2L19A

An arsenate reductase in the intermediate state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGSGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title (1)H, (13)C and (15)N resonance assignments of the arsenate reductase from Synechocystis sp. strain PCC 6803
pubmed doi rcsb
source organism Synechocystis
molecule tags Oxidoreductase
total genus 41
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l19A00
2QZJA 3RVPA 1JH9A 2GKGA 1VPWA 2NZUG 4S04A 1PHRA 3GWGA 4Y9TA 1QNLA 4MR7B 5GQSA 3RVJA 2IKSA 3CHYA 3QX9A 4KMRA 5GOTA 1Z16A 1EWVA 3G1WA 3H1GA 3O21A 3T95A 1JYEA 4XAQA 4D6YA 2VUIB 3T6KA 3JPWA 3O1IC 4YR7A 4RK1A 3KLNA 3SY8A 3Q7RA 3JVDA 1PUXA 3UUGA 1GCGA 3GRCA 2QR3A 2KYRA 4UHJA 4PZ0A 1JX6A 5FWYB 2V0NA 1YTUA 4EYKA 2P9HA 5B3JC 2PL1A 3SM9A 2IPNA 5IEBA 1Z25A 3H5LA 3KCNA 4MQEA 3LUKA 4EUKA 2HJ9A 1BVHA 2Q5CA 1JDPA 4KFCA 2GBPA 3FFWA 2R25B 3A3KA 3QELB 4LZLA 1QKKA 4NICA 5HKOA 1DRJA 1JHZA 1LBIA 4Q7EA 1MVOA 1KGSA 4RKRA 2QVCA 2CWDA 4NV3A 4N0PA 2XDYA 1H9CA 3RVMA 2QV0A 4F06A 3F73A 1T34A 1ZVVA 1BDHA 4N76A 1Y1LA 3OLYA 4H60A 3I09A 4L85A 4RS3A 5JNUA 3TX6A 2YHAA 3O75A 3NNSA 4NCBA 3O2SB 3JPYA 5KQPA 2ID7A 1VRVA 1VLZA 3GBVA 4LDZA 1JL3A 3CZ5A 3N0XA 4WXEA 2NT4A 2MYUA 3DGEC 5CNIA 1QPZA 1URPA 5IC5A 3FGZA 3DBIA 3EULA 5B3JA 5HQJA 1YIOA 2FN9A 2L19A 3CFYA 2MSKA 3LUHA 3MYYA 2AYXA 3D8UA 2CHFA 4RK7A 5ABPA 3CU5A 2JBAB 4MGEA 1DG9A 4MR9A 1GUBA 1FFWA 1YK0A 2HQRA 2IPMA 3CTPA 4JAVC 2JCGA 1EAYA 4LE1A 3UKJA 5JNWA 4Z99A 3LUJA 3A0UA 1Z2DA 3O74A 6ABPA 1Z12A 1EWKA 3BRQA 5EWMB 3H5TA 4FB4A 2F8TA 1ISRA 4OLAA 2FQYA 1C4WA 4MS4A 3O1HB 2FLWA 4MR8B 2MYNA 4MPTA 1KMIY 2FTKE 2OENG 3KSMA 3MQ4A 5KC9A 4RKQA 1NXOA 1DBQA 4OATA 1DCFA 4ZJPA 5KQMA 2PUEA 4XFKA 2P4UA 2IDMA 3M9WA 3DLBA 1Z26A 5DTEA 3NBMA 6CHYA 1Z13A 2L2QA 3DGFC 3HCWA 4RSMA 1R8JA 1TJYA 3CG0A 2GI4A 4XLTA 4QYWA 3HM9A 5KQGA 3N53A 1B00A 1M2EA 1NXVA 1PNTA 5HM6A 4MS4B 3RQIA 1JFVA 4DN6A 2IYNA 4ETMA 3GBPA 3QEKA 5IUNC 3N8IA 3C97A 3EAFA 4MRMB 1NXPA 4RY8A 5E3JA 1YK1A 2R47A 4MS1A 5D2CA 3F6PA 2PLNA 3VNAA 2VK2A 2PMCA 4O1IA 4MS3B 1QO0D 4GPAA 4OG2A 1YS7A 5DCLA 1QP7A 1JFTA 3L6UA 2PAFA 3D02A 3JVIA 3HDGA 4G97A 1ZN2A 4RY0A 5C5CA 1JBEA 3IPAA 2E4VA 3DZDA 4MS1B 1P2FA 5JNVA 3FFTA 1WETA 5EWJA 5IBQA 1LBHA 1NXXA 2N9UA 3HJFA 4F8JA 1F4VA 1M5TA 3MM4A 3RVLA 1AB6A 3KHTA 4OTZA 1DBPA 3T38A 5TPWA 3BREA 1DJMA 1USGA 2RDMA 4O1HA 4N0QA 3QLVC 2MSLA 1ZH4A 1GUDA 4WZZA 1YS6A 4G0ZA 1Z17A 2HPHA 3B2NA 4UHKA 2FQWA 1MB0A 4PEVA 3EODA 3OO0A 1ZGGA 3H5VA 1RZRD 1AB5A 2IOYA 3QEMA 5TE9A 1RNLA 3OQOA 3HO1A 2JK1A 3K9CA 2TMYA 3QLTA 4HNRA 2RJNA 1DCKA 1FSPA 1U2PA 5IUJC 5ED4A 1M2FA 4RU1A 1FFSA 2GWRA 4G0XA 1USKA 2VUHB 5TPZA 2VYCA 5KC8A 3HV2A 4EY3A 3SNKA 1NY5A 4EVSA 5BRAA 1CYEA 4JP1A 3KKEA 5JNSA 3LUGA 2FVYA 1NATA 3GL9A 4RXTA 4EVRA 1SXIA 1ZY2A 3OQNA 5I4CA 4IMIB 4MQEB 3VNBA 3P9YA 1JFSA 2FMHA 5CNMA 5CNJA 4Z4EA 3I42A 4MLDA 2R48A 3IP7A 5EWLA 4PE5B 4XARA 1KRWA 4OLBA 4Z4GA 2FEWB 4Z4HA 1ZESA 2HQOA 1ZH2A 4KREA 4Z9BA 5KQLA 2BGGA 3JY6A 3H6HA 4YWHA 3RVSA 4IILA 2DRIA 3N0RA 3LKVA 3ROFA 3KYJB 4WWHA 1XHEA 1PNRA 4G0QA 2RJOA 3IP9A 4RY9A 3M6MD 4D6XA 4YS6A 2RGYA 4EYOA 5FBKA 2QXYA 1EHCA 2A9OA 1QQBA 1F51E 2HSGA 3OLZA 4Z4CA 3H1FA 1RPJA 1A0OA 2F8SA 3IDOA 2FMKA 1YMUA 4EVQA 1QP4A 2FXIA 1ZDMA 3GV0A 3H5IA 3KJXA 4RK6A 4Z9AA 1OXBB 2PKXA 5CNKA 3TB6A 4LE2A 1P6QA 1W25A 2QW1A 3K4HA 4FE7A 2MYPA 3Q15C 4RZSA 4EYGA 2E4XA 2FLKA 3O2JA 5T7BA 5FWXA 1L5ZA 3JS5A 3LUCA 1DRKA 3FMVA 4KV7A 3EQ2A 4QICA 1JLKA 1PEAA 1E6LA 3GT7A 4MR9B 4LRQA 3CG4A 4RK0A 3NHZA 4G86A 4ETIA 4MQFA 5DKFA 1SXHA 5KWSA 1TMYA 3HUUA 1GLGA 1ABFA 4IRXA 2FQXA 3I5AA 4MYRA 1A04A 2MSWA 4JA2A 2FN8A 1BDIA 2FW0A 1FQWA 5TQ0A 4WUTA 4WT7A 3OLVA 4G0MA 4M88A 1L5YA 4LX8A 4ZYLA 2I6FA 4G0YA 3NNDA 4H3KB 4N47A 2MYTA 5C5EA 2WB4A 2E4ZA 3KLOA 3C3KA 1BDJA 3Q7SA 5JNRA 2IPAB 3O1JC 2LUOA 4F11A 2FEPA 4JB0A 1DBWA 3H1EA 1NTRA 4ZPJA 3FFXA 5IUKC 4YCSA 1YMVA 2QSJA 3F7NA 3CNBA 1JWLA 1MAVA 2WMYA 3C6QA 4QPJC 4KK3A 4KNYA 2L17A 2LIVA 2J48A 3OLWA 4GNRA 4YRZA 4JASB 2PJUA 3LTEA 1C0EA 2E4YA 4KQCA 1BA2A 2AYZA 2H0AA 2A9RA 3BBLA 2NZVG 3ILYA 3TMYA 2PUDA 4KVFA 4YGXB 1DCMA 3OMWA 4NQRA 5TQJA 1QMPA 4E7OA 1QO0A 3SAJA 1CEYA 5BQ3A 3EDCA 4DADA 2A9QA 1ISSA 1JF8A 4G0PA 1JDNA 1K68A 2NT3A 4DQDA 3IP6A 1IIBA 3EQZA 2M1ZA 4PICA 5EWJB 3RVNA 9ABPA 3NHMA 2QU7A 3CZCA 1DP4A 3HZHA 4TLLB 4ML3A 5IX8A 3FDFA 4RXUA 3LOPA 4P98A 3Q41A 5CHYA 4EYQA 4XASA 2JVJA 3H5OA 3MMNA 3N75A 4W5TA 1ZAYA 4Q6WA 2FKAA 2W42A 5FWYA 2FMIA 5TPWB 2WJAA 2WWVD 4G0OA 5HSGA 5JS1A 2WJWA 3RVOA 4OBBA 4IF4A 5FBHA 4PYRA 2PUCA 1OXKB 5TPZD 1XHFA 4W5RA 3A0RB 8ABPA 1SD5A 3QELA 5PNTA 3ROTA 3KS9A 3H6GA 3G85A 1FFGA 2X7XA 2JVKA 3QEMB 3HVRA 3RVKA 1RXIA 3HS3A 1U0SY 5BRJA 1I3CA 2GX6A 5BR1A 4N41A 2E4UA 1QQAA 2CHEA 1RZRA 2R4QA 1EWTA 3JTEA 4QYMA 2WY2D 2PUFA 1U2QA 3M9XA 4Z4FA 3E61A 1D1PA 3IPCA 2FMFA 1LJUA 3EGCA 5KI6A 4IGAA 4TMYA 3T8YA 3HUTA 3Q9SA 5JS2A 1TVMA 1Z15A 2FSPA 4XXHA 4RK5A 4YLEA 5JNTA 3DLHA 1XWWA 1DC8A 3QLVA 2ZWMA 4YP9A 2M98A 3KTOA 4O5AA 3OM1A 3CS3A 2YHBA 4NCAA 3OLXA 5EWLB 3LUAA 4Q6BA 3W9SA 1QP0A 1KRXA 4RV5A 3E3MA 3TD9A 1U04A 3HSYA 1P6UA 2OQRA 1E2BA 3F6CA 1USIA 1D4ZA 4Z4IA 4HNSA 2O20A 1SXGA 2PUBA 1DZ3A 1J56A 2PL9A 1LJLA 4MAAA 3LUDA 1UDRA 2JBAA 4KQ9A 4KZKA 3GA5A 3KYIB 1D5WA 1ZHHA 1A2OA 1GCAA 4LE0A 4LDAA 3I45A 3MA0A 3QK7A 4S05A 3O2QB 3OQMA 2WRZA 4TLMB 5EWMA 1D2AA 3MF4A 2PUGA 4HNQA 4L4UA 3LFTA 1D1QA 3NNNA 3CKMA 4B09A 4MR8A 3LUFA 1NXTA 2JRLA 3N0WA 1CHNA 1HEYA 4FE4A 4WXMA 7ABPA 1Z2EA 2NUBA 3QLUC 4F12A 2ZAYA 1VKRA 4MLCA 3URMA 3CRNA 3RVQA 2IPLA 4EGSA 1YVUA 3A10A 4RWEA 3N6VA 3LMKA 5FWXB 3QX8A 3LKBA 5TQ2A 5DLEA 1SRRA 3HEBA 4W5NA 1TM2A 4YV7A 1NXSA 1Z18A 3IP5A 4KRFA 4HYEA 3EJWA 3H5WA 1E6KA 5F64A 4MQFB 4MRMA 5IULC 3H75A 2LPMA 3OO1A 2PUAA 2QVGA 4MS3A 5TQ0B 4CBVA 3L49A 1P8AA 3KG2A 3RH0A 4RXMA 2JVIA 4RDCA 4TN5A 3S99A 3CLKA 1MB3A 3MIZA 2FEKA 3BRSA 5TQ2B 3SQNA 4ZMSA 5DGCA 3C3MA 3HK2A 3R0JA 1DC7A 4KK4A 1U8TA 1LK0A 4JOQA 5T3YA 4Z0NA 1TLFA 2HQBA 3OM0A 1K66A 2H3HA 4P1ZA 1NXWA 1W9HA 1E6MA 2B1JA 2L18A 4JB2A 3SG0A 1ABEA 4KPYA 4H3HB 2JB9A 4W5QA 1EFAA 2LP4Y 2PE5A 1APBA 3OMXA 3RVRA 4D74A 3TO5A 1M5UA 1PEYA 4ZMRA 2A9PA 4MR7A 4RK4A 3GYBA 4E7PA 1ZGZA 4IMJB 1S8NA 3BILA 3QLUA 4F3TA 1RXEA 2CD7A 2E4WA 3HDVA 1JYFA 3UK0A 3Q7TA 3ILHA 3C3WA 2LBPA 5IEJA 3HXMA 1MIHA 4N03A 2B4AA 2ID9A 4YO7A 4ETNA 1BAPA 1ZITA 4W5OA
chains in the Genus database with same CATH superfamily
1TM7E 3OECA 1ZI8A 2QM7A 4E5KA 1G8MA 3NASA 2ZI7A 3V9PA 1RJGA 2HGZA 5L53A 1KP3A 4S2EA 2B0JA 4KRYA 2O1XA 4JHXA 4MR7B 3VQTA 1RAIA 1K4YA 1ULAA 4JITA 5EKSA 5CDFA 1F3OA 2UDPA 3KKLA 2Y1XA 2O06A 1H2FA 4C5CA 1ISMA 4G2NA 2C5GA 1SAYA 1JDBC 1HH4A 2JK0A 2HEGA 3ABQB 1S02A 1BEZA 2A1IA 3C7CB 3HWSA 4YJKA 5H0IA 4DWVA 3DPSA 5C53B 4AYWA 2Y67A 3BCRA 1J8FA 1K98A 4NEGA 2HN9A 2I29A 3WLLA 4UHJA 1KO8A 1W1UA 4FMDB 1Y8CA 3UMJA 2YJTD 3BIFA 3HE3A 3WYBA 4UBOA 5JMOA 5JV5A 2EKQA 1T0IA 4IJVA 2OEPA 4R01A 1I5EA 2E37A 2JLQA 3ZE6A 1NQXA 1Z5UA 2X1VA 4HS9A 5BQPA 4Z2YA 1T5IA 1R2QA 5BSUA 3WMRA 4DIDA 4ER7A 1K97A 1AKNA 2Q2WA 3DUFA 5AT1A 4F96A 3PD7A 1I3KA 2V3VA 2WUVA 5FOXA 2GS9A 1A9SA 1A3CA 1GQQA 4WDQA 5CFPA 4QYSA 4MGYR 1NU6A 3FJYA 1YC2A 1ML3A 2BISA 1N2EA 1QKKA 3DDCA 1L0BA 2WJGA 4ISBA 4M4SA 4F4UA 4DDTA 5C37A 3VYUB 3I2GA 4LBWA 4O2BA 5DMXA 4E11A 2BKUA 3M3HA 1TVCA 1XKQA 1P45A 4W9NC 4F06A 4QLBA 5BXQC 3F73A 1DWUA 1FTNA 4YT5A 3FPLA 4BO8A 1AUOA 2GO7A 2EKDA 3CXUA 1PJBA 2OO5C 3X1YA 1Q1BA 1PJ8A 3AF3A 4PPYA 4EFMA 4PSDA 1V95A 3BF7A 4YRRA 1MG5A 4IG4A 3SN6A 2E9SA 5IAAA 4LY3A 1QHYA 2Q9AA 3CA8A 5HCIA 1GRVA 5LZ5A 4OM8A 1ENZA 3S8YA 4OHMA 2GVNA 1G1MA 1J99A 1KORA 2XADA 3GEBA 4GWGA 3E1GA 4EHFA 1RPZA 1KE1A 1XROA 5JBNA 5A5DA 4OQZA 2OPBA 3AFGA 4G0NA 4YP5A 5CX1A 3H8SA 3JWGA 4P84A 4R2LA 3CW2A 3T0FA 4BO0A 4RFVA 2VR1A 5AICA 1WOMA 1N0IA 1TEXA 1RWVA 2N46A 2WTNA 1Z5NA 2X8WA 3QU2A 1IHDA 3GGOA 1XZLA 4DY4A 3KSAC 1K4MA 4CM8A 1RYEA 2WT9A 4X63A 5CLHA 1HZJA 3MTEA 1E1QA 1FQKA 2BCGY 1VPLA 3P19A 4JXKA 3VYSB 2WSBA 3SNHA 2ZIZA 5AOCA 1CUHA 3C1AA 3DZKA 4OLAA 1P0QA 1Z6PA 1WX1A 3O8BA 1WXQA 1M6EX 2RSLA 3D0RA 3H8VA 4Q0MA 1I7PA 3AVYA 1B8NA 2V0CA 2P5YA 4BMVA 5I9BA 4PX3A 1W49A 3B60A 3T7AA 2OHHA 2B9EA 2P1DA 4I3FA 2XDWA 5KWEA 3MGAA 2O4CA 1DXYA 1KA9H 1RM0A 1LTKA 4XB6B 4OI1A 4OI4A 3U3XA 4TVKA 1T9AA 1ZO8A 2G5CA 4Y6SA 5E6SB 4BJ1A 3WAJA 4UC0A 5ISMA 2O8BA 1A96A 4B40A 2GA8A 4JL8A 5BYAA 1ADGA 3N53A 1B00A 5EXPA 1M2EA 4M8NE 3RQIA 1AH2A 2J87A 3S28A 3TBKA 5E4TA 1TL7C 1ZJJA 5EGSA 5GZ3A 1PK7A 4FNMA 1M75A 5TEWA 1HT3A 2WYVA 4U6SA 1P5JA 4RL6A 1YC5A 5HKKD 1NXPA 3FUWA 4RY8A 3NS7A 4OV6B 1QBGA 5D2CA 1Z6XA 2FE4A 4AG5A 2VK2A 2PMCA 4O1IA 3PUKA 3OTGA 1M1YA 1MQ8B 1XN4A 5LC1A 3LP6A 1QUEA 3OUUA 2G88A 3NG1A 3WYEA 3NTRA 1M2VB 3FWPA 3UO8B 2H1HA 4KTTE 5F4BA 2ZPUA 5L3ZA 3Q8XB 2IX3A 2PAFA 2CF5A 3CRVA 3OX4A 4RJKA 4TXNA 2XUQA 3BH7A 3UTDA 5FPKA 3CVVA 2QJWA 1K9SA 3T9CA 4RY0A 5BW8A 1ESEA 3R23A 4GPIB 3OJOA 3OWOA 4KMOA 4QFCA 1A77A 1SCUB 2NVUB 5EZYA 3Q5GA 3SF8A 3LNCA 4BASA 2H51A 1NMYA 3NEJA 2HBRA 2ZWPA 3P9CA 4UCFA 3VRHA 2C7GA 1W4LA 5EZ5A 2UVQA 3AIMA 1P9RA 1FRNA 3L06A 5LR6A 1P7ZA 1WMSA 3A4IA 1AURA 4QU5A 3NAGA 4BB6A 3R7WA 2UZ1B 3T38A 1YQDA 2XRYA 2VPXA 1WCXA 2OCBA 3AEQA 3AV0B 1NBME 1Z2NX 1DEKA 5BT8A 2QYTA 3FTCA 3NALA 4H6VA 4KGVA 4HVLA 2ZIFA 4IGKA 1R74A 3BHIA 3C8MA 3DL2A 2Z6QA 3FCEA 5KMGA 2FWNA 1X1AA 1ZW6A 1FTYA 2B0CA 3A3NA 4ZVSA 2B1QA 5F77A 2E48A 4M36A 4IDDA 3CIFA 4O2AA 3R75A 3GK3A 3H4VA 2EWMA 1RR6A 4I6GA 5I7FA 1HM5A 4G8BA 3KOYA 5LP1A 3DL0A 2R7MA 1WP4A 4PG5A 4FQ5A 2AK2A 1JXQA 3K1YA 1DKQA 1W46A 4MWSA 1FSPA 2GWRA 3KAJA 5L45A 1USKA 2AXEA 3FYUC 3AHJA 1J5PA 4AICA 5KC8A 4EY3A 3A14A 3A6KA 2NUPA 3DT9A 1UPTA 4RE5A 4RVCA 2QTZA 2DFPA 2NUTB 3HPQA 4UHBA 1I8TA 4MOWA 1NVKA 1AXRA 1DRVA 1MIOB 1PJSA 1ZY2A 2VP0A 3PUXA 4LRSB 4TZ6A 1RQPA 3MBOA 5EL0A 2P62A 5CP8A 4DC1A 1MO6A 2BH9A 4M9QA 2X8JA 4KE7A 4MLDA 1ZK2A 1JNXX 2CZQA 2YRXA 4NWIA 3VYVA 5JAHA 4MUHA 3G0DA 2ZE6A 1WUTA 4BUZA 1A8HA 1Z3IX 2J5RA 4DSUA 1PFQA 4KQXA 3T1OA 4E03A 5CIWA 4B5LA 1X3LA 4AJ9A 1U1EA 5C51B 4NDAA 3GFPA 2ZTMA 3PC4A 2EDAA 1PQUA 2WHXA 1JVBA 4ENRA 3ZDCA 4LS3A 3DBRA 4YH1A 2IZ7A 3V4SA 3O2NA 2CNNA 1ZK1A 3UMMA 2OCLA 2QLMA 1ORHA 5EE3A 1ZR2A 1KH2A 1V1MB 4IX9A 4WV3A 3GROA 3B9RA 1IHPA 2VQ3A 4JBWA 4UREA 4EIWA 2QL6A 1YD7A 4M6WA 1JJFA 1CFJA 1EH5A 1KAOA 1PR9A 1TT5A 2CLLB 1VE5A 1VPVA 5HBRA 3FDIA 4OXNA 3RUHA 2FQ1A 2W2MA 4BATA 1OWOA 2Q2NA 1J06A 1P4SA 3NRJA 3ZDYB 1KPGA 3UWDA 3ZYCA 1YFJA 2ECKA 2C3OA 2IY9A 1UBTS 3RJMA 1JG4A 2RHTA 2CLSA 2E4XA 1NSFA 1A7AA 1OXUA 1I2CA 1B7GO 3T5DA 3UEOA 2XUKA 2GESA 3QM1A 1E7MA 4MB0A 3OEEA 3EXEA 3X43A 2H0QA 3MS4A 4PG8A 5BSEA 1WW2A 1E2EA 3MYRA 3F6SA 1WA5A 1VQ1A 4MYRA 1R0RE 5A5VA 3BK7A 2XQVA 1U7HA 1XQYA 4JA2A 4TWBA 5D01A 5DM4A 3DL7A 5C4GB 3B13B 2OC4A 4ZTUB 3QSGA 3OLVA 1VFPA 4EAAA 2C00A 5HILA 1PS9A 1IRXA 3EFOA 4PO8A 4QL3A 1CUWA 3NNDA 4DAOA 3QOYA 3ORQA 1WRBA 2BTQB 4KQEA 3IQFA 1ETUA 2JLSA 1G5TA 3LQ2A 3IPRA 2JEZA 1XPUA 8GPBA 1MDBA 3OSUA 4F11A 4FYMA 5JSZA 1DBWA 1JG1A 3RVBA 4ENUA 1CVIA 1G6KA 1RJEA 4AKHA 1OT3A 3HYNA 3VZBA 2QSJA 3BFVA 2V9ZA 3ILXA 1MAVA 3GJTA 4UE3S 1BWQA 3SFTA 4AC9A 1TA0A 1UQTA 2B4TO 1J49A 1RJWA 4ZD6A 1CRWG 4UBMA 1LF0A 1VRCA 2AMFA 2NU7B 4RUKA 1V4NA 2QT0A 2BHRA 3OLWA 4PSUA 3GJQA 4YJ3A 5DFAA 2IY7A 4MW1A 4K6FA 4I3GA 4L51A 3IURA 4EG6A 4J6FA 1WSDA 3I2KA 5K4GA 3ESRA 1L4MA 2XDQB 3QITA 3QE2A 1CD5A 2CVOA 4K9QA 1P9LA 2PUDA 2OZLA 3WQHA 1JDZA 1MBZA 1P0CA 2C31A 2XUOA 3QPAA 5SY9A 1NKTA 1W5EA 3PJFA 5AOBA 3RS5A 3R9IA 3ZWOA 1YCGA 4B83A 3HADA 4G0PA 3QF4B 4P5DA 4DMRA 5HS4A 5KWIA 4MA0A 1E7RA 2C0CA 1IIBA 2I34A 1S01A 1K88A 3ZS9A 1FTWA 4B0OA 5LMUB 2BBTA 1GPWB 3EPLA 1W73A 4QYIA 2DHQA 4TLLB 5JPDA 1UDWA 2VDWA 4ZEMA 4RZ3A 5DCWA 4JJFA 4RFSB 4BVBA 2EKZA 2ILTA 5LUBA 1WZ2A 3FKQA 4ERXA 3RUFA 4UE6A 2P35A 1D4FA 4CW7A 4YJGA 5DASA 1DGQA 3CN7A 3I12A 2W98A 3GP3A 2WJWA 2W7TA 5BSGA 3A04A 4P4GA 5JISA 3FVWA 4OMUA 4AZTA 4GW3A 1CUUA 1PTKA 4EABA 1C2TA 1A4RA 1LDYA 2PH7A 4EATA 2G08A 4LOKA 3RLFA 3MAAC 3MJHA 2I6UA 2ZULA 4B6OA 4DILA 3LU1A 2R65A 1RXIA 5KYUA 4ILEA 1BDBA 1E4EA 2EZ4A 5JAPA 4CEHA 1KY2A 1C1HA 1N5RA 1EWTA 1T3HA 1T15A 2HEIA 2TMKA 3JTEA 3ZHVA 4HEA1 2PUFA 4R83A 5JYCA 3BE6A 4XFDA 1PNOA 2IF2A 3GLFE 2Z4SA 3R8CA 3FOEC 2W43A 4J1NA 3FUTA 1PFGA 1WDKA 3DMGA 3ZY6A 4JBLA 3RV3A 1WZEA 1T6XA 1OOEA 4RV4A 3P7MA 5A62A 3ZCXA 1ZCZA 1G63A 3P9IA 2QR2A 3RBXA 3AHEA 3WKEA 5JDCA 2DF8A 5EYPA 3MS2A 3HFRA 4JI6B 5JATA 5KTYA 1ZA2A 3AEKA 3DP7A 4FNOA 3W9SA 1CEEA 2DT8A 1E6EA 1HYEA 1TKAA 2HGSA 3L05A 3L84A 3DDSA 1R66A 4J75A 4R8RA 4W99A 5L95A 3NJ4A 4TMXA 4OM7A 3A11A 2JDID 3ENQA 2IWHA 1EHYA 4KTVE 3PC8A 4YJFA 2ZS7A 4E21A 5I7UA 2QRGA 4LYAA 4QECA 4TTRA 3VR5D 1JT2A 2XBLA 4B6EA 3U6BA 2X1LA 4PTZA 2WIJA 3FUXA 3N2GA 5AJUA 1JMVA 2H11A 1ID8A 5AW2A 3BXGA 4CKBB 5L6LB 5CLLA 3LTNC 3IGFA 4RM2A 1A95A 1OW3B 2ZSUA 1A2OA 3H5AA 4B31A 1LI7A 4L5IA 2B69A 2IYRA 4P6VF 2OHVA 1US8A 2DFDA 2ILVA 3I45A 3P52A 4WBSA 3TR5A 4EM6A 1C9EA 5GIPE 1SHLA 4EI9A 1PWXA 2SECE 2PVPA 1E1CB 4D0SA 4G01B 4RHTA 1NZFA 3JAWA 3KOWA 2P8SA 4QU0A 2IWRA 3N2KB 4Y2SA 4PAMA 3TMAA 1I4WA 3HB9A 1HEYA 4LISA 2PZEA 4KGXA 3FAKA 4R7ZA 2QZ9A 5K8CA 3DQPA 1R4MA 4BRZA 3SX0A 3T54A 2BEVB 4TKMA 5BSWA 3AVVA 1BCRB 3U5TA 5FWAA 1ML4A 1GPBA 1QP8A 1X2BA 3ABRB 3EC2A 2AMLA 3NQ41 2YZ2A 3SLKA 4D8TA 4E46A 1UWVA 3BJMA 4CQMD 4D25A 1SRRA 2WU4A 4J2OA 1YJXA 1JKXA 4N3NA 1WZUA 1XVVA 4C78A 4CCYB 3IP5A 4XOIA 3ER9A 1R9GA 1S7GA 2GEVA 2Q2OA 1WMEA 4EO4A 2OHOA 3UHAA 4HNAA 3VO2A 4QOGA 4Y6QA 3WYGA 1B76A 2ODBA 3LHIA 4RZIA 5D3QA 3KJQA 4QOIA 3USES 4CQJA 2LPMA 3WWOA 5IDWA 3G0CA 1DBVO 4DJEC 2EGHA 2RHWA 4LXUA 1XJWA 4HB2A 4DJ5X 3WMFA 3QIAA 3DHNA 2AI1A 4TQUS 4RXMA 3OQPA 4K7JA 5C7YA 5L3RA 5JCZA 5F1PA 4CF4A 4QOHA 1Y63A 2AJDA 2BZSA 4TMVA 2W4MA 5E8JA 1IN7A 1UMCA 3CNHA 4KYIB 3OOEA 4KIJA 4FFPA 5IH3A 3H2ZA 4KFUA 5C7LO 4PYMA 5GMOA 1DC4A 5G41A 3DLPX 5EY5B 4B17A 1O58A 3GDOA 4ENQA 3P26A 2RGBA 4G81A 1EBBA 1KJ8A 2R5NA 4N7JA 1L6RA 1UJ5A 5KOHA 2PE5A 3AHGA 3AR7A 2WJ4A 4MV9A 1KQOA 1NONA 2WZBA 4RACA 2XZDA 4HLUA 1N5OX 2JJ2A 4A16A 5KTOA 1UBGA 4IMJB 3TN7A 1L8QA 5H59A 5B1DA 1PNVA 3AXSA 5AM2A 3PSHA 3ZHXA 2IYZA 4HH0A 3QEAZ 3X1JA 5M34A 1ZMTA 2ZR7A 1ZWKA 3LOUA 2P2NA 4FT4A 5AHKA 2J9YB 4DQXA 3PFHA 3F6BX 3OIUA 4X84A 2GPSA 2PX4A 4W5OA 1YR6A 2O8DA 3AUTA 1LQTA 1AK1A 1BWPA 4YRNA 1YQWA 2DKFA 3EVEA 3ENKA 4NCXA 1NTOA 1TMKA 3GHYA 4ZT5A 2YDYA 1F7VA 2PT5A 2RCYA 3GVIA 4MKGA 5GOTA 3K70D 3HGQA 1EP2B 2PKWA 1V48A 4CKZA 1W4AA 4NEQA 1OE0A 4NMXB 1UK8A 3E0QA 4B3XA 4ZMBA 2D5IA 4AO8A 1FFXA 1NUAA 1YJ5A 4QXMA 5K8UA 4WLVA 1OT5A 1T0HB 2YINC 3JR7A 4NKRA 4DYHA 5HA5A 3OKAA 1JX6A 3THXB 3NAMA 4YRCA 2OBYA 1MVLA 1MJGA 1O4VA 1REQA 2PL1A 1T5DX 1N0VC 4GUDA 2VCHA 4P58A 1EGHA 3UJHA 3DV9A 5KTPA 1GG5A 1G6OA 2QN6A 1F3LA 1N2XA 1QYVA 1GG2A 3RIXA 2XLCA 3AEXA 3S3TA 3AF5A 5C5IA 1C3VA 1CULC 3AY0A 1KFKB 3J81k 4B74A 3KJNA 5CG2A 4N8EA 3OZTA 2JLYA 4Y2RA 4ZC8A 1LK7A 1NA5A 1YCHA 5E0OA 3M9LA 5AM4A 3VAYA 3W5JA 1Y33E 1V8OA 2GM9A 3CCFA 1P7YA 2OORC 2MSNA 2ZT5A 3EGOA 1CDEA 3MRSA 2JANA 2QV0A 1YA8A 1HLDA 4PGAA 4B6PA 4H4EA 2RHLA 4N3CA 5K3OA 4LYDA 3O92A 4D0NA 3QFSA 3OPXA 5JQGF 1YRWA 2I4NA 3LX5A 3JASA 1S2NA 3I9FA 1BHQ1 3JPYA 4OQYA 1CQXA 2OECA 3UWOA 2EW1A 1PX2A 2YWHA 3OPVA 3H11A 4GXNA 4BCCA 1PS0A 4EY7A 1UC4B 1VB5A 4MKZA 2EBHX 3OOSA 2JI4A 4MUAA 2X8BA 1ULTA 4RPLA 4UNQA 3BG5A 5B7PA 3FYHA 1NP7A 2XH8A 3H19A 3IMEA 1PL7A 4IDFA 3MJ4A 3WWZA 1Z2OX 4ZOEA 3UANA 1YI8A 3SIWA 2VJAA 3HCFA 2D6FA 1EDBA 3CUSA 3I04M 3B6EA 3CU5A 3GH3A 5BMOA 2PMWB 1QIDA 2W2TA 3HDHA 1PI3A 4JZKA 1SCQA 3LLVA 1ZI9A 1F5SA 4HJXA 4JAVC 3HB7A 1EAYA 2FZ4A 3MJVA 1GGNA 4JLVA 4LE1A 4JH0A 4N49A 1MU0A 3A0UA 4OKNA 4ER6A 2DGDA 3T5CA 1N9ZA 3BB3A 1EWKA 4EYEA 1FVXA 1UBMS 3H5TA 4EARA 2XCLA 2IU4A 4G5QA 4RVFA 5J9FA 4QPNA 3TGPA 4EX6A 2E18A 2OENG 3TNDA 1V25A 1XIVA 4TV9A 1GARA 5C4MA 2FR8C 2I9KA 4DQ0A 4XFKA 3F49S 4IZIA 5KJ6A 4KX3A 3VPXA 4IHQA 1DWQA 3LCUA 2L42A 3NBMA 4L75A 2G8LA 3MD9A 4Z7OB 1EZZA 3NTOA 1XAIA 3L7YA 4QNNA 1N9GB 1BW9A 3CG0A 3D8HA 3FNRA 3HL0A 4UNIA 1C4OA 1KRHA 1A2KC 2PSFA 1JEQA 1QQ6A 2W8BA 3QW4B 4RQUA 4OU4A 3P9RA 3HYTA 1K8ZB 4DN6A 3JQRA 2VJKA 3DO8A 3F7OA 3GRZA 4RETA 3Q3HA 4A03A 3GBPA 5KOIA 2JLUA 1GQRA 1JKIA 4DCJA 4ZYWA 2H06A 4IGEA 2J0UB 5K3SA 4V02A 5EJEA 3UMBA 3PFFA 4DIKA 5K8IA 1BU8A 4W7HA 5LFAA 2JIPA 2SHKA 5EHQA 5EJ9A 2RKWA 4U00A 2D5AA 1EESA 1YS7A 3NR2A 2JH9A 1ZNZA 4R4JA 4EGQA 2QRQA 1GAEO 3KALA 3RIGA 2CNOA 2O8EA 1TT7A 3RYCA 3Q3EA 3HKBA 1J2YA 3OM8A 5BUSA 4MJXA 5JSKA 2GD0A 5KSOA 4QU9A 2RHBA 2H7CA 4F4JA 5CXUA 3H99A 2V3WA 3EZFA 1QH9A 2IX9A 2E4VA 2A0YA 3MTGA 3JD1A 3FFTA 4M83A 1IQUA 4BE9A 4J7XA 4DR5B 3U44B 2IS6A 1NBOA 1WXIA 1E3EA 4RY2A 5EP2A 2D5BA 4BLPA 1H1TA 2A86A 5A3SA 1NRXA 2BEJA 2GNPA 2H5IA 2HSEA 1U7ZA 4CU2A 1GZ3A 3E8XA 1HLFA 3MM4A 3LIIA 4NCJA 4E13A 5A7FA 1JHUA 1PUJA 5TF4A 1OC4A 2D1YA 2WIGA 5D3MA 2FZVA 3X2SA 1Y8QB 3ZVRA 3GJ4A 3TL6A 3BERA 3QY0A 3TSYA 5K05A 4FHGA 3B51X 1I3NA 1Q1NA 1IK6A 1T2DA 4G0ZA 4ND3A 3MWEB 1ZM4A 3C7AA 1WMBA 4EY6A 1X14A 2ZQYA 1E61A 5HDBB 5KYYB 1FVHA 5EZ6B 4D4MA 4YAUA 4CXMA 1GAWA 5A6VA 1NM5C 2YHIA 5JQGB 1SNYA 1Z0KA 2BF7A 3FPBA 2EERA 3NW9A 1L2TA 3CCCA 4RF4A 1N1EA 5FOVA 2BFOA 1W4RA 2BFMA 1NHWA 3OTOB 1KAEA 3HA2A 1DX9A 4YCBA 5C32A 2J9FB 5H7XA 1SCNE 3DZGA 3ZJYA 5A0TA 3ASVA 4QUAA 2C4HA 3LXUX 4GMXA 1CUFA 3UMVA 1R4NA 5MN4A 1ZVMA 2G9VA 4IOLA 1X80A 5B6PA 2P6UA 4E6EA 1HE2A 2FG7C 2FMHA 4K6GA 5HEKA 3RG8A 2B30A 4WACA 4M0FA 2YV5A 4R2HA 5KNBH 1ISFA 3S8EA 1WCYA 4F9EA 2LTAA 2PQ6A 5J4KA 3KLBA 4OUKX 2ZUVA 4Z4GA 2XYGA 1ZCJA 4J7CA 2A1TR 4FHCA 5FKJA 5FTJA 2GDZA 2P75A 1VBMA 3FCAA 4ZEXA 3UT5B 3USZA 4DNOA 1O4WA 3SDSA 3VX3A 3QU9A 2JARA 1QLJA 1XWIA 1P81A 2I7CA 1E0SA 2W48A 3H2KA 3U2QA 2F8MA 3ROGA 1A5TA 3LDHA 5KCZA 4HRXA 4DUGD 1FMTA 1N2SA 3M6XA 1AGYA 4G0QA 2IHNA 4INAA 2LR0A 1FUUA 3QVUA 4N3BA 3MWKA 1MJNA 2BHLA 3H17A 4RA9A 1N33B 1K6EA 3E23A 4RNCA 1UAYA 5JAQA 2ZCJA 3NBUA 4UM9B 3OLZA 3C74A 2EJUA 3O8QB 4KUGA 2PJRA 4F86A 2R79A 2WJPA 1DARA 3PL1A 4HQNA 4OJMX 1CIPA 4YP1A 3G6WA 1G4HA 5BXYA 1TTTA 4UU1A 3AERB 1RQNA 3CW9A 4BN5A 2AG6A 3KD3A 4OH1A 1I4TD 1HYHA 3PHGA 4I4IA 1H4VB 4WAUA 3VC1A 1KS2A 1SZDA 1ZUNA 4NCKA 4WK0B 1RYFA 3D3QA 2VK8A 2JFWA 2BGTA 3LX6A 4HK4A 5CJJA 2J0EA 4ESVA 1FW6A 3A1UA 5JSFA 3BN3A 4FE7A 3VR2D 3T7RA 3IQDB 4IHJF 4ZRMA 2H2WA 4UMDA 1XTQA 1DRKA 1T1SA 1FDSA 4V0RA 3O47A 4AMBA 1UM8A 1PZFA 2E1PA 4HYTA 5EGNA 3GGCA 1ZL0A 3G2MA 1H6BA 5KWSA 4FOTA 2HA0A 2NM0A 5MN6A 3KJIA 4OQQA 4Q15A 1ABFA 1SUFA 4RMJA 2Z9DA 4I0WB 3TQHA 3ODGA 3TIXB 3TTTA 4Q16A 3TL3A 1JYSA 2FN8A 4LY9A 2FW0A 4LECA 1FQWA 4FR0A 5JD3A 4BP8A 4ZK2A 2A3RA 5CXQA 2HYDA 4U7GA 2Y1LA 3IJRA 4EJSB 2HCRA 4QODA 1FJGB 1PBNA 1R0XA 5FPTA 3VNVA 1L5YA 4ZYLA 3Q2OA 4R7GA 1DQZA 2FG5A 3GLHB 1YE5A 4O2LA 3SZRA 1SWWA 3SE7A 2VDQB 2JLWA 1MPTA 3DMDA 3LHDA 4JVSB 4Q05A 2V7QA 3HRKA 3P2KA 5DHTA 4ZVOA 1TGYA 1WXEA 2IPAB 4ABYA 4KR9A 3PFIA 4ZV7A 4R16A 1UWKA 5FLKA 3K8OE 2D0DA 1Z4IA 1JR2A 3NBFA 5FUMA 2HLNA 3UHJA 1FDIA 1KMQA 3MB8A 4H0CA 1XTTA 2YFQA 3AR5A 4RH1A 1PZEA 2B5WA 4QPJC 2G5PA 4J0GA 5M3BA 1NI3A 2C92A 4YDSA 5BSTA 2Q0HA 1IG0A 2PAAA 2ZEJA 3C7DB 3G5MA 1MA0A 3K5PA 1KC1A 2FSHA 3N0TA 5IW8A 4D4HA 3GCWA 2F3QA 2E4YA 4HO1X 4IH1A 3S2UA 1F6BA 2W0MA 2VDOB 2CJPA 3Q3VA 1TQHA 2H0AA 2V7GA 4HS4A 4KODA 5AUOB 5H9WA 4L2IB 5I51A 2DR2A 1NT2A 4KO1S 4BFVA 4YT2A 5KNCA 2HRQA 1PQWA 3K0EA 5DK4A 5DN6A 2LCFA 3V2HA 3STWA 4GMHA 3PA6A 1FFCA 4RTRA 3NIGB 5AK6A 1HE3A 2XXAB 4E2FA 4ZYYA 1GCUA 1ISSA 1C4KA 1RQ2A 1FSFA 1JF8A 4FMCF 3R76A 3TSCA 3ZE2B 1G7CA 4IXMA 2QQ0A 4R84A 5I8ZA 1H2BA 1NNLA 3ZY5A 1XRJA 1PGOA 1PG2A 5DRTA 2JFBA 4AJNA 2IYQA 2W37A 1BGXT 1UMBA 4KC0A 2A58A 3W8NA 4ARSA 1PV2A 1QGUB 2RG7A 4D97A 3I6IA 3PJEA 1GZ6A 3ZWNA 3LKZA 5F2OA 3BZBA 2YVLA 3I2YX 5DWVA 5TPWB 1VI6A 1U2GC 4FYPA 1NNI1 2BDUA 1T3LA 1T0BA 4IVRA 1NUHA 3RVOA 1K7FB 3CVUA 3MWFA 3ZCTA 1NAIA 1Z75A 1XMOB 1EK6A 4ZWNA 4ZDJA 4IIHA 2GD1O 2BY4A 2AF4C 3IODA 1PE0A 3KQVA 5LQJA 5JDIC 1LSSA 3R7FA 1CETA 4GL4A 2EWVA 5EKUA 5KTKA 1GR1A 1E4VA 1SR8A 1JSLA 1XUOA 2OBMA 5M2QA 1RRGA 2P6OA 4C7JA 2JBWA 4A2PA 4YT4A 1KAMA 2VC2B 1WUYA 2WTAA 3FMOB 4FW9A 1OGYA 3FBTA 3GJ8A 4HMPA 3ZHYA 3FI9A 5G0UA 3V7NA 2HHAA 5H4GA 5KNCH 1FL9A 3WRXC 5E1OA 3AJ9A 4YCDA 1ICEA 4JROA 1XCOA 1W1IA 2Q2QA 3P4XA 4IDNA 4K8RB 4QXAA 4QXRA 1RXWA 1JILA 3KJHA 4WJZA 5H70A 4YAKA 5HNKA 1FU8A 2X6QA 3IP1A 4WFKA 5AOVA 1ZNXA 4IHJB 5DN9A 2VTDA 3OQBA 2H4YA 3AVPA 1KYQA 3HPRA 2GN9A 3LUAA 2YJ4A 3NC1C 3OLXA 1RT9A 3R5XA 1IVNA 3KV1A 2QD3A 1OJLA 1GSOA 3Q7EA 4K6HA 3LY9A 1MO5A 4MAFA 3U3OA 1KXZA 4KLNA 2VJOA 3L7IA 4AQDA 3QQPA 3TIVA 2I4LA 3GEPA 2VAMA 3DOEA 4PSCA 5JAZA 3STXA 1ZEJA 1JDBB 2GSWA 2RHMA 3BRWA 4QSMA 3EXHA 4CPDA 4EW3A 1M83A 3OKCA 2COKA 3WNDA 2GLTA 5CA1A 1A4UA 5K01A 1KQGA 3T4UA 4KZKA 4CF7A 3GLVA 4C7MA 3W5UA 4PC6A 2EIXA 4PX5A 1D5WA 1MB2A 1X0VA 2FAXA 1P3JA 2GAFA 1RRVA 4TSKA 1XEXB 4UM8B 5HQTA 1WDLA 2C9YA 3SSMA 2C54A 4EEZA 1C80A 4LDAA 4S05A 3Q9NA 3D6UA 4Y8VA 3F2IA 3OQJA 5KVCA 2WB2A 3FPFA 4TLMB 1B1CA 4HFRA 2AJLI 4ZC1A 4RTJA 2CV0A 2OAQ1 1QCZA 3VNRA 4IJMA 1LPAB 1OFVA 3HJUA 3QP9A 4QDUA 3KQTA 3NHSA 1RKVA 1PJRA 4LZWA 2PX8A 3VU9A 2FPGB 4QBFA 4YYZA 5EKTA 1X39A 4V38A 2FKNA 3TZKA 1YR3A 2BKVA 1ZYUA 1L4YA 3OLCX 4RWEA 4JN6B 2BFEB 2BHSA 3BMNB 1HDYA 4URWR 5IJ0B 4FP9A 1VBNA 1XK7A 2REOA 1HT1E 4R2XA 3DF7A 4FLEA 4UW9A 2Q7XA 3EOBI 3PIIA 1EGAA 4XUCA 4G23A 5CT6A 4DM4A 3H5WA 5DE3A 4KRFA 1E6KA 2XMBA 3VZCA 3GVPA 2WNSA 4MV0A 1S2OA 2PLFA 4G41A 3WLKX 1TA9A 4BJ3A 2YV4A 3KXLA 3QKTA 3H9UA 5SY4A 2NXCA 2V3CC 1G8KA 1YBMA 2IDJA 1CT9A 5F33A 2UVPA 5TGDA 1P8AA 2LDXA 2V6JA 4FMCB 1OLXA 2H1CA 5B53A 3T0IA 5DXAA 4CR6A 4C9BA 3GBSA 4KJXA 1Y7TA 1EGQA 2XITA 5AW8A 4HNHA 1DG1G 1UQUA 4OF4A 3ZXSA 1SFRA 5HHTA 2VN8A 2DFNA 4Z0NA 3B8HA 1IB6A 3ZV5A 2IOFK 4CM9A 1KQNA 2O5RA 1AOXA 5DP1A 5ECGC 2BFFB 3DBVO 3ZNPA 1N36B 1VOTA 3BL6A 5JH7A 1Z74A 1APBA 3K70C 4E5YA 4EI7A 1N8SA 1QSGA 3IKVA 4TQAA 3VKGA 3E5RA 3TAHA 5IDQA 4LHZA 2CV2A 1M6WA 4U2FA 3KLPX 1E0DA 1M0TA 1EA5A 1T4BA 4RC9A 2CD7A 3FVQA 1OC2A 1H6DA 2WHPB 1T5BA 3K0FB 4JSRA 1PQYA 3ILHA 1TU3A 2IP2A 4RJLA 1G18A 4FYKA 4MO2A 5BY2A 2ZVPX 3A70A 4LJ4A 5IJZA 4ENTA 4ND7A 1TADA 2QLNA 3H9JA 3O38A 4UUAA 3RVPA 4A0HA 1UKAA 2DT5A 1F2UB 3TI7A 4UBNA 1VSVA 3ZN2A 2GN2A 2QVBA 3ZXYA 1DBRA 3EUFA 1GPAA 3COVA 3GCGA 4G36A 4WX2B 2R84A 3TQRA 3IAEA 3O1IC 3IT1A 2NO1A 3MSCA 3ZDZB 4BO1A 1JSZA 1OH8A 3GRCA 4LJ8A 2KYRA 2I7DA 1ZLYA 2NXJA 4UFOA 1P80A 1HRDA 3IVRA 1SHTX 5JCOA 2ZRQA 1A4IA 4KPFC 2P9HA 5CH5A 3T3GA 5KYXB 4K28A 4PQRA 4DNQA 2FX2A 4I1VA 1Z6YA 4IIBA 3SGLA 3PEFA 5E7QA 3U4HA 4A1FA 4BZWA 3NGXA 2XGOA 2GYWA 4CM6A 2REBA 4Y98A 3HH8A 5ALFA 3CUEF 3U31A 5KTSA 3MTBA 1SC6A 4LA4A 5FRDA 3ANTA 4K46A 1WVGA 3PNYA 1JPJA 2Y1WA 4RVGA 5ER6A 3A9RA 4ZU6X 2IIVA 3MQ2A 1CV2A 3C16C 4AVYA 1EP3B 2RGCA 2QVCA 1D8TA 3H2IA 5ALGA 2QD5A 1VLQA 3TTYA 3OD1A 4GKKB 5JJKA 2I65A 4R9UC 2IGTA 5BWMA 1KYIA 2G4CA 4HUQA 1U0GA 4XFJA 2D1SA 4RVSA 2UZ0A 3F6YA 2DC1A 3QXSA 1Z7EA 1NUUA 5H3HA 2P2CA 2QE7D 1YR8A 1G8GA 1W48A 3G2OA 2AK3A 1C0KA 3PRYA 1G8FA 3STHA 2DHDA 4NCIA 4B2YA 4U2KA 1KEEB 4R1UA 4RTQA 3JAMA 3AKEA 2FEOA 4F84A 2WHQA 5HCUA 1XX6A 1YKGA 4JNCA 4MINA 4PNHA 4DM7A 3O8NA 4K9NA 5FBVB 1HSOA 7AT1A 3C43A 3JRXA 3QZUA 4LV6A 5CNIA 3MK31 4Q9IA 2JFNA 3IQEA 2W2KA 4OL0A 4JL5A 4LYGA 4H3SA 3FG9A 2Z6VA 1J5XA 1U8CB 3W0LB 2IS2A 4CMIA 1SZCA 1VECA 1L5WA 3A6EA 4OXXA 2QUBA 3T7CA 3WGIA 4D99A 1R0LA 1AG9A 3PFCA 4JUAA 3D8UA 2YVQA 1B1AA 2QPOA 1G2OA 1T4GA 1HV8A 2RH4A 1XRSB 3FYUB 4KWEA 5ARCA 2CUNA 4MGEA 4FWBA 5LP6B 1TO6A 3M6VA 3L0OA 3LA6A 1RIFA 3U3MA 5GZ1A 1Z08A 3LDFA 5JNWA 1P7WA 1BMTA 3LUJA 2G5TA 3OEHA 3Q85A 5DNVA 2O2HA 3DO5A 3T9DA 3B78A 2AVNA 2Y9PB 2PWBA 1NNSA 2FLWA 2OLEA 4XIFA 4A6PA 4KE6A 1HSZA 4O8ZA 4ZJPA 1F38A 1Q6YA 2W2VA 3C1TA 1L4FA 4ND8A 1E98A 5IVKA 3OJFA 1YRAA 2WPDA 3FDZA 3QE9Y 4LOLA 3OX2A 3M1LA 4HFJA 1AUPA 3PENA 2XB2A 1M8JA 1YB2A 1QVWA 1AO3A 2Z5GA 1YRHA 2PRKA 4GDFA 1WZIA 1QB8A 3JSXA 1RPAA 3KPYA 3DWFA 4JR1A 4B6JA 3GRFA 2OD2A 2YXLA 3UOAB 3NYQA 3CUVA 5TT1A 1EK1A 4CEJA 3ZTWA 2EYQA 3I9OA 4MRMB 3IALA 5JCJA 1NE2A 1YK1A 2AOWA 2FETA 2R47A 2V74B 4DPMA 4MW4A 3CWZA 4BFLA 4UEWA 1HOXA 2DZDA 5LU9A 1YHZA 3SSOA 3GAAA 2C82A 2PX3A 1EEHA 1XMIA 2I6SA 4GKBA 4L9WA 2AZ4A 1HEUA 1IWPB 1NVEA 3RROA 5C8DA 3DAHA 5IYZB 5LZ7A 4AY5A 3PX7A 1A5BB 1GZ5A 3EDOA 2NU9A 3PITA 1MVNA 3N8DA 4HMOA 2QL5A 1IJFA 4WN9B 3SDBA 3U3DA 1OWNA 1CNFA 3Q0IA 3RV4A 5C1OA 3VPAA 2WDZA 3GX1A 2YWJA 2R7AA 1Q16A 3D2LA 4CWAA 1RHQA 2BI8A 2NTNA 1ZM7A 2C88A 3RSHA 5FTLA 3TOCA 1WXGA 1KFBB 3W5AA 4IZHA 4LHXA 4NNJA 1Q3TA 2N9UA 3VTFA 3DKRA 1L5OA 3EIWA 5KPJA 2J85A 4HLNA 3JYQA 4ZJZA 2ZJ6A 1SBTA 1AB6A 3O82A 5B1SA 2OC9A 2VJMB 5AHXA 3MNFA 4H08A 4HBGA 5HK8A 4BMOB 1TKCA 3UAZA 2RGAA 4UE2A 1JH8A 4RHXA 4B85A 1NY6A 2B35A 1KHHA 5ES4B 4DZRA 1H3EA 4GL2A 2QTLA 1AE1A 5FLEX 1S2GA 4ZAFA 1ICIA 1E7SA 1QTRA 3TZHA 2F9FA 1PFWA 3PGA1 4GOMD 4O59O 4RDIA 5DCUA 4MV3A 1OB5A 3LIPA 1EFDN 5ENZA 3S44A 3W77A 3TTUA 1AS3A 2FEAA 4A0RA 2BIFA 3CT6A 1R6UA 3LL7A 5I9MA 2GZMA 3EBOA 1P18A 1RW4A 1TPZA 1XQ9A 5H3CA 1F14A 1TRKA 2O0KA 5EUCA 5FOSA 5TPZA 1E69A 4UBJA 2EW8A 4ZVVA 1B8PA 1LPMA 4TTVA 1IOWA 1KZ9A 1YUNA 2ZSFA 2FSGA 1Q0SA 2HC9A 2VA9A 3I9KA 2DU8A 4PZDA 4RXTA 3O3NB 1NLFA 5K3EA 5K99A 5J3JA 2VLIA 1COWA 3RKSA 3KDSE 3C85A 2ZOSA 1UM9B 3O84A 3P9YA 3JWHA 1JS1X 4FS8A 3S2IA 1MJ5A 3HI6A 2IYUA 1J90A 1WZCA 3TR6A 2DKOA 4RA6A 3IHTA 2XD9A 2ZJBA 2B8JA 4D4JA 3BMCB 4UARA 4FFOA 5EIHA 2FEMA 2FEWB 4LHSA 4PINA 3LUBA 4EPXA 4L8GA 3DZJA 4LJ7A 4DR7B 3SE0A 5LZ2A 4V0QA 1N4AA 1ESNA 2IQIA 3BAFA 4IQGA 4RPGA 4KOEC 1HNXB 4C76A 4OHVA 1ODFA 3IIEA 1BTOA 3DZHA 4ZGBA 3ZCVA 4GKAA 3VPDA 1SKMA 3L8CA 2QPLA 4FQ8A 1E9CA 5EMHA 3TPZA 2HWKA 5AHRA 4X7BA 5KDDA 1XHEA 3EN0A 4BO6A 4R5HA 1AZWA 4ZVTA 3WTCA 2YHSA 1FYXA 2YN2A 3QFFA 2O2SA 3B1XA 3DP9A 3UF0A 4W7SA 1E2HA 3DE2X 1LZKA 4N9QA 3W78A 1BKDR 1ZU5A 2D7CA 2JIDA 4LK2A 4RHFA 3R7BA 2W6ID 3DYBA 3T1NA 4JEMA 2G1KA 4MV7A 1ZD1A 4YONB 1FRQA 1E92A 1U0HC 3G5LA 2ZUWA 1SXQA 5HJ7A 3DEYX 4R31A 5FBZA 4OBEA 4M0KA 4ND6A 2VPYA 1N1DA 3AWDA 3HYCA 1T35A 3C4JA 3QKUA 3OT1B 4I36A 4IICA 4O4IF 5FPYA 4BNJA 4NPHA 3TR0A 4CL0A 5DBGA 2ZAMA 5HIIA 4ZYZA 5AVOA 2G0AA 4U6NA 2WVHA 4NYJQ 3K72B 4B3CA 2H5LA 2VUUA 1CX9B 1FY2A 1R0BA 1U6KA 1XZKA 2YV1A 3B20A 3DE4X 3N8KA 4QICA 5FOTA 4PHTA 5FWXA 1VIMA 3GPBA 2GXUA 3I34X 2CXPA 1HY3A 5CH8A 5CPBA 4DSAA 3CG4A 3MAJA 5AVTA 3WGJA 3IAM6 3DE3X 3B89A 4BNLA 4N5DA 1QJCA 1X94A 1AN0A 1CUAA 3O9ZA 5EESA 3W5DA 4G84A 2OO3A 2Z5VA 1HE1C 3HYRA 4L6IA 1BDIA 1ODSA 2Q41A 5TQ0A 4GP7A 2OWDA 1FP7A 1ESZA 2Q07A 2XE7A 5DTIA 1GL9B 2MR6A 3GMTA 1NUQA 4UBKA 2VUSA 4M88A 3V6LA 1WVIA 1KY5A 4GI2A 4LF8B 3VNQA 3PPIA 5CFRA 3PQ7A 4N47A 3RSQA 1U0LA 5CT4A 3RBZA 2HXYA 2IEBA 3FJOA 4H6WA 1OAOC 1W30A 5DI3B 1BROA 1QFZA 4Q3KA 1DOHA 1FSSA 2GBLA 3WL4A 4C1NA 2HPVA 2W58A 3CT4A 5THXA 3N6XA 4ZPJA 2VHUA 3B85A 4E4TA 2IU3A 4LDJA 5C8VA 3KOUA 2AMYA 4A8TA 4G5FA 1B8OA 4OQLA 3DTNA 5EIAA 4Q9AA 1VLJA 1YZVA 4XZ3A 1LWOA 3RK4A 1RFGE 4XQCA 3VDNB 3W9UA 1CY7A 3L7AA 1YQQA 4L5CA 3H87A 4UXJA 2BKXA 2DHRA 3MINB 4QDKA 1GSAA 1OI7A 4LEIA 1DAIA 1F4LA 3M3PA 3H2BA 3TJMA 1NMZA 3ZU3A 4KR6A 5H83A 1ZQ9A 3I6YA 4FDAA 1FDWA 3GT0A 3NEPX 1CJKC 2XVYA 2BFPA 3OPNA 4XWYA 3VFDA 4JJEA 5HKAA 1MC4A 2ADOA 2YY6A 3U17A 3U3JA 2I2XB 3B3FA 2QIOA 4JT8A 3BQNB 1VE7A 5ADHA 4HUJA 1SUAA 2AF3C 2I7XA 1E9FA 3C8ZA 1RWMA 1A2BA 4OQEA 4ZQGA 3AB7A 4DSTA 4Q4DA 1ZCAA 3C3CA 3TCXB 4M9CA 4EFDA 1GAQA 2QG9A 2V8OA 3ASUA 4B7AA 1QGOA 4QFDA 2HJVA 4CDGA 5HYVA 3K2QA 3QLJA 1WB6A 2QRVA 1TF7A 3FDFA 2YZNA 3T7SA 3FTFA 3Q41A 1CUIA 2ZAGA 4WFQA 4DR2B 4Z0HO 4GOXA 3GGDA 4WZAB 3IHLA 4OP2A 2EYUA 2C2MA 3IXMA 4I9UA 3U39A 2NZYA 3CNLA 4M0PA 1OVMA 1E99A 3OAAA 3CLRC 3O26A 4Q7JB 1DIBA 2P77A 4HTAA 2G28A 4OBBA 1M1XB 3H9QA 1UQRA 3M83A 1A97A 1XHFA 5ED0A 2ZE7A 3KR9A 8ABPA 1IZ9A 2OG2A 1TIPA 3OZGA 1J6UA 1ZONA 2GEKA 1VXOA 3BGDA 3DCYA 1HMPA 5BVGB 2X7XA 3UJNA 1U9JA 1O9GA 2W2LD 2W2XA 2ERCA 3ESBA 3FNHA 3MT9A 3R0VA 4MWOA 2EFCB 4C4ZA 4D8XA 2FY8A 1T43A 2F1JA 4JLMA 1DC5A 1DT3A 2AFIB 4MRNA 1RDFA 2WY2D 5KDLA 2JHGA 3IPCA 3ZLUA 4OHCA 1PP4A 2NVOA 3UH0A 1IDN1 1XRPA 1T6NA 1PVVA 1DKLA 3ENVA 1A9XB 2BMVA 2JD2A 2ONYA 3COYA 2EJCA 4QHTA 4D1YA 1FDTA 2FK7A 4O4IB 4ZK6A 4ACBA 3S2ZA 4ZYVA 3VKUA 5BNWA 3A28A 3BBPA 3QLVA 1QK4A 1E8MA 3JQCA 4QTTB 4WKOA 5IC6A 3VOBA 2WIBA 1YHYA 3RKRA 4BNMA 2M98A 2G9ZA 1K06A 3FUUA 3UMYA 2YHBA 4IIFA 4NG5A 3W6NA 4FS3A 2D2EA 4C7BA 4CI0B 4UDXX 1QP0A 1F8YA 1G4AE 5DZSA 5FUYA 3FSRA 2O8NA 4CHGA 1GDHA 2ZUDA 4P33A 1U65A 3KXPA 1GXSA 3HCPA 3K94A 4HAZA 2EX1A 3H1BA 4N7RA 1U7XA 3TRFA 4BCDA 5JCXA 2H8KA 1QB7A 2IXEA 4D9GA 2OQVA 3ZXXA 1LJLA 4WLOA 2PX0A 3HRIA 4MVJE 2QENA 2R7KA 1E1QD 3MTJA 4ASUA 1E0AA 1VIYA 2D1QA 3UFXA 1RC1A 2QG4A 1IOVA 3PC6A 4FFSA 5KNDA 4DUYB 3D5TA 2O54A 4JCOA 5BVHB 4ZVMA 1J0EA 3FGOA 4CF6A 2QTRA 1YO6A 1POXA 2PKEA 4BXOB 4KZPA 1CJBA 1SRQA 1SU7A 4R1LA 1OFIA 2IUEA 4LXXA 3KQLA 4HNQA 2GYVA 3LFTA 2BI4A 2ETXA 1K5HA 2CV1A 1MXHA 4F92B 1N3IA 2JD0A 1WG8A 4M0CA 1BE1A 4XCXA 2FFAA 4LJAA 4TXJA 1L9KA 1FJXA 1X1BA 4FE4A 5AJTA 1E9SA 2Y6UA 2QUAA 2VF5X 1MRNA 1ZSNA 3CH5A 2OWEA 3B1WA 3HCAA 4MLCA 2B98A 3URMA 2JIBA 5EIEA 4ZOQI 1G21B 3EXIB 1ZRNA 4U0JA 3G2HA 3Q3IA 3HKEB 3N6VA 2I6GA 3PWKA 4G24A 1PIWA 3VVBA 3C8UA 4QGSA 3ICCA 3KKOA 3HBJA 2Q6TA 4IIVA 4BPRA 2WNHA 1BFDA 1DAPA 1XLWA 3NRCA 1NW7A 4QJ5A 5LQRA 2PKQO 1CDOA 4AKGA 3F6EX 4AF8A 1Y5RA 2DE0X 2KHZA 4RPJA 4UJ3A 5EVCA 4D41A 5BT9A 3F74A 4PVCA 2HHJA 1WTCA 1Q50A 1CLEA 1PYOA 4CBVA 1GQOA 4F38A 1CNMA 3RSZA 4FCWA 1YBHA 3I30X 2FOLA 1XC7A 2PUTA 5I7SA 3Q5EA 5J1SB 5IJXA 4V0NA 4AAYA 2PGDA 1KQPA 2I66A 3EXG2 2VOEA 4CT4B 4GOOD 3JWIA 1ECCA 1TEVA 5EXEA 1E6MA 2A35A 2L18A 3PC7A 1SGWA 2JFUA 4UDOA 2AKYA 3GGGA 3U7RA 2ZTSA 4I9NA 4ZIRB 5JXIA 1KYYA 3RHSA 4JL6A 1P4JA 2BCJQ 3CSDA 3UUWA 2A9PA 2O07A 4M1EA 1IAQA 3IE0A 5DGIA 3QLUA 1R9JA 2CVPA 4JLDA 2E4WA 1T8RA 1P73A 2FMXA 2FPUA 2P7IA 4EPVA 2UXDB 1U2EA 2A6PA 4LWPA 2AR0A 1DTSA 2NYUA 2D7JA 2VNJA 2ICAA 2H31A 4XWAA 3B6ZA 2O0HA 3TCNA 2Q3CA 1XLTA 3OZCA 1T1EA 1V16B 1QHSA 1LC3A 1X8XA 4Y1GA 4A8JB 4KB5A 1IZZA 1SY7A 5LJLA 2NZXA 1YU9A 2CFRA 1J33A 1YASA 2V6IA 3CRMA 3VYWA 2PPLA 3BA1A 4FGKA 5ERGB 1HZZA 3H0KA 5ALMA 2C4VA 4H9GA 3Q5DA 4LWQA 1OYOA 2P4HX 3M2TA 4FW8A 4YR7A 3EISA 3PQFA 1I3OA 4BQRA 3OM9A 4D8UA 4H7DA 4K2AA 1I1OA 1II9A 1V45E 1Z5GA 1J9GA 2EBUA 1E1DA 1Z0DA 2CFOA 1KJIA 2C0QA 2EIHA 2ROQA 5BN4A 3ID6C 4DDKA 4II7A 3LNTA 1M74A 4KWTA 1PZGA 2IH5A 2HJ9A 1M1YE 1L4UA 2A92A 3PA8A 4UHEA 3VM6A 3W4IA 1EFLA 1FS5A 1I4LD 2OCAA 3CNQS 2BFBB 3OT5A 4LRYA 4D6PA 4EB6A 1R15A 1U3VA 2IYXA 4HNTA 5JXHA 1KY3A 2XHEA 1YT5A 2ID8A 3FYDA 4Q7EA 2GCOB 1NVGA 2P9JA 4KNVA 3F78A 3RHZA 3FZNA 3RU7A 3RAEC 4MDFA 4YJHA 1MGOA 4A6XA 3IR7A 1H9CA 1NYLA 2AQ8A 3ASYA 3T7EA 1I7NA 2B1IA 1KJJA 1ND5A 1U9ZA 2VZ8A 4TRMA 4YAGA 4BZPA 5LMNB 3TE6A 2J4CA 1FTQA 2PFKA 2BBOA 4KPEC 4V0OA 1AJEA 1NMQA 3RB8A 2D13A 2PX5A 2RBEA 2ZJAA 2VS1A 3NNSA 4J0JA 4M0MA 1JSRA 2Q5FA 1HEIA 4RESA 5EPOA 3RYHB 3SSNA 5JUWA 1ORDA 4AZ0A 1VRVA 3IQZA 4HY3A 2O0MA 1AMUA 2YIMA 2ZGVA 1RXCA 1JL3A 2PYZA 3DUWA 3GD7A 1Y1SA 3KTFA 3OQVA 3TFOA 1F1BA 1MJGM 1W9MA 3IUBA 2ZUFA 2XBMA 1IZ8A 1NBWB 3L1IA 1HR0B 2NTYC 2DEUA 1THZA 3KQSA 4Q9DA 4ZPXA 3BD9A 3AZQA 5J4LA 1KP9A 1N5DA 2DFKB 2MSKA 3CFYA 3E18A 4PLZA 1P0FA 3MYYA 3OEED 4M99A 2I3BA 3R7NA 3TNLA 4CIDA 2YYZA 4DC9A 4F91B 4KI7A 1GUBA 3EG9A 4QFMA 1DXHA 2CJXA 6ABPA 3D8RA 4RABA 3SKXA 1PN3A 4NBKA 4I1RA 3OWHA 4KPUA 1HETA 5U1PA 5WRFA 3TUIC 5SYAA 3VR1A 2BE9A 1KMIY 1RYNA 3NHLA 2WZCA 1U7WA 1SCDA 2CW5A 4W9NA 4L4RA 3G2IA 3D7MA 5CGZA 4EHDA 3DLBA 2ZWIA 2BSAA 1WPGA 4NF2A 2GVDC 4JXJA 2HHCA 2XMZA 3PC3A 3N9IA 2FHSA 4UBLA 1Z4QA 4FGLA 5DULA 4RSMA 3PHBE 4B8WA 1JJAA 1D03A 2WAAA 1CQIB 1G8HA 4ACAA 3BGVA 4G4JA 3ECSA 1JQ3A 3BTUA 3CR8A 4BFTA 4JI8B 2QE6A 1SM4A 2ANCA 2QMZA 5FBWB 2WIDA 2OGUA 5IK2A 1QBKC 2ZSEA 5AI0A 4U7HA 1M8GA 1CQZA 3MCAA 4EF4A 5CB0A 2YJNA 2CZGA 2FE1A 4M7OA 3W2HA 1X7GA 2FF7A 3QEOA 3FGPA 4G5OA 4CNBA 3JYOA 1L1RA 3IJPA 1YDHA 1X77A 2I67A 3LBNA 1N6RA 4YASA 1JWAB 2W11A 2XYRA 3HGMA 4GXQA 3TZEA 3V8VA 3TG2A 2G1PA 2YC4C 1J23A 1YQEA 2VDLB 5EIFA 2CL5A 1RQRA 1Z4OA 3WAKA 4BDTA 2P90A 4OUDB 4BPBA 3THSA 1M2OA 2ZB4A 4R0NA 1RPTA 2V7VA 1HPLA 2BFCA 2VHVA 1C7JA 4PYIA 2FWIA 1SUSA 3T99A 3DZDA 2IYVA 1DXQA 5JNVA 1IC6A 2YY7A 1LSJA 5DTQA 2FFBA 3S0JA 1Y4UA 1HFKA 1YZ3A 2OCDA 4IM7A 4XB1A 1OU0A 3R3XA 4EENA 2GN0A 4KO2S 3SYTA 3CJRA 1X6VA 2IYAA 1M5TA 1NP6A 5AOAA 1Q0PA 2YWGA 1ND6A 4LI3X 1FLAA 2WIKA 3LWDA 3A4NA 4NVRA 4N0QA 1SQFA 1YOVA 2OCGA 5T4HA 2PUWA 3BH0A 4B76A 4EZEA 1YDGA 1Y1PA 1UKCA 1ZGAA 1P39A 2FG6C 4B71A 1SCAA 4F1JA 4QDJA 2JHFA 3L02A 1ZGCA 2BEWB 3FI0A 4KR3A 3E7XA 3OO0A 3L6CA 2ZIVB 1U7TA 2K87A 4QJ3A 3JALA 4KQGA 3VR6A 1BG6A 4O4JB 3VHLB 5JEDA 2WICA 4XVHA 2YMQA 4NV0A 2XZTA 2C7RA 2JF0A 3U4CA 4GRIA 5JI3E 3B3AA 1VA4A 3G2NA 1O96A 1V71A 1Z29A 1NXQA 3R3JA 1G60A 2EJTA 5T7BA 2B7CA 1ECGA 2AQKA 3A1EA 2VYCA 2RH8A 3AONB 5EFZA 3I61A 4I2NA 2WYUA 4AQYB 3U09A 4U7TB 1TTHA 1FOEB 2LZ0A 1GA4A 1ZD4A 2O52A 3BXEA 5JNSA 1TYZA 1J9ZA 4XE5A 4WA8A 5DYTA 4REQB 3QOFA 5F3DA 2V1XA 4ALMA 1GTSA 3ELWA 5PGMA 1B23P 2A30A 4KYVA 4KN9S 1NF2A 4HNUA 2WP8J 3P0RA 4RIHA 3I42A 4B6QA 1GTZA 4BX8A 4PE5B 2HQ1A 3BWYA 3QKRA 2EQ5A 5DDIP 2I7TA 3QBJA 4NMLA 2XPCA 4GP6A 4PBTA 1U8UA 1PGNA 2PK3A 2PSSA 2SKDA 4HZUB 2WU0A 2I7VA 4OCZA 5EN4A 1WCIA 4N01A 2H59A 4BB9A 3GLGA 3HA7A 5K5EA 2QQGA 4DMLA 3L7BA 4W5WA 5AQEA 2VHEA 1P7PA 4JP2A 2WMDA 3MOGA 2DTXA 3TLGA 2BCEA 2VT7A 4XD7D 4XJXA 3SXUA 1P17A 2WR8A 2ZXEA 4JUBA 3D1JA 4FONA 4P3XA 2AD5A 1O03A 3LP8A 2VXCA 5BNTA 4Y7DA 5JFGA 3C4QA 4O4HA 3PKZA 1ZC3A 5IHPA 1W35A 3ADBA 3OZEA 1ETHA 2A9OA 4I08A 1F51E 4HX5A 4KN5A 1JB9A 3SOZA 3E5MA 3T5AA 3RC7A 1JTEA 3PNKA 1NW9B 3QFHA 4RV9A 4NRDA 1GNVA 1A0OA 5K6AC 3DKVA 3REQA 1W6UA 2C5AA 2TMDA 1D6NA 3EEQA 3ER6A 4L0DA 3WB2A 4EAQA 4OU5A 4GBGA 4QWWA 4BTVA 3KJXA 4Z9AA 4HQRA 4AP9A 5KVVA 3ZE7A 2J6CA 2OXEA 2Z95A 2MYPA 3Q15C 1Y6ZA 2DG2A 3QU5A 3UENA 1R0SA 2VPQA 3E22B 2V03A 4PX9A 1IM2A 4JJGA 1XTVA 4EPRA 2YV3A 3KE8A 1ORRA 1HKUA 4MR9B 5K20A 2LIPA 4I1OA 2Q3BA 1AQIA 4J91A 4BV2A 1UZLA 3I62A 4I46A 1MCZA 3UOGA 4EB8A 2GK3A 3SQLA 2FQXA 2WFAA 2LDBA 2MSWA 3DJYA 1X7XA 3L8GA 3MS7A 4V24A 2OHFA 3TLXA 2C8JA 4WBNB 3GDFA 5LKAA 4LYEA 3CYFA 1AGRA 3BDIA 4HN9A 5KSWB 3E9MA 4KQWA 3QFRA 1XL0A 1KWKA 2I54A 2W6MA 4PW0A 4EKEA 2J0QA 4N65A 1ISJA 5HPYB 4EYSA 3KQNA 2R00C 3OJEA 2QLLA 4HX9A 2GXAA 1OX5A 4JLKA 2MYTA 3QW2A 2XRZA 3KLOA 3DVAB 4R3UC 3V3KA 3ZGYA 1SKBA 2C2GA 1QQ7A 3C3KA 3FIJA 3K5HA 4FGUA 4GGPA 4B9EA 1JA1A 4DM3A 4E14A 5E6UB 4ZZ0A 5BV2P 4FZJA 4NYIQ 2C97A 4HDMB 1EVLA 2JJ2D 2Q3EA 3FFXA 1JR3E 1Z0SA 3F5DA 4TSRA 3VTAA 1SB9A 5ERXA 2FSIA 2X0FA 1P7CA 5AQ1A 3D7RA 4CQMB 4X7PA 1GZVA 5TQVA 3B7GA 1OR8A 2BHTA 1LEHA 1P33A 2G3YA 2YZMA 3DB2A 3M34A 3QPVA 5FBLB 4TL7A 1I36A 3TIGA 2J3LA 5EMNA 4IR7A 3LWBA 4CMEC 5E4JA 3QF7A 4DHWA 1QHHA 4BGEA 2A9RA 3RF6A 1TC2A 5LKRA 2QTWB 4CQLA 3G5AA 1XRMA 1DINA 4EKNB 3OMWA 2G36A 1QMPA 4OP3A 5CLFA 5ALZA 2AN9A 4NZOA 4ZT2A 2ZUTA 1U5BA 3T5TA 3WO0A 4DADA 2EW2A 4JVMA 1PFYA 3K53A 3EGXB 4LQDA 4NCHA 1GU7A 1KK3A 3W1EA 4DDHA 2ZYGA 3SZ3A 3FLMA 5FA5A 1KI6B 1QANA 2BD0A 2YJ3A 9ABPA 2C9OA 2OGSA 4KRGA 3DLIA 3QXJA 4QHSA 5G2OA 5A9RA 4RXUA 4ROSA 2Q7DA 5KX5A 2GILA 4FZ3A 4Y18A 1YZKA 2ORIA 2VH2A 2WJAA 2QRPA 3QVTA 3A3OA 1JFFB 4GPZA 4JU9A 5FJIA 1TFUA 3JVVA 1EP9A 5A9SB 3GAMA 3AI1A 4W1PA 4MDEA 5FBHA 3OE5A 1HT0A 1U4OA 2VOJA 4B35A 4DNXA 2VF8A 2IHZA 4CEIB 4DB2A 1S8FA 1UBSB 2HXSA 3KS9A 1J25A 3L01A 4MDYA 5ELLA 4BC0A 3DFFA 5U4XA 4C07A 2FDRA 3BH6A 1QFMA 4G65A 4J29A 4KLCA 1ORWA 4O0LA 3INGA 4CUJA 1KEKA 2VO1A 3ND5A 2O2DA 3KVYA 2YWEA 2R62A 2FZWA 4ADSG 4G8CA 4ZXPA 2HKIA 3K70B 1T3GA 1TD9A 1IHYA 5AI4A 1FQOA 4EG0A 2WF7A 2FFQA 3CNOA 3VVLA 3OHMA 3HUTA 3T8YA 3P0IA 1VJ0A 1CJSA 1Z47A 2Q8QA 3PUYA 4NMHA 1NULA 4UUPA 3FCOA 5HTKA 3PFNA 3SHTA 3MWJA 3CRRA 1CQPA 3DBHA 4UEOA 5KJ1A 2IXAA 4LQCA 4Z5XA 5ILQA 3M6UA 4IH9A 1II8A 2Y8EA 4Q3EA 1YAJA 1SHZA 1SQSA 1YVEI 2GFQA 3QFTA 3ZOZA 2E6KA 3P9SA 3D43A 1N5JA 2XMPA 5DNWA 1CY1A 2OD7A 1BGWA 1P6UA 5IDYA 3RJ9A 1M0WA 4EO9A 3IE1A 1USIA 1PZMA 3DMNA 4Z4IA 4PQFA 4MK4A 4WPGA 4LZJA 3L4SO 2PL9A 3GOHA 2ZI3A 3EGWA 1F06A 3JR3A 3QBTA 3SC2A 4E51A 2NYAA 5A5EA 2YJGA 3CX4A 5ES3A 3RPEA 3IUSA 3KB8A 4WLNA 3UG7A 5BYKA 5JMTA 3W6OA 5KOJA 3TGWA 1KO4A 2QW8A 3V7UA 3ZNOA 4S1NA 2JATA 2JGKA 3UK1A 1LGYA 2G0TA 4BU0A 1YQTA 2P9EA 1C81A 4E09A 1AZTA 2Q8PA 2Z0MA 4I81A 4N8SA 3EZ6A 1EB9A 2WD7A 1YJCA 4Z49A 4RTKA 5CUQA 5ALOA 2J3EA 3F4LA 1EB8A 2WWXA 1IN6A 4MR8A 1H1LB 2JIZA 3LUFA 3UTCA 4ZI5A 1HDXA 2QP9X 3N58A 1N0UA 5CU7A 5DYGA 5K3FA 3QYFA 4E0BA 2JFVA 5BN3A 3KTDA 7ADHA 4DLTA 1X7DA 2CSUA 2ECPA 3ZGNA 2OL4A 2L82A 2A94A 2IEYA 1H8EA 2WYOA 4JR0A 1YVUA 2HNKA 2NV0A 3CLTD 4MYHA 4WTOA 2REQB 3LMKA 5EZSA 3V8PA 1C3LA 3TQQA 3BL8A 1YFLA 5D6NA 4UQLA 4UTZA 4C0AC 3ZY2A 1HDRA 3VKWA 1JHOA 4DCNA 1FDRA 1QK5A 3K8YA 4FWIB 4YJDA 4E31A 1OUMA 3GI1A 4ITVA 1B6SA 3ROMA 4O33A 5IULC 1BEEA 3OHSX 1ZKMA 2X76A 2XQGA 2P7HA 1R5OA 1VYUA 4IDEA 4DQUA 3TAUA 3UG6A 2XOKA 3O7MA 2IXBA 1ZD5A 1DZIA 2J45A 3C6YA 2JJQA 3CH4B 5TQ2B 2FPXA 4U3JA 2IODA 2VJPA 2LNDA 3D1LA 3Q7PA 3BGIA 1BE0A 4IIJF 3WFZA 1CY2A 4N0MA 4MI1A 3BSYA 1QAQA 4CFYA 4MW6A 4TWRA 1K66A 2YS7A 1IJBA 4FFLA 4EEKA 1PGPA 4RELA 2PD4A 2FP4B 2YXEA 4DQKA 1LA2A 1T24A 4E5UA 4ZGWA 3KEGA 2I9PA 3D81A 4A6EA 3F9CA 2CLCX 3PT9A 4JMLA 2DYKA 3NIWA 2JGDB 5E4FA 3EEOA 1V4BA 3FZGA 4LN1A 1YR7A 1NJFA 1GGFA 3LY5A 3DMFA 4MPDA 1PLLA 4MR7A 3WL3A 4LWZA 3BTVA 4M46A 3EXFA 1W94A 2FJPA 3LO5A 4HWTA 5KTTA 2BRUC 3I72A 2WQ7A 2X2OA 2BL4A 1XCMA 2O50A 2SCUA 4KN6A 1GGMA 5LZ8A 1ZOLA 1SBZA 2ARKA 2Y0BA 3PHJA 3ZHSA 3ORSA 2RBGA 3DEJA 4URVR 3HXMA 1X1SA 5HDQA 5FIUA 4Q39A 3A3PA 2GPBA 2J6BA 2P2YA 2M6SA 2QZJA 5AHOA 5EAIA 1XL1A 2OA0A 3DLTA 1YI1A 2NOAA 4DRXA 3ONDA 1Q3KA 2JKVA 1ZD3A 1Y37A 4MDHA 5CB4F 1Z16A 4RENA 3T95A 1JYEA 4FLMA 4D6YA 1J70A 4HYYA 4POOA 5ADUS 5LQNA 4RJJA 3SY8A 5JC1A 3NC0C 3UUGA 5AW7A 3QUQA 4TTQA 3WXBA 3E7DA 4AS2A 4F72A 3NBYC 1L9XA 1ZRSA 2BGLA 4FYYA 5DOZA 4FDVA 3OQ6A 3VUFA 1MO2A 2EV9A 2BPOA 1QTNA 2Y0EA 2WHRA 2XW6A 1NVWQ 5EXXA 5F3WB 3KCNA 4JP8A 3S1LA 4XWOA 2FOIA 1YZFA 3DTTA 2PGAA 3S2SA 4RTMA 3AKZA 3LWNA 4O4LF 1YB6A 1VMDA 3EVAA 2CMGA 5FUBA 4BN4A 4UHHA 1DU4A 2GBPA 4EHHA 1W0KA 2ZDGA 4GVXA 2ET6A 4IUBS 2WU3A 2X9QA 5JJCA 5D84A 4NZMA 4ZREA 3REFA 3U56A 1PJCA 1XZCA 1LBEA 3TF5A 3C8DA 1WPQA 1BXKA 4Q5IA 5BP7A 4N0PA 4NDNE 1C30A 5LB2A 2V7EA 4KNWA 3UKOA 2Z58A 3IYLW 3BE8A 4KLRA 3HKDB 4RIGA 1HT2E 1PAUA 4CLRA 3JQAA 3NFYA 4I6JA 4N76A 1Y1LA 4MUGA 5TXGA 2OUIA 1SO8A 2EGGA 1XPJA 2YHAA 3H04A 3IEUA 2UYQA 5FQNA 2UXCB 4ZKDA 1WIWA 4KFSA 2VH1A 6YASA 5DT2A 1AA6A 4MW5A 2P0YA 4FFVA 1R4AA 4LTDA 4J07A 4XH9B 3GQVA 3INNA 1LVUA 1T9GS 4ESEA 4IRUB 5LDDC 4HVAA 4YRFA 4L27A 1C8VB 1N3YA 1NNEA 1XMJA 4II2A 4K6MA 1L5RA 5D5HA 1DKOA 4N7BA 1URPA 3HBAA 1L4LA 1X42A 4P86A 4CTKA 5B3AA 1WQ4A 2NQ2C 4HTFB 1PG0A 3NEAA 3K9WA 4Y0AA 2BGIA 4GD3Q 4JFRA 7MHTA 5A4JA 2R8XA 5ABPA 1YGPA 5DU2A 5B6IA 1K6IA 3AL3A 4M1SA 4NBLA 1XAGA 1H23A 4LF9B 5T6MA 4MIOA 4PPFA 1KJZA 2Q9UA 2R1TB 3L7JA 3IR5A 4GE3A 3QEJA 2YQ4A 1OTHA 3K2IA 1ZISA 5CAEA 2VSOA 2F3UA 3IMGA 4WLFA 3A2MA 4QREA 5EHNA 4BWGA 2J9GA 1JI0A 3T7TA 1E3WA 3LBFA 2Y99A 4IIJB 4INZA 3AHCA 4NYMR 5A4AA 1KTIA 1Y0BA 2CB0A 4MRAA 1P4RA 2K4MA 3CEPB 1TQDA 2X5OA 1IBLB 2BDEA 1DBQA 2V7QD 4OATA 1WDTA 1L5HA 3D6TB 2UYYA 4OD0A 2PLRA 3SJUA 4KVZA 4J0FA 2VNIA 2BW0A 4MYTA 5BMVB 1K7YA 2P1ZA 4YY3B 2GA9A 4E30A 3BL5A 3U40A 3P0FA 4CKCA 1KHTA 1TJYA 2GI4A 3IX7A 3U1BA 1EYZA 1NBMA 4N82A 1M2VA 4U8HA 4LJLA 2DWQA 4QBGB 3RUAA 2Y1KA 1R8QA 1G19A 5I8WA 1I51A 1QCCA 1WD5A 2J31A 4AF6A 3QEKA 3P97A 4UCWA 1XTSA 3QEBZ 4Y2TA 4IZOA 4EGFA 2C3UA 3MHTA 4IFTA 1TYAE 5GZ6A 4TKZA 5KNCD 1LU9A 3RYIA 4YMLA 2ZT8A 1T29A 3CQ9A 3SS9X 5DN6D 5F2EA 3MTAA 4GI3A 4TS4A 3ACBA 3MBIA 1QRUA 1C9NA 4GPAA 1DJQA 4QPZA 4WINA 1UXKA 2AX3A 1DAKA 4RH0A 2O23A 2YWCA 1U2SA 3DLAA 2B5VA 1V5GA 3NTVA 4QNMA 2OV2A 2XT0A 3VO1A 5BNIA 3ASZA 2DMRA 4QATA 1TM4E 2UZ1A 4G1BA 1UK9A 4ZI7F 4IFEA 1IUPA 1ZN2A 3U4QB 1XGKA 2NO9A 2XVXA 3JVUA 1UJ4A 4LDQA 1B93A 2HDHA 2WABA 1H0KA 2YYSA 4L7VA 2WE7A 1WETA 1RMQA 2HU2A 2KBEA 5MDHA 1RZVA 2ZI6A 2ZT6A 2AN1A 1CZLA 1LBHA 3KEOA 4HAOA 3M1AA 4O4LB 4Z1MA 2QUZA 3GEDA 2DY1A 1E7WA 4IUYA 4HWOA 1MZPA 4EI2A 4OTZA 4RD6A 2WWWA 5JZBA 2QA5A 1XTPA 1B15A 1B2RA 1XFAA 2QGNA 4YRJA 1P62B 4KIUA 4JY7A 4TPKA 1CXZA 3MRXA 3ZU5A 3LV8A 4JOBA 2BKEA 2J6HA 4ZO7A 5GADl 1OXVA 3I6QA 1O6ZA 1XZ8A 1ZR4A 1BX1A 3EZ2A 4I5EA 5CEFA 4XJSA 3AGQA 1UWCA 3GIDA 5K8JB 1T4DA 4G6ZA 4AN1A 2Q49A 5EMKA 3GVXA 3PC8C 4JDUA 3NVKI 1E32A 4GFDA 4BZQA 5IUJC 4ARIA 2VT6A 4BBPA 2TSYB 2QMUA 1AN9A 4AW9A 4C5AA 1ZK4A 1IAVA 3OZWA 3WG9A 4EUFA 2P0AA 3SNKA 1HC7A 1FDVA 2VBGA 4AKSA 5I9SA 4OFWA 3ZLVA 1QJ4A 5SZHB 1ST3A 1M1NA 4A0GA 4U2DA 3THOA 1FVOA 4LFAB 3NWEA 4WXPA 3OE4A 3LRPA 3EPHA 4U7FA 1NJ2A 4NBSA 4QIHA 5CFMA 3VJMA 3RE1A 3EBPA 3WJ2A 2G67A 3HC7A 4ZOLF 2HMWA 3T7IA 4BLOA 1HL3A 2FWMX 4QVGA 1C7RA 4YMTA 3BRWD 4NBWA 4GF5A 2B2NA 2HQOA 3EEFA 3NV7A 1CUXA 5DYYA 1V1MA 4OIMA 4QVIA 4S0XA 2NAFA 2FSVC 2XUPA 3IUJA 3M4YA 4I9HA 1QFJA 1AY0A 2I33A 4IIYA 1T5LA 1JLLB 1QAOA 1E7YA 1RCTE 4JDPA 2ZCVA 4D4LA 5I9LA 5U4QA 1LNQA 1KMHA 3D4OA 1GPMA 4I99A 3KL4A 4LW8A 1XU7A 3ROFA 2NU8A 1W4ZA 4A91A 3M6MD 5EJ7A 2PKCA 2O0LA 2RBKA 2NTEA 4B3JA 5D5PA 4EZIA 1X38A 2QLBA 1XV5A 3ZG6A 5ESWA 3KEQA 4Z4CA 2FZKA 4JT4A 4Y9RA 1NM5A 1Q7RA 3FWHA 3NIFB 2G25A 3GPIA 4WLUA