVQA 5LQKA 4L4SA 1J8MF 4MQFA 4Q9KA 4Q9JA 1X1BA 3BMCB 4TVBA 2VNKA 4UHJA 3THRA 3Q12A 1RQ2A 5KAPA 2ORVA 1T1IA 3EXHA 5KSOA 4KYVA 1GUAA 1JJBA 2WHPB 2OG2A 1VHTA 3COPA 3GY0A 5CDHA 1TA0A 2UXDB 1UK6A 3L0YA 4WBSA 5JMWA 3DDSA 2C5FA 1RI3A 2FN3A 4AWBA 3A4LA 1Q0LA 5FAXA 4EUFA 1DZIA 2ZP1A 4FK8A 1MC1A 3HDTA 4HDNA 4DQUA 3EA0A 4B6FA 4ESVA 5HJ7A 3RRXA 4FCTA 5DHPA 3VYWA 4DCPA 2C0QA 4MQEA 3LT0A 2NWQA 2W90A 3W6ZA 4NXNB 2AH5A 1Z6ZA 1OOEA 3GARA 3MD9A 5KWSA 4EGFA 2G5TA 1RXVA 3EEYA 1PE0A 1J2RA 2J32A 1I14A 2E4XA 1QF7A 1MAUA 3ZHUA 4CMJA 5BWMA 2VJLA 1APBA 1DPFA 4JDUA 1MW8X 4IXMA 2OENG 3SKVA 1PSDA 1CQZA 4TT3D 4B6PA 3D0RA 3P32A 2I78A 2D2IA 2J48A 2O3RA 4YMSA 2XOKA 3B6EA 3VPHA 1Y9JA 1JAYA 1Q12A 1RAGA 2X5XA 4JI6B 1D2CA 3O5AA 1U5AA 1A96A 2YTZA 2YFQA 4JR2A 4AG6A 3KSAC 2FSPA 3GJ5A 4ZDIA 4TMTA 2BFCA 1T6BY 4TN5A 1L4HA 1E3DA 4GPD1 1TPYA 1TADA 4R2XA 2Q3JA 3I3SR 1YC5A 4Q93A 4RKRA 4ARVA 1QGOA 1VLVA 5J1SB 2CXSA 4J0EA 2LWIA 4BRWA 3CA8A 2UUPA 1LWNA 2J4FA 1FDVA 1SBHA 2FN4A 3DEIA 3KIPA 3KJXA 2UVQA 4PIVA 1R0ZA 4R1NA 3AINA 5ALXA 3RFFA 4C4SA 5IJWA 3A2KA 4ZOAA 4R2MA 5DZSA 3ZDAA 1YU9A 4BPBA 5H4HA 3KVRA 2YJ6A 4NMHA 3JZFA 5A02A 1FBNA 1IVNA 1UBEA 2POCA 3WKAA 1BVRA 3V3KA 3HBFA 4YRKA 6AT1A 1CEEA 4IGAA 1H9BA 1TK9A 2Z4RA 4LCJA 3TOCA 4CWAA 3CE9A 4RWEA 3MWKA 1T0JB 2HLHA 5A4FS 1NJSA 5C8YF 1VG1A 2BCJQ 2RGRA 2IYOA 4RK0A 4YIKA 1V5IA 4Y2YA 3ZV6A 3FNIA 4LRQA 3PRJA 4O0LA 3WC4A 2XCRB 4PBRA 3D6JA 1VGQA 3IAXA 5GONF 2P2NA 3EFOB 1GO2A 2ZE8A 3OLCX 4MARA 1NVVR 2VCEA 1S02A 5HDQA 4NEGA 1K8YB 3PL1A 2HSWA 4PWYA 4WXYB 4X7PA 4HVTA 4D81A 3EEOA 1W73A 4PNHA 4Q1FA 1TLTA 3ESAA 4C03A 2FPRA 3GVCA 4H35A 4MUJA 5LP6F 4KBFA 2IYTA 6LDHA 2RGYA 3AF2A 2PUAA 3HEAA 3AONB 4G81A 4W8HA 1PJLA 4TSFA 2FQ1A 4DJDC 4S05A 2Q3CA 2GA8A 3SF8B 3QVJA 4PYOA 3W77A 2Z6QA 4MV5A 3GRAA 2B7CA 3U19A 1EAMA 4OKSA 3PLAE 1PZGA 4CG1A 5D3KA 1L5HB 5DULA 3PFBA 3QWFA 1R0WA 1QRTA 2AFHB 2Y66A 3DL2A 1K8RA 5JEEA 2PLRA 3KOUA 3A6DA 3LOQA 4PS0A 4CCWA 2JA1A 2JVJA 1LC3A 4BNDB 4CQMA 4NYIQ 1SR8A 2Q3LA 3V7WA 2H3HA 4BO1A 3KUCA 2FZLA 2H29A 5JNTA 4ZI7A 2VTVA 3C87A 5D1HA 2OORC 2QAGA 1PHRA 3CTPA 4B46A 3CVYA 2P68A 4YCCA 2DH5A 3GD5A 3TZEA 3HTXA 1KJIA 1E2BA 2ZIGA 3R40A 3AW9A 3KYCB 2G4LA 3QPDA 5ESXA 5FNVB 1R5BA 2XJ4A 1VSVA 1XXHE 2HH9A 4UBOA 3CZAA 1TCBA 2WWIA 3DLAA 3DVAB 3FYDA 4LZOA 4LSGA 3DCNA 3P4YA 4RORA 1Z4OA 1ZGGA 4DLLA 3IIJA 1KVSA 3QFTA 1XHFA 4DKXA 5JIBA 2WABA 3PHLA 2BFFB 4B4WA 3FWZA 4PLHA 2YHUA 1H05A 5BYAA 3DZGA 5AVRA 3S68A 3K53A 4IJ5A 4XSGA 4ZYYA 4CBVA 2ZJ0A 1Z4PX 4N48A 5HFNA 1RXIA 4BRUA 5IT4A 1NBWB 1CYDA 2QF7A 4MRVA 1WXHA 3HE3A 1TM1E 2GHQA 4YVFA 2RC5A 3LYLA 2TMGA 2Y1GA 1DC5A 3MINA 4PEVA 5IEJA 2FOXA 1X7WB 3VH3A 1JDZA 3D2CA 4B87A 3MJVA 3MELA 4IJVA 2JJ1A 3OOWA 1L1FA 4X1YB 4ML3A 2G5PA 3D3QA 3KKEA 2VJCA 4MQ4A 4P7KA 3UUFA 4JYZA 2O6LA 4PZCA 2F17A 1FX0A 3RAJA 4JL6A 1DLIA 4M9CA 5GJCA 4PW0A 5ARCA 3RTBA 1Z5VA 2PT9A 3A9RA 3Q87B 5E1DA 5UKDA 4IUDS 3VNUA 2GBGA 3ZPXA 2JLYA 3SE0A 1C9DB 3OQJA 4QDXA 1E9SA 2CBXA 4Z3KA 1X1CA 2YASA 4OLFA 1EWKA 2AX3A 2P3SA 4A2QA 1FB5A 4BO9A 5KQLA 4NFLA 1DDOA 5AOCA 4H31A 3ZG6A 4RZSA 1GM5A 1WEKA 1DGQA 2J09A 5HCNA 1FQJA 2NP6A 3PTLA 3T9BA 2IP2A 2OHXA 1GEEA 4ER7A 1FYFA 1WKVA 2JAUA 1YL7A 2MOKA 1QONA 1T8YA 2UZ3A 3IJPA 4HYYA 4D4KA 5K8JB 5F1OA 4MGHA 3JQ8B 4GXNA 4J75A 4QIHA 1U8YA 3JQFA 4EBFA 4RDXA 4HSEA 4EG3A 5BV2P 3OWHA 1PJ8A 4YX9A 3MERA 4K2AA 1GTG1 3G9UA 4EJ2A 3GPLA 4XVHA 4ZVLA 1AF7A 1BGWA 2RHCA 1DDGA 2F90A 3NDBB 1YB4A 3H13A 3MT9A 1IQPA 2ODEA 1N34B 3H87A 4ZV4A 1RQXA 4D8VA 2JFWA 3A6PC 2WTMA 3IPYA 1SVMA 1DBPA 1Q1ZA 4LAFA 1NKVA 1E0KA 4K9LA 2WHRA 2VLIA 4X7BA 2BOVA 1USWA 1HYQA 2DQSA 2P4SA 1H2EA 3FB1A 5H3HA 3UV3A 1Y4DE 4C88A 4DAOA 1XD8A 5A5DA 2QD1A 1EEXB 5TQ2B 3EGDB 2G0AA 4CMCA 3BTVA 1IZ0A 2EFGA 2PT7A 4MAMA 1Y4UA 4DARA 1UPCA 4Q48A 2J7PD 2PMWB 4HB3A 5JASA 3AK4A 3JQAA 2NUTA 4M2LA 2QI9C 5IULC 1IAQA 1RKUA 2RKOA 1GV0A 4KPGA 1N7HA 2HKIA 1L1QA 2YN4A 4H60A 5LBTA 4INAA 2YH2A 3NHAA 1EZ1A 1NQAO 4K7JA 3JSXA 2VXBA 5DNVA 5IF3A 3LUCA 5JJ5A 4WNAA 1U2SA 1YAHA 3JALB 5CUQA 3SP1A 3VSDA 4DREA 3GAZA 3KT0A 1R88A 1JSXA 4FWIB 4ZC1A 5KNCD 3PDJA 2HA4A 2ZUUA 1OB2A 1EVIA 1YMUA 3P2MA 1QH1B 5A5FA 1RWNA 1U3TA 3DOJA 5K3OA 3GRKA 4BEVA 2XA1A 4OG2A 5P21A 4GKBA 3G7UA 1Q57A 2ZIWB 3RIGA 4G36A 4O4JF 1CJKC 4OQLA 3P2EA 4RTPA 3GGGA 4AD8A 1FPMA 1RXEA 1E5TA 1V7QA 1LW6E 2Q7XA 3HA3A 4TV9A 2JANA 4TLMB 4ZVRA 1FVFA 2VAWA 1XAHA 3ZWXA 5AW8A 4MXDA 2FPPA 1NXTA 1ZL0A 2BR5A 1JKJA 1O6GA 2CXPA 2W2TA 4QFDA 3CNOA 2GH1A 2XDAA 3EVGA 3OIFA 3L9XA 3T3OA 1UPAA 1UMCB 3R7BA 5BW4A 3H8JA 4DIMA 1QAOA 4HS4A 4XUCA 4JJGA 2EGUA 3NV9A 3L6RA 4B3XA 3TKAA 3R9XB 2HSZA 4IEEA 3IVXA 1SHLA 1FUEA 3L43A 2YHAA 1O97C 4MWCA 1MU0A 2DWOA 2OBXA 4MV7A 4WJLA 5E95A 5HJ5A 3IOMA 4H1WA 2VQFB 1DPGA 4PE5B 3TVTA 1WB6A 5HQ3B 3IVRA 4HAYA 5JJBA 1NLMA 3WMWA 2P3LA 3SF0A 5MF6A 1PQYA 3PWZA 3U7QA 4DLAA 1BQEA 1MQSA 2QTTA 3NAMA 3R20A 1PZEA 1RYZA 4KQXA 2R87A 2XCOA 1Y7TA 3ANYB 1T5HX 3C70A 2Q07A 3K6SA 3BXOA 3O8DA 4LJAA 4I9NA 2IRWA 2OV1A 4XOIA 1DRWA 3LLUA 1RMYA 3VI3B 1XJ0A 1X9GA 3I28A 1SQFA 1TEXA 1QGZA 1R8YA 4JZKA 3RK4A 3OF3A 3I5MA 4LY0A 2CT8A 2R7KA 2DQYA 2RFLA 5C7OO 4BE9A 1T24A 4BP8A 1JSCA 3UJNA 3EVBA 3BM5A 4FMCF 1ZO8A 4LFAB 3DTTA 5I9BA 2BFEA 5A05A 1HO3A 2H8KA 1TEZA 4ALKA 5JJIA 4Q4HB 1ESDA 4Q3OA 1YE8A 1JKFA 4ZVMA 3TKYA 2WRZA 3QV1A 3DYBA 1L7RA 5IZ4A 2B99A 4OLAA 2YYAA 2Z6UA 2YIMA 1NRXA 2FW7A 2V6IA 4X95A 1XG5A 3HCRA 4HB2A 1P1HA 3VC7A 4AU1A 2FK8A 1EXNA 2OV4A 3PDUA 4HWPA 3VU0A 3N2KA 5LFAA 1DIAA 3B1YA 3ZKAA 2FSHA 1PL8A 4KE6A 1ULSA 1QU3A 4KUGA 1ZMBA 1URPA 2J0VA 2XNDA 2BUCA 4ARBA 4QKQA 3BEOA 4JJZA 1NLFA 1OXVA 2P6OA 3F6YA 1WD7A 1R9NA 2WKRA 4LX0A 4QJBA 2IHZA 1BGXT 3DHNA 3DV9A 3PUHA 4YLEA 4KQ6A 5FJIA 4DM7A 1QF9A 2GD6A 2Q45A 3ELWA 4N3AA 4XB6B 3RS9A 3EG5A 1OROA 2VXYA 3MOGA 4QEZA 5AICA 2JPDA 4BLUA 3WAKA 3WISA 1ORRA 5TGDA 3VVBA 3DXXA 2RBGA 3NHWA 4NV0A 3HNRA 4KFTA 2O8FB 4DV4B 2QUHA 2C94A 1J21A 3O8QB 4HGZA 3BL8A 3PA8A 4WCFB 3SBOA 4YI3A 4DCOA 1S2IA 5CBPA 1GAEO 2MTBA 4YRPA 1B2RA 4CVNA 5JPIA 4F21A 5H59A 1YIDA 4LCBA 4QTYA 4N47A 1TO1E 3ZE8A 4BLWA 3FOBA 4B3IA 5KNBA 3X1ZA 4LZPA 2PUTA 4OX9Y 3G1WA 1U04A 1XVTA 2YHIB 4PHGA 3PC8A 1LFAA 3M5DA 4RPCA 1FMFA 1YCFA 4KE7A 3ZWVA 3QVLA 3H4IA 4O2AA 5DOZA 3PXGA 3T0GA 1NG9A 3HH8A 2A3RA 4HQNA 2YUIA 3O84A 1TIPA 2BTQA 2I1LA 1RHQA 3K0CA 4IGIA 4N39A 3H2YA 3O1LA 4C87A 5M29A 3ZQJA 5D84A 1BS2A 3BXEA 3PHCA 1AE1A 2XRYA 1VKNA 3OZRA 4ZQHA 4F3YA 2PQ0A 1XL1A 5D85A 1R66A 3UGTA 3P9YA 1N0IA 1P0PA 2F64A 3ISJA 1QLJA 2H1RA 2Z08A 2Z3ZA 3ADPA 3O3CA 4K9OA 1P2DA 1HE8B 5I7WA 3VFDA 4D79A 3LXXA 5KNCH 2D1QA 3P0IA 4R2HA 4X0EA 3WLNA 3WK7A 3ED1A 1JU9A 3LV8A 1JEJA 5FB3A 4FBLA 2JZOA 2J5RA 4DRYA 1ESMA 1OGIA 4UCWA 5GWXA 1FJGB 2PUEA 2AD1A 3UCXA 3K7EA 4NKRA 4K3UA 3RC3A 2ZJ3A 3DWEX 4GE0A 3MEQA 3N6VA 3D2BA 3MRXA 4F2GA 1A3CA 4J1TC 5HKLA 5IANA 1RI4A 1C9JA 3A05A 3DDHA 2P1DA 1IPHA 1JR6A 3GIDA 1PFQA 1ULHA 2XRMA 2O0HA 4G09A 5IKXA 3BMQA 3G2PA 3TS1A 3WWOA 1GFZA 1DAPA 1U3FA 4A8PA 1B8UA 1UADA 1YHZA 5G1PA 4ND2A 4CF3A 1Q7GA 4YJFA 4BO4A 5K51A 3OM8A 3I01A 1N1GA 2DU8A 2BSAA 2TSYB 3EUWA 3KSBC 2QTWB 4MUEA 4OSOA 3T4UA 2WF7A 2UV8A 3Q4GA 3VGJA 4BVLA 3O38A 1R12A 3ADKA 3DEAA 3OT1A 1FUKA 4KSCA 2NU8A 4JJFA 4GEKA 4GPTA 1EU1A 2HWWA 2Z8XA 2V96A 4FP9A 5E6RB 5T4BA 4A2PA 4ZYVA 3H18A 4K6OA 3R6DA 4PZYA 4I55A 4X92A 5KYUA 4K9DA 4F0JA 4H3SA 3W5HA 1XDGA 1OH8A 3IIEA 1C7QA 1UP7A 3ZE9A 3R3YA 2YQZA 1B0AA 3LRTA 5T57A 3S8EA 4RLSA 4NOKA 5ESRA 2D13A 1NVXQ 3GZNB 2JAXA 4FW9A 3RE1A 3WL7A 4E3ZA 4F38A 3S2YA 3L0SA 2ZVDA 4BJ3A 3TVYA 1KYQA 3O9VA 3C7TA 3RKUA 2R6DA 3SCZA 5A04A 2E1PA 3JVDA 4MINA 4TTVA 3WGNA 4B8ZA 4G84A 1VPWA 4Y7DA 4HX2A 4OF4A 1XRJA 3DAOA 3T41A 3NIBA 3WWZA 5EEGA 4JS0A 2GJ8A 1A5SB 1W0CA 3U2QA 3WSVA 5F64A 5IH7A 4AMBA 2JK1A 3HUUA 4C2BA 4E51A 4EHKA 1UBGA 3UAVA 3WRXA 4PVCA 4AZTA 3F9CA 3FPJA 3M5CA 5TT1A 3V2HA 1QRDA 2IE8A 3PBKA 4XQ0A 2R11A 1QU2A 1TK2A 1GEGA 1ORDA 1RRGA 3EIWA 3B12A 4U8GA 1P2BA 2F3SA 3M6AA 2O2SA 3C7AA 4NRDA 4YRLA 4DCUA 3RFTA 4JLBA 1KEPA 1U2PA 2NPOA 3IAM6 4R8MA 4ZYTA 5IDXA 3EBLA 2H9AA 4PAGA 4AQYB 4JKOA 1ZCJA 4AY3A 2CSXA 4UZFA 1RAHA 1LU9A 1NUHA 2H59A 4WACA 5BQ5A 3HK2A 5JI3E 3G0BA 3GN2A 2QTNA 4CLOB 1OBFO 3G8BA 3KE8A 3NCTA 4OYRA 4X8MA 4EHIA 4YMLA 1M34A 2FEPA 3Q3GE 1UJ2A 2PTHA 2DEUA 2I91A 2GN0A 3DHYA 3L1IA 5KAMA 2EBHX 2F1HA 4IS3A 2MMCA 5FBRB 3ZWBA 4CIWA 3LRXA 4FE3A 2NPIA 1UAGA 4HGYA 4IWYA 1GZDA 4XWOA 1XCBA 3EVEA 3KYJB 2X1LA 4CV0A 1Z6XA 2ZJ6A 1RRKA 2F6RA 2HBYA 1V7ZA 2C4WA 2A9VA 2ODQA 3PNSA 3OJFA 4F04A 1B41A 1GD1O 2JZNA 3DUFA 1RJ9A 3JQPA 3CONA 4GR9A 4JLAA 4YEDA 5H9VA 3D1JA 2XY4A 5TJ9A 3ZI0A 1Z0SA 2DM6A 4W9RA 5DNEA 5C2JB 2GN8A 2HM7A 5J63A 1QOPB 2PWAA 2X1HA 5EY5B 3VKVA 5ILOA 2G6BA 1UEIA 1ZC3A 2QM3A 4F11A 3RTAA 5KVVA 2RD2A 1TTTA 1HC7A 3V3TA 1EK5A 3OFND 3BXFA 4TSKA 4D2IA 1CQXA 3V6LA 4PFSA 3WGMA 1N5KA 3D54D 3S5JA 4C29A 4CKCB 1J1UA 5U4QA 3RUCA 1Z12A 2RCNA 2QU8A 1TXGA 3ZC3A 3KXDA 4REOA 3WLQA 1NX6A 3HXLA 5ED0A 3TDNA 1PBTA 1DEKA 1MJGA 2BP7B 4IGFA 4LXXA 3NBMA 5ICFA 3ZGNA 3HYCA 3D0KA 3BHNA 1LKZA 1XWFA 1F17A 1BKSB 4TTSA 2K5UA 2C3UA 2CC2A 1R6VA 2XRZA 1HKUA 1LBEA 2P5TB 2G9RA 3AOGA 3DJYA 3QELA 4MOWA 4QARA 4QEKA 4X60A 5FWDA 3ZEIA 2WKPA 2PDAA 4NS4A 2WU4A 3F97A 4HUQB 4FX2A 3TTSA 4JBIA 1LRLA 2XITA 1EK1A 5CHYA 2O8EB 1SBIA 1O6ZA 4RK1A 4I9FA 2ZTSA 2OO7A 2LTAA 4S1OA 2X13A 4CI0B 4YV2A 3GFFA 1A4IA 5C80A 4FYXA 5A0VA 2NT3A 5JLAA 2XMPA 2O07A 1QTIA 3KKMA 3QU9A 5CMLA 1CQIB 3TZKA 3WP1B 4DLYA 2FPMA 4DLPA 2CLLB 1K1EA 2IPXA 2RHGB 3ZNPA 3QVXA 4GYJA 1W93A 4MUXA 3MK31 1AUOA 3WJ7A 5BQOA 3KD2A 2VYND 3AF5A 4MRMB 4R1MA 4JUAA 1FPQA 4RJ2A 4L5BA 3HCAA 1D4ZA 4O8CA 1FXWA 3RS2A 3ZIAD 1GA6A 1BMQA 3AM3A 3PHGA 4KWHA 2MCFA 3ZXSA 4RAOA 2NYUA 3I8XA 2AFIA 2VQSA 3CUSA 4PZZA 4RVHA 2O8BB 4OBWA 2FZ5A 3OU7A 4D3YA 3WHPA 1FFBA 2IXDA 3GQBB 4EUSA 3B7WA 1EFVB 2OV2A 2ZT6A 3FKSA 5I47A 3KAPA 4RY9A 4Y1GA 3UOWA 2H1VA 2PXXA 2A57A 1NI4B 4ZOLA 4G63A 3IP9A 2ECFA 1PTJC 4IJWA 4JLPA 4JUBA 4NDAA 1V6AA 3RIMA 3PUYA 4DM3A 1TJNA 4KYTA 3GCDA 2VDLB 3Q11A 3L7YA 1PD1A 3NVDA 5LIRA 1YVRA 3G9ZA 3H84A 4RLHA 3JWEA 2PL1A 1LQTA 2VOJA 3L06A 1JR4A 4M4SA 4RXUA 1V6SA 2BW0A 2R4TA 4YRBA 3E6AA 5HM8A 3RFCA 4HCJA 3KUUA 4RA9A 4LZZA 4L27A 4RVSA 3W1EA 2NUPB 5I3CA 2VZEA 1UT6A 1XQWA 2G25A 5K6AA 1OSNA 1RW4A 1HA3A 4YJGA 4FZ3A 4EB8A 2GBFA 3EX7C 1H1DA 2FYTA 4LNAA 4RDCA 3JAKB 1O97D 1OBCA 4FD2A 1B74A 4CM1A 1TVMA 3PGVA 1YHYA 2VA9A 3TNYA 4EUKA 1NW8A 2EX1A 2GF2A 2JJ2D 3R5XA 5I7EA 3BIWA 1KNXA 3IPXA 3OPVA 5JY1A 4GRIA 4TQGA 4ZEWA 3CZPA 3UUWA 3BT7A 3HNPA 3R0VA 3ONWA 4FYHA 2HK7A 4H6WA 2FK7A 3VDQA 1VHLA 3ZZ1A 4FWTA 5IHXA 4JFAA 5JTTA 4UTXA 5FFMA 5LL6P 1Q91A 5HW0A 3KQNA 2FG6C 1ZCAA 2E4UA 1CUCA 1OGJA 2FSUA 4MLDA 2OZEA 3AZOA 5HMMA 1XNHA 5IVIA 2H9IA 2OM2A 3BFVA 1JZQA 3IQZA 2ATEA 4DVGA 2W43A 1IQ0A 1O89A 3LQRA 4GYWA 4QU8A 3KPYA 1O95A 4P4SB 2P1RA 2AR7A 3B36A 3U7HB 1DC7A 2IUEA 4G0WA 1RM3A 3R3VA 2FZKA 3HDYA 3L6OO 1YZKA 4BTEA 3K09A 4UCFA 2QVZX 4C1BA 4O3MA 1V43A 1S6YA 1PL6A 4N76A 5D3ZA 4YJ2B 2QJOA 4MQBA 1QJ4A 3LY7A 1NFRA 4XVUA 1JBQA 3V55A 4BX9A 2GUGA 3VR2D 5AI4A 5GZ3A 4IFEA 2V7UA 1JHAA 3AYXB 3D7RA 3MM4A 4BFUA 4IZIA 3P0FA 1UWVA 5M2QA 1W88A 1KPIA 5HMLA 1KI3A 2PGJA 3Q1KA 3FUTA 3SJAA 4PCAA 5EPEA 3EZYA 3CJRA 1QQ7A 4OV6B 2IGTA 3KBOA 3O93A 3GVPA 3Q41A 2Q2QA 1VKZA 2WC1A 3RU7A 5L40A 2Y05A 1OT5A 3ITEA 3Q85A 5K9ZA 5JDIC 5A3RA 1JFRA 2AXPA 4PICA 5BOSB 4QQRA 3W5JA 1M6VA 5FXMA 5B3KA 3V5NA 1XJWA 1A9SA 2X8LA 4BVAA 4JJ6A 1EDBA 3OLVA 1KAQA 1LF0A 2GM9A 2YXBA 4GP6A 4WJKB 3LFTA 2XWBF 1ACJA 4WT7A 3WNDA 6NULA 1Y8AA 4IBOA 4GT1A 1IQUA 1EBFA 2HA5A 3ESXA 4D96A 4YJKA 3AUFA 2NUBA 4TLCA 1E1YA 1A8SA 4JB2A 5JSQA 3L8EA 2AOVA 2BMEA 4X84A 3TCNA 5GIOE 2P65A 3PC8C 1SIUA 4FFWA 2JAQA 3T15A 1IU9A 1USVA 2C58A 5DASA 1PX2A 1G4UR 2AI3A 3NTXA 4WXMA 1TB4A 3ZGVA 1H2BA 4R01A 4M8KA 3F9RA 4N65A 3FPGA 2F7SA 4ASUA 1T2NA 1GUBA 3CCFA 1UKZA 5JEDA 3CB2A 4ZI7F 3V8NA 1B43A 1C8VB 2C4NA 1OBOA 3PHHA 1Q0RA 2OWDA 3H8SA 4MULA 2HMWA 3ZCUA 4BU1A 5CFMA 5JR3A 5LJIA 2VWHA 5ECYA 1SQ6A 4YUXA 3OQPA 5HQJA 4H16A 4NAUA 1MEOA 4M1ZA 5FCDA 2B1RA 4S35A 3PG5A 4UZEA 3ZGXA 1TKCA 1A9QA 4TKUA 1UDXA 2C9CA 3L4BC 1KO5A 4D3DA 5JAOA 1W8IA 2VNAA 3FDJA 5JISA 4GR5A 2WSBA 4OPMA 4WY8A 1FMTA 1IM5A 1QR2A 4PTZA 2XE7A 1N5DA 3GLKA 3MW8A 1NVKA 5AJWA 2DR3A 1Q22A 2FETA 3A8TA 3R3WA 4TTPA 5AI5A 2RHJA 2YDXA 4A03A 2I6QA 1H2ZA 5KTRA 2XGOA 2HK6A 2ZOSA 3HJHA 1QYVA 3R6GA 2QJFA 1ZC4A 2CHVA 1LI5A 1T3ZA 2YICA 2O3QA 3CIOA 4XQCA 1F1JA 1YMVA 4EJ6A 5LUAA 3H1EA 4Y0NA 3RHZA 4C5CA 1V3QE 1R3UA 2ZE7A 4AO6A 5LOVB 3CNQS 1R0CA 1L0BA 5A06A 1WMDA 4LRYA 4AJOA 1HUQA 1YJBA 3VO8A 1TD9A 2DFTA 1W19A 2WUWE 2ZFUA 3QFHA 1G8FA 3DB1A 4L73A 1ECCA 2VKTA 2WJPA 1OTXA 1PZXA 4CLEA 2G1KA 1U1CA 2B4KA 3E5NA 2WFAA 5F2OA 2I4NA 2ZYIA 3L8HA 4F9EA 2LIVA 3WBBA 2C7GA 3HLKA 1ZPDA 2XWPA 3WADA 1HZJA 3Q8MA 5CH3A 1IZZA 3MQ4A 5LDDC 1NASA 5T8KC 1HDXA 2O2DA 4DXHA 2V98A 1E0JA 2KS6A 1E3JA 3OQBA 4R8LA 2OV3A 2QG4A 1V2GA 1OC4A 3QXSA 5B6PA 3G3EA 1GTSA 4D9FA 1Y9ZA 1ZRMA 4GMGA 4J4HA 4R68A 4OH1A 2XQGA 1NRWA 3N5KA 1YR2A 2AJ8A 3ON5A 3URKA 1EK2A 5CAEB 2M9MA 1L7NA 4C0JA 3D4OA 4EL0A 3VNVA 4B2IA 4TWIA 1A7UA 1RE0A 5FA5A 3LJKA 1P2SA 1UC5B 3KJEA 4O4LB 4U9HS 4UNNA 1Q50A 4WFJA 2IYZA 3ZZNA 1RKXA 1Y3FE 3OJEA 3UHAA 1Y63A 2I6TA 4ETWA 4HQOA 2AOWA 4LRWA 4HFNA 4HVAA 2ISQA 1N5RA 1OX4B 4K0RA 3RCBA 3NVKI 1KNQA 3AFNA 2ZI7A 1IRIA 1RADA 2HU8A 2ZE5A 3X1JA 3WGUA 2VUTA 3IUPA 3PUZA 2HSEA 1QGUB 4UFNA 5BWNA 3LX5A 2GPNA 2XGSA 1V39A 2V9ZA 4JWKA 1N1EA 1YNSA 4GUAA 2ECPA 4GM1A 4EKIA 1AJEA 1GPKA 4EZEA 1I7LA 3RBXA 3AUYA 3DTNA 3CLKA 1ZR4A 2GX6A 4NNJA 4ZWNA 2OILA 4DL9A 1RJWA 1OILA 3IOEA 2FWIA 5ALGA 4KRYA 2R97A 1JYFA 3FCYA 4KN6A 4LE1A 4YCDA 1KDPA 3QG5A 4O29A 4EVIA 2VDMB 1L8AA 2XUDA 3VUEA 3K1YA 4MR8A 3ND7A 1A5TA 1KDTA 3PHBE 2DUUA 5T3UA 3SIWA 1GTZA 1CHDA 2FN9A 1DQSA 4UU7A 4J0FA 1S2DA 2R8RA 3VNSA 2CXRA 4XCXA 3TFOA 4IGKA 3BMXA 5WRFA 5A4AA 4D43A 1L4YA 1VMAA 5EIWA 4L1KA 3M2TA 2NU6B 2OFFA 1ISSA 3ZIUA 2AL7A 4RTOA 1C30A 2VTBB 2BTEA 2PPVA 1MORA 3P52A 3AF0A 1EGVB 3FLAA 2NPFA 1XPUA 3WB2A 2PO7A 2QRLA 4ZQCB 3U3DA 2IF0A 3CT6A 2CL0X 2PCLA 2PUVA 2M2IA 1SO8A 1JEOA 3LKVA 4MZXA 5K3DA 4TV9F 2IV2X 3ZIDA 4YRNA 1DARA 4ENRA 5KNLA 3N53A 3UHPA 2ZR0A 1TQ4A 1B73A 2OXIA 3D7KA 4MEAA 3JRWA 4U2DA 1BHO1 3HM2A 4I50A 1JA0A 2P2SA 1YIAA 1AMUA 1K3TA 2Y1XA 3HVUA 2XI4A 3P9NA 4S04A 1EK6A 1LRJA 2R84A 2WB4A 5EP1A 5LNK1 1CF4A 3UJHA 2JAOA 3GFSA 3EXIA 1T35A 1I0LA 5BSEA 1J20A 4X6XA 3SM3A 4BRZA 3PD0A 3D3EA 1K0FA 4OP1A 3HO1A 4M8NE 4EPWA 2YZ2A 2TMDA 1UXKA 1X1QA 3PPVA 1X1SA 3PUWA 3AJEA 1M75A 1VHDA 1HMPA 1M66A 1T5DX 2GGSA 2A67A 3CVOA 3DFUA 3OCVA 5U4XA 1ND6A 5IJ9B 1SVSA 3EQ9A 1YCGA 2ZWVA 3EIHA 3ZYZA 4PIPA 3CLTD 1BMFD 4PCVA 3ER8A 4BNUA 1N2BA 2DPGA 2FPLA 3I6MA 4WX2B 3BHIA 4HFRA 5L3VA 3HXQA 1UOEA 3AKDA 3I9V1 1GQSA 4L4YA 1F2VA 3ECAA 4NQZA 3R75A 4H1TA 4GQBA 3MMXA 3QXXA 4RBNA 1EDOA 2X23A 2IFTA 1ODFA 3AGPA 4M9SA 1OWMA 4YTEA 5GZ6A 4BX2A 5K2OA 1XPRA 3WGTA 4F4UA 2GZHA 2LW7A 3I9MA 4FNOA 1KR2A 4RY0A 4KPUA 2XVZA 5D6NA 4ZZ2A 5C8XA 3WLLA 1G2PA 1Z22A 4RSRA 1YQXA 2ZYAA 3HV2A 1U3UA 3EFBA 2V7QD 5CM8B 2AC2A 3X1YA 4YJ3F 2HXGA 4WVLA 5K8LA 1YFLA 5B7QA 1HLFA 3NGLA 5LQSA 4IRMA 2Z2IA 3RKRA 1OB5A 2CFCA 4M86A 1N7IA 3MCUA 2IEDA 1AA6A 1T9KA 3BXGA 3IT3A 5DT9A 1H66A 3PV0A 3PD7A 3S2GA 4GI5A 3UY4A 1AXGA 3WNVA 1ZK1A 5L6MB 1Y3AA 3TTVA 2QT0A 1G1MA 2W6PA 3BN3A 1I3LA 2CF6A 4JDPA 5KX5A 4YS6A 4HAVA 5K09A 5GJWC 1QKKA 3AQIA 1ZOOA 3IAEA 3RI3A 4DLBA 2BMJA 4MIEA 4O0MA 4L51A 2YFHA 3TECE 1IN5A 1P5JA 4INPA 2XKJE 4F3NA 4I9HA 2ZIVB 3AEKA 3JD0A 4I1IA 3UMSA 1HL7A 1PW5A 4RL4A 1JS1X 2ZSDA 4BEBA 1AKUA 4L9RA 4AZ3A 1E4EA 2UZ1A 2EC5A 2FPGA 2Q9UA 2XNSA 2ZQ5A 3CF6R 3KT3A 3MPUA 5EUMA 1KBZA 3OQHA 2VNJA 4H2DA 2AE1A 3NIWA 4GOND 4PNEA 5HX7A 5J47A 4JLDA 2DWCA 2Q5EA 2AOTA 3AKEA 3C3CA 1Q6ZA 3CNBA 3M1LA 3UFXA 3R5SA 3P9SA 1RMTA 3PWSA 4FQ8A 3GPBA 4HN4B 4ZCLA 1ESCA 3SKYA 4FLMA 1TFUA 4HQKA 1SCQA 1MVOA 3EOAI 3UWOA 5A9SB 3OC0A 1TAHA 1TYDE 5BVHA 3AL2A 3H4VA 1CS0B 1G8HA 4CMBA 1X3LA 2G06A 2HA0A 3HKDB 1PIWA 4OAQA 1E60A 1J2JA 5G3YA 3ZQUA 1WZNA 1LA2A 1T15A 1X80B 3BSYA 4YAGA 3L4KA 1XMOB 2GN4A 2YFYA 4M8LA 1U8EA 4X62B 4IIJB 1YB5A 3RSSA 1ZK4A 4G65A 4Y9RA 4O2AF 4QRIA 3FDFA 2BZ1A 1Z17A 4DR3B 2Z58A 2QN7A 4IDBA 4HVLA 4ZKDA 3MJHA 1JR3E 1IQRA 3B9RA 1XMJA 2CL7X 1RCTE 4LG1A 3T7JA 3VUFA 4EB6A 2BMDA 4ZHQA 4HVCA 3ENNA 1YZGA 2V4ZA 4LV8B 2IZ7A 1FP4A 1L5LA 3QKSA 1LV7A 4HRVA 4MMXB 1MD9A 3KEGA 5K20A 1H8HD 3DD5A 4BVHA 5BPHA 2WQ7A 3FTNA 5KNDH 4PIMA 4S3MA 4PZUA 2W22A 3HDQA 1KYWA 1KSJA 4RF3A 5G0TA 1HYEA 5GADl 2GOYA 5AK4A 4WNYA 4M0CA 3ZV3A 3GOHA 5JARA 4BLTA 3KS9A 4DR4B 3QNMA 4KXFB 4RV4A 3VSCA 2CK3A 1UFOA 2FJUA 4WA8A 4WN9B 1YTLA 1C41A 3UGJA 5M3BA 2IJGX 3FOAA 1P1RA 3E7FA 5C0OE 4JBGA 4OUDB 4XUGB 3LWBA 5J4VA 3DZ8A 3OZEA 3PT5A 2E18A 2A5GA 4NBTA 2QGNA 4A0FA 3IQGX 2GDZA 4OD0A 3K8OE 4MWOA 1P2VA 4GBED 5DTQA 5ADHA 2YIVX 4OFXA 3WYDA 4X1IA 3FOEC 4BMPB 4DIBA 1IOVA 4EHFA 1QHHA 3IOBA 4GMHA 3LX6A 1I1OA 5AI6A 2IX9A 2MINB 2Q7DA 5EMNA 4AJ4A 4NZZA 4DOMA 1ZNWA 4UTVA 4J0IA 4MW9A 4F46A 4EY7A 3OEWA 1FDUA 1FSFA 1JPVA 4OXNA 2WJ3A 1QIHA 1TA4A 4RF2A 5CJPA 5AKXA 1CUFA 3L0PA 4HPWA 4UBNA 4CV1A 4XWWA 4M7OA 1O2DA 1K7SN 3LL4A 2XBUA 3LDFA 1D2EA 3IKLA 5AW4A 1Z3CA 1N2HA 3Q9UA 1ZSYA 3F7MA 3UJ6A 4EF6A 4I55F 2ZWIA 5A3JA 1IOWA 2AYXA 3IQWA 3EDYA 3THWA 3EJWA 5ALRA 4K9QA 4US2R 4A36A 1OAAA 2AEMA 3J80A 2X7JA 1JSLA 1OLSA 4IDAA 5IKPA 2BVNA 4EKNB 2NVUA 3B9PA 1TU4A 3K9NA 3T7KA 1BNCA 3EHDA 1NVEA 1XZKA 3FJ1A 3JYPA 4L5IA 5GM2A 1H22A 1OIXA 2FW9A 1HL3A 3JQBA 3T4XA 4DC0A 5JZSA 4ZOBA 4W9NC 1MAVA 4JZYA 5IHPA 3F78A 3I34X 1ILEA 2VAMA 4NU6A 3EWIA 2WI8A 5ULLA 2PZGA 1SCIA 3O91A 3IEUA 3EIEA 4Q4LA 1SA0B 2IDJA 1NZDA 2XA2A 2CFSA 2EHDA 2ZRKA 1YV9A 1MQ8B 2OC9A 2X15A 3NS7A 4ZAXA 1M2FA 5F7XA 2IHUA 1KAEA 2EKBA 1DG3A 3TTYA 3BPSA 5CDFE 5HXAA 1VBNA 3F6BX 2Q0XA 5K8IA 3WGJA 1TT5A 3AR3A 1ZINA 5EZYB 2J3QA 5EQJB 1PG5A 3GH1A 1A8UA 2FUCA 4YLGA 5AM1A 2XUGA 3CNLA 4AIIA 1GPYA 4OYYA 4CEJB 1UMBB 1E1RD 2RJNA 4PX3A 2H0QA 4R2LA 4QU9A 1GITA 4IIUA 4OSEA 2GYWA 4P93A 4Q82A 3TBFA 3CO5A 1QXSA 2Z2YA 1ODJA 1Y0BA 1Y8RB 3IILA 1WUHS 3QW2A 3ROTA 4COOA 1X7XB 1A9XA 2QBYA 1KC1A 4ND8B 1IMJA 3U9SA 1J5PA 2H1SA 2GDJA 1NBOA 3O94A 1SVOA 3LHIA 2P78A 1QGAA 4JFRA 4WLEA 5TDHA 2B7LA 5CFPA 5CFNA 4EATA 3DHEA 4X94A 4YRGA 1KETA 3ISTA 1OLUA 5CLGA 3BE4A 3WJ2A 3H11B 4C07A 1XMQB 1QC5B 1UT5A 1QGYA 4XYMA 1FFXB 3LBNA 5BQXA 3ZOZA 1YU6A 1PJQA 1FDSA 4Y6LA 3D6HA 1XCJA 3T3DA 3KKZA 3A1EA 4L0CA 3JQ7A 2Y6VA 3ROKA 2WKWA 3PGLA 1EFPB 3NANA 1BDIA 1MHPA 1P6QA 1CPYA 1KPGA 2LV8A 4P9NA 4TKMA 1U7HA 1FDOA 3QUTA 4N7BA 3Q8KA 2I4RA 4M3NA 3UATA 3BXZA 4EARA 2ZRNA 3L04A 4OATA 2I9KA 3LQYA 2GCOB 4EG1A 2E48A 2PUCA 4WKBA 4C08A 1YFKA 3PKIA 5AYVA 5TMPA 1E0AA 1DRVA 2QZ9A 3CKLA 1JQKA 3I2IA 5ELXA 3W8NA 2V7TA 2QLJA 1UP4A 1J2TA 4IMPA 2M1XA 2O1SA 2LBPA 3JV7A 5D1NA 3SN6A 3V4ZA 3C16C 3DCYA 2VJDA 4ZCPA 5CBKA 4DTCA 2ZSKA 2IVFA 2Q6OA 1ZBQA 1I33A 3Q5DA 3LA8A 1BROA 2XXBA 2ZRAA 4G4SO 2GWRA 3TRHA 1P9WA 5ESWA 2J9FB 2R1TB 1KEEA 4UM8B 2WHEA 1NBEA 1XK6A 2B4RO 4CIVA 1BIFA 4J76A 3ZDCA 4DT1A 3E84A 1F4LA 1JKXA 1CZUA 4JYBA 3RU2A 5MN4A 4KDFA 1X1RA 1YDMA 4XWTA 3B51X 4Y6GB 2HI0A 3V33A 5H81A 3WK4A 1VBKA 3W5DA 1QORA 3WJAA 3RSFA 2OAEA 3OFVA 2UYQA 3UBTA 1PV2A 2DHQA 2HA3A 1B93A 3BQMB 2BV3A 1QZ3A 3EAQA 4XPIB 3IP6A 4KGXA 4KH1A 4XWGA 3SZLA 4CTNA 2B1QA 3GNLA 4DDTA 5FTLA 2ZR8A 1CJVC 1WX1A 2JJYA 4OTZA 5HKKA 5IJAA 3Q5GA 4PQYA 5DWDA 4G1MB 3TTXA 2RSLA 5IM5A 4KAFA 5D3MA 3L2OB 2ZR9A 3AHIA 2PAAA 5F21A 3F74A 1VJGA 2ODAA 1WJGA 3C6ZA 4GXQA 4QYMA 5YASA 1E9RA 2A1UA 3Q7SA 4D4HA 5TSDA 2CZGA 3SQOA 1DO2A 3LD9A 1XU9A 4BZXA 3BDAA 4OYHA 4D5EA 5G02A 2NX2A 4PLZA 3GLFB 3OI7A 3N39C 2XYGA 3D5QA 1WY5A 3K0AA 4M46A 3P0EA 1X2BA 3MHTA 3PA6A 4J0CA 3GFOA 2LCIA 5K1ZA 4M8SA 5CNKA 1MX3A 5K5EA 5F7JA 1EVYA 1KY2A 2V5UA 1YVPA 1JFSA 5ER6A 4EYEA 5DX1A 1VQ1A 3CUUA 4W9MC 1NG1A 1QHEA 5B3AA 3MD0A 3TO5A 4CF6A 5A4MS 1RWXA 4NX2A 3TB6A 4YAUA 4GOXA 4ER6A 3WL8A 1ZM2A 3OZUA 4F86A 1IN1A 4DHWA 3U7JA 2FTKE 4PAMA 4WA7A 1ZRNA 5AI0A 4EH1A 4V1CB 1GTRA 1P1JA 3M8KA 4BCCA 1AZSC 3FWHA 5LCXA 1GGJA 1D6NA 1GPUA 3UGKA 3HM9A 1DINA 3A06A 3QKRB 1YZQA 3ZK8A 3FI9A 1OXSC 3ZBPA 1NUAA 2CVQA 1PR6A 5F51A 3MWFA 1JG6A 3BVPA 1C3JA 1WG8A 1A4RA 3STVA 3OU6A 2CNOA 4AF6A 2NU7A 6CHYA 3KRTA 2ESRA 1ZLYA 3WWEA 3SZMA 1XZPA 2RH4A 2QYSA 4TSRA 4PLTA 1QE3A 3VR2A 2P1ZA 4P80A 1RBQA 3PFWO 2VG8A 1MVLA 1TZKA 2W2LD 1TW3A 3CH7A 3DVRX 4N0PA 2ANCA 3Q8XB 5EERA 4LF9B 2XTMA 1G2QA 2O1EA 2IPLA 2XOEA 4WKGA 2IPOA 2J1LA 1P72A 2OUIA 4D99A 1ZXBA 5EIXA 2Y3IA 4GZ5A 2WD7A 3O73A 1TD1A 2PX3A 1NXSA 3N6XA 1PK8A 4RW0A 1YVEI 3VU1A 2F2TA 3LUBA 3M34A 2R48A 3K71B 1OFGA 3D4LA 4MYRA 3THYA 4NYMR 4ERNA 5IFLA 1YGPA 1SCJA 3BREA 4U8HA 5H3CA 2XZOA 1HETA 3ISVA 1CRQA 5BSUA 4EG7A 4BGUA 4OMDA 2WZDA 4HOYA 4GR4A 3FNGA 2ZB8A 4Q1VA 2G36A 3IRUA 4IR7A 1BW9B 5KIAA 3IUNA 3KBBA 1AMNA 5G0VA 2W6QA 1ZYUA 4AVYA 5LP6C 3D4NA 1IM2A 1PNRA 6ADHA 2FP4B 3F4BA 3PHIA 4JUIA 1V9SA 4YO8A 1KQNA 8OHMA 1Q0HA 3T7RA 5JI2E 2P2YA 4AN1A 1YJ8A 4RHUA 5I4KA 1DKNA 3AUKA 5ITSA 1JPNA 2P91A 3A32A 1QE5A 2ZS7A 2V3CC 3FBWA 1OYWA 2Q49A 4XJSA 3F98A 2I3AA 2GHIA 1MUUA 2FPSA 1GNSA 3CVJA 3G1TA 4N8EA 4QAQA 3UF0A 3OJ0A 5BQFA 1BOOA 2V55B