4EMTA

Crystal structure of human sting bound to c-di-gmp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
175
Chain Sequence
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of STING bound to cyclic di-GMP reveals the mechanism of cyclic dinucleotide recognition by the immune system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Transmembrane protein 173
total genus 56
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4emtA02
4F9EA 4QXRA 4KSYA 4QXQA 5CFRA 4LOJA 4JC5A 4F5DA 4F5YA 4EMUA 5CFLA 5CFPA 5BQXA 4F9GA 4QXPA 4KC0A 4F5EA 5CFQA 4EMTA 5CFMA 4LOKA 4QXOA 4YP1A 4EF5A 4LOIA 5CFOA 4LOLA 4KBYA 4LOHA 4EF4A 5CFNA 4F5WA
chains in the Genus database with same CATH superfamily
3PQ2A 1KZ1A 3VU9A 5KJEA 4PINA 5G0VA 4GFDA 1I7QB 1RKUA 3AL0C 1DCFA 3ABRB 3ILHA 4WCFA 5H9WA 2WIDA 1Z0IA 3T9DA 1X92A 1VXOA 3WWOA 5I7UA 3F9CA 4XFKA 3D2CA 4FOPA 2RHGB 4X6LA 2ZU6A 2VT2A 2A5JA 5AT1A 3PE6A 3OQMA 2XKJE 2QRVB 2ERXA 4E5UA 1NQ5A 3RIYA 3T3DA 4N6NA 4F45A 5C7OO 4QXPA 3HXPA 3ESCA 1L4BA 5BOSB 2PQMA 5AKGA 1B14A 4HEJA 1KAEA 4MW4A 2JFBA 5KNDD 4QUAA 3NBFA 1B6TA 4E6PA 2OESA 4Q82A 3TZHA 1TYAE 3T99A 4B4OA 4X61A 5U1PA 3EQ6A 4GOND 4CF6A 3QKWA 2VYND 5CNJA 4QIHA 3KT6A 2ZIFA 3I9V1 4UVHA 3EC2A 3FCEA 3CX6A 3H2KA 4PLYA 2FUG6 4URYR 3KEGA 4HPWA 2VXBA 1KARA 1AXEA 5C18A 4IQGA 1CVRA 1Y9EA 2OM2A 1YB6A 3BMNA 2QM7A 3P52A 1G19A 1DC4A 4R9SA 3STUA 5IT5A 4G5RA 1NSFA 4OQZA 2NLOA 4TL9A 2ZBPA 5HKLA 3TZLA 3COZA 3FUVA 4G86A 3A9CA 3RRZA 3U3OA 4Z3KA 4IF4A 4KMRA 5ADHA 3ABOB 4H3SA 1NG9A 1HG0A 3FN4A 1Q0TA 2HXGA 2O5EA 4CG2A 1TAUA 4DBZA 3IPAA 3GHHA 2A35A 5JCJA 2XSZD 1RCFA 1TAHA 1DGQA 4KV7A 1E3WA 3UBMA 3ICVA 5AVOA 4PHHA 2QTVA 2AF3C 1G3IA 1KRHA 4JLMA 3E5MA 5GM2A 1Q91A 1SCNE 4YWJA 3KOOA 3WWPA 5INTA 2BEVB 1QQBA 5AXCA 2J6HA 2PX2A 3MTBA 1EUCA 3ORFA 1JV2B 3NYRA 4G65A 4PYOA 3Q7TA 4FONA 3B7PA 2RHRA 3NUQA 4UM7A 5BMVB 1II0A 4FC6A 1OFHA 3GJZA 1CLEA 3HE3A 4PCVA 3HKCB 5TEWA 2FE1A 1R0ZA 3BGOS 4D8UA 4MDYA 2PNFA 2C5HA 3JCZA 4OSPA 3Q8LA 2ZE7A 3IEMA 2IYRA 3O84A 1M1NA 3NGXA 5DLQC 3CVYA 3CYFA 2EZTA 1VA4A 3OICA 5C8YF 1Q21A 5CB0A 3IBYA 1CQWA 4EGJA 4KVZA 4EFDA 4HXYA 2GDZA 2LD4A 5KX5B 2VTEA 4GVXA 3RVQA 1XPUA 2CUKA 3QEMA 2Q62A 1DB3A 2FSPA 4KSYA 4P4NA 1PZXA 4DWVA 1USKA 3GC6A 1XNJA 2JLQA 1U4SA 3SSMA 4E1BA 1EYZA 4URWR 4O63O 2HD4A 5TPWA 4YAOA 3ZPXA 4F4DA 1Y7LA 4GP9A 2AXPA 3FNBA 1HA3A 2R1VA 3E7XA 4FMCB 3AJRA 3GPLA 3TLAA 1USUA 1TZBA 4B6OA 1GG9A 5F64A 4HB4A 1UDRA 1DLIA 1JAIA 2QT0A 3OT1A 1X8KA 4GDMA 4DTIA 3H5IA 4ZOLA 4BO0A 4KH1A 1B1CA 1U8TA 3KYDA 1Z7GA 1FMCA 2ZOSA 3N2LA 2I62A 2OP0A 1BVRA 4OM7A 2C5AA 3SNHA 5KTSA 3CKYA 4S35A 2DGDA 1UP4A 3Q85A 4WD3A 4XRGA 4NSNA 3QQPA 4Y6SA 3HA7A 4NYJR 3STXA 3ZXXA 2DY1A 4HUJA 3ZYCA 4MA4A 5HIAA 4NEQA 2V8OA 1S9HA 4ZOLF 1NIJA 2WVAA 3DEKA 3ZDEA 2BCGY 2FMHA 1L7RA 2PZBA 2XNHA 3EVGA 3EARA 1E3TA 4FW8A 2BSXA 4TTTS 2DPGA 1SHKA 3KEOA 5T4FA 5HZKA 1YA6A 2P2DA 5DCWA 2G9NA 1R6BX 3GNQA 4CUZA 1SXJA 4UTZA 2I2DA 1IN1A 3IE1A 4FB4A 5DF1A 5LU8A 1GOTA 1NVTA 3TN7A 4ZN6A 4V0SA 3MAAC 3OJOA 1C1HA 4FWIB 4M9RA 2VDLB 4XTCS 3GCZA 3TW8B 1N78A 3A3PA 1T8SA 2WVGA 3PWZA 3D0RA 2G72A 4HP8A 5JR3A 5DRTA 1YS2X 1X7DA 3FYCA 4GR4A 4H3VA 4BMXA 5AVWA 3GEBA 1KJWA 2O8CB 1ZX1A 4IAOA 3ZDCA 1J8YF 4WBNB 1SHTX 5CDHA 3K71B 2A1UA 2PDAA 4P38A 1Z4OA 5KHOC 1AKUA 4TLMB 1ZGJA 3UB3A 1MB0A 2I1VB 4NLLA 1L8QA 2OUKA 2WJIA 3FROA 1THTA 1UM9B 5K3BA 4ZC8A 1MTOA 1Q0HA 2AKYA 3ISVA 3PUIA 1U2GC 5LBUA 4AMZA 4EY4A 4BVKA 4JJFA 1OPRA 4CEHB 1Q1ZA 4H0CA 4ABTA 3G0BA 1W36B 3QPDA 4OHPA 4I5GA 1ZN8A 1XFDA 4RGVA 3E61A 2W71A 1SVOA 3KKEA 4NAUA 1EGAA 3L46A 4D26A 4IXMA 4OF4A 3EEFA 1L1QA 4JXJA 1YULA 1VL1A 1M1XB 4KNVA 5EE1A 4AWAA 1JJVA 3NP9A 1UXHA 1NJFA 1YL7A 1QLJA 4HEA6 4ZVRA 3KB2A 1C2TA 1UZMA 2V7WA 4C04A 5H16A 3SF8B 5T41A 3T3NA 3II6X 5JBIA 2HZ7A 1RQGA 4Z0NA 1WZEA 4C3UA 1T4GA 2IQ5A 2QLJA 1RWMA 3ND5A 2WVHA 2EWVA 3H5VA 3TUIC 3S44A 3U7EB 4FLMA 3JAMA 4MITA 3RS0A 4GI5A 1G98A 3QGMA 2WDPA 1Z5ZA 3ZK9A 2IYSA 5ALXA 2QORA 2I7XA 1S4MA 4BGVA 5K03A 4E21A 4OJNA 4CLRB 3MMSA 3A6EA 2GFIA 5H7XA 1A77A 2RGAA 3NP7A 1PL7A 3ELBA 1TA0A 2ZE6A 2BKUA 2J3KA 3ONVA 3TKYA 1CUVA 1QFYA 2FR8A 4KN6A 5JI2E 2W2QA 3HV0A 3L8EA 4JJIA 4QTXA 3S2UA 2VF2A 4IGFA 4PC7A 4OBWA 2CXRA 1XU7A 2WJZB 2XHEA 3QW4B 4C2UA 4R31A 1CUIA 5TB5A 2IU0A 1J5XA 1O9GA 3A1SA 3W2HA 1K0UA 1E6EA 4IHJF 4J0JA 4AS1A 4MTCA 1EHCA 5ALDA 1VKJA 3GGJA 3NRBA 1KBZA 1S3FA 4A0RA 1P5FA 1RM3A 1BDBA 2AMLA 3VSDA 3W6NA 2H4XA 1K9VF 4HDRB 1CG6A 3HNRA 4O2RA 2B6HA 4Q4JA 4R54A 2FPUA 3WKEA 4LX8A 3DP9A 4EMBA 4UTVA 3T1QA 1T35A 1X39A 1DQRA 4J94A 4WEOA 3GJRA 5BP7A 1RQ2A 4B46A 3L7JA 3N05A 4ER0A 1L5OA 3PNQA 3R5SA 4RS3A 4TQAA 4YRZA 1MJFA 4LJ5A 2FEKA 4ARZB 2X6RA 1QE3A 1USGA 1RRCA 1W7AA 1Z88A 1JTEA 1T91A 1H3FA 2J9ZB 2PV0A 1TAGA 2H4YA 4JI6B 4ZYTA 2ISCA 4BECA 2B3DA 3CG4A 3DCNA 1B8UA 1NTOA 4JHLA 4TSRA 2PRIA 1P72A 4IWNA 3VAYA 3OFVA 1PD1A 2MSNA 4R8KA 1RBQA 3DXYA 4WFJA 3RBVA 1TQDA 3SJAA 2I7CA 4BUCA 1T29A 4XYLA 4DNXA 1NX9A 3PIIA 5FUVA 3KVYA 6Q21A 2XGJA 1YI8A 3JZFA 4NDZA 4UOQA 3UTDA 3DOHA 2AR9A 4ZGGA 2PYZA 2E5FA 1ECFA 2V58A 2XECA 3LKZA 4PTZA 4BKMA 4L7VA 1LI7A 3O73A 2HSGA 2IYUA 4Q7QA 3K8QA 1POWA 4CLDA 4EJ0A 1E7WA 1L5FA 5L45A 4PYQA 2FPGB 5CFRA 1WTAA 2PXCA 1ILEA 4U2DA 4EHDA 3GCWA 3CKLA 4TKUB 5F4ZA 3MNFA 3H4MA 1A4IA 1ZIDA 1RJDA 4OHVA 1S5PA 3PCRB 2GQ0A 1NVUQ 1P7ZA 3WGMA 2AN3A 4MV9A 4UCQA 1SU8A 5A9RA 1K2VN 4BLUA 1Q11A 2WT9A 1I2ZA 2RH9B 3FLMA 1BS2A 2H1WA 4QZVA 1F3LA 3GFGA 4NOKA 1R74A 1ZLYA 3JXEA 3BFVA 3ZBPA 5A3JA 2INGX 4QYMA 3SEAA 3L5OA 5IPFA 3GUUA 3OUZA 3SZUA 1JYFA 1EP9A 2Q9BA 1PGQA 1Z36A 1F2UB 1BX1A 2NYAA 2XCIA 4FHEA 3ZV3A 1EFHA 3ZWPA 3G5MA 3GGCA 3ZG6A 5EJ6A 1CQJA 1SFRA 1SKQA 1XVAA 2JIQA 2NYVA 3T52A 1E2EA 1TEXA 4WJZA 2YV2A 4MB6A 5BOSA 2X15A 1PBNA 3AF4A 5FPYA 3G79A 5DX1A 4Y9DA 1T2DA 1I2AA 2VXCA 3NYQA 3RSQA 3IOEA 4ES6A 3GRVA 3GEHA 3ZEIA 2I78A 2PX6A 2RI1A 2WU8A 1S8NA 3SF0A 4HSEA 1A9XA 5J59A 1U2SA 1ABFA 1V71A 5EMNA 5DHAA 2FW8A 3HY4A 3M3PA 5K05A 3ESZA 3WKDA 1A9TA 4ENRA 1D4OA 1E4VA 2FQWA 3O3MB 4A4DA 5JHHB 4KN9S 4O8ZA 4UOZA 4ZCIA 1P45A 3SF8A 1GT91 3Q6NA 4D3XA 3GVXA 3AHIA 4X1YA 5HKAA 1FX1A 4PEVA 1FQJA 1ZK3A 2AN5A 1JBEA 1RPJA 2GLTA 2DJ5A 4NEHB 5ALYA 4UVDA 3AM3A 4C7JA 4D8XA 1RYMA 3MD0A 3UBTA 3NU1A 1N3YA 1KYTA 2WHYA 4LXXA 5SY6A 4IHAA 1BYIA 3L01A 1CDZA 3PFIA 3WQQA 1O4VA 4GWGA 5FBKA 5B12A 2FF5A 5CITA 2GCEA 3PRJA 4QAQA 1DHTA 1ODTC 3WLNA 2L18A 4Z7JA 2C95A 1E3WB 1SQ6A 1SUFA 5ALUA 2CFCA 2RGRA 2QYSA 1KOFA 4E13A 3OP1A 3UAXA 1X8LA 4EF6A 4JUFA 1E3EA 1NJ6A 4HB3A 5TQVA 4F1WA 5JMPA 1DS6A 2C2WA 2K2QB 3L0CA 3DW3X 3BEDA 2ZRKA 3QEOA 4UOEA 4L4ZA 4MGIR 4X1KB 4TZ6A 3CTPA 1EVQA 2WMDA 4O0LA 2GXAA 3SG0A 3AVUA 4MDHA 1N0WA 4NMXB 4YRTA 4CF7A 5EZ6B 3A04A 4DRZA 4D41A 5F98A 3F6BX 4IY1A 3A6ZA 1Z7BA 1XCOA 4HDRA 2O8FB 2CF6A 3ROFA 2J9YB 5ECWA 4GPD1 5F1KA 4YLEA 3FPAA 5DBHX 1E2BA 5KX5A 4ZT3A 4FJ1A 5HXAA 5DYIA 4V2UA 3ZIAD 5K0TA 2P6OA 4W5OA 1FBTA 1ZVQA 4R68A 5JEDA 3ZDAA 3OQJA 1ZJ4A 5K3OA 1JBQA 4KODA 3THOA 3P9QA 1VHTA 4A6EA 3CPSA 4I4NA 4ND3A 5DGTA 3C1AA 4P34A 2WZBA 1K9SA 2Q5CA 2PMDA 1NXOA 3L8GA 2P6MA 4LXIA 1HLDA 3RS3A 1WABA 3M5WA 5A5DA 2JLWA 5DK4A 1P3JA 2ZT8A 4N8EA 5EP2A 5IRCD 4W5QA 1CUYA 3FTCA 3PF9A 2NVUB 3VH2A 3RR2A 2M98A 2CNOA 2XNDA 1WULS 1QFXA 4K81B 4BASA 2H3HA 4YAJA 1UJ2A 5KQMA 5JLAA 1ZH2A 1V9SA 3ANSA 1CUEA 4E2ZA 5LMUB 3L4BA 3DOIA 3KLBA 1GCOA 1E79A 1AF7A 1G5HA 1UBMS 2HBYA 4YA6A 4FDLA 4RTMA 1P3Y1 5KVVA 1DWOA 1K3UB 2YXBA 3LVQE 5K4HA 2ZAMA 1U1GA 2VHEA 2WTXA 2ID9A 1HZZA 1NZJA 2OFPA 4MQEA 3KOYA 3IT2A 5K3AA 4C6TA 8OHMA 1TYDE 1ZMTA 5KTMA 1XJ5A 3FNFA 3VNRA 1KWGA 1VLVA 1ZMRA 3OO1A 1Y6JA 5BN5B 1PSDA 2Z5VA 2ZGVA 3PQCA 4YRRA 1ST2A 2RHLA 3FPSA 3H87A 4REQA 3H8VA 4NFYA 4XUCA 4R81A 3Q7IA 3VNSA 1NE2A 3GLGE 3RCBA 2F1HA 4DCPA 4EJSB 5EJ4A 1Y6FA 4QEDA 1LBHA 1P4RA 2J3QA 2XA9A 4K7JA 2IEBA 1U8EA 1V8PA 2O2ZA 2QX9A 2Y1CA 3ZGVA 1VKOA 2FG5A 4EMTA 3JS5A 5TLSA 4B3SB 3W8NA 3EQ2A 1LTKA 4RMHA 3T1TA 3IMKA 5GVRA 1LVUA 1QTIA 2HA5A 4K9PA 5DTRA 3RS8A 4N7BA 5IBCA 1FNDA 3FZGA 2REBA 2DBVO 4QM7A 2P9EA 1M1NB 3TNJA 3GLUA 2O8EA 1A8HA 1JHRA 2Z5FA 1C7FA 1M1YB 4KQWA 4W5WA 3I0MA 4BN5A 3A1DA 3UJ8A 3LQYA 4II7A 1MHPA 3KPVA 3ZH9B 3CPJB 5LVAA 3VZRA 2YMMA 3NHMA 5AM1A 1SPBS 5D5HA 3OFNA 1RM0A 3KQYA 4KSBA 4M6WB 4WY2A 3UANA 2BFMA 3O91A 1WMFA 4OQEA 3LQ2A 4IXNA 1C9EA 4S12A 4NOMA 1A9OA 2P91A 1VRWA 1U3VA 3MW8A 3QLTA 2Q5HA 3OPVA 2D0PB 3DBLB 1JLRA 1T1SA 4KO4S 2A58A 3MTEA 2GPAA 1SIOA 3L9XA 3S99A 1YJ8A 3AFNA 3QYFA 1H23A 3B6JA 2I2CA 2V55B 2C4WA 4G8JA 4ZAGA 2GTIA 3HVIA 3NEYA 3TZEA 4YTEA 4P0PB 1ZD8A 1BD3A 1C41A 2ZIUB 5I9IA 3B2EA 3BWBA 1T4DA 2I6QA 2YWBA 3RC9A 4EY3A 3L6BA 4QGSA 1Y7IA 2ODEA 3EMBA 3KJEA 3UUEA 1AZTA 3FSJX 2BGRA 3BSWA 2QM8A 3A28A 2VPPA 3ER8A 2CY0A 1LQ2A 4TPKA 5LQUA 1GCGA 1Z6XA 3C8UA 1A8PA 3P0RA 1EVJA 4BYGA 1VXRA 1X7ZA 4QVIA 4PSCA 1IVNA 5JNRA 4QU0A 4KV9A 4FOOA 3T0IA 2PVSA 4IX9A 1LBIA 3ZXIA 1G8GA 4BVGA 2EKBA 4QGGA 1A71A 1MOZA 4UJ5A 1V5EA 2XUDA 4IP0A 5C34B 4CMHA 2FB9A 5IU6A 5EC8A 3FOWA 3AIIA 5JSZB 1ZAKA 2EBHX 2PO5A 4XDZA 4YHBA 2GB4A 4JYPA 1DLJA 1N25A 1W2GA 3DC2A 4V02A 5HRUA 2EBWA 4MKHA 1CS0B 1N2CA 3LVBA 4CUJA 5JDIC 1FB5A 5FI1B 3Q9LA 5BR8B 5BUSA 4PM4A 2JW5A 3DCIA 3TD9A 1U9IA 4TMWA 3OE4A 4X8OA 4CM4B 1T0IA 3PKZA 1AGRA 4DWJA 4KP7A 3CO5A 4HLUC 4JKOA 1DJOA 1LF0A 1M1UA 3G2QA 1SK9A 1T10A 3K09C 3R9KA 4I3GA 1HL3A 1NQAO 4FEEA 1VMEA 4V0RA 5EY5B 1K8RA 1SOWA 3T5BA 1BJRE 5KWVA 4C29A 3L7KA 1UUFA 1C0EA 2GJ9A 3LA8A 1RI3A 2HCRA 5GJVC 2NO7A 5L7WA 4L6IA 1LU9A 3AW8A 3F2IA 3TL6A 4D0GA 1VHDA 4UBOA 1G8HA 2Q3BA 4DEXA 3HR7A 4KH0A 2JCXA 2PEYA 4TQ9A 5JARA 2HK9A 1XZNA 1F0YA 2IOQA 5MFPA 1AMUA 2NTVA 2D1SA 3I3SR 1V3QE 1GNTA 3FYUB 3RVDA 2DFPA 4U63A 4YP5A 4OB6A 2H4WA 2P9YA 4Q0MA 3WIDA 4AICA 1T2NA 3FDZA 2XUHA 2TMKA 5BSUA 4C7XA 4DEVA 1F0KA 2XMBA 1U2EA 4L0QA 3ZHOA 1DQZA 3D7LA 3ZWMA 1OI7A 1TJ4A 4D57A 2V9ZA 1NFQA 2A0WA 1JUDA 1BVUA 4XCVA 4DCMA 1EGHA 1V4NA 1W1UA 3UEOA 1TNDA 5IX8A 3VVMA 5A0VA 2OBNA 3C4JA 3UW1A 3AB7A 4RLHA 5T8KA 1Y7TA 3CCCA 2OFOA 5TE9A 1D0IA 1YCGA 3V8MA 5L3SA 3LT5A 5EQDA 1PFVA 2WKWA 1G7RA 1WDMA 5AI9A 2IUYA 3W5JA 3G8AA 1NP7A 3L02A 1JQDA 3NBQA 3RYIB 5LL6P 2HTEA 1ZGHA 3IUSA 1GTJ1 5AUQA 3AQ4A 2C92A 3QXJA 5DM70 2PLWA 5BXQC 1D8TA 4X7RA 3PE3A 3E18A 2G40A 4LJYA 3F6SA 1MAUA 3QIVA 4L75A 3AG6A 3PRHA 4QUJA 4TV9F 1RI5A 2AWOA 4ZZIA 4J90A 3AUKA 1VCOA 4BU1A 3IALA 1QWSA 4IVNA 5JADA 5AVXA 1CDDA 1JB9A 4MPRA 1Z6ZA 3VOAA 3AM5A 3EDOA 4M0PA 5K3DA 2IZ6A 3TZBA 1ZGCA 2J33A 3A2MA 4BX9A 3RBXA 4BLTA 1YOVA 4X41A 2A0KA 4HYTA 3LXRA 2ODTX 4ND8A 1T1IA 2GHQA 4WADA 1GTRA 4UXIA 4EUSA 2BFEA 4HTFA 1XL0A 2NQ2C 2ZJZA 3L4BC 2G9RA 4TTRA 5B7GA 1GA4A 2Z58A 4JLNA 3SJBA 5EIBC 1NY6A 2JGIA 3AL2A 1BXGA 1DAOA 1WKBA 2MSCB 4J16C 4P4TA 1WU8A 3KR2A 4F7WA 5IJ9B 2HFKA 3LTEA 3LGSA 1Q0SA 3B8EA 3CEHA 1P5HA 1F9EA 2C84A 2J6IA 1HO3A 3DP7A 3LD9A 4G36A 4N12A 3UOGA 3W2IA 1G3RA 4Y6LA 1JHZA 4P3NA 3WLFA 2GYUA 2VWHA 3CN9A 3EGEA 2WWFA 3GU3A 4K28A 3TLMA 4DV1B 1KYYA 1OXTA 2JAHA 1XTZA 4L9RA 1RAHA 4RTNA 1EFTA 1P9OA 4G97A 1E2MA 3DBLA 4CU5A 4PLVA 1ZH4A 2F43A 4JXKA 3TXYA 3N07A 3E3OA 4I55A 4GQAA 3O6VA 1PNTA 2QD1A 1GP2A 2ZJ7A 3NPMA 3R5HA 4OOFA 4QXQA 1H6CA 2YVLA 2ZEJA 3PPYA 2WVJA 5C0OE 2WOJA 2X42A 1Q1EA 1BWSA 5DISB 2WM2A 1A9XB 3KQKA 1KRWA 4M1EA 3LUBA 1EHIA 1CUCA 3R3SA 4F71A 3CF4A 4NCBA 3IUNA 2NSJA 2XDQB 3OLCX 4Q4AA 3NHKA 3IV9A 1FLDA 3REOA 1VL8A 4YMGA 1O94C 4WN9B 5FBQB 2H31A 3U9TA 5EEGA 3RFFA 3VPGA 2VZLA 4J1SA 3DEZA 2HXSA 4H7FA 1FP6A 3FETA 3O8QA 4JN6B 1P77A 4J6FA 5EXDA 3K30A 3T1VA 1NNSA 1LZLA 2EP5A 1GAXA 2H1LA 5JAZA 2ZUEA 4GXTA 4ND4A 1R10A 4NIMA 3ROQA 1OXUA 2FP3A 4X45A 4Y3UA 4B4KA 5C81A 4NF2A 1R66A 3PKIA 1T43A 4IDAA 4PRYA 4FQ8A 2IY9A 1ISSA 2P2CA 3BD8A 5CEFA 6ABPA 3Q1KA 1JLLB 3DTNA 3FTFA 1I80A 1O2DA 4UASA 2VYFA 3H18A 1TTTA 4JP8A 1SRQA 4HDNB 4U9IS 1LJLA 3SYMA 3LRPA 3WMGA 2C1ZA 4F4HA 4EG6A 4PQFA 2UXCB 1L6RA 2WWGA 3DMHA 5JAIA 1QK4A 2WSMA 4H7JA 3SFVA 3ENKA 2P41A 4BQPA 4BTEA 5I7HA 1KJJA 1EK6A 2R8XA 3U4HA 5ITSA 1M34B 1I3LA 3U16A 3G9QA 3THYB 1TF2A 5AJTA 4ZKDA 4JL5A 3F98A 1JEAA 3KJNA 2WWWA 3DW1X 3JX9A 3PGVA 1N4AA 4WBNA 5I8WA 5IVPA 1IZ8A 2QTRA 3KUXA 1ZW1A 2ZSKA 5C7IO 1EP2B 2F1JA 1Z3CA 3ZY5A 4BNWA 4TTSA 2YYZA 1AKEA 3CURA 5KYXB 4KR9A 3IUMA 4CHTA 4EGQA 2FPWA 2ZUWA 1VE6A 3R3YA 5E8RA 5IBRA 4DNFA 2RKBA 2X7HA 2V8BA 2IHUA 4D3FA 2R1TB 1V47A 1RRPA 1FTSA 1W0KA 2LXNA 3AFIA 3NJ8A 3O92A 3UNXA 4EJSC 3T1YB 1ZK0A 2HHJA 5FV4A 2JLUA 4AY6A 2HU5A 3IP1A 3SDBA 3LT0A 3K1JA 2C5GA 3JQBA 3PFGA 5ARCA 1EE2A 4XSVA 2VJDA 1SOUA 4WKGA 5CW1A 3ZE0B 3ZW9A 4AROA 4MHSA 2VDQB 3HA3A 5DV9A 5KNBA 2VQFB 1XMIA 1FU8A 4KPEC 2QTWB 1N92A 1BH2A 4LF8B 4TTAA 2EQBA 3P45A 2HEIA 4BIMA 1M5RA 5DHTA 4O08A 2COKA 2I3DA 4CF4A 3SSAA 1GHTA 3Q7EA 2C4KA 3ML1A 5DWDA 2H1VA 3V00A 4BP8A 4WXMA 4E5VA 1B3RA 1E1QD 5AMXA 3RTAA 1XTTA 1S0UA 3F9IA 1JJFA 3K5PA 1HF3A 3BX1A 2VCHA 3AT1A 1WMBA 2AC2A 5DCUA 4C43A 3AHDA 4XJSA 3VGPA 2Z2JA 1I32A 2FFQA 5K8JB 1E1RA 2I6TA 2X3FA 3HEMA 1W52X 4XOIA 1Z26A 3RHFA 2Y0EA 3BFPA 3LDGA 4INAA 4XWTA 3HSSA 2RGCA 2H0RA 1SHZA 1EWQA 1IN8A 4NZZA 3HEBA 4TRRA 2WSYB 2B25A 2R8YA 2FRXA 2X9NA 2A78A 2OR3A 4YI5A 3HBMA 4EG7A 4WI1A 3KCQA 2OSVA 1QFZA 4R6WA 5JE8A 5AH0A 3QVVA 4N5HX 1Q95A 2D1YA 1Q16A 4P92A 1NR1A 3CEMA 4L4YA 3SC3A 3UB4A 9MHTA 3UUFA 2WU0A 3MN1A 1MC8A 4GRAA 2CLDX 1UEIA 1VBKA 2UZAA 3QWHA 1BE6A 5AW8A 3RLIA 4EO4A 2C2YA 4P32A 3UJBA 3WWCA 4AJIA 1PR2A 5TF0A 1R9JA 2BEWB 2QJFA 1NI4A 4IHJB 4AVYA 5KTRA 4IIJA 1I10A 2WQ7A 1WWKA 3BIXA 3KJIA 4J29A 4GAEA 3EIFA 3WLEA 4JUIA 1W5FA 4F96A 5CNIA 2AE2A 1PWYE 2GOYA 4AYTA 2UXDB 1ORDA 2OXEA 1L9KA 3PC4A 3NGMA 2LW7A 2YN2A 4P4LA 5BW5A 5J4YA 5FIUA 1NNLA 4E5SA 1JR3E 2VUTA 4X24A 3G89A 4ALJA 1W29A 2ZUVA 2QN3A 2VK8A 2W6NA 5AJHA 1RBMA 4QJ3A 3EXHC 2I99A 1YZHA 3GZNB 2DE0X 1GQYA 4ZVMA 3W8DA 4UTPA 4JUCA 3IBTA 2TMGA 3NONA 4QOIA 1Y8RB 5DLEA 3MGKA 1SQ5A 3AH8A 3OEHA 4D3SA 3O8RA 2RCNA 3V4SA 1B4DA 1FZTA 2H4HA 2WV9A 4M36A 2FSVC 1BVHA 1WEKA 4KRXA 4EVIA 1GZ3A 1RE1A 2G70A 5E3JA 2ACWA 3IQGX 4WMLA 5LC1A 5T6MA 1UKEA 3BT7A 4QVGA 1I0IA 1FDSA 3KQMA 1O8BA 1Z3IX 1V5FA 2YFKA 1X14A 4H3KB 3NWEA 1VMIA 1X1BA 3OZEA 4HFRA 4B8ZA 4QJ5A 4YMSA 2IRWA 1PZNA 3BAFA 4LC9A 4A1OA 4CMIB 4OXKA 4QNRA 5M29A 3SZ3A 4DIDA 3WNCA 4MWTA 2HN9A 5J5CA 2F3SA 3DAOA 2AN4A 2Z9BA 3AP2A 3WMXA 1MB9A 2H5EA 2CB9A 2H16A 5A7HA 2AL7A 2OG1A 2CHFA 1H66A 2JJ1D 3V33A 4JL8A 1V1JA 2ZYVX 1U0OC 5FA5A 1NVWQ 4G0PA 2ZI6A 1ABEA 1ENPA 1W4ZA 3NANA 4U8HA 2HMAA 1E9BA 2AR7A 3MFYA 4EKIA 4F11A 2OHGA 1T5BA 3CC8A 2ZSAA 4MO9A 3TE6A 1Z16A 1CXZA 3EISA 1PQ4A 3MT0A 4KWCA 4L78A 2O50A 3NAQA 4XUGB 3RARA 3KKOA 3PQ7A 2BELA 2HMSA 3DUWA 1I3OA 4LYEA 2FJ0A 1T3LA 2QVBA 2UYGA 3F1LA 1D7AA 4DKXA 3T5CA 5EIFA 4HDMA 2ERYA 1E7YA 5IT4A 1OV6A 1TIPA 3BIFA 1AA9A 1LC3A 1MPTA 1NBMA 2J0VA 3I3OA 1IBLB 2ZBFA 1PLJA 3HMKA 2WTEA 3F7MA 1VZ2A 4GVPA 1BMFA 1XP5A 1RU3A 4W9MC 1P29A 1GLVA 2PUBA 3DOJA 4HADA 2DU8A 2GR9A 4C5CA 2I4TA 4GZ3A 4JEMA 4EMSA 4YUYA 1FYWA 2FMTA 4DJDC 5IHPA 1TZCA 2WUDA 3KEMA 1HEIA 1P2SA 4NBNA 4NDAA 4MUAA 1HMPA 1PWHA 4NTZA 3MJHA 3V46A 3U3RA 3VZCA 2NU7A 3EW7A 1PZGA 3RYFA 3MWDB 2AK2A 2MINA 4BNUA 3RYIA 3Q87B 4D4IA 1Z8HA 3ORQA 5FBRB 2WBLC 4J8PA 4QOEA 1PEYA 3IMFA 1NR7A 1HRKA 4YAWA 2YICA 1I6WA 4YO7A 1HV8A 1MVOA 3A4YA 1U3TA 2ZI3A 1Z17A 1RKVA 2WAYA 5DTMA 5B57C 5DLYA 3ZBQA 3M3DA 2YNMD 3EXHA 5DHPA 1XQ6A 3GRPA 4YXWA 3FWKA 3SOZA 3ZS9A 4IMPA 2WKPA 4Q3EA 4CKZA 3U19A 1YBFA 1PCXA 4R0NA 4X90A 3SIPA 1RAAA 1G41A 2Q6TA 4L5BA 3I5YA 2C58A 1NMQA 3FHJA 4CNQA 4UUAA 2O07A 4TKZA 4ZV4A 2YQZA 3LT2A 1Q3HA 3PXBA 1ZJZA 2G1KA 1QIIA 4J0KA 4YCDA 4DCTA 4KQFA 3RVJA 1C0LA 1NV9A 1MOPA 2FPXA 3L8ZA 3RU2A 4ETIA 4EY5A 3TK1A 4DSUA 2Z3WA 1SQSA 2CLMB 2Y76A 3PHCA 4OJKA 1XVIA 1ETHA 2QZZA 4XXHA 5IUNC 3PD1A 2FSSA 4N0QA 1T1JA 4NICA 4LF7B 3FYSA 4GI2A 4BFTA 2C82A 3OFKA 2FN3A 2YJ5A 4D45A 3K2QA 1LDEA 1X1AA 5A9TA 4GM4A 1T13A 1MB4A 4E22A 2VFAA 2CE2X 1E8MA 5M34A 3DMGA 4PW0A 4BAUA 4HLDA 5KYWB 1HDRA 1BDJA 5HKKD 2D6FA 1CQZA 2G80A 3DDHA 4BV9A 4CTNA 3QPUA 3D5QA 1J8MF 3WZLA 3BGSA 2I3ZA 2PS3A 3CXRA 2BHNA 2R96A 3LCCA 4KITB 2ETXA 3TFOA 2OPHA 4OFXA 2MCFA 1H2WA 3WLAA 1I1NA 5E7MA 3V2UA 3Q3VA 2L2QA 1OGYA 5AM2A 1C7EA 1NF3A 4EL0A 5FPHA 5L8VA 4ND6A 4OU5A 1YT5A 1KVTA 1G5PA 1LNZA 4GLOA 1N32B 1LSSA 5KCMA 2HCFA 1QO0A 1TC1A 3DDNA 4RFSA 2Y1WA 4IDCA 5HPYB 4GSKA 4BNGA 5F7JA 5H1YA 1KS9A 2JAQA 2BJHA 4WN9A 3I39X 4E07A 1ZM7A 3BVPA 3NAZA 3ODPA 4LDQA 4CKBB 4DR1B 5GPBA 1UBOS 2QD4A 2JGNA 1RYZA 1FP2A 2IA5A 1MZVA 2WINI 3NOQA 1G6KA 3FMFA 3TSOA 4OFZA 5LZ9A 1J2YA 3BL6A 1R88A 2P79A 4ZVVA 2GF0A 4CV1A 3JQAB 4B7UA 1M0EA 3A11A 4JASB 1Z83A 4NBLA 2A1TR 3NLLA 2GLXA 3Q8WA 1DAHA 5LZ8A 3NC0C 4NCXA 5A2QA 1EFAA 3L7MA 4EAQA 3IPLA 5E2AA 4PGAA 2H1HA 4GI7A 3WMWA 5IANA 3C48A 2ZSIA 4I1RA 2AJ8A 4BLWA 4HRVA 4DQDA 1BOOA 1RFLA 1CNEA 2PT6A 3HDQA 3FPBA 5IAOA 3R40A 3CPHA 4MRMA 3FHCB 4Q6BA 2ZUTA 4I8DA 2BEJA 3PNYA 4U7TB 1Z56C 5HCNA 3W2FA 1BXGB 1L5ZA 2PKRA 4BE7B 1UZAA 2ZCJA 4JT2A 3ZI4A 5K0EA 3FAKA 1AXRA 1WA5A 2HIHA 1TCBA 4PC6A 3UG6A 3D8RA 3QYAA 4N0MA 2QSYA 2Q7XA 2QMZA 1OKKD 2C9CA 3WOVA 2O8EB 1M1YA 1I24A 1XTPA 2X3UA 1IXYA 4PICA 1T15A 2DFKB 4CLOA 3FTEA 1X87A 4HHEA 4PCLA 5LOVB 1RXCA 4C0QC 2FWMX 3A10A 2G4LA 1SM4A 5LQCA 1EDEA 2I6UA 3BH6A 3M82A 3FMPB 4BNHA 5LU9A 4TRMA 4FJ2A 3WJ7A 4H0FA 2C97A 4K5QA 1L8XA 2EF1A 3OF5A 4KOAA 5T4EA 2FK8A 4FK8A 1AN0A 3UKJA 2TRSB 4YS6A 5JQWA 4FFVA 3U56A 1N7IA 3PC6A 3DMPA 4MYUA 1Z5VA 4FOSA 3SC2A 3CM0A 3B13B 1WXQA 3GLHA 2VJOA 1IYZA 1NBWB 3KB8A 4OKSA 3W90A 2HOQA 5DNCA 5MHTA 1QQTA 3S81A 1Z25A 1QGZA 4MKXA 2VH2A 4AWBA 2QF7A 5FOXA 3E9RA 1OWPA 4YPOA 2YN0A 1CJCA 3RUDA 4XD2A 5A4MS 1UQTA 3Q9NA 2G9QA 4J2OA 4H7KA 3PJEA 5HCIA 1N2SA 2DQYA 3LH5A 4N3BA 2I29A 2C2MA 3GW8A 3H3JA 4AP5A 2X2PA 4JDPA 2JA1A 3L6EA 3PD0A 3S1SA 1OTYA 5HWSA 3H13A 4O4JB 3H8JA 3RHTA 1KEZA 5BMVA 1AKWA 1FBNA 4YQZA 3EEOA 3AU8A 1HMYA 4OXQA 4I3HA 5WRFA 1KJ8A 3BB4A 1LDNA 2ZJ8A 2EHDA 3SMVA 2NV6A 1ZY2A 5DWQA 4DJ5X 3RM3A 1ZRHA 4GG1A 2RJNA 1DUVG 1GPMA 3CJRA 4D5GA 5HS6A 3EG5A 4ER5A 3MMPA 3OBIA 1UXKA 1LSUA 1VGVA 2ERCA 2I3BA 2VOEA 3I76A 3OWXA 3IP5A 4K86A 4J43A 5EGNA 1AC5A 1G4UR 3MBIA 4NEGA 1DL5A 1XZQA 4YCLA 4EO9A 3DV0A 1R27A 3D6VA 3KXPA 1IUPA 4MW5A 4WZBB 1DBWA 1BEZA 1RJEA 3D1JA 1SUDA 1EFVA 3FSGD 4MSUA 1R9GA 3IH5A 4ZCQA 4RELA 3OQIB 3P4XA 4IXDA 3P9NA 1MB3A 3GH3A 3I9LA 4MEJA 2QRVA 3TIVA 5K6AC 3HR8A 2I66A 3IB3A 4FR0A 3BOSA 3D64A 4MX8A 4CV0A 1GL9B 4F3NA 1PNRA 4ZT2A 4M3NA 2A1IA 1N6NA 2Q8PA 3OHMA 1DJMA 2WJAA 1G16A 1SC6A 4MWOA 2Y3IA 4RMGA 2UZ3A 3NIGB 1ADGA 3ZZTA 2EFGA 2HLDD 4JLOA 4Y9UA 2PL9A 4R9VA 4JSTA 1FJXA 2IL1A 4JUBA 4ZPJA 2GEDA 1XPOA 4TMXA 4RD6A 3GGPA 3H5RA 4Z0TA 3RVPA 5BSRA 1YVEI 4MS3B 1ORTA 3M6FA 4BPBA 2Z2ZA 5FP0A 5LUBA 4F0JA 3BXXA 2JAOA 4L08A 3RWMB 3A1WA 4B5LA 4NZ9A 3NRJA 4ER6A 2B98A 1ZHOA 3OQOA 4O4JF 1NMEA 3SBOA 4DV3B 1FRQA 1T9GR 3EXEA 4NKRA 1NQXA 1MOSA 1P3DA 1ZONA 2GUWA 3BMQB 1X42A 1FYFA 4LGCA 3OOSA 4FKBA 4R41A 4CKYA 4DOMA 4C2TA 3BZBA 5TS3A 4JB3A 4Z4HA 2P5YA 4QC2A 1AQLA 5KTKA 4YY3B 2VAPA 2XCTB 1LK0A 5GY7A 1VCNA 3RNOA 5DOVA 2P5TB 1L7BA 4I1VA 4TXJA 4QTTB 1KSFX 4MWGA 4B6EA 1MA3A 1U28C 4ZALA 1DI0A 3ENZA 5EVJA 5FOWA 3LUDA 5A4KA 5ERYA 3EPKA 1YSCA 1QB7A 4CKWA 2BGKA 1ZI6A 1GWNA 3ADOA 3I4FA 3SVTA 1BW9B 4XVCA 4ZI3A 3F5SA 2OM6A 4Q9JA 5FAXA 3AR4A 3SN6A 2QRZA 2WE8A 5KDDA 5EJIA 4EGCB 5IVKA 1GIAA 4EYOA 2BFEB 2W98A 3BHJA 4HTFB 3PRKE 1Z2AA 1L5VA 1MVLA 1YBAA 4GBED 1KFKB 1PFUA 1U5AA 1QYDA 1AK2A 3SIRA 3QE9Y 4CVNA 1JPNA 1JAYA 3HB1A 1BDIA 5LOVA 4REOA 2C8VA 1CYEA 2XBMA 3BMNB 3K1AA 4YJFA 3V1TC 1AU9A 5LLTA 4MHTA 1XE3A 2MSLA 1LVGA 3MMZA 5K0CA 3V1NA 3HJAA 5TPWB 1AQUA 1WXDA 4YMWA 5DSTA 2B0JA 1OQAA 1IG0A 3FGOA 1CUUA 2Z56A 1RXWA 2J9FA 3QPBA 1JWBB 4KAAA 3GRAA 3LUPA 3Q2KA 5D51S 3GVCA 4BX3A 4OLBA 4YUAA 1QHHB 3GEDA 2JANA 1CHDA 3JD0A 2ZAIA 1NSTA 2VHXA 2ACEA 4BNJA 4ZZ0A 1R0LA 3L07A 5KMGB 4RZ2A 1RYFA 3LCMA 3DZHA 3JU3A 3KUKA 5BVGB 2OZKA 1TJYA 2CL5A 2D2EA 2PK3A 3LX5A 4MK4A 4AMYA 4IUCS 2O1SA 4RQBA 3VO8A 3OJLA 1VKZA 4RZSA 4DANA 1DXQA 3AOEA 1J4AA 4IIVA 4A8JB 1NNI1 5GIOE 2G9VA 3UXHA 4M8LA 3KWMA 4KJZA 5DVZA 5FNVB 4IBOA 4EZBA 4XQCA 5D7BA 3JPYA 4YRSA 1P31A 3M49A 3B78A 4OPMA 1ZJWA 4QDUA 3H9UA 3BSSA 1UWLA 2EGGA 1YIAA 2YHUA 4A6XA 1KFCB 4L22A 2HPZA 5JNTA 1KVSA 2AR0A 3BD6A 4BMZA 2WR8A 3GFRA 1QV9A 2R9VA 1SUPA 3WP1B 4IQ8A 4CGZA 4MQ5A 3D0OA 1XMPA 3EVTA 4QJ4A 4EI8A 2BDEA 1FLAA 5ES3A 1EVKA 2OXFA 4BLPA 4UCFA 2QG6A 2M32A 4HI0E 4RMIA 4HYEA 4R0MA 2I4NA 1ZRSA 3TS1A 4YT2A 1JLLA 1KI9A 2JAXA 2IK8A 3ICQB 3T5PA 5EE3A 2JBAA 1FTNA 5ILOA 1Y9ZA 3C0KA 4KI7A 2OC9A 3NIWA 2IGTA 1BHQ1 2OVFA 4H0NA 2HDOA 1FF9A 5B3AA 3TL2A 2I8AA 2NGRA 4LJRA 2AYYA 1DG1G 3AV0B 3HDVA 1Q1AA 5BMOA 3ADDA 3HUDA 1GGEA 4DN6A 2JGAA 3MWEA 2WF5A 3QVWA 1F2VA 4KYVA 3VR5D 4BAZA 3EIUA 4KLNA 5CLLA 3D5EA 3KYDB 4RA6A 5CM9C 3ESBA 2QA5A 4CI9A 3OEEA 3JAKA 1EK2A 3GLIB 1HFKA 1H0KA 5HBGA 1JAZA 2B1JA 3TMAA 5LIPA 2AJLI 3QSYA 4TWRA 4MGZR 3JD4A 1GPJA 3E22A 4AS3A 1GZ5A 2BGMA 2XGSA 3BYZA 4Q05A 1ZITA 1YR9A 2CBZA 3ETNA 3R23A 5DWVA 3V6LA 5EJ7A 3PEUA 4MNTA 1IZYA 3B85A 1G7CA 2QQ5A 2HSWA 2VH5R 1XLVA 4IUDS 4W63A 4Z4QA 5KHAA 1ZSVA 5TNXA 2GDJA 3GN1A 4GXNA 1D0VA 1ZCBA 2ACKA 3TL3A 5LQRA 3O8QB 1KERA 3D8TA 4HVCA 1GPBA 1MX3A 3STVA 2IF0A 4OYYA 3LZ6A 4INZA 3AXTA 1PR3A 2XCRB 2CXXA 2FZWA 3M1AA 4OMDA 1G63A 5ESXA 3K2EA 2JIZD 3WL4A 4NI5A 1QK3A 2LNDA 5CCDA 2JVJA 4G4IA 5DU2A 4YJ3B 2H7XA 4UDNA 2H17A 3BIWA 1AV7A 2M1ZA 4C3OB 1LK7A 2VZEA 2ZUBA 3D7KA 3UGKA 3VJMA 4OAPA 1UIRA 1GARA 1N1MA 2ZDHA 3KJZA 4BFXA 1EDOA 1C7ZA 1ISHA 1O87A 1QP7A 4MI9A 5CH3A 1F5SA 3UWPA 3FVTA 1M8FA 3EXHB 4P5PA 1MQ8B 4C89A 4CLRA 1EM8B 2PKXA 2WQ6A 3L5KA 4X93A 4OGFA 1JEQB 3ZKWA 3B7WA 4XR9A 1MQ9A 2HBQA 4LY6A 1W1WA 1V2HE 2G63A 5TMPA 3IAXA 5IKPA 5ICFA 1X3SA 2EKLA 3PFCA 3R6TA 4J3JA 4ZCLA 2CFTA 3DEYX 3ZHRA 5TQ0A 3AKZA 2Z0MA 4LWOA 4S1WA 4BMVA 1Z6YA 4LI3X 4KWEA 2I2BA 1L8OA 3UC5A 3R5JA 1MJHA 3MCVA 3TLEA 4BKPA 1G21A 2IZZA 2NV2B 2Z83A 3S28A 1WF3A 4DM7A 2GNPA 3WYCA 2VHVA 4BDSA 3ZKAA 1JNXX 1NMXA 4QREA 4RV5A 4HF7A 3E0XA 3LHFA 4XJTA 5F77A 2QQEA 1QE0A 2EGUA 1L7VC 2CNBA 1GLNA 2GPTA 2IU4A 4JIGA 4KLRA 3T06B 3V7FA 3ZD9A 3TAHA 3RVOA 5JANA 5AVVA 4P0TA 4CLOB 1EUZA 5GV8A 3HK2A 2XF8A 1SZJG 2VS1A 5EJAA 3T9AA 4AY5A 2CV2A 2IKSA 4MW9A 4WFQA 2QN1A 2FXVA 1XEWY 1JPUA 1MAVA 1RTKA 1OROA 2QLNA 2PFKA 3CNLA 4CGYA 2FA9A 2HWUA 2JC3A 2HBZA 4ZODA 2O7SA 2JZOA 2PO7A 3QJ5A 5FHQA 4IW3B 5E9AA 1E2UA 5IS2A 1BOFA 4DLSA 1XL1A 1ORVA 1S2MA 2ZRBA 4NDNE 5NULA 5TXGA 1OA1A 3ANNA 3I72A 2QUKA 3SHVA 2P8SA 3E9EA 1RDFA 4K3UA 1SBYA 3H8WA 2LIVA 1ZD2P 4U2FA 3NHWA 3PFKA 2WJYA 2AZDA 3BQ9A 3CKMA 3I01A 2BI7A 1JHXA 4PWYA 3WWEA 1FRFS 4I55F 2W4QA 1H2FA 1S7GA 2J7PD 5TSDA 1A2QA 4RHTA 1YRHA 3EASA 1PX0A 3KV1A 3SXPA 1C14A 1K7YA 1A8QA 1PUXA 3E3AA 3EZYA 2A2ZA 3OX2A 4O59O 1SO8A 1X3LA 3IODA 4C3ZA 2XWJI 2G5GX 3JQAA 3TJMA 3GLTA 2UUCB 2E4ZA 4EHFA 4FYVA 3FYHA 2VDNB 1SZCA 4RY0A 2H2GA 4BZZA 1O5IA 4LF5B 2J09A 2B61A 4CIBA 1MJNA 3WFZA 3EFHA 1RI4A 3DC7A 3G8BA 2QR2A 5GONF 3OCCA 4M7PA 1DKRA 4OLAA 1P39A 5EJGA 2OZEA 1H42A 5FYDA 3VC2A 1H2YA 1MP0A 1WB4A 1LDBA 5HK9A 1A8IA 1U4NA 2PRJA 4KBGA 4AJKA 1MTZA 4FFLA 1I7NA 3DO8A 3GX1A 4BJ1A 1BGVA 4MI6A 1CNFA 4UM8B 2QPTA 4Q7MB 1KQNA 2W6QA 4J49A 2EEPA 2IYEA 4KXLA 5EFOA 3IQWA 2X0DA 4KW7A 4ZD6A 2O0KA 1QONA 3HBJA 4HN2A 2DLNA 1PQWA 2H59A 3WHIA 2QDXA 1AO0A 3LECA 2OHHA 4ZOBA 1DIGA 3DLPX 1RJ9A 2OT3B 2FKNA 2BZSA 5KQRA 2Z6VA 3E23A 3I9MA 4B7AA 1SC1A 2ZXFA 3MOGA 5EYPB 4MPPA 1EJ2A 3H6GA 3TQFA 1UP7A 1GADO 2F90A 3QPAA 4OKNA 1R8JA 1ZI8A 4GWLA 1WY5A 4WDRA 1TO1E 4PGHA 5A5EA 1WEHA 3Q41A 3QFRA 2OCGA 2PJRA 1T9ZA 4RDHA 2V97A 4YJ3A 3EA0A 2PBFA 4OTZA 4UHEA 5K6TA 1VB3A 2BONA 3V8BA 2YIJA 1H2HA 2LGJA 4WLFA 4X1YB 1IEQA 3M1LA 4PG4A 1XRSB 4F2GA 1YBMA 2IWHA 2D62A 4KXXA 3CWZA 2DFVA 3LY9A 1KDPA 3AK4A 4N3AA 1G8PA 2XSZA 3Q3GE 5T3UA 4YMIA 3EUEA 3DAYA 1FPQA 2C8LA 4IUYA 5JUWA 3DGFC 1KK0A 1JHAA 2ISSD 1FNCA 3AP3A 2R68A 3NNDA 1QGDA 3RUEA 3QX3A 2QN8A 4FCCA 2VRWA 2HUNA 2QT1A 4K05A 4LJ6A 4N1AA 4M7WA 5LFAA 5CB4B 2ACVA 4REQB 2Y05A 3RGGA 5ABPA 3PGKA 1RJGA 3DHWC 5CGZA 3PIDA 3VOBA 3LV8A 1N5OX 4W7SA 4D5EA 5G53C 3OWOA 1VHJA 2FDCA 2WOOA 1ULUA 4OQDA 3MK31 1BEUB 4B8YA 3WYNA 1DPFA 3IYLW 3PC7A 4C20A 1XFAA 3GRZA 4JBXA 1X9IA 4KR2A 3RJZA 2W70A 4MVJP 1U6IA 1XJCA 4K9QA 4DLPA 2JDIA 4GOXA 3LUJA 1EX7A 3D7NA 3JQBC 1SZPA 3I73A 3EBOA 3N3AC 3UK7A 1P2VA 5DBIA 2AEEA 1DVRA 2HCTA 3C3DA 5CVEA 1FTGA 4FIDA 4RCVA 4XIYA 1EUQA 3HB0A 4NRDA 3PLAE 5GTDA 4WZBA 4M1YA 1W4LA 4PU0A 2BBOA 1U5CA 3WAKA 3PPVA 5DTIA 5C9ZA 5KVAA 5A04A 1PHRA 4KXQA 2CB0A 3AF5A 1E62A 5CT5A 3U4IA 4LFAB 3IVMA 2XDWA 3PDIA 4RVHA 1SBTA 2CMKA 1M2GA 2QXYA 2VP2A 3PHBE 4FBGA 4RH1A 3RVMA 4NAHA 1TQ8A 3BRCA 4EUNA 1QZUA 4GR5A 3EVFA 1IXRC 2GPBA 4DZZA 5K3EA 1I0LA 1FNNA 3VR4D 4MVJF 3WZ2A 4BGDA 3F46A 2RH4A 3WK4A 4F91B 1NU6A 1TLTA 1E2IA 2RGGA 1BVYF 3LP6A 2QKYA 4LJSA 3WGGA 1I3MA 4IIEA 2AF4C 4M1QA 3IXMA 1WLSA 3OH8A 2NZ2A 3LL7A 4M2LA 3ZZUA 4B9EA 5IZCA 3DE6X 3RS4A 1W93A 4YGXB 2RC5A 5ALNA 4UCWA 4BRUA 1YJCA 3EUAA 1E2DA 2HGZA 1LPSA 2LRHA 3UH0A 4EIWA 5B4UA 2WFLA 1VCMA 1ZQ9A 4MUIA 4ZVTA 3TOZA 2W6MA 3I2YX 1TT5B 4KDCA 1KFBB 3RIMA 2RGEA 3V8QA 1FDOA 1NOIA 4G0YA 2VSNA 1X8JA 2RSLA 1QYXA 4Z2YA 5I7VA 4G0VA 3PSHA 3I9V6 2HMTA 4QWWA 1A9ZA 2VH1A 3K35A 1MIHA 5KKNB 5CX4A 2QM0A 4MR8B 1HURA 4CKBA 4YRKA 1MDFA 3PNVA 4C4ZA 4DDKA 4I4TF 2P9FA 3X1ZA 4LJAA 1P5RA 4DLAA 3QBTA 4G5XA 4LVCA 2CKMA 1KMIY 4LCJA 2ZTVA 4O4IA 5HQ3B 2LDXA 2Q6IA 1RXSA 2VAVA 4XQ0A 4C4RA 1HFJA 1DC5A 2C29D 3CRVA 4W1PA 3U17A 2P3SA 2PMKA 5JDCA 4I4TB 4K6HA 1RCTE 1Z5GA 1GTL1 4GZ6A 4LOLA 3QU9A 3P9XA 1T3ZA 4PYNA 3SBDA 4D92A 1JDUA 4LKOA 1L4KA 4FW9A 3DM9B 2Q2OA 5FJJA 4MRNA 4V3BA 5HF6A 3U3DA 2BI8A 5B30A 3KUDA 2G36A 3ZN2A 1FVHA 5IJXA 1K8ZB 3IQEA 2O48X 4JENA 4DLRA 4QKQA 3HJCA 3S2ZA 4EZEA 3EOZA 3S29A 5F7OA 1UPAA 5L4NA 4IDOA 1AQYA 2B8WA 5BVHA 4HG2A 1U4OA 3GVIA 1U2DC 4AJPA 2ZBDA 3MYRA 4IJKA 4C7OA 3AESA 5A2GA 4ZRDA 1SCIA 1JZQA 2XBLA 4YJGB 3VH1A 3ACDA 1Q7BA 1SCKA 3C8DA 3G9TA 3I5UA 4TWBA 4QQNA 3FD8A 4FDVA 5BSHA 3C15C 4CM8A 4F93B 3EGDB 3GPIA 2H8KA 3I5AA 4I6JA 4L3VA 4EKDA 1RPTA 2C1EA 3PHHA 1T24A 1WL8A 3BH7A 3HJNA 3QF4A 5JXIA 4BFVA 4NMHA 4OXYA 4R3UC 3ZU2A 1X80B 3HXLA 3M81A 4LNHA 4F46A 1DRUA 1TD9A 2OBMA 1QAQA 4QSMA 3IEVA 4RD1A 4KQEA 3GZJA 3JV7A 4MKGA 1QVRA 3LHDA 5EKDA 2AEFA 3CIOA 4A8PA 3VR0A 3EZ7A 1VA5A 3NKFA 4QGBA 1PGJA 4PX2A 1ULHA 2P3LA 4RPGA 3CZQA 4RE6A 3S2SA 2CHQA 2QN2A 3JSXA 1K2WA 3DEHA 1OBHA 3H3FA 5JRZA 3C3XA 1A5ZA 3TVDA 2WJJA 1E94E 3OQ6A 5EXSA 4EB6A 1M5UA 1IUOA 3WYAA 4QSHA 4WE3A 4YAIA 1Z0FA 3AEXA 1L2TA 1WBJB 1YMQA 5HK8A 4W7IA 4AO6A 4H35A 1F2DA 2VJNA 2H2WA 3LK6A 1LPPA 1U9ZA 3NWPA 2B2CA 1OWMA 5D6NA 3ST7A 4RE5A 3C2QA 2QTNA 3O82A 5IAKA 2F8MA 5DTQA 5JXJA 1NBHA 2VC2B 4TX1A 1Y81A 2CCKA 5AVSA 5KX5F 2PSJA 2Y92A 3OTWA 3PGA1 2IGBA 2HNBA 3BIJA 4LW8A 4BMYA 1WCIA 5D3QA 2JEYA 1TRHA 2UUAB 2BHLA 1JYSA 1O6GA 1X1SA 4C6HA 1TLLA 5EI5A 3QK7A 4Z5XA 3BXPA 4B7CA 4OIFA 1U1CA 3ZDXB 3ECSA 1FU4A 2HFJA 1B74A 2E5WA 5CR9A 3RANA 1EESA 4HGQA 4L85A 5F3WB 2B4YA 5IC4A 2JK1A 3ORYA 5KTOA 3RIEA 4MP8A 3K0EA 5K6RA 1B8NA 1T0UA 1T6XA 1M66A 1UJ5A 4LDJA 4YR9A 3AGPA 1H1LB 3KQUA 2QW1A 3DTVD 4TQGA 3JQGB 4JU9A 3V7NA 3UATA 2FUNB 1F8GA 3I05A 1M2WA 1RBYA 3L1IA 5CT4A 4CDMA 3B3AA 5AK6A 2GA9A 3NKVA 1P6UA 2JFHA 3HCRA 4O25A 4M76B 1NC3A 2C0CA 2UZ1A 4PX5A 4BNFA 1HYGA 5GINE 4AUKA 3L7CA 1L8LA 4YROA 2ORIA 1EVLA 1B00A 3O31A 4DBLE 3BCUA 2JS7A 3DF9A 8AT1A 3LPLA 4IH1A 1L5YA 3F5MA 4JJKA 4UATA 2BHRA 3ZU5A 2FHSA 3A7EA 5KO2A 1AZSC 2X0KA 4G5YA 2ZQYA 4JXZA 1DBPA 4YQEA 3NIFB 2FXIA 2CXTA 3OLWA 5FX2A 3WAJA 3NDBB 2GAIA 2EJTA 3AYXB 3BWYA 1IHPA 1MKYA 3KJFA 3MUOA 3ZHZA 1GZSA 1ZCJA 4FFBB 4LY0A 1E9DA 3M33A 5CHEA 4F8EA 3QEAZ 2PUFA 2ZR0A 1DKMA 4WTOA 4Q9HA 2RGXA 2QZJA 1YL6A 3GT3A 5FPQA 1SB9A 2A6PA 1BU8A 2GN4A 4QQ8A 4W5TA 2OO5C 4IJVA 5KYKA 4KPGA 1IBCA 2OD9A 2OQRA 3WXMA 1RVDA 5DP1A 3E03A 4L74A 3CS3A 1PTJA 2H57A 1H2BA 4IL5A 4CQLA 3VKFA 4RVDA 4INOA 5JSKA 4F3CA 4JK3A 5G2OA 2HJHA 4KEAA 1PT9A 4WNAA 3I04M 1J2JA 4I1OA 1QG6A 1REQA 4ARSA 2FGJA 1Q0LA 5J1SB 2QIPA 2UYCA 4KFCA 1XZKA 5L95A 5A4DA 3IILA 2JLAA 3QEJA 4FHZA 1Q7GA 2P6PA 3IE2A 1C3XA 1D0SA 1GPLA 2O8FA 3IQIX 1GZ4A 1V25A 2EJBA 3QITA 3GJQA 2GRUA 5JFTA 3PT5A 4WOBA 4MROA 3WFIA 3T4EA 5K8UA 5JALA 1DPGA 3JWEA 2XKKA 1D5CA 1CZNA 5ED0A 3AY6A 3DJFA 5B3JA 2IFTA 2Y0PA 2JGFA 5GJCA 3KG2A 3W5SA 4BQIA 5LXTA 2CF5A 2B7LA 1M75A 3UGJA 2ZJ6A 1M34A 3WGUA 5FXMA 4Q7JB 4DV7B 1QBGA 2XQJA 5HA5A 3KS9A 5L7TA 4RD3A 1ML4A 4E11A 2JIRA 4PIPA 3KK0A 5TGZA 2C99A 2Q9AA 1SUAA 3H9EO 2H6EA 3KPWA 3LUCA 3KKNA 1N5DA 2D8MA 2XZTA 2CDCA 2OK7A 1LX6A 3M0EA 4KR3A 2MT9A 5CYPA 4A23A 4CM8B 1ELOA 3GDOA 1ZU4A 3KU1A 3MJRA 1IWPB 4IIFA 3TLJA 3WGNA 3Q72A 3ETDA 5IDYA 3KVNA 5EA2A 3A6FA 2P2NA 5F12A 5C31A 2DZDA 1GN9A 1ZESA 2W2NA 3GBVA 1D1PA 4K46A 4PBTA 3U4GA 5AD1A 1CEYA 3OESA 1G0NA 2MYPA 4MH0R 5DNDA 1EGQA 1MIOA 4ARVA 1MV5A 2H1CA 4RK7A 2R8PA 3RU3A 4C0SA 5JBNA 4PPYA 4OV6B 3QV2A 2I2WA 2QGNA 4C4YA 1V3TA 4OREX 3ZHQA 1D2NA 2ORYA 1JQBA 1ONNA 4LI0A 5FADA 4AMBA 1DXOA 4CG1A 1JIUA 3JWJA 1KQOA 4HMQA 2XX3A 4MEBA 2ODWA 2XB6A 1BAPA 4AG3A 4HFNA 5LA6B 2CZGA 2OKGA 3RT1A 1XD8A 4ZEWA 4RLFA 2QNIA 4KRYA 1X8XA 3T3GA 1KP2A 4MZDA 5IH3A 1JT2A 3H75A 4Y1FA 1R0KA 1QAMA 2G0TA 3UCXA 1OHHD 1Y6GA 5TVKA 3NHJA 4LQCA 2ZATA 4GWKA 4KQGA 1O6ZA 2ZDQA 4HWPA 5ESWA 1U63A 2VF4X 4E7OA 3H9CA 3ONDA 4HK4A 4HD8A 1VL2A 2YRXA 3O4FA 5GOTA 2XADA 3ZW7A 4UZFA 4LE2A 2LCFA 5YASA 5JFGA 1QDEA 3EPPA 3L7IA 1VDZA 1CZRA 3FLEA 2K4MA 4CIVA 4P4GA 5EXTA 4IRUB 3S70A 5REQB 1W36C 1E6MA 1JEYA 5TT0A 5BN1A 4PLWA 3DZFA 1XZ8A 4JLPA 2C4VA 5J2TB 2PZKA 1Y82A 2C2ZA 5HUHA 1ZBQA 3ED1A 4JVOA 4TMKA 3SZRA 2XMDA 4MTLA 4PE5B 3BERA 1U94A 3NTLA 3P96A 4B0PA 5H68A 1MAHA 5DNUA 3R76A 2QD3A 4CL8A 2WQZA 1A7UA 3THYA 4KXYA 2PKCA 2QX4A 2I34A 3BWDD 3EJ6A 1CS4C 3O9ZA 3H65A 2B83A 4R2MA 5FWAA 2X6QA 3DONA 3GLVA 2ENWA 4M1ZA 1O58A 2BJWA 1NYLA 1PYGA 1H85A 4G8DA 1QTRA 3WLQA 4DA0A 4GX2A 2BSQA 5JYBA 3VR5H 1GPDG 1UBRS 4E3ZA 4DYVA 4TWJA 1PV2A 1GKYA 1RM5A 4NYIQ 5HOQA 1VGRA 2YH2A 4LXTA 4AIRA 1DOHA 2PJZA 4A36A 1JT9A 2NAPA 1JKMA 3FDFA 4X20B 5BYJA 3OOWA 1IY1A 1CJUC 2Q1WA 4PR0A 4UW9A 4YT5A 3D7MA 1C7IA 2FN7A 1GN8A 2JLBA 4A8JA 1JG1A 1HT0A 1KU0A 2V03A 3EZ2A 3HFRA 4M49A 2XNDD 2JBWA 2CJPA 1ACMA 1XQ1A 2BMWA 4OHZA 1YFLA 3G0CA 1O6FA 3UCEA 3VUFA 3QMWA 4G9BA 5LQSA 4U02A 4K2HA 1P61B 4M9XA 3JZMA 5IZ4A 1UEJA 3DDZX 3L1KA 2DBRA 1GQRA 1N57A 3VKHA 2JGMA 4MQMA 4DJEC 3BJIC 5H80A 4D79A 5KNCA 1KOJA 3BZUA 1J2EA 1CS0A 1N2CB 3M6AA 3JARB 3I8SA 1KZ9A 5EHGA 3ZZNA 3W2TA 2GPNA 5KAMA 3T7DA 5F2EA 3MS4A 4NZYA 3P26A 5D3ZA 1TTPB 2AJCA 1IQUA 1A76A 2UYQA 4MUYA 4YBRA 5C8YA 3QBEA 4L0CA 1KAMA 4E94A 5C46F 1U9JA 4ZT4A 4C2BA 3UJDA 1TZMA 3OLYA 4QOJA 1NSYA 1LTHR 2F1KA 2WYVA 4W1SA 4B6GA 4QUIA 3LYLA 3GR6A 3P0EA 3VMFA 4BP1A 2Z8YM 3PQ4A 4G85A 3CR8A 4YMTA 1YA4A 4S2EA 5ALQA 2N0SA 4BRWA 2J3LA 4CNBA 2OCIA 1G8MA 1XNGA 1YASA 3DF7A 4IG9A 4NNJA 5FL7D 4EB3A 1OCEA 2F8LA 3ET4A 4ON9A 1U6KA 4IS2A 4YCNA 3TW0A 3WDMA 5AFSA 1P75A 2E5LB 1VG8A 1ONSA 4F1JA 4LHEA 4X3CA 5EIAA 4LZWA 4W6ZA 1RLJA 3W1EA 5LQMA 1TGVA 4ONEA 1DAPA 4NABA 2V3VA 3FOZA 3GHYA 4MQUA 3S2EA 1RIFA 1ATIA 2FZLA 2Q45A 1M2NA 1L7PA 2VSQA 3MWGA 4K88A 4KE6A 3SM3A 3TJRA 3V7YA 2ILVA 3ETEA 4ZWNA 5DIZA 3PXAA 1B43A 3D3EA 3OIUA 4TN5A 4OQFA 1G20A 5DYGA 2B2NA 3PI7A 4ZV9A 3WE7A 2W6JA 2R1UA 3P27A 3L40A 4PYRA 3VI3B 4R05A 1XA0A 1C1DB 1JG2A 2QV7A 2RK6A 2OL4A 4PSKA 3GEPA 2X0JA 4PC1A 3TEFA 3R09A 5DMXA 4OI0A 4Z4GA 4PXSA 4Y2GA 1AA6A 1OR8A 1DDGA 3KPJA 4GPBA 4OUDA 5B6PA 4QHTA 4UD6A 5B64A 1Z5PA 4AKTA 3SEQA 1IK4A 1TU3A 3GWGA 4FDAA 1SVMA 4AJLA 4DRXB 3GD7A 5BUZA 2PU7A 4RENA 1DKUA 5JD3A 3IR6A 5LZ7A 1NRIA 3AYZB 4LPSA 3HSKA 2C20A 2YCBA 1L4LA 1F0NA 3IDOA 4BNKA 1DDOA 3H1AA 5IH7A 1U0RA 3CF0A 3RD5A 2FZKA 4XUEA 3ZJTA 4EFMA 1E61A 3FTNA 3KTFA 1RYYA 5D84A 3R5TA 3RAJA 2QMHA 4D3ZA 1R4MA 3KO8A 1DG9A 3N7TA 2WHXA 4UM9D 3D8UA 3IV6A 3D3WA 3Q7RA 1JNYA 2QTZA 3VZPA 4UNRA 4DSTA 1NURA 2C94A 4ERXA 2YTZA 3LKBA 3OA0A 3K9FC 5LWQA 2G5TA 3R41A 3BGDA 1G66A 3ORRA 4X00A 1BXRA 2P11A 3V8VA 1CR0A 2CBXA 3W3AD 4B09A 5IFKA 4YHHB 4EFKA 5DN6A 5BQ5A 4F2DA 2GF2A 4WLNA 3OD5A 5ALLA 5KYYB 3GV0A 3GLFA 3JWHA 3D1VA 4UMFA 4TYQA 4EMUA 5K6AA 2F59A 3D4PA 1YE3A 4DDUA 1PZMA 3CSDA 2RBGA 4D9IA 4F12A 1K97A 4QG3A 1U7WA 2ES4A 3I4LA 4KGXA 4TVSA 3ZBTA 1ZWKA 4MKRA 2G06A 2O6HA 3GPDG 2MSEB 3I42A 3OT1B 5EQTA 3RAPR 2YZKA 2YZ7A 4ADSG 1QZTA 3TD6A 4H1TA 4ZV7A 2J3JA 3G5UA 1OBOA 1ZOPA 1A9PA 4LK2A 3SXJA 4ZDKA 4M38A 1C30B 4MULA 3WO1A 1NW7A 3K9BA 1FXWF 2CDBA 2OPBA 3QUCA 3GFVA 4UU0A 9GPBA 5HM6A 2EYUA 3OX4A 4MWZA 5DM2A 1NPTO 5EZSA 1BTOA 4ZANA 2ENUA 4Q24A 4G25A 3CNHA 3GLQA 2HGSA 2ZCVA 2IP1A 2XKBA 5I7WA 3FXAA 2CUZA 2J3DA 1T3HA 3MXTA 5ECYA 1OBVA 2AUMA 3PEFA 3OG9A 2ZWPA 4JIMA 4W1QA 5H82A 5TX7A 4EQZA 5BV8A 1PV4A 2VUUA 3QLUC 1OFTA 3IT1A 4KYTA 4TWZA 4V0NA 2EWWA 3R8XA 3N2YA 2JFVA 1GO2A 2HU2A 4KQHA 4WLEA 3IB6A 3R7WB 2JKYA 6GPBA 1DAIA 2VN8A 2R7LA 1N77A 4Y2TA 1FDWA 4QA9A 1PFWA 3X2SA 4DG5A 4OGWA 2XUQA 5KYNA 1H2RS 4XLZA 4GVLA 4R01A 3WBBA 1U8YA 3T6KA 1WD7A 4ZYXA 4IEEA 4X7PA 1P17A 4DZRA 1H4SA 3GVPA 3W04A 2CGEA 3RRXA 1JRLA 4L5CA 1MCZA 3AJEA 4NHEA 1OH8A 2R6DA 1V48A 4H7HA 1O9HA 3FI9A 4CLXA 4JBGA 1SXQA 2W83A 2O57A 1KZHA 2O8CA 2ZYSA 1NXPA 2H48A 2RARA 1YAHA 2XWQA 2E4WA 3DA8A 4WNIA 1PR6A 2C3MA 1GUYA 2A1UB 4MUHA 2VNIA 3DB2A 4IV5A 5TPZD 2XPCA 2C2OA 4HY3A 4BKQA 3ZWYA 4E5NA 1JDVA 1FMTA 3VU1A 5KU1A 1E58A 5KDLA 4Y2SA 4EKEA 4LZOA 2IPXA 1M6HA 1V8ZA 2QVLA 1L3IA 3UKOA 4DCNA 3FOCA 1R8YA 4R84A 3T5DA 5IM4A 3E81A 2FZGA 1PO7A 3PT9A 3KNZA 1QIJA 1MO2A 2VBCA 1LCIA 3AEKA 4G56A 2ZB7A 3CMMA 4MS1B 1H1TA 4EB0A 4O2BF 2BF7A 3IMGA 1K5PA 4IJUA 4JELA 1VIYA 1QG4A 5F2KA 1UMBA 3F8WA 3BXEA 4GMGA 4QD3A 3W5VA 4X1IB 5CCXA 1N8SA 1UPXA 2HIMA 2Y9MB 3ORHA 3TTXA 3BMXA 3A36A 2DT5A 1YZ3A 2EF0A 3LUKA 4UE2A 1TFRA 3LPMA 3PR2B 3DWGA 4GOKA 5CJ2A 1GJRA 5CFZA 3SHOA 5KWJA 1K7XB 4RM2A 2FFRA 4Y6OA 5SZIA 1HNWB 4PWZA 4UKDA 3UK1A 1PI3A 4DV4B 1DJLA 5JASA 3O9VA 4FCWA 2B20A 4LV5B 3LPCA 3TQQA 3ZXSA 3OFSA 3THSA 1UT6A 3H5WA 1EX9A 4ATNA 1D7OA 3JD2A 3O03A 2JI7A 3DLCA 5PNTA 3H5OA 4OUDB 5ENZA 4Q01A 2GESA 4CCWA 3DE5X 4J9UE 2R97A 3IVGA 2MHCA 3TOVA 1KS2A 1KVQA 1XRQA 2Q6KA 2ZQ5A 4RZUA 3VR2A 1NJ1A 2JFZA 2HPHA 4CCAA 1VLHA 1T1EA 4FFBA 4LHYA 3EC1A 5K45A 2B82A 3LBIA 5FOTA 2FZ5A 3N5CA 2JCSA 2DYKA 1TYZA 4LF9B 2XR1A 2BY4A 2FWPA 4J2HA 4NG4A 2W37A 3OZGA 3QVKA 4PNZA 5FOVA 2C9BA 1WCV1 3D6FA 3HADA 4MV1A 4X6YA 1V7PC 3F74A 4YP1A 2OXTA 2R1ZA 4JUDX 1DKNA 1YS9A 4R9UC 2J0EA 5A03A 2JLZA 3M4JA 3DFZA 1IHOA 3ED5A 1V6CA 5TDHA 2XTNA 3ROGA 4NARA 3D6HA 1SGWA 4P3KA 4GDFA 1NPDA 1RVV1 1V7ZA 2VPTA 1OIWA 3C43A 1DX4A 1C8VB 2V7TA 3E4CA 4UMDA 1BXRB 2V5UA 4FGZA 1F8UA 1XZLA 4IZOA 4TLCA 1G60A 1GA1A 1OLXB 5H3CA 2WKRA 1XLTC 3KJXA 1DRWA 3GJ7A 4IGAA 4NZMA 4K8OA 1M0SA 1AHHA 1EFRA 2W2LA 2NNLD 3T34A 4R3WA 1TTQB 2C9MA 5HX7A 2XMQA 1L7DA 4LYJA 1VBMA 2HQ1A 1U0LA 2YDYA 3GPBA 2BGLA 2XXAA 5LKRA 1LRLA 4M0FA 4LF6B 3I4CA 3N0VA 4LZLA 3AR5A 2GM9A 1PJAA 1JI3A 2RB5A 2YN4A 1VDMA 3MPOA 4TMVA 1A88A 4PNHA 1SRRA 4BBJA 3R6LA 1SBQA 4LVNA 4AIIA 4CL2A 3EH1A 1Z5NA 1VSUA 2P68A 1SXPA 2PMFA 3AEUA 2NX2A 2Z09A 3UMVA 3ZWNA 5AW7A 8ATCA 3QJGA 5JXWA 3VSBA 5A5GA 3FCYA 1AV6A 1OX6A 1XGKA 1YQTA 3N7AA 1WXEA 1HEYA 1S89A 1CHNA 1P1FA 2H4FA 3BGVA 3FA2A 3GELA 1CR4A 4G8CA 4M83A 3AO0B 4PVCA 4Y8VA 5BSVA 1UINA 3H9BA 5BRJA 2RMKA 4A9AA 1RADA 3Q4GA 3UJCA 3HEAA 4HRYA 1DAFA 4S1PA 3RAEC 2VPZA 1E3SA 3VTKA 4HS9A 4AF6A 4B3IA 3BS4A 3K9HA 4WESA 5AVQA 4HATA 1RBZA 3S68A 4YV1A 3SBXA 1NJ8A 2AC7A 3EBPA 3AP1A 1PVVA 3LCRA 3R9WA 5SYAA 3KYIB 3QEKA 1LRJA 2H85A 1Q0ZA 2BMDA 5IASA 1Y7PA 2QS9A 1TL7C 2DC1A 2JATA 3PICA 2AK3A 2IX9A 3DFFA 2D2VA 3DO5A 5DSZA 3T9FA 4NBTA 1COZA 2E21A 5I01A 2ZJ3A 4FB5A 2BF4A 1VGQA 4D8TA 1ADFA 1SCJA 1F9AA 2CVFA 4N3GA 2VSOA 4DMGA 3ZQJA 4KR0A 1YFZA 3A9SA 3HI4A 3GA5A 4FE4A 4ALLA 2I76A 2Q7DA 4KQ2A 3EXEB 1A4XA 2QDKA 4TKLA 1CY4A 4O4LB 4BFLA 1J56A 2PQ0A 4V0OA 3MEQA 2CNWA 2XDYA 3T41A 4NK4A 3X2FA 1UJBA 1GNRA 4CV3A 5CBPB 3A6DA 4HC4A 5J3JA 2PRZA 4OX9Y 3D2AA 4TKVA 5F78A 4LYFA 4J2TA 4ND8B 4AY4A 1FLVA 3K0AB 2X8LA 1Y3FE 2V7QA 3H9JA 4Z54A 3AESB 1ID8A 5I9TA 1JJ7A 3I9NA 5B7QA 3QPVA 4MRAA 3V34A 3PXDA 3QQ5A 4RKQA 2XMPA 3ZU4A 2VQ3A 2C7QA 1MORA 1V16A 4PONA 5IJ9A 4H6WA 3ZY3A 4CM9D 1Y5LA 2PS0A 1WNFA 4V0QA 3NRCA 5A7GA 4D9MA 3J7AC 5D2CA 2IEDA 1CX9B 3DTVB 1D2MA 4X5OA 4GYYA 2QMYA 4B84A 5IKEA 4LYYA 3TX2A 1OAAA 3WLLA 3ZLVA 3IE0A 3KB6A 4D9GA 4LMPA 1RAEA 3HZZA 5I3CA 2WIJA 5AOBA 4C4XA 1BMDA 1G20B 3B9BA 4MJ7A 1JBKA 3HCDA 4C4TA 3DSRA 5CCEA 1KTVA 3T9CA 4DUZB 2MMGA 4CJXA 1M6NA 4PQYA 4UNIA 4Z0HO 2JGDA 1I94B 4A2QA 3RHZA 1KVRA 3E9CA 3K15A 4YAUA 1A97A 3ANYB 1FMLA 5E4TA 2ZSDA 4GMFA 5EGSA 5JAHA 4C88A 1K6JA 2B6NA 3V9PA 3IP8A 1UWKA 1F8YA 2D5CA 1RC0A 1MUUA 2WWHA 4AKEA 1OXKB 1JFLA 1T2UA 1KZ6A 2FMIA 5LD2C 4EYQA 1U9IC 3CVJA 4F5WA 2PGJA 2H9AA 2MYTA 4QECA 3GJ8A 2QPOA 4B3FX 3JALA 2IV2X 3IVXA 3U0BA 2Q0QA 5LB4A 2PANA 3SS9X 4ZEMA 1ZXBA 5FWXA 1HLGA 5JTTA 4Z9BA 1U0BB 1E9SA 1R4MB 2K7ZA 2IS1A 2VPXA 1YXMA 2JAUA 2V7EA 2G4VA 1E2FA 2XB9A 3T7SA 3OFJA 3D3WB 5HG0A 1W5TA 1TF5A 1IZ0A 4MJ3A 2GT1A 3AKEA 4LNAA 5CT6A 3ELWA 4PTYA 3GWZA 2I1WA 4KR7A 1PEKE 2WYHA 3QNWA 1Z8FA 1J9ZA 3FE2A 1WW3A 2GNOA 5TF4A 1JJIA 3RYHB 4D8VA 4NATA 1MABA 2AJBA 2O8NA 4N48A 3BA6A 5AI0A 4MYRA 2NN3C 3RI3A 1JMKC 4UAUA 2J7KA 3UY4A 2JFUA 2YHSA 1E9RA 3B5IA 1CR6A 3RC8A 4CTKA 3DBOB 4A8HA 1OASA 5DX0A 3FMIA 3STHA 5IWAB 3LOUA 4R4JA 5AHWA 5JWOA 5A0TA 1IEWA 3VNAA 3I28A 4WBSA 4MEAA 3WQSB 2D1RA 2ZDGA 4GL4A 4BE9A 3DV2A 1K3TA 3VU3A 3VYSB 4TVBA 4P4SB 4MRSA 3ZZ1A 4D56A 3R9XB 1FYXA 1BRTA 1FFSA 4LXHA 1IOZA 1GPUA 1I7PA 1RACA 4KAFA 2N46A 1T9GS 3GEMA 4CG0A 4CMGA 2ZYRA 4J0DA 5G1NA 1BU5A 1CCWA 2XZLA 1BJTA 5CJPA 5FUYA 2CZCA 4L2IB 1Y8ZA 1CB7A 1NQTA 5A4AA 3C4QA 2Q41A 4XSHA 2IBTA 3W9YA 1NBMD 2FN8A 4FS3A 2BPOA 4TLBA 5HMMA 1E1YA 1J97A 1WXFA 2OD2A 5L3QA 1XXLA 1JFTA 2AEMA 1ES9A 2OG2A 4H08A 5EVCA 4A91A 1VI5A 2ASVA 2P3OA 1UFQA 1AKTA 3MGCA 4B6SA 3CVXA 2V0GA 2QMUA 1M0TA 3VHRA 1ODLA 2VP0A 4MQEB 4HNAA 2DULA 4WRRA 3GRCA 1FE8A 3TSAA 1U7UA 2HF7A 1LWNA 3RLFA 4B6PA 2ZAYA 1UKYA 4GPAA 5T64A 3HR4A 1H5QA 1Q1BA 3H2GA 2IBSA 3ZD8A 2I7DA 4KE7A 4EFNA 1MU0A 3OE7D 4LOKA 1DINA 4PZAA 3RBZA 1VPLA 1XDUA 1YR1A 2PJUA 5JNSA 1RXIA 1ODFA 3IOYA 3LK7A 5F1OA 1SPXA 2J6CA 4JI2B 4DSNA 3BWXA 3HUTA 3LKDA 4HDSA 4XA8A 3ZV5A 4OAQA 4C0XA 2A30A 5B3KA 2YIVX 4O3MA 3HL4A 1JI0A 3DMNA 4QPDA 2UYHA 1M7BA 1E6WA 3ER9A 1U0JA 1GSIA 1GYPA 3GT4A 1SD1A 3WLJA 4X8LA 1JE0A 1NBME 3KDAA 3QFCA 4MO2A 1DEOA 4M6WA 5EP1A 1OYYA 4WA7A 2FMXA 2GYYA 3ITKA 3P32A 5JECA 2IBMA 4P7BA 4YIKA 3TDKA 2WF8A 4R1UA 4WZAA 1HDOA 1ISMA 1AKMA 1OXSC 2A33A 2V1XA 3OCUA 4FU0A 3JZDA 1P1BA 2IY8A 2KX7A 3NI2A 1QCZA 5ALWA 1GU7A 4D99A 1SVWA 5EE0A 3AONB 1KI6B 1A8SA 3L49A 4DHEA 3L1VA 2YDXA 2C2XA 5JNWA 1ZIOA 4RWEA 4HBGA 2E4AA 4OQQA 5AW5A 4OOEA 2VK4A 2G9ZA 5GM1A 5I9SA 4BCCA 4BRZA 2XVMA 5FPKA 1Z5WA 1GG2A 4LE1A 4TT3D 3HP4A 4NMLA 3DHVA 5BSMA 1ZD9A 4AJ9A 4DPLA 4QEZA 4N8SA 2H0QA 2DBZA 3GNSA 3V4RA 2ZJ5A 2TYSB 3L06A 5FKJA 3OLXA 4CKCA 5LKAA 2JBHA 1X2BA 3C3CA 2PMCA 3I9OA 1RYEA 1YDHA 1RKXA 5KQSA 4L9SA 4OGGA 3TOXA 4QJIA 2VF5X 2GSWA 5FNVA 4OK6A 3BMOB 4PAMA 3W9SA 4FR2A 4JI5B 3WIEA 1GXSB 4MQ4A 1USIA 3U4MA 1V1MA 1YNSA 3N9IA 1S2DA 1ISJA 1IZZA 2XYHA 1P2DA 2Z8YA 4XX0A 4D80A 3J80A 2NZJA 3AM1A 1MB2A 1VC2A 3ECCA 4WKBA 3A1NA 2QRLA 2MDTA 1XOIA 4M0EA 1KDYA 3WQHA 2P2GA 5DM4A 2IYYA 4NHOA 3ZVKA 3JD1A 2QP9X 2DHQA 3FGZA 1JWAB 4HYYA 4ND5A 3ZIUA 2PL3A 4AU1A 2CXOA 3G23A 1ESDA 4OUKX 1NYTA 1TAQA 1X94A 2EFJA 2XH8A 3IAFA 4MCJA 2LKDA 4K6GA 4OA5A 3HG7A 5K8TA 4F4IA 3PSAA 5LP1A 4RXMA 4YLYA 1P7VA 4M60A 1G5IA 3KVVA 3WADA 3JARA 3NVDA 3MCTA 3A7DA 3A0UA 2GD6A 2NM0A 1GV0A 1KNXA 4BMPB 4Z49A 1ZMXA 4UE3S 5DNAA 4D3YA 3CRQA 4Y98A 5SYNA 4R7TA 1M2OB 2WA1A 2VT7A 3LVRE 2C5SA 1G8YA 1IVSA 1MJ5A 4FEGA 4RA6B 1NLFA 1X1EA 3MB8A 2C7GA 3BB1A 3WP0A 5HIKA 3NBZC 3GLIA 2WDZA 3CG0A 4URFA 4GS5A 3KM0A 5I4KA 2WU3A 4G81A 1HKHA 3B5EA 4NE7A 4Q19A 1S6YA 1VYHA 2GKGA 4RVFA 5LP6F 4AL4A 2Y68A 3PG5A 1ML3A 3O1JC 4MAMA 4UUNA 2NZ8A 3UWDA 4MUEA 4REMA 3OD1A 1YGPA 1VLLA 3SJ7A 4AKIA 1D1SA 1YBVA 2A92A 3ZX4A 4RKRA 2WV7A 5EWLB 1NUTA 2C88A 4IMJB 2AN9A 1UKZA 4TWIA 4JOCA 5K51A 5LP6C 2FN4A 2G09A 3CTMA 1J9GA 1R5BA 3DVAB 3KHTA 1F2TA 3P9CA 1PJBA 1YU9A 2A59A 2BM9A 3MIZA 3IRUA 5E6UA 3ZW8A 4GL2A 1YQXA 4FTWA 1I5EA 2XTMA 1AK1A 1PTJC 4ZJUA 3K9LA 3GCGA 2AKAB 5DHQA 3RHSA 2PN1A 1SVSA 4LC1A 4C0HA 2QN6A 4MP3A 2O20A 2FSIA 1EFCA 1EI9A 5FTWA 1RRGA 3NC1C 4I6GA 4DY6A 4J9VA 2IC5A 3LRXA 5AKEA 3F7OA 2GKSA 4RHCA 3ROZA 3TZKA 3BKWA 1W48A 4F9FA 4Q66C 1KBOA 3Q9SA 2FPRA 4BBAA 5L4LA 1JFSA 1AD2A 2CC2A 3LHSA 1LBSA 2NXEA 3CUTA 1KH2A 5CT9A 5FRDA 3RYFB 1SU4A 4OVKA 4AB1A 1P1HA 4C7KA 5FCDA 4P93A 1EE1A 4BDTA 3EUWA 1SUBA 1YZLA 3OP4A 2IIVA 4ZO4A 3TB6A 1ONBA 2BGGA 4H4DA 3VAZA 3MF4A 4XM2A 1CT9A 2JB9A 5AJXA 3H2YA 3KZ1E 4NMWA 1RLMA 1KA9H 1YQWA 5D5PA 4PG6A 4IRXA 3EG9A 1CY7A 1V1RB 1XO1A 2O2HA 3IP9A 5E95A 4BJHB 1GUZA 1BWPA 2C07A 3PL5A 5C7LO 1JG6A 1X1TA 2BCJQ 3I2HA 4R2WA 5DYNA 5CB4A 4H3HB 4IDPA 2C2HA 2VCEA 1EWYA 1IOVA 3PDUA 5C8ZA 4R83A 2WTMA 1O08A 1G42A 3IHWA 3M4NA 2G25A 4I2NA 2IIQA 2Q29A 1IRIA 5I8PA 1X19A 3UJ3X 1QVWA 3ZZMA 2HWXA 4YRDA 4EI2A 2YJNA 1KQ3A 4U0KA 1S3SA 5BW6B 4OI4A 3MWFA 3ZTYA 1ZHHA 3DNPA 4PZEA 5JAMA 1FDIA 2B1GA 4TMFA 1ZKMA 3V4OA 1C1DA 5KJFA 5KTTA 1QFJA 1FFDA 5HOEA 1JL3A 4XYGA 3TTVA 3CX3A 1L4FA 1FUYB 2JKZA 2RHJA 3FDIA 3RQSA