4EMTA

Crystal structure of human sting bound to c-di-gmp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
175
Chain Sequence
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transmembrane protein 173
publication title Structure of STING bound to cyclic di-GMP reveals the mechanism of cyclic dinucleotide recognition by the immune system.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4emtA02
4QXPA 4LOLA 5BQXA 4F9GA 5CFMA 4EMUA 4KBYA 5CFPA 4EMTA 4F5WA 4JC5A 4YP1A 4QXOA 4LOIA 5CFRA 4F5DA 4EF5A 5CFNA 4LOHA 4KC0A 5CFOA 4LOJA 4QXRA 4QXQA 5CFQA 4F9EA 5CFLA 4F5EA 4EF4A 4F5YA 4KSYA 4LOKA
chains in the Genus database with same CATH superfamily
2GMWA 1NRJB 4N6GA 5JH7F 1RPAA 4FZVA 3AHCA 4CI0B 1E2HA 1QKJA 1ZEMA 2EEZA 2XMSA 3QRWA 4GPEA 5CXXA 5EJAA 5SZJA 4BNHA 1GZUA 1U3GA 1QZ3A 4YGYA 3WLSA 4JQCA 3BWBA 3WDKA 3ZVLA 4GF5A 5KPJA 1YDMA 2W8BB 1DX6A 1E7SA 3O21A 4HWGA 4UUOA 5TEWA 4ABTA 1PZFA 3BWYA 4JBLA 4DBLC 1OAOA 1U1IA 4GAEA 5EUQB 3RT1A 4O63O 4G0OA 3HJBA 1U98A 5JJBA 2LR0A 3C1OA 5AXAA 5G0VA 1T6YA 3R7BA 2OT3B 2PS9A 2R7KA 3D1JA 4QFBA 2PS0A 1II9A 4BCCA 4DS3A 1JEDA 1JIKA 2VDRB 3OOSA 2BR4A 1AMUA 4KPEC 3OG9A 3CNLA 4O2AA 3W2GA 2X1VA 3DZFA 5DNVA 1WMFA 5GONB 2FKNA 3M89A 4M0CA 4PC6A 4HNTA 4B2LA 1VRWA 1DQPA 4DUZB 1PX0A 3JD4A 3ET4A 3K6SB 4IRUB 1SY7A 1IVNA 3E9NA 2RKWA 1YK0A 2ZPTX 3U2QA 2OK8A 2DB3A 3WL4A 1U7HA 3CVXA 4XJTA 1U7WA 4O1HA 3PXDA 3H1PA 1NPDA 1TF5A 1PWEA 2ZETA 1Z5NA 2HV8A 1N5LA 2Y1XA 3Q10A 4IJMA 4WZ6A 5B3AA 3G8AA 1N0IA 2BFWA 2JI8A 3I01M 2PYDA 5DGIA 3MUNA 5AH0A 3AR5A 2EQBA 1I6MA 3PFBA 3OEHD 1O87A 1RQPA 3ISTA 3MJTA 4DN6A 5A5GA 1JFLA 5TMDA 4FNGA 1QIHA 3KWLA 2P9TA 4RF5A 5F1PA 3U7JA 4E12A 2CVQA 1D4ZA 3R0ZA 3IIKA 4XTCS 4ZK6A 2QGNA 2XNCA 3AX6A 3G5TA 2D2XA 1GO2A 5SV2A 5HZGA 3CTMA 2DTDA 4U39A 3A3NA 4EY5A 2GBGA 3L9XA 3UOWA 1SUCA 5TPWB 4N65A 1TU0A 3LC7O 3QGMA 4R8VA 4YHBA 1UPCA 1DAPA 2P1ZA 3L6RA 4PG4A 3FZEA 4FOTA 2ONYA 1KZ1A 1FQWA 2AN9A 1PZNA 3FKQA 3HKBA 3FJYA 1X9IA 1Z7YA 3RS7A 8OHMA 3QE9Y 1PTKA 3T3NA 4H4DA 3QNUA 1O0CA 1V16B 4DQ0A 3B53X 2WU8A 3GRPA 3ROTA 4RTJA 5GJWC 5KVSA 2J3IA 1OZAA 1O77A 4F3KA 1K92A 2OBMA 2O5CA 4BFXA 1TEXA 1PHPA 2SCUB 4BX3A 1NMYA 4DV2B 1WDTA 2EP7A 2JGAA 2D2IA 1X8KA 3NDRA 4KJZA 2JLRA 1NVFA 1W9HA 1DJLA 1DPGA 1L4YA 1AC5A 1Y6RA 1E6KA 3W5SA 4HVAA 4YR7A 4YPFA 2D4HA 4EJ2A 5CW1A 5TEVA 1P3DA 1SU7A 5H70A 1VJCA 1WNFA 1I0ZA 2IHNA 3DOUA 3O94A 4LVOA 1M8PA 4M88A 4PV7A 1C3XA 2BMVA 2CEKA 1XDGA 2HQBA 3WGHA 1PHRA 3BH0A 3K8ZA 5CK5A 3X3HA 4EDHA 4NTZA 4B3BA 4L28A 4P53A 1Q0TA 3NYIA 2WPDD 3D5EA 3L0PA 4LRQA 3V2GA 5AJXA 3U4GA 5CFMA 3EXAA 4WI1A 3MS4A 4AW9A 3NIFB 3QUTA 3RYCB 3UWMA 4UVEA 2KW5A 2XXAA 4S2UA 1ORWA 1E96A 2B78A 4BNZA 1T36A 4EWLA 4EY3A 2O2XA 1YXMA 1CZNA 3V7FA 2V97A 4A16A 2IH5A 3FDFA 1Y8QA 1W48A 1VL0A 2CUKA 2JK0A 4QFMA 2O3UA 4FMCF 4KDRA 5AOVA 3UKJA 1Y98A 2O7SA 3DDHA 5KYWB 3THXA 2ALJA 3DT9A 4HDMA 3VR5A 2WU4A 1RFLA 1C9YA 2GDZA 3WHLA 1PTJA 3U4QB 1A9TA 4Y1RB 4RADA 2BGJA 2R6ZA 3EIHA 4G1BA 2M98A 3R5KA 1XNGA 3U9SA 4K46A 1L0BA 1ATZA 1DINA 1E2DA 3DL2A 2I6XA 3KAPA 3AM4A 1WO8A 3ZD8A 5JOQA 16PKA 5FTMA 2B25A 4MI6A 1GZ7A 2HYIC 3JARB 2GERA 1E2FA 2PMKA 4MO2A 4UDYX 4ALJA 5D6NA 2J3HA 2OORC 3OKFA 5ALKA 5E3IA 5H7XA 2OKCA 2XODA 3K9HA 5CTAA 4FHDA 3UK0A 1UKYA 1M0EA 2YFHA 1XYGA 2I3DA 3FJOA 4JHXA 1E2GA 4BVGA 3GH1A 5BMVB 1FFSA 2QG9A 4L85A 3WRVA 3QBEA 1ZGBA 2EERA 4Z54A 2FOLA 1UXJA 4A8JB 4B4DA 2HSDA 1N5IA 2Q6LA 2B0JA 2M6RA 3JQAD 5F5LA 2QU7A 5GAJA 2OILA 3FRHA 1I4TD 5L40A 2XNHA 3AI1A 1P17A 4B3RB 1I9CA 5F9MA 4BX2A 3FDZB 3OZ7A 4B74A 2KLHA 2QTNA 1E2QA 4OO3A 4V1CA 4AY2A 3BHMA 1Y7IA 4I9NA 4CTKA 1ZI8A 1RZUA 2MWMA 4NPCA 4GRDA 3V2IA 4LF8B 1QP7A 3QKSA 4TM8A 4YJ3B 3IEVA 4RQBA 2CHUA 4DMGA 2IXFA 3QMVA 2ECKA 2NZXA 4J07A 1N5MA 4PGFA 2FTKE 1Y5NA 4Q3DA 2YCLA 5FNVF 1Q1BA 2RI0A 2BEJA 4NL4H 3ZCTA 4E03A 1NJ6A 3NTUA 2GBIA 1HFKA 121PA 3QPAA 3HCRA 2ZJ7A 1E4YA 3BWMA 5I9LA 1Z16A 3IULA 2OCLA 3B8HA 3SFVA 3G2PA 1DIBA 2HU8A 1UQUA 1Z8FA 2DAPA 3LAWA 2OXFA 4Q24A 4XDHA 4AUMA 5DT2A 3R1IA 1NJ1A 2AXNA 1THZA 4XX0B 3N9IA 4FFRA 2XGOA 5C4IA 1MOQA 4AKSA 3C39A 1Y42X 1JXOA 1NFFA 4G4SO 5FUWA 5IKMA 5KVAA 5FTWA 1LBQA 1CE8A 5DK4A 2XCOA 4ZP1A 4M0FA 5C1DA 2NIPA 3ZXUB 3RBVA 3IDFA 3IKTA 3K16A 2DSNA 3FCOA 1E58A 2C3PA 3TQQA 2PVPA 2W6JD 3OP1A 1C1HA 2GK4A 4DGQA 6NULA 2VPPA 3P9YA 3H86A 5T6MA 4ZV7A 2WA2A 5KSYA 3K4PA 4HATA 3IBTA 1JHUA 4C7BA 2Q2WA 1KOLA 1TYEB 3KEQA 4J0KA 4I55B 4TRJA 3DXYA 1QFSA 3LZ6A 1S9DA 4WFKA 2OGWA 2YBDA 2FLWA 5EXPA 5LZ9A 3ROQA 4W5RA 1YVRA 2Q9BA 2RGXA 3I5AA 5DO9A 2VSFA 2WDPA 4F4IA 5AOAA 4YMWA 1BMFD 1IBRA 4KNWA 4KXQA 1N8NA 3WQBA 3EUEA 5HZKA 1LTQA 1N2XA 2ZXFA 2W43A 4KQ9A 3GPDG 3J81A 5I9BA 3U4CA 1AKTA 4I14A 1GSIA 3HHPA 2QNBA 4KXWA 3DDNA 1Z6GA 2ZBEA 1CHDA 2Z1MA 4YLEA 1KXZA 5ILQA 4A6PA 3HACA 4F93B 5IRCD 1R5OA 2L42A 5GZ1A 4FYPA 2VYNA 3O47A 4G4JA 3HKEA 4ZPXA 1QHGA 3N8NA 5KYUB 5EJIA 1NNEA 1LZKA 1TECE 1ZL2A 3RGWS 4JR1A 2WSIA 3M70A 2A9FA 2YWJA 6YASA 2ZI3A 4RXTA 5T3UA 1O4WA 3SJUA 2VP6A 3NIWA 4DWWA 1OXXK 2GOYA 3TJRA 3LKDA 1VE5A 2FLVA 1CJCA 4MKIA 4PG5A 1HSOA 2QD2A 4M86A 4R05A 5FJIA 5KTKA 5LDDC 2Q8QA 1DXYA 1RJWA 3FDXA 3QVGB 5CMLA 5AI8A 5AUNB 1JDVA 3BCSA 1UMCA 5LUAA 3J80A 1U8ZA 3WBFA 3ZZ0A 1LK5A 1GZHB 2C61A 4LHEA 2FKAA 2PMBA 5B4VA 5JALA 3TI7A 1NPYA 1Z34A 2WICA 4HTFB 4Z4CA 3D9QX 2CW5A 5HQTA 1SQSA 3HDTA 3WGIA 5AK6A 3C3CA 3PHIA 4HAZA 4RTQA 2FZ4A 2GCOB 3RSZA 1YS4A 2JI4A 3ICWA 2IHUA 4PLZA 2XNSA 2H85A 2BOVA 5AI0A 3BL6A 4CMKA 3G79A 3DC7A 1JR4A 3V34A 1UBRS 1YK1A 2PUJA 4R83A 5L9AA 1QC5A 5ED4A 2V7BA 4MVXA 4Q4DA 1E2PA 2RH9B 4EMBA 3D8RA 1E2EA 1X7YA 4YAGA 3BRQA 2VQSA 3AFNA 1S9HA 4RF3A 1TMOA 2PSHA 2Y71A 3UJHA 5LN1A 2NU7B 3LLSA 4NV0A 1YNOA 3P9XA 4UMFA 1CVLA 4CDNA 1E5VA 1OE0A 3KZKA 3PPWA 4KDCA 2ACWA 1M3SA 3ZJYA 2CCGA 2Y8EA 3OZVA 3KPYA 5J5AA 3NAZA 5AW0A 2XOKD 3RHSA 1I3CA 2JGMA 5JBQA 2BZSA 4CW7A 2EOAA 2JDID 1L7PA 5C53B 3UAGA 4HNRA 2BW0A 2UKDA 2G5GX 3HWRA 1DEOA 2V58A 3PGJA 3IELA 3BICA 2W6CX 1A97A 4OUDA 1Z63A 2A78A 1CR2A 1EKXA 3W1EA 1FP2A 1T9GR 4R8LA 5EJFA 3R9IA 3SEZA 5JAHA 4RTNA 1BEEA 1VDZA 4TL7A 3PYMA 3A3PA 3QIAA 4MWCA 2YZ2A 1TKRA 1DEHA 3H1TA 4UNSA 4WCDA 5LU8A 1AHHA 2P2CA 4BZQA 4WKCA 1SA0A 2WWGA 1I9GA 1V8ZA 4PYMA 5JQGF 1Z2AA 3ROXA 2BKLA 4OM7A 5K0ZA 2G88A 3T7DA 4BLPA 1IMJA 3CG0A 4BQPA 5I47A 4DMFA 3QLJA 3HXKA 1UXHA 2QJOA 3H3FA 4XWKA 2QMOA 2NQ8A 2HMSA 2ZT7A 2WKWA 2VPQA 4YGXB 4UFNA 5K0LA 4BIMA 1KI6B 1N78A 2BFPA 4BMNA 2KS6A 2J9YB 3Q7PA 2NQ2C 3ON5A 3CN9A 1QF7A 4O4LF 5A9TA 2DKFA 1Y1TA 3I34X 3B3QA 3ED5A 4WEOA 4GBMA 1AZWA 1Y5MA 3EZYA 3R7NA 3GRVA 1GNSA 2XT6A 4D80A 4NBUA 3K5WA 1E61A 4WV3A 1EP2B 1C7QA 1HG1A 3AKCA 1U65A 3EDMA 3QLUC 3ZU4A 1AA6A 3NM5A 3U3OA 1QFJA 3RC3A 2ZULA 3BB3A 3D8BA 3L77A 3QVKA 3GR6A 1RXIA 4GMXA 4H2DA 2X9VA 4TL9A 1LGYA 1YIDA 1H69A 3L04A 3M8KA 4DQKA 5LQMA 2CVHA 3W8DA 2Y27A 1K0FA 3BTOA 4HNGA 2NVUA 3JQBC 1IB0A 3L7YA 5LBIA 3T06B 1XXHE 5B3KA 5KMGA 3U1TA 3FI0A 2DBVO 3IR5A 1QDEA 3OU2A 1I5RA 1NGSA 2NX2A 4L07A 4F6RB 4F4UA 2ZRBA 5B3JC 2J0VA 4PBTA 5BV2P 1M1YB 4KMSA 1C3JA 3INTA 3NT4A 3QMMA 3WKBA 4F8EA 4RXUA 1YDFA 1YBAA 4HFRA 3OCUA 5CD9A 5G4KA 4J1SA 4YJKA 1GCAA 1NVEA 3BDIA 3FCUB 3QVLA 2C0QA 3GJ4A 1M6NA 2QT0A 3MAGA 2IH2A 1BWSA 1LBSA 1WDLA 4NXNB 4C88A 4UCWA 3GUCA 1OX5A 4RH0A 1EH5A 1T13A 1TU3A 1UPXA 3NRBA 4WOBA 4LJ6A 4X7RA 3BM5A 3C5EA 3M4ZA 4TTPA 5C8VA 4DKJA 1EFRD 3FUVA 5AJHA 1X14A 1JU9A 4XDZA 1RZ3A 4FLFA 3AB8A 2QSJA 1Y81A 3HDJA 1QDUA 1UKBA 3BTVA 2PBLA 4Z2AA 3BSYA 1GILA 1H93A 1MORA 3IAUA 3TPCA 4AP9A 4CYMA 5BN3A 4HLUA 3UT0A 3LTEA 1GGVA 3FPLA 1OIVA 1Z73A 4NNPA 4D9BA 3HYSA 1VLQA 3FFAA 5FBQB 1VYTA 1XHLA 3KNZA 3WOHA 4UZSA 5AVJA 2C7PA 2DXIA 3DZ8A 3RC8A 1U80A 2FQXA 3V6MA 1HDEA 2JHPA 3QUBA 2A35A 1F60A 3HCAA 1OMOA 1W93A 2OV6A 1UJMA 4I5FA 2YKGA 5EJ7A 3CUEF 1SXPA 5LNK6 4QGGA 4J0HA 5LL6P 2PUHA 5E38A 1RHKA 3E9RA 4A0QA 4CMHA 1GSAA 4Z49A 1J8DA 2OB2A 2E37A 2Q28A 2XKBA 5AKLA 2ZSJA 3HCPA 2Q07A 5EJGA 3RAEC 1MHTA 1B8VA 5FUVA 2J31A 2UUPA 3ITKA 4LOKA 5JO9A 5KKNB 4CM4B 1C8LA 1XYYA 1HH4A 4WNCA 4EA7A 1Z33A 1GA1A 1WTAA 3G2MA 2NUPA 2Z9DA 1F4VA 2YMLA 3PGVA 5JSFA 1OVGA 5AR1A 1KRHA 1YS9A 3GH3A 4R9RA 4B87A 2A9JA 3GIDA 4OJNA 2ZTSA 3PUWA 2YOGA 3ABIA 4ROSA 1X7ZB 1KMNA 4OK3A 2EHDA 3H5IA 3L6DA 4OSPA 1Z8HA 2CLCX 5EWLB 1ZJ4A 3L4BA 4Y2UA 3F5MA 1C29B 4MUMA 3EF0A 1E6WA 3EA5A 2QPLA 1U9IA 3KYBA 2VI5A 3R0IA 3KR2A 4IWNA 4JB0A 5TE9A 5LFAA 4RKQA 5LIRA 4WH0A 7REQA 4MWOA 3I37X 3DOIA 4BCBA 3PHJA 2BFFB 3I9V1 2X1HA 1CZHA 4TOIA 3M3DA 2PKEA 4A9AA 4XCVA 4C4OA 1URPA 1SBTA 3DZBA 5EE0A 1SCAA 1BCSA 1IHYA 3HB0A 1MBZA 4GX1A 1RXVA 3SDSA 4U9UA 5C51B 1PD0A 3A0RB 2DYKA 1L5ZA 4KN5A 5LA6B 2Z2KA 3WQSB 4JI2B 2OMKA 3VJMA 2WUVA 4M4SA 2BEKA 3STVA 4DJ5X 2ST1A 3I2FA 4D5GA 4X84A 1KC3A 1J07A 1PR6A 2RIRA 5K0BA 3WZ2A 3LCCA 1TM1E 4JYPA 2EBFX 5AQEA 4ZT2A 2C04A 2VCYA 3BMOA 1MGOA 2SKEA 4I55F 2A1TR 3OUTA 3K6JA 1S2OA 3D6MA 4KYVA 4EAAA 1L5HB 2QMQA 2VNJA 4UZFA 2UZ4A 3K2QA 1YGYA 4LZJA 3E4DA 4EPXA 4KXMA 1A50B 1ZKMA 2PPVA 5BXYA 1IQ0A 1MW9X 4UZEA 3PD0A 2LGJA 2G71A 5IZ4A 2H9AA 3GN2A 5HUJA 2H31A 3B5EA 1N6IA 1W36B 3BGSA 3VXKA 1X0XA 1FZQA 1RVV1 2IFTA 4OKSA 2GSWA 4MYTA 2M1ZA 3RRZA 1HNWB 1YTUA 1VB3A 4FCVA 1U0OC 3C16C 3AUTA 4UFOA 4LTNA 2W9XA 3C15C 4F45A 1XRLA 2ROQA 2UVPB 1Q3TA 2VFAA 3I45A 4NJMA 1C5KA 1G8SA 4M60A 3EYWA 3THWB 1THTA 1YZYA 2D3TA 1QQ5A 2FW0A 3CNHA 5COQA 1FIUA 3ZQ6A 4CKYA 1CIPA 1YZTA 1LW7A 2ZSUA 3HY4A 2J9FB 2QD3A 2XOXA 3VZRA 1M72A 4D46A 3R6GA 1NF2A 4XD7A 4PS1A 4BNWA 3QXJA 1E9DA 1G20B 1YI8A 5TV2A 3TIGA 2VAXA 3I3SR 3HNRA 1H0RA 2AJDA 1FTYA 2RBGA 5DP2A 5IF9A 1PJ3A 2AEFA 2E5WA 3DZHA 1L6IA 5FOVA 5KQSA 1N3BA 1XU4A 3GL9A 3LPAA 1OLSA 2ZSIA 3NW9A 1ESMA 1Z4QA 3VKVA 1XE3A 1RHJA 1Q0LA 2BMAA 3E8XA 1R0LA 3NH9A 4N6OA 4ZANA 2ETXA 3O4HA 5ILOA 1R27A 4HB4A 1H65A 2BZGA 5LMZA 4I0WB 4BC1A 2ASVA 4C3VA 3JWIA 5E2IA 1L5GB 3SQWA 4M87A 2XA2A 4ZOAA 1YB2A 3EY9A 3U3DA 4R71A 2JLWA 5FTLA 2IUYA 5K6AA 4EHIA 1E64A 1PUJA 5HW0A 3QUCA 3A3OA 2J9ZB 4Q3CA 1Q15A 4RORA 4LECA 4NZ9A 5I8ZA 4AUNA 4GI7A 2ECFA 5TPZA 1ZSYA 3FOZA 3D8SA 4GMKA 2HF8A 3EH2A 2XI4A 4DSZA 4FN4A 1CCWA 5IKOA 2ARKA 3MJHA 5AVTA 3DGFC 2H63A 2AMFA 4OXQA 4Z9AA 5IDWA 2ID9A 4K2HA 3KZ1E 1FLVA 1BE8A 2ESRA 1ZMRA 3I6MA 1X2BA 1B6SA 2Q8PA 4LJSA 4LQLA 1X87A 2P68A 1ISGA 2O8NA 3GPBA 4KB5A 1NI4B 3FMIA 3I1YA 4G2NA 3BVPA 3JQ8A 1H2XA 4TLEA 3WLOA 3L4EA 3HHEA 3UOAB 4KO8A 4US1R 4UUAA 3ML1A 4EA9A 1EVJA 3O7MA 1RFGE 4ITUA 4E07A 1NT4A 1NVMB 2FZWA 2I4LA 2X15A 3IOBA 2FPPA 4N5DA 3OPYB 1FUIA 4ZQHA 1TMGE 1DRKA 1JEOA 3USZA 4KG7A 1PBNA 1FX0A 1PK7A 3P9CA 3LBHA 2ORVA 2CJYA 1AS2A 4I8DA 5DWQA 3HU2A 3RQSA 3UCXA 4CQMA 3F7MA 4GI5A 2NSLA 5BQ3A 4DHEA 4DRZA 4CLRA 5ECGC 1KU6A 3WO0A 1BFDA 2SKCA 1DX9A 1NIJA 3EEFA 3I2YX 3DHYA 4IDBA 3JWGA 4RU1A 3U0VA 3SM3A 4HB3A 4L08A 1UC5B 4R31A 4KMMA 1SUDA 1CUGA 1HFJA 3OZSA 3GGCA 2V9CA 3TQFA 5IEJA 2A14A 4FFDA 2X2OA 1X1EA 1MD9A 1X7WA 1KVTA 2VEOA 2OYCA 2Z8YA 1XDDA 3DFZA 4B71A 1NJ8A 1QM5A 2Q5JA 2HK8A 4N54A 4MKFA 1RJFA 1XJCA 3RYHB 4BB0A 2XWSA 1MA3A 1UC4B 2C9ZA 3F8WA 4F1JA 4YI3A 1U8EA 5IBRA 1I6LA 3RV3A 5JDIA 3NT2A 3CNOA 2HV9A 2POQX 2PTGA 3ASUA 3FMGA 2ZCJA 4MS1B 5CJPA 5LQAA 1TVMA 1AB6A 4DLWA 3HK2A 4YCBA 1VGVA 4Q12A 3GA7A 4NABA 5HR5A 1MCZA 5IULC 2WTUA 3GEMA 3CU5A 5EXDA 5EAIA 1MH9A 2RC5A 1YJAA 1C9MA 1N2BA 3I2IA 4G81A 3BQ9A 4RV5A 3KZXA 5DNWA 1YA4A 1WHTA 3Q5EA 3TIIA 1MKYA 5KQRA 1M74A 1JG1A 1KI1A 4PXSA 2WIBA 3JTEA 3FROA 1H9CA 1E79A 4YJ2B 3WGTA 2NU6A 4EO9A 1CJSA 1LPNA 1LQ2A 4M9QA 1UKZA 4RCVA 5JPDA 1LFAA 4INZA 3K05A 2HT1A 1HE4A 5EIXA 1DJNA 3F2IA 2FRDA 4HGYA 1R4MB 1Z28A 1LSUA 4KQ2A 2ZIFA 1LF0A 4OK6A 4WESB 4R9SA 3ESZA 4E2XA 2ZBGA 3EC2A 4ZYVA 3S2FA 3B9QA 4QOGA 1DLJA 4QELA 1KEUA 4JJ6A 1VJRA 1JECA 1FFGA 1XQWA 2B2XA 3OZRA 4CWAA 2VXYA 3CGGA 3NVAA 2M6KA 4NZPA 1EGHA 4K9DA 1NT2A 1PKEA 2OAP1 4TL8A 4DT1A 3IPLA 3MVEA 4X54A 2XA1A 3LHKA 3GCZA 3CA8A 3MJSA 2AVDA 4A8HA 1FFXB 2BDTA 2WUDA 4NYMR 2J0EA 1NJGA 4CQLA 1CX9B 4CMBA 3HCEA 1UBEA 1XX6A 1J0DA 1SO8A 5BUSA 3O84A 3G1TA 1SK8A 4CT0A 4CKEB 3KT0A 3OJOA 1TTHA 2ZRIA 4RZXA 1C81A 1T9BA 3ASZA 1VLZA 5FWXA 4DR1B 1K75A 1FW6A 4TYPA 1OFVA 3ZBQA 4DM4A 1SOWA 3ZJVA 2W2PA 3KOMA 3GRZA 3NBUA 1JJBA 4HI0E 4DJTA 4QD3A 2FP3A 4F4FA 4HHEA 4LXXA 1JZSA 4QJ5A 4FZJA 1UP6A 3ZVMA 2LTAA 3PJFA 4WE3A 5CFLA 1RM3A 3C7AA 4H17A 2BH9A 1TAUA 2VJMA 1OWOA 5E9JA 2QPTA 4DAEA 4URFA 4RVCA 3W9UA 4MJLA 3WL8A 4Z53A 4FSDA 2QQGA 2BT4A 1EX6A 5FAKA 3NOOA 1FMCA 2VIIA 1LRJA 1XZBA 3KWFA 1U5CA 1OBHA 4W9RA 5DNYB 1G3MA 3L6CA 4AZ0A 4TV9B 1TVCA 4GBED 2H57A 3LUHA 1RYMA 1BGXT 4PG6A 4B34A 4KE7A 4MCIA 1IY9A 2YN4A 5F76A 3CM0A 1E4EA 3FYUA 1BAPA 1M9NA 4FZ3A 4K6KA 3X2SA 3LE8A 2EJCA 4QU8A 2FW7A 3P97A 3PHGA 1F48A 2PSSA 1Z2NX 4E2WA 1N3YA 1SHUX 5C37A 3E8SA 1Y6ZA 2KM1A 3M5DA 2IYYA 2VL7A 2Z09A 3EWSA 3UHFA 4PANA 2XHZA 1PCXA 3DCNA 3V00A 1HK7A 1TUGA 3K15A 1L7BA 3RNLA 4KLAA 5I7VA 2NVOA 1VPDA 3AESA 3KQYA 3BWEA 3HSKA 2QR5A 4K6CA 4XA8A 1M66A 2ID7A 2RHGB 4H7HA 3V7YA 1OBOA 5KUTA 2XEDA 3V7UA 3X44A 4BV8A 1YQQA 1LDBA 2RDMA 4ZEVA 1WB4A 3MWGA 4JB8A 5ENDA 3ER6A 1IHOA 3K8YA 1L7NA 4KBFA 1X92A 4BEBA 1ZGGA 1B41A 1WOYA 1ZRNA 5EE3A 4ZVLA 4EM6A 5DLDA 1TE2A 5CNJA 3D0QA 5ARCA 2BEWB 2FF7A 4UHCA 3F7NA 3FRIA 4I66A 4BFZA 2AH5A 3Q3IA 3S44A 3FE2A 3CF2A 1JU3A 1V1JA 2QL6A 4FW8A 3ER9A 5D84A 3BMCA 5HBGA 5L3SB 4M54A 5IX8A 4RX1A 1F0KA 3V4PB 1IHXA 3OFSA 3DT8A 1J39A 1QUEA 3R44A 1H2BA 5IDQA 1KAGA 4E51A 1KI3A 2F67A 3MB5A 1Q3KA 2WZQA 2GK3A 5GV8A 5JBIA 4TMFA 2PA3A 5K8UA 1E5QA 2CXQA 1L5QA 3DSRA 2X9LA 3OOEA 1TIPA 3TTTA 1EVLA 3JAKB 4QAQA 1E1RD 1U7TA 3DFKA 3T38A 1KIMA 1H8HA 4XQGA 2Y2VA 4BO9A 1CZRA 2ZANA 1ISJA 2DZDA 3OLYA 2JIQA 4X92A 4LXGA 3NPAA 3SS9X 1AT1A 1WB9A 3X0DA 2A5JA 3QE4A 1EVYA 5F7XA 2XE7A 3BJMA 3NHUA 2GKSA 2OV1A 2RK3A 3QXXA 2TMYA 2VDUE 3AZQA 3UNXA 1S8AA 2KBEA 2I6UA 4YRBA 3OT1B 2AC7A 3HUEA 3O4RA 1QCCA 2NXNA 4PYQA 1I94B 4UMVA 1QWSA 2WIFA 4NDZA 2K6GA 1Q50A 2EJTA 1WEKA 1YNSA 3L07A 4FEGA 4K7JA 1ONOA 5TC4A 1QONA 2Z6QA 1FS5A 3WMEA 1PLKA 1YZFA 2CCJA 2ZKLA 4Z4HA 2WTBA 1XJ0A 3GARA 4RETA 3IP7A 1OFUA 1KOGA 1L1FA 2CEAA 2Q8NA 4KITB 4CMIB 3G6WA 4KQEA 2OO5A 1KERA 5E6RB 1QB7A 5EOVA 2QVLA 2DPGA 1GPJA 2H3EA 3U7QA 4MQ4A 3ZI4A 1CUVA 3IKVA 3PWKA 3SHVA 3X43A 1VKOA 5HQ3A 3IBSA 1I0IA 3KFXA 1DG1G 4OYHA 3QLVC 1KRWA 3DO8A 4G0YA 2VJLA 1C4KA 3HXOA 2WINI 4GP7A 1KEVA 4F06A 5LP6B 4MARA 4J29A 1UT8A 5K8TA 4Q3NA 2KLBA 3PR2B 4KR3A 4E14A 4RM2A 1D07A 1Z0DA 2NTYC 4N4AA 1NLUA 1APBA 3S55A 2G63A 1OZ0A 4LYFA 4C76A 3KV3O 4X1OA 4B09A 1E69A 1PS8A 2DWQA 4A3SA 4GI1A 1IIBA 3I04A 3I92A 2L17A 1XN1A 4C4ZA 2R751 1H4VB 2FW8A 1JG6A 3VDRA 1H3NA 3MPOA 4U2CA 3KELA 3FCYA 4R8SA 2WIDA 2XDQB 3JPYA 4IGIA 3U4HA 4CN8A 4PYJA 1QJ4A 3OX1A 4MKXA 4AJ4A 4QUEA 4C0WA 2VP4A 2WJPA 3VHXA 1R0YA 1QPBA 3LUDA 4GS5A 3TUZC 1ZH8A 1ILEA 4K9LA 3IOEA 2ZRHA 1EX9A 5EIHA 4QYMA 1XCLA 2ZBDA 4KH1A 3ZGLA 3ZKWB 3RCBA 3VPCA 3PGA1 1E5TA 4GPIB 1OXKB 1XEWY 2ZDHA 4C0LA 3DUFB 4B35A 2C2ZA 1TM4E 5D6OA 5L7WA 1YQWA 2GYWA 1M8JA 2QYOA 1Y8RA 4FW9A 3ZNNA 3Q9UA 1MT0A 4GZLA 4D44A 2A86A 3FKJA 1ZM7A 2H4WA 4FT2A 5EP3A 4JLNA 3RUAA 1CIVA 5HOQA 4XRGA 1OWLA 2ZGVA 3VTFA 3A2KA 3NHAA 3AJAA 2RGCA 3KFLA 3MWEB 4NU5A 4TMWA 1QHHB 2I2CA 1F2UB 5IDVA 1G5TA 4M7OA 3DEHA 3R7LA 4ND2A 2WYIA 5MGNA 1NKSA 3TPFA 4GKBA 3PUIA 3EXHA 4P7JA 1YB7A 3IOMA 5CLGA 5IVIA 1S3IA 4G9BA 2QLMA 2JFNA 3OA0A 2Q3EA 4HGOA 4D4IA 2EARA 4URXR 3ZU5A 4TV8F 3MBIA 4MWEA 3TZHA 1G3IA 4W99A 4EO7A 1C41A 4D7AA 1S3GA 2UAGA 3QFCA 2R6GA 3BGVA 5G0UA 3UH0A 1QVVA 3ANNA 1MF7A 2YV3A 3RVMA 2JL1A 1XAHA 2R00A 4Q9LA 2I4IA 5LP6A 1E8MA 1G64A 2FPRA 2NTEA 2XLBA 4PCVA 4U7JA 2FEKA 4WZZA 5J58A 3UF0A 3OQBA 2ORWA 5DCWA 1TJPB 4ZCLA 3VKUA 3E22A 1RRCA 2JHFA 3KLOA 3OE5A 4LF4B 1K63A 3DV2A 3JYNA 4YXWA 1PN3A 4BP3A 1PWZA 2J85A 3D3KA 3GNLA 3DL0A 3QQ5A 2O1WA 3MTBA 3RSGA 1GPMA 1H2YA 1JH8A 1BIFA 4Z4IA 3L7NA 4Y2YA 1AUOA 2PX5A 4ZVUA 4MUKA 4NZYA 2DHCA 3E9DA 1M2FA 1Y0BA 3FVTA 4LSZA 2ZJYA 3GFGA 5EFZA 4ZTBA 2LRHA 2N9UA 3RVJA 1CUEA 4UOQA 4AM8A 1JSXA 3AVVA 2HXYA 2Q27A 1IQPA 1ZXBA 3D59A 1SOVA 3A1VA 3NKLA 3OHPA 4KGXA 4Q7KA 2AXPA 3MJCA 3W5JA 1EJ0A 3ZWWA 2FX3A 2K5UA 4OK5A 3O75A 3CEHA 3IESA 4NULA 3JQAB 1NF3A 2VDVE 4K9QA 2Z95A 3JX9A 5SY4A 3L7KA 1NMQA 1VKHA 3K8QA 2C58A 2ENWA 2VH1A 2XYQA 3EDQA 4MRMA 2AOXA 4ZT5A 4TTSA 3NV7A 2JASA 2X1LA 1J90A 4KQMA 4LE1A 3ICPA 2QRLA 5DOVA 2VP0A 3DCIA 5JXWA 2QJWA 4QPZA 3V4LA 1RAHA 3L7IA 3KL4A 3O2QB 2NWQA 2B36A 1HYQA 1V6AA 4QU0A 5JHGB 2A7XA 2V7WA 4XSGA 1XU9A 1VJ0A 3PVCA 3QX3A 5IFKA 4IHJA 4WTOA 4HZUB 3V8PA 4EQ6A 1A8QA 4B3IA 4BASA 3ENNA 2OLEA 3GWZA 4HDRB 1H3EA 1E20A 1GQFA 5DYIA 3UJ7A 4R2JA 2IS4A 2OYSA 5ICGA 4CF5A 2PUFA 2XUOA 1K97A 3MS2A 1F8GA 2HM7A 1GGHA 3MK31 3UWKA 1WIWA 1EA5A 1WLYA 4EHBA 4DJAA 2QX9A 4JI6B 2M1XA 4QULA 3Q7RA 2I03A 2P4QA 2RCNA 3WJ2A 4EY6A 3PA6A 5HEKA 3M9LA 1SC9A 2D8MA 2JARA 1ESZA 4IXDA 4EG6A 4IVQA 5KJFA 1WMSA 3OJWA 1TIKA 4MV5A 1SUSA 1RWVA 2ANCA 2Q9AA 2ZS8A 3AL3A 1PV2A 3AR7A 3MXTA 1X0VA 4IDCA 2LUOA 2C8KA 4IY1A 3S2GA 2W00A 4DV3B 2Z58A 3ET5A 5HIIA 4POAA 4D99A 2XRZA 1TEVA 4I5GA 1JALA 1KOJA 3IUEA 1YR2A 3M34A 5ALGA 4BMVA 4ZO9A 1H66A 4TLAA 1REQA 2D62A 2V0CA 3BWXA 1SCNE 2DG2A 4KKXB 4MGIR 1EUYA 2Y6VA 3ZY4A 3HKDB 5J1TB 2FPMA 2J3KA 2C9BA 3FAKA 2JLVA 4O29A 3EPJA 2Q6VA 4U9HS 5A9SA 1FFYA 2B8WA 1QFZA 1O6CA 4BECA 4M49A 4S0XA 3EOAI 3REQB 5KQPA 2YBEA 1S2GA 3A70A 4A6XA 4K81B 3W1WA 4B4WA 1P91A 1W5BA 3B2NA 2FQQA 5UKDA 1W1IA 2HGSA 2PT9A 5ITWA 2H9YA 1H2RS 2IXBA 3ACDA 3PJGA 4M1ZA 1WW8A 3G2HA 4PZAA 2GEKA 1YF3A 1T3GA 5J23A 1TEHA 3EULA 2CNWD 5E95A 2QAGA 3KB2A 4JJ8A 5JO0A 4E11A 4QQ8A 4RE5A 3TQHA 1CUWA 1SU4A 2R65A 1KAMA 5JNVA 3SG0A 4I4TA 3IJEB 2GD1O 2VHCA 3UAZA 2C07A 2WMNB 2GT1A 2R8XA 4GNRA 1EWQA 2VT3A 4X1YB 5C8YA 4D8TA 4KVGA 1JNXX 5AKIA 3UMFA 4CIAA 4RS4A 1FE8A 4A6EA 4K6MA 5LKRA 5A4FS 1FSGA 5DBFA 2V7TA 4RQAA 1CETA 1VDMA 3RH0A 4PNEA 621PA 5KQLA 1S3FA 3BE5A 2XSZD 1T3TA 1EEXB 1JIQA 2G1UA 3T9EA 5B2ZA 2HJHA 2IKQA 2PRKA 3ODGA 4BWFB 4HSGA 1X19A 1L7XA 1NN5A 3R3JA 2P40A 1MQ8B 1RYYA 5I9MA 1CJTC 1KH1A 1M10A 1MG0A 3BMXA 3G1UA 2GR9A 3VNBA 4XIFA 5C1OA 5A1TA 3TGPA 5H3LA 1RSZA 1NTOA 3CH7A 5AKKA 2EIHA 4M9XA 4RYDA 3W7BA 2B9EA 4IHAA 4MVJH 4DDUA 1HUQA 2MJLA 3GUVA 4ZJPA 5IAEA 2BISA 3PHLA 4XTRA 4BVAA 5CLHA 3DHWC 1JQ5A 4OB6A 3W2IA 4RK6A 4TMZA 3F9IA 5ALNA 4BZZA 1GYPA 1ST3A 4UNPA 4C78A 3KYDB 4WW0A 3IQXA 3LXRA 4MXDA 4MRPA 3OU7A 3LUPA 1XZGA 1ZK2A 4NJEB 3V3TA 3RS5A 4DV0B 2AOUA 1G60A 3BD8A 3F3MA 1M75A 2R8YA 1U0HC 2H7YA 5FV7A 1JIIA 2EQ5A 1Q7TA 5IP5A 3T5AA 4DF3A 2P9EA 4MW6A 5BQPA 3ROEA 2DRIA 2IODA 1K8YB 1FW8A 3K0SA 2XKAA 3MUOA 3OM8A 1AQIA 4L3OA 1X8JA 2FWNA 3EFHA 5AXCA 2H0AA 3EZLA 3O8DA 3RIXA 3J81k 4TXLA 3VVCA 1MOZA 4LGVA 3G0IA 1V9LA 3A1NA 5DBHX 4Q4LA 4UARA 1P7VA 1Z6QA 1QGOA 4DLAA 5ALQA 1DG9A 3C24A 1E2LA 4D2IA 1D2MA 2ZRLA 6ADHA 3A6ZA 3KETA 1C7RA 1CG6A 4F6LA 2VDQB 1R4NA 1V5GA 4KLCA 4X97A 4Q3OA 4UPVA 2V1UA 1G8GA 2C92A 2JCXA 1NW5A 1UKCA 2FJUA 4Y18A 4N3BA 1L5NA 3ZS8A 5MFZA 2R8OA 3BG5A 3E1GA 3NALA 1SCQA 2Q4EA 3A7DA 1J2RA 3EF1A 3RD5A 4BUJA 1HWYA 2OSVA 1NHGA 4CIDA 5T4HA 2H2GA 2BFBB 2YZKA 3H3XA 4BB9A 1ML3A 4KDEA 3NHMA 4BV2A 3DJYA 3UWOA 2I4NA 1Q74A 3EXG1 4DSOA 2WD7B 2F7SA 4G0PA 5A62A 1HDRA 1ZUHA 2WI8A 1Y7PA 4E5DA 1VRVA 4K9SA 2D1SA 2PFGA 7AT1A 1SHZA 3JVEA 4NK4A 3V48A 3VOSA 1B3RA 3PS9A 2IUSA 2BFDA 4G2TA 2WMDA 4NV3A 5ALZA 5K3BA 4QVIA 4GOJA 1Z3CA 3QIVA 4TRRA 4AULA 4KQJA 4EPVA 4MDFA 1DO0A 3FPGA 2VCHA 4FGJA 4QTZA 2QQ0A 4ND1A 4QGHA 1W44A 2XE6A 3KOUA 6REQA 3NHYA 3NS7A 3U56A 3COVA 4B3TB 3IQGX 2HTFA 3KQSA 1U28C 1EUCA 2H4XA 1J56A 1ULSA 2NO1A 1HLGA 2OO5C 3B2QA 1PT8A 3PTZA 3QU7A 4N39A 4XUEA 4JOQA 1I4OA 4D3SA 2O0KA 2P9QA 3BERA 3GELA 5KOJB 3O91A 6ABPA 1TYZA 5AHOA 4KREA 4ZZ1A 3ZWYA 2WRZA 1P3JA 3UGTA 3OLWA 3ZDFA 5C5CA 3KSRA 1O95A 2ZCVA 2X8JA 3MSCA 3DTVB 5EIOA 1FZTA 4AN4A 3GFQA 1JSLA 3HE3A 3DOCA 2JIBA 4KKVA 4JBXA 5EJ4A 2QMZA 3A04A 4IICA 2O8CB 2O50A 4YCAA 2B69A 3PE4A 4QPJC 2FPLA 5HSGA 5A1JA 1YB1A 2A4KA 3NNSA 3ZQKA 4G56A 1J2YA 1D09A 1KSHA 4IGKA 2OY0A 3GG2A 3JQQA 2P5YA 1M7BA 1VZ3A 4P4UA 1K6EA 2QK4A 1G3QA 2YWBA 2JKVA 3OTHA 4O4JF 5K4AA 4EHAA 1J9EA 2IUTA 4JI3B 1TVKB 3FZNA 1ZCAA 1FFAA 1X1QA 2LKDA 2Y9MB 3EQ9A 1UEIA 4OSEA 1P5RA 2PKQO 2YNMC 3IAS1 4QYSA 4GEKA 5AJTA 3FZGA 3U4IA 3ZBPA 1SVWA 3UPDA 4LQDA 2A0UA 3T8YA 4EA6A 4XYEA 5DZSA 2P62A 3FSGA 4JLWA 4BMZA 1GQOA 1XZMA 4WNAB 3GJQA 1X1AA 2FRXA 1G18A 3KVVA 1TLFA 2FOIA 1Z0FA 1W5TA 2I76A 1XO1A 3C41J 4H77A 4R2WA 5DMXA 4TVOA 2ZR7A 4B7ZA 3CUWA 3CZ5A 2D74A 4Y6GB 5E2AA 4LUCA 3GPIA 1Z45A 1DC6A 1DXQA 1NURA 3HR7A 1D2CA 4B85A 2I2DA 1SXGA 2HXGA 2VDJA 3BFPA 1VSVA 4Z99A 1S2IA 4D4GA 3GU3A 3Q7EA 2LDXA 1KJWA 4MLPA 4WJKB 2VDWA 5KQMA 3IPRA 2A8YA 1DXHA 1FXWA 1PL6A 5DSXA 3MERA 2D7CA 3T5DA 3HU1A 4RESA 2O8BA 1YH3A 1DOZA 3DBLB 3PQFA 1DBSA 4G5FA 3W0LB 3TVTA 1KBOA 1MNQA 1YHYA 4M22A 1D4FA 1MC4A 3I8XA 3KV1A 4PX3A 1E1NA 3A3YA 2A0XA 3LC2O 1KI9A 5LLDA 4QHYA 3Q4GA 3W3ZB 2G0TA 2IK8A 2NU9B 2EX4A 1LW6E 1UDWA 3S2EA 5JNTA 4RTOA 1ZM3A 2R5WA 1NRWA 3BD6A 2WP0A 3RSQA 1KS2A 3P7MA 5CIYA 1N9GB 2DWUA 1HL3A 3IOCA 3WLLA 2V96A 5KSPA 1NM5A 1TTPB 4WK4B 3L7MA 4X41A 2C97A 2B2CA 3RFUA 1XHEA 3U7FB 1F0YA 3DA8A 3JRXA 4ENWA 3UUGA 5HCIA 1H9AA 3P9NA 1KFJB 4ZYWA 3OOJA 2C3UA 4W7IA 3B6IA 1JWBB 2YFQA 1ULAA 5B6IA 4ZYYA 4RQUA 3G17A 4M8LA 1IFXA 5C35A 2P4EA 1B1CA 2Q3BA 2B92A 4IS3A 4M6WB 3GLHE 5JAQA 3VZQA 5CFRA 4GU5A 4N7BA 4Q6WA 1IN1A 1KY3A 4TN1A 4N8DA 2DPLA 5CGQB 2AFHB 3HH8A 3LOQA 1G0OA 1S1CA 2Q6KA 2WHPB 2WNHA 4H6VA 5M3BA 4AKIA 1QIKA 2FDRA 2FMXA 4HDCA 4OHMA 4WL0A 3MLAA 3PUJA 4L0MA 5HRCA 1YRLA 1LV7A 3NXKA 3FPBA 4H9GA 4PYKA 4ZAGA 3B3GA 3C8MA 5AT1A 1OFHA 3L6BA 2GZMA 3SR4A 2P3OA 4BNDA 4OLJA 4JNKA 1P6XA 6PFKA 4OH1A 1Q16A 1CJBA 3NM6B 1RRGA 3V42A 1BC5A 2C78A 3DCYA 4UHJA 1V7PC 1MP0A 1KJYA 3SHOA 1R7RA 4ZJYA 2PZJA 3AKDA 4Y6RA 2IH4A 3OD5A 1KTVA 2C99A 2P6UA 3LT0A 3EG5A 3WIDA 3NCHA 2QRVA 3CNBA 3U9TA 1VI5A 4X95A 1NQVA 3I0MA 1AN0A 1XQ1A 3UCEA 4OQXA 5I4BA 1LK0A 2R0QC 3D6NB 2YASA 3SF8B 4AT1A 3AL2A 5LIPA 2R3SA 1U3UA 4LNAA 3T7KA 3TTUA 2CDBA 3RUCA 4ZAXA 1PV1A 1N5KA 2M2IA 1WY5A 2RHRA 3TBFA 3L4JA 1V35A 4QGFA 3OZXA 1JDBB 5AD1A 4PVDA 4EG5A 2JAQA 3L9WA 2O3JA 4AY6A 3WLRA 1KDRA 3MJDA 4R40A 4UAVA 4ESVA 4CODB 4ZC8A 3ZCPA 5D5QA 3FBWA 3FVRA 2DECA 1LVGA 4RANA 4ZRDA 4OP3A 4URZR 2R66A 1LXCA 1XVUA 4ON9A 1P29A 5BT8A 1HI9A 1L1RA 1RYEA 2HLDD 1ODSA 2PGOA 4Y2HA 2ZRKA 1T5BA 1UH5A 1Y3DE 4FP9A 3CW2A 5BURA 4TXHA 3L8FA 3PNLA 4LI0A 4GDFA 4UTPA 2FPIA 1WD7A 1QP0A 2NQTA 3T9AA 3R3WA 3UC5A 4F2DA 2YS7A 3QEMA 4LFCB 1II8B 2Q0HA 4EUNA 4EUFA 1OLXA 3K09C 4OHBA 4CFYA 3DOHA 5AVXA 4CM8A 5CVCA 2AKYA 3JATB 4E6EA 4X93A 4RLSA 4BO4A 1PK8A 3TLGB 1UOQA 5B55A 3D6UA 3I9NA 2PLWA 1QVRA 3FNGA 4JGIA 5GIOE 3GLHA 4LFBB 2O2DA 1L4LA 5BRAA 3OICA 2DTXA 4O33A 2J09A 4QDKA 4HNVA 1ZK3A 5DHTA 1ZOIA 1PGPA 5IVDA 1CY6A 3V8VA 2A5LA 2R4UA 2VO1A 1UBCA 1GR0A 3T35A 1P4HA 2CGEA 4L5CA 1YOBA 2P78A 3F4KA 4YQZA 4ZYLA 2G5PA 1HRKA 4EHDA 5E4TA 5BSRA 4L3VA 3M6FA 2PL3A 4B3SB 1FUYB 1QMPA 5H5JA 1I32A 3QFRA 5G53C 1BS2A 1ZX1A 4NX2A 3SOPA 2JVKA 4EFMA 4J1TC 5BY2A 1A4XA 3VKWA 1O9HA 1FDVA 3CZQA 5KNDD 2PMDA 3OLXA 4G5QA 1M1NB 3TECE 4WOJA 1JEQA 5BN4A 4XXHA 2V7XA 1ISMA 1M0WA 4R7GA 3RVBA 1YFZA 1H1LB 4WY8A 1UPBA 4AJ9A 4JYBA 4LSMA 4TWJA 2AFIB 3TZLA 3TTXA 4V1CI 3O26A 5HQJA 1SVNA 3I9FA 1W8IA 3IODA 1I5OA 5EKDA 4HGRA 4A03A 3DLBA 3BA1A 4PLCA 1W7AA 3QJ5A 2X41A 1X7XB 1QG4A 2JLAA 1BXGB 2VS1A 4FYKA 3IKMB 4YRIA 4DG8A 2GYUA 4BNNA 3H87A 2MINA 3IIMA 1KY2A 3CVJA 2IYWA 3AHEA 1UPTA 3QH4A 4OMUA 5L4NA 3ADCA 4JMLA 1EM6A 4GX0A 1M2OA 3WQRA 1SZJG 2WILA 4KSBA 3WYNA 4YMIA 3FOEC 4UAUA 5EHZA 3V9PA 4ZCPA 2HCRA 3KEOA 3PEUA 4MPJA 5L7YA 1DAKA 3FHTA 3PG5A 1QH8B 1KTIA 4MR9B 3NJ4A 4LZAA 4TYQA 5DPMA 3QPDA 1M5RA 3DLHA 4WX2B 1JVBA 1CY4A 1P75A 3OE1A 1FUEA 3F6BX 5TNXA 1FBNA 2J5XA 4NIMA 3TKAA 5EZSA 3BCUA 1AN9A 4NYJQ 2Z4RA 3LSTA 5CLQA 4DABA 1DU4A 2Z2JA 3NDPA 4YWJA 1V11B 4Z9YA 1I3MA 1E60A 2O0LA 4J7CA 5K2MA 3K1AA 1BZYA 3ZZUA 4IOMA 2VHXA 1E1KA 1UFKA 5H1YA 5JCXA 3W04A 4L73A 3W9YA 2AHRA 1G7SA 3WJ7A 3N6VA 4JC5A 2F1IA 4MB2A 1W4ZA 3GC6A 3M6LA 4L5YA 2WAMA 3HDQA 1E63A 3SYKA 1Y4DE 3PP8A 3TVYA 2IYRA 1WUHS 2XCUA 1L5FA 3HUUA 4L5BA 2ZUBA 4OHRA 1SQFA 5IKPA 4F96A 5EINA 3WMFA 3EC7A 2E87A 5BQOA 1VFNA 2ZR8A 4RDCA 5TQJA 4EFLA 2ZFUA 3KJQA 3TLAA 1II0A 3GLGE 3HSYA 3CONA 1LCIA 4D1YA 3RUFA 1QPGA 1TZCA 2G36A 1LJUA 1V37A 4D41A 1U02A 4YT5A 4OV6B 5JY6A 5ALOA 4X71A 2R86A 3MF4A 4BP9A 1MR3F 2DFPA 4WXHA 5AHWA 1LLFA 4WN9A 4MINA 4F9GA 2CHGA 3H5VA 3MLEA 2GILA 4MPTA 3P2OA 2CJWB 4ZJUA 5DM0A 4OHYA 3BRWD 4V2UA 3ZDRA 1JHXA 3E3MA 1F9AA 1E9FA 3E5NA 1I2MA 4NG4A 4R1LA 3F6YA 1O6GA 4BNIA 4DANA 1AZLA 5ERXA 5AQ1A 1QKIA 1F7UA 2GNPA 5NLLA 4BO8A 5IZCA 3EZFA 4F3TA 3VDMA 2PUGA 5DM60 4L2IB 3RK4A 5EKSA 5AJVB 1DO8A 2OBNA 4OUKX 4DDHA 2ZRPA 2W6ZA 3M3HA 2AD1A 3M5WA 1OGIA 4CU2A 3RU2A 4GZ3A 2OENG 4ZARA 9ABPA 3U60B 2OHOA 2AN4A 3OLVA 1K06A 3ZOKA 5B3LA 4ND5A 4OA5A 1KVQA 4CVNA 5H4GA 5JDCA 1ORHA 4KO3S 2HMWA 1CUZA 1I24A 2ACKA 3TZ6A 4L5IA 2CMKA 1DCKA 1NXQA 4QX6A 3N8DA 1G4AE 5TQ2A 3WMXA 2XTMA 3TSOA 2I66A 1FPMA 1SCUA 3EA0A 5DT9A 1W59A 4YRNA 1DJQA 4HDSB 1D6JA 1E6EA 3RUDA 3P19A 4W1QA 2P0AA 3VZSA 1GDDA 1WE2A 3AI7A 4TPKA 4MVJF 5J63A 1D9ZA 2NZ2A 2BJWA 2YWEA 4D9JA 3IQDB 3NTXA 2VJBA 4U2GA 4WJZA 3ZXYA 3DE5X 1N2GA 1VHJA 4RMJA 5JY1A 1QLHA 5ANRB 2AG5A 2JAWA 1NX9A 3IUPA 3AFGA 3I01A 1U8FO 4MVJM 4PLGA 2IOYA 4XARA 8LDHA 4ASUD 1ONNA 4YAWA 1V1MA 3IP3A 2CC2A 3KVOA 3QVOA 1JI0A 2VAVA 3HO1A 5DDIP 1WXEA 2B4TO 4RIEA 2HA6A 1Q7RA 4PSUA 3P0FA 1W73A 3Q2IA 4TKVB 5L8VA 3T7JA 4ETWA 1YV9A 3DHNA 3PWSA 2B30A 1W4RA 2RAFA 4G89A 2ZP1A 2WJHA 4RA6B 2P41A 2RCYA 2YNMD 3GP8A 4MR8B 4PAGA 4BNVA 1PJSA 3QE2A 1YACA 4IJUA 2CDRA 5AKHA 4Q1AA 1NDHA 4QTYA 1YVEI 3FIUA 3QKWA 1OCEA 2VH2A 1G9TA 2H6EA 1NPTO 4LDNA 4AMBA 3ECCA 2ZYVX 3P94A 5FBLB 2Z98A 4N47A 1S96A 4KXFB 3V1UA 4WNIA 2DCUA 2OOSA 1ZGZA 4KQFA 3IAHA 4HPJB 1DO2A 4WPGA 3BKWA 1PQWA 1C50A 3N8HA 4Q18A 1QDLB 4DCCA 5JNRA 3GLGA 4MW5A 1CF9A 3HYLA 4HNQA 3PQ6A 1AKWA 4RXMA 4C22A 1IPHA 3DW3X 1XTRA 4FONA 1KWKA 4KLRA 1LRLA 2C84A 1AK2A 2ES4A 2P67A 3UAVA 3DF7A 1TPZA 3P4UA 5I7RA 2CJXA 1I3LA 5K6TA 5GZ3A 1XQ6A 2GPJA 3P0JA 4FYXA 2IPAB 3LY7A 4KTTE 1BXRB 3R5SA 3S5UA 4QL3A 4HB2A 3TLJA 2SHKA 1GLVA 2WWIA 5ITZA 1T9DA 1UJ2A 3TAXA 2INGX 3UUFA 1QVZA 4M1TA 2NUBA 2D06A 3TD9A 5J9FA 4MCAA 4P8RA 3R40A 1I13A 4GKKB 4ACAA 1LWOA 3QLEA 5DGCA 5A2QA 1ZU5A 2XMCA 1EDDA 5E0KB 3RVOA 4AECA 5KYXB 1HTWA 3B13B 1F14A 4TUYF 3CVYA 3WGLA 2R85A 3JALA 1OU4A 4XZ3A 3HL0A 1A96A 5LC1A 3X1KA 2CK3D 3AEZA 3B9RA 3DTNA 4KPYA 4M55A 1H1DA 2HDHA 3HEMA 4UCQA 3LXXA 1Z38A 4G1CA 1XA0A 3K9BA 2X9NA 3AKYA 1Y3FE 2DPHA 1C7JA 3DDSA 4YJGB 4IDQA 3KZNA 5FUXA 3VPAA 4QEZA 2V98A 4ZVPA 3CCFA 2V4MA 4I4LA 2XCLA 4Q4JA 3WWYA 4FOPA 4DNPA 1VJTA 1TUBA 1J42A 5AJYA 3OFND 4G1VA 1UDCA 2VVTA 3KZMA 1YAJA 2B8NA 4LNUB 4MGZR 3RAFC 3RHZA 2V7GA 1ZONA 3Q6MA 1PIWA 3AF1A 5CDSA 1L5KA 4BB6A 3OZBA 1ECLA 3MGKA 1FYXA 1ZLXA 3C3JA 1GFWA 3EWNA 1P4AA 1GP2A 3CUTA 4AIRA 1C3VA 5JC1A 2QSZA 3T9CA 2HT6A 3GOHA 4ZO4A 4BRZA 1NVBA 3FETA 1YQTA 4XDYA 5CIQA 3RIYA 5TQ0A 4BE9A 1G5QA 5DHRA 2IVFA 4L4XA 3LHIA 2ZK7A 1BW9B 1QTIA 2X5JO 3MZ0A 4JJKA 4MUJA 4N0EA 5ERGB 2MYTA 5DI3B 5K03A 4EHKA 2FPXA 4R2XA 1M2GA 1J1ZA 1ZUNB 3EMBA 3IUMA 3VTAA 2ZB7A 3PZRA 4WXEA 5JWRA 2JA1A 4N5HX 5A06A 1OW3B 2FPGA 1ZSNA 1WD5A 2BM0A 1VIYA 2GSDA 1IY0A 4N40A 3IL2A 3EGEA 2QUKA 2FEMA 1B8PA 3KFVA 5H80A 1WXXA 5EQFA 2HW8A 4U3JA 5EPUA 3QK7A 2ODQA 1EUDA 1GEGA 2XGSA 3GFTA 3SMQA 3I52A 1VKNA 1E5LA 2CFOA 2C2GA 2W90A 5I48A 2XJ9A 2LCQA 1Y6GA 3KG2A 4NNJA 3WIBA 4OMDA 4C1NA 1NYTA 1TO1E 1UOEA 3DFIA 1TRHA 3KQOA 3FYTA 1KSJA 1NVTA 1W87A 3PKJA 1ZH0A 2JD2A 4CG0A 1NOKA 2P0EA 4C4SA 5KB3A 4B4UA 1RP7A 5DM70 3QF4B 1KVSA 3LQQA 1OC4A 2IYEA 3QZUA 2RAUA 3DKKA 2B0CA 5T4BA 1VKRA 2PH1A 3T0GA 3RSSA 1XA4A 2W71A 4MWZA 4K9PA 1CUIA 3HY3A 4URWR 2JF0A 2JAXA 1Y1SA 3HYRA 4ODIA 3MCAA 3IQEA 4ZIRB 5BQXA 3QU4A 3PD1A 1XNQB 3IP6A 1K8ZB 1ZM2A 1J0CA 2ZSBA 3LBFA 4K26A 1OGYA 2GF9A 3M6MD 1L5LA 4JSTA 1U2EA 3T94A 4PSVA 2IKSA 5AESA 1WDMA 2BFNA 1LPAB 3K5PA 1EDBA 2PTHA 3F47A 1Y37A 5BYAA 4H1WA 1PZEA 2PH5A 1Z35A 3H9CA 4LXQA 4F4HA 2Z8XA 5ALSA 1A9RA 2ECQA 1C0KA 3ZJ4A 1M1UA 3LVQE 1AKRA 1YR3A 2DQYA 4J2HA 4BAZA 3BD9A 4LQ4A 1L5RA 2AX3A 4KW7A 4Q1EA 4C4XA 4CT5A 4D92A 3O8BA 1NYQA 3RIGA 3O8RA 3IBFA 3QHPA 4TKUA 2RI1A 4G3XA 3V1NA 2DBQA 3H5AA 3O73A 2H2FA 2YHSA 2BP7A 3H7AA 3ESYA 4COKA 1FU7A 1T2AA 3LXMA 3I42A 2JLYA 3L41A 3C3EA 3MIIA 5KOYA 1M1ZA 4E30A 3WO1A 4OQLA 4U7FA 1NAHA 1ULZA 2HHAA 3PU6A 2OCDA 4MUNA 4TWBA 4C9BA 3W7VA 4C7OA 3GEGA 3ONVA 4G8BA 3AM3A 1XMXA 3KZCA 4LBVA 5CGZA 4NAVA 2BFCA 3DQZA 2GN9A 5DLEA 5A7GA 1EP9A 5JJLA 3BXOA 5AVWA 1FDUA 1N8SA 3IV9A 3ZD7A 1JPVA 1ND5A 3H18A 1OZGA 3M6IA 5D51S 5JS6A 3UJNA 3VVLA 1LPSA 3R7WB 4BQFA 1CT9A 3G2IA 4PQEA 1EDZA 3B1JA 4NF2A 4RK5A 2W5UA 1RHRA 3HRIA 3HVKA 4UHEA 5F3RA 1U6JA 2D00A 3VHLB 3MTQA 3MOIA 1CP3A 5C7OO 2ORYA 4OJKA 1RXWA 2O1XA 4Q7LA 1QG2A 2ZAYA 4WFIA 2H1OA 2BZ1A 5HJEA 3VU9B 1TO6A 4MK4A 5ILGA 1QF9A 4CZ2A 2VSYA 1CEYA 1EWKA 5FL7D 3SJ7A 2DU8A 2AG1A 5CLIA 4C4YA 1M2HA 1P9LA 3QBDA 1LA2A 1ENPA 1YOVB 3CLKA 3W5DA 4GX2A 2FR1A 3R6TA 1W19A 1Q6ZA 3GLSA 1OLUA 1BFKA 3MBKA 1WXQA 3HP4A 1GR1A 4BC0A 4CTJA 2A0YA 4CTOA 2FW6A 1WDWB 5JUWA 1Z7EA 1COWA 2ZUTA 3NRJA 3GEPA 4I81A 3RLIA 4LI3X 2I1WA 3EYAA 4PC3A 3LFHA 4YMTA 3HR4A 4FDUA 3PDCA 4KQ1A 3ANMA 3LDAA 1TZ2A 3AOEC 5EGSA 2QZJA 1I51A 3ENQA 1GPBA 2Y1FA 1R37A 4JLPA 1PVOA 5I51A 3WMGA 1VSQA 3G9TA 5CRIA 3WA6A 2G9VA 4HTAA 1GCGA 4KK3A 4Y7DA 3DP7A 2FPUA 2AJ8A 3CLTC 5GONA 4J1NA 2B6NA 2GPNA 4ESOA 2AZXA 2I80A 1FMLA 1OXTA 2UV8A 3OT4A 4IG4A 2AI1A 4HLDA 3RAJA 4EI9A 5HKKA 2I4OA 4K6FA 4QZVA 4HUJA 1FRFS 4U63A 3A1DA 1F6DA 2JG3A 2J59A 2F8TA 4LDZA 1PSWA 4R3NA 5ALYA 1Z0UA 2HMYB 1Q20A 3FYHA 4KDFA 4LTMA 4HG2A 4PU0A 4EJSC 2O05A 3HMQA 2CNDA 1N36B 2O9JA 4FOSA 4JVOA 4N7JA 5CT5A 5L51A 1PR1A 3DMYA 1DARA 2V7VA 4MQ6A 3LUJA 4NBTA 1MGPA 1X9GA 4DCUA 3B2EA 1Y8AA 3KC2A 5CDHA 2O2SA 2PJUA 2FFRA 3G85A 1D5WA 4JP2A 3FUCA 4MV7A 5AM3A 3MT9A 5IBCA 5IZCC 2GASA 1T8YA 3E6AA 1QO0D 2CMFA 5FADA 3LS2A 1SXIA 2XE8A 1GG5A 3QNMA 4LDPA 2VZEA 3SBEA 1MXFA 3LGXA 2VK4A 1P2FA 5JQGA 2BZ0A 2PNFA 4YQYA 3FKSD 4B7CA 1AGXA 1U0SY 1CY1A 1DOAA 3JTMA 1TCBA 1CNEA 2ZXEA 3CTPA 2NTNA 4J0JA 4DIEA 4MUXA 3TDKA 2QAJA 2OXEA 3EASA 1BD3A 1ABFA 1BSVA 1GPAA 1TFRA 1WCYA 2JIRA 4S35A 1G41A 3B48A 5KKCA 4LXTA 3F0TA 1XMOB 1V16A 2BHRA 1CZOA 1M0TA 1FTSA 1M2VB 1JEJA 3L1IA 3VDQA 1VKJA 4P4NA 4JGBA 4O4LA 1ZBDA 1K7EB 1EBUA 3B12A 3MMNA 3LL4A 2SCUA 2F8LA 1RXSA 3L1HA 3N2EA 1N4DA 2Y1GA 3JQGB 3B6KA 3N2GB 3ZY3A 5K3AA 1RWPA 4HOYA 4X5OA 2SKDA 1ZNZA 2C94A 3CPHA 4FFPA 2E82A 5HJ2A 5IJ0A 2JFUA 4UASA 3OSZA 2CHQA 4YCJA 2ONJA 2AQKA 4KFRA 3HA3A 3BE6A 2VUUA 3HVHA 2R87A 5DU2A 4IFTA 4BFUA 2O5VA 2P35A 2VWPA 3DB2A 4OHWA 2IXTA 2WMOB 4HAOA 3RIMA 3ZDBA 3AM5A 2DY1A 5EIFA 3EFBA 5JZSA 1HZZC 3ZWXA 2AMYA 3IVMA 3PGXA 2GQ0A 2Q3JA 3RAPR 1E6MA 1F9EA 1FUKA 3CO5A 3VSAA 4AU1A 5KNCD 4BFVA 5CB8A 4LV5B 3MCUA 4ZV9A 1PJ2A 4ITVA 4KYIB 4QPDA 4CLDA 1VJDA 1U3FA 1RCTE 3KSBC 3IJ5A 2I2FA 4YP5A 5J2UB 5BMOA 2HZBA 2I3AA 1WMDA 4KRXA 2Q6OA 1A2KC 3ZXXA 2QM0A 4ITRC 2YJGA 1YWGO 2WVJA 3V6LA 2W2LA 4ZAYA 3JYLA 4XWGA 5E7IA 1D1TA 1V8OA 2YXEA 4EDFA 3E15A 4TSFA 3RVSA 2QORA 3E9YA 3NBYC 3U62A 5KYWA 4Q4CA 3JVDA 5EESA 1Q1NA 3I76A 4Y1RA 2OCXA 1T2EA 1A1VA 4QUHA 1KK3A 1VC2A 4DFDA 4KHZA 2A94A 1B42A 1O94C 1P62B 1YASA 4FYJA 4GWLA 4EHLA 1ZH6A 3F74A 2FUNB 4Y2TA 2R6DA 4PPGA 3WWOA 1YU9A 1KYXA 4D0GA 5DGXA 2XD4A 1U2DA 4D3FA 8ATCA 4LF5B 1JNYA 3BA6A 2A1UA 5K0FA 3IE1A 4ZA2A 1RC1A 4RVDA 3KEFA 3LCMA 3TEMA 4CEJA 2HSZA 2EW1A 4JP5A 4ZQIA 5IN4A 5BMVA 4O2BB 1PT7A 3IC5A 1EFCA 1D9XA 4C87A 4DDWA 1NG1A 5KCMA 1DBIA 1PG0A 2AUNA 2BGTA 2BN4A 3K2EA 5HWSA 2DJ5A 4ZTZB 1JBQA 5FR2A 3PNVA 5KAMA 4H7DA 4HV4A 3C4QA 3GEDA 5ALEA 2O0MA 3VPHA 2ISCA 4ER3A 4YXFA 4BLVA 5BWLA 1RAEA 2WTXA 2K2WA 2XIQA 4YJ3A 3HFJA 4PGMA 1NR5A 3REFA 1QOQB 2FDCA 3KKMA 2V5UA 1E7QA 5K09A 1C7IA 2H18A 3FH0A 1W35A 1JRLA 3KKZA 4PGAA 2EX1A 2BGIA 1A2OA 3ZWQA 2Q0QA 2WABA 1VPVA 1A9YA 3HJCA 3ND8A 3VM6A 1KEKA 4PN3A 1CERA 2AK2A 1KJIA 3VHQA 4B8WA 2HPHA 2X42A 3LA6A 2VZLA 2F3TA 4KGVA 2AFRA 2W2VA 1W85A 1RS0A 3QY9A 2VZ8A 1TTQB 3R7SA 1J5PA 1RYBA 2AUTA 2DTEA 2EU8A 1QG0A 3B3FA 3VMFA 4E2FA 3BTUA 3STXA 3K5HA 4PYOA 3VSDA 2J7PA 2XWJI 1FJHA 4L95C 1DIGA 4IIJB 1BMDA 4U7TB 3N8KA 3CBQA 4OJYA 2YHIB 4L6IA 3RWMB 2NO5A 4V0SA 1WQ4A 2QIOA 4YBZA 4D9IA 1CY0A 2NZYA 4AJOA 4DY6A 1CJKC 5GY7A 3BSFA 3WDLA 1UIRA 4DR5B 4GL2A 4HGPA 3WKEA 2BMEA 1DMSA 5H9VA 1G8HA 4YX9A 4GM0A 5CW2A 3VRHA 4JVSB 3P9PA 3WXBA 3V4VB 5CFPA 3WB2A 5EXXA 5REQA 3WLTA 3EFOB 2VP5A 4I55A 2PN1A 4RPKA 4D3XA 4JT9A 2I2WA 4URHA 1KPGA 3I5XA 1GFSA 1S5PA 5AO9A 1GQRA 3EDCA 3DVAA 3O31A 3EEBA 7MDHA 1EP1B 1TW2A 3N86A 3RI3A 4DB2A 3ESXA 1ZGHA 5DX1A 3K4QA 2L2QA 2BGUA 1LH0A 1X7HA 2I1QA 2PK3A 4REOA 4XEUA 2O2GA 2GZDA 5A6SB 1P9OA 2PUBA 1E2NA 1KJNA 3G7UA 5KJEA 1MRZA 3W06A 4RK1A 1BRMA 1CUDA 5A05A 4MWDA 1X13A 2H07A 3STTA 2QN7A 5LZ7A 3F46A 3EMKA 1EGMB 2J6CA 4K5QA 3EVTA 2X2PA 1P0IA 3PICA 4C30A 3CRVA 3I6ZA 5HKLA 3AY7A 3T3DA 2JIMA 4I1VA 1RWNA 4MLCA 3CHYA 1CYDA 1N2CB 2OCIA 2R68A 2VK1A 3NNDA 4MGYR 3RS2A 4PF1A 1J2UA 1R6BX 2XUHA 4YACA 3VSCA 2UYCA 2JGDA 2IU3A 3T3IA 3TM4A 4JQYA 3UY4A 2RGDA 3VX3A 5AW6A 4KK4A 4E15A 3SKXA 3ZK9A 2WUFA 5J2TB 2VPTA 3KB1A 3NC0C 1IHPA 3QVGA 5FBWB 4F4CA 5BRJA 1IJFA 2C4UA 4CFSA 1PNRA 3GMSA 4P9NA 1KKLA 3KTFA 3P2MA 4OHUA 4R1PA 4ZT4A 3ZWDA 2FVXA 4WHMA 3EIFA 4Q82A 1WKVA 2XX3A 3M6AA 1ZG3A 1ZOLA 1QIMA 3RTGA 4IH1A 3LX4A 2YH2A 4OLFA 3W77A 4B6EA 1M1YE 4F2GA 3H0CA 1X1BA 4LHXA 3WV5A 4EG1A 5CEJA 3A1CA 5EHGA 1ONPA 2CHEA 2QN1A 1WX1A 2I6QA 1COZA 1RLIA 3AFIA 3QWIA 3D7KA 1ZESA 4HH1A 1A4RA 1M34B 4IIBA 3WICA 1UAAA 4X3OA 2O8DA 3Q2OA 1R88A 1GZDA 1HXHA 3P96A 1ZJ5A 4WVFA 4Y6OA 3RSCA 3THYB 4YAUA 3KOOA 1UMBA 1WSAA 3ELUA 4WXRA 4JB3A 5EP1A 5T57A 1KFEB 1OI4A 2P9FA 4DIDA 5J47A 4BXOB 2ZZNA 1X1SA 1XWIA 1KI2A 2FZGA 4M0EA 3KLBA 4QNNA 1RMQA 4PAQA 2BM1A 2CNLA 4QDUA 2NU7A 4Z1MA 3CH6A 1H5NA 2FAXA 3QUSA 4BLOA 3H4MA 3KTAB 2RSLA 5KDDA 3W90A 4JOCA 1E1QD 2OZVA 3ST7A 1NC1A 3A9WA 5HILA 1EUZA 4W63A 2OBYA 3VR5D 4KQ6A 4QXOA 1MABB 4DLRA 3KJEA 4DE5A 1HFEL 2HBZA 3C6YA 4OHOA 1U8TA 3C4JA 2ZAMA 4C5AA 2QLLA 3R4CA 4I50B 1DL5A 4Y2QA 5DBIA 5FA5A 1G66A 2EFJA 1VHLA 5ULLA 2GHQA 5DW3A 1YC2A 4DPMA 2X4GA 4B6JA 5CEFA 1PGNA 2WVGA 4M0KA 1JLKA 1NBMA 3UMVA 4E31A 3NPMA 1UPFA 4HL6A 4ZZ3A 2AV6A 4BYGA 1H9BA 4WOPA 4U2FA 5K8VA 1FFBA 1K27A 4R84A 2PGJA 4G5GA 1R3DA 2VWGA 5IK2A 4EP1A 2C5BA 3SC6A 4QLAA 3N2YA 4DZTA 4XYBA 1RTTA 1R0RE 4L5AA 3NEJA 1DQZA 2XYVA 3SSMA 3X2EA 1D03A 4DCOA 1DDGA 2FG7C 1XROA 4QG7A 4X7BA 3RDPA 2PX3A 4C0QC 3IT0A 2WQ6A 2G8NA 4Q1VA 4UMEA 1WNTA 4ZEWA 3AEUB 5FOTA 4JYAB 1RBYA 2E55A 2OB1A 4AMGA 4R41A 1XCPA 4QUIA 4Z5XA 4NFSA 2OECA 1MFPA 4FIDA 4OQMA 3EPLA 2H5JA 3K32A 2CLFB 1CW2B 4LQCA 4WBNB 3VOTA 3PPVA 4UBIA 4YRZA 1P81A 3E9EA 1TF2A 1U7UA 2H17A 3ROFA 4DCGA 3U40A 3NEAA 1ZOPA 3PTAA 4AAYA 1YQDA 4ZGGA 4YAJA 2QRMA 3EIOA 3L3BA 3MIZA 4RWEA 1W1WA 1U0LA 3DG9A 1BN7A 4C6TA 1YCHA 3WHKA 2A3RA 3N0TA 1OFGA 2EW8A 2PVCA 3CO0S 4NCJA 2NACA 4F6RA 3GLQA 3BXHA 2Y1KA 2GXSA 4MW0A 1FYVA 1YFKA 2AW5A 4V03A 4DLTA 4ESHA 3LUCA 3EVNA 3M2TA 3ZDXB 1GADO 3BMNB 4ARIA 3FI9A 3VHRA 4B47A 4MV6A 1GLGA 5HDBB 3N75A 3T7RA 3P9SA 1ULUA 4FWBA 2JBWA 1IUNA 2B5WA 4FJ2A 5IKEA 2PXXA 2Z2XA 1JBKA 3KAJA 4RPLA 1YZQA 2DEUA 4MKHA 4MWGA 1IQUA 4LIPD 3C5WP 3WK4A 4B32A 2QTZA 4EGFA 1U1GA 2JRLA 4L4UA 3VR3A 2R47A 3HVRA 3BJIC 1I4DD 4FGKA 3WQQA 2GLUA 3RGGA 2QTRA 2PCLA 1NSYA 4ZD6A 4EAQA 5KPDA 2BFMA 1TJ4A 4MOWA 3KB8A 1PJQA 2OR3A 4H7PA 4QLOA 3HYTA 1QBKC 1HDIA 1VG9B 1K7XB 1TAQA 1SUFA 1TPYA 2A59A 2CKMA 1SUBA 2PWBA 2WYHA 3B60A 1NBEA 4HWPA 3G9QA 5C3MA 3MGAA 3RIEA 3DR3A 2QVYX 3T7CA 2EFCB 4OREX 4RMIA 2A1IA 4IOLA 2QTLA 4UBNA 4G8CA 4GX5A 5AMXA 4X66B 2BFOA 1LX7A 3MOGA 4AY3A 1Q95A 5CDUA 3CJTA 2L18A 1W4BA 2D2EA 3ZGXA 1RBZA 4XPIB 3AG5A 4ME6A 3W78A 3OTWA 2HXSA 4TT3D 2ZTVA 4UM8B 1K0UA 1TK2A 2BDUA 1G20E 3H3JA 2BPOA 2HREA 3B5IA 3IHKA 1JN0A 1IZ0A 3BJZA 3H8JA 3LWZA 3V1YA 1KJQA 4RVNA 3O8NA 4FVTA 3ZJUA 5CXQA 4CR8A 2XH8A 2AE2A 2C96A 4CM4A 1EXVA 4LY3A 2VF5X 1I4EB 1E7YA 1MHPA 2P4HX 4R6WA 5KYNA 5I4CA 1T2VA 4A27A 5JCOC 1P1HA 3LIIA 4PIVA 4EJ0A 4R1QA 1NG9A 3BQNB 1IN5A 1X7ZA 4Q16A 1CJUC 3QKRB 5LB2A 2GYVA 1SXJB 3ZXIA 4PZUA 5EWLA 2QHXA 1QQAA 4ENTA 1GRRA 2H9IA 4NSNA 3PC8A 5TS3A 3IBGA 4CDRA 4J0QA 3N05A 3DZIA 3P9IA 4M9RA 4HAYA 3CNQS 4JL8A 4PTYA 2PGDA 4I9FA 3BB1A 1W46A 4HDOB 4LHYA 4PZ0A 2HDNB 5EY5B 3L8ZA 4COOA 3NV9A 5BOVA 5HOEA 1XC7A 1E7WA 1QYWA 4JQSA 3IEPA 4JI5B 1SUAA 1C3EA 1DKUA 1QGED 3BS4A 2N47A 3LX5A 2LDBA 3ZNOA 3TVDA 3EPRA 3H5RA 4R98A 1O94D 1Z5VA 2W0MA 4GXNA 1N8KA 4K8RB 5EMHA 4DLLA 1YZGA 1XMPA 3F3SA 3ZJ5A 3OQ1A 5JQWA 3WI7A 3UC9A 5CXUA 3QEAZ 1JEYB 3WGOA 3HN7A 4DCMA 1T1SA 1IXZA 1J2EA 1KEWA 4QBFA 4V38A 3SHWA 3P20A 1T4GA 4A2WA 4E2ZA 1DP4A 3KQTA 4A8JC 1I3NA 4FTWA 2N1MA 1L5HA 2X6RA 4GC9A 1Z4PX 3RRMA 5TX7A 4Y1EA 1ZIPA 1RQXA 4AXBA 1B6GA 4RHXA 1PJ4A 2HWKA 4CN9A 5C5DA 1DOHA 5E3JA 4AZTA 1M67A 1H94A 3EVEA 3Q6IA 2H1LA 4QM7A 2WKQA 4P86A 4L9SA 3ZE6A 3BFVA 4CF3A 4DBVO 3Q7SA 3KLNA 1L4KA 5ENZA 1VHDA 4AS2A 3LCJA 3USES 1PDWA 1RWXA 1EK6A 2I4MA 3RVRA 1E3SA 1H42A 1ZN9A 1N7GA 3GPCA 4QRIA 4WVLA 5DHUA 5KX5B 3K7EA 4YMUA 2AYZA 1IN8A 5B7QA 1OZFA 1EWTA 1WPXA 2G1JA 3UIEA 1SQ0A 4QTUB 1G9SA 1ZWLA 3E27A 3PGLA 5KYYB 1GPLA 2J9FA 3ZCSA 5K05A 2X22A 1OPRA 2R2AA 4Q5IA 5LQNA 3D8UA 4PR0A 3KT3A 3FTEA 4JQOA 1G20A 1ODTC 3HNOA 5DYGA 2CLLB 3PZBA 4JP8A 3EVBA 3GLRA 3DMTC 1XQ9A 4BMSA 4O4HB 1AS0A 4JA2A 4ZKDA 1W2WB 4N41A 3QELB 4ILKA 2D8AA 1U2QA 5EE9A 3WNCA 3PR3A 1D3AA 4MS3B 1G1MA 4RDXA 1DADA 5KTTA 4MROA 1FTNA 1LJLA 1SHJA 1A1SA 3QYAA 4RL4A 4OHKA 1JPJA 3PIDA 4M98A 1QTNA 5LQKA 4ZDIA 4OFWA 5ALHA 3Q8WA 1XEWX 4ZVVA 4YV0A 2FSPA 2XTAA 2GJSA 4PG8A 3FGNA 3EA4A 3CPJB 1G2IA 2V0NA 3O93A 1P73A 5FA6A 5J5VA 3UHAA 5JEDA 2QZZA 2F90A 3AXSA 3GEBA 3OE4A 4TMTA 2DM6A 3EFEA 1O8BA 3EXIB 1HQCA 3M9XA 5DFAA 1DCTA 3BH7A 2J0UB 1I3OA 1G8YA 2AF3C 3M3PA 4G5OA 5CG2A 4DUYB 1U0NA 1Z4IA 2WTAA 4Y0AA 1O9BA 1KF0A 4IZIA 1N5DA 5BYKA 1RADA 1XEXB 4KVFA 4WASA 5CCDA 2LIVA 5EIBC 1H0KA 5F5NA 5A03A 1YC5A 3Q3JB 5GADl 3HCNA 2ZSEA 3C6KA 3H83A 2JIZA 1NI4A 2GBPA 3CH5A 4LYYA 4PLHA 3MFYA 1CNFA 2JKZA 2GAIA 4Q19A 1DRWA 2QTBA 3PF9A 2YMPA 4H6PA 3RUPA 2OSBA 2G1PA 4MJ7A 3KO8A 5U1PA 4BN4A 5CVJA 3D5QA 5KS2A 3OPYA 2PZEA 3ADBA 1UDBA 3AHIA 3KHSA 1EK1A 4JSYA 2A4MA 1EVQA 3LA8A 4TLBA 1ZIYA 2CYBA 3HUDA 2A5GA 2W98A 1V8DA 2UVQA 4WZAA 3V2UA 4KPUA 1RDFA 4ZI5A 4BLUA 3QFFA 4W6QA 3SBDA 3N2ZB 4CU5A 2VDNB 2YWCA 3AKZA 4KAAA 2AXEA 3RFFA 5FXMA 3DL4A 3UWSA 5IFLA 1WS6A 1NF8A 1SELA 2PSEA 4BNLA 4HT3B 4JUCA 2Q62A 2QN6A 4RTSA 2BM9A 4XVRA 4KBYA 1P1BA 2VH5R 3O90A 4MI9A 3KS9A 3ZGNA 3FWZA 4YVFA 4QM6A 1JXQA 5GTDA 2CUZA 2GA8A 4WMLA 4BNGA 4RA9A 3ZWNA 4O4IF 4L9WA 2GEJA 3RYHA 1JLMA 1PFVA 1RWWA 1A76A 2WWTA 1ZN8A 1XZPA 1ACJA 2O57A 3A6EA 2O6HA 3BAZA 2HGZA 4PLFA 3FPJA 3UK6A 4E5PA 3GRYA 2ONZA 2XIJA 3G2LA 1RZRA 5A5EA 4NQZA 4X8MA 2JC3A 4Q9IA 4MR7B 3X1ZA 1BGWA 2DPXA 4OXNA 3O4FA 3FM9A 3LKVA 5AK5A 3GFBA 3Q5GA 3TLZA 3EDRA 1H5QA 1T1RA 1Z62A 2I3ZA 1O1YA 2F1JA 3CX8A 4NOLA 1ZNWA 5EWMB 4DJFC 3A26A 2YHBA 3OWOA 4YJHA 3SC2A 3OHMA 4YJ2A 2FUG6 3OKAA 4KYTA 4IIGA 4KXNA 2R11A 4GGOA 3S2YA 3SGLA 4ZRMA 4DVJA 3KYIB 4DG9A 2RARA 3RLFA 1QSGA 4RJTA 5EJ2A 1FP1D 5AHXA 1H05A 1CUCA 1R4MA 1EFKA 3BXXA 3MELA 3OECA 5GJBA 3JQ9C 3OM1A 3NHFA 1LKZA 3BIFA 1R3UA 4MV0A 5GM1A 1DT3A 1EMDA 1LU9A 2EW2A 3KOYA 4FMPA 2PIAA 1XDWA 3A28A 3VC7A 2HL6A 3CLSC 4EK9A 2UZ0A 1QV9A 4WCFB 3DFFA 3JCZA 3TQOA 4TZ0A 1ZICA 4C2AA 1IRXA 2XBUA 1PWYE 3OMWA 2EIXA 1XBTA 1EZ4A 3QA9A 1NV8A 1QKKA 2GCEA 1O6BA 1OAKA 4XLZA 3PX3A 1KAQA 2ZB8A 2YQ4A 3E05A 4HMOA 5LD2B 1KZ7B 1R6TA 3PR1A 3GMDA 1E1CB 2J9GA 3AFHA 1OYVA 3GD5A 4QDTA 3WG9A 5IABA 3GLUA 2GPWA 2I0FA 1N9KA 4CKEA 4Q9JA 2QEQA 2BCJQ 4R0NA 3I5YA 4NK5A 1E1DA 5I9NA 2XMRA 4UDOA 3DPUA 5DNEA 3DOJA 1KIFA 4JELA 4QJ3A 3RTEA 1N0WA 4R01A 2H8KA 4AFNA 2X7HA 3SU8A 4J16C 2KWIA 4ENQA 1C8BA 1V43A 1WPGA 1M76A 2ZWVA 2BUAA 2O7QA 2YWRA 4UTVA 1VRCA 2QQ5A 4WECA 5ADHA 2HKIA 3PI6A 3H5OA 3WBKA 1T9HA 3DEKA 2JGRA 3LCVB 1O58A 2HC9A 3U44A 2GEFA 2ZRNA 2CF6A 5K8CA 5F98A 3LO5A 2BONA 3AINA 4GNKA 2B34A 2RHLA 1L5WA 2IXEA 3K9QO 1W0JD 4BGUA 5KNCH 4MW7A 2O8FB 4BATA 4MHSA 4YV1A 1XD2B 2DHEA 4GVPA 5DBOA 2IHZA 5KAPA 3S2IA 9ATCA 3KEGA 2G77B 4OFZA 3GYGA 8ABPA 3KQQA 3PDIB 2PZMA 2Z57A 3B1FA 1V5EA 4BJ6A 2PHZA 4IJ6A 4G4SP 3VKFA 1M8FA 3OLQA 3RUIA 1Z15A 1A04A 4FCWA 4M0UA 5DX8A 4GVXA 1XZQA 4XWTA 2ZYDA 2EFGA 2Q0SA 3OQHA 4N0DA 3GRCA 3PX7A 5A71A 2OFXA 2GKGA 3Q72A 2II6A 4H6WA 4AZ3A 1BROA 1XAJA 2A84A 3EEIA 1WLSA 1NL3A 3H2SA 4A7PA 1JP7A 3ITNA 4PQGA 3JASB 3TLKA 2WJWA 4PHHA 3VR4A 3STUA 4IJ5A 1S4MA 3RIHA 2R1VA 1W0KD 3GX1A 2WYWA 1VJ1A 3E9CA 3K0KA 4KL8S 3VO1A 5FWYB 2ZAOA 1UP4A 2NV0A 1VYUA 1I7LA 3AERB 4IO0A 5FUYA 2N0SA 2B2NA 1ZNYA 4P6VF 3EVGA 4AKEA 4Y2JA 2PU7A 3L1JA 5JMTA 3ADPA 4XOIA 4EZEA 3ELYA 3B1VA 5F33A 3V8RA 1JYEA 2IEZA 2AS0A 3VAAA 2G9RA 5CAEA 2P6RA 2DH6A 2JLBA 3Q11A 4C03A 4D9GA 3O9MA 3IT2A 1P72A 4E6PA 2RGNA 1QLJA 2WE7A 2VJOA 1KVUA 4WXYB 4HAXA 3GAFA 1RRFA 5DTQA 1U8YA 2FFAA 3BFXA 4DMCA 1QU3A 2JFBA 2QX6A 3HNPA 4UPEA 1JHZA 5DKFA 1K7FB 3FX2A 4AJ2A 4YRMA 1CS0B 3NVDA 2PV0A 1JDUA 3P2KA 2BEUA 3IERA 4EF4A 3OF5A 3NAMA 2EBHX 3L2OB 5LR6A 3RF7A 4LGMA 1UAGA 3QKUA 3OZGA 4FINA 3M6WA 4JLSA 3TPZA 3JAKA 3WVNA