4EMTA

Crystal structure of human sting bound to c-di-gmp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
175
Chain Sequence
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 173
publication title Structure of STING bound to cyclic di-GMP reveals the mechanism of cyclic dinucleotide recognition by the immune system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 56
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4emtA02
4EF4A 4LOJA 4LOKA 4F9GA 5BQXA 4QXQA 4F5DA 5CFQA 4LOIA 4JC5A 4YP1A 4KC0A 4LOHA 4EMUA 4LOLA 4EF5A 4F5YA 4KBYA 5CFMA 4F5EA 5CFPA 4F9EA 5CFRA 5CFOA 4QXRA 4KSYA 5CFNA 4EMTA 4QXPA 4QXOA 4F5WA 5CFLA
chains in the Genus database with same CATH superfamily
2PL3A 3D1LA 3G8BA 1Z2EA 5KTRA 1JJAA 2PMFA 3I53A 1ZGGA 4OQYA 3CH4B 2X2EA 2LVBA 2O4UX 4PXAA 4PHCA 3DUFB 3QG5A 2XX3A 5H16A 3ZWNA 5HK9A 3V1NA 1D2NA 2JLCA 4LYYA 1G98A 3D4IA 2GGSA 1M6EX 4K9PA 3MJTA 4OVKA 1JR3E 3A6KA 3UV7A 1N5RA 4QBIA 5GTDA 3AJRA 3MT9A 5AJTA 1AKWA 3C5HA 3PHJA 4PYQA 4RORA 4X1IA 2AD5A 3PC7A 1CDDA 1YV9A 2Y6UA 4JUAA 1EQUA 1YKSA 1X6VA 2WJHA 2Y1GA 3QPWA 2GM4A 1M5TA 2J5BA 2OCBA 2DR0A 5D84A 2P30A 2YIDA 1L8OA 2HTEA 4HLCA 4EFDA 1NSYA 4IDNA 4P08A 4BQNA 3FVTA 4DQDA 1JAHA 1XZ8A 4JITA 5H02A 4YB8A 1L8XA 1VJRA 1VSBA 2PBZA 2AN5A 3HYTA 3WL8A 4X1KA 1CTQA 1A8UA 1IC6A 1XOIA 2JFZA 5IRCD 1P17A 3FTEA 3VHQA 5MN6A 2QX8A 2QD2A 3FMOB 3OOSA 4WCVA 5A03A 2P2ZA 2NUAA 1IOVA 4Z0NA 1XTTA 2O07A 3ONDA 3V42A 1BE1A 2J09A 2JJ2A 2QAJA 2I7DA 4JR2A 4DDVA 2FOLA 1Y9EA 3BMCA 4LE2A 5DK4A 3ZDDA 1QGUA 4TWBA 4FFPA 2OAQ1 1UFQA 3HDQA 2H5EA 1OR8A 3HCAA 4TSRA 2FCAA 1W5FA 1H4VB 1Q1NA 4GPAA 5L9AA 4DLKA 3OF5A 4ZT7A 1OLUA 1X13A 4BV9A 5D6NA 1D4AA 5KO2A 4OBWA 2XUDA 1XDZA 3UW1A 1ACJA 2DPHA 3HABA 4M1YA 5K3SA 5KYYB 3BXGA 4MUIA 2JIQA 4YGYA 1U3VA 2B8TA 4LQ4A 3FB4A 1E6LA 1URPA 3E2MA 1CFJA 5FUBA 3T5BA 2BE9A 4A0HA 2IXBA 1VE5A 2Q3JA 2ZIXA 2V97A 3TH5A 5FJIA 3VMFA 2GD0A 4DHWA 3HP4A 3BCRA 3HKEA 1DKRA 2CXUA 4MJLA 4OG2A 1DZ3A 5AOCA 3BCHA 4RK7A 1XZLA 1GUFA 1X2BA 2CUKA 3AKYA 1DBQA 3I9NA 3LA6A 3NBYC 1X80A 3PNQA 4IHQA 4JSRA 1E1DA 3N87A 2E5FA 4MPPA 4MQFB 3AHJA 4NL4H 4COOA 5IT4A 4ENVA 3TLBA 1WKCA 3UAGA 3FRJA 3GW8A 3S2FA 3VTFA 2DB3A 3KYJB 4FLFA 3OQBA 3ER9A 4DM7A 3N86A 3MLEA 2XUJA 4KACA 2BZGA 1HLPA 3KKZA 1UKAA 4ZVQA 4RD6A 5DWVA 1PR3A 2YINC 2Z57A 5K3BA 4X65B 4FYHA 4R81A 3WDMA 1CVLA 4U7DA 1IUNA 3ZY3A 3QYAA 4BV8A 5CNIA 3NEAA 5FL7A 4E5SA 2B6NA 4DIDA 3MWYW 4UNNA 4QWMA 4Y2UA 2X4LA 2Z1DA 3FPKA 5BR8B 1JECA 1LX6A 2G4CA 4IAOA 1ZVMA 4OQLA 4OQEA 3BH6A 3W34A 3Q9NA 1F6DA 1I5OA 3IVCA 1GAEO 1YOVB 3CH7A 3ZBQA 4LI0A 3ZW8A 1G6HA 1NC1A 2C2ZA 3LPDA 3HNRA 4ZT6A 3SS9X 4DSZA 4K9MA 5SYNA 4L5YA 1LTKA 1I7SB 1QMPA 2HN9A 5FIUA 1X8JA 5JS2A 2RC6A 4UEQA 3I76A 1Q1BA 1IJBA 1Y6JA 3CJQA 5D85A 2D1QA 1PJZA 4S1PA 2NG1A 4LNUB 4OUKX 4F38A 1XQ6A 1DARA 5FA5A 2EWWA 4B5LA 3H9BA 4JVMA 1XRPA 2IITA 2ZEJA 4LE1A 1VYVA 2BFEA 3BAZA 5HOEA 1KVQA 1S2OA 4TRJA 1JMVA 4KIGA 4EI7A 1NUSA 4GX0A 2AFHA 4HMQA 4JBXA 2X8BA 3U19A 4BZZA 1PR4A 3JYOA 5FULA 1QB8A 4NENB 1OKKA 2QT9A 2I67A 1TT7A 3AL2A 4F8EA 4RZQA 2QE7A 4B3IA 1GZ5A 3GMTA 4N49A 2OLJA 2BFDA 2OV8A 3AESB 3UK6A 5KVSA 2Z6UA 1N2BA 4RCZA 5EEGA 3BSWA 3IB3A 4JOBA 3AUXA 2HCJB 1SIWA 1B15A 2J0UB 2W43A 1BCRA 3H2ZA 1Q2UA 3IB6A 4YX9A 2WYVA 3U3DA 4LF5B 4IJ5A 3NWEA 3PPIA 1CNEA 3HA2A 5C9ZA 4OHMA 1VE3A 2QQFA 1PEAA 5KVCA 1K3TA 1LDEA 1PVVA 1P1KA 1KJ9A 1RLUA 1SXQA 4BMOB 1CYDA 2F3PA 3VPHA 1NT4A 5K8CA 1FSFA 4P5DA 1Z5GA 4QPPA 1XVVA 1TRKA 4Q4DA 4FCTA 5L7YA 3RROA 2H0AA 1US8A 3LC0A 4QJBA 3R23A 3A9WA 1LFDB 1P8JA 2H2IA 3RG8A 2PBLA 5F1KA 1IG0A 1L6RA 3I5AA 3R6WA 2OV6A 5FTNA 5BXYA 2NNLD 4M89A 4EPVA 2ID4A 4AN1A 4FB5A 2PRZA 1XZEA 3HXQA 3E03A 1A50B 3CG4A 1TIBA 1J49A 3W3AD 1BGXT 4BNFA 5KX5A 4D74A 2X6RA 5G0WA 1TJPB 2V7PA 2RHHA 5A62A 1DIHA 1F2VA 3E9RA 4BUJA 4CM7A 2Q0SA 2WDPA 3WLJA 2J9GA 3QUBA 4QDOA 2Q5OA 1O95C 3TTVA 1X1SA 3K1JA 3L6EA 4ZVTA 1SC6A 1YDMA 1KZHA 4BP3A 1UPCA 2D3WA 2FZVA 1I9CA 3DMTC 1K8ZB 3WQRA 4CMIA 5BVHB 4GOMD 1H0RA 3KOWA 4HQRA 4II7A 3W5UA 2CMDA 1FDUA 5FPKA 3QBVA 4BNLA 4J7AA 5ALQA 1Z2PX 2MDTA 1B2LA 5LNK1 3B7PA 1V1MA 2KHZA 2C82A 1F9EA 5CFLA 3C3JA 2VCHA 4Q66C 4X41A 2IZ0A 1N4DA 3P9KA 4JR1A 4LX8A 5CMLA 5EMJA 3VZBA 5KWJA 1TPZA 1XD9A 2NSYA 3EXEA 1PJCA 3FF1A 4KDRA 3EAQA 2OAEA 5HFNA 1SPBS 3GJTA 2NX2A 2D5BA 3MTEA 1TECE 3OOEA 1ST2A 3ZJ4A 2JDID 1E6KA 1P7WA 3GJRA 4D9FA 4MA5A 4NEQA 1SMKA 4PNPA 1IEXA 1C3XA 4J1TC 3VSEA 1LPNA 1NZJA 4CODB 3IAEA 2BHRA 1IQPA 4L4XA 4EB0A 2GEJA 2H57A 3AU8A 5LDHA 2GXAA 3HCNA 3ZK9A 2UYCA 2NYRA 1DS6A 1U28C 2OG2A 3ELDA 1VMEA 3PF8A 4Q1AA 2HZ7A 2DU8A 2L19A 2ZJZA 3KOUA 1O8BA 3VKHA 3V4OA 1SUCA 2REQA 4UZFA 3IUSA 5BN1A 5CA0B 1UWVA 2HRDA 1G1AA 4C6HA 3Q6IA 1VPVA 1PG0A 4KOAA 1QCCA 3EVGA 3QE2A 4V39A 5KTKA 2O8DB 3EIXA 3NHZA 1L7AA 4LJRA 3IVXA 3EF0A 1PFGA 1TK3A 2I62A 4OFWA 3ZIDA 1V8OA 3QKRA 4ZARA 5DASA 1S2GA 1ZNYA 4F12A 2GR9A 4ALJA 1WVMA 1HLFA 2WTAA 3VJMA 5JXHA 2J59A 3DFIA 3HSKA 1WF3A 3DF9A 4QEZA 4WESB 4D82A 1O7JA 5DM70 1MABB 3L9XA 4GXNA 4RHEA 5EWLA 3K9GA 3L6OO 3K0AB 5JBQA 2OFXA 5BQFA 1G38A 2ZYIA 1ISFA 1RVDA 3ZTTA 4E5DA 5JALA 2EP7A 3QRWA 4UTPA 1GN8A 4PIPA 4HEA6 5LB2A 5ADVA 2Q41A 1JLHA 3SSMA 4AK9A 2ATVA 4G8DA 3HYRA 5FORA 1RNLA 3TN7A 1EA7A 4INZA 4KITB 1QFYA 1B76A 3FYUC 4UM8B 3D8TA 3GFSA 2GDJA 2PR7A 2UYOA 3NUGA 2AZTA 1LJUA 1Y7IA 3BE5A 3NTOA 5EN4A 4ER6A 4ZVRA 1V96A 2ES4A 1BYIA 3LM8A 4MV0A 3DBRB 2H2GA 3JWHA 1XEAA 4IDGA 2C9OA 5E9WA 3ZHZA 2HI0A 1H8HA 2DSTA 3BYZA 3JCZA 1VCNA 4YV1A 4A8JC 1H2RS 3HU3A 4U2KA 3BMXA 5KYGA 4RESA 1U2TA 3I3SR 8ATCA 2WD8A 1C0LA 1GLGA 4RD4A 3KPUA 4KMRA 3N7TA 5IABA 4LDAA 3K9HA 2VKQA 2ODNA 2OUIA 2X6QA 5CCDA 1F8FA 2DPXA 1X8KA 3QUQA 4ARZA 1CY2A 1ORIA 5HR5A 4XOIA 5E6UA 1MDFA 4F8YA 3URMA 1AK9A 1GNQA 4IKOA 4LC1A 1BMQA 4H0FA 4M8LA 1ZMTA 2FX5A 3OKFA 1M2WA 3WJ2A 1X7DA 2QRKA 1EU1A 3O31A 4GL2A 1TU4A 1LNQA 3MYRA 1F0KA 3PE4A 5A1TA 1FW6A 2JAHA 1QF6A 1N5JA 1W36C 3FF4A 1U2RA 4PSDA 2VR1A 4ZQBA 1WUTA 1ZK1A 1QORA 1HPLA 1YDHA 4HAIA 2P3QA 5EKXA 2YVUA 2DBQA 4FFBA 5JD6A 2DBRA 3AV0B 1WA5A 2G71A 3JASB 4CFYA 1PZEA 1ZN2A 2GCPA 3PRYA 4I6GA 1EFLA 1DIRA 1ZN9A 4PWZA 5ESDA 4DM3A 1XXHE 4E3WA 5HQJA 1P9NA 4IIEA 3N8IA 3PFNA 1H66A 2KPOA 1L5WA 2GM3A 3BB4A 4HQLA 4M8NE 3QVSA 5EHGA 3OHPA 3EDCA 1N6OA 4K26A 4ND6A 4NMWA 1DOAA 2B1IA 2G5TA 1XMIA 3AR9A 4DYHA 5LXTB 3SJ7A 1KHTA 2IOQA 3AFIA 4L8FA 3IR5A 4C21A 4KE6A 1X1CA 4FNMA 2V7QD 4HT3B 5JNWA 5F9FA 3OEYA 4WLNA 2VJYA 4NJEB 3IQZA 5CB4A 2CYCA 5A05A 2XKKA 2QDXA 1LI5A 2O0LA 2AXEA 1J00A 1GCGA 2HT6A 3FM9A 4IIYA 2BBTA 4O4LF 3ZI4A 4KDEA 3VOTA 2V5UA 4BB0A 3FA2A 5EG5A 4HXGA 4CKBA 1VL8A 2E37A 1ULUA 1NX9A 1Z6AA 3MNFA 2Q3MA 3MTDA 4J03A 4NE2A 4RNDB 3U0VA 2XB6A 3AUTA 1IZYA 2H5JA 4NVRA 1WCYA 2O1XA 4QUGA 4NONA 4XD2A 2W6ZA 4KVGA 5ELLA 3VVMA 1WCWA 1FBNA 2HTFA 4BRSA 4F4UA 1FXWA 1XAGA 2IZ6A 2P2GA 2VEOA 1ZQ1A 3P5SA 2O2YA 1C30A 4R3NA 5K3FB 4A0RA 4UTRA 3IEMA 3RKUA 4R68A 2PJUA 2W6OA 4YC7A 3KEFA 2ZI6A 2BPOA 2G0NA 1Q6YA 3Q87B 1UDXA 3RUCA 3GVXA 4KPUA 3NO4A 4Z1MD 2EHDA 1B14A 3KZCA 3ZY2A 1GPUA 1D1SA 1ZH0A 2BP7A 2QU7A 2H3HA 4XUGB 5CP8A 4LRWA 3RU2A 2WYWA 4LRQA 4TV9B 5JVDF 3I4CA 1ZSYA 1NNSA 2C0PA 3F74A 3M1YA 3BE6A 3L8ZA 3NIFB 2BEWA 3IDSA 4XB1A 4CQMB 2H4ZA 5KWSA 2RI6A 1DV1A 1OYYA 3P96A 3PD7A 2HQSA 4BLOA 4B6OA 4NI5A 4WZZA 2RIRA 5CBPA 3UBMA 1ZI9A 5ESRA 3SP1A 2H7XA 2AK2A 3I30X 4PGGA 2YJZA 3L8HA 3WWDA 2FMFA 3BF8A 2RIPA 1O87A 3CRVA 4QGHA 1SA0B 2RGNC 4MJ3A 1V9SA 1TLFA 2ZI7A 3K16A 3FCCA 1Z5UA 4KV7A 1MOSA 3NALA 2EG5A 3PCXA 4OBXA 1F2UA 3EWIA 2DGDA 1MX5A 4YJFB 5J4YA 2IW1A 4R8KA 5TVKA 3T5TA 2RJ3A 5IHXA 1IN5A 1JFLA 1O57A 3T1VA 1GGVA 2IF2A 2QW0X 1JMYA 1QH8B 1FTWA 3BWBA 4M7OA 1N2XA 1EK6A 1FLNA 1Y81A 2V5VA 2Y4NA 4OHKA 4P9NA 3EVEA 4QM7A 4EFMA 3ZGLA 3H0KA 4PTLA 4FFNA 3OBBA 2GZ2A 2QRQA 3R6LA 1M8GA 5IBCA 2EFEB 5C18A 4OXXA 2Y1EA 5BUCA 3WMEA 5AVRA 2I7CA 4HZGA 2PPLA 3F2IA 3KOOA 5EE0A 1TD1A 5BORA 4FDUA 1W93A 1QO9A 2ACVA 3QKUA 1N0WA 2H52A 4J3NA 3ESAA 3VAAA 5EXPA 2J4FA 5H3LA 3DXXA 2VK1A 1T6ZA 3QU9A 3SZRA 3SX2A 1ZUHA 2HLDD 4QQ8A 4XYMA 1HE4A 1WS6A 3PV0A 4OM8A 1QS0A 3WICA 1MPTA 5TMEA 5BWOA 3V2IA 1AZTA 4PPQA 2GM5A 3GJ6A 3EULA 4KYVA 4R16A 3LW8A 2R84A 3OE7A 2AJ8A 2ZRLA 2PUHA 1SRQA 3W05A 1CJMA 5BSFA 4A2PA 3BXXA 3ASZA 3FTNA 1NBAA 3OKAA 2XNDD 5D7BA 2EGGA 1T43A 5EEHA 1ZM4A 1AKUA 1Z8FA 3BULA 1FTQA 2NUPA 1R4MA 3D8BA 2CJXA 2IDKA 3FY4A 1VBFA 3GA7A 3JRWA 4N8DA 4PBSA 2AR7A 3FFXA 3IP9A 4FYKA 5FV7A 3CLRD 2ECFA 4AY5A 2PZAA 1P2BA 1SK8A 2G09A 3L0DA 5AXBA 3UENA 1N78A 1EFAA 4IIJB 3RYFA 3U7QA 3NHBA 4HAYA 1CZNA 4BTEA 1JVSA 2FLKA 1WD7A 4DCJA 1RCUA 2GCOB 3PFGA 3EFOA 3V8VA 2C1ZA 4YIHA 1X7WA 2PEYA 3S44A 1M6VA 3CNHA 1T8TA 1VIVA 3THSA 3G2MA 4FDMA 1RHRA 1SHKA 2ZIWB 1K4KA 5KYUB 3W1WA 3BA1A 4HH3C 4H7EA 1NC3A 3I52A 4UMEA 1LBQA 3D64A 3LWZA 4NEGA 2VA8A 3E5NA 2HSJA 4IINA 1C81A 1LPBB 1UBRS 3PXGA 1I0ZA 2H5LA 2V0GA 4V02A 2YS6A 3BTUA 1ECJA 1ID8A 1CQIA 1N0HA 2OBYA 5TMBA 4B0PA 2NUBA 3SJBA 2D4HA 2HK6A 4JELA 1NVGA 3CLRC 3LJKA 4AMZA 1A97A 3O03A 4ESHA 4MQ6A 2VUIB 2XMSA 3H9GA 2PMBA 2XUQA 4PC1A 5ERXA 5CURA 1CNFA 4DMUB 4UKDA 2VS1A 2ZSUA 1A8QA 4GOLD 4MV7A 4YO7A 3AP3A 1Q1GA 3R3HA 4UU0A 2D1YA 3ZHYA 3ZQJA 2Y27A 4LF6B 4COKA 4PYOA 2OYSA 3DB1A 4YRTA 3I72A 4YYZA 1JU4A 2QN8A 3KOZA 1ZUD1 2DFDA 2CXHA 4AMGA 4U3JA 5EKTA 2I0FA 3OEEA 4HDKA 2ISSD 1LWOA 2X0IA 1Z8NA 4HLDA 3SHTA 2BDTA 2ONYA 4L27A 1N9GB 1ZK2A 4JLUA 4A5SA 2FSVA 3VU1A 4AKTA 1ZONA 2FEOA 1C7ZA 4QBGB 2VYVD 1Y8CA 4PAOA 4AZ3B 3FUCA 4YUYA 4CV1A 4C6TA 2ZG6A 4D98A 4OXKA 4RHCA 3EXHC 1X7XB 2FFBA 4DR1B 1Q14A 2AHRA 2EGUA 2H4WA 3W5SA 1Z4KA 1NSTA 1QKIA 1YQQA 2GN1A 2JEOA 4FYJA 4X94A 4D9MA 2Q4OA 1J0DA 3ROZA 2FGJA 4G56A 3ZYZA 8OHMA 3K0FB 2WRZA 2C7PA 2YMPA 4IKEA 3P1JA 5DW3A 1PEYA 3RIMA 1U63A 5T6BA 2EF0A 2FPKA 1Z38A 3G17A 1MJ5A 1XK7A 4LBWA 5JO9A 2HIAA 3H65A 4E14A 3GJ8A 5FI0B 4OHYA 4UREA 2CKDA 6YASA 1T0UA 3SNHA 1KI9A 3LCRA 5FXMA 1NWCA 2OYRA 3TAUA 4YECA 3ZWWA 4LDPA 3X44A 2GO1A 3HFGA 1X77A 3N7UA 5CLLA 3PEUA 2VPTA 1CEEA 2JLVA 2Y71A 4OQFA 2AW5A 1KEKA 1YFZA 3MRVA 4RF4A 2VBFA 5A04A 5EGNA 3OT1A 5WRFA 5A9SA 2O8FB 1V47A 3GEEA 1GAQA 2EZ8A 1OGYA 4FHZA 3RJ5A 1M0EA 4QPJC 1TUGA 4BO9A 3ER6A 4EG1A 3AYXB 4ZYVA 3JAMA 3V4LA 3FZQA 2VHUA 3WQHA 2ZRPA 1T9CA 1QSGA 2FPUA 5IWAB 3EE6A 3IV9A 4IXMA 2FPSA 1CUAA 3WYCA 1F48A 5NLLA 3DAOA 3VYTB 3NGLA 3VPSA 2VYND 1BJTA 4P4LA 4N03A 4OATA 1DEHA 4UEKA 2XWQA 5EIBD 2DC1A 4JP3A 4Q3DA 3RFTA 1N77A 1UAAA 2QMUA 1SVNA 4Z4FA 1U3CA 3R9IA 5K0JA 1AV7A 2VJLA 3O83A 1R1DA 3A3OA 5EHQA 1ACMA 4R0MA 1EUCB 2GYWA 1WVIA 2Q0XA 5FP0A 2ZZNA 4OLJA 1BHQ1 4M60A 5CPBA 1II8B 2ZU6A 4PU0A 5L53A 3HB1A 1AH2A 1OAAA 1VIDA 3OZCA 2R7KA 2I78A 3FMFA 2G7ZA 5AVTA 4PN7A 2ZPUA 1MR3F 3R7DA 3WK9A 4A6XA 3VJLA 4GYYA 5FEUA 5HJ2A 1Q7CA 1REQB 2OXCA 1IHPA 1YBMA 1ZGHA 2ZITA 2BY4A 4RGYA 2UZ1B 3JVEA 4UUMA 1Q0TA 1L0BA 3A4TA 3KYCA 4TQAA 2PY6A 1G8KA 4PV7A 3S1AA 1E2EA 2OORC 4C9BA 4F04A 1E9EA 5EIBC 2ZRJA 4G1VA 1PJ2A 3NDRA 3EMDA 5K20A 3ILYA 3WMFA 3FHJA 2YTZA 5CVCA 5IYZA 4C2TA 2AH5A 5B2EA 2WJ3A 1Z29A 3VPXA 4R0VA 1DCTA 1G5PA 4EPWA 2B98A 2FPGB 2JGJA 4P32A 5D3QA 1CERA 4IY1A 1W0KA 3KXLA 6CHYA 2JAWA 1YVDA 2WWVD 3N2ZB 1NBME 4OJMX 1MG5A 1UP7A 2EC5A 2JVJA 3PR1A 4TTPA 4YWHA 5BN4B 2CBGA 3VZCA 3Q7QA 5K0CA 5L3SB 1V16A 3UXMA 3OSZA 1AUVA 3HMQA 3EXFA 1T5LA 3H1GA 3KG2A 3QU5A 4DRYA 4P3NA 4E15A 4UUBA 3JQ8B 4FGWA 2B3TA 3FTFA 2G1UA 3IKVA 4YLGA 5CFZA 4OHFA 5G02A 2OMEA 3VX4A 3FOFC 1TT5A 4H2DA 2BIFA 2Q9BA 2ZWAA 3MWJA 1PRYA 3F7OA 1TCUA 1TUEA 1U3UA 3KK0A 1RMQA 2NUTA 4TS4A 4OXYA 5LZ2A 3MM4A 4D41A 3HDTA 1RRCA 2J0SA 3RVDA 2W2KB 2MCFA 5KTTA 2G28A 1YR7A 1ZXXA 4GR9A 1OT5A 1R18A 5IARA 4HJXA 1KQOA 3PGLA 1TK2A 1SNYA 1CJUC 1M6HA 1D6MA 1Y98A 2PSDA 4X61A 4KAXA 1UC8A 2JGFA 4GI2A 4KIJA 3I23A 1NA5A 4BMPB 3GLIE 3CUSA 2DUWA 1B7GO 3BIFA 4P4SB 1U8FO 1V7QA 4JGBA 1YR2A 3U3JA 4WGFA 2GVDC 1T0BA 4B17A 1FNDA 5IH7A 4KPYA 4TKLA 4XM2A 5TPWA 3CSUA 1TU3A 3HGMA 4ECAA 4HEA1 1AQJA 2XWPA 4RL6A 2G72A 4H15A 5EA2A 1JIKA 4C22A 4DCTA 4B8YA 4C1BA 2XA2A 3LK6A 4OQNA 2JIMA 4L9SA 4ZZ2A 2OC9A 4YRGA 1K4MA 1L8QA 2C00A 4HADA 4OFZA 2UUCB 2PSSA 5HCUA 1HE5A 2PWZA 4MYCA 4X5OA 4Z8XA 4EENA 1Y0BA 1V5IA 1J2RA 2I3BA 4TYYA 3CZ4A 1ZY2A 4Z4IA 5HIJA 3TSAA 4F7WA 3ASYA 4EI2A 5J9FA 2DR2A 3U39A 2MOKA 5CXXA 2PLAA 3B38A 5EJFA 2ZB7A 3VGPA 2JGKA 2YXBA 4H7DA 1ZJWA 2IYOA 4F72A 3TGLA 1XPOA 2AQKA 4WWHA 4NC9A 4CLRB 3K8ZA 3SXJA 1YHYA 3G1TA 2AQ8A 3EUAA 2IOFA 3JZIA 2XUAA 3LGAA 4Q4JA 4J2HA 1OA0A 2CNWD 3AV3A 3PWTA 3WLOA 8GPBA 3AVYA 3IQHX 3O2JA 1L1FA 1V5GA 2FFRA 1PQYA 1N6NA 4ZAYA 2YXNA 3O8NA 4HXFB 3OAAA 4LYJA 5GVRA 1G3MA 4HYTA 3HV2A 5JSKA 1M1XB 2BFWA 1NE7A 2PWPA 4RO0A 1ZUNB 3UV6A 1QYIA 4X6UA 4BQEA 1F1BA 3INRA 4C4PA 3RCBA 4D8YA 1FOEB 3K2EA 4DFDA 5AT1A 2YVQA 5CFQA 4Q3BA 1WXWA 4KBFA 1NKSA 2C07A 3BL5A 4C0AC 5G3ZA 1BROA 3QMVA 2PGIA 2IEDA 1V3QE 1NT2A 3EY4A 3KSMA 4GM1A 4AWAA 1L3IA 1U0RA 2WDZA 3PKZA 1OZGA 3SBXA 2F55A 4PR3A 2G9NA 3UVEA 4MB0A 1ZK3A 4KIFA 3TM5A 1OXBB 4F21A 1MF7A 3MPUA 2D0PB 3PSHA 1ORHA 1HTBA 2IHKA 2JK0A 3LBIA 4OD0A 3AZPA 1EESA 5ELXA 4K9KA 4G4GA 1VPWA 1CZRA 1UFOA 1Z0AA 3SE7A 3MMPA 4YXWD 2ZJ8A 1YL5A 4NOLA 4V0SA 1FVFA 4I8XA 3NPAA 4PO1A 5E4YA 4Q4HB 3CLUC 2EEZA 4DDTA 4OMFG 4XQCA 3ICEA 3GOHA 3R9XB 3HUUA 3W5JA 4YDRA 3EXAA 4OP3A 2D6FA 5FH9A 1RZRA 2X3YA 3IKLA 2QGZA 1PHPA 3HLYA 3LH5A 3MEQA 4RZ3A 2V54A 1L5RA 3T1HB 5CLGA 1L5FA 2AI1A 1C2YA 3OSUA 3DQZA 4E12A 3U56A 3GRVA 1HL7A 2YDXA 3BFPA 4MJ7A 4RSGA 4ZRDA 3TZCA 5CCBA 4M1QA 4JN6B 3G0HA 3KDSE 5ALTA 5CVTA 2O2CA 1Q91A 4CT5A 3WGMA 4H6WA 5IDYA 2EKLA 2QRMA 4JBGA 3F6YA 1RC0A 2GZRA 2Q0QA 1E98A 1NFFA 4RVHA 3VDRA 3V46A 1RDFA 5AKEA 2G5CA 1C8VB 2C59A 2P0AA 3NHSA 4NBTA 3LRPA 5C5EA 3DPSA 1CZHA 1ZD8A 4TSFD 3FNGA 3KALA 3LHIA 4I50B 4NP6A 3TUIC 3JPYA 2P6PA 1PZFA 2R6FA 5BN5B 3GLSA 3OQ1A 3Q7SA 1EB9A 3RSCA 1Y6ZA 3X1ZA 3LSTA 2CE2X 3SYLA 4JZKA 3ZU2A 2OCKA 3T54A 5KX5F 1D7OA 2W4MA 4XFKA 3JX9A 1PS0A 2ERCA 4IP0A 3C3KA 3DGFC 5FNVF 4D9NA 2PH5A 4MCAA 1AD2A 1J1ZA 4DJTA 1H6DA 4HNVA 4F9FA 5C8DA 4M9ZA 4BCCA 5B6JA 4CI0B 1DEKA 5JDIC 5FPQA 4QLAA 4HEQA 1M1YE 2JZCA 2A5DA 3I8XA 3W2EA 2PMCA 3FUTA 4CR7A 4WSOA 3EC1A 3FYCA 4JC8A 5EKDA 1VSQA 3VPFA 2HNBA 4JLDA 4ZXFA 1TU0A 1UM8A 4PW0A 1SM4A 3IVMA 3WADA 4JOCA 1ECCA 5CG1A 4CDRA 2M1ZA 2VQDA 3O4IA 1C0PA 3AW8A 5CVDA 2NYVA 3N8HA 2N42A 1F4VA 4N6NA 4LUCA 3TKYA 1I3MA 2C9CA 3IXMA 3RK1A 2XGOA 1EFTA 3FDJA 4KGXA 4ZDWA 4B48A 4FK8A 1UXKA 2ZPTX 3DTNA 4HO1X 3D6AA 3WOHA 3GT7A 3L0SA 2BZSA 3EOBI 5BSUA 5DX1A 3UHPA 4XWOA 1K92A 2C4KA 3VBEA 5J4VA 4FFMA 1IXKA 2HUNA 4B2YA 1IN7A 1E3QA 1WB6A 2JAPA 2XVAA 4BQPA 4L5BA 2PH7A 1RBMA 3FUUA 1UC9A 2H1WA 1U7HA 3L0ZA 3IQWA 4F1WA 2AFRA 4YP0A 3RH0A 5DP2A 1ZRMA 2EP5A 1BXGB 3DLCA 3HLTA 5I4IA 2X0JA 1SBHA 3GEPA 5AJXA 4E22A 3NIWA 4RXUA 1L1QA 2RHLA 4G0OA 5FFFA 2OM2A 3JXEA 3F1KA 3SR4A 1G6KA 4ZCQA 4DLPA 5BWBA 2ZS7A 4ZYWA 5CFOA 4HQOA 2V7BA 3QZUA 4S04A 1H9BA 1W5AA 2C4VA 1M0WA 1C41A 1XAJA 2F67A 4FZ5A 4I9UA 2JI9A 3N6VA 4J16C 3CPJB 1U0SY 4CDNA 5FOUA 1YZGA 3V2UA 3EZ7A 4CG2A 3BIJA 5DH9A 1Z74A 1SU6A 2H4HA 1LLDA 2ZTMA 2W6PA 3F7NA 2HO5A 4HWSA 3QQ5A 1TGVA 2FPOA 2GZ3A 2XAUA 3KM0A 1IU9A 1QIEA 2CSUA 1DI0A 3VYUB 4F4DA 2ZRAA 2FSGA 1I4LD 2VBCA 3AFNA 4RA6B 4Z9FA 1OX6A 2C8VA 4P5EA 2FW1A 4RSMA 1KYVA 2D2EA 5C8YB 4JUFA 1T5IA 2VLIA 2GZDA 3F1LA 4MA4A 3H05A 4MVWA 3KSAC 5CFRA 3LP5A 3UH0A 2ZUBA 3PQ8A 1IXSB 3HM2A 1LWNA 1VKNA 4KGVA 3PBKA 2M98A 2P5TB 3KTAA 2OB1A 1L6IA 2QLJA 2C2KA 1EHYA 3B5JA 4BVFA 3BQ9A 2AV6A 1NR7A 3S2YA 4DLRA 2Q1UA 1IUPA 3ICWA 1UKVY 3LFTA 4W7SA 4X71A 4U2GA 3R7WA 1PV2A 1XMJA 1YB1A 2B3DA 1XZCA 2QN6A 2WFLA 3ANSA 2DQZA 3BFXA 3KAPA 1NM5A 5TGTA 2JATA 3VR3D 3WWEA 1T9BA 1OFGA 1U80A 4RTRA 1MT0A 4DJAA 5T4HA 1RRVA 1RWVA 2MJLA 4FGUA 1T1GA 3U44A 4R1MA 1AK2A 3WP1B 2OLKA 1T5TA 2X1HA 3KKPA 3OKCA 4FYYA 4RVCA 2Z95A 3IO5A 2ADFA 1B3BA 5F9MA 4NARA 4EO7A 5JANA 4QVKA 2DPGA 3Q3CA 4JQYA 4AZ0A 1C4OA 1RXCA 4LBYA 3MA0A 3BMQB 1WMDA 4OYHA 2AOWA 3KWJA 3BTOA 4QGBA 2WY2D 4MPRA 5AW9A 4YJGB 4G1UC 2FQXA 2G7MC 4FYVA 1NP6A 4DYDA 3PUHA 3DL2A 1JHXA 4MQ4A 1GUAA 3DAHA 4HDRA 4MRNA 2C4UA 3DFZA 3GGSA 4S1VA 5EJ2A 3SHVA 4XVCA 3G85A 1XNRB 3AEQA 2ATCA 4YP5A 4BVBA 1UT8A 2VWGA 2ZR8A 2XECA 3QLEA 2BGTA 2BZ1A 4HS9A 3T1NA 1FDSA 2A0FA 5HMMA 3VC2A 3A9RA 1OSNA 2BFBB 5ARCA 3EVCA 2BYTA 2WABA 2WSLA 3PJGA 2F8MA 1QFZA 1YBFA 2PA3A 4Y9RA 4ZO4A 4Q7QA 5K8IA 1XL1A 4DSNA 2VWQA 3CMMA 3VU8A 1ADGA 3E1KA 3PX2A 3JQ9A 3CX7A 1N2CB 5FTWA 2A84A 3I2HA 1WV0A 4K9NA 1V7CA 1QC5B 4F5WA 5D87A 3T5DA 4E5VA 2J3KA 1Z06A 3BREA 4RH3A 1NIJA 4R7TA 2XNHA 4NCAA 1DQSA 2GESA 1OGIA 3FETA 4MRRA 2EU8A 4R4JA 4U2DA 4CETA 1LBSA 4I1SA 3KB1A 5T67A 4BCBA 5FWXB 2C0CA 2GBLA 1Q0SA 4Q9AA 4EELA 1I6KA 5IZ4A 3WZ2A 1Z4OA 5HJEA 2HQOA 2R86A 1JKXA 3H5NA 4MW7A 4DAEA 1HEUA 5CB4F 3I0ZA 3T6KA 1SRRA 5DLDA 4KRFA 2BMWA 5F7JA 4BNYA 3CGGA 2BN4A 4V0RA 3V3KA 5A1JA 2PE5A 3NHJA 3U7HB 2QPAA 3GPLA 1Q15A 9GPBA 2HW8A 1XLTC 5JRDS 3RHSA 1L7RA 4RCVA 4YJ3A 4QU9A 1J97A 1O97D 1ZRHA 2VBIA 2OV2A 3HCPA 3NFYA 4FMCB 2FF5A 4H1UA 4ACBA 4BZXA 4DNOA 1SUIA 1I7DA 5EIWA 4CNBA 3DL7A 1TVEA 4HZIA 3V2HA 1S2DA 1FXWF 2J3DA 4KE8A 5FYQA 2O54A 1FE8A 4PZCA 1LVUA 1CX9B 4MHSA 5C7OO 1E0JA 2XCOA 1DG3A 1OILA 3DM9B 2Y1KA 4KUGA 4C7JA 2JGLA 1YDGA 2ZWOA 3ZDQA 2X8JA 3AU9A 3LX6A 4CBVA 4BFTA 5H3HA 3IQIX 2NU9A 2FZ4A 1N2GA 4YTEA 3TEMA 1F8XA 3JYNA 3OUUA 4ZP1A 4HLUC 3QV2A 1NNEA 3Q3JB 4OUDA 1QYXA 5ALHA 3KPVA 3TX6A 2IP4A 5K6AA 3IPLA 4LXXA 4LA4A 1T1EA 4OEHA 1O97C 5DTJA 4DWJA 2ANCA 3K9NA 1PT5A 4E2WA 3HK2A 3AETA 2H8GA 1QQBA 2DH5A 4HQKA 4OHUA 4A82A 2FWNA 3ZR4B 4PPYA 4DBLE 3G0CA 2WC1A 3GRYA 5CM8B 5J2UF 3KU1A 1JEQA 2JLWA 2CHUA 3GU3A 3WRWA 1NVKA 4C0SA 4F6LA 2CV0A 2IS1A 2FWPA 3VGJA 3NC4A 4D4IA 1D0VA 4R1OA 4CI9A 4LOLA 3LT1A 4JCOA 5BSRA 3ZWCA 1PGPA 2IXGA 2ZRDA 2YKGA 4H3HB 3C3PA 4G0QA 3PFCA 3S7ZA 2WG1A 2FPRA 3ENNA 3C15C 4D92A 2A1IA 2WAOA 4XYGA 3FJ1A 3ORYA 3TTUA 3TVYA 1TM5E 3PXDA 1HI9A 3JWPA 4TL8A 2JJQA 4BPRA 2F9LA 4RC9A 1D0SA 1JHYA 2HCFA 4A6EA 2AD1A 2DX7A 1LBTA 4NBNA 3RYHB 2ZUCA 4FUQA 2A3RA 3DBHB 3WA6A 2GPYA 2O05A 2W6ID 1RADA 1E32A 3A3PA 4NDAA 4QTTB 1FQWA 1RYHA 4B32A 1T1SA 3NP9A 3UMMA 1PR1A 2VHZA 3RTAA 2SICE 3HB9A 3JQAD 1K6XA 4MITA 4KIUA 3AJ8A 4L2IB 2Z4RA 4G86A 3ZY6A 2CLMB 3B2EA 1M73E 4JBYA 2AQIA 1JDJA 2VK2A 3LE8A 3T7EA 1KOJA 3KKEA 2CLDX 5C34B 3QSGA 2CLKB 5KSOA 3AG5A 3ZW7A 3HN7A 4RPKA 4N48A 1A9XB 4ITVA 2GZSA 1JG2A 1FDVA 1XRNA 2A3NA 4KQFA 3EPKA 4HY3A 3MJCA 2X42A 5CM2Z 4WW0A 3ZDEA 2C4HA 4BNGA 3PL1A 1ZOPA 1QZ3A 2NSDA 2XRZA 1NTRA 2NVOA 4UZEA 3MK31 2IYYA 1THZA 2BSQA 2WFAA 5TRTA 1ZAKA 3DE0X 4MHTA 2FFHA 3COSA 3MTIA 2FN7A 4OYLA 4V1CB 5CIQA 3A05A 3VMMA 2RG1A 1TFUA 3GNSA 4XI9A 2HD4A 2ZWMA 2Q4DA 4IUDS 1ZC3A 5B6PA 1CY7A 3BICA 4NZYA 3RQSA 3I61A 1IEWA 2QW8A 2HDOA 3LLSA 2QVGA 3N5CA 3MCWA 5ER9A 1C9JA 4EBBA 2JHPA 3R76A 4B2PA 1P1FA 4I1VA 5TGDA 1Z7EA 2QTMA 3UK2A 3T7RA 1ZA2A 4Q93A 1MTZA 1OFTA 4EDFA 2QPLA 1NXVA 4DSAA 4L75A 3JQ7B 5BN3A 3GZNA 2G9RA 1Y8QB 3L49A 1MH1A 2QTWB 4NBLA 5CLHA 3U60B 5E8JA 1F0PA 2I6SA 4BLQA 3FCYA 4P84A 3T0FA 1R9NA 4K6KA 5K7SA 1SBTA 1N1MA 2G1PA 3FKSA 2EBFX 2Q6IA 2RGBA 4GZ5A 2X5XA 2PS9A 1N5DA 2XITA 4W7HA 1J1UA 2XYHA 4KN9S 1FVHA 1DG1G 4JLVA 2X3UA 5M5BA 5DTIA 3RFUA 1RQNA 2NQTA 3Q6MA 4BLVA 4PSKA 3RKRA 3AVUA 2DKNA 1W85A 2FN9A 2AEMA 1ZNZA 1R9JA 3C8ZA 3AF1A 2NSJA 3O1JC 1VSVA 3D59A 5I7AA 3WBBA 2BKLA 4JP5A 2V6MA 3W78A 1DOZA 4II2A 2VSNA 4WNAA 1XEXB 1O9GA 2Z4SA 4X63A 2PKRA 4M9CA 4LNHA 3KR9A 4I4CA 4Q47A 2WWXA 5JMWA 1A5AB 1XU4A 3NBXX 2IS2A 1NYTA 2PXCA 4NK4A 5IH3A 5I5EA 1LPMA 3F5MA 1R0SA 2Y05A 3M82A 1P61B 1SFRA 3QELA 4DLSA 4DV0B 3K70B 3BJEA 4QG7A 1V45E 4IKPA 3H5LA 1UBHS 3ILVA 4IR7A 2PUFA 1U2DA 1YZLA 1L5ZA 3CONA 1GADO 5D51S 3QEMB 3WLIA 3D3QA 3ILXA 5EZYA 1YB6A 4RKRA 1PU2A 3LWNA 1XJQA 4OV6B 1DT3A 2HV9A 2Y9MB 3GMDA 3JSXA 1EWRA 1SXJA 1DUVG 1YZKA 3DMYA 3MWDB 4NCHA 2HMAA 5AK6A 2AK3A 5DXAA 3UC5A 1EXNA 2OPBA 3FMPB 4G0VA 4DWOA 2PGJA 2LZ0A 4KAJA 4FDVA 5REQB 3S1LA 4DCOA 1MO2A 4WFKA 3OMLA 1VJ0A 2HHAA 1BVRA 3KUKA 3IP3A 4WT7A 1SVWA 2QHXA 4PGAA 3ZNNA 2CLHB 2QQ5A 2Q6KA 2VRNA 2ZAOA 5G3YA 3TTSA 1LQUA 3AKCA 1PV4A 2R48A 5MFZA 2RHJA 2VDRB 3A58B 2GN9A 1EXDA 1HZZA 1NJSA 1OU0A 1OX4A 3B78A 2Q6OA 1YDEA 3FMGA 5JD4A 1UXJA 1Z7GA 1LDMA 2JVKA 4CIDA 2Y76A 4HDQB 4I66A 1BFKA 4LWQA 1R66A 1ORTA 1A1SA 2XF2A 5EWMB 5GADl 4MEBA 3K8YA 3LOUA 4RIHA 1PW7A 1SOAA 1PAUA 1JHVA 3SF8B 3G7UA 2HLPA 3OD5A 3T38A 3VRHA 3NOVA 5DXJA 2BSXA 1X94A 4MMXB 4XIYA 3A3NA 3WGGA 3M7IA 3PQ5A 4BXOA 3X1YA 4AJ4A 5A2QA 3WSVA 2QT1A 5GM2A 3COYA 3C3EA 4KWEA 3IIMA 1N7JA 1LS6A 3TI7A 4EATA 4RTMA 1YI1A 1UMBA 3UGKA 3GFFA 3M4NA 3PJRA 2C20A 5AW3A 1X8LA 3SZMA 4CJXA 4FMPA 1BX0A 2YWDA 1PD1A 1UMKA 3DUFA 4JH0A 1BFDA 4L4UA 1I3NA 1W52X 4LW8A 4L4RA 1M2GA 3A7EA 4N3BA 3TDNA 4CMEA 4DIEA 2K5UA 2HPVA 2MSNA 1GL7A 2P7IA 4OB6A 3ZY5A 5KNLA 1GCUA 1BC5A 4IYJA 2C92A 4AS2A 4AJ9A 1UPTA 5LQCA 5C3MA 4XIGS 1V1RA 2NLOA 1E7WA 1YBVA 2ZTVA 1EDDA 5DHFA 3GJ0A 4E5MA 1MRZA 4O08A 4E2FA 1YB4A 4F97A 1EXWA 5KUTA 3E8MA 1IIBA 4F8JA 2E3JA 2RK4A 1QFSA 3EPRA 2P5SA 3ZU6A 4CEIB 1CQJB 3I6MA 1CQPA 3WKEA 2W2LA 2M6LA 1JG7A 2Y2VA 2P69A 5FTMA 1QU3A 4Q15A 3M89A 3TNJA 4OQQA 1ETUA 1QKKA 2W6QA 3D2LA 3HGTA 3UMSA 2VPIA 1IEVA 2Q3HA 1G5RA 4YPFA 2KS6A 3P9NA 4DA4A 2E4XA 4BE4A 2OBXA 1PTJC 3ETEA 1TW2A 2MYNA 4EH1A 4MQBA 3PPWA 1AGYA 4LXQA 2J6BA 5J1TB 1OIWA 3P4UA 1ZGJA 1CVIA 2J30A 4JMPA 4HUQA 3FPEA 3GRFA 2J3MA 1PEKE 4I1RA 5KJFA 1H2EA 1KXJA 3JD0A 1ISIA 1EJ0A 1PK7A 5LP1A 1E9CA 3JQFC 3OLWA 3CF4A 1DRKA 1AY0A 4E21A 1U11A 4HS4A 4J0JA 4TXLA 4YQYA 3H5OA 3KZMA 3CX8A 3QEBZ 1LLCA 3E23A 2SKCA 4X0EA 4UE3S 3U7IA 5FQOA 3TB6A 5JECA 2H1VA 2BKAA 2IDJA 4JC5A 2K2WA 4O0LA 4EHBA 3AM3A 3JALB 4G0NA 4YAIA 2PZGA 2AI2A 2P4SA 2HJGA 2TECE 4N5LA 4B34A 5JWHA 5HWSA 2NP7A 4YN3A 1IY0A 4IPTA 5BRNA 2ZJYA 2RH4A 2E82A 3E5MA 1YXMA 3W77A 4MQFA 5CVVA 1W25A 4HH4A 2V6FA 4B81A 2VATA 1ZCJA 3TFOA 4A03A 4BRWA 1TZCA 1I13A 2J3QA 3X0DA 3E1GA 1GUDA 1Q1ZA 2Q5IA 5ERYA 4KQKA 3ZVNA 2XOEA 4A15A 4Q6WA 2V1UA 1GVHA 1HSZA 1JDNA 3EDYA 3VSDA 2J85A 2DQ4A 2QTCA 1TEXA 5JCJA 3U16A 2Y1OA 5DIFA 5KYVA 3CIFA 4ZEOA 3H84A 2CHQA 4RS4A 3CLKA 1PJRA 5EUCA 4ZAZA 4RV5A 4AJNA 3GQVA 2GAJA 3SSAA 4NFYA 4M38A 2ZULA 1XDWA 1Z45A 1WG8A 1WZUA 4N8SA 4L6IA 4MV8A 3JYHA 5BSKA 1YOVA 4OIMA 1CUGA 2PUWA 4HVTA 2YOHA 4EI9A 2I65A 2HO4A 3R0JA 4UBIA 2H5IA 2Y0PA 4UULA 1DFGA 3L1KA 3LCJA 5A4MS 1JXQA 5FTJA 3RRBA 2Q49A 1H2BA 4XM0A 5D3KA 3EVDA 4I4TB 4QVIA 3HTXA 2FP3A 1HO3A 2VNAA 1KE2A 1BD3A 1U6JA 2EQBA 4Y2SA 2Q27A 2O2ZA 3T4EA 1CU1A 1AK1A 2PS3A 3OEWA 4BOYA 1W5EA 3KQSA 1RC1A 3GNLA 3HADA 3HB7A 4QARA 1R8JA 2IXTA 3CR7A 1NASA 4OBEA 3SVTA 5EVJA 1NI4A 4W63A 2A9PA 5IVKA 3DA8A 4IDPA 4RKYA 3A06A 1EQAA 1KI2A 1KKMA 4JL5A 2E1RA 4NBUA 1W5BA 1FYDA 1Q3HA 4NENA 5IN5A 1JZQA 3D6UA 2BTEA 2EKPA 3D3NA 4TM7A 3ONVA 3CZ9A 3G02A 4ZYTA 3AESA 1G8JA 1JDZA 1H23A 3FSJX 3VR5D 5I7VA 3OPNA 1T91A 1J22A 3QU4A 3C8DA 1ZUWA 5DBFA 4ODIA 4DLLA 2J0UA 2A5LA 3U17A 4BX0A 5F76A 4MAFA 1KI6B 2KYRA 3DWEX 5JDCC 3S4YA 3AGQA 1CDEA 2AG6A 1B41A 4E11A 1IQRA 2I2XB 3C6MA 4BHTA 3IP8A 5F73A 2FMIA 4RZIA 1P2TA 1DUIA 1NAIA 1WSAA 3ZHQA 5BNIA 4UTVA 5IKOA 2ZT7A 4YQEA 3T61A 1XVAA 2WMOB 1YRQA 5FUWA 2DQKA 4YMVA 1W9HA 3DR3A 1N3YA 4Q1DA 5BV0A 5G40A 1PL7A 3PR3A 2WP0A 1FBTA 3R7LA 1OPXA 1XYGA 3AM5A 4IIFA 3SHOA 2J9FB 1VLMA 1QKJA 1N7HA 4RPHA 4WXMA 4MP6A 2D1RA 1ML4A 1TYZA 5JAUA 5JCXA 1IJEA 1HK7A 1V5EA 3QWBA 4EEXA 4BQOA 3TLXA 3GBSA 3RD5A 5LQJA 4CMBA 5DEOA 1YA8A 2BHLA 2TMKA 4BO8A 2IH2A 1WW2A 2W11A 3TW0A 3LU1A 2E55A 3SZUA 5HUHA 1PWXA 2AUTA 3G7NA 3GNQA 2C7BA 2DRIA 3RRXA 1X3LA 3A9UA 4D2IA 5BVHA 2UUAB 3Q2IA 1H6BA 1YNSA 1W0JD 1M1YB 2P79A 1C7RA 4FGSA 4P3OA 5HIAA 2B0CA 2P3OA 1Q0RA 4YCJA 2R8EA 3TQSA 5FLXA 5KNDD 3LO5A 1GZ7A 3G1UA 9ABPA 2VPZA 1SQ5A 2CE7A 4E2ZA 1N5LA 1YZUA 1XZDA 2VZLA 4OYYA 4HATA 4H0NA 2BBOA 2D4AA 4D4GA 4L1KA 1UXHA 2W2PA 3A0UA 3VFDA 3STTA 3GAMA 1KOGA 2I6TA 2X2FA 1TQ8A 2XRYA 4MVJI 4HAXA 4IDAA 2C5SA 4OSEA 1Y7LA 4JDUA 4RIIA 3X3HA 4MB6A 5CXUA 2INGX 3JRNA 3NG1A 5C2JB 3OO0A 4DQKA 4ZU6X 3SEAA 5LPNA 1HRDA 2C84A 2V74B 4ND8B 1EFKA 4PLVA 5ALDA 4UOEA 4X20B 3GK3A 1KL7A 2ZWVA 1POWA 3VKFA 2GKOA 4UU7A 3Q9UA 4LKRA 3LYUA 3L0IB 4JASB 3U5TA 5JO0A 1T10A 1YMQA 4L76A 4WJKB 5E6RB 3T7TA 4AF8A 4QD3A 4RF5A 1GSIA 5B58T 4AFNA 1O6GA 3KU4A 5CA0A 3VXKA 1N2JA 1WW3A 5AQ1A 1TAHA 2G36A 5EFOA 4DLZA 3ETGA 4C7XA 1Q3KA 1NFRA 2IBMA 2FSHA 1NDHA 3KP1A 4BJ1A 4Q3KA 3R7FA 1MB2A 1WHSA 2B5WA 2HM7A 4NNOA 3THRA 3CUYA 2QZ9A 3UOAB 4OLAA 5GY7A 1EK5A 3NHUA 4CZ2A 1UBMS 4D9JA 5SY6A 2Y1DA 2JHFA 3EZ9A 4E51A 1LH0A 1XDUA 1AC5A 4FUTA 5AIAA 3DBOB 3GFTA 3JQQA 4DHEA 2XEXA 1HT0A 4N5DA 3AW9A 5JHHB 2G3YA 4UUNA 4ZEVA 3ADPA 2GO7A 3DZKA 3K0AA 1ECGA 1QUEA 2PKEA 4NF2A 1GM5A 4WJZA 4KNYA 3M49A 1V6AA 2P0EA 4DPKA 4GNKA 1UJ5A 2OHVA 3SNKA 1BU8A 1NNI1 1C1DB 2JF0A 2OQRA 4DMKA 4DLNA 3VO9A 1TTTA 1PLLA 1RXWA 2HB6A 2YWGA 4UU1A 3RFVA 4KDCA 2ZAGA 3O8DA 3CUUA 4NH0A 3IJ5A 1Z6XA 4XX1A 5I9MA 1X1DA 3AUUA 3MJFA 4PLCA 3VH3A 4QM6A 1FTSA 2BHSA 1U2SA 2GLTA 4U5QA 4P0QB 1AV6A 5C1DA 3WAGA 3NMUF 3TI9A 4RM3A 3RU3A 1FK8A 2VQ3A 3VDXA 2GK4A 4DABA 1TYCA 2W0MA 3ABOB 1FJHA 1L5VA 2QTZA 4B74A 4A3SA 1YS6A 4BX9A 5K99A 5K0LA 5IKXA 5B5SA 1ILWA 2E9SA 4PGHA 2Q9CA 5MN5A 3HLKA 4GP6A 4L95C 1UK6A 1JIJA 1N6LA 2V6GA 3IBFA 3NLLA 3SFZA 1SIUA 2OXTA 2AYZA 3GI1A 3W2TA 5AK3A 3GUZA 2WZCA 4C0LA 3ITEA 4O25A 3H1BA 2R8BA 1PGNA 1LDGA 1BAPA 3CA8A 4R31A 4XOUA 2F62A 4LSWA 5SICE 3M2PA 3P9CA 2DTXA 1E7RA 2VSQA 2EZUA 1SVOA 2HRRA 4YP9A 3WIOA 3ZG6A 4FD3A 3NKFA 3LKDA 3HXKA 1YDFA 5BWMA 4ZVLA 1U7TA 2PT5A 1J06A 4I81A 1L4FA 1PJ4A 3NHWA 4G2NA 2HF9A 2HY7A 2WHPA 3H7AA 2ZSFA 3NATA 5SY4A 3VO8A 4KGZA 2IGTA 3CBGA 5CH3A 4JI4B 4BJHB 4LF4B 1LNSA 2DBYA 3PQ4A 3T3DA 4XJVA 2ORED 4HBZA 1KAQA 2G83A 2IP1A 4P98A 3IV6A 5AR1A 1ODCA 5IULC 3VAZA 3ANTA 3FTQA 3MOIA 3Q1KA 2IHUA 5CD1A 4XCXA 2CYBA 4AW9A 1FFXA 1BJRE 4XFJA 4Y6GB 1N2ZA 5BW8A 4S12A 2QK4A 3Q1LA 3T7CA 3JASA 1HE8B 3QWHA 2X3FA 4LJ7A 2IPXA 3K1AB 1C4WA 3SHQA 5CA1A 3FNQA 1OHHD 3E9DA 2GSWA 4D8WA 4JI0B 2XNSA 3FSRA 3IAFA 5K8VA 3IP1A 3FGNA 1XZKA 1Z83A 3A3KA 3ISVA 1U9IC 2GBPA 4GSKA 4KV9A 4QTZA 5F2NA 2AFHE 3DNFA 3E0QA 4ZDJA 2WQ6A 4H4DA 3BIWA 1JWBB 2Q4RA 2Y0CA 4IQ4A 3CLSD 4NYJR 3TIXB 5KVVA 5LSAA 1IBRA 4XPIA 2QM8A 5LXTA 2E4WA 3H2HA 4QUKA 1L7NA 1EFDN 3OUZA 3GFPA 3V4RA 3UANA 3ZVKA 5CDYA 4PRLA 4ZTBA 2QP4A 4MI6A 1GTJ1 3AGPA 4GMDA 3CMCO 4NJEA 4AQDA 1QRTA 5DBHX 4L50A 1HT1E 3IEXA 2QN3A 4RANA 3DAFA 4DBVO 4BB9A 4Z7QB 1XP8A 5UKDA 3TQFA 4JAVC 4PNEA 4KFRA 3I9LA 3DM5A 1YU9A 5CRIA 4FFDA 2WPDD 3UF0A 1S89A 2CL0X 5FDFA 1JG4A 3SM9A 1SK9A 4NRDA 3CVJA 4A0SA 1FVOA 5K3FA 4LF7B 2H8KA 3G2PA 1T34A 1P2SA 2I54A 2X86A 4J6EA 1JL3A 5AVWA 3DH0A 4EJSC 2KB0A 3A4MA 3EFHA 4KKVA 5I9NA 1J24A 1ECPA 1YA6A 3JRXA 1KRWA 1Q7TA 5IC4A 4ZFNA 3L5KA 3T3OA 2QT0A 4WY8A 1R0RE 2X14A 2IP2A 3EGWA 4TKMA 4LTNA 4DCSA 4I6EA 1P3JA 4IICA 3EUEA 1NLYA 3G68A 3GJSA 1J07A 5IUNC 2BONA 3C7KA 4D4LA 3NS7A 4TV9A 4GGMX 1JXOA 3UZUA 3VR4A 5AUPB 2C8LA 4K6HA 4AJEA 1Y5NA 2J6CA 3E9NA 4E5YA 4HUTA 5LU8A 1L9XA 1P1CA 3F96A 4PLZA 2PCLA 2XXJA 1RYMA 3RM3A 5HF5A 1Q0HA 3W5BA 5EY5B 4HB2A 4C5AA 5AQEA 3RJMA 5LOVF 5DYGA 3CZRA 1M5RA 1GLVA 4GLLA 1Z75A 2CJYA 3REFA 1POXA 3B8HA 1SA0A 1W76A 2ZPAA 4G9GA 4X1OA 1PF7E 1E2IA 4J6FA 1AU9A 3RTBA 4WK4B 4S1WA 2ISCA 3J7AC 3VO1A 1F8UA 4OB7A 4P38A 4YJFA 2H00A 3Q3HA 2W22A 2FQYA 5JMOA 1XAIA 1LDNA 2OHHA 1FFSA 1LQ2A 3FZYA 3MZ0A 1QXSA 2FK7A 2NXJA 2Y67A 3R24A 2OPHA 2QJRA 2R8XA 2XMDA 4I2NA 4MYTA 4ZCSA 5JZOA 3II6X 4UVDA 1WD5A 5KNCA 1JSLA 1ND5A 4D3DA 4FDAA 4I5FA 4MUJA 1CF2O 1U0JA 4XEHA 1L5SA 3UMVA 4OCZA 3KQLA 4YRRA 1C3OB 1F4PA 1KZ6A 1MNQA 2DF8A 3C5CA 1G4HA 4WPGA 4ZZ3A 4EEKA 1KJYA 1XTBA 2BGNA 4YRZA 2VHXA 4DJDC 1A04A 3GOQA 1YKFA 1QOPB 1V71A 2V8OA 3COWA 4ZT2A 4UNIA 3FOCA 3GHYA 4BNWA 3WMXA 4Z7NB 3BX1A 2EP8A 1A9YA 4U00A 5EYPA 4WKCA 5FBZA 3RF6A 4F86A 2PD4A 4AS3A 1GRNA 2OHJA 1MRSA 3F8WA 4ISCA 3TQHA 2O2JA 1IN4A 1DQYA 1DDGA 4K6FA 3I2KA 4JI2B 3TAXA 1SCQA 2C8JA 2XBLA 4X3PA 1C0IA 1SVSA 3SLGA 2VPYA 4EKGA 1YOBA 1NULA 1OFVA 1DQPA 2FJ0A 2Q6VA 1SBIA 2X5NA 2YV1A 3E61A 4X9XA 5LA6A 1QK5A 1WXHA 1QIDA 4R54A 2AFIB 5CFNA 1SKYE 1B6TA 1KFKB 2Z5FA 1GGJA 3GBVA 1RJDA 5ALIA 5AVXA 3QITA 5ES4B 1UMCA 4M0PA 3WDSA 1HNXB 1MENA 2MIIA 4IIJA 4NPCA 1WXEA 2IE8A 3AFOA 4F06A 4DG8A 4HTAA 4ZYXA 3N76A 1DO2A 4H7HA 3REQB 1M2FA 4NZMA 3VVCA 5TNXA 4RZUA 4G65A 3FMIA 5F12A 4GHWA 4O2RA 2WVHA 2XMZA 1JR6A 1NUPA 4Z9XA 5CT5A 3D6HA 5E1OA 1G17A 1I3OA 3H7IA 1GZHB 2XODA 1PO7A 3UWKA 2QNRA 1RZVA 3KFXA 4J9VA 4YQFA 1SCBA 1OF1A 1QRDA 3DOCA 2WW8A 2IEGA 4FFLA 1E0KA 4NAHA 4IDQA 2R1UA 3CT6A 3ECCA 3P0EA 1F17A 4K0KB 3OKPA 5CJ2A 5IHPA 2H0QA 3N2NA 2QMEA 4MI1A 1O5OA 4JENA 4G8BA 4D9IA 1JVNA 3OFSA 4HYQA 5K3OA 4GPTA 2VDQB 3AJAA 3OWXA 3O74A 5B3JA 4KL8S 5JZ9A 4AKGA 3M1AA 1R64A 1OZ0A 4URVR 1S6YA 1KP3A 2P9FA 3EDMA 4BIIA 4ER0A 1EX1A 4NYIR 4WZAA 3RT9A 5IXYA 1C7JA 2B25A 3NNNA 3OBIA 4F5ZA 3KVNA 1NZFA 4E5UA 1IWBB 1CUHA 1V8BA 1NN3A 2CL6X 2IYFA 2C2XA 2YY7A 4HH1A 3QWIA 4MVJP 4BMVA 4CFZA 5JSHA 2NU6A 3FAZA 1LPSA 3IA7A 1JE0A 4H1VA 5H59A 1LRLA 3FYUB 4GWKA 4DUPA 4EHJA 1ZL2A 4WOCA 4OI0A 4RYDA 4Q3EA 5KSYA 3ZWMA 1GFWA 1YQGA 5A4JA 1X7XA 1IQUA 1CUBA 3GPCA 4BNDB 3SBDA 1XTKA 2DQYA 5CX4A 5LZ7A 3EJWA 1GG8A 4I46A 2YXLA 5BV1A 5IBQA 5FO1A 1G291 3WOVA 3DKPA 3K0FA 4DQUA 5JJKA 1SH7A 2WKWA 4KYTA 4TX1A 4OSPA 4ZZ0A 1R0XA 4FOPA 3W6OA 1YUNA 4A8JB 1Y1SA 5KZMB 2FMKA 3OF2A 4FEYA 1TA0A 4Y1EA 1KGDA 2HMWA 4F2GA 2Q4TA 1G4UR 1VBKA 5TQVA 3UAXA 2G1AA 1KMNA 3NBAA 4ZCIA 3TW8B 2WJYA 4JVNA 1QQAA 3JD4A 2D74A 3EQ9A 2OGTA 2PUDA 3MIZA 1AUXA 1JSZA 1DJQA 1RPTA 2H92A 5ILGA 5LUAA 1TZJA 3GRPA 2XQIA 4ZOLB 1L4LA 2YXEA 2PBRA 3MUOA 4D81A 2XSZA 1BIFA 1LRJA 3W79A 3PFWO 1WSBA 2IYTA 1ZH6A 2YMLA 2W70A 4FR2A 1ESNA 3BZBA 3ELWA 4TWIA 5EZYF 1E58A 1A4RA 3MGGA 3SX0A 1KYIA 3RT1A 4NCIA 1VFPA 4CM5A 4K9DA 1JDPA 1G2IA 2QQGA 4HDSA 4QAQA 1KOLA 5JVDB 2OC4A 3S27A 1U31A 3R20A 1N3BA 3ZE7A 4JXXA 1W36B 2I7VA 4PRKA 2HA2A 3EHEA 4CTMA 4ZC1A 4B3CA 2WD9A 1BWPA 1L2TA 3EZLA 4OSOA 5AKLA 2ZZMA 4GWGA 2CBXA 5IF3A 3VM6A 1BDIA 4NH4A 2OGZA 5TSDA 1HETA 4C14A 3LBFA 4PEVA 1KVSA 5A71A 3B20A 5HKOA 4INAA 4ZT4A 1EBUA 3ETDA 4QPZA 1I1HA 4Y9UA 3BWEA 2O7SA 4I0WB 2O50A 1M83A 1PX0A 2VAPA 3K0KA 4B80A 5U9CA 4IQFA 2IFTA 4ZQFA 3VDNB 1TKBA 4AU1A 4FYMA 5A06A 3T9FA 3ERCA 3GEDA 4Y1RB 1MAAA 1XRLA 3GP5A 1II8A 3BXFA 4MYSA 4HDMB 1VI2A 1P5HA 2W71A 3MCAA 4O5OA 3QPAA 4WEOA 4TWZA 5CXSA 3STWA 1U0GA 4CEHA 3V1YA 1F3LA 4LJKA 3LQ1A 1WDKA 2COUA 5AHOA 2XMQA 4CQJA 4EVQA 1ONPA 1XWFA 2VQFB 2CB0A 1REQA 4EFLA 4J49A 2HL6A 3GPBA 4X6YA 2JJ2D 5L40A 2OHIA 2VG8A 2QUBA 2UZ1A 4X1YB 1OFHA 4RFSB 5JFTA 4WK6A 2FFJA 1V9LA 1ONNA 3GROA 5JXJA 2E1PA 4MGEA 5HKKA 3TJRA 4QT0A 2H63A 2WU0A 2WA1A 4H59A 1NG9A 2ZS9A 1EB8A 3G59A 2JLXA 1BN6A 1GEGA 4CE6A 1DWUA 1GQYA 4P2GA 4TROA 3DVSX 3ITNA 4GVPA 3ACDA 3FWZA 3V33A 5BN4A 3AYZB 3IQDB 3ZLTA 3Q8XB 1YUBA 2IZ7A 3RBZA 1E61A 3IEKA 2NVWA 1L5GB 3JQ8A 2C5FA 4HUJA 1Q7GA 3HFRA 4YI5A 3N70A 3NM5A 5CH8A 1JG3A 5CB0A 1WIWA 1U3TA 4RZHA 4W5RA 1U0BB 2ZYAA 3DL4A 4KCGA 1RFGE 5B30A 4LYAA 3G8AA 2PLWA 1OTXA 2GNAA 2EYQA 2NNWB 1EGQA 2ZDGA 4MDHA 5DLPA 2YWJA 2CNKA 3PFIA 4KQEA 3WK6A 3ZCXA 1K7EB 1JG6A 2WJPA 4DA8A 4RXTA 1TAUA 3F97A 2PPVA 3LY8A 4BLRA 4P31A 4R2KA 1NMZA 621PA 1JWAB 1PNOA 1PQUA 4I14A 3BBLA 2I33A 4FIDA 2EKZA 1R3DA 4V03A 5FL7D 3KEOA 4P4SA 3ELBA 1TO1E 2Q5CA 3FYHA 3W1EA 4BC0A 4RTNA 3ST7A 5GINE 2GFIA 2VDWB 4KO1S 5A4IS 2ZRHA 4Y2JA 2JLSA 2CD7A 3CN9A 2J07A 2ONCA 3QTBA 5HGJA 2OKCA 3R8XA 4IFIA 2PUVA 2GJ9A 5C35A 2C7GA 1KFJB 2A1TR 2CJWB 4YK7A 4FS3A 3QHPA 1DXQA 4RMGA 2NTEA 5EZSA 4R9NA 1CF9A 1YASA 1K63A 2A9QA 2PT7A 2PYIA 3IJPA 2X13A 1FDTA 4O33A 5DM4A 3UYLA 3FH0A 2D2VA 2AVNA 1WAMA 3DONA 3E48A 3TTTA 1OB2A 1H93A 2V3WA 4R3WA 2FFQA 4ROTA 5TB5A 1OAOC 4BO5A 4H60A 4QLBA 1EIWA 1V3VA 5FPTA 3N8NA 1AGNA 2GEKA 4DZRA 4NXMB 1I6MA 1R4NB 4FGLA 4EOGA 4PY2A 1ZSNA 3EQ8A 4B3XA 4F5EA 5K8TA 4CKCA 4CLRA 1MC1A 1YMUA 3IMGA 3H5RA 3OJXA 3OX2A 5ARDA 1Z36A 3OFNA 5GVSA 1HWYA 3ICOA 5EJMA 3W5HA 5HGXA 5CDTA 4JB0A 3RC7A 1LSJA 4FHFA 4GMXA 1T3ZA 3RFXA 2VHYA 3UXHA 5FFNA 1A5BB 4BNNA 3GLTA 4C7KA 2D54A 5IDQA 1OKKD 1WSDA 5F9HA 1B0PA 2QE7D 4UMDA 4YMHA 5CXQA 2HRBA 3N9IA 4HBGA 4RAQA 5JSZB 1NONA 5J59A 3GA0A 2RKWA 3JSAA 1EGHA 2WF8A 3IAS6 3BWXA 3KT8A 2PQ2A 1XALA 2ZS8A 3MBIA 1NMQA 2O8VA 1Z3IX 5T8KA 3QXGA 4NE9A 3VHXB 5JCPA 3I5UA 5JY1A 1H8EA 2B82A 4ZQEA 2AYXA 1C9YA 2LBPA 3EEFA 3L4SO 2VUUA 4XGIA 2DY0A 3O3NB 2R7LA 3I01A 2AE1A 1Y3DE 3M6WA 4S1NA 2PFKA 1YVEI 1LJ8A 4ND5A 2ZJ4A 4ESVA 3FZGA 1WBDA 1DJMA 2Z2JA 1KO7A 1XTPA 3F3MA 1DMRA 4LSZA 1P4SA 2WILA 3CX6A 1DG9A 1R5OA 3GZJA 3VPAA 1EZZA 1A2QA 3VQTA 5GZ6A 4AMUA 4DCVA 5GJBA 3OQ6A 2W2VA 1YI0A 1GU1A 5L3QA 2QTVA 3E22B 3L7YA 1P31A 4UZSA 5JR3A 4UVIA 1B6RA 2Z1NA 5B1EA 5FV4A 1UKCA 1JYFA 4Q4HA 2C61A 3ZBUA 1LTHR 5AXDA 2AQHA 1H5NA 3R9XA 1SHJA 5EINA 1GFSA 3FW1A 2GRJA 3H5WA 3E4CA 1VC2A 4BU0A 3GUHA 2IYVA 2UXDB 1QGYA 1NN1A 3BD8A 2R6AA 3JW8A 4IH1A 4RVGA 2Z9CA 2GKSA 1EDZA 4JJAA 2ZI9A 1GY8A 4MGIR 4M88A 4CIVA 4YRNA 5LWQA 1Q5PA 1E18A 1GSOA 4ZAWA 1QJ4A 2BSAA 1NMSA 3AHFA 3ECAA 2P1DA 2WIKA 3G5LA 2I4TA 1P2UA 1IHYA 2J9XB 3ASUA 4KYUA 5IJAA 1XCOA 1II0A 1FNMA 4Q03A 4R8VA 4XWYA 4Y9TA 3TQQA 3W4JA 1RZUA 2RGCA 3KLBA 2FNAA 3B9BA 5B1HA 3G89A 5LKRA 4IMIB 4PR0A 5K3DA 3SPXA 5F7OA 1RJFA 1PUJA 1Z47A 4G0MA 3PNMA 4HWOA 1L8LA 1I7PA 2VA9A 3O9VA 4KQ6A 3EXHB 1C4KA 4XARA 4WUVA 3UQZA 5K0FA 4C7OA 4WHMA 4D3SA 3EVZA 3FHTA 4HDCA 4E88A 2UZIR 3WQBA 3AVQA 2GTHA 2WSSD 3QXHA 1PYDA 4I50A 2YZKA 1XRJA 1GG5A 4XGQA 3EB9A 4KFTA 3BOSA 5FR1A 4CDMA 4DXDA 2CXOA 1ZU4A 5BN5A 2XT0A 4JJ8A 3ZE0B 2AX4A 3BDIA 4BQQA 3FB1A 2B94A 2XIQA 5HE8A 4C4AA 5ICEA 3G5TA 1NXPA 2WIDA 1FP1D 3KXPA 1N9KA 2ZRBA 1G20A 1VPDA 4AF6A 1KYZA 1OLOA 2L82A 4GXQA 1PBNA 2QL5A 5I7EA 5C53B 1YFLA 4Z2YA 4BGIA 2I6QA 4GMKA 1VKZA 2LUOA 4RADA 2FZEA 5J5VA 2QB5A 5BMOA 5LU9A 1DADA 3P94A 1QLHA 4RHFA 4JQOA 5HNKA 2BELA 2JL1A 4QBFA 2R00A 2ZAIA 5A3SA 2YYZA 1MN6A 4D9EA 5JC8A 3NHYA 1Q7BA 5JCOA 1K7CA 2OK8A 1J2JA 1T2NA 2Z08A 3KS9A 3X1KA 4M6WB 2BKEA 3KSUA 4IOMA 4N01A 4C4YA 4QJ3A 3GJ4A 4U7TB 2GM9A 2JFPA 3VR5H 4MIKA 3SEQA 4QHSA 4RQBA 2NMVA 4X1KB 2GHIA 2JIOA 3SXPA 2PZEA 3RWMB 4EUKA 2HIMA 2Q3LA 4RYLA 1I10A 3EW9A 3UJ6A 3KB6A 3VNQA 2EJBA 3AB3A 2VNJA 3NZEA 2NUAB 1E1NA 3O92A 4LEIA 4MWGA 1BNCA 4M1OA 5JSFA 1NZDA 3ESBA 2I3AA 4K1LA 1XBTA 4Z54A 1IDN1 3ICCA 3BMCB 2BR3A 1U3WA 1X14A 1QGUB 2IHJA 3EH1A 3G1WA 3LBNA 1B1AA 4FYXA 4P4UA 2WHQA 3CG0A 1BYUA 4FWBA 1RWKA 4JBIA 3URKA 3WLKX 1ZM7A 5I7SA 3K20A 4AO7A 2O5CA 1SCUB 2FPWA 1NVEA 5EOVA 1OLUB 1DKOA 4D6XA 1BXGA 3U09A 2ZBRA 2HUPA 3E7FA 2PUBA 1GYRA 1J0CA 5CA0F 3KKKA 4HEHA 5JW6A 4C30A 2B78A 5FAXA 3PI6A 1SKMA 2J5QA 4FHGA 2A9JA 1WETA 1H8HD 2N0SA 1CJVC 3PJEA 4EHAA 5JFOA 1D07A 3GFRA 4AYXA 3JAKA 2ZIVB 1Y8ZA 2OCDA 3BJIC 5D7NA 2AEEA 4A36A 2J3JA 2ALJA 2AC2A 3HEMA 4XKJA 3UFXB 3LLMA 2PWAA 4KDFA 2Q1XA 4DOMA 1CIJA 4NJOA 1X80B 4TWAA 1QFMA 4HNTA 3PTZA 3RBVA 2JJ1A 1U4NA 2FW7A 1DE0A 1Z56C 2QG4A 3L7BA 3OQHA 4L4SA 4I3HA 1EVYA 2BGGA 5KNDH 1COZA 3HN6A 2C8KA 2QX6A 2WI8A 4Y6RA 5CYPA 5C8YA 3W8DA 1H2HA 1KXZA 3V4ZA 3EVTA 1ESMA 2GCEA 3GH3A 4CU5A 4DKJA 5HQ3A 1QIHA 3VR2D 3FWPA 1W73A 2WIJA 5KTOA 1XG5A 1H42A 1OLXB 1GPKA 1CY6A 2OMKA 3KIPA 4L0CA 4ZANA 5CLJA 1P2VA 1CD5A 1XRRA 2C2YA 1SCNE 4Y1FA 4FKMA 3MVEA 5TJHA 1NN5A 1H3FA 2QLMA 1ONSA 2QTBA 3MMZA 4GXRA 2EG9A 4HHEA 1EVLA 3LHSA 2ONKA 1QE0A 4FJ1A 5BRJA 2C7QA 3ES9A 2WU4A 4I55F 4IV0A 5CITA 1GGFA 4TXMA 4QJIA 2IV7A 1NBOA 4J75A 2PJDA 1Z22A 1GUZA 2IIQA 4MW9A 2GMWA 1T6NA 2EFHB 1LLQA 2PV7A 1W59A 1UQRA 2HFKA 1P3DA 3D5TA 3LWDA 3PD1A 3V9PA 5C32A 1XNHA 2W7TA 5ETJA 5G1OA 1T6XA 1R6XA 3MHTA 2GVNA 3BHJA 5BURA 3H19A 4D26A 1JJIA 3TQTA 3DVQX 1WJGA 3SKXA 3L8MA 2IT1A 1GKYA 1XP5A 3B5EA 1UOEA 3PC3A 1NF8A 4HK4A 3WO0A 1KQGA 3VHXA 1WULS 3BMQA 4TMXA 2YR0A 4RKFA 2ZXFA 2W37A 1I2CA 3UHJA 2B9VA 4YJGA 5KWEA 3HN2A 2FR0A 1O3YA 2CEKA 2YHSA 1CJTC 1EWVA 2OD9A 2Q3CA 3MERA 4M1WA 4R98A 1QG4A 2WM2A 1PSWA 1JFTA 1A9QA 2PS1A 1GRRA 4DMGA 4XQEA 4ALLA 1OW3B 2E0IA 1WCIA 1EDBA 3FVQA 3I9V6 3N39C 1XMSA 2BMJA 1DWPA 2AF3C 1RYEA 2JD0A 2WAYA 3NM6B 4C1NA 5DHPA 2D62A 3WMRA 3KETA 2GASA 1V7PC 3KHSA 4JJFA 2BFBA 2XKJE 2YWEA 4OYRA 4R05A 5E7IA 1V8PA 2BFDB 1R37A 1SQ0A 3CKYA 4RIEA 2P65A 4KXQA 3JR3A 2BFFA 1OVGA 1DBIA 4YRBA 3R8CA 1RQXA 3VR6H 2VWPA 1WB4A 2GFHA 1EK1A 4MI9A 1N2CA 2V7TA 4BAZA 5CA1F 4HKTA 4ILKA 1IB0A 4U6QA 3UOWA 1YO6A 3TD9A 1CB0A 1QC5A 1QG0A 1T8RA 3ELYA 1YQDA 4D25A 3V4FA 5JXIA 4PZLA 1EGVB 4QXQA 3C6YA 2J6IA 1ZHHA 1YZFA 1DTWA 2L18A 1B1CA 2PQ0A 2EIHA 4O4HF 1US8B 2WG2A 5HKLA 1QV7A 2C5AA 3PITA 3I9KA 1AQYA 1QR6A 1Q1AA 1DBSA 3ZDRA 3VJRA 1ORVA 3JQPA 1K97A 2JGNA 2JRCA 1O0BA 5IK2A 2CXRA 1VL0A 4A6PA 2QMYA 5D86A 4DADA 3NKVA 3AF6A 3L1JA 1L5HA 1TVKA 5ILQA 2O7QA 3EVAA 3TRFA 1TPYA 2I4MA 2OY0A 4CGYA 5B58C 1Q50A 5KX5B 3H75A 2E7ZA 5I7FA 1Z34A 1KQNA 2IYQA 1NW9B 1KEZA 4CCWA 5JI3E 2IH4A 1O1YA 2CMHA 5FNVB 3PQ2A 1QM5A 3A10A 1EE1A 1TKCA 2QRNA 2QE6A 2X8AA 3L46A 3G88A 3R09A 4NESA 1Z26A 4MIYA 3T7AA 3QLUA 3DC7A 4HX2A 3W6NA 4DW8A 3O3CA 2YCLA 4CMIB 4NAUA 3TXXA 3DPIA 4J94A 5F2OA 1X92A 1NQTA 3IDQA 4FHDA 5BO5A 5HP4A 1JPVA 4JQSA 5FUQA 1Q17A 3CRRA 3EY9A 3B85A 5C4MA 2C0QA 2X1LA 3JD3A 4E1AA 5K05A 1K6MA 1HDEA 4G0XA 4MAAA 3RSZA 4B4WA 2ILTA 3GUCA 1U7OA 3RVRA 1ZD4A 3EXEB 3CE6A 1QE3A 4RDCA 4HLNA 3ESXA 2WSMA 3FTPA 4ND2A 4UXJA 4D8TA 1G3QA 4YVFA 3PE3A 3AR6A 4IH9A 4N0QA 3WNCA 4BMDA 4EJ6A 3KKNA 4KNVA 3ZGOA 3C6QA 1G3UA 3GGOA 1GZ6A 3ID6C 4JT4A 5DNCA 2PANA 3CHYA 2LCQA 4LSGA 1AS2A 3GLHA 2HBRA 5EJ4A 2ZRNA 4DIMA 5KPJA 4M87A 2W9XA 3OE7D 4MW0A 1OYWA 1GJRA 1LXCA 2HRQA 2X8WA 2RAVA 3Q85A 5DDIP 5T64A 3D0RA 5I7UA 821PA 3A27A 3LQKA 4TKZA 4QFMA 1OFUA 3A70A 4AJLA 1NQUA 1UEXC 4GO1A 1QG6A 3BTSA 2YJ4A 3LHKA 1MEJA 4QGAA 1NRWA 5CPFA 4BQIA 3AO0B 3RQIA 4DVJA 2XCLA 1UKYA 2PEZA 2Y66A 1EVEA 1ZIPA 1G5QA 3GRKA 3GT3A 4LY3A 1VCIA 2P9CA 1E1QA 4P53A 1QONA 1PR0A 1JKMA 2ZTHA 3MWKA 2ECOA 2JEYA 4ZI7A 1IM5A 1FFHA 2YV5A 3DBHA 4S3MA 2I7XA 2P77A 2PG3A 4ZA2A 5FBWB 4EJ2A 2Q50A 1E77A 1XK6A 6PFKA 3RVMA 5EJ9A 3I5MA 5M34A 5EWLB 2HWWA 1L7PA 1NJFA 1U3DA 2D06A 3H5TA 3RRFA 3TCKA 4L2IA 4UCXA 1GNTA 1SKYB 3VU9A 2D8MA 1E4EA 5HE9A 4F0JA 1ZH2A 2IVFA 1I7LA 5DNDA 4D5EA 3Q7EA 2DXIA 2ZIEA 2OCIA 4B85A 1JHRA 1EAMA 4GZLA 4GD3Q 1BVUA 3D2AA 4N7JA 4OXIA 1QWOA 4LRSB 5E9AA 1CUVA 1E3LA 4EB8A 4YY3B 1W34A 2VH2A 1MU0A 1XQYA 3I1IA 2Q2WA 1CRWG 2XRFA 4NWIA 4DDKA 4L7VA 4ZQGA 5LA6F 1BXKA 3H5AA 1KVUA 2PMDA 3GEBA 4FI3C 1LB1B 3G2LA 1AN0A 4KSBA 3UMFA 1Y9ZA 4V1CA 3HKDB 1CPYA 2DWUA 2H51A 2V65A 3JZFA 3KR2A 4UM5A 1DCMA 2CJFA 1CZLA 3R4CA 4E32A 3OIVA 1ZESA 3QPBA 4TTAA 1GR1A 1PQPA 5IWCA 2WJJA 5FOWA 4B71A 2GUWA 1G6Q1 2Q1YA 4TMZA 2MSDB 5CR9A 3BT7A 2AG5A 3REGA 3TGWA 3EQ2A 3MOSA 2C83A 4QHTA 2QP9X 1Z39A 2KM1A 5DB4A 3VYSB 4WI1A 5SYAA 5FI5A 3W3ZB 2H3EA 3ZGVA 3BE8A 4PYNA 3JQ7A 1Q57A 1FCJA 3ZGNA 1Y8QA 1M54A 1JHMA 2H4XA 4KXWA 4DNFA 3GVHA 5AKZA 5E6UB 1DAOA 3RPEA 2ZTUA 4PG6A 4R6XA 1NVTA 2F59A 1KNXA 3G9ZA 4QPDA 1YB2A 2BD0A 3DEAA 4CMGA 1IN1A 2FSSA 2OBLA 3KKQA 3V00A 1GUBA 4IL5A 2XKBA 1XZIA 1P44A 4W9RA 1A76A 3RVLA 4MKFA 3V1MA 4F1KA 5AVUA 3KNZA 4YACA 2PGDA 3Q2OA 4PS0A 1VTKA 3ZZTA 1JT9A 2X7JA 4S0ZA 2WM8A 4RLQA 5AJUA 2C96A 2W2TA 3NH6A 4QTXA 5FPHA 3CW2A 5FBQB 2VYCA 3H0CA 5LQMA 3JQEA 2OXFA 4TQ9A 1HMYA 1Q2XA 4NMHA 3KQHA 4LDJA 4B6JA 4ENRA 1XPUA 2HMSA 2P2DA 1Z73A 1XEXA 3NIGB 2HHCA 3IAS1 1ODKA 1YAJA 3KQVA 1CR0A 2ZSJA 4C76A 2EXXA 4PSAA 4ED9A 2O3SA 1LSUA 3QP9A 3RS5A 2QN1A 3U80A 2DFLA 3O6VA 1MOPA 2KW5A 3MN1A 1WKVA 1VIMA 5C4GB 1W4AA 2QIPA 1PJSA 1H4QA 1RQ2A 1EWTA 1F14A 2QVYX 4JLJA 2GZMA 2ODWA 1GA4A 1PE0A 1RCTE 1GPH1 4LK2A 4N3GA 1OLSB 3A04A 3QEMA 2FMXA 1DIAA 2OXRA 1ZAYA 2HHLA 3IAUA 4IWNA 4KXMA 3D0KA 3O8CA 3MWDA 3FPCA 3QUSA 1A27A 3LC1O 5BUSA 1U2EA 3PEEA 2P9EA 3KE9A 1SB9A 4MHOA 5CT4A 3EPJA 4G2TA 4GWLA 2EX4A 4TTTS 1P0FA 3UN1A 5C1BA 2O3QA 2YC2C 3E9ZA 3LVBA 1FLDA 1DX6A 1UCFA 3FXAA 2UZ4A 1P7CA 2WWHA 3AUKA 2ODBA 1Y1TA 2IXFA 1OZHA 2G8LA 3BWVA 1XMVA 3ORRA 5H7XA 1O96A 5AI6A 3R9KA 4YAKA 1IZ0A 2YFHA 1KDVA 1NV8A 1JDUA 4KUEA 2P9GA 3ABQB 4D9BA 4M21A 4KPUB 3NHKA 3JVVA 5JD3A 1E2KA 4KXFB 3W5CA 4XWAA 1YH3A 3ZIUA 1ZGAA 3ED1A 3OZAA 3ZNQA 5ARBA 1IMJA 1LD3A 2I66A 4V0QA 1W46A 3EZ6A 4Y7CA 3LVQE 5HIIA 3KEQA 3FWHA 2BEWB 2OCAA 1SQFA 1U8EA 2W6JD 1ZM3A 2E4YA 4IQGA 2WICA 2YFYA 3PGVA 2GBFA 4M1SA 3M70A 4MVJD 4MS1A 5AKYA 2WNSA 3U3ZA 1XTIA 1NR5A 3E1SA 3PQDA 5HDBB 1ODIA 2BUBA 3CZPA 4ZU3A 1MDBA 5J2UB 5AJVB 4XR4A 3TZKA 2D1SA 1OXXK 4ARBA 1MUUA 1Y6RA 4A4DA 1SVIA 1CY4A 1QHFA 3DBIA 5BP7A 1GU7A 1ZNQO 1F2UB 3EOAI 3VBCA 3IAXA 3A31A 2FQQA 4GPZA 5EJAA 3ZHVA 2LPMA 2G08A 4ZT3A 2BGUA 3EX7C 4HLQB 4YS6A 1CUFA 4D0SA 4LNAA 3FGZA 4Q9LA 4CEIA 3MXTA 1Q77A 1CQJA 4JJ7A 2Z8YM 4P93A 6ADHA 1QAOA 1QP4A 4LJ4A 1JW9B 3QYFA 2C5BA 4D8UA 1ZBDA 4QDZA 5AYVA 5T4EA 3BXHA 3O93A 3BL6A 4MV5A 5G4LA 3WDLA 2HRZA 4EMUA 1HT2E 2VCEA 5C4IA 2POCA 2PXHA 2DWCA 2CFSA 2N75A 3KOMA 3BGVA 4AQYB 1Z4LA 2J4DA 2IWRA 5GZ1A 1KQ3A 1KRHA 3PPVA 4PC2A 3FLBA 3OWOA 3CJRA 2NU8A 4B6SA 1VGVA 5B3KA 3D4PA 3I8OA 5U1PA 2EGHA 4DCMA 1IY1A 2C5EA 2WAXA 3DEHA 2JA2A 2VYFA 4YMUA 2RCYA 2F6RA 4R40A 1A5TA 2IEIA 1DOHA 3K73O 4AG6A 1LVHA 4M49A 3F7TA 2YCBA 3FN4A 2C2HA 3S99A 4M2LA 4X7BA 3ROEA 1E4OA 3GLGB 1R4MB 1H9CA 3QE0A 3L1HA 4ZVKA 3C74A 3K8OE 1GGMA 3ELUA 2VUHB 5ECWA 1U1FA 1ZX1A 2JFOA 1L5YA 4PANA 2J8ZA 4WMLA 2O3TA 4KXUA 4BNHA 2BV3A 2AN1A 3EC2A 3GLGE 4GKJB 2F2TA 3DLAA 3OCWA 3DDWA 3RYFB 2QNIA 1SBQA 1Z5ZA 4PCUA 3B6MA