1PP4A

The crystal structure of rhamnogalacturonan acetylesterase in space group p3121
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
233
structure length
233
Chain Sequence
b'TTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVLTTTSFEGTCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnogalacturonan acetylesterase
molecule tags Hydrolase
source organism Aspergillus aculeatus
publication title Crystal packing in two pH-dependent crystal forms of rhamnogalacturonan acetylesterase.
pubmed doi rcsb
total genus 81
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.1.86: Rhamnogalacturonan acetylesterase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1pp4A00
3DT9A 4JJ6A 1VJGA 1V2GA 1IVNA 4OAPA 1DEXA 4DEVA 3DC7A 3HP4A 3DCIA 3C1UA 3KVNA 3MILA 3SLRA 3SKVA 4S1PA 1YZFA 1Z8HA 2O14A 1FXWF 4HYQA 3PT5A 2HSJA 3RJTA 2WAAA 4RSHA 3DT6A 4K7JA 4TX1A 4I8IA 3W7VA 1J00A 1WABA 2W9XA 4HF7A 4K9SA 5CD9A 1BWQA 3U37A 1JRLA 2VPTA 3BZWA 2WAOA 1ES9A 4JKOA 5B5SA 1VYHA 2WABA 4JJ4A 3DT8A 5JD3A 1DEOA 4K3UA 1ZMBA 4Q7QA 1BWRA 4NRDA 4IYJA 1ESCA 2Q0QA 5BN1A 4RW0A 1BWPA 4H08A 4OAOA 4M8KA 4LHSA 4K40A 3P94A 4JGGA 4JHLA 1PP4A 4Q9AA 1U8UA 1ESEA 2Q0SA 1FXWA 2APJA 4PPYA 1K7CA 4XVHA 1ESDA 5A4AA 5HOEA
chains in the Genus database with same CATH superfamily
1TYZA 1C8LA 2EP5A 1JDSA 1L7BA 2GM5A 2GRAA 2XR1A 3JY6A 3LI2A 3MJ4A 3PR3A 1GKLA 4MPDA 1FU7A 3SZLA 3CEMA 5KC8A 1XA0A 3JWHA 3NZEA 3E1SA 5JS6A 4M99A 2ZIVB 2DTEA 5DGTA 1RADA 2QM8A 3QMPA 1XBTA 1ZI9A 4L5BA 4P7JA 4EB6A 1BRMA 1VG1A 5DM0A 1L9XA 1Z0DA 3BREA 1UDCA 1KR2A 2Z8YA 3AUXA 3IR6A 4WV3A 3RIEA 3U3KA 1UK7A 3OAAD 1XNQB 2XNJA 4D8YA 1E2BA 1X8LA 2FN4A 5B53A 3EMKA 3IAAA 1DDOA 3PD7A 3UN1A 2XUIA 3ZNPA 3HGMA 1CF4A 4NPCA 2G8NA 5IJ0A 3I9NA 4NAVA 1SBIA 1YK0A 2ON6A 2DEUA 2JCXA 4NI5A 2CLCX 1U1GA 1TDJA 4KDEA 4N76A 4JLSA 1ZNWA 4G63A 3U7FB 1A2OA 3X0DA 4DV7B 3ZJVA 2REOA 3HU5A 4XFJA 16PKA 4XQCA 2W2LA 5GQSA 5LD2B 2I7TA 4KMSA 5EVJA 4B2IA 3FRHA 2VVTA 1CSEE 1ABEA 1FPQA 3DVAB 4TPKA 4RKFA 4JX8A 4H0FA 2VYCA 1LNZA 3D4IA 5KZMB 4LWPA 1E1YA 3ROEA 1I2DA 4YONB 2J30A 5BT8A 3BFJA 1GV0A 3E4DA 3TB4A 1L5HB 2I6UA 2AYXA 4G2NA 4IDHA 4CEJA 3OQ1A 1TVEA 2GK3A 2JGIA 1DRJA 3GJRA 3O8DA 4UMVA 3BZWA 3C43A 2AMVA 3HYRA 3I1IA 4QELA 5JYEA 3GGCA 4QXOA 1FP2A 4S04A 5KKCA 1ZJWA 1FDVA 1Z22A 3PWTA 4UQOA 5BSEA 1XQVA 2RB5A 1R74A 1QGED 4R9SA 5PGMA 1BCRA 3QLTA 2CD7A 2BFPA 4FFBB 5E2BA 2FKAA 3BJEA 3DFFA 1NJ1A 2AX4A 4TTAA 4BJ5A 2AKYA 5TF0A 1W88A 1YR2A 2XQJA 4ECEA 3KSRA 2G0AA 4G0OA 1OXTA 3JYQA 4IIEA 4LEIA 3D3QA 3FCSB 4ZU1X 4LA4A 2C94A 2C3UA 2OLJA 3UJCA 3AR8A 3GLFB 2WVAA 3K2IA 1JHYA 2H18A 2YZKA 2WJ6A 2J3QA 3MB5A 4YRLA 4H7EA 1ZJ5A 5LZ5A 4OK6A 1GXSA 4UASA 4DJDC 2IKQA 4BEBA 1JU3A 4XW2A 1RQRA 4F97A 3IODA 4LK2A 1BN7A 1SZJG 3O4FA 2OYCA 2CCGA 2IEIA 3NFRA 2D4HA 2HCJB 4Q3LA 1TW2A 1ZCZA 2ZAMA 1EGMB 4A0HA 3BH6A 4B81A 3HCWA 4PLCA 4BB9A 5E3HA 1IXYA 4N48A 1WSBA 5KYUA 3C6MA 1I32A 2DG2A 4ARBA 1BMFD 3FLAA 2BJWA 4FCCA 4E5VA 1J07A 4DZTA 1HC7A 2PSJA 1NJ5A 5KHLB 1KO8A 2CLMB 1MJGM 2FPXA 3CINA 3BRWD 3QLVA 1AKQA 4IV5A 4NYMR 3OEEA 3T8YA 3EULA 5UKDA 4Y9TA 2HLHA 4M86A 1EXDA 3AKYA 1OBCA 4GM0A 4TXLA 2EERA 1MQSA 4M9ZA 4WINA 2B2XA 5JG7A 4DE5A 3K9BA 4EKGA 2WA2A 1KQNA 2C4TA 1EH5A 4WWHA 3NHRA 1PK7A 2LGJA 3D8BA 2WE8A 2AJLI 4O4IF 4OJQA 5F76A 4YPVA 3NTUA 4LQ4A 4WLNA 1VCOA 1FIUA 1ZDMA 1KBZA 1SCDA 2AR9A 4QBKA 3KYBA 4NOLA 4E46A 3TTUA 4P4NA 3SDBA 4BQFA 3BXHA 3DE0X 1U0BB 1XDGA 4YUWA 1GILA 3GQVA 2ZOSA 1QHGA 3MG9A 3PX3A 4CQLA 1FRVA 2BCEA 3R9KA 4Q34A 3DEYX 2FX2A 3KCQA 2O07A 3T12A 3G2MA 3Q8LA 2J4DA 3GRPA 4LWQA 1RTTA 3LUPA 4YJ3A 2CDCA 4CUKA 3DOOA 3P9SA 3G1TA 5ECWA 3B53X 4P35A 3M82A 1NVXQ 1UJNA 1H8EA 4WZAE 3GQBA 3KVYA 2XV1A 2FZGA 1RC0A 3V8VA 4B9AA 4EKYA 4RENA 3OTOB 4MTCA 1UAGA 3JQ9C 1KDVA 2XTMA 2GZSA 3AM4A 1YZLA 2QORA 3DZCA 1N5LA 3PVZA 3R0IA 2DBZA 3WNQA 3TFOA 4MR9B 4PWYA 3GLHE 3O92A 3D8TA 4LFCB 4DR3B 3E05A 3C39A 4G0QA 2PJDA 3LU1A 1L9KA 2VHYA 3EGXB 3PTZA 3GCZA 4RHYA 1S2GA 2C2XA 1F2UA 5JRJA 5JJ5A 1C4KA 4P92A 2O7QA 1QIMA 2R1VB 4G84A 4LXQA 3D6FA 2OCLA 3GW8A 3S2ZA 2GNOA 3JARB 3NYWA 1AK2A 3O2JA 3BS4A 4NDZA 2G4CA 3OOHA 4A0GA 4KPUA 4YJGA 4KN9S 4CDRA 3FCUB 2RK6A 2PA3A 3LQ2A 3FBWA 4NMXB 1QF6A 4X20B 1JYFA 3MYRA 1RC8A 4C4SA 5L95A 1CJUC 2BISA 4WZZA 1OUMA 1PFGA 2W6JA 2YJ5A 4JL6A 3RTBA 1JH8A 3LRXA 4UU0A 5A06A 3MWEA 4FDTA 4MZXA 3B20A 3EG9A 3CLSC 2G08A 1Z07A 1UDWA 5HS6A 1EE9A 1DOHA 3BD9A 2ODPA 4EMSA 2VDLB 4RKRA 3OPYB 1LS1A 3G8BA 4RV9A 4PQEA 5E7QA 2G4LA 3Q3CA 5HZHA 1IEVA 4EHHA 4ZJZA 1ZVMA 1XTIA 4C0LA 2DH6A 4DLXA 4XWTA 4YRFA 4TS9A 3ND5A 1B2LA 1R0WA 2EJCA 3LW7A 4IHKA 4IUCS 4A5OA 1NI5A 2OV1A 1Y8ZA 4IZHA 1V5WA 2OECA 1P62B 1U3GA 4FFPA 3QUTA 3RANA 1GVHA 4A36A 1JAYA 2IELA 2PU7A 3DH0A 1A4RA 1CUHA 1T4GA 4R69A 4LMBA 5E0KB 4CQJA 4CPDA 3JVDA 1XWWA 4DCTA 4ZIRA 1K8RA 2IU6A 3GCWA 3PZRA 3ZWCA 1H6AA 3AFIA 1RPTA 5U4XA 2DH5A 3LT2A 5I4IA 1D5CA 1AGNA 1VE6A 1OGIA 4XFKA 5BSUA 3OEWA 4UBLA 1QZ3A 2O48X 1TQ8A 3TDMA 3WMEA 5E7IA 2V5AA 1XMIA 3T7JA 2CE7A 1PT7A 2FEPA 4PO8A 1UL1X 3R74A 1Z4IA 2WB2A 4IDQA 4OHUA 4YXWD 3EDYA 2VPZA 4RVOA 1UK9A 1UMCA 2NVUA 2PXHA 3ESCA 4G8BA 3FSGA 4XCXA 4BMOB 1GQRA 2VT7A 3M5CA 4H59A 3X44A 1YR6A 5JWOA 3KK0A 4YDQA 2X9NA 1HQCA 4HEQA 2JHFA 5HK9A 3PT9A 4ZQFA 4MQFB 3K0AB 2IS2A 1OFUA 1HBJA 2O4UX 3T3EA 3GD5A 1OYWA 4MW9A 1NAHA 2EWVA 5BYBA 2ZTLA 1SEVA 1N6RA 3AP3A 1KDOA 2M98A 3ELBA 1P80A 2VO1A 1JQ5A 1FNCA 4ITUA 4ZT2A 1PVDA 1B3RA 1Y1RA 1YVDA 2B3DA 4HNTA 3H5TA 3R23A 4DYHA 3SSMA 3VPBA 5I51A 1KMNA 1P60A 3GPDG 2H07A 2Q9CA 4V0NA 5GAJA 3O6VA 1KMCA 1IWPB 1T0HB 1BEEA 2I29A 3ZBUA 4EITA 1RQLA 3LD9A 3GBSA 2GXQA 3BTVA 3Q5GA 3PCTA 3LGAA 1QF7A 3OTGA 4WNAA 4PTZA 3BULA 4UBIA 3BBLA 4FDVA 3BK2A 2QUKA 3CH4B 3AUAA 1ADYA 3C8ZA 4H60A 4I1UA 2C58A 4CMCA 4BO5A 3T7KA 1EK0A 1EWYA 2RG1A 1OTYA 3N53A 1JBKA 3CVVA 3MTQA 4IIJF 1E66A 3WLIA 1E3QA 3ECAA 4M6WA 1UFVA 3VYRB 1M2VB 3ZXXA 3M6LA 2IZ5A 3GJ0A 4NQZA 3ZJYA 421PA 3G3EA 4J2OA 2ZI5A 2Q49A 3CPHA 1ZGJA 1MENA 5CA1A 1CR4A 2JH8A 2JLCA 2CFTA 5CG1A 1Z4JA 2MSNA 2P4SA 4GLBA 2V98A 4LC9A 2E5LB 3PTAA 1XTUA 4E13A 4M0KA 1N2SA 1PEDA 1WNTA 3GJQA 3BB4A 1HX7A 3OFVA 1EK6A 3WRXA 5IKMA 5HMMA 1ZVVA 1TZMA 5LZ7A 1D7OA 2LDXA 4DQ0A 1PL6A 3IJ5A 2F8MA 3HVJA 1ZSYA 4GDMA 4TKZA 5P8WA 3PYLA 3G02A 5JQGB 1Z28A 3ILSA 4RA9B 3I9OA 2C7RA 1DV1A 2B35A 3CVOA 4KRYA 4LK3A 3P2MA 2VXCA 1CE8B 3FLEA 2EFCB 1Y8AA 3E8SA 2V7QD 4GOXA 2E5FA 1Z2OX 2FSGA 3BWEA 2QTRA 2VJLA 3IIIA 4QOSA 1IN1A 2CWWA 4NABA 4J7XA 3E9QA 4AX4A 1Z0IA 2ZEJA 4Q9JA 1DBRA 2ST1A 1SVWA 1Z4MA 3ROPA 1ICIA 3RUCA 3UXHA 4OH7A 5FKJA 4LMPA 4O5OA 4YJ2F 1KR5A 3IQFA 2VTEA 2FMXA 5DP1A 4AUEA 5EZQA 1JPVA 4ZZIA 1YBAA 5ADWA 4R8MA 3DMHA 2BV3A 1UJCA 5FUMA 1PFWA 3H2GA 4HHEA 4L28A 3ZZMA 4MVJM 3WJ2A 2V4UA 4CU2A 2KHZA 3PE4A 2CMDA 3I6ZA 1MCZA 3SBXA 3QJYA 2H06A 1GGMA 4ND2A 4G26A 1IWBB 4Y1FA 1GTJ1 3UHJA 1YZGA 3TW8A 1G2QA 3V32A 4FFSA 1H8HA 4RDHA 5CCXA 4O4LA 3GDGA 3T38A 2CMFA 1SKUA 3MXOA 1QVRA 4KRFA 2JDIA 1M2HA 4CEHB 3CFYA 3RR2A 1FRFS 5E4FA 2PXXA 2QROA 1CRZA 1YZ3A 2PZ8A 1TX4B 3OZRA 5MHTA 2I7DA 2JK1A 5FPQA 2A0UA 2L42A 4AJJA 4AKHA 4S1OA 3QKIA 2CGEA 3PGMA 2VNHA 2D74A 1T4MA 1FUUA 1W96A 1V8FA 3I9V1 3KKKA 4DV6B 3KUUA 3L7IA 1JFFB 1K9VF 2PX4A 3H13A 3LFUA 1R0LA 2V45A 1SBNE 2WF6A 1HG0A 1L8AA 3KWLA 1ZIXA 2QMQA 4MVJI 5J5VA 1QV7A 2QM7A 3ROQA 4X90A 4ZEOA 4F91B 4P3OA 2RHLA 3EWSA 1Y9ZA 2YHBA 3D8UA 2LCQA 3EDCA 3WDMA 4CM7A 4DUGD 2XGSA 2R8ZA 3K16A 4RZIA 3D3KA 4FYVA 1P8AA 1RHQA 2IHTA 1Z34A 3D3JA 4FGLA 4M8SA 1GZ3A 4QSHA 4C06A 3L0ZA 5BR8B 4RK7A 3AB7A 5A9SA 2JLYA 1NI3A 1VJRA 2QF7A 4CDMA 2R6DA 1T2FA 3IQZA 4JI3B 2GJ8A 2JH3A 1VIDA 4JFRA 2GD1O 2HDHA 3TLBA 3F74A 1IDOA 3X1XA 1YQ9A 1HFEL 4UAGA 1S1CA 2GEFA 1XCGB 1K2VN 5CR9A 3LQRA 3P9XA 3GJ7A 1KH2A 3OX2A 4MI6A 2XYRA 1EUDB 5BWNA 4Q48A 5CGQB 4JI1B 1LTQA 2MOKA 4J0HA 1E2NA 3H0CA 3DLAA 4RPKA 1Z5OA 1X3LA 1YUBA 2J3IA 1HDIA 4N18A 1NP3A 1RPNA 4RK6A 3VDRA 2EKZA 2OXCA 3LBFA 3HGTA 2IU0A 2QY9A 3OPVA 3PICA 2BFFA 5JISA 2P9TA 3LUDA 5CNJA 4NZMA 1ZRSA 2VS1A 3AUJB 3MWDB 4E2ZA 2I78A 4GEGA 1ZM2A 3JTEA 5CA1B 4OVKA 2I55A 3QFFA 1DDGA 4RF2A 1UT5A 3S1AB 5JJKA 1C4OA 4M1WA 2CLSA 2XE7A 4EEXA 2OAQ1 2QLLA 3NVAA 4BKMA 4E4RA 1YFKA 2FCRA 3TNFA 3H1FA 4XGKA 2RGAA 1YI8A 3FGNA 4BDSA 3HB4X 4L4ZA 3AY0A 4WBNF 2AOVA 1JHZA 1OB5A 1TM3E 4OGKA 4GKKB 1QQTA 1JDJA 1SIWA 2O3TA 5DPMA 1VDZA 1KJIA 5JO9A 2FWAA 3ANLA 4C6TB 4PYNA 2OV8A 1EFLA 5DM4A 3OZEA 4OATA 1L5WA 1N57A 2YVUA 2Q9UA 1CS0A 3STUA 3A32A 4U7GA 4XJSA 1D2GA 3KT6A 1GSHA 2OO3A 3H2ZA 1VBKA 5CLJA 1SQ0A 1RMYA 4NTZA 2VQ3A 4PSKA 4JQYA 3UYKA 5KO2A 2V7UA 4X61A 3HJNA 4QNMA 5ITWA 1WDLA 2XRFA 1C7JA 1AKUA 1FFGA 3GARA 1YO6A 3K92A 3ZCPA 5GP1A 4JLBA 4O4IA 3OCYA 1WBDA 3A06A 4RMHA 3VOBA 4MUNA 4RMGA 3SS7X 2PZBA 3HY6A 5JZOA 2YIMA 3RVJA 1Y6ZA 4YMWA 4KR2A 1KDRA 3E5MA 3QVSA 4EJMA 4WK6A 5BVHB 1GT91 4PZEA 4NJMB 5JZMA 1J99A 4AAYA 2CXSA 3FR7A 4DREA 2PKWA 4X91A 1CYEA 3HZOA 4P1ZA 4WJZA 3TZQA 5FOQA 2ETXA 4EYEA 3DLHA 3S1AA 2JIQA 3AF3A 4PGFA 2FUG1 3OJEA 1PZEA 3ZBQA 3IRUA 5JATA 3GRZA 4KITB 1MAUA 1U04A 2BEWA 1R18A 2WWFA 3GJ6A 3DCIA 3OWOA 2PR7A 3ZCSA 4D3YA 4YRKA 2HX1A 4YAUA 2B20A 1PEAA 3CLVA 3I92A 2MSWA 2MMCA 3PLNA 4O2RA 3ZW7A 1L1EA 4JSTA 2CFSA 3SP1A 4LVNA 4BCCA 1DKNA 1TQ6A 1DAOA 4C04A 4OREX 4Q18A 2DWUA 4PSDA 3E70C 4ZQHA 2R6HA 4U1RA 4IM7A 2WICA 3WFJA 6PFKA 4ZZ3A 5LP6A 3ZR4B 2D2VA 2X0DA 5KYYB 2N3ZA 5G41A 3CEPB 7YASA 3UCFA 1C7FA 4KLNA 1RM5A 2VJNA 5DNAA 3B78A 1QR6A 3O7MA 1QDEA 1T34A 2FOIA 3RFTA 3O4VA 3KOUA 1GYRA 3WYNA 1WL8A 2ISSD 1EFHA 1ST3A 3HN2A 1Q7TA 1KY2A 4YRGA 4EFLA 4UHCA 3TECE 3BK1A 5JBNA 3STXA 2G4VA 1Y6QA 3HXMA 3QLUA 1YB7A 3HGQA 1SKYB 3DZGA 3IVRA 2OHOA 1PYOA 1DT5A 2R751 3F98A 4FOTA 4O2BA 4RJ2A 3R7DA 3U37A 3WHIA 2Y6UA 2WD8A 3FVTA 2GFHA 2YQ4A 1ZXBA 4C22A 3P2IA 5HKKA 3UG7A 4ZMBA 5B3LA 3KS9A 1WQ4A 1ATZA 1IVYA 2C5EA 1ZGAA 4BUZA 4EF6A 3L7MA 4PV7A 2OR3A 3DBRA 3HA5A 1NWCA 4XTCS 1HO3A 1Y80A 3AB8A 3K1ZA 2QWXA 1WZCA 4W6QA 4IJMA 4J0JA 5FTKA 4J16A 3SS8A 1RS0A 3FUUA 3AOEA 3O82A 3FB4A 3PFIA 3QI7A 4YQZA 4LCBA 2WU0A 3LF2A 4XQ9A 2ONJA 1EG2A 3AHEA 4MVJA 3GMTA 1I9GA 2C2WA 2XODA 4EGJA 4BNJA 2XD4A 2V03A 4O2AB 4A8JC 2PPVA 1XR3A 2YXBA 4OQDA 4F6CA 1UXGA 2G06A 5JRZA 1H05A 4JXXA 2PT6A 1M1YE 1OJ7A 3A6KA 3OQNA 4M0FA 2FMUA 4BLPA 5K4HA 4CGZA 1L7EA 4UZEA 3TJMA 1UXOA 2ZS7A 2W00A 3FHOA 3LQYA 1XDBA 2VP4A 4I50B 1BHSA 3I12A 4Q6WA 3CUEF 4YBZA 2HLPA 3TOSA 3SN6A 4DEXA 5LOVF 3QPUA 1MX9A 4IDDA 4D9IA 3HBAA 2YJ4A 1BAPA 3GH1A 1C9DB 3N1UA 4LWOA 1KOLA 4LAFA 4K81B 2AQHA 3OUTA 4RXTA 3SM3A 3VGPA 4XDZA 1G16A 3B1FA 1ESEA 3MRXA 1Q0LA 3QY9A 3A2LA 4H6WA 4IZOA 4LPKA 4D5EA 2H1RA 2BMJA 3LC7O 3KZMA 4GGOA 2X4LA 2A0WA 3PI7A 5SICE 2JFPA 4XM2A 2IOQA 3KZKA 2V65A 4MQFA 3WL6A 4WXHA 2WPNA 1M7BA 4KBYA 4L4XA 4XJXA 4OAQA 4A8JA 1F2VA 1DXHA 4EW2A 1DE0A 4PU0A 3U3OA 2QTBA 1P2SA 1T1EA 4MV5A 1LDYA 1Z56C 3REQA 5L8VA 1XO1A 5FA5A 3W1EA 2QN9A 3OUUA 1A4XA 2EEPA 1E9FA 1DCKA 3WGYA 1W36C 4FR2A 1AMUA 4KXUA 1OASA 1LEHA 1I1NA 2ADFA 4B33A 4PHFA 1MT3A 5F7ZA 2MSLA 2XHEA 3MOIA 1KU6A 1RXYA 3HM2A 4AY2A 3W9UA 2FXVA 1JLRA 5DT2A 3ZQJA 5AKHA 1HDEA 2J09A 3AXSA 4QUEA 1H3NA 1E0JA 1P0PA 3IDFA 1H23A 2IZ1A 3H18A 1LY1A 5BV2P 5AKYA 5JSKA 2H51A 5HDBB 5FULA 2HSJA 3NRJA 3ILYA 2JGJA 1MIOB 4MGZR 4MIEA 1V9LA 4NZ9A 3SJAA 4DLTA 4EYOA 2XIQA 4QAQA 4GOMD 1VGVA 3LPNA 5KNDH 1XEFA 2F3QA 3OQJA 1N2CE 3PENA 4O63O 1S02A 3L7AA 2I4MA 1ZN8A 2WNHA 1GT6A 3ANMA 5A7HA 4R3UC 3W5AA 2AZMA 3LY7A 1D2HA 1NOIA 3OFSA 3WKDA 2AN9A 4X8OA 4MW6A 3NKFA 4Y3UA 3P20A 3CKMA 5EJIA 1AD2A 4H1UA 3UAGA 1GM5A 1JQAA 5E6UA 4JY7A 2O8EB 1R27A 1K86A 2QR2A 4ACAA 1V47A 1ZVQA 2ZUEA 1NIPA 1NJ6A 1LSUA 2HXSA 3E2MA 1EWVA 3IVXA 4RACA 4RVUA 3LSTA 3CISA 1XZBA 3TCKA 3WAKA 3VR3D 1R6UA 4EVSA 3VOAA 1QHHB 2R5WA 2HT1A 3BCHA 1XYVA 3CNNA 5BSKA 4N12A 4TYQA 4IV8A 1WXQA 2QIOA 4ETMA 2IE8A 4GLFA 2OHVA 4TXMA 1DC6A 4LYAA 1EDEA 4KRGA 4AY5A 2XQIA 3FHJA 1XZFA 2VYND 5K51A 4EHBA 3VR4H 4ISBA 3CF4A 4PQYA 2QYTA 4XLZA 1TEVA 5HWSA 1K1EA 3DMGA 2HUPA 5LQJA 3Q1LA 5JCJA 2B9EA 1QJ4A 5CXSA 4DNOA 3M9LA 3U44A 4W9NC 3LO5A 2VDQB 3M1YA 3JRWA 3IO3A 2E49A 2VHTA 5GONF 2VF4X 1G7TA 3C3EA 1E0KA 4NHOA 3O3OB 3LT0A 5IBQA 4G1BA 3N2ZB 4PX9A 2QQ5A 3H87A 2ZZMA 4XSVA 4LECA 3MT0A 4HVAA 5ALTA 1CT9A 1CDEA 3GK3A 3QX7A 2GPSA 1PQUA 3WGNA 4F3KA 1DDIA 3SDZA 2F3SA 3VR5H 4H16A 4J0KA 4BV2A 1Q3HA 3GV0A 3S40A 1ANKA 2AK2A 3I5AA 2WHXA 1IWOA 4MKGA 2P9QA 3KT3A 4U5XA 2ZT5A 1DELA 4YH1A 5LYJA 4F1JA 3W6NA 2WD9A 2CXRA 3B89A 1FVXA 1FXWA 3WB2A 1AA6A 1FZTA 1BOOA 1E58A 2VH2A 4D9BA 2VBGA 4CLDA 1DJMA 4TMWA 1EUZA 1IOLA 2QY6A 2VHXA 3FNHA 3KR0A 1F0PA 4FZVA 2P9EA 2P3LA 4E22A 3PFFA 1WB9A 4LJLA 3BD6A 3H2SA 4QXRA 4RLSA 2HHJA 3ETGA 5JVDB 1IFXA 1QLWA 4PG4A 1Y9EA 1SVNA 4DVJA 2QR3A 3H1PA 2BH2A 3JVUA 4Q66C 1E2LA 2PSDA 4UVGA 4WVFA 3HC7A 4B85A 3TX2A 3QXSA 2PL5A 4KFTA 3WLQA 4QAJA 3JQBC 3IMCA 4IY1A 4LC1A 1TOAA 3ASYA 5KNCD 1NVVR 1T3HA 2Y77A 1USIA 1PR9A 1AZWA 1T5DX 1W1UA 2FEKA 3NNNA 3MB8A 3JWPA 1HE3A 3EVFA 4AMUA 3RO7A 1HEYA 2IYAA 3OM0A 3SR0A 4J0CA 2RBEA 4WT7A 1F0KA 4D97A 5DM70 3ANYB 4DBZA 1WLSA 3MCWA 3M4NA 3L7DA 4ZQIA 2VH5R 2HQOA 1QGDA 1WV1A 5E6SB 3W04A 5ESWA 1WZ2A 1RXEA 4NLLA 521PA 1RMQA 4P22A 7AT1A 3Q5EA 1JV2B 2QS9A 4QU9A 1LBTA 5EP4A 1WMAA 3MCVA 1T0IA 1TYEB 3MTJA 5DGIA 3G5AA 1FBNA 1GNVA 4H3SA 4FVTA 1M7GA 4TL9A 4AJPA 4EFNA 4PPQA 4OPMA 4HG2A 1NN0A 1YJAA 4UOQA 5C1IA 3IUEA 4PYLA 1NVUQ 1VI6A 3LY5A 4PN3A 2WM9B 5CD1A 3KEQA 1FTWA 1GG5A 4MWDA 2C31A 1EK1A 1KF0A 1IN5A 2IX9A 2X9QA 3SX4A 1N32B 3M34A 4KQFA 4PIPA 3UMSA 2QUBA 3EW7A 2ODQA 4RZSA 1U2DC 4D4LA 3TR6A 4P7KA 3QH4A 2IF2A 1SOWA 1AUVA 2BY4A 2C9OA 3FE2A 1ES9A 3GF4A 4PHHA 1W76A 4NJOA 4JKOA 4EPVA 4WBNA 1M74A 3SFTA 5EJ7A 5JOQA 4F3RA 4FS8A 2QE7A 4RSRA 1WNFA 1X7WA 3P9IA 3IAM1 1YZQA 2ZDGA 3EBOA 2E9SA 1PHRA 2C5BA 2VOEA 3IUMA 4JWTA 4KO3S 5G0WA 5THQA 1REQA 3MGGA 4RW0A 4D0NA 1GDHA 2YZNA 3ZGNA 1I30A 3PUWA 1E69A 1K7SN 3KV1A 1NTRA 4CYMA 1OH7A 1G66A 1NV8A 4KI0A 4EP1A 4ERNA 1FYDA 3K9HA 4AZ3A 3PYXA 2V59A 3KKEA 3U26A 1ORHA 2OYRA 2CYBA 3F6SA 5FEMA 4TS4A 2WNSA 2Q4RA 4LHSA 4WACA 2EX0A 5AHOA 5A4FS 1QHNA 2CXNA 1EVEA 1Q1AA 1LCIA 1NMYA 2C95A 3FNIA 1BDMA 1JA9A 2XOKD 2GYVA 3C7KA 1FU4A 1VSBA 4TWJA 2VPXA 1MV5A 4MDYA 4G25A 4WLVA 3U40A 5D3KA 2NV2B 4BDTA 2K2WA 4IIJA 3AEQA 3CV3A 1DBIA 1GY8A 2WJ4A 3D8NA 3IFSA 2GFQA 3IP3A 2OA0A 3GRRA 4N3CA 4B6FA 4RVDA 3NWJA 4CMJA 4LZPA 1J0DA 3PQ7A 2W11A 3U7IA 4L8YA 1DU4A 1IZZA 4LF4B 1UZAA 6LDHA 1ZD2P 3Q6NA 2ILTA 4FHFA 2ZRDA 1T0UA 1BYUA 4NBUA 1A5TA 2BHNA 4NYJR 5BN5B 1KO5A 5LP6C 1A9SA 1DOAA 3I76A 1NQAO 2XKAA 3OM8A 1QC5A 2OMKA 2P1RA 4RJIA 2HM7A 3WGZA 2FX3A 1R9JA 3LLSA 3B7GA 3EOAI 4CIBA 4DT1A 2G5TA 4BVKA 4MQ4A 1G8JA 5C3MA 1WEHA 2QVGA 2RD2A 1KIFA 3OE4A 4XM1A 5ENVA 4Z3KA 1QB7A 3DVLA 1KE1A 3T3IA 4D8XA 4V0KA 3RVPA 2QD2A 1LC3A 4AJ2A 1VHJA 4OHVA 2GXAA 4K28A 2D1YA 2O2DA 1EAYA 2VXOA 1ZHHA 1JAIA 4KQMA 1SPXA 4X60A 1JTEA 4WK2B 4GKVA 5DLYA 2GHQA 4MEAA 7MDHA 1DT3A 2B2NA 4YXWA 5AIBA 2PSFA 4FQ8A 1RHKA 3A4NA 4GBED 1O54A 4TWAA 1E7MA 1HMYA 1L5OA 4ZRMA 3ZCRA 1Z5UA 5JD6A 2XGJA 2CLHB 4BQOA 4DDUA 3T1QA 1U6IA 3KDSE 2QTVA 4TKLA 5CCDA 4R1MA 1C81A 3JQGA 2AF4C 3PLRA 3WGQA 2GHTA 2FLKA 3VI4B 4Z7QB 4Q03A 4WFQA 3RBXA 1YUMA 4UU1A 2GAAA 3PRKE 4EAAA 5C51B 2WFMA 1SKMA 4CM4B 1YJ8A 2RGNA 2O7SA 2WHPB 2D5BA 5KYNA 4A2CA 4KIJA 2P8SA 4KN8A 3W78A 2XMZA 5L6MB 5SYAA 1KMIY 3HTXA 2AFRA 2ZI4A 4OP3A 2ZI6A 3W34A 1Z4PX 5CT6A 2GSDA 2PV0A 4MYHA 3GGDA 3RYHA 1Q19A 1K2WA 3WYAA 4QYMA 3ZHXA 3CEHA 4B71A 1DTSA 4XIFA 5FI0B 1FDWA 1N75A 2GK6A 1ZUHA 3JQ7A 4FBLA 4WESB 5BSRA 3WSTA 3UCXA 4PC3A 3I5YA 3HXQA 4DOMA 2F8TA 4LZNA 2WUWE 4IW3B 2WJ3A 2W71A 4UCQA 4GU5A 5DEIA 4JVOA 2XSZA 2HCFA 4Q1EA 4QODA 3OOWA 1VZ2A 3JZAA 2WUFA 2IXAA 3OCZA 4DT1B 4I6JA 5ALOA 3D6JA 3IIMA 1RYYA 2F4VB 3H5LA 3AY6A 1V1JA 4DRYA 4B87A 1JTVA 2GEVA 1ZXXA 2BMAA 3ZXYA 3NORA 1M66A 3OQOA 5AKLA 1G9SA 3KJFA 1JFRA 2QYOA 4GSKA 1KJNA 3HR7A 5CX1A 5FWDA 3BN3A 3H4TA 5HQ3A 1PSZA 2H2DA 2W58A 1VHDA 4YCJA 1B15A 1FYXA 3BRCA 4HDNA 2IDJA 5BYKA 4IINA 3U62A 4DV1B 3FFXA 1D6MA 1HZZA 3ZHRA 1K8ZB 3IIJA 4C2BA 4CLRA 1W73A 4NARA 4NEHB 3MMSA 2Y0DA 1TCCA 3K1JA 1WW3A 2Q4DA 1P17A 2IVFA 2ZS9A 2ZWIA 2NTJA 3FSRA 2B69A 1EFDN 4MVCA 4CGYA 1D3AA 1KPGA 4R2JA 2QMEA 3N28A 4IKEA 2VDPB 2ALJA 2PEYA 2DTXA 2PSEA 1A2KC 3W06A 1CETA 3LHFA 1MXHA 3EZFA 3N8GA 3UA3A 5KCZA 4L74A 3EY4A 4J9VA 4B5LA 1D6NA 4WA8A 2LUOA 4C7BA 1DIRA 5EYPB 2D0PB 3CZ5A 4HJXA 3TCXB 3QIAA 3A6FA 4E32A 4DV2B 3EDOA 4F7DA 1KI6A 3HO8A 1PL0A 2RHGB 1WU8A 4UHEA 3RUIA 4F71A 2NTYC 3IKVA 1J0BA 5EUBA 1JKIA 4Q9HA 1YQWA 1OFGA 1D0SA 5AH0A 3ENWA 4YMIA 2ZETA 1QHXA 4QJ3A 4ZI7B 2HZBA 3GUZA 1ULSA 4ZQEA 2OEPA 1TA0A 4K6CA 4BLQA 2FJPA 4EUSA 1CY6A 4GI1A 4P84A 1PQPA 5G4KA 3EZXA 1OXSC 4XWGA 5B55A 3OKAA 3I5XA 4H7DA 4J0DA 4RIHA 1U4SA 2PX5A 3HKEB 5COQA 3J81k 1H6BA 5AIAA 1QX3A 5IC6A 4OXYA 1NQUA 3CZAA 1KXJA 3GUCA 1O0SA 1HNZB 2Z95A 3B1WA 4A27A 1SXPA 4G5XA 1OIWA 5DTJA 4L08A 1V1RB 1XE3A 5IFLA 2D7DA 1UKAA 3IBCA 3OX4A 1XTVA 2QRNA 2ADOA 4XUGB 1MO5A 4BWVA 1MAVA 5DM60 1JI3A 4M21A 4D99A 5F7JA 1KMHB 1NN3A 4HOYA 4KQEA 4LS3A 4F2DA 3KQPA 2OWEA 5J4HA 2ZKIA 4MDEA 3C5VA 3MRTA 1NI4A 3NLLA 2Y1DA 1B26A 5HJ7A 4F86A 2EATA 3GNSA 3RF7A 5EXPA 2WIDA 4ZAWA 2QTWB 4LZJA 4RVGA 2ERYA 3B9PA 3EGDA 5CFZA 2VAXA 4O6VA 1NTOA 4J29A 3VR5A 3ZI7A 3FYTA 4AW9A 1NBMA 2PO7A 2UAGA 4AN1A 4CMGA 4KXVA 1H4QA 1OXXK 1S9HA 4A15A 3HXKA 4YECA 1M1YB 4CQNA 1BDJA 4MP3A 1N6NA 1T0PA 2X77A 4IX9A 4DADA 1YR8A 1SPBS 1PO7A 5IXSA 1MGPA 3LLMA 1U02A 2ZYWX 2IUYA 2FGKA 3J7AC 1KVTA 3EZYA 4R9UC 4RU1A 5JHGB 2ZBUA 3QPCA 1QV9A 1GHTA 1MN6A 2B25A 1MB3A 3HB0A 1CY2A 4UMEA 1KHHA 4RIFA 3R0QA 4BAGA 1WF3A 2HJGA 3HZHA 4EKEA 5H9WA 4LFAB 1LLCA 1RVDA 4GMXA 3SOZA 7MHTA 1USGA 1E3TA 2GEKA 2YXPX 3QWAA 3OQHA 4RPIA 1TLFA 3DC2A 4TS1A 1CUFA 1RLTA 5JBIA 1JNYA 3CRNA 4OMCA 2IPAB 5SZKB 1UBMS 2Q2OA 2V3WA 4FHCA 5G1NA 4CU5A 4C0SA 2JKYA 2O59A 5K0EA 1M75A 4ND5A 3AB3A 1JR4A 4OF4A 4AC9A 1BROA 1U2TA 3LP8A 4IYJA 4B45A 1FTNA 4C21A 4F6LA 3QU7A 1G20E 3OJLA 1NJ8A 3N39C 3ABOB 4LSMA 5K4AA 4DLPA 5CAEA 3QFCA 2HHLA 3L4BC 3CR7A 1K8XB 5DRTA 1X9GA 4BRSA 4GVLA 2V97A 4ZCLA 2ET6A 4IDOA 3RVOA 3PJDA 3O3NB 3QOXA 2VPIA 3RGWS 5HVNA 4IMPA 1JEYB 1IPEA 2BVNA 4MQEA 1R0ZA 2VDWA 4X0EA 1IIBA 3OECA 2WMOB 3GPLA 4YPFA 1MB0A 4X64B 1Y3IA 4KRXA 4CLRB 1VE5A 1VLMA 3F4BA 4IG4A 1ZJJA 5T64A 2LZ0A 3ZIUA 2YQ5A 1Y7LA 4RE5A 4ALNA 1SXJC 3H99A 2VR1A 4X00A 2OCKA 3M89A 3D6TB 2WJGA 1ONSA 3V8BA 4TUYA 3AKEA 4LBYA 1F9EA 3ZCVA 2P5YA 4B3GA 2OZVA 2P62A 5JQGA 1O89A 1Z0KA 2YCLA 3LPLA 3QUQA 4GLJA 3SEAA 1LFAA 4LOKA 3U17A 2AMYA 1DO0A 3GJYA 4CQMB 1O58A 2Q99A 1ZW6A 3WRXC 1D9ZA 1SY7A 4N5LA 1IY1A 4G9GA 1LZKA 4OKIA 3QPVA 3A10A 2NU7B 4IFBA 1NSFA 3I2YX 4R16A 4RY8A 1D2RA 4DNFA 2PUCA 3SS9X 4KVGA 2WJWA 5K1ZA 4B3FX 3AL3A 1N8KA 4CR7A 1JIXA 1EVLA 3OT5A 3R6WA 5BOSB 4ENVA 2NWQA 2C1XA 2QKYA 3CLRD 3GCXA 4RQUA 5EE3A 4MAMA 1IK6A 2Q1UA 4ZVQA 1IAQA 4ENSA 3MT7A 4H7JA 4GSLA 3TX6A 3WXMA 5C32A 4GI7A 1EUDA 1U2DA 3B5JA 3PT5A 1SZPA 2AQIA 4AFNA 3O0DA 2MWMA 3T0GA 3T4EA 1PBNA 3Q3GE 4F5EA 5GZ3A 4QE3A 3DE6X 1U0EA 1LXCA 3JD3A 4A0QA 1HQYE 1PUIA 4EA6A 3LBYA 2R8OA 2YTZA 3ZK8A 1Z06A 3RCBA 2P41A 1UFQA 1FNSA 2DTDA 4P0TA 1IUNA 5IF9A 1ZM3A 1U2EA 2E55A 1AV7A 4CIVA 1NI4B 2I4RA 3I6YA 5AW1A 1OWLA 1PQWA 1G41A 1GARA 3WB1A 4IXMA 4HF7A 2ZCJA 1VL8A 3KR1A 4K9SA 5BRNA 4E5NA 2C7BA 3C6ZA 3V9PA 3N7AA 3GMSA 1MPTA 1ADCA 3RS2A 2J67A 3F6CA 3E15A 3FTNA 3WLMA 3ZY2A 4AMGA 5LVAA 4NSNA 3GZNB 1U8CB 1UKYA 4NBSA 4DUPA 1XV5A 2Y4NA 1AJEA 4V1CI 4BGIA 4FJ1A 4LOAA 1P18A 2GH1A 3HKCA 1YL5A 5DX0A 1KY5A 2JJ2D 4RWEA 4EQ6B 5I7VA 3DW1X 1NURA 4WKPA 3QXGA 2RHCA 1OVMA 2BTQA 1P2UA 4B3JA 4CF4A 3OCCA 2PVSA 3M4YA 1DUVG 5DHQA 5HFNA 3G0OA 3THWB 5I7HA 2YHSA 2ZSFA 5K03A 3G0HA 1J1UA 1TK2A 1YQDA 3BCSA 3AETB 4AQDA 4DA8A 1QF9A 1NU6A 1ZMBA 2ZRMA 5KU1A 2AYYA 2J9FA 1AGPA 4RZ2A 1YQUA 1EUCA 3K70C 5LQSA 4Z0TA 4KODA 5AVSA 1PKEA 4P3PA 4DLWA 5I9NA 2BGGA 1W4RA 2YJGA 3DV0B 1RFGE 5D85A 4I7EA 4WCFB 1QU2A 2DHCA 1BCRB 4PYRA 5AVQA 4HEHA 2XZOA 3HFRA 1WZEA 3VYTB 2VQSA 3L0BA 4OM7A 2HC9A 5LA6F 4Q4AA 4OX9B 2BKAA 3DDCA 4FYYA 4JZKA 3V8EA 1NVMB 1HGXA 1E4YA 4H1TA 1FUYB 1CY4A 3I37X 3DL4A 3F8TA 3LBNA 4QOGA 3RU7A 2Z8YM 4V2IA 4X93A 2XJ9A 3WJAA 5I9TA 1MH9A 4URUR 3P4XA 3ZHQA 4A0FA 4KIWA 4WLFA 5D6NA 1CZHA 4AN0A 4U7DA 4FFOA 4URZR 4H3HB 1KP9A 3E9YA 4DSNA 2JJ1A 3EZ7A 4DLZA 3H7IA 3OVMA 2G82A 4GR5A 4K6GA 4WN9A 3S55A 3TN7A 3UJ7A 3VR4A 4FYPA 1QE3A 1Z45A 3RVNA 4Y2UA 4UC0A 2WVJA 5F1YA 3NGMA 5IVDA 2JW5A 4FEGA 3OICA 2ZSKA 4YWJA 4DIBA 1VPTA 1W93A 1XWIA 4L5CA 4CTOA 1OAAA 1O96A 1TK9A 3SGLA 1G3MA 2H1IA 4FOLA 4ZVKA 1YDFA 4HVLA 1R0YA 1OPXA 1VHWA 2FPOA 2QUAA 1U2SA 3CRRA 3DFIA 4Y2PA 2CLOB 1F2DA 1T36B 2CBGA 1V1MA 4JUDX 5AW7A 3IQHX 3AUYA 3KETA 4FS3A 3AESA 4N7BA 3C4QA 5LU8A 3HO1A 3HJHA 2PJZA 3H4VA 5AM1A 1O6BA 1V1MB 4RKYA 3ROFA 4BEVA 1JJ7A 3OZAA 2Q5JA 1AS2A 1DLJA 5IT9A 2MSEB 2GQ0A 1H4TA 3N7TA 2EFEB 2MJLA 1M2OA 2F1KA 3KZXA 3QXJA 4NBNA 4OFBA 5SZIA 2NU8A 2RGYA 3DQPA 4JI6B 1Z2DA 2OVFA 5TMPA 1FJGB 4NH4A 1KDTA 4MW1A 4O8CA 3U19A 4R9NA 2GAJA 3PEVA 2GN9A 3PGJA 1Q7EA 2P4HX 1QTIA 1SURA 1W6RA 1YI1A 2F1OA 2SCUA 2Z0MA 3GFQA 3AI3A 4KAAA 1A71A 1EDBA 4R2XA 4ZEWA 3WWPA 1WP9A 1SCQA 3URMA 1SXQA 4ARIA 1VGRA 2LRHA 1ZK3A 1A8HA 1GLVA 3U5TA 2AB0A 4OHMA 1J70A 2SCUB 2XDWA 3KZVA 2XLCA 3OE5A 1MX3A 4G4SP 3F1LA 3Q7TA 3RQIA 3RSOA 4NBTA 4RLQA 3OLXA 3WK5A 4WXYB 4LKOA 1YVEI 1RT9A 1LDMA 2QE7D 2W2OA 1ZIOA 5YASA 1OVGA 1FRQA 3MTDA 4NFSA 5D3MA 2Q2QA 4AIIA 4GL4A 3UWSA 2NO0A 4QVIA 1PS8A 5AFSA 3FZQA 2DMRA 1U9ZA 1PT8A 4JN6B 4KO1S 4MP6A 1B2RA 1K63A 2Q7OE 2BSAA 3QE2A 5DP2A 1PNRA 1QAOA 2MT9A 5DX8A 3WLTA 1YOVB 3IBTA 1I5EA 3H2JA 5EG5A 1RCTE 2QRQA 2Q5LA 5EUCA 1PW5A 3PNVA 3QVJA 4W9RA 1FS6A 2VG8A 5IXJA 3UT6A 1T8TA 3JQPA 1EYZA 4HS9A 1WPXA 5EMMA 3GGJA 2WT8A 2ODTX 3R3JA 1WDKA 3CSDA 3ZCTA 3A14A 4BIIA 2C5HA 4G5FA 2VHQA 3PQ2A 3CNLA 3ZWPA 4R2LA 3UH1A 5JPDA 1PCXA 4R7GA 3HCFA 1PZXA 2XA9A 2FEWB 5JNRA 1YR1A 3ORYA 3KOWA 5CJPA 2DT5A 1KYWA 3KZNA 2DUNA 1YQQA 2PWYA 3HSSA 1EFRD 3C1OA 2WWGA 4NC9A 1JQDA 2ACVA 1QBGA 1MH1A 1QYDA 2QTVB 1NX9A 1SBYA 1H0KA 4OCZA 3A2MA 2L18A 4ZAYA 5IKOA 1Y63A 1DKQA 4DARA 1X94A 5LCXA 3SNHA 2ZDHA 1SUPA 2YJ3A 4CODB 5HZMA 1TTTA 3HL4A 4JBWA 1AVTA 1QYVA 1UR5A 3NJRA 3R7WB 4Y7DA 1PHPA 1A8PA 1YTLA 5DEOA 4FNMA 3UMMA 2ZBGA 2X23A 3BFXA 3KLOA 1T91A 4ALIA 3T99A 3TSWA 1YA6A 4M7PA 1A98A 4FKMA 2C92A 1ZN7A 2D3TA 2H63A 1WLYA 1ST2A 2YWXA 2Y0EA 5D86A 1K5PA 4WERA 2R6GA 5CHYA 1JEAA 4Q4HA 2CLIB 4WLOA 1NL3A 1Y8CA 3OCXA 4HQ6A 1BE6A 4YWHA 1RJEA 5FBHA 5LNK1 1XD2B 3N0XA 1ZUWA 3F5SA 3Q6MA 2IP2A 5E8JA 3EVEA 2P91A 2W2XA 4C6SA 2H1CA 4Z7NB 5DO9A 2YNMD 8AT1A 1QANA 3QLVC 4BO1A 2NO9A 2O2EA 4HRXA 4XGNA 3O4GA 1JPUA 5EXSA 3WA7A 2CZGA 1KAGA 2XW6A 3EDQA 3OO1A 3TW8B 1ETUA 4Q9LA 1QO9A 2PGOA 3UC5A 5LJLA 4HTAA 3EXIB 2ES4A 1E64A 2RFLA 4D43A 1NAIA 1LK0A 1J0AA 2DCUA 3WGOA 1W5FA 3E4CA 1L7OA 4B7UA 4EUFA 3WNCA 1E0DA 2GKGA 1B8VA 2VK2A 1N78A 3QVXA 1G17A 3LAWA 3DNFA 4R01A 4P3YA 4G4IA 4GQBA 3HCNA 5CVTA 3IAS1 4KPUB 4YJGB 1DJNA 3H1AA 4BRZA 2W2QA 1FMLA 2HA4A 4C7MA 5FADA 1L3BA 2DBYA 2R11A 5CBPB 1VIYA 1ZFNA 1EP2B 2CEAA 3VSCA 5KJEA 5KMGA 3A9VA 1IEWA 3B7WA 3VR6H 2ORED 4E4TA 3QMMA 3ST7A 4R05A 1AGXA 1LI7A 4P5DA 3VU1A 4D9KA 1PGNA 3CRQA 3FWNA 4GOOD 5KNCH 4AD8A 3L9WA 5DM1A 3NIGB 1B8PA 3U4AA 1DEKA 2ZS8A 1QUFA 2RH9B 2Z2JA 1HH4A 4NF2A 2IY7A 4LHXA 8ADHA 4C01A 1P4RA 2XB2A 3L0SA 2P2NA 3HB5X 4R1NA 3P2JA 4RF4A 4P32A 4M37A 2QP3A 2NT4A 5EEGA 5FTNA 3HK2A 4KHZA 4K88A 1Z6TA 2Q7DA 5CB6A 3U16A 4CEIB 1ZI6A 5KTSA 5LQUA 4Y67A 5EZ6B 2HWXA 5A5VA 1T6YA 1CUZA 4KSBA 5AESA 3F8SA 5BURA 1N5MA 1TEXA 2UVQA 1AHNA 3C3YA 1Q2UA 4W5RA 1NLMA 3GLGB 1Z7GA 2ASEA 4FZ5A 4BJHB 4MWGA 1RJ9B 4AYXA 3Q11A 4XB6B 5L3SA 2FUCA 4IDAA 3CKYA 1NBAA 2XNKA 1SXIA 3L6BA 1C9EA 2HRCA 3CMMA 2GEDA 5FNVF 3X1MA 1B0AA 1H2EA 2OORC 3GEIA 2DPYA 4FJ2A 4FUTA 4G2TA 5HK8A 5LBTA 3C6BA 4YQFA 3KB1A 1G8HA 3ES9A 4URXR 3U1BA 1UBCA 1W5EA 1A7UA 1KJWA 2HMWA 3JVEA 5AK5A 4GKJB 4IQGA 2PGIA 3C6XA 5FI1B 1DO8A 3TSOA 5DWVA 3SC4A 5AVVA 3GOQA 1FUEA 2JA2A 1JXQA 5BORA 2GYUA 2VQEB 3E23A 4IPTA 3GFGA 3FVVA 3CU5A 3IALA 1KXZA 4PRLA 4NAHA 1DQYA 2KE5A 1YHZA 2LCIA 4TSKA 5I5GA 2FPPA 4MWBA 5KYXA 3VHXA 1C7QA 3U0BA 3HJTA 3TUZC 3JVIA 1OZGA 1NLFA 2ZYRA 2ZZKA 4W4TA 5ICFA 1G7CA 1OU4A 3FYCA 4CKWB 2Z4RA 1MW8X 3ESAA 2ZJ6A 3KHUA 3HJBA 4QOEA 3RTAA 1MIHA 5H16A 5KDOA 2JLSA 3PUKA 5IHPA 5IABA 1C7EA 3UJ6A 4GPD1 4RLHA 4DIDA 2CNWA 2PUWA 2DX7A 1G3QA 3MFQA 3GYGA 3WWZA 1KAMA 3X1YA 2HJRA 3NAQA 5A71A 4OFWA 5LDGA 4KDFA 5TT0A 1EI9A 4TTPA 2BI8A 3P71T 1U9IC 4BV3A 3DZDA 5JMTA 5ALJA 4Q9IA 2GN1A 5I9MA 1ZEMA 5AW5A 3VPSA 2HGSA 3CB4A 2PD3A 1I01A 2B78A 2HT6A 3CZCA 4FSDA 4PVCA 4C4ZA 2HJHA 2XRZA 1Z0AA 4X8HA 5IASA 4L02A 4S0XA 1QVWA 3KEFA 1SOUA 2GD2A 4JQOA 3CG4A 4CMIB 1W9MA 2HMSA 4DIKA 3GLIE 2B4TO 1T6BY 3T5PA 4V1CA 2HU2A 4L0CA 1XZCA 2CUKA 4BZZA 4FLMA 1WB5A 1C8KA 3WLEA 2XWJI 3ZH9B 5I48A 1LI4A 3UFBA 1EXWA 1X1DA 3LYLA 2WSSD 5TEWA 1X7XB 1LJUA 4CR6A 3K5IA 4KYIB 2ZCUA 4JOQA 3NX4A 3GP8A 2B6HA 4G1VA 1DTWB 3BMOB 3NIBA 2IYRA 2A9KA 1I4LD 2ZIXA 3NBZC 4E5UA 5HXAA 4UUQA 3R1IA 4CI0B 2NSHA 4QFMA 1MNAA 2X8AA 3IQEA 4BCDA 2UXBB 1ODKA 2JBAB 1Z9BA 3DEKA 1ZL0A 4QL3A 2OLEA 1GPAA 4JSYA 4RQAA 3I2FA 5KAMA 3HEBA 2N75A 5T4FA 1VPWA 3T3OA 1NLUA 3KWJA 5KINB 2E85A 1SVKA 3F9CA 1KRHA 1STOA 4N5HX 4BFZA 4LCEA 5LP6B 1FDSA 3U3ZA 2FSHA 5CA1F 1MVOA 1ML3A 1F0NA 5C8YF 1RJWA 3HS3A 5CUQA 2HPAA 2RK3A 4LJKA 4P4LA 5DFAA 4DR5B 5ES4B 1VFNA 1UP6A 3R5KA 1TIPA 1OE0A 3BE4A 5FBZA 2ZZNA 1E59A 2RAFA 2I7VA 3IPCA 4QGSA 5A7FA 3Q72A 3VNQA 3R4CA 3ER9A 4OLHA 2NP7A 1TZJA 2WAYA 2ENUA 5JMPA 3GIWA 4YCLA 4OMFG 3TSAA 1GG9A 3OLYA 4ZO4A 3NM5A 3BMQA 1D5WA 3O90A 3I4CA 2BTOA 3TF5A 2CZQA 3EEQA 3SJCA 3KC2A 4BVJA 3F2IA 2GPJA 1L5KA 3TQRA 3FCEA 4F1WA 3I5MA 4PG7A 1EWQA 4KE9A 3M83A 4Q00A 3SYNA 3IQIX 1Z47A 3PTLA 3E8XA 4ED9A 1MRSA 2Y1WA 4KH0A 4RAQA 3WWYA 5LUBA 4EPYA 1G55A 2Q29A 5TGZA 1NQWA 1NW8A 3UPDA 4B6EA 1J20A 1DPGA 2VJOA 3DXFA 2EZ8A 4QDKA 4AKSA 4GPAA 3NBKA 3CLUD 3HN6A 4FZRA 3SXUB 3NBUA 2UUCB 1YVPA 3BMCB 3JAWA 3REFA 9MHTA 4HAVA 1DTWA 3BMOA 2HFJA 2ZW9A 3NV9A 4XJTA 5FOWA 3LY8A 3O7WA 3TWOA 3BIFA 4D8VA 5FTWA 5ARBA 2CV1A 4MLCA 5D1HA 2BFDB 1CVRA 3NT5A 2XVAA 1U5BA 3P94A 1XNGA 4FMDF 5J63A 3TNYA 3TLMA 1Z2CA 1P33A 4UVEA 3UT0A 1KKMA 1V0JA 5IJ0B 2HLDA 5CPFA 3K6JA 4WEQA 3UANA 3U7RA 3O26A 9LDTA 4DDVA 1NR1A 3W5UA 1EINA 2W7TA 1XFDA 1BXRA 1N1DA 3R2JA 4EA7A 3K8YA 2Q0XA 4D4IA 4HMQA 5HCUA 1OFTA 5I8ZA 5I7OA 1CJMA 3G2JA 1F6BA 2V8BA 3CUUA 1OT5A 2QRMA 2WYUA 4FLEA 2EJBA 4BKOA 2IA5A 4NE9A 1JAXA 1MX1A 3M2TA 1ZI8A 2PH1A 5EEHA 5DB4A 4DIMA 4Z4CA 1YRYE 2J9GA 3B13B 1O0CA 3LZCA 3CXRA 2H1LA 3VO2A 1DBWA 2DLDA 2EW8A 2IP4A 2HK9A 2ZBQA 4M0CA 4PANA 3TQOA 1VJGA 2EKPA 3HXLA 4RO0A 1THZA 4QX6A 2CVQA 3OZCA 4KSCA 1D1TA 1OIVA 4LY9A 4GI3A 1NQXA 1GKYA 1Z68A 2PL9A 3W8NA 3OPQA 1QYCA 1FCJA 4ZT7A 2RHHA 2A0FA 2HTEA 2C9BA 3DHEA 1J0XO 2B99A 3IPXA 3TQFA 5C8XA 1JHPA 4AQYB 3KKNA 2NZVG 3B5IA 4X97A 4LQLA 3GEMA 2J0VA 2A92A 1CRWG 3KIPA 3L7JA 3MILA 4YROA 1HL7A 2PZAA 4C4PA 4CKEA 1AGRA 3JWJA 4KP7A 4F3TA 4MCHA 1F1JA 2W6QA 1RWQA 2RHMA 4PLPA 1CIPA 3T06B 4HEA1 1Z12A 5BUZA 3VC1A 1U8ZA 2B8TA 2XTAA 4FQ7A 2B7CA 4UD6A 1X92A 1Z8DA 4JL5A 2WU4A 1MZPA 3JAWB 5B6JA 1AH2A 3SE0A 2GWRA 5EGSA 4JBGA 3UF0A 1F48A 1C1XA 4BMSA 2IS4A 4L8VA 2WKRA 1V3UA 3CGGA 2J31A 4OJMX 4Y6LA 3ZGXA 2RH4A 3PXXA 1YU6A 3F6BX 1BHJA 3MS4A 1V3TA 3IUSA 3PC4A 5D3ZA 4XFDA 3R77A 2XUDA 5TF4A 3RC3A 3JQBA 4B4WA 1WOYA 2WYHA 3FDXA 3HO6A 1KYQA 4KN5A 5IVHA 5F3WB 1T4CA 1QP4A 2VUIB 4A1FA 1F60A 2BUAA 2XUFA 2FRXA 4C0AC 3VZRA 4Q3KA 3BQNB 3Q0EA 3M6FA 2F67A 2PQ6A 4GOJA 4UBNA 3D5EA 1SOMA 5DRYA 4DV4B 1N9ZA 1UQUA 4ALMA 2BN4A 2QD4A 1E89A 5FF9A 4BRUA 2IVZA 3NQ41 1GPH1 2NXEA 3GEEA 4JAVC 3WQSB 3DFZA 5JD3A 1OA1A 1VMEA 3PRJA 3RIMA 4J2TA 3HVRA 1W85B 4WECA 3OEHD 3EN0A 1T2CA 4QOFA 1CLEA 2XA2A 2DY1A 5AOCA 3TZEA 3H8WA 4KR6A 3P0IA 3QVLA 2OZKA 3ZWVA 2P2GA 2OQRA 4A8JB 1I3KA 1ZZEA 1YR9A 3ETEA 2V6MA 3LBIA 3DLBA 4MKRA 4N39A 2R25B 1TJ5A 2GPAA 2ZULA 3EAFA 5FTMA 2LW7A 4FQ5A 1E1NA 4HQ0A 3L4EA 4MVJD 4LYFA 1Y8QB 1XF9A 3ECCA 3HRHA 1ZH8A 4OU4A 3SYLA 3K70D 3ETJA 1QRDA 2KWIA 4RH0A 1C50A 1EUQA 4DCOA 1JNXX 1FYEA 1ZNQO 1M67A 3LS2A 4RX1A 1RWXA 2J0UB 2PGXA 2W2TA 1OXUA 2XT0A 3GEGA 3GJSA 5HSGA 1GUBA 2A6PA 4MR8A 4A9AA 3OFNA 1X6VA 3UMJA 4F46A 5BNWA 3V3KA 1MJHA 4ME6A 4FSXA 3KQMA 4I2NA 1XQWA 4L2IB 2FSPA 3CX7A 1PR3A 4MGHA 1YHYA 2VCHA 1KI2A 3KJNA 5KQRA 2JFWA 3HDQA 3OOSA 2WIAA 3B1KA 4OG2A 2WFLB 5EUMA 2DHEA 3ZWBA 2WJVA 3OTQA 3DEJA 1UPTA 1HDYA 1XJWA 1JALA 2Y1CA 2X7XA 3NU1A 2WJIA 4O02B 4O4JF 2JI8A 1PK9A 3AY3A 3EMDA 5CFMA 1GDTA 3FKJA 4B3SB 1D1SA 1C9NA 2HMYB 3PHHA 4K3VA 1X3SA 1PRYA 4FE7A 1I4WA 4UOZA 3A3YA 3HMQA 2XVZA 5HG0A 1DG3A 4PAQA 3VU3A 3NT2A 4D81A 3UW3A 3MD0A 1TM7E 2OORA 2YS6A 1GN8A 5IU6A 1K08A 1XZKA 1L5RA 3LDGA 3I62A 2C98A 4ZDJA 3ZV3A 1L4GA 3SZ3A 3SHTA 1IQ0A 4ARZB 4E11A 1O94A 1S7CA 1HKHA 2QR5A 5B2FA 1B41A 5IH7A 5DISB 2YFYA 4MUYA 4NONA 4CKBA 2FF7A 4WKOA 3CNQS 3SYKA 2GZAA 3ZWQA 4WX2B 4CE6A 1V6AA 2FZKA 3KU4A 3EC1A 4RA6B 5B7NA 3ZVLA 4AY3A 4J03A 4GL2A 4N3NA 3NP9A 1KJYA 3LC0A 4EATA 5DXJA 2ZAYA 4HWPA 2ZRKA 2IE0A 2WR8A 3OETA 4RA6A 3U44B 5SV2A 1YWGO 2E4YA 1G8KA 1M6VA 1WBJB 1M0WA 4MI9A 4G4SO 2X2EA 2C2ZA 1HY3A 3WQBA 1RBZA 1AF7A 3G7NA 3ORQA 4H7PA 4N6NA 3T7SA 3TTVA 1DXYA 3KJIA 3QGMA 3M0EA 2CXXA 2WG0A 4HAUA 4FP9A 2JVKA 1OXVA 5C1OA 1Q50A 5REQA 4Y0AA 3EUFA 1D2NA 1EEXB 2NXJA 2PCLA 1U3TA 2EZ9A 5K8UA 2I03A 3CX8A 4IWXA 2V0NA 4JBHA 3WWDA 4B43A 4YAKA 4EB0A 1AQUA 1J09A 2FW6A 2Q4BA 2FYTA 3L4SO 3TLKA 2ONKA 2P2YA 4CL3A 1ISMA 1XZDA 4DLLA 2DU8A 2C3OA 3IPRA 4KWHA 4ND4A 5A4KA 2Q28A 1ONPA 4ND8A 3WSWA 2E6UX 1MABB 2Z04A 4QUAA 3BF8A 4R2KA 3GEDA 4ODIA 1OI2A 4DW8A 3TIXB 4IQ0A 3EGDB 2A5LA 4RZUA 5FV4A 2Z2ZA 3BEDA 1HQDA 1D0IA 4PGAA 3H5VA 1VL6A 3IKLA 4UMFA 1W4BA 1E5QA 1Y0BA 2DOKA 2QYHA 3WTCA 2J3LA 2UYYA 4WSOA 1XZMA 2B83A 2PX3A 3INYA 3RSFA 1FX0A 3D0KA 4P58A 3IOCA 4FYJA 1T13A 3KQYA 1LSSA 3OHSX 3RAJA 4A26A 2F00A 3T0FA 5DN6D 2H65A 1ZD5A 2XGOA 5C35A 4GRIA 1M34A 3CN9A 1KYIA 2KPOA 2OV3A 3ANXA 3TCNA 4BU0A 2WIFA 2OKCA 4EHAA 4D8UA 2ZWVA 3KOXA 1RABA 3LUCA 4NCJA 1DIHA 3DHNA 4DKXA 3TIGA 1EM6A 1FRNA 1U1DA 1II9A 1T5LA 2IODA 3IELA 4G5HA 3S1LA 4E4YA 3OQMA 3FX2A 1KOJA 3KJQA 2RBKA 2ZITA 4BBZA 3BJIC 1BU5A 4BFTA 5AVXA 2JJYA 4JLJA 5IULC 1BS2A 5FD8A 1Q84A 1EFUA 1Y42X 3QVKA 2C59A 4UDOA 1G63A 1RZRA 2NZXA 3H9BA 3EC2A 4URWR 3ODGA 4BEJA 4CMEC 4EFMA 1PUJA 5I01A 1H5QA 4O0LA 4QPPA 2WYVA 4P80A 2WF8A 2Q5OA 4X6XA 3UYLA 1LNQA 4B7CA 4OM8A 1SVMA 3E9RA 4L27A 3G79A 5CFRA 3B36A 4S12A 3OE7A 5AI9A 4ZEXA 4GVXA 1Y5RA 4NJEB 5BPHA 1G21B 3ZIAD 4CTNA 1C4XA 4MJLA 2CW5A 1PTKA 2E18A 4CM9A 3QNMA 4EPWA 1DL5A 1RFLA 2HRQA 9LDBA 3ILXA 2Q1XA 1TYDE 4X1IB 4NJEA 2BTEA 4PFJA 5HDQA 4Q82A 1O5OA 5FDFA 2C7QA 3ZX5A 4MITA 1H65A 1VPLA 2PIDA 4KWIA 4ZRDA 1AO3A 4EY5A 1P2DA 4R3WA 3VDMA 3O4JA 2CSXA 3I9KA 4BMDA 3ANTA 3FWYA 4UTNA 1AXRA 2B21A 4AMBA 1YMQA 4Y6SA 1P0MA 3WKBA 2WF9A 4CHTA 3VR0A 4U7TB 1XI2A 2PUBA 2CC2A 1C7RA 1I7PA 1SQSA 4TKUB 3NRBA 4JA0A 2JATA 2RHOA 1DAMA 3H3FA 3AJEA 4PYIA 1J90A 2FMHA 1ATIA 1A8SA 3FMFA 4ZVTA 5T4HA 4ZYZA 3JCZA 3W7AA 4KH1A 5FR2A 5GGYA 4R8VA 1JFVA 2W9XA 3DCNA 4ZQGA 3GRCA 1IRXA 3CR8A 3KYIB 2ZB3A 2QIPA 1Z0JA 2OZEA 2Z09A 2Q21A 4ZVOA 3V34A 1E2EA 2NXNA 4U7WA 1JVBA 2BKXA 3K20A 5TR9A 3HN7A 3KFVA 2I6TA 4M0EA 3A1TA 5SY6A 2WU8A 1U6JA 4PPGA 3HRKA 2HSWA 4YYEA 3WLOA 1XELA 1ELOA 1KBOA 2VYQA 4HWKA 4YCDA 1GQYA 3AEUB 2R6AA 4ZQBA 2P2SA 1Y82A 3ZBPA 1G8MA 1NG9A 3RS9A 1QG4A 1YI0A 1GPBA 3DEAA 5HHTA 2BGKA 2HQRA 4ZYXA 1X1CA 4U6QA 4BECA 2GILA 1EGHA 4K9QA 2MINA 3L6RA 5C2JB 3Q87B 5JS8A 4K3UA 4RBNA 3LBAA 3TS1A 5J2UB 3DR5A 4YCBA 2HW8A 3TH5A 2AD1A 3FN4A 4QVGA 2B8WA 4MJXA 3MTAA 1VSUA 4GI5A 3RS8A 5JCOC 2H4JA 1EBBA 2FPIA 2EF0A 2C3MA 2NVOA 3FNRA 3HEMA 3QKRA 1GG2A 4IDGA 3B12A 4D74A 4R1QA 3KQUA 2JLXA 2VA9A 2HA7A 2IITA 4CLXA 5SYMA 4HNVA 1MXFA 1QP7A 1XOIA 1M6YA 1BXRB 2IXTA 1EFAA 2L17A 1VB5A 3VDXA 4OLFA 2AFHE 3GLVA 1EP3B 4BZXA 1I3MA 3DXYA 4IDBA 5AM3A 5I4CA 4M7RA 1TE2A 1M6HA 2NX2A 3R09A 2QBYA 3VNBA 4JLVA 1NXTA 3T0IA 1DQPA 3NHUA 2MTBA 5K0TA 5I4KA 3JARA 3KV3O 1W5BA 4GECA 1KZGB 2X3YA 4J3JA 1CS0B 5ER6A 4MHOA 5DN9A 2F3PA 3BH0A 4LPSA 1AKYA 4AZ3B 3F71A 3MELA 1XQ9A 3AESB 5FWAA 3NAZA 2FPRA 3S7TA 2FKNA 4UUOA 2G1PA 1DB3A 3ZI0A 3SX2A 1VLVA 4RS4A 5EA2A 1PLKA 3LT1A 5BT9A 3F47A 4C3OB 3T5CA 4TT8A 3IBYA 4O2BF 3TM5A 4G24A 4IFEA 3TZCA 4Y1EA 2JI6A 4ZCPA 5AT1A 2R62A 2QAIA 2PNFA 2CEKA 2J9FB 2R8EA 3BAZA 5AUPB 2IUEA 1UFRA 3IOMA 3F8WA 4MQ5A 3NHPA 2WC1A 1NY5A 1ZR2A 2X8BA 3KL2A 4NY1A 2CL6X 5EYPA 1BXZA 2MYTA 3MLAA 2AD5A 3WGVA 2HUNA 3DC7A 3EFEA 4Z5XA 1VJ0A 1S7GA 3DTVD 4EI2A 1WUYA 1MFPA 1SNYA 4G81A 3NBYC 2X19A 4LTMA 3L1UA 3OMWA 1E4VA 4NENB 1U2GC 2JGNA 1PV1A 3HL0A 3OTHA 1IL0A 2WUDA 4OD0A 1HF3A 1NSYA 2V96A 4RK1A 1EG7A 1PVVA 1TIBA 1PZMA 1X2EA 1BDHA 5D3MB 3URKA 4I19A 1TKCA 3C6QA 4IMRA 2WY2D 4ENPA 3O1LA 3KSAC 1XMPA 2IDZA 2P78A 1G4AE 5J2TF 1N77A 4YV2A 2JGDB 5NLLA 4GBMA 2QVYX 3VZQA 2PMDA 2OXTA 4HPWA 2Y3IA 2KB0A 1E92A 2NO6A 1EE1A 1SRRA 2QMHA 4NBWA 4UHFA 4WZBE 2GJ9A 2FQ1A 2VNKA 2PH7A 5KU7A 1ZK1A 2AG1A 3X1KA 3LXUX 5TE9A 1G6HA 1NVKA 1VKHA 3ABIA 1ZIDA 4IRMA 4O4JA 3UWMA 1BOFA 2YWRA 1RHUA 3K9CA 1J9EA 1V9SA 2ZI3A 4OQMA 3UH0A 1NVBA 3H42B 4QBFA 3ADCA 3TZKA 5KPDA 1JLHA 4D3XA 1JT9A 1QH8A 1QZXA 4E14A 5E8RA 2VEOA 4NPAA 4TZ6A 1QZTA 1Z6ZA 1EZ1A 3H11A 3FPSA 5AJXA 2H4XA 1V11B 3C85A 3LVRE 1X87A 2JS7A 4LCJA 1P7CA 3KPWA 3JPWA 1US8A 4IIFA 5BN3B 5AHXA 3M3PA 2E6KA 1J6UA 5KUTA 4W9MC 4OO3A 1EWRA 3PC8A 2TMYA 3X2SA 3Q3JB 1Q22A 4UPDA 4Q5IA 3HV0A 3U2QA 2OHXA 2ZGVA 3BZBA 1Q6YA 2VJYA 3ZZ0A 5FQNA 4U02A 3FIUA 3N59A 3B38A 3RRJA 5FEUA 2QN1A 3KQHA 5ESRA 1G7RA 1KL7A 2R4TA 4MYCA 1S89A 2FZ5A 4XWYA 4EELA 1TLTA 5BVHA 3CN7A 2MINB 1XRNA 3GEPA 2AF3C 1XP5A 8ABPA 1QG0A 3O21A 2OILA 3PRYA 4B44A 4QICA 3T7EA 3A31A 4KXXA 4EUHA 1L5NA 3ABRB 3KKZA 4OQ4A 1TT7A 1ZUIA 4XA8A 2B36A 5JE8A 2COKA 2FPWA 2YC2C 4OU5A 1MJFA 1C14A 3GFPA 1PGOA 3I45A 4M55A 4QNRA 1C0KA 5EKSA 5LLSA 1K88A 1H1LA 1EMDA 1WVGA 2PKQP 4ZN6A 5B58C 4NMMA 4XPIA 4IMJB 3RBZA 4YALA 2GCIA 3NEPX 1Z7YA 1NVVQ 4C3UA 2OBNA 1NKSA 1DC3A 2I2WA 2R9VA 1JQ3A 1TGYA 2GZ1A 4I50A 1W4CA 4IDCA 3GVCA 1XTTA 4UPEA 4ZJUA 5AW2A 1HTTA 3PUJA 1N2XA 2WJAA 1PWEA 2J5KA 3LX8A 3LVQE 1QS0B 1QCCA 2P4QA 4EHKA 4FB5A 3ANNA 3VNRA 3EVDA 1CR0A 4E6PA 4R1SA 1TQDA 4Z2YA 3O8RA 1O4VA 3VYUB 3UW1A 2ETVA 2XVMA 1TQ4A 1Q12A 1HT3A 4Q02A 4TMZA 2H1WA 4H7KA 4NV3A 1MVNA 3ELWA 3PUYA 4P4TA 3DDUA 4JJ6A 3IT3A 2BBTA 1GPUA 2I99A 4QTUB 4CIXA 4L6CA 2D1SA 1M76A 3M6MD 4OAPA 2H2IA 2IEDA 5K01A 1E20A 1GFWA 4XE5A 1U8XX 4NU6A 3FH0A 4D9CA 2Q6LA 4AO6A 1IB0A 1T5TA 4B6GA 5BMOA 5KEIA 4N7MA 3BWCA 4YP9A 4F2HA 1JAZA 4ZGWA 2ZIUB 3HWWA 1WPRA 1S9DA 3QW4B 4H7HA 2IPXA 3X2EA 2P9FA 2QVZX 1SKBA 3DO5A 2GERA 3V4RA 3UPTA 1H8ED 4ZI7A 2ZJZA 3M6UA 1M5TA 1J42A 3NKVA 4P98A 4DHEA 1EM8A 1RQGA 2CLDX 4EEKA 1LSOA 2CBZA 1W0JA 4FIDA 3F5DA 4EL0A 4G67A 2C7PA 1EWTA 4K0RA 2BLNA 1QOZA 1ILWA 1J0EA 2OVBA 4FDAA 1GAXA 1J06A 3UB4A 1BX0A 1WXFA 4BPRA 3F78A 3DPIA 3NI2A 1I7NA 1L2TA 3OHPA 4NEQA 2B1RA 3BL8A 3LQ1A 4MCJA 3LGXA 4XWWA 1PG0A 5A3QA 3AJDA 5AVYA 4HAZA 5HF6A 4LFBB 1VSVA 3FSJX 2ZR0A 3KD3A 4NS4A 1KMHA 2YV1A 2GLTA 1GCUA 2R5FA 2DULA 1SCIA 1NFQA 4LVCA 1C9MA 1HLDA 3H83A 1EFTA 1XXHA 4P3KA 2A5JA 3SSNA 1QO0D 3K9FC 3RVDA 5HOQA 3G2HA 2MSKA 4IVRA 4KTVE 5EC8A 3BQ9A 3CWZA 2BI4A 3USCS 1HT1E 5TDHA 4J0GA 4UDNA 1AV6A 4QLOA 1P73A 1GQFA 3W5BA 1M2WA 3D7MA 2AW5A 2G04A 4IZIA 4BMZA 1BYIA 1Y5NA 3KXIA 4BQPA 1GWNA 2C77A 5B5SA 3DVRX 4TQUS 1FW8A 1QHHA 1N25A 1O94C 5DTMA 3HA2A 5H7XA 4DA0A 2QJOA 2QJRA 4RYLA 4WY8A 4GQIA 1JHXA 4UM8B 2ERXA 4AT1A 4MI3A 1HKUA 4EGQA 2JIMA 3ZWKA 4A6DA 4CVNA 4BNGA 1NXSA 3ER8A 3QE0A 4R8SA 2BGNA 3V6LA 1PJLA 4YUVA 5LPNA 3NYQA 5TEVA 2G8LA 5J4YA 5A4DA 2YJZA 2BM8A 5JNSA 4GZLA 2WOOA 3C8DA 4E7PA 1YSCA 3AIMA 2IRWA 3FTQA 4ENTA 1EX7A 4S2UA 2FEMA 2X13A 1XZHA 1TO1E 2WWRA 2C57A 3WIVA 2NV6A 3N3BC 4FD2A 1CKEA 4HBGA 4KWCA 2JG3A 3DOJA 4BFWA 4Z49A 5JCZA 4FWIB 1MORA 1JA0A 4H77A 2X0EA 3CLTD 1HE5A 2D2XA 1VYTA 1YRLA 1X1TA 3ELYA 3GFSA 1VJ5A 1BW9B 2J3DA 2HCTA 4JMPA 4RH1A 4S3MA 4CBVA 4YV7A 2HA5A 1N5DA 4KXYA 3T54A 3TXYA 2R7LA 3K15A 1ACMA 3ZZNA 5JROA 2PSSA 3ITNA 2UXCB 3AV0B 4EUKA 2VDMB 4JLUA 3YASA 2IOYA 3VOTA 4Q4AB 2KQUA 1DHRA 3WR5A 3GEHA 4YRPA 2IYFA 2WJHA 1FXUA 3K5WA 3ZE2B 4DSUA 1YNSA 4TKVA 3RYIA 3OPXA 4AK9A 3V48A 3WJ1A 5ALKA 4LISA 1IY9A 4IIBA 1TJ4A 1A7KA 1KETA 4FUQA 4QXMA 3WG9A 4EAQA 3V5NA 1THGA 2IZOA 3GGSA 5TS2A 2VDJA 1KJJA 5DBEX 1YIAA 5U1PA 1QIGA 2JCGA 1OY1A 3DAOA 4KIFA 2HO4A 3D3NA 4ZTBA 4NHEA 4BWGA 1MO4A 1UJMA 4DDKA 5HGXA 4WMLA 1P9RA 4RZXA 3IAM6 2A58A 2O2ZA 4H6PA 1YRQA 3PCXA 4NU8X 1ULAA 1RM3A 3F5MA 2AZXA 1D4ZA 3OIVA 4I9FA 5FOVA 2PGNA 1Y4ZA 4WTOA 3EWNA 1RXVA 1MNQA 4KR0A 2PAAA 3H9JA 5K09A 1L6RA 2LV8A 4KIUA 1KY3A 4PAWA 3SLRA 1UKCA 1XKQA 5BWOA 5ALMA 4LDJA 3AZPA 4WKNA 1I94B 3A9UA 4IZ6A 1FFAA 1CRQA 1KYZA 1M6WA 3G85A 4OV6B 2ZBPA 2X0NA 4OI4A 1V45E 4RSHA 1N2ZA 4B9EA 1I2CA 3I23A 3DVAA 5J23A 1M54A 1SVIA 3GRAA 3V4OA 4AWAA 3PUHA 3S8MA 3AZOA 4WK0B 1IC6A 4QYTA 1M8GA 2OPBA 1OFUX 4I4LA 1GR0A 1P6XA 2Q45A 5I7EA 2FMKA 1C30A 3QBEA 3QNWA 1EU1A 4CM3A 1DP4A 2HB6A 1AS3A 3ZS9A 2A9JA 1N2EA 3DHWC 4EG5A 1YDWA 3QKTA 4M87A 4OYRA 3A3NA 1VI2A 2L2QA 4BZWA 2O54A 2YZ2A 4QKQA 4U9IS 1K06A 1GA6A 1DIOB 1HFJA 4MMXB 3LPAA 3THOA 2ZE7A 4EJFA 1R9NA 2YVKA 5ITZB 1DEHA 4WADA 2A4MA 4KMMA 5G3YA 4D0SA 1DRVA 2EYUA 2WM2A 4YJFB 3N76A 1MDFA 2HCRA 2NO5A 3SXUA 1HDGO 1TD9A 2YY6A 3B52X 1JUDA 1G21A 1FNBA 1K75A 1U8EA 1RI3A 4NCHA 1T9DA 4WY5A 1K27A 1PJBA 4D0RA 3VSEA 5CIYA 3C3BA 1XUOA 2I8CA 2JJ8A 3LCMA 3PBKA 1VIVA 1RZUA 3QUSA 3R3YA 3K70B 4A0RA 1XXLA 4MGYR 2PT7A 3OLQA 4TVKA 2ZAGA 3NM6B 4NE7A 1ZLYA 3A6DA 3FKQA 2EP8A 3MIZA 4L3VA 4JC0A 2VXBA 4LJ8A 4UEOA 2LWIA 5D5HA 4Q16A 1BWPA 2OBBA 1A97A 1SG0A 1DARA 2B5WA 4WDQA 4ZRNA 3TD6A 3EXEA 1KVUA 3DGEC 2OWDA 5CW2A 4PGHA 3RJ5A 1CY1A 3KPVA 4UM9D 3L79A 3GVIA 1RNLA 1XB2A 3O8QB 4JGBA 2G9NA 5CCEA 5J4LA 3CB2A 1I4OA 1UWKA 4NX2A 2VBFA 2X86A 3K6SA 1ADJA 4ECAA 5IJAA 4FNOA 3FCCA 3PGLA 2XMSA 4MYUA 1FMJA 2J9XB 1JG2A 4BTVA 2G9UA 4GH5A 3WK4A 4BQIA 2C0CA 1NN1A 1N0IA 2AOWA 4JB2A 4KVZA 4UE3S 1Q2XA 1IY0A 2A9VA 2XEXA 1THMA 5JXGA 3AVXA 4EHJA 3TNLA 3UT5A 1XU7A 1OFIA 1V4NA 3LYUA 2VLBA 1N6LA 3NH9A 4PN7A 2I33A 3I4FA 2D1QA 3T4XA 5A4AA 2ZAOA 5C7YA 4MXDA 1URPA 5C4MA 1O77A 1AA9A 3WISA 3N2IA 1M1UA 3A8TA 2UXDB 4ZAFA 2PS0A 3FTEA 3UOGA 3VAYA 3HWX1 2DFLA 2C8KA 4DC0A 2NZ2A 3RYIB 2GETA 1WDWB 3TNJA 4DJFC 1OAKA 3HNOA 5THKA 2I91A 2AIRA 4OH1A 3DFKA 3TQHA 3QPDA 5GVRA 2VWHA 3LMKA 5FYDA 1D6SA 1F5SA 1Y4AE 4W5OA 4PC2A 3RPEA 1Q0TA 5L3QB 5AKKA 4Z53A 2ISQA 1K7FB 1TEZA 1CQZA 2Q3FA 2X14A 1GZ4A 3EASA 5TMDA 2FMFA 1W36B 1GITA 2K2QB 1I1QB 2H0QA 1ABFA 4MV8A 4ZVSA 1NJGA 1GRNA 2AN5A 5EE9A 2B4AA 1GL3A 3G7SA 1CZRA 2EOAA 2XYPA 3OQIA 3P9PA 3R6DA 3BA1A 3GLRA 1KU0A 1TUGA 2YHIB 5TQ0B 2A0KA 4E31A 1YZVA 1E1KA 4JLOA 4PYKA 5ICSA 5JO0A 4Q7MB 2VRCD 4Q47A 3SF0A 4D41A 4PHTA 5A03A 4DG5A 1W52X 1VGQA 3PX2A 1JIUA 2I66A 3GT7A 3LH5A 4A5SA 1C3XA 5J2TB 1S8AA 2ZRLA 1SRQA 1ZSNA 2V6IA 1RYFA 5MN5A 1Q1QA 3FPLA 1FP4B 1EUCB 4H9GA 2VT3A 3CGWA 3OWXA 4RFLA 5L9AA 3IIEA 3MAAC 1K6MA 3K3PA 6NULA 2CKDA 4JS0A 1E7RA 1C3EA 4RD0A 3RUFA 3MQFA 3C1TA 3PEYA 2VP3A 4DC1A 4QYWA 1L3CA 3FR8A 4C4YA 5BOSA 2HMTA 4TXNA 2ATEA 1M34E 1RRPA 3MPUA 1P4HA 3D7LA 1JEJA 4XI9A 1IXRC 1IY8A 5K0LA 2PTHA 3W5DA 4WDRA 3NXKA 4WGGA 3RC1A 4PLVA 1BA2A 3WLHA 5A3JA 1V16B 1XTPA 4D80A 4L4UA 4ZZ0A 1E79A 3IULA 5AUOB 5ADUS 4BHTA 1QGUB 1M83A 4X3PA 4G0PA 3AJAA 4HR7A 1VJDA 4TVOA 3R7FA 4B6RA 1XNJA 4UTRA 3ENVA 4DQVA 3HCPA 4GFDA 4BN5A 4RKEA 221PA 2W5UA 3JQFC 3SKYA 1R0CA 4L5AA 3ZWDA 5T5QA 1MAAA 3C98A 5GM1A 4DVGA 4PTYA 2Q3BA 3VR1A 5I8WA 4Q05A 4UXJA 2BJHA 2E4AA 3C3MA 1B73A 2C54A 4ZXPA 5BUCA 2CL0X 1ZJ4A 3B1YA 5H4GA 3O8CA 1X7YB 4E88A 3DXXA 1NW6A 3B1ZA 1YZNA 1Q3TA 4KOAA 4NNOA 3UM9A 5I9IA 3TGPA 3N8KA 2H5JA 3P0RA 1MO6A 3UJNA 1ORVA 4CG2A 1XEXB 1M2JA 3OT1B 5ERYA 1QOPB 2R4QA 1KVQA 3RAPR 2DQSA 2VATA 3O8QA 2DXIA 5DYWA 3GOHA 4B6QA 3A1WA 2BFNA 5BXQC 1RZRD 4CIYA 4C7OB 3S81A 2ZTMA 4FFRA 2XY4A 4R9RA 4Z1MA 4HNUA 4PLFA 1U6KA 3OF2A 4J16C 4YLYA 4QOHA 1MB9A 1DWQA 2DM6A 1Z5ZA 2C8LA 2GTHA 3EXFB 4JJ7A 2GZ3A 2GO7A 3JQFA 1YMUA 1W5AA 1YULA 2HMAA 5CYGA 3PQ5A 2XIJA 4GICA 2FR1A 2R7MA 1ITZA 2PEZA 2FWNA 3I9JA 4EJSB 3ZHTA 1L7MA 4X7PA 2O06A 1V6SA 3AT1A 4HH4A 2O0LA 2RONA 4AU1A 2FW9A 3EYWA 4INZA 4X8LA 3F73A 5JFGA 2VYFA 1JZSA 5E9WA 2RCYA 4I8XA 1G8AA 3GUHA 1R10A 4BJ3A 1JKJA 5E1OA 3LA6A 1F4VA 1L4YA 1OXMA 3H3JA 4V38A 2EYQA 1DX4A 3IEKA 4LDNA 1QKIA 1AB6A 2X6TA 3IAEA 4REQB 3V7UA 5G4KB 1C4WA 1V96A 3CWCA 4IUYA 4OLAA 1G5QA 4CLOB 4GP7A 1CCWA 5CB0A 1QIFA 4FGWA 3HVUA 4DFDA 4ZT5A 1N7GA 2P0AA 3ZU5A 1UP4A 2D62A 3CRVA 1OILA 7GPBA 3CPJB 2EL9A 5TQVA 1XL0A 3R3WA 2FZLA 3IVCA 2ARKA 2Z1MA 1U94A 1U28A 4MLPA 4BFYA 5KSOA 3A9CA 1CZLA 3U31A 4QFBA 4GD3Q 1T3GA 721PA 2EKBA 2FQWA 1XG5A 4L57A 4HNRA 4RS3A 4UPVA 3IXLA 1QIKA 5KI6A 5KNDD 4MA4A 4WFJA 1PV4A 3CUWA 4TRNA 1VB3A 1I13A 2RIRA 3DB2A 4RFSB 2JIPA 5C1PA 3BF7A 3QXCA 3KOOA 3G8YA 1OLXA 1IRIA 2MSCB 2O3UA 4ERXA 4FHGA 4S05A 1WCIA 2OBLA 2C78A 4QG3A 1U3UA 4W82A 4I5FA 4EYKA 2NVWA 1JR3E 4NV1A 1WKBA 2PD4A 1KQ3A 4P36A 4IICA 1CZKA 3INNA 4MEJA 3IUYA 1Q74A 4G97A 4N8DA 4EFDA 1SCUB 5EVCA 1JIJA 2OCGA 1OHHD 4BO7A 3RROA 2OAGA 4JD5A 4B35A 1CW2B 1LPOA 4LZAA 3L4JA 4YRZA 1Z0ZA 3ASZA 3DQZA 5ITSA 5FB3A 2PNJA 3BE6A 1JLLA 3RRYA 1QCYA 2XAAA 3I42A 3ZZTA 5IZCC 1CULC 3JQRA 2FSIA 1DGQA 1CDDA 1EESA 1SKAA 3DLIA 3TRIA 1K3UB 3U39A 1QDUA 1K66A 2XMGA 3KCNA 3SZRA 4X54A 3GLGA 1JFLA 3B6JA 3QFTA 3E3MA 2WWXA 1GCIA 4DYVA