1PP4A

The crystal structure of rhamnogalacturonan acetylesterase in space group p3121
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
TTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVLTTTSFEGTCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnogalacturonan acetylesterase
publication title Crystal packing in two pH-dependent crystal forms of rhamnogalacturonan acetylesterase.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
total genus 81
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.1.86: Rhamnogalacturonan acetylesterase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1pp4A00
4OAOA 1WABA 1IVNA 1K7CA 1ESCA 2O14A 4K7JA 5JD3A 4RSHA 4JGGA 2Q0SA 1VJGA 3W7VA 3P94A 4PPYA 4I8IA 3KVNA 3DCIA 4S1PA 1BWPA 3DC7A 2HSJA 4Q7QA 4Q9AA 4IYJA 3MILA 3DT8A 1FXWF 2VPTA 1PP4A 4JJ4A 1FXWA 4HYQA 5BN1A 2Q0QA 4DEVA 1Z8HA 1ZMBA 1V2GA 1J00A 4HF7A 4XVHA 4K40A 4RW0A 4H08A 4K3UA 4K9SA 2WAOA 1ESEA 3SLRA 4JHLA 2APJA 1DEOA 4JKOA 4TX1A 3SKVA 3BZWA 3DT9A 5CD9A 3U37A 1BWRA 1JRLA 4JJ6A 3DT6A 3HP4A 1YZFA 5A4AA 1DEXA 3C1UA 1U8UA 3PT5A 4LHSA 4OAPA 3RJTA 1BWQA 2W9XA 1ESDA 5B5SA 2WAAA 4NRDA 4M8KA 2WABA 1VYHA 5HOEA 1ES9A
chains in the Genus database with same CATH superfamily
2H7CA 2QMEA 3HA7A 1IYZA 5KYWA 1P8AA 5FAXA 1UCFA 3GC6A 4CWAA 1JI0A 2A92A 2ECOA 3SBDA 1ESCA 4BV8A 4ABTA 4CTNA 3V48A 3RBZA 1VPVA 3O75A 1Z5VA 3ONDA 4UHBA 1UPCA 4UDXX 5GV7A 1TEVA 3C8DA 2J0EA 3T95A 5KJFA 1UT8A 3QG5A 3A3PA 2WHQA 5I7VA 2QZZA 2FRDA 3KR1A 4U02A 3U3OA 4XAQA 1YFJA 1SU8A 2W8BB 3QZUA 4UNQA 3HGQA 3EZ9A 3ONFA 3T38A 1FY2A 3OHPA 4GMHA 1QGUA 1GQ2A 1F7VA 2NZUG 2YOHA 3KRTA 2ZJ1A 1KI9A 4JVOA 2EDAA 3EAGA 4F6RB 2G09A 2Q62A 5CB4F 1XZGA 2VP0A 4QOSA 3LY5A 2AG0A 3IVXA 2QLMA 1G8GA 1LDGA 3CLTD 1F60A 4JJ8A 1H9CA 3LUKA 3ABOB 4IIYA 1AKNA 2ZPAA 3DAPA 3RVRA 1SPXA 2Q9BA 5KYGA 1F6BA 1Z33A 4WXRA 1XZJA 1RYZA 4S24A 2ZT6A 4X6UA 2PFGA 3RS3A 1XMXA 1C30A 2CDAA 2ZS7A 2QUKA 3WDLA 3CW8X 3D1VA 1W59A 3E81A 3T4PA 3EGDB 1YXMA 3BULA 3LK7A 2O3JA 2PY6A 3R6TA 1H2FA 3C43A 2DFLA 4KQJA 5EE1A 2WHPB 1GG9A 4KRGA 3UMFA 4EUHA 1QRUA 2VHYA 1NNLA 1NOJA 2WT4A 1OHHD 3I2IA 4J2HA 2CMDA 3TQSA 3DNMA 4P1ZA 5ED0A 4F5ZA 1GUZA 1I4LD 3ANMA 2CVPA 1YK0A 1OKKA 2VJDA 1NKSA 3B70A 4DADA 4JJGA 1ZH6A 4XM0A 3U9TA 3OZ7A 2XXAA 1IXRC 2Y1WA 1AMOA 1KRWA 1T6ZA 3PRJA 4LRYA 1CY2A 2VDJA 1T36A 3OOSA 5GADl 1IJBA 2HDWA 3LUDA 1E1QD 2A2ZA 1Y9ZA 1SXPA 2XWQA 5TMBA 1UBSB 2JIZD 4O2BB 2OQIA 3UAYA 5FLEX 4YRKA 2PJUA 1MVOA 3F6BX 4W9RA 1VRVA 1QH1B 3GJ3A 3MTEA 4GBED 1DPFA 1HSZA 3CF0A 5AVKA 4HDQB 1L4YA 3S5JA 4P5PA 2KS6A 3U6KA 2PSSA 2RG7A 4HLUA 2OHIA 3DT9A 2XVYA 3AHGA 1KDYA 1Q50A 2FPIA 5K2OA 2HRQA 4EG3A 4MXDA 2UYOA 2XOKA 4BVFA 4AZ3B 2B8EA 1UEXC 2PHZA 2P1RA 1NBMD 3UUFA 3MM4A 1LTHR 1LNSA 1ZCFA 1BGWA 3CMCO 4PTZA 3TM4A 1IN1A 4J0CA 1Q77A 5ARDA 1E2EA 2ISSD 3DDNA 4YAGA 2FEPA 3AFIA 3THWB 3SG0A 3DE3X 2SKDA 3GJZA 5AQ1A 4I66A 5EFZA 5MFZA 2Z09A 2I2DA 3FDJA 2JLSA 2EL9A 1NURA 1E2PA 4Q02A 3SOPA 3RG8A 1Q0SA 2WTNA 3NEYA 3P20A 5DM4A 1B0UA 3B2NA 3R6DA 2J7PD 4IMRA 1J5EB 4Z4IA 3M6VA 1EQ2A 1OD6A 1EK2A 4N7JA 4ZDJA 1YQEA 1R88A 4C0KA 2QL7A 4BPBA 5H4GA 2WG2A 3SKXA 1VZ3A 2EIHA 4HNGA 3HCFA 2EIXA 3AR9A 1QF6A 1HE2A 3QE4A 4EUEA 2BOVA 3L4SO 4JNCA 4U8GA 2EFDB 3KQYA 3OIFA 4IJQA 3WL7A 4UPEA 2UXBB 4L8LA 4TMWA 2G7ZA 3F8TA 3MTAA 2CLEB 4J0DA 3T7RA 4OV6B 2FSVA 5FNVA 1B2LA 5A4IS 3MINB 2EV9A 5CM9C 3FNQA 3EUFA 5KTTA 1IUKA 1DO2A 1ORTA 3GRAA 5EP3A 4HNUA 4KEAA 3BIWA 3RUFA 2O8EB 1RR6A 3C7KA 4IV8A 4YGXB 1YQWA 3BN3A 4JC5A 5HXAA 5BSKA 2COEA 5I51A 3IELA 4ROSA 2H29A 2XV1A 3PP8A 3HSYA 5T7BA 1KE2A 2YJNA 4WFIA 3MOGA 5H16A 1Q7CA 5DSTA 4D96A 2AL7A 2HJGA 4R1PA 4RJKA 5F1YA 2DKFA 2ZYDA 3TDKA 4YQFA 3FR7A 5JPDA 4O0LA 2VPXA 2H0AA 4F4UA 3KJEA 4KIJA 1K8ZB 4ZIRA 2Q6VA 4YXFA 4UMFA 3IQGX 1ZGZA 2QBYA 1NVVR 3UQYS 3VX3A 4B87A 2GUGA 5HYVA 3C41J 2ERYA 1TCUA 1V35A 4WOBA 1CJCA 4BLTA 2R6HA 5GVRA 3A0RB 3F7MA 4CIXA 4EYKA 2IBSA 1Z6QA 1U2QA 2O52A 3PIDA 2VLIA 4XW2A 1JT9A 1JDBB 1G21E 1GZVA 2OKCA 3CU5A 4K28A 4QRHA 2JI6A 2PR2A 4Q3KA 3AM1A 3IVAA 1J25A 2H1VA 3WBBA 1X92A 4DLRA 1GT6A 2FZ5A 3NBYC 1KKUA 5DYWA 4P31A 4JX8A 3IAS1 3TTYA 4M1MA 4MUXA 4RANA 1TKAA 2DLNA 4KE7A 3ZDCA 5J23A 4Z4QA 1HFJA 1VXRA 1PQPA 3UJ7A 4LFAB 5DHTA 3VSBA 1NF9A 3ISVA 5HTKA 4Q9HA 4DRXA 2P5UA 2JCBA 2EGUA 4LPKA 2XMGA 2ZR8A 3G0CA 2OZLB 2G67A 3WFZA 2XGSA 3D7LA 3LFUA 3FOEC 4P08A 4JSTA 3VR4D 5A4DA 3IP3A 3E05A 5LP1A 2VF5X 1SK8A 1VL0A 3G2IA 2VZ9A 1ULAA 2VA9A 3HYCA 3PG5A 3EZLA 4P5DA 4AXXA 1T25A 3SR3A 4BFSA 2CHQA 4IINA 4WWHA 4NBSA 1J56A 4WZAA 3OE7A 1SC4A 3GLGB 2CMGA 1GRRA 2PD4A 1UT6A 4N3CA 3K92A 3Q40A 4LW8A 4OSPA 2YV4A 2GJSA 1G38A 1YA8A 2HPHA 4ZZ1A 3C7CB 1DSSG 1V9CA 4X8HA 5F7OA 1LVUA 4O1IA 4C1BA 4YR7A 4UU0A 1B23P 2CXTA 1W0KD 3O26A 4C6TA 4BZWA 3FOFC 4CEJA 1OFUX 2IPMA 3A1TA 3HBLA 4D9MA 5HJ5A 3JW8A 2JLAA 4JQYA 4CGYA 4K5QA 2ZEJA 3U6BA 1GKUB 2AR7A 1NLYA 2ZR7A 1MKYA 4RL4A 3E8MA 5JZSA 5IVIA 1V37A 3SCZA 3PQ3A 4MGIR 5HJEA 4QYIB 3C1UA 5INTA 5KYWB 3OWHA 2RBEA 1TD1A 1X8LA 1U0SY 2XYRA 1XTJA 1H8EA 4ENRA 1RW4A 1V4VA 5DZSA 4DIMA 2YXDA 3F67A 1EK5A 4IJVA 1N5MA 3OQIB 2EW2A 5CBKA 2BEUA 4O4JB 4XOIA 1IXYA 4RY0A 2YQ5A 3FSGA 1NX9A 2OFOA 2W6PA 2VNAA 3P0EA 1X19A 4L5IA 2WSLA 4ENPA 1ZNYA 4HTFA 4G37A 4N82A 2JA1A 4GDMA 3NC1C 4KXXA 4M7RA 1DU4A 4E1VA 6ADHA 2C98A 1IEVA 4O2RA 5LJIA 3TFOA 3MERA 3T5DA 3AXTA 4W9NA 2G5GX 1LNZA 5THXA 1M8PA 1VYVA 2O3SA 2UZ0A 5J3JA 1OIWA 1EVKA 1UZLA 3WYAA 4X93A 4DJ5X 4YAEA 5A4KA 2PAAA 4HH4A 4BNYA 1DUVG 1MQSA 1HL7A 2YQ4A 2QTTA 1JF8A 3LKVA 1YBMA 4RTMA 3H8WA 2GEFA 2XGMA 3QU2A 4LSGA 2V6FA 4RZ2A 1K9VF 5DWVA 5K6AA 2R8ZA 2Z2XA 1M5UA 2LP4Y 2ZI4A 3LHFA 1QRSA 2AYXA 4DMUB 5EMLA 3AJ9A 3IO3A 3KQMA 1D6MA 5THQA 1NVTA 2PTHA 3VZCA 5CMLA 2IQ5A 1WSAA 4DMKA 2MHCA 2AW3A 1XAIA 4BZPA 2Q5JA 1KO5A 2GDZA 1XCMA 2BGIA 3EUEA 2H8KA 3HH8A 1J2RA 1XVAA 3ZQ4A 1FBTA 4DFDA 2BZ1A 1UOQA 5LB2A 1EUZA 1I3OA 3VPFA 3I9MA 4MSUA 2WQ7A 3DTVA 1T36B 2GHRA 3AUTA 2GZAA 1E8MA 5H83A 5K3OA 3HS3A 4I5GA 2XRZA 3QIAA 4AY5A 2R8RA 4FMDF 2FVYA 4QWWA 5A9SA 3F3MA 1EJ6A 2H2IA 1V3VA 2W6MA 4I5EA 3OY7A 2FHSA 4OSOA 1MC1A 1SCNE 5DGXA 1G64A 1XJCA 1Y1RA 4A92A 6Q21A 4S2UA 4D5EA 1J9EA 1FP7A 1U02A 3PKZA 1SHJA 4HB2A 4DR7B 4X7PA 3SDBA 2G80A 2IBMA 4G23A 1ABFA 2ZGVA 1M33A 1MABA 4G5GA 3BDIA 3P2EA 4Z8YA 1CIVA 3GBSA 4REMA 5CA1F 1XMVA 4P35A 4P9NA 4X6XA 4ZDWA 3D8HA 3EA0A 2YVLA 4MHTA 1W4BA 1NQXA 3PU6A 3PUHA 1IY1A 2HMUA 1L7PA 3E15A 4IMPA 4PZLA 2QLTA 3PUIA 3W5AA 2FMXA 4MZDA 4Z0TA 1J09A 1ECPA 3TK1A 3WQRA 1GKIA 1JQLB 2EFJA 2JK1A 2MSCB 3ROEA 1N77A 2IEGA 4ALNA 3E27A 1PWHA 1RHJA 3VISA 5EE9A 1K7FB 4FI3F 1Z29A 2W71A 4U6NA 5IHPA 2CMHA 2FR1A 4RENA 10MHA 2DWPA 4UFPA 4KFCA 1KIAA 1KEKA 1UKBA 1XNRB 5FPPA 3GELA 1L7VC 1NBWB 3FLAA 1OGIA 4Z3KA 4H7JA 3CX6A 5BNFA 3L4KA 4K2HA 1CZHA 1RWQA 3T7AA 4BMXA 5BMVF 4EGFA 1A82A 1M2KA 1GG5A 1Z5PA 1CSEE 4KH0A 2RGYA 2D1TA 2XOEA 1P0IA 1JTVA 1M1YA 1LPPA 1Y1QA 4FDLA 3GLFB 1DKLA 1UJBA 3RVLA 2FSGA 1UBTS 4FBLA 2Q4BA 2WZCA 4CL3A 4S04A 4M8LA 4EG1A 1NDHA 1AT1A 3CJRA 3FBTA 4R1MA 3V3KA 3THYB 3VUFA 2RHTA 3OFSA 1Z6GA 1MQ9A 4J29A 2XJ4A 3OP4A 2OA0A 5TEVA 1T9AA 4BP9A 1P7ZA 3OQJA 3RNLA 3WWDA 1E2MA 3TBHA 2GNOA 4GMKA 1HFWA 3RFTA 1NXSA 1KEWA 2M1XA 3ET4A 3G82C 1NRWA 2VRCA 2W6NA 3HJUA 3O92A 4KUHA 3G2MA 4NR0A 1T4DA 3VR5D 2KX7A 3N2KA 4ZIRB 4DR1B 1FP4A 3EFOA 4UM9D 5EJMA 5HQJA 4XSHA 1NUPA 4CLHA 5L9AA 5IKXA 1PR2A 4WVLA 2D54A 5JPIA 2QBYB 2G1UA 3UXMA 1J1UA 1UBLS 5B3JA 4Q05A 4XGNA 3RU2A 1K08A 5A4FS 4GPTA 1TKBA 2SCUA 1RC1A 1MXHA 1I4TD 2UZ1A 1L5HB 1NQUA 1Z4OA 4HG2A 2B7BA 3AF1A 5DYYA 1Z82A 1DAOA 4B3IA 5HCIA 4KN5A 1GFIA 2PSHA 1F20A 4IHJF 1G8JA 4E5YA 3NP9A 1FUEA 2QORA 3KWMA 4W5JA 2BEVA 2JJYA 4AYXA 4AO8A 5DKFA 1XYYA 4E94A 2NIPA 4UM7A 3IERA 4PPQA 1COWA 3BBLA 4BC0A 2W2VA 3A25A 1D9XA 1W4CA 3PWSA 1RAHA 3QOFA 2P9JA 1R0BA 5FFFA 4M38A 4NEGA 5LC1A 3W0LB 3GJTA 3W8FA 2YXPX 4K8OA 3I5UA 1QRRA 3UYLA 4LE1A 2EARA 1WZCA 2CNKA 4DRXB 2YZNA 4ZALA 1M8JA 2AG8A 3F97A 4LWOA 2Z98A 1P9OA 2XUAA 3RAFC 2XGJA 4INZA 4OYRA 3BGDA 4Y6RA 5LWHA 3N53A 1WOYA 3OD5A 4FZJA 1AX9A 1WXGA 5A05A 3RIEA 5MN4A 2VPQA 3N9IA 1YZNA 2IDMA 4LXHA 3C48A 5F7XA 1FA9A 3GVCA 3NYRA 4QSMA 3QY9A 2HBYA 1MUUA 4BMVA 3UJ6A 3QTBA 2IEDA 5B7GA 4DBLE 4WZAB 1E89A 3FFAA 3A3NA 3FZGA 1Y9JA 3MRTA 4KXYA 4N5MA 3H9EO 3DEHA 2XB9A 1GY8A 1SM4A 5EGNA 5EY5B 2HU5A 4BBPA 2G63A 1MU0A 5FWYA 2YMLA 2AZ4A 3TI9A 1KARA 2PL3A 1X1RA 2QMHA 2VTEA 4FFPA 1B73A 5FLKA 4Z2YA 2AUMA 4LJ4A 1GAWA 4GQIA 2WJYA 2ZBRA 4EG5A 2WYUA 5BUCA 1XA4A 2BE9A 1TNDA 2MYUA 3A4YA 1NBEA 4P98A 3NM5A 4RADA 5A7HA 4OOFA 1QK5A 3B52X 5FR1A 5CDUA 1V2HE 2VNHA 3HB0A 4Z8XA 4FOOA 5EJEA 4KXMA 4NE7A 3MB8A 3KQUA 3HCPA 3PQ2A 3RVQA 3KLNA 3MGCA 1PT9A 3G9XA 1QDUA 2P67A 1E92A 2DMRA 1SO8A 1U9CA 2F3QA 3DMYA 4IGIA 4JDPA 5D5HA 3VOSA 2Q9UA 1DAEA 3DQPA 3QKWA 4R1LA 4PLTA 1DOZA 1BOFA 2YDYA 2ZKIA 3I1FA 3OCCA 2NTVA 2B21A 4UBNA 4ZT6A 3EVZA 3ZU5A 1D6JA 4UASA 3FNRA 4KZKA 2NSDA 2BEUB 3ASVA 2E1RA 4YRAA 2F00A 2J41A 2WTMA 2LWIA 4U7HA 3Q5DA 3RVMA 3ZD6A 1DEXA 3QPWA 3H1TA 3M34A 5IH7A 2C5EA 1NRJB 1NW7A 3H0EA 4R1UA 4AU1A 5J4LA 3AEYA 3U39A 2H85A 2R8YA 4YBZA 2P11A 1T6XA 1M7HA 1ZIYA 5J9FA 3WGMA 1QF9A 4HVAA 4Z1MD 4YP7A 1E20A 4LQLA 4WOKA 5BYBA 1ZW6A 3QMVA 2FPXA 4LNUA 1ODKA 1YTLA 2PZGA 4OL0A 1SQ0A 1ZJYA 1HNXB 4JA0A 3CXRA 1SURA 4Y9TA 1T0UA 4M83A 1T4CA 1JN0A 1XZKA 1R6VA 2DQZA 2GA9A 2I2XB 2WM8A 3C3DA 4C07A 3I5XA 3F2IA 4TVOA 1TGYA 4BN4A 5GIPE 4RZQA 2WSMA 4DNXA 4RTPA 3FYUA 5AM3A 1DCMA 4LC9A 3TTWA 3B9RA 2O3TA 1P5ZB 1ZH8A 5KTNA 1SU4A 3PTLA 2G9RA 2ONKA 2JVIA 3DTVB 2K6GA 2HA2A 1JAXA 1RWXA 1TVMA 3MSXA 1P19A 1P2TA 5T3UA 4D43A 5A9SB 2B20A 4C2TA 3CUUA 3KZVA 3BUSA 3LQ4A 4K87A 2OVFA 4KJXA 1HE5A 4WINA 2ESRA 3H9BA 2IK8A 4HQNA 4XSVA 1XTRA 4ZQBA 4UUNA 4BZZA 1R0SA 4S2EA 3TUIC 3EW7A 2CLOB 4IXTA 2BBOA 3WGNA 1KI2A 3DQQA 4ECAA 4NY1A 3MD9A 1F7UA 3NHUA 4OU5A 5E7JA 1BXGA 3UAOA 3ELYA 2X3YA 4MV6A 2FK8A 4J2TA 1ADBA 2PUTA 1UFKA 2BFNA 2QN1A 3LWZA 1D2EA 1EH5A 1PAUA 3AEUA 3OOHA 3ZNNA 4E09A 4K9MA 1U81A 4HDMA 1KOFA 2D5BA 4IZIA 3H1PA 1H6DA 4E88A 3FSJX 1GQOA 2PCJA 2MINA 3ENQA 3OOWA 4IYRA 1NR1A 4NYIQ 3KAJA 4PFJA 1WP9A 5MGNA 4R69A 3D4IA 3O2SB 3TLGA 2AN4A 4TXLA 1RC8A 4KWEA 1D03A 4J16C 3KTFA 5HKLA 3SHTA 2W2LA 1USUA 4N0MA 3TZ6A 1GPUA 5TNXA 4F38A 2OV6A 3LLUA 3VSEA 1ECCA 5DT9A 5JUWA 2GCPA 3IUSA 3QUBA 4TKZA 2G07A 1ZGGA 5DPMA 2OMKA 1YKSA 3T7IA 4FN4A 4PANA 4WNYA 4DJTA 1KNXA 2A0XA 3TUZC 1M1YB 1X1DA 4IXMA 2XT9A 1T9BA 3CKKA 4B4OA 3ZNOA 1X86B 2N75A 5BP7A 1YAJA 1AOXA 3TL6A 1JAIA 2HLDD 5B4TA 1TECE 4DYHA 4AP9A 4E30A 5AM2A 1Y8ZA 3DT6A 1U7DA 1ZWLA 5KSYA 4H7KA 4LJ7A 4MR7A 5E4TA 2NNWB 2DHCA 5EIOA 3H83A 1P73A 3QEMA 4ZOLA 1R8XA 1NQAO 1FU4A 4RVHA 1O57A 4GPBA 3T1HB 1T3GA 3FPBA 4AQDA 4WIAA 2GN2A 3N2KB 5B58T 1JG7A 1FP4B 3ZZNA 3EFOB 4L7QA 1U8TA 1WUJS 4UULA 1TB4A 3FDIA 1H0RA 3IP7A 3BXEA 3USZA 2HMTA 2EJWA 5D6NA 3V33A 1DE0A 2NZXA 1GCAA 1QYCA 2QB5A 3M6IA 3H04A 3QE2A 2OUIA 1GYPA 2VYQA 4MW1A 1SEVA 1OY1A 1JIKA 2UZ1B 2EQ5A 2HA6A 5C7LO 3DAFA 4LVCA 4JSRA 3K0FA 2FPUA 4PXAA 2VRNA 3ODPA 5JJLA 2FXIA 1MB4A 1I30A 4FFWA 4EYEA 4LDZA 4PU0A 1KL7A 4YRIA 2CEAA 2WYOA 1ZAYA 2IHVA 2BEVB 2CKMA 1UBOS 3DFFA 4GPIB 3ZZ1A 4CKYA 3HJRA 3TQOA 1EDBA 2OILA 1DIGA 5KYUB 3E9QA 4CDMA 1Z5NA 1M6EX 2EC5A 2EXXA 3AEQA 1V47A 5D7BA 3W5UA 1Z4QA 1NULA 2A5YB 4OPMA 3K1ZA 1MTOA 1QP7A 4DA6A 4C0WA 1GRVA 1DMRA 3JZMA 1ULBA 4Y67A 2FP3A 3SZMA 2WU1A 3V1MA 2C7PA 3AL3A 2Y0PA 2V58A 3DLBA 3Q7EA 4BBAA 5CG2A 2JIRA 1FRVA 1Z2AA 1B15A 1WW2A 3GJ7A 2NT3A 2O06A 3JQFC 4Q37A 3U56A 3QOWA 2FW7A 4EVQA 1SIUA 4KQEA 1N5OX 5AOCA 3BH0A 4WFQA 4EVRA 1ZJJA 2RGRA 1A9QA 2HK8A 2QUAA 2FZ4A 3GD7A 4LF8B 5T5QA 4OB6A 3ORFA 3OZWA 4GT1A 5G0VA 3MWYW 2FP4A 3ASYA 4CMEA 1CUGA 1XN1A 5FWYB 1IHXA 4JC0A 3W5CA 1YUMA 1GPKA 5FO1A 3O8NA 3THXB 3ZYZA 1QHSA 2OBYA 3DOHA 4NP6A 4G07A 2IZ1A 3WISA 5A0FA 4U7WA 2Y0CA 2QK4A 1YRLA 2F43A 3QXJA 3ESXA 3IP9A 2NO6A 4FE7A 2YY7A 1H9AA 4EJ0A 1EP3B 4RQBA 3L4JA 2J45A 1N2SA 2C4HA 2ZPUA 4RGYA 2CJWA 3QIVA 5IC4A 1X9HA 3EXFA 3RBAA 2ID4A 1UBRS 4MIOA 1N9KA 2C2MA 5E9AA 1YCHA 1YHYA 4U5XA 1WCWA 4BLUA 3ICCA 4IDNA 3KJFA 1FMFA 3L7YA 4UOZA 1ZA1A 1GCOA 2DT8A 1I0IA 4PBRA 5A7FA 4BO9A 2LVBA 1J97A 5IPFA 1GLNA 1BE0A 1NV9A 4BVLA 1U0NA 3LVBA 3U7FB 1LEHA 1GTZA 2QTZA 4ZQGA 4MROA 5IC5A 4TV8B 3ZHBA 5H68A 4BE4A 1FYXA 2PWZA 4CV2A 1NONA 1U0FA 3BZWA 2ZSUA 2H08A 3QJ5A 3DBRB 4K6CA 4QDTA 5EHQA 3RT1A 4AJLA 4EK9A 3ROXA 1BWRA 4DV4B 3AB7A 3FW1A 4LRXA 1JLLB 2Q4TA 1A0OA 3O73A 3L43A 3C70A 5FOXA 4IKEA 4HXFB 1MNAA 1Q1QA 3TX2A 2D7DA 5HRUA 1QG6A 2CXNA 1H1LA 4BBZA 2HFJA 4EB8A 4B82A 2NXCA 3L2OB 5D1HA 4NYMQ 3CM0A 3VR6H 2VDNB 3LGSA 1TM1E 4JI5B 4LNUB 1EZ1A 3FBGA 4N0PA 4FYIA 4LHYA 1NNSA 3TG2A 2VOJA 3DYVA 4W1SA 4ARIA 3AVYA 3AIMA 4RVOA 3L8DA 4UBKA 4W6ZA 4XJVA 5C1PA 3HM9A 5L3QB 2VDLB 4RZXA 4DPLA 5FULA 1C5KA 3OJ0A 3ENKA 1A8UA 1RYDA 2YZGA 3G2PA 3BWEA 1YJAA 1GLGA 1WHSA 2CL7X 5HX7A 3FYUB 4JLSA 1MOSA 4Y8VA 1U11A 1KBZA 1YRWA 1JFTA 3T9DA 4ZJUA 3CLUC 2R86A 1G4HA 3KT0A 5FIUA 1O94D 5BRAA 1P5RA 4YUXA 1FJXA 4GS5A 1C8VB 2GS9A 3N05A 1T6NA 1ZCBA 3QX9A 3ACDA 4NBUA 2OE2A 2GN9A 3O0TA 1FVXA 1LV7A 1UPAA 2ZYAA 1DAHA 4NATA 3V32A 2LNDA 2Y66A 3CG0A 5HSGA 3CUKA 1VDZA 3T35A 2BZ0A 2I4OA 3CRQA 4IVPA 1H4VB 3BXZA 3RI3A 2WU8A 2EAUA 3KOOA 3TQCA 1QFSA 1M0TA 4FFSA 1LS6A 3B9QA 1DTWA 4CDGA 1Y4DE 5AWFC 5JAOA 1D8AA 4HWKA 1O5TA 2QPTA 4R05A 1FYFA 1KEZA 3PJDA 3PENA 3H9GA 1EHCA 3UO8B 1DBVO 4AJ9A 1TUIA 2W2MA 3TLJA 2DQ4A 4K03A 1ECLA 3P9KA 2X0IA 4ZO7A 3LBFA 4V3CA 4YRZA 3K9LA 4P54A 3F6YA 4I8IA 4FX2A 4CR7A 3AEUB 1HYGA 1JLMA 1GL3A 3LUGA 5KHLB 2HRDA 5HIMA 3NHSA 1DB3A 4TMYA 4PZPA 1E3QA 4IDCA 1QAMA 4IIFA 1H93A 4YMSA 4ZOAA 3GA5A 3W8EA 4G9BA 3VJKA 1H9BA 2OOSA 3CJQA 2XRMA 3OIVA 3JYOA 1K63A 4NPAA 1DGQA 2JW5A 3JD4A 2E21A 1QHNA 1GAQA 1QH0A 2HGSA 5CJPA 4XM1A 1YACA 2MMGA 3TLGB 4J8PA 2CLSA 4UNNA 5KMGB 1KERA 4TWZA 1JYFA 5DDIP 3E3AA 2P1DA 3KT8A 1Q0PA 4RHXA 5G1NA 5JSUA 5AO9A 2DLDA 4EKYA 4HH0A 1CULC 3OEWA 1RLOA 4IEFB 1GA6A 4Q9JA 1RRVA 2CE7A 3HB9A 3K3PA 3C24A 5I4BA 2VF2A 4GMFA 1X7HA 4DRZA 1I94B 1QIMA 2QUBA 4YLYA 5B30A 3AINA 4R0NA 1SJ9A 3ZW7A 3C6KA 4X54A 3EVGA 4KK3A 2IV3A 4XRGA 1SC9A 5CDSA 3FH0A 1K3TA 3E3NA 4MR7B 4URYR 1HKHA 2ODWA 2X14A 3QEMB 1CY7A 2W93A 4IF4A 3KZCA 4PZUA 4ZOLB 4E51A 2FN7A 4NDAA 4W7IA 4ZMRA 2DTXA 3T1OA 1Z2PX 1R0ZA 3CVVA 4NCBA 3Q41A 1NQTA 1T5OA 3CE6A 3UKOA 2MCFA 3LO8A 4HAIA 3ZS9A 4DDHA 5JCJD 1ZVMA 3UMGA 4M8IA 4XTRA 4EGAA 1SXJC 3QE9Y 3JWHA 3R8XA 3ZWDA 1SULA 1UMBB 4QOGA 4YAWA 2EP8A 2O3RA 3NYIA 2DQYA 4QPNA 4H6VA 3FWHA 1BU5A 1DINA 3DEFA 2EBHX 2Z1NA 4AKGA 3CNQS 3AHFA 1KO8A 2XBUA 3K0FB 1OFTA 1YGYA 3R5HA 3E7WA 1WXXA 3C14C 4QFDA 5FPYA 1TC2A 5JJIA 4WPGA 4DUPA 3T1VA 5C31A 3U4IA 3VAAA 1Y3IA 1UFVA 3IJRA 5AK6A 1SKYE 2C2XA 1NW6A 4ZEOA 4B3CA 4ZMSA 3AG6A 1N1GA 2GK7A 4N5DA 4GM0A 1DI0A 4LBZA 5BW5A 3AEQB 2DR2A 4R4JA 4L8GA 3DM9B 4ZJPA 1S8NA 1H1TA 4YB8A 2RHGB 3KKPA 4PICA 5EJ5A 2HCFA 2QMQA 1OXTA 3K0SA 2CNWD 2Q1XA 2SKCA 3BICA 4C4XA 3PTZA 4HFMA 4YV1A 2VO1A 1LLDA 2ZWAA 4LZOA 4GDFA 4E21A 2IH4A 1NVXQ 3H05A 3K0EA 4NU0A 3V8QA 4G1UC 1QV6A 8GPBA 4JI8B 5HBGA 4JL5A 2H1CA 4LZNA 2FX5A 1G59A 3U3ZA 3P27A 1P29A 3T12A 3UJPA 3OQNA 2M6KA 1YULA 3DKPA 1N25A 2Y92A 1J1ZA 4QPCA 4EEZA 3VAZA 4P3YA 2HV9A 2QQFA 3ENWA 5BQFA 2FP4B 4Z7NB 2HRRA 5KYXA 4KAXA 4QLAA 3E5RA 3V4PB 4E07A 3VKVA 2BI7A 4FE3A 3NZEA 2ZJAA 3MMZA 4WZ6A 3VKWA 1H6AA 3GI1A 1WMBA 1RPAA 2D5LA 3P94A 4FLMA 4PPNA 1N6HA 2HEIA 4QULA 3NVKI 1M1NA 4L0QA 1G5TA 2QUZA 3LIIA 1CIJA 4E7PA 1NWCA 1N2EA 2F43B 1XNGA 3TLZA 3DBIA 1XQ1A 1Q57A 3O4FA 1EWYA 3KYJB 4P3KA 1AZLA 4F06A 4PINA 3OECA 3KXKA 3AESA 1XTTA 3HA5A 5LCXA 3VR2D 2FZWA 4C89A 3RSLA 4MA0A 3KOMA 1VIAA 1U7PA 4M22A 3OG9A 4UTNA 1CR4A 1XDWA 5E6UA 3O7MA 1G5FA 3GYBA 3NT4A 3VR6A 3WTCA 1CY1A 5E4FA 3V00A 2ZJ7A 1W76A 1PD1A 4MYRA 3HL0A 4L76A 1K2WA 1M1UA 1P3JA 2XEDA 1JMKC 4F2GA 2DHRA 1GTG1 1NXOA 2HO4A 4DRYA 3RKSA 3W5BA 5EA2A 2ZAOA 5D84A 4E11A 2P6RA 3HRKA 4BXOA 1TTQB 1GCIA 4YFVA 1LPBB 5GJCA 3R75A 4BVKA 2X0DA 5LVAA 4W5HA 3BCHA 4G4JA 3DA8A 5T67A 3KUUA 2LD4A 4JXXA 4C21A 1P4GA 1YGPA 2R96A 1H1LB 3SSOA 2YWEA 3ZWWA 4QBGB 1DTSA 2H3EA 3QX7A 3HFGA 4B3SB 1J8MF 3BWDD 3GR6A 3RV4A 1P7CA 4HFRA 4JI0B 4DXDA 5SZIA 3OZSA 5FTKA 4O02B 2YMQA 2APJA 3LL7A 3QH4A 3U7JA 5KNDD 4H27A 2DPGA 4XEHA 1DZ3A 1WVMA 3WHKA 3I2JA 2Q3FA 2IY8A 5F78A 5IHXA 1ZHOA 5BW8A 3HSSA 5MF6A 2C7BA 1V11B 3LXMA 1TEXA 1ZJZA 2JH8A 2VT3A 3B6KA 4P3OA 3UENA 4Z2AA 4ZV4A 1QFZA 4HN9A 4H9GA 1LJLA 1E1CA 2HQ1A 4DWJA 5EXTA 3SM3A 4LXQA 3DLIA 1XZHA 1C1DA 3A37A 2PIAA 3A8TA 3HUUA 5M3BA 3ESRA 3VM6A 3M4XA 5CX4A 1FVFA 3TCKA 4UXJA 3MCUA 3WL5A 5F12A 1CUSA 2PMCA 4QUEA 4Y7CA 4IDEA 1JVBA 4A27A 2C5BA 1DADA 1VGQA 1K5HA 4PQGA 3LBHA 5IX8A 3BWMA 1R5OA 4D80A 3DFUA 2FX3A 3VPSA 1FFXA 3A6LA 4PVDA 5DNEA 2LW7A 2ZE5A 2BKLA 3IHLA 2V3WA 4G1BA 4DAEA 2H4JA 4INOA 4HNRA 2XLBA 1DTWB 1GR1A 3MHTA 3HE3A 5KWEA 4TTTS 3V9PA 3IEKA 5IAJA 5K45A 3PQ5A 1NP7A 3DOEA 2X9NA 3IB3A 1IY2A 1EP9A 5EHNA 2Z2IA 4YY3B 1LRLA 2PUDA 3AUYA 3W5IA 1OU4A 1ISRA 2J87A 1F2UA 2JDID 3Q9LA 2GM5A 3UEOA 4RVNA 1T29A 2G1PA 3S68A 5EQDA 3TH5A 3J7TA 1JDZA 5BOSA 2P69A 3A6KA 1FTYA 3ZUGA 2Z04A 1CQXA 1E0JA 1K7YA 3SF8A 3DZJA 2JH9A 3M6LA 3SZGA 2MDTA 2AN9A 4QODA 4E08A 1EK1A 1MB2A 2BKXA 3F6RA 2R85A 3OSUA 4CM9A 5CP8A 1INLA 1CXZA 4G36A 3KR9A 3O03A 3P4UA 1XYGA 1HF3A 4LHZA 4YJFA 3GDFA 1WB4A 2R66A 3H2HA 2GYUA 1ILWA 1BDHA 2K2QB 4WI1A 1N3LA 5FA5A 4AKHA 2VP6A 4J1SA 2QDXA 4Y9SA 3D8UA 4FP9A 1CQPA 4WMLA 3D81A 4FC6A 4O5AA 3H18A 1ULTA 2HHCA 4HYYA 4DW8A 4I3HA 1QPBA 4A3SA 1Q15A 2YFQA 4RFSB 4I14A 5JMWA 2NWQA 1ACLA 5K09A 3I64A 5JTUA 2YWXA 2FMTA 3FPAA 4RQUA 5BV0A 2X86A 2OHVA 2O3UA 3CRZA 3MCVA 2VAPA 4MI1A 3HADA 5CH5A 1S3IA 3DE1X 4OLHA 3IUBA 3TB4A 4S12A 2QMUA 2XZLA 3CTPA 3CVOA 1DT5A 5AUQA 4Q01A 2YNMD 2ZJ8A 4QT4A 2PX4A 2SHKA 2VKTA 3KE8A 4HF7A 5KCZA 5C7IO 2Q5EA 1SVLA 1SPBS 4P58A 4JYBA 3OF2A 3DZGA 1E2DA 1EX6A 3CURA 4LXGA 3CPJB 2PUVA 4JGBA 1ATZA 1GSIA 3CF4G 3C8UA 4AXBA 3BT7A 1DC8A 2GD1O 2Y0DA 3HJFA 2RFLA 3FUTA 1YL5A 3EZ2A 3CEMA 4M88A 4EI2A 4Q66C 3R7WB 1NAHA 1QO0D 1OC4A 4UHHA 3TRDA 3H5NA 5DP1A 4DLWA 2A0UA 1JSRA 1XU9A 1DCKA 4HCJA 5F1PA 2NZ2A 2VAMA 5EUBA 1E6CA 2OD9A 5LMUB 1B41A 3JYQA 4R2WA 1V5IA 1X8JA 2J4DA 3CRVA 3WJAA 2A0KA 4CM5A 1YZHA 3LP6A 4ZOBA 4ZHQB 1U7ZA 3KR2A 3TZCA 2OBMA 1BFUA 5FOQA 5AXCA 2O8CB 2QWXA 5AW5A 4OAQA 1DEHA 1PFWA 4TMXA 3S4YA 5KTMA 1DQPA 4JSYA 5ALKA 1KAHA 3K9WA 1NT2A 4O3MA 2R84A 3NTLA 2NO7A 1T9HA 3DM5A 4GP9A 1ZGCA 4DJEC 1KP3A 3VTZA 5LQJA 3QYPA 1OR8A 1O54A 1GZ7A 2D0DA 2Q2NA 5IARA 2QE7D 2EFCB 4J1TC 3PUWA 3FB4A 4NZNA 4KG7A 1YQUA 1Z4JA 1U6JA 2Z30A 1HZZA 2X77A 1I4WA 2RJOA 1E4YA 4CQMA 5T4FA 4GFDA 4L9WA 5GAJA 3SHVA 5IKMA 4B34A 1Z0UA 3Q10A 5CA0A 1JG6A 3REGA 1Z2OX 1DUIA 1N1DA 1ND6A 1Z73A 1YQXA 2EWWA 1T91A 1A8PA 2ORED 1J23A 1OREA 3D2BA 3KZKA 3QLEA 4JOCA 1A4XA 4O5OA 1PE0A 1ZC4A 3DKRA 3DVAB 3OEHD 2RK4A 2WIFA 1ZISA 1Y7IA 3NBZC 1REQA 1M1NB 1IU9A 1Z6ZA 1V7ZA 2AV6A 1OBCA 1NR5A 2HDOA 2JRLA 2O2XA 4MAFA 1L4HA 1Q44A 4R9VA 4ENVA 4BX8A 2NUBA 3TGLA 1XALA 4OQXA 2ECPA 2TMYA 1VG0B 5A3JA 2X23A 3SSMA 3LSYA 2HJHA 3GN2A 4RKWA 4OKSA 4PGFA 1V3TA 4ARVA 3QXHA 5E7QA 3VSCA 4OUDA 4XUGB 2ZUVA 1AKRA 3SYRA 1TZJA 3AESB 3MAGA 3NKVA 1JR3D 2D3WA 3PHGA 1AHIA 5DTJA 1WOMA 2XR1A 4DYVA 1KJNA 3B60A 2QUHA 4KQ1A 5ALYA 2P78A 1JJAA 1XLTC 3PF9A 5E6UB 4DIEA 4G0WA 2J6HA 2YWRA 1KVRA 2IP1A 3N0RA 3SZ3A 1ZU5A 2E4XA 3DMDA 3Q7PA 5CG1A 2VUUA 4DN6A 3HVRA 4XDGA 5TQ0B 1F0KA 1QZ3A 5IDQA 2IXDA 1F4PA 3VC2A 2AOUA 1BDMA 5LOVF 4MQLA 2OCLA 1TM4E 1MEOA 4KNVA 1C41A 2R11A 4G8BA 4EB3A 2GZSA 3KEQA 1Z07A 5FBWB 5LA6A 4AZ0A 2PT5A 2EHJA 1NVWQ 3SXUB 1SQ5A 3WL8A 3WFJA 3CT6A 4O4HB 4BXOB 4F97A 3RDPA 1KMCA 3EEBA 2QGNA 2R5FA 4B4DA 4KV9A 2XUZA 1U0GA 4LQ4A 5EL0A 2WYHA 2H4YA 4UDNA 3T9BA 3EMVA 1V7CA 3NC0C 4IKOA 4RA9A 2XYHA 4DY4A 5DSXA 4K6GA 6GPBA 5EXPA 3KSMA 1LPSA 2DG2A 1KXZA 3GFBA 1JU3A 4GYKA 4B4WA 5J4VA 1F38A 3E7XA 1DO8A 3PR2B 3L0SA 2FQ1A 1E1LA 3FNIA 3L41A 5JH7F 4IH1A 4MULA 3U7QB 3FJ1A 5DI9A 2XTNA 1ZSVA 5F2EA 1ISSA 1J21A 1E1CB 4YGYA 5JZOA 3H2YA 2ZZMA 1SKUA 2Z9DA 2BZSA 3CUVA 3IQXA 3KZOA 4HL6A 4TRRA 1TIKA 4IDHA 1LBIA 2R6DA 3L0OA 1OH7A 1QDLB 4MVJG 1WXFA 5CNMA 3ELDA 3UTDA 1GGFA 5HMMA 4OFWA 2CNDA 1U0RA 3PHJA 2VHVA 2PKQP 5HJ2A 3RF6A 4QGBA 4C01A 3RU7A 3P7MA 1ND5A 3CZAA 1KGDA 2VK1A 3BGOS 4FMCB 4JXJA 3Q88A 2QVBA 3FE2A 4GW3A 4NZPA 4PR0A 1I2DA 1AQJA 1FFXB 4DUGD 4LISA 1C8BA 3BHMA 3IKLA 3ZD8A 2JB9A 2QS9A 4YT4A 5M7EA 4LC1A 1ZBDA 1XTPA 2Q2VA 2WB2A 1XX6A 2WWVD 4MUIA 5DLYA 5A9TA 5JZVA 2QYTA 3RRZA 4P92A 1NF3A 1S8FA 2YJ3A 4PRKA 5DF1A 1EIWA 2GGSA 3CF6R 5CB6A 1GU0A 2MSWA 2XYGA 2GCIA 2R25B 4MVJD 2B99A 1B16A 1DWPA 1JQBA 1KY2A 2BCGY 1JQKA 2QRNA 2PGOA 3DNFA 3DWIA 2QX6A 3EXAA 3FCYA 3H6KA 4Z9BA 4NU5A 5SZKB 3UG6A 1ACMA 2UYCA 4E5SA 3Q0EA 3JQ9C 3FPJA 4UHCA 2CDCA 2OD2A 2CV0A 4NXNB 1AM4D 2HTFA 1PSZA 3PQCA 5LZ5A 5BOSB 2MU1A 4KO8A 3SF8B 2J5RA 4FN5A 5AW6A 3FYHA 2P9QA 3F5QA 2HC9A 3E9EA 4KL8S 4Y1GA 1MQ8B 4B0PA 2WU3A 3Q6IA 1DX6A 4OQEA 4JAVC 3DDWA 5BR1A 2DKNA 4RDXA 3TLBA 4B17A 5KB3A 2ZE7A 1T5LA 5A4JA 4LMRA 3F78A 1WUYA 5LD2B 4IIJB 3LDUA 3HNOA 4R54A 1M5RA 3ZTTA 2UAGA 2A88A 3ZU3A 2PA0A 3NMUF 4EQ6B 3B1VA 3PC4A 1OKKD 4FFVA 2IIVA 3IUQA 5GJVC 2JZOA 3BJIC 3U1TA 3ZWBA 3PVSA 3CGGA 1FFAA 2DWUA 4C22A 2VCHA 3UMVA 1F8XA 3E4DA 2UYYA 5FF9A 3HXKA 3QVOA 3BFJA 4FZVA 3W2EA 4KI7A 1QHHA 1T8RA 2PWPA 3S81A 3U1BA 3R7SA 5EQTA 3ZWQA 5AKJA 1FE8A 4NVRA 5I9BA 1MO2A 3UM9A 4KK4A 4FHGA 3R3VA 3WDSA 4D7AA 4IDGA 4RK4A 1P33A 3LUFA 2GPAA 1IBRA 1AKMA 4QPPA 3WK6A 5M5BA 1OIXA 3NC4A 1T5BA 2RGCA 4B83A 2DEUA 1FNDA 1CZNA 2XOKD 2ODAA 4OHPA 4FGJA 4EECA 4M1SA 5CTJA 2PRJA 5EZ6B 1XTUA 1W8DA 1GIAA 2GCOA 4RQTA 2AHOA 2IZ5A 1H4QA 2WHRA 2I03A 1AQIA 3A2MA 2A1UA 2MYPA 3AVOA 4DARA 1JKMA 5F1KA 4MTCA 2QXUA 5CGQB 2MSDB 3FHOA 4JQOA 1VIYA 4KTTE 3ICWA 4EA7A 1UEIA 3NAMA 4EI9A 4X00A 2EWVA 2IYZA 1EZZA 1AA9A 2OORA 3WLFA 3GV0A 2PMWB 3GDWA 3HEAA 4G2NA 4L1KA 2C5AA 5IZCC 2VWQA 3T94A 3LL4A 1GAJA 4JR1A 4PG8A 4EB0A 1DBSA 3NHFA 1JI3A 2VH1A 3UKJA 4MQEB 5LSAA 4HYEA 4LHWA 3W6OA 3FYTA 3LK6A 5C51B 4F12A 4DNFA 3UOAB 3VDXA 1XEWX 1WU7A 3P0JA 3KD3A 1YR6A 4KFSA 4QXQA 3P9ZA 5LL6P 3ZHOA 1EFAA 3A4LA 1SOVA 2HSDA 2XVMA 3JSAA 2V65A 4AMBA 4LQCA 3AF3A 4JJEA 1ESZA 1G7TA 2J3DA 2JCXA 4ZMBA 5ILGA 1RAEA 5DASA 2QN8A 1WV0A 4WBNA 5BN3B 2ERXA 4C6RA 4IBOA 3EH2A 2I4MA 5F76A 1NM5A 3EC2A 1K7EB 4PN3A 3BWYA 1ECJA 1NHGA 1REQB 1ZZEA 4C9BA 3I1JA 5BR4A 5JNRA 3QMPA 5LUAA 1XZBA 5AYVA 2E1PA 1OXUA 1ZQ9A 2F67A 4BGEA 1NVVQ 4ZQIA 2QAJA 4FK8A 2NO9A 1W49A 3V6MA 2VVTA 3HBAA 5BYAA 1PJLA 5AVYA 5FUXA 1MOPA 1T3HA 4GXTA 4OHWA 1X7GA 3U0BA 1KYXA 1X8XA 1IHDA 2CFOA 4OUDB 1GKLA 3PJEA 4H60A 5HUJA 1S9HA 2JFVA 1DKOA 2AJ8A 4FS3A 4OFXA 4OKIA 1JKXA 1A4RA 1AXRA 3CTMA 3FFXA 4OJTA 3U26A 4CXMA 3D8SA 3LUBA 4BNXA 4D9CA 1Z18A 4IJ5A 3TFQA 4X20B 2HMWA 3TQTA 1DIOB 5K8LA 2QV7A 4JKYA 1GWNA 2AJBA 4I4LA 3UW1A 5D5QA 1JIVA 3DPSA 1UKAA 5CRIA 4CR8A 4HGPA 3EBOA 2AOUB 1V39A 2H5JA 3QELA 3EARA 4YPOA 4JI2B 2SECE 3PVZA 5B1EA 3MA0A 2C3YA 2GCGA 2IUTA 2WWHA 4MB0A 3NYQA 2GDJA 1WDLA 1Z88A 3G23A 3ONEA 5IUJC 3NIDB 4YEDA 4N3BA 3W7VA 2QZPA 5DBOA 3DD1A 1CEQA 3UZUA 4I5FA 1Q17A 2WSSD 3DHVA 1HFEL 3R23A 4WXHA 4BMOB 2C1XA 3WLQA 1ISFA 2V7PA 4ZGWA 1BWPA 1BRMA 2O0LA 1D07A 1N2BA 4RA9B 4YMUA 2PEZA 4IQGA 4TM7A 4YHBA 2VEOA 4LBYA 3D6MA 4Q34A 3VGJA 4MQ4A 1SZJG 4KLRA 3M1AA 4IYJA 1VRWA 3HCWA 3AUAA 4U2GA 1FNMA 3UT6A 2CL0X 2BI8A 1D5CA 5EZ5A 3OTHA 1AC5A 2ZIAA 1CZLA 1SG9A 1V5GA 3AW8A 2O4CA 2O2ZA 2FNAA 3U5TA 1NUAA 3QV2A 4OGLA 3SC2A 2K87A 3SM9A 1OT5A 3VJRA 4G1FA 2D0OB 5AJXA 4MI3A 1J90A 5AJUA 4NAVA 4WUVA 1CQJA 3K35A 4L9SA 4YYZA 2R8BA 1O95C 5EKXA 4INJA 4TV9A 4XVHA 2RKBA 4CKCB 5BW4A 5IF3A 5DRTA 1R0XA 1NW8A 4NHEA 3ZDEA 5EPUA 4JL8A 1K98A 1QK4A 4MUKA 1IIBA 2ACEA 1H8ED 3GLUA 2DUNA 4A82A 4R8VA 4ZJYA 2K5UA 2O5RA 3A6JA 4F2DA 2M98A 3FRHA 1GILA 1GSOA 1JSCA 2HRBA 1PSDA 3HCEA 2GAIA 3PCTA 3R3ZA 3ND6A 3QMWA 1S5PA 1Z37A 2AI1A 2JCYA 4Q3LA 4CR6A 4PBSA 2XWJI 3GAFA 1QJ4A 1DAPA 2OCKA 3E18A 2FX2A 1QNFA 5PGMA 2IPXA 1M0WA 5FT9A 2IYXA 3V4ZA 2DY1A 2PUJA 3FLBA 4BO2A 5IF9A 2YIDA 5IUKC 5HFJA 2QMYA 4A2WA 3W04A 3Q2KA 5E3HA 1A71A 5JS2A 1YDMA 1MOQA 1R8QA 1J8QA 3ENNA 3WA6A 2PMBA 3F7NA 4NMLA 3LFTA 2ID7A 4G5FA 3WO0A 1T2EA 5CGZA 1WUKS 1PJ3A 2WPDA 1NWHA 1W8IA 3EVCA 3IC5A 1ZUNA 2I67A 3OJLA 2Z83A 1JALA 4JR0A 4WA7A 5JC8A 1F17A 2YINC 2VPIA 2G17A 5FWDA 2ZU0C 9ATCA 2H4ZA 5D3KA 3OTGA 3W79A 1H1DA 1WE2A 3UCXA 1SA0A 3E1GA 5KYYA 4IDAA 1T9DA 3RVNA 1QYWA 1TLLA 2WY2D 1WCIA 2H7YA 1LVGA 4JLWA 3RYFA 1JMYA 2HADA 4N1AA 1BMQA 1V96A 5DGHA 3OHSX 1ZCJA 1WTCA 2X19A 1EVYA 2FW9A 3QU9A 4TXJA 2HL6A 3FJOA 1NVGA 4ZVKA 2PT6A 2VJYA 1MLDA 5AH0A 4IDQA 1QHHB 3IV7A 4MHSA 4QAQA 3ZE0B 5IWAB 4IWNA 8ADHA 3NDJA 4QTYA 4D9IA 1PL6A 1VM6A 2II6A 3DO8A 5J40A 3ZH2A 4J3NA 3OVMA 1PZMA 1QTQA 1I6LA 4U8HA 1YHZA 2Z0MA 3DCNA 2YWFA 4MRVA 1LPOA 5BSUA 5I7FA 1KYWA 4UDYX 1YI0A 2GERA 2V6JA 4XPIA 2RD2A 3D6UA 3OJCA 2E18A 5EJ8A 2IS2A 1OMOA 4OMFG 3UMCA 1XRQA 2WU4A 2NACA 3DCIA 2GZRA 3CHYA 4G0MA 1X14A 2XWSA 4XWYA 4ZI7B 4RF4A 5JDCC 1CTQA 2GCOB 1QHYA 2GJKA 3CZ9A 3HMQA 3LLVA 4IIDA 1QLJA 2GCNA 2WJGA 4LDAA 4RU1A 3ZQUA 4Z3OA 1UOPA 4DNPA 3OQMA 2R6CA 5TRTA 1XIVA 2YXEA 4YRCA 4NZMA 3N58A 1QFXA 3S29A 1RCUA 2VHUA 2POQX 1BVRA 4ZRNA 3TOVA 3EN0A 4IZ6A 4F5EA 1NLFA 3G2QA 4CMIB 1Z38A 1CB7A 2XXJA 3GXBA 4A23A 1XEWY 3A26A 4TTAA 4C0SA 4BYGA 1DXQA 2BONA 1EEHA 4EFMA 1NY5A 1UFOA 2V1XA 3LLSA 5JROA 3TDNA 2Z2ZA 5BN1A 2GB4A 2WIJA 1HMPA 1X2EA 4FILA 5FPSA 3ADDA 1Y82A 3PPXA 1UXIA 2YRFA 4BP8A 3MPOA 2O1SA 1FEZA 3S6JA 2H57A 4S1NA 6AT1A 1MAUA 1KU6A 4H0FA 4O3FA 3MBOA 3EF0A 2PRSA 3D7NA 1QHIA 3ROZA 4BKRA 2QUIA 1R8YA 3EPRA 3R1IA 3OLWA 3K0AA 3TJZA 1WVGA 3KOXA 4DM3A 3CKMA 4R84A 4A8HA 3NVDA 3GAMA 5ICCA 2OPBA 2RKWA 5BWCA 1ENYA 2RK6A 5T6BA 4WBNB 1NYRA 1E8NA 5C52B 2GM3A 4BRUA 3WBKA 4E31A 4KVFA 5JTTA 5BV2P 3UHOA 5JS7A 3PC8A 1TK3A 4EGSA 1HH4A 1YWGO 4C3UA 3V1NA 3VH1A 2A5LA 1PHPA 2PJZA 4RV4A 5COAA 5DBGA 2R62A 5IM4F 1MF7A 1RT9A 1QQAA 3GHYA 3ITNA 1ABEA 4R71A 2NADA 2ZRHA 1UBMS 2VBFA 1FDUA 2EEZA 3ELWA 4RF3A 3L1UA 3UKDA 5EJ7A 1FNNA 4LY6A 1TTPB 5ICMA 1RJWA 4ZYWA 2V0CA 1NXWA 2P3LA 4FDVA 4MVJF 1GAXA 2YWBA 1HETA 1TMYA 2X58A 4RK1A 4WGGA 1IN4A 2Q5OA 3HDHA 3ZTWA 3NTOA 3MHPA 4HAXA 4JY7A 1RHRA 3K5PA 3DYIA 2C04A 4NENB 4JODA 5E3JA 1TEZA 4RTJA 4OIMA 3QELB 3NEJA 1Q3HA 1U28A 2QYHA 3CWQA 2FLKA 1L5NA 1BA3A 2YYSA 1USWA 3OPYI 3G02A 4ETMA 2V4MA 2WBLC 3KWJA 1JFFA 3CXUA 3SF0A 1E2KA 3U3DA 2ORVA 5IMSA 4A8JA 2IWHA 3VR1A 2Q49A 3K5IA 5PNTA 1KAMA 5KAPA 5TC4A 1W4LA 3ESQA 3ZNPA 4COKA 4M76B 3RR2A 2ZUEA 3T7EA 3F8WA 2PRIA 3OWOA 4BJ3A 4P7BA 4TS4A 2HX1A 3QUTA 4QUIA 2H2WA 4HEA6 1M2HA 4ZAXA 4DSZA 5EHXA 3S8EA 2HF7A 4ZCQA 4TKMA 3PWKA 2HF2A 1Q0UA 1BG6A 1MD9A 1ZCAA 3ISTA 4B9EA 5HIKA 5JDIC 1Z6YA 1O2DA 2QQEA 3PFGA 3S55A 3ZLUA 4A6PA 1UZNA 3EYAA 2ICAA 5LXTF 1W9MA 3L0YA 4UNRA 4AF6A 1ZS9A 3VHLB 5GJWC 2ZSIA 3KEMA 4UU1A 3EA5A 1G7RA 3P32A 3ZQKA 1EGHA 5J2UF 3P9SA 3EQ9A 1XK6A 3CX8A 3LU1A 1H85A 4L2IA 3EXEA 3KCNA 1Y1PA 2G8NA 3WRXC 3GEBA 5FH9A 2GX6A 1CQJB 4ZQFA 4X1KA 3BKWA 4TV9B 2PKEA 4LKRA 3TOSA 3I6YA 3D3EA 4U4AA 1I1NA 3NETA 2IEYA 2Z5GA 3NXSA 4P53A 1KZ4A 3O6VA 4FD2A 3VO1A 4BMCA 5JT1A 3OZDA 3QEOA 3THOA 1BN6A 2JATA 3BQNB 1XRRA 3GLIA 3LFHA 1IHUA 5LP6F 5G1OA 3REFA 4ADSG 4BUJA 4K6OA 3U4CA 5AOAA 1P1KA 1RKVA 1JUDA 1CW2B 1EWVA 1P4RA 3FGNA 4EW2A 4F3CA 3OUZA 4NBRA 4UATA 2QEQA 1LWOA 4FYMA 3S2GA 1VPWA 3B51X 2WP8J 5KYNA 3LCRA 3PFHA 4C14A 3E4CA 4JI3B 1MG5A 2HA4A 2E7ZA 1RHQA 4H6XA 4PHHA 3U19A 3NCHA 3RE1A 3M4NA 3IAXA 4GUAA 4QOJA 1ICIA 1MC5A 1QZUA 3FG9A 4RVSA 2EQAA 1N6IA 2RHMA 1ST3A 2J0QA 5FNVF 1L5LA 2WV9A 1Q7RA 1USVA 1DQZA 3VH4A 2HDNB 1HRDA 1EYZA 3WGZA 1SXJE 1EGQA 1X7WA 3IXQA 1PZGA 1SA0B 1BEUB 1Z4PX 5CT8A 5KYYB 3IIKA 3S7ZA 1I5OA 1OBOA 2HQBA 2XDQA 3G8CA 5E0OA 4ZCRA 1G6HA 1WCIB 3A36A 3QE0A 1YIAA 4TT3A 4X8MA 3O93A 4AVYA 1AH2A 1N5DA 3RYFB 5BUSA 3RQIA 2A1IA 2IBTA 1YCDA 6LDHA 5KSWB 1N6KA 1ZGHA 1NUHA 5GTDA 3K70D 2O8VA 3F3KA 3ISJA 1ZIPA 4P83A 5EJ9A 4GX0A 4RZUA 4F9TA 2XIJA 1Z28A 3C1OA 4XDZA 1Z0DA 2GO1A 2VDKB 2XJ9A 3F4LA 3MYYA 4NQRA 3VNUA 1FMCA 1CYDA 5HA5A 3TIFA 3PFKA 5KKNB 4IFEA 2D2VA 2EOAA 2ZSDA 1RP7A 3IEMA 4NE9A 5T4EA 1GGNA 1RRPA 2PVPA 1S96A 2C78A 3M2TA 4LOLA 3O4JA 4QGGA 4B3FX 1VCHA 3BAZA 1UWCA 4D3DA 3U3XA 1UFQA 2I76A 3C45A 3Q5GA 5EIBC 4RTOA 2WVHA 2IUYA 4XPIB 3B3QA 4D0NA 2RC5A 1FQKA 4JN6B 2EX1A 3HXTA 1JIQA 4C30A 1HLGA 3RGGA 1ORDA 2Z6VA 3T9FA 4NABA 5HQ3A 1I2BA 3LJKA 5K8TA 4OHYA 3A2NA 1Y33E 3GMTA 3USCS 1ZONA 1YS4A 2DYKA 3OT4A 5K0BA 1Q16A 3OC6A 5FPKA 1ZH0A 4KQGA 2BM1A 2NUPA 3T4EA 5CFLA 2W2KA 2I91A 3W1EA 1N7IA 4HVCA 2X9GA 2DSTA 5AMXA 3WKBA 2HSZA 3O9VA 4L8YA 3I30X 4OTZA 5EQJB 3WK8A 4HGRA 3DO5A 4OGKA 2HF9A 4K81B 2ZM6B 3TR5A 1T2AA 1D1PA 2W2LD 3GRRA 4HK4A 2WFMA 3V4LA 1N2HA 3E2PA 5CB4A 5FADA 2XUQA 4LHXA 1PK8A 2NVWA 6NULA 3OIWA 2AEMA 1J7KA 5KAMA 4JBYA 3S2FA 4A2QA 4BFWA 1EFPA 1RXYA 2XKKA 1USKA 4AZVA 1CIPA 1XQWA 4D9HA 1YZVA 2X8JB 2HJWA 3JPYA 4KNWA 3TJRA 1O7JA 1W0CA 2PCLA 3PUKA 4JLOA 2IXEA 4LWQA 4CTMA 4GM4A 4J6FA 5D01A 2B1QA 3AR6A 3LBYA 1DBQA 3LNTA 4HTAA 1AY0A 4DA7A 2QTNA 4Z7QB 4C0QC 2UUAB 4HB4A 5C5CA 3K0AB 4I5IA 3WKCA 4X24A 2CFRA 1FDTA 3ICOA 1CS0A 3GO4A 3LQ2A 2WKSA 3OLQA 4Y98A 5LZ7A 3TINA 1ZK2A 1A2BA 1B8UA 1XZMA 2NAPA 1EJ0A 1Z8NA 2LCQA 2XIQA 3PDWA 1ZI9A 3E5NA 1KJWA 3ENZA 2FZVA 5A5EA 2RSLA 3ETJA 2CCJA 1N6LA 1VIVA 2GM9A 2H00A 1MR3F 3Q2IA 3R0IA 5H80A 5JYEA 1TTHA 2RAFA 4B7XA 4AURA 3GMDA 3QEBZ 3OX4A 3TBKA 1HC7A 2WSIA 4EGJA 1T8SA 3BFXA 2IV2X 5FAKA 1F3LA 3HWSA 2HWUA 2ZCUA 3BM5A 1U0BB 2PZMA 1YKFA 1FRQA 3WLSA 1DAMA 1BVUA 1MORA 2X42A 4D3YA 1SG0A 1P18A 4JT4A 2YWDA 3ZY2A 4GNKA 3NBQA 2D8AA 1W85B 5H5JA 4QASA 2V7XA 4RZIA 3UUWA 1R4ZA 2FMHA 2QSZA 3O3OB 4JJ6A 5IT5A 2HD4A 1POXA 2P2YA 4H17A 5K6TA 5H3HA 1MP0A 4CUJA 5JEDA 2D5AA 3FTNA 3CJTA 2XWPA 1CZKA 3JZFA 2HMAA 5L4NA 1GUAA 4HDNB 1IBMB 4BNHA 2YV5A 1JE1A 2Y3IA 3LZCA 3Q7TA 1THGA 3OBBA 3I9V1 5LLSA 3B3JA 5JRZA 2C8JA 3EGVA 1KPIA 1RHUA 1JFFB 5J4YA 4JBWA 1Z7BA 4EA8A 3AL0C 1KORA 4A8JB 4BLVA 5ETJA 2WKRA 4QXPA 4XIGS 2AD5A 4FD3A 2ZQZA 3HRIA 9ABPA 3MS4A 1EDDA 1O9HA 2JJ8A 3H86A 3A1WA 1D0IA 3LW7A 5AVOA 3ZQ6A 3GUCA 1F06A 3AIKA 2CF5A 4FFDA 3UHPA 3FCOA 4Z0NA 3RRJA 4OXQA 3MJEA 4V0RA 5HOEA 2M9MA 3NOOA 5FP0A 3RJ5A 3UK6A 1MX1A 1FPMA 1W5SA 2G0TA 3EE6A 4CIDA 3O8QB 4KIGA 3DV0A 2ALJA 2DBYA 3M7IA 2XH8A 3M2PA 3CLVA 3ROTA 5C37A 3V5NA 1BVHA 4LJ5A 1S1CA 4DG9A 4RA6A 3CR8A 1QWOA 3WRYC 4MV0A 3E3OA 3VYTB 3MWEA 3CY6A 1UMDA 4KODA 3OLXA 5DYGA 4JL6A 4L2IB 4EUNA 5ALQA 3ZHCA 3EXEB 4C1NA 5ES4B 4FEAA 3ORYA 4L6CA 4EMTA 5GZ1A 1Q0ZA 1KPHA 4RYLA 1E66A 1IOVA 1CWUA 1X42A 1YDFA 2HK9A 3DTTA 4X1KB 4A16A 1R5JA 3TLKA 2IODA 2RGBA 3IOYA 3CLSC 4D99A 4H3VA 2BHTA 2C83A 4HVLA 4D8UA 2R5NA 1CDOA 1AS2A 3HR8A 5I7SA 1F1JA 5FA6A 1DAGA 1PV1A 3FDZB 3SVTA 2IYTA 1L5RA 4Y6PA 5F21A 3GLIB 3R6GA 4I1VA 1EUCB 2WF6A 4EO7A 4IPTA 2Y71A 3GFGA 4KLNA 4MEAA 3AI1A 4O8ZA 3AHEA 5A6SB 3ZGVA 3CZMA 1WMSA 2CLIB 1A5TA 2PS3A 2YWCA 2OM2A 5T4BA 3AJDA 4O4IF 5KKAA 1YS2X 3RREA 3VPHA 3ELUA 1RFLA 3ZZMA 2AIRA 2ZBPA 4BQRA 4NG4A 1G2OA 5FLXA 4B84A 2IL1A 2YWHA 2IS4A 3LC7O 4DCSA 3OKPA 2C54A 2G71A 4KQKA 4NIMA 5AM1A 3G5LA 1BMFA 4E6EA 4UFOA 2VP2A 3L4EA 1XR3A 5ENDA 3OOEA 2ZP1A 3WDMA 2BLLA 3SLKA 2DWQA 3H75A 4H2DA 2IX3A 4WUTA 2C77A 4LE0A 5BORA 3EGXB 2FSUA 2FG7C 2ZREA 4O2AF 3DF9A 2Z3ZA 1VKHA 3RLFA 2P6NA 3OZVA 3I83A 2RGEA 3TOZA 4AB1A 2H65A 3IE1A 4RTQA 3COZA 1N7HA 2WG1A 4YP0A 2J3JA 4G8CA 1ZSYA 3E0QA 4ZZIA 5JY1A 1SCJA 4AC9A 3JQBC 5JNTA 4WECA 3LAWA 2A5JA 5JPCA 3NV9A 3HFRA 2WUGA 5CUQA 4EPXA 2XDQB 1F2TA 3VGPA 1TQ4A 3HA2A 5C34B 1L4FA 2CB0A 1S1MA 2RHLA 1AKWA 2C4WA 2UDPA 5HIJA 2BKVA 4HDAA 5KQSA 1ZU4A 2QAGA 3VU9A 1W5BA 4LNAA 2J3QA 1C80A 4Z1OA 1PFVA 3DOFA 1RQGA 4XCXA 1AURA 2PANA 3EK2A 1O6ZA 3ZHSA 1AQUA 3HU5A 3D2AA 1KI6B 2VHQA 4HDKA 2OBLA 2VSOA 2AEFA 1YKGA 1L5VA 2QYSA 4Y18A 4EM6A 3KQNA 3AEKA 3KQLA 3GJ4A 1J33A 3HU3A 4BFCA 2XX3A 5AKHA 1EE9A 3ETNA 4XD7A 3CNBA 3MT0A 4LC0A 4RJTA 3WIDA 1WDMA 4X41A 4EB6A 4X64B 4CKZA 1TJNA 2GYWA 2VS1A 1RAIA 1EE2A 4NNJA 4CKBA 4IRXA 1JYEA 4G0NA 5HQ3B 2Z4TA 5KWJA 5TMPA 3ZGYA 2IT1A 2BUCA 1EXMA 4K46A 1O6GA 2R65A 1YJQA 3WMRA 1LVHA 5TY0A 5JXJA 4WZBA 1I24A 2D1YA 2PZ8A 1P9NA 1L7NA 2NUPB 1Z2CA 1T2FA 3LQKA 1FXUA 2O07A 2W2KB 3MC1A 1ZH2A 4GM1A 3BSFA 5ALIA 4Z9XA 3U48A 5I7RA 4HUQA 1CD5A 1LW6E 1J06A 2A86A 2CBXA 3LA8A 4NFYA 3KM0A 1QCYA 3V46A 2X9LA 4PLWA 4EJ6A 3K9GA 1U9JA 2E4ZA 1FBNA 4ISCA 3RC8A 1XWIA 5CB4B 1OWOA 4MB6A 3LHSA 4LYDA 3U9LA 3E0XA 2O57A 2H52A 5BR8B 4E6PA 5B3AA 3AKDA 3DEIA 4GLFA 3I8OA 4ALLA 2CHEA 4LGYA 2KHZA 4BNMA 2EJCA 2ZM5A 4P4LA 4R7TA 3EEIA 3BIJA 4Q4CA 1VJDA 3EXHA 2FRVA 3O21A 1UDBA 4MWBA 5EPOA 3NTXA 3UJ8A 2BI4A 4F45A 2EJBA 2HQOA 1P2BA 3L6DA 4BX3A 3GPCA 4DXAA 1RXVA 4L8VA 2QE6A 1KE1A 3M6WA 2RMKA 3GRUA 3D64A 4CEIA 2PQ2A 3WWOA 4F3KA 4ZCTA 1CS0B 3C5HA 3FFBA 5I9TA 2Z4RA 3NKFA 5K0ZA 3N28A 2MOKA 4M36A 1YO6A 3AJEA 2JEYA 3IAM6 3L40A 3TQIA 1P1FA 3LCVB 4FZRA 6REQA 3K9CA 1G5IA 1PX2A 1TUBA 2JHAA 5ECYA 3KJIA 4HDRA 2QT1A 4RS3A 4X71A 5EIHA 1FMTA 1Z6TA 4F4HA 3KOUA 3GA7A 4OGWA 1Q83A 5EAIA 4DS3A 5I7HA 3RT7A 4MAMA 5KINB 1FFYA 1J0DA 3VC1A 5EP1A 1Y81A 1NE7A 4Q4AB 4C4PA 3ZY5A 3BH6A 5AW3A 3RFVA 4UDOA 2XDYA 4DDTA 2QN7A 5JBIA 2IZ6A 4NG5A 2R7NA 1A97A 5MHTA 3T7TA 1AUXA 1ID8A 3RVOA 2Z6AA 3X43A 5FBQB 1IEWA 1N5KA 4I1OA 3HVIA 3V4VB 1R5NA 1ESMA 1LDBA 4RDIA 3ZBUA 2GVDC 5DLQC 4JVMA 2FETA 5CA1A 3FJYA 2ORIA 1JEOA 1Y3FE 2NUTB 4C7JA 3L0DA 1PNTA 1RQ7A 2ONCA 3LQQA 4M1QA 4ZOQI 2HO5A 4MLCA 4TTPA 2GXAA 2P79A 1D4OA 4C7OB 3GK3A 4RWEA 1Q2XA 1NUQA 2YX1A 3K30A 3LHIA 1PW7A 4EUKA 5L95A 3MT8A 4AUMA 2AGVA 2I34A 4FINA 4Y6QA 3T54A 3AOEA 3R41A 2ERCA 4GOXA 5F64A 2OD7A 2OC9A 1M0EA 2OZEA 3ABSB 1YU6A 1H66A 2C2BA 4IX9A 3QXSA 3WMEA 1JAHA 3CLTC 5FUMA 3FUUA 4COOA 3BJEA 5CCEA 1OZ0A 3MF4A 3N3BC 5K4AA 1YNSA 4FPXA 3DV0B 1E2NA 1WM1A 5BMVA 1ODIA 4GKJB 2ECFA 1GU7A 1O03A 1P81A 3R5KA 2QD3A 4RA6B 4KW7A 1BGVA 2YCLA 4EAAA 2EW8A 4B33A 2I6GA 2CDBA 1NXPA 3MWEB 2H2GA 1UMDB 1W88A 3CCFA 4ZT3A 2NXWA 1E1KA 3JWIA 4GKVA 5CDFE 1QR6A 3U7IA 3QJYA 1CY8A 2BYTA 4IS3A 2P9BA 1HKUA 2B1GA 2LCFA 4KSYA 3W2TA 3AERA 2IXTA 4JQCA 1IN5A 4EENA 1STOA 2HZ7A 1NJ6A 4MRNA 2OFFA 2QM3A 3WGHA 3K71B 3FHTA 1US8A 2NW6A 1XEXB 2AKEA 4E5DA 5BSVA 1TO2E 3VR6D 4B40A 1ADCA 4UVHA 2C92A 1GQYA 1QSGA 1U04A 3EOBI 2Q3BA 3PR1A 5HKKD 3IQDB 5GOZA 4B48A 3R5FA 1TYBE 4TVBA 4E4RA 4KMOA 2CHFA 2F17A 3ENVA 3H9UA 2AJLI 3FKJA 4A1OA 2V8BA 2VSFA 3WYBA 1WPQA 4EVIA 3F8SA 4IHJA 4MINA 3I6ZA 3ZBQA 5F5XA 4HS9A 2VYCA 1XZCA 1DOAA 5HQTA 2G76A 2JC3A 1Z2DA 3FZYA 3L0CA 2HTEA 3OFKA 4M21A 4XUCA 4CCYA 2VCEA 3FWKA 4XDHA 1KAOA 2RC6A 2V9PA 1ZH4A 3UA3A 2JBHA 3HY3A 3INRA 4HLQB 2PUFA 4QUJA 4G4SP 3AFGA 4TZTA 5JQWA 5D6OA 4AS1A 2EVWX 1JFVA 2Z5VA 5AKEA 3OD1A 4DJDC 1T2DA 2EJUA 4RK6A 3V8BA 1WTAA 3A4IA 1FPQA 4IXWA 3WLAA 4PEVA 3LCUA 3UVEA 1O89A 1KC1A 1F2TB 1U1DA 2X0NA 2F1HA 4OSEA 4BWGA 4ZT7A 2HA3A 1VYTA 4QU5A 3UB2A 2H8GA 3BYZA 4OHXA 3TRFA 3VU9B 4BB6A 1A98A 1KR5A 2J7KA 2RJ3A 1VG9B 3KQSA 1RRFA 3HL4A 5EZYF 4GI2A 4ILEA 4MJXA 1C3EA 4AZWA 4ER7A 1BHQ1 1SCKA 5GVSA 2D62A 4RYDA 4HDKB 4MYTA 4U1RA 1KYZA 5HGJA 1TAHA 4XQCA 5E7MA 2OYCA 2O7QA 1QVZA 2HHHB 3KAKA 3RYIA 4RGBA 3HR4A 1Z35A 4KFRA 4X97A 3SMVA 2HUNA 4L50A 1E4EA 4RY8A 4MTLA 5K3SA 2CFCA 3WLMA 2J48A 2Q28A 4MV3A 1MVNA 2Z8YA 4I08A 4TLCA 5COQA 5CVUA 5HRCA 1Q0RA 1QB8A 4PC1A 1MHTA 4EB6B 2ZRPA 1N92A 4M0LA 3W2HA 1FSPA 5EERA 5C8YF 3IKMB 3QVUA 1XJ5A 1AMNA 1D7OA 5FOWA 4CKBB 4BQQA 1THZA 2KSQA 1GFZA 4H18A 5TJ9A 2V5AA 1NBMA 1VE7A 1WO8A 5LIPA 3VC7A 2EZTA 3FR8A 3C39A 5HIIA 2D6FA 1LB1B 5GOTA 5JASA 4LXUA 1ZMXA 2JJMA 1G8KA 1VMAA 4QPZA 4WADA 3JS5A 2H07A 5AKXA 4UVIA 2BSXA 1RXCA 3JASB 4HUQB 4UEOA 1EWKA 4IUBS 4PY2A 4URHA 1KAEA 1JEDA 2J7PA 3ESCA 3A1NA 4KE6A 5MDHA 4CM9D 3O1HB 4XA8A 2MJLA 2Q3MA 2WAMA 5A02A 1W44A 3O8RA 1U0TA 4XFKA 3BIFA 1B8PA 3BA1A 4A1FA 1ZX1A 3LCJA 4OLJA 1IUNA 2R0QC 1XQ9A 2I5PO 3I23A 4IVRA 4ESEA 3EG5A 3EWNA 3WDKA 1C7IA 1P6XA 2ZANA 1UOOA 3EXHB 2W2QA 1L1RA 4YYEA 3LX8A 4RULA 4YAIA 1M75A 2FCAA 4KCGA 2OFWA 4M54A 1OH6A 1CQZA 1LGYA 3JR7A 3REQA 4CEIB 1D1TA 2F1KA 3FTCA 3BL5A 3H2JA 3U7GA 1F9AA 2A9PA 4NH0A 1B14A 3WTBA 1ZD1A 4BTVA 3B8HA 1XTVA 4U7PB 5DWDA 5F77A 5AHKA 3F4KA 4EF6A 3JALB 3QEJA 3VR3D 6REQB 1AN9A 4BAGA 3L0PA 5JD6A 1CNEA 4PX5A 4A0FA 3WNBA 2DP4E 4HDRB 1TJ3A 2JIBA 1HE8B 2VXOA 3A1CA 3LPMA 3X2SA 3MJDA 4B8WA 1TMOA 1DWOA 1TF7A 2RH4A 5GWXA 4FMDB 3M82A 4I99A 2PKXA 3QMMA 3V8EA 1R0CA 5G0UA 4ZJZA 2UVPB 4JYPA 2PX0A 2DQKA 5FXMA 4N40A 1CU1A 5JFTA 4R7GA 2V7EA 2W37A 1DFGA 3AVWA 1GPWB 4QFMA 1WB5A 3IHKA 5DH9A 2IZZA 2WMNB 3RTEA 1MW8X 3I1YA 2G83A 2PSJA 4GKBA 4PLGA 4R2MA 3NAGA 3PQEA 1ZEMA 4CRWB 1Q1NA 1NGSA 1WZEA 4KDEA 1LPAB 3WMXA 4EAQA 5CA1B 3B36A 1OXXK 3B9PA 1O6CA 1II9A 3SXPA 3S1LA 2Y1KA 2NSJA 4KGDA 1E1MA 4XIFA 4WZZA 1XAGA 3LPAA 3SBEA 3Q3CA 4D56A 1FLAA 1RBYA 3EQ2A 2RH5A 3G8YA 3O8OA 3QUQA 5AESA 3AY3A 1WBDA 3BDVA 2DR3A 2P9ZA 2IYQA 3GPDG 3PEFA 1YDHA 2PS9A 4OQDA 1XMOB 3QBTA 2QLBA 2XTMA 3PNSA 2VDMB 3UK0A 1UJ2A 1NUSA 2Q6IA 4LJ6A 8ATCA 3D7RA 4RLQA 3BD9A 2UUBB 1T4GA 3BB1A 4HGZA 3AM5A 2H54A 4EL0A 1W36D 2A5GA 4DY6A 4CQMD 3C7DB 4QBKA 1PJBA 1SIBE 3G59A 4RUKA 3RS4A 1O5IA 3A2KA 1E9SA 4OLFA 5JNSA 2GBLC 4I46A 4G25A 1NMZA 1L5KA 3FUVA 5FJJA 1E59A 5BMVB 3CBGA 2C3PA 3BCSA 4WK4B 5G4LA 3GT0A 1JIUA 5J5AA 3Q0IA 4HR7A 4V0SA 1OX4A 1RD4A 1VOTA 1W88B 3HUEA 3NDBB 4ND4A 4OBXA 2HV8A 4JIMA 2IPLA 2W2TA 5T64A 2Q2QA 4BGVA 4FOSA 3HJNA 4IJKA 2BRUC 4RPHA 4UOEA 2IJGX 2ZI5A 4PRZA 2HHAA 4E5MA 2CLKB 2SKEA 4X3CA 3WLIA 4DMRA 1A2KC 2DFPA 8OHMA 5KIAA 4MVJI 3C74A 1SXHA 3JZDA 4EJFA 2GNAA 2P1ZA 2PFKA 3L6OO 4PLFA 3TW4A 5I7UA 1T9GS 2QTLA 1JXAA 3V8NA 4UUOA 4RTKA 1VSQA 2QIOA 1YS7A 3AHIA 3EIXA 1X3LA 1S4QA 3QVKA 1Z36A 2WF5A 4N7MA 4M8KA 3DBOB 5TPZD 3ZK8A 5B55A 2PWAA 2XKBA 3MS7A 2F64A 2Q8NA 5GONF 1YRBA 3HCRA 2IUEA 1M2JA 4TKUA 3SQOA 2VDPB 5K20A 2FPLA 4OHFA 1DKRA 4BNUA 2QGFA 1U7XA 3DHNA 3GCWA 1VMKA 3IV6A 3DMGA 1KF0A 2PVCA 4IHJB 2GWHA 4MJLA 3D8TA 2CUTA 3MTJA 1G20A 3GUYA 5AI0A 1G7SA 2CZCA 1NJGA 3CLKA 1N75A 4H1TA 4RDHA 4CCYB 1XSEA 4F0JA 3ANSA 5L7WA 1IRIA 4FHCA 4L4RA 3QFCA 4HI0E 1QVAA 1DRWA 4FYVA 3TQHA 4BNTA 1J4AA 1N2CE 1PEYA 3CB4A 2MR6A 1DVRA 3HB4X 2Y0EA 4MPJA 5CCBA 3GCGA 1JAZA 5AKGA 3UA4A 4B3XA 5B6PA 4L9AA 1QAOA 3DMTA 3GUZA 1Y37A 1NI3A 4MLDA 2HXYA 4W6QA 4ATNA 4ZC1A 2ZPTX 4FEYA 3VSAA 2O5EA 2IP2A 4RGQA 4BB9A 3JY6A 2W58A 3D3JA 4BAUA 3O4VA 4B2PA 4FB5A 3BRWA 2WFLA 3LW8A 3THYA 4EFNA 2V4UA 5IT9A 1RAGA 4UCQA 1KEVA 3ANLA 4UUMA 4CMCA 3GP8A 4H7HA 4MP6A 2BN4A 2P2DA 3B53X 3T1QA 5F7JA 3UJCA 1NI5A 4JBNA 4LHEA 2ZWIA 1ZN2A 3RIMA 2WIDA 3R3HA 2W8ZA 3EBLA 2Q1YA 5CX1A 2FWAA 2YYAA 1Q2UA 5DIZA 3W6PA 1EXDA 1UL1X 3QVVA 1I0ZA 4DTCA 5ESRA 4KWHA 1LPNA 1U2ZA 4I3FA 4WDRA 1E4EB 4AG3A 5AVQA 5KTRA 5IVHA 1G55A 4MUGA 1IHYA 3EZFA 4MPRA 1DIBA 1T8YA 1XDZA 2EL7A 3H1GA 3DVLA 2C5GA 3EQ8A 2O6LA 4JENA 1JU4A 3NNSA 2IYFA 2ZJBA 5M29A 3FI9A 2I1QA 5IULC 3ER8A 4PONA 3TOCA 3NUZA 2JFPA 5FB3A 4C20A 4R40A 5KTSA 4QHTA 1SU7A 4HWSA 1DL5A 1ZVJA 4LOHA 5EKDA 4OB7A 3RHFA 3C1AA 3OE5A 1P3DA 4BEBA 4TVSA 4ER5A 3LKZA 3ETDA 3GEHA 1JBEA 1JU9A 4URFA 1UMKA 4OL9A 4AJHA 3JX9A 1G1MA 4KU4A 1GTMA 2FR8C 3WFIA 1BHJA 1GFSA 1OBVA 1Y1SA 3GRPA 4IJ6A 3KTAA 4JASB 1PW5A 5TQVA 4BNJA 1V5WA 2AFHA 4BGUA 4P4UA 1SN7A 3LXUX 2ECKA 2QPLA 2UVDA 1Z56C 1C7QA 4F8EA 3H9CA 3I6BA 4RTNA 1RRCA 1KJYA 1B3BA 4H4EA 5IBRA 3CFYA 3D7SA 4H15A 2IW1A 3PJGA 4YUVA 4JC4A 5KNCD 3FTPA 1TO6A 3Q0TA 4MPPA 2PZBA 1KP9A 4Q7EA 1X9GA 3OQ1A 5GY7A 2JVJA 3VTAA 1TM5E 3JATA 1NXVA 2B7CA 3OF5A 3PFIA 3ZEAA 3I05A 4C2AA 3PGA1 3RJTA 4BN5A 1ZCZA 4FBGA 1JYSA 1U63A 3AR2A 4X65B 3QLVA 1QB7A 2YR0A 3S0JA 3WYFA 1AGXA 4Z5XA 3RAPR 2B8TA 3BXXA 3REQB 1H22A 4OATA 1RVDA 2NN3C 1VYHA 4JLJA 2VP9A 3GUVA 3I2YX 2QRUA 3WHPA 1CUXA 1V5FA 2YUTA 4R6XA 3RW9A 1KQGA 1EU1A 2GQ0A 4K86A 5K3FA 3CUTA 3N7TA 3GVHA 3M9WA 4KC0A 3OOYA 4EUFA 3AR3A 1HURA 4QTTB 5DT2A 1C4KA 1JVSA 5CH8A 3KKEA 5CXUA 5JZ9A 3F9RA 1CVIA 3G5UA 3IP5A 4LI3X 1VYUA 1F4LA 1P4AA 2RI0A 3D8RA 1RXIA 1VHLA 4GZLA 2IYPA 1P7WA 4NONA 4PWZA 4PGHA 4CE6A 5H8WA 5AUOB 2ATIA 4LMPA 4IFIA 2R8OA 2V97A 3RTDA 2W4IA 3SYLA 1ORWA 4WXPA 4IQ8A 1KJ8A 1QLHA 2JHCA 1USGA 5ELLA 4FKZA 1Y9EA 2OCGA 4OQFA 2WILA 4QXMA 2O05A 3ILSA 3W9YA 1FQJA 1XLTA 1PZXA 2ZRCA 1J24A 1QHEA 1T1GA 2GAFA 2GN4A 1Z5UA 3HEMA 3G68A 1A9OA 3MTIA 1P4JA 5A6VA 2PRKA 4K6KA 4CDRA 4ZEMA 3EEOA 1H2AS 1M2OA 2PGAA 4UAVA 1XQVA 1Y34E 1ZMRA 2I8LA 1ZOPA 3B5IA 4J9UE 4ZDIA 3DGEC 3DJYA 3SQDA 5K1ZA 4CFSA 3O8OB 1WHTA 2RGNA 2V5VA 2ZRJA 3OICA 4H1VA 4MLPA 4MW2A 1IJFA 4CM1A 2PVSA 4WACA 1UPFA 2ACVA 2L42A 1E79A 1HFKA 3RARA 1Q1GA 3OIYA 3QU7A 4QUAA 2J30A 4NCHA 1CETA 3PHBE 1RM0A 3HKCA 1H3NA 4E22A 3GJ0A 5IVKA 1I2MA 5LMNB 4D92A 1A5SB 2EP5A 2A9JA 2JFGA 2Q3LA 3A6HA 1I9CA 3EAQA 2W42A 1Y9DA 1VP9A 3JQRA 3RYCA 3TVTA 1CJTC 2ATVA 2R7AA 4WCVA 4NOJA 5HDBB 4G01B 5L3SA 1YZGA 1UK7A 1U3GA 2VSQA 4LJKA 2AYYA 1EB9A 3P1JA 5CLGA 4BNFA 4MDFA 1TRHA 1PCXA 3D9QX 1OX4B 1QG2A 1Y4ZA 3DJFA 2OR3A 1H2BA 3W4IA 3WX0A 3X1MA 3HB7A 4DV2B 4DSNA 4HWPA 1NSTA 2YIVX 1L4UA 3I2FA 5ESDA 1PWXA 1Z5WA 4N54A 2FMFA 3IGFA 3ZXYA 4U3JA 5CD9A 4UXHA 2CE2X 2HSGA 3PSHA 4PLYA 1DWQA 2GPTA 2HIMA 5ELMA 4DA0A 2B8JA 4F1WA 5B7QA 3R9IA 1EKXA 3RKRA 1B8VA 4EY3A 2ZJ6A 3B3FA 2JZCA 4QAJA 3HP4A 4LRWA 2QU8A 1JS1X 3H5LA 4KKXB 3TPCA 2GEVA 1HYEA 2H11A 2MWMA 4B2LA 1Q0TA 4CM3A 2OKGA 3B85A 3I6QA 3LUPA 3G9ZA 3LWNA 2FPKA 4H1WA 1DRUA 2VQ6A 2FFAA 2WHXA 1TCAA 4FYYA 1U2PA 4TKUB 3P0FA 1LRJA 3WBJA 4KFUA 2HRCA 2BDTA 2FMUA 4HD8A 5A2GA 4D8TA 3H4TA 3G8DA 5I8ZA 1XP5A 1Q84A 2BKEA 2XE7A