1MVNA

Ppc decarboxylase mutant c175s complexed with pantothenoylaminoethenethiol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
RKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDNLLTCIIRAWDYTKPLFVAPAMNTLMWNNPFTERHLLSLDELGITLIPPIKKRLASGDYGNGAMAEPSLIYSTVRLFWES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PPC decarboxylase AtHAL3a
publication title Crystal Structure of the Plant PPC Decarboxylase AtHAL3a Complexed with an Ene-thiol Reaction Intermediate
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 60
structure length 182
sequence length 182
ec nomenclature ec 4.1.1.36: Phosphopantothenoylcysteine decarboxylase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 1mvnA00
4MWGA 3MCUA 4RHFA 1MVNA 3ZQUA 3QJGA 4ZAGA 4ZAVA 3LQKA 1G5QA 1G63A 4ZAZA 4ZAFA 1QZUA 1MVLA 1P3Y1 4ZANA 4ZAWA 1E20A 4RHEA 4ZALA 1SBZA 2EJBA 4ZAYA 4ZAXA 3WISA
chains in the Genus database with same CATH superfamily
4TRRA 3PTAA 1S2LA 3MD0A 1SM4A 1GD1O 1VXOA 4Q4CA 4PVCA 1M8PA 2M6RA 3V8BA 3NJ4A 1A9SA 3VVCA 4L2IB 4Y0NA 3SIRA 1HUQA 3FE2A 2XRMA 5KMGA 1VHLA 4MR9B 4A8JC 3DM5A 4GBED 3ITDA 4NBKA 3T3DA 2XA9A 2XCQA 2H07A 4QUJA 1O96A 1MZPA 1PW5A 5KTOA 2Y27A 1U2PA 3BWYA 1ESDA 2F1JA 3GT0A 1CRWG 4Y1RB 3KHUA 4TMVA 4H7EA 3EC2A 2GS9A 1K6XA 3L0ZA 2EYUA 3I5UA 1GUAA 3NWJA 4M1MA 4QBFA 4Q5IA 2UKDA 2VP9A 2FPIB 3CSUA 1GTVA 2YZ7A 5CVTA 2YFYA 3F97A 1N5IA 4FFSA 2FR8A 4MZXA 4HWPA 5A0VA 1D8TA 3O1HB 3LTEA 1I1OA 3E23A 5HZMA 1PDVA 4LECA 3IT1A 1Z8FA 2WZQA 3ZQUA 1SAYA 1Q7RA 2BHTA 3FOWA 5EQTA 3C5WP 3NU1A 2AT1A 1X7HA 4PQGA 4AJ2A 4GVXA 1P7ZA 4JUIA 4XASA 3LPDA 2COUA 4E3ZA 1R0CA 4WERA 5B64A 4QRHA 2J5XA 2OHGA 1FJXA 5EJ2A 3NH9A 3CWCA 5AMXA 4D8TA 2OVFA 3W3AD 5A2GA 1PR5A 1NKVA 1ZLXA 1BHJA 3PITA 4U2EA 4J9VA 1X7GA 4UM9D 2IH4A 5KYGA 1ZISA 3PGXA 4WAUA 3UYKA 3VBCA 1Y81A 2WC1A 1KH2A 2NVBA 2ODBA 2PKWA 3KQSA 5EE9A 1O9HA 2Q5QA 3UXEA 2B4AA 4FBMA 4C4PA 1SEPA 2XKJE 3A1EA 4L4UA 5LZ7A 3VZQA 1UBKS 2PYDA 2PZBA 3AW9A 3HCBA 4LBVA 5CD1A 3DDCA 4PAWA 2WA1A 4RJJA 4XQGA 4ZPJA 2Q4BA 4Q9LA 5JEEA 4V2IA 3DXYA 3VFDA 4ZJUA 1THGA 4G5SA 1RPZA 1YDWA 3CG4A 3PD7A 2TS1A 2H2HA 3DE1X 1UQUA 4ISCA 5JBIA 2V7EA 3MD9A 2RE8A 3L9XA 2AOUB 1BWSA 3BORA 2ZKIA 3D8SA 1CUBA 2WWRA 3B20A 3KL4A 3PNLA 4PPYA 3EMVA 3CCBA 1RKVA 4RWEA 5IXYA 1U0GA 2H4JA 4LKOA 4YWHA 1MX3A 1GNRA 1R5JA 2GZAA 1OH7A 2QTBA 1ZSVA 3WTBA 2Y99A 2JHFA 2GF9A 2FFQA 3P9YA 1ECFA 3NRJA 4E21A 5KWVA 3QNWA 4MUXA 1EGQA 1XWWA 4B3XA 3GLFB 2BONA 2YQZA 3UMCA 4Z0TA 4YJFA 3PQ4A 5K3SA 2LKDA 1VLZA 1FXWA 3BHNA 4L08A 3SS8A 3K73O 5JQWA 3OBBA 1RI3A 4ZA2A 3OZSA 4GP6A 1XAGA 2QTZA 5L3RA 2QTVB 4FD2A 4N5NA 4D4KA 5IULC 2ZRLA 3T6KA 3W0LB 1AOXA 2FN8A 1VXRA 4D9NA 2GA8A 3ZW8A 1J8MF 3JAKA 4EA6A 2XB6A 5TEVA 2YFKA 1WPRA 3WL8A 1FTGA 3FVQA 5JYDA 5CCBA 2WJ4A 4IUDS 4D41A 1WCXA 1NATA 3LA6A 4E32A 3AHFA 1JWAB 3SFVA 4DRXB 4E12A 3AEXA 4UBJA 3NYWA 2O52A 2PZFA 4GR9A 4N76A 4IKEA 4X41A 4YT8A 1PGPA 3R0XA 1GTL1 4QWWA 1P0PA 1PEYA 2FFJA 2WWGA 1BXRB 4WZ6A 1EESA 3G9TA 4UDYX 1GGVA 4JI0B 1XJQA 5BWBA 3D2LA 1RJEA 3GLKA 4GGOA 4GNRA 4HGYA 3HDQA 1II8B 4RVDA 5EWLA 1T8RA 2ZTMA 2AD5A 1SD1A 1GPNA 2HZBA 3H9BA 3LPAA 4K3VA 2IODA 4L7QA 5G1NA 3WFIA 5BN3B 3T34A 4AJKA 4GE0A 3PGKA 4OOEA 4X6XA 4P0PB 1OZGA 1WMEA 2DU8A 3GOHA 3HPQA 3NBYC 5EAIA 4ZO7A 3UO8B 1GXSB 1V7ZA 3R41A 4I5EA 1G98A 4J0CA 5JJBA 2IIQA 3TZQA 3VO8A 6Q21A 4BMZA 1ZOSA 5DTQA 3ZY3A 4ALLA 1TX4B 3SOPA 3BMOB 4KN9S 1G5PA 1EDOA 2I4RA 4ME6A 3IEXA 3THWB 3B1ZA 4BOYA 2Z5GA 3RT1A 4DG5A 1RAIA 3R3HA 4QXOA 4J91A 4NU8X 3QM1A 4JI1B 3C6YA 1CIVA 1CJTC 3QWHA 1TKRA 2XGMA 1NJ1A 3MXTA 3QKWA 4C1BA 5F1OA 3R2JA 4OJKA 3AKCA 1M2OB 1VE1A 5E7MA 2XEXA 3GPDG 2VI5A 2X2OA 3T1QA 4JVLA 4AJ4A 2VDWB 1HQCA 1SMKA 4K0KB 2P0YA 1H2BA 2GT1A 5KNCD 4KQ2A 4Q05A 1NN1A 5T3UA 2IHYA 3MGCA 4K9OA 1VKRA 1I10A 4DCGA 1P45A 3T9BA 4NBLA 1KMHA 1N7IA 4A8TA 4O4IF 3HBAA 4TKMA 5EE1A 2ERYA 2ZIGA 3NW9A 3GA5A 4YUXA 4F6RB 3BCSA 2ZTVA 1DT3A 5HUJA 1RQ7A 2ATIA 1O03A 2P5SA 2H54A 1GR1A 2HC9A 4IBOA 5ABPA 5LQAA 4GC5A 1GPDG 1JHAA 1TU3A 4A5OA 4UNIA 5HBGA 1QF6A 3WK5A 5LQSA 2W2PA 4CM6A 3QENA 3L6DA 3GMSA 3CBGA 5SYMA 1UDAA 1H5NA 1UKZA 2P3QA 1A9YA 4JKIA 1FDWA 1C9DB 4ZEXA 2BEWB 5I6DA 4PO3X 1P9RA 3TZBA 2F8LA 1VIVA 3AYXB 1V1JA 1MKYA 4C9BA 4MKGA 3S70A 4KNYA 3IODA 1TFRA 1C29B 1QC5B 4ENPA 3DE2X 1LTHR 4D25A 3TW0A 4F12A 5J1SB 2VHEA 1GNLA 3NPMA 1UAYA 3NM6B 2MSLA 4OSPA 5T4BA 1DXHA 5C7YA 5EWJB 5JWRA 3G82C 1ODFA 4HBZA 4HGRA 2W6JA 5CM9C 5DGIA 1E0KA 3HFJA 2DUMA 1SHUX 5L3QA 3KQQA 1KJ9A 1A1SA 2JFGA 3OZWA 3BIOA 1WXDA 2IYVA 3HJHA 3QVOA 3WRVA 5IT4A 4DIOA 3H5AA 1QX3A 5BQ5A 2O20A 5FWAA 5J5AA 2VN8A 3EVNA 1Z0JA 2BMEA 2C2MA 2VJCA 5EC8A 4ZCPA 3TKYA 3C3KA 4DCVA 5ILOA 5F51A 5A5FA 4QPPA 4KIFA 4IYRA 4UXJA 2QTGA 3U9TA 1MA3A 3KYCB 1XLVA 4OHUA 5KWJA 1F4VA 1K08A 1VJRA 2WAMA 2FUNB 4TTQA 5K0NA 4JJFA 2NTYC 3SXUA 1MJNA 2AFIE 4PN3A 4W5OA 5EZYA 2PUCA 1UBGA 2HLHA 1NLYA 3EN0A 4J0DA 3UF0A 3R44A 2WU0A 3EEBA 4YUAA 1UPCA 7MHTA 2J9YB 2WKQA 3QLVA 4RVOA 1IONA 4UD6A 4ALKA 3NBAA 4L85A 2PLRA 1PJRA 3F5FA 4I1YA 4WNYA 2JCVA 2G17A 1VE3A 3R3XA 1TA4A 4M0PA 4U2BA 5P21A 4NKRA 3LVBA 1OVGA 3UXMA 3WIVA 3EGVA 5IANA 3OZIA 3OCYA 3ZG6A 3ESDA 4XDZA 5F35A 4O2LA 3UUFA 1FZQA 1P7CA 3NCHA 4HOYA 4O29A 2YY6A 5BSHA 3KSAC 1G5RA 2PRKA 3A32A 4HRVA 4HS4A 3ETJA 3UWSA 1HH4A 1VBKA 2VQDA 2WYHA 3GVXA 1IJBA 2GHQA 4LYDA 4J76A 3STYA 2UUPA 4JCOA 5BXYA 2IDMA 3W1WA 3I34X 2TMKA 4A1OA 4CMGA 1E3JA 3H1TA 4OGFA 5TQJA 2QQ0A 2W4IA 5B36A 3ONDA 2G1UA 3OWHA 4PIMA 4UFPA 2FPGB 5B1SA 1RXIA 3G1UA 1BCRA 3ZXIA 3GCGA 1X6VA 5T57A 4ZYUA 1ENZA 2D54A 4EKGA 4V3BA 5AI4A 3WGUA 5B6JA 1Q84A 3OT4A 2V4MA 4JYAB 1FW8A 1S1CA 5AXDA 2Z2YA 3V5NA 3A2NA 5FPKA 4B6FA 4N40A 4GYYA 2MJLA 4OI1A 3IB3A 3ROKA 4JDPA 3SQDA 2HA5A 2JRCA 4MW4A 1OTXA 3RS7A 1WMFA 3H2GA 5IVKA 4DPLA 1T9GR 1IIRA 2HDNB 2BOVA 4PAQA 2D1QA 1CSEE 2II6A 3ZHSA 3VZPA 1B42A 4A03A 1R8JA 4MB6A 1U5BB 1P2UA 1KDRA 4RKQA 2QT0A 4MS1B 5M2QA 4X7RA 2NSDA 4O59O 4R68A 2GAIA 4HDAA 4RXUA 3IVGA 2EBUA 3LKZA 1FXUA 4MDFA 3VHXB 1LTKA 2ZWOA 3RK4A 2DBRA 1RYHA 1Z22A 2CFOA 2OKCA 2WMYA 1A69A 3E7PA 2F1RA 1CDEA 1RM3A 1PQUA 1F4LA 3ZZ0A 1RRCA 4RIIA 2ORIA 5TC4A 2R44A 3M6LA 3F67A 1C9YA 4ND5A 5HCIA 3PICA 2EGHA 5F2KA 4RTQA 3T5AA 2A3NA 3V8MA 2DH5A 4MDHA 3L8CA 5BMVA 1E3DA 2AYZA 2PQ0A 4U2DA 1BYIA 3PIDA 5CA0B 2H4YA 3OU7A 4ZKDA 1T24A 1N3LA 1VBMA 2JFYA 1E1YA 3DAGA 4C4SA 1A82A 5KOHB 3BBPA 3SYKA 4IQ8A 2J30A 5F1YA 3UTDA 3UIEA 3D6MA 1VSQA 3RIEA 4QEKA 1X80A 3JZFA 2QTTA 3NV7A 2R48A 1NVFA 4X90A 1EVZA 3JD2A 2E1RA 2RH8A 2QTNA 1Y8QA 2YRXA 3IVCA 5JASA 5CJPA 1L5FA 3N0XA 5F3DA 3AI1A 4KRFA 3NRCA 4LFBB 2E1PA 4B82A 4WFQA 2ZRBA 5DYIA 3VO1A 1DC7A 1CE8A 1H94A 1IY1A 1EHYA 1OASA 2IZ7A 3RVNA 1PEAA 3AR2A 4JHLA 1I30A 5JNVA 1AMOA 2QAGC 1LFAA 2GN0A 3C6KA 4XUGB 1VECA 3MOIA 3FPKA 3L49A 4Y1EA 4BFUA 2DPGA 5J2TB 1OAAA 1Z6TA 3L4KA 3WL6A 1XMQB 1ZUD1 3LCCA 4MB0A 4LV8B 4Q1EA 3V7UA 2VTKA 4FFBB 2XKKA 3U9LA 3CTPA 1ADFA 1Y8RB 1QE5A 3PVZA 4U7GA 4MUKA 2IYEA 4FJ2A 1PX2A 3DOCA 3FMIA 4D56A 1VQ1A 2OL4A 2D7JA 3IDSA 4MUIA 3VKWA 4XQ0A 4C2AA 3PRHA 4TT8A 5KNBA 2ECPA 4JWTA 4JSYA 2N3ZA 1RXYA 3FYUB 3OF2A 2IHVA 2YOGA 3ZU4A 3O8QB 4FGLA 4G1CA 5FTJA 3HYNA 4HRXA 1JR3D 3K32A 3MWEB 4BNYA 4Z6KA 1OJ7A 1CY1A 2XYQA 3PT5A 4HWKA 4CTNA 5JS8A 4RA9A 2DPHA 1T0HB 3ICEA 1R4MA 4DV7B 2DPMA 3DQPA 3FIJA 4Q3NA 5FUVA 2VRBA 3HS3A 1L4EA 2XMGA 1RE1A 3DV2A 3PNBA 3MT7A 2EVWX 2R6HA 3DZIA 5DM1A 3A3YA 1P73A 2AOWA 3OX1A 2ZYVX 4AX8A 4EJ2A 1WBDA 4LYHA 2HF2A 1N6NA 4W9NA 1ZOOA 1ZEMA 2R11A 4QUAA 1DAIA 1I1HA 1VSTA 2EW1A 2R6CA 1AXGA 2P9ZA 2X40A 5A6SA 1WSWA 3OU2A 4ZYVA 4JYMA 4YRFA 2J0VA 4D6PA 2AW3A 3PJDA 4PFQA 4B8ZA 3AM1A 3GFRA 4EHJA 1PKEA 1FTWA 2BUCA 2QSUA 2XNDD 3AZQA 4NPHA 4R9RA 5EESA 2UZIR 1GSAA 3BKWA 3WLHA 3DBRA 1MABA 4RORA 1KJNA 4BE7B 4KSYA 2UYOA 1QXSA 3CLHA 4GXTA 3TXXA 4EJMA 2CXNA 4KIUA 1MTZA 4C7MA 4ZV4A 1Z5OA 4DKXA 2AFHA 5CUQA 4BX9A 2YWRA 4S2UA 5LBUA 3LUJA 5KHAA 1SKMA 1V9SA 2UYHA 4OFXA 5B2EA 1UODA 3L40A 3TS1A 3RYTC 3L41A 5E0OA 3QSYA 2EFHB 3NWBA 5HKKD 2WJGA 2QP4A 2X4LA 4HAIA 5C31A 1O8CA 4I4TA 1NHGA 2I2XB 3CRVA 1M2WA 9LDTA 5J4VA 1DX9A 2FPXA 4Q9JA 2ODQA 5LMNB 1SPXA 2ZYDA 3I2KA 3QWAA 3MLBA 1JYEA 3WSWA 1MRZA 3RABA 2OAQ1 2Y0DA 2X7JA 4NYIR 4CEIB 1JVNA 4IF4A 2O0LA 1JN0A 4O5OA 4R8VA 3N0VA 2ZOSA 2O5EA 5FULA 5BUQA 4LHVA 4QHSA 1JHPA 4YCJA 1DEOA 1SO8A 4NONA 3O92A 2A9QA 1QRAA 1PZFA 4FZJA 2B4QA 2O4CA 3GLQA 4ZU6X 1CLUA 5EMHA 2IP4A 4GOND 5BWNA 3OOYA 2I3BA 4ZI7A 3P5BA 3O03A 1GEEA 4P31A 4NEGA 4YJ2B 2IV2X 3WWYA 4EA8A 5B1YA 2EFJA 1V16A 2FQ1A 4QQRA 1NRXA 1S0UA 3ETGA 3LQRA 1DUSA 4HYYA 3EEFA 4LMBA 4B7CA 4Q12A 1QH9A 4K9RA 2GXQA 5KYUA 3OIVA 3VPBA 3KZ1E 1NWCA 1PJLA 3AT1A 2AEEA 4RDCA 1KRXA 2EKLA 2FSGA 2QRKA 5D3QA 4TTPA 4LRUA 2A1IA 2B83A 5DEIA 4LVNA 3RB8A 4B76A 3FNBA 1Z75A 4ZI2A 1XZPA 3DVLA 4DDTA 3W2FA 4JL6A 5DK4A 4PZDA 1SBQA 5EUMA 1NAHA 1T3TA 3EMDA 3FR7A 4JUAA 4PQFA 4YI3A 1MHPA 3RJ9A 3SM3A 4A8JB 621PA 1R0ZA 4LISA 5KNDH 2QW1A 1MH1A 5KKAA 2CW5A 4IDPA 1YQXA 1S2OA 3KT3A 3JD4A 1YGPA 4KCGA 3LWZA 5K3FA 2YUIA 3BCHA 3PKJA 1Q11A 3ZLJA 4GT1A 1KIMA 4TLMB 5BNWA 2ZTHA 2FQQA 1JTEA 3C41J 4MYTA 2ZRHA 4OHVA 4BFCA 1R18A 1X39A 2JATA 3DTVB 4GPTA 5TSDA 3K15A 3LHIA 5JATA 4IGIA 4KQMA 1V5FA 2COEA 4KLAA 2ZBEA 4LWQA 2A88A 3OM8A 1QLHA 1X87A 2CFIA 2PAAA 2CFSA 5JLJA 4C6RA 4A0HA 2X3FA 1QZ3A 2O1EA 1VPLA 4ND1A 2BR3A 4ZO6A 5IN5A 2ZB7A 2I3AA 1FSGA 3G8DA 1NF8A 4GQIA 1IZYA 2FEOA 4JODA 1YB2A 5CEFA 1X1QA 5DFAA 4RX1A 4ZVMA 1MJGA 1OA1A 3MIIA 3BMNA 2IXGA 1QRSA 3NIBA 4JR1A 1MJ5A 3IILA 4YX9A 4FZ3A 2AF3C 1Q1QA 2ZANA 2F1IA 1E1KA 4HFJA 3ZU2A 3TTSA 1IHOA 2WDZA 5JEDA 5ERXA 4P4UA 5IUNC 1A7KA 4GI7A 1C7ZA 3VMMA 1L8OA 3GH3A 1ZZEA 3PXGA 3AVUA 2GBCA 3AR4A 1AZWA 4K5QA 4Y6QA 2WQZA 2DFKB 4C05A 1QZUA 5SZHB 5AW0A 3AV0B 4DM4A 2WMDA 4L0DA 1XZAA 4F4IA 3C74A 3FB4A 5LU8A 4AIIA 3CH7A 1KEKA 1KQ3A 2FAXA 3DE0X 3H99A 4QBHA 1VBFA 4IIXA 2N9UA 5EMJA 1TO1E 3DFZA 1W88B 1Y8AA 4A6PA 3AHGA 1M0SA 3FGPA 3LMKA 4RZUA 5CLGA 1AUXA 5LB2A 3W5CA 2XF2A 1S2IA 3A6LA 1KPHA 2ZXFA 2JGNA 3AIKA 1X1AA 1NVAA 3L8HA 2QQFA 1DQRA 4GOKA 5ADHA 1SHKA 1E3IA 5JCPA 1VJCA 2EDAA 5DM2A 2TSYB 4ER7A 2H1HA 1ZITA 1QFXA 4GMKA 2YXPX 3T52A 2I7CA 2OFXA 2VTVA 3QX9A 2C8VA 3MM4A 2P6OA 1BMQA 1X19A 1XN1A 3FSRA 3RLIA 4P5EA 5JZSA 1ISSA 5CDGA 4UNQA 4ML3A 2B8WA 4TTRA 5CVDA 4GL4A 2DFVA 5BN1A 5B58T 3ZWBA 4N5MA 3S3TA 3ZHUA 4M76B 1F48A 3FGNA 2XB2A 4UBMA 1BW9A 1EXMA 2YN0A 2YZ2A 2R7AA 5IK2A 1HFKA 3TCKA 1ZXXA 5DHSA 1XPRA 2YASA 3ZYZA 4NTZA 1IATA 4HDNB 3SCZA 1ZMBA 1R2QA 3COVA 4XUCA 3CPHA 1MOSA 2K2QB 2VK8A 3MC1A 2QT1A 4M60A 2B4YA 5IBRA 3SJAA 3ZIUA 4C3VA 4CQMA 1BOOA 4FD3A 5ALRA 3AP1A 1AD2A 4A7PA 3PC4A 2HO5A 1EUCA 1XEWY 2HRDA 5U9CA 1ND5A 4Y67A 5AVYA 2OV2A 2JC3A 4X8LA 3GLRA 5KOJA 3SBXA 2GJ9A 2XVYA 1WHSA 4YI5A 1CZUA 4FDAA 2BDTA 5HK9A 4FR2A 1FTNA 1NBMA 4OXRA 2NU7B 1CZLA 3M3DA 1ZGCA 3WWPA 4E1VA 2R87A 3M4JA 4CV0A 4DNPA 4HSEA 4QREA 1C4OA 1XZGA 3F98A 3GHHA 3Q7PA 4KBYA 2IHKA 5IC4A 1IXRC 3K2IA 4QD3A 4UNNA 2XCTB 2UUAB 5DTRA 3QYAA 5P8WA 3T9FA 1N36B 3GFPA 3CG0A 1RYDA 3I23A 4ILEA 4LCEA 4U9IS 1SVWA 2YXLA 1ECBA 1L4NA 1UFOA 2O8NA 4N0QA 2QG4A 3AETA 4C4RA 3UJ3X 3X0DA 1AKVA 4F56A 1EI9A 2Q5HA 3DWFA 4H7HA 4O1MA 4RA6A 4Y9DA 4IGKA 1JB9A 3QVTA 1XD9A 1YC2A 3KJNA 4BP8A 4FYMA 2QWXA 3JRNA 2R2GA 4MUHA 1F8YA 3KSUA 4V0LA 4C4OA 5CFZA 3DOHA 5GGXA 3IYLW 3U7EB 2QZPA 4HNRA 2NPOA 2PU7A 1TDJA 5ALTA 2C42A 1XTVA 1TQ4A 2J48A 3PI7A 2WF9A 2RGNC 3UCXA 3JATA 2HF9A 2I0FA 3FOZA 1Q0TA 4HDRB 2G67A 1ORDA 1T3HA 4ZEWA 3LUFA 5H70A 5T6MA 3GFFA 3U31A 1P81A 3FYSA 1L3CA 2JIDA 3M5DA 2GAAA 2L42A 1LCIA 3KQNA 3QKRB 4HWGA 4CG0A 4UXIA 4TZ6A 3M6MD 3SKYA 1AGRA 3CV3A 4RNDB 2DULA 5BVGB 1JPVA 3D4LA 2HXGA 3WDMA 2AMVA 5ELMA 3AOGA 1LJLA 4YA6A 3R8FA 2QTHA 3D4NA 3LP6A 2Y0CA 2BI7A 3AU8A 3GFSA 1VIMA 3N6VA 2EIHA 2C0PA 3D6UA 3GRCA 3R3SA 4M88A 1QYVA 2PIAA 1NW5A 3WK8A 1X9HA 4MCJA 3DMDA 1A8SA 3EQZA 1EA5A 1IB0A 1RLUA 3QEMB 4MITA 1QV9A 1XWIA 5B5SA 3TW4A 3IE1A 1QPBA 3LUDA 4H17A 4U9UA 5HIJA 4M21A 1SQGA 1DX4A 1DKOA 2VDOB 3Q0IA 4FYWA 1BVHA 2C95A 2VVTA 1U3FA 4PLYA 3ZQ6A 4M1SA 4J3FA 2R68A 3OJCA 4F1JA 1JSLA 2GD2A 4B4UA 2XA2A 4K9PA 5KNDA 2WPDA 1JU4A 3KKZA 2QMHA 3IAFA 3MQFA 3RIHA 1UT8A 4JJIA 3ONFA 1X8XA 4FGUA 4X1KA 1OPRA 4J4TA 1XPUA 5K2MA 4ZQIA 2VJAA 3H9JA 4QG3A 1JA9A 5I5EA 2YYSA 2ZBGA 3IP8A 4D46A 3OKCA 5JY1A 1P75A 1G8PA 1GPLA 3KSZO 2R8YA 3PDJA 4HY3A 1TU4A 2EKDA 4E5NA 3R3UA 2FR0A 3I9KA 4RMHA 4F2DA 1BDIA 1GA6A 2XUOA 2G70A 3GJ6A 4BNFA 4OQZA 1SC4A 4NBWA 3PGJA 1NKTA 3H8WA 5JFGA 4OQYA 4UUBA 3WDSA 2JARA 4BP1A 4H60A 1W49A 2D4AA 3Q8XB 4LHZA 4B8WA 1K6EA 1HO3A 4YR9A 3E61A 3K4PA 5G4LA 2C7RA 4FVTA 3I42A 5HRAA 2O8DA 1A9PA 3EWIA 1G5IA 1GRCA 2XKAA 3MCZA 1XNJA 3P9KA 1JBQA 2GPSA 3UFXB 1FZTA 2OE2A 2OBFA 3FBGA 3N07A 3HN2A 1NW9B 3T5DA 4QULA 3E58A 2BDEA 3WNQA 4NH0A 4C04A 4TT3A 2EFYA 2A9PA 2GB4A 4NG5A 3UW3A 4PG4A 5HJ2A 4W1SA 3QXGA 3PPYA 3W8FA 1WPGA 3VVLA 3SHQA 3Q72A 2AUNA 1WVIA 4ZQGA 4NU5A 4EMBA 1C1XA 1NQWA 1UCFA 2R60A 1XA3A 3ICVA 3IRVA 3OLQA 3DAHA 5AOAA 5TY0A 1VGQA 2GRJA 1ZGAA 3GLHE 4LXIA 3ZGZA 1RHQA 1X1SA 2XZTA 4F11A 1VPDA 3SVTA 2WWWA 3E15A 5J1TB 4Z8XA 2XA1A 2R5WA 4J0HA 5C5DA 4MR8A 1M2VB 4EQ6B 4LY0A 2RARA 1ZDMA 5J63A 4DM7A 1MO2A 1WU7A 1YVUA 3AV3A 4P32A 5AVQA 5FTMA 4OHKA 5AKEA 2JIOA 4OP2A 2V7QA 4CUZA 1RYZA 3A3PA 3R8XA 2BW0A 3HC7A 3FDZA 1UJ4A 4OFZA 4JAVC 1TMYA 1JG7A 4KO1S 4S2EA 5DRYA 3GDFA 1Y98A 3NP9A 4LGMA 1DJOA 2AZ4A 4M7OA 3VYVA 4BEWA 3IQEA 2DY1A 3HKDA 3R0VA 4H0NA 1NVVR 2GZHA 4ILKA 1T9DA 1Y33E 1E3TA 4ND8A 2ORED 5D84A 3SYNA 3PI6A 1T8UA 2JANA 2PGLA 3N8KA 4HQ6A 3BJRA 2A35A 1FBTA 5AKHA 4JLPA 2YV2A 1U2GC 4RHFA 4U7TB 2GCOB 3OLWA 3GGGA 3O8LA 5KVQA 1HYBA 4BNNA 2GRUA 3RBZA 2HXSA 4L16A 3U3JA 3W1VA 3JARA 3DC7A 3F5MA 2DSNA 2YY7A 1NXXA 3ABZA 1IWBB 4DDMA 5C9ZA 3PXEA 5A05A 4BVKA 4PCUA 4DA8A 3QIAA 4BTEA 4WY2A 4R0VA 4EVIA 1QIDA 4EFMA 2UZ3A 3F7TA 1YQ9A 3WIDA 1J42A 1ZK2A 3OQJA 4H3VA 3HXKA 5DO9A 4C7VA 2XSZA 1NXWA 1F14A 3O8BA 3K0FA 2RONA 4K1LA 5T8KA 4CT5A 3PUVA 4D0SA 2XGOA 1JKXA 1UBSB 2G5PA 4IZHA 1M0TA 2ZUSA 3CEJA 4YEDA 4WKGA 1YUBA 4KITB 3OPQA 1PS8A 3CH5A 3A25A 3VZSA 2C2YA 4CWAA 5AVVA 1YQEA 4E14A 1YHYA 3W04A 4PXSA 3IQGX 1E9VA 1UXJA 2BGTA 2W6NA 1AZSC 3HNPA 3A1WA 3HBMA 3PFKA 4IIYA 4QL3A 1NBHA 2VBGA 2JHPA 1Z39A 3GNLA 2IV7A 1EXWA 4MULA 1XXHB 2ANBA 4PYIA 4WLVA 5EA2A 4AKTA 3MHTA 1DBVO 1WDLA 2G06A 1KYZA 4GKVA 3L0YA 1Z7YA 3IMKA 4HADA 4MV0A 4PG7A 4PZCA 5THQA 4B7XA 1T5IA 4OHBA 4WLOA 1V0JA 2H06A 3TTVA 3PL1A 1T9ZA 1BEUB 1K9VF 1MX1A 1W2GA 2Z4RA 4FSDA 4ITUA 5EIOA 5J2UB 1G5HA 3B9BA 3PRJA 5LYYA 3VPGA 5C8ZA 1NBEA 5K8LA 3DL7A 3BK2A 1CBUA 3DHWC 3H0EA 1GL3A 1LJ8A 2O2DA 2BFMA 2IPAB 5LQKA 3P0RA 3HCEA 1H1LB 2PPVA 3DVAB 4WXYB 4AWAA 3AIIA 3Q40A 5EXDA 5E3HA 4URXR 2F17A 5JZVA 3A9WA 5EP2A 2BGKA 1DDGA 1EFPB 2KSQA 3STVA 1LZLA 2QYSA 2OLEA 3U17A 1E9EA 2C59A 1MX5A 2OZEA 3IUBA 1X13A 5GZ6A 1KWKA 2DTDA 3OE5A 3JQFA 1QPZA 1MO3A 2YFHA 3B1XA 4IHJF 4X0EA 1IFXA 4UCWA 3COWA 2I4OA 4MAAA 1X8LA 4MQEB 4PNHA 2BTQB 2SCUA 5UKDA 4OVKA 3T9CA 3O9ZA 4LK3A 3E3LA 4YS6A 2Q2NA 1U0OC 3ANMA 3AY0A 1N8TA 3RH0A 2Y1WA 2PT9A 4RD4A 1OQAA 2J33A 3DUFB 4UUMA 5CB4F 3AFHA 3LVRE 4NU6A 3ASUA 3GAFA 5LP1A 3DBVO 4IAOA 3Q4GA 5TT0A 4E08A 1YZGA 3E5MA 4JENA 3PXDA 4E33A 3TM5A 3AX6A 3KSBC 3G13A 3E82A 2JIZA 1CUWA 4LHXA 4KWHA 4EAQA 4EY4A 3BJIC 4BMVA 4ZVPA 3VX3A 1F38A 4HR7A 4BNWA 3KQMA 4Q7JB 4NSNA 2ZSUA 2YW9A 3QOWA 1ZU5A 4CIAA 1C14A 1XPJA 3L0CA 4PIVA 5H16A 4EJ6A 3FGZA 3GEHA 2HUNA 4XAQA 4NOMA 5DNDA 5ULLA 2F7SA 3EXFB 3T8YA 3TQFA 2C29D 4RSHA 4DLSA 1MAVA 2AWNA 1KRHA 3EZNA 3THSA 5H8WA 2P2SA 2O2ZA 4Z9YA 1VLLA 3R9XA 2VF4X 3LC2O 2AN9A 4DQDA 2QSJA 5L7WA 4NCKA 1YR9A 2VNAA 4HNSA 2VRCA 4Q4LA 3T3GA 3UV7A 3NUQA 4LE2A 4GEGA 2ZRNA 3GDOA 4CKXA 1UMDB 5CDSA 3KYDB 2GLXA 3THXB 2DBZA 2G8NA 2YWCA 4W82A 2R5FA 1T6ZA 1U3CA 2GCIA 2XCLA 3QELA 1MZVA 1L5GB 1L1FA 3S40A 4ZMRA 1RXWA 1U02A 1VFPA 3V2UA 1YVEI 3RHZA 2IZZA 3SYRA 3D3JA 1O6ZA 2W48A 4RVHA 2RHLA 1J33A 1TMGE 4UEQA 3RSGA 5CJ2A 1BFUA 5ITVA 1T5SA 1I2DA 3MS7A 4GLBA 4NZZA 1YNSA 5DSTA 1K1EA 1CUGA 2YXBA 4W5NA 2AI2A 3UB3A 2NZ2A 4RMNA 5IF3A 3SLKA 3QXJA 4KQGA 3EGIA 4NP6A 1G1MA 1VIAA 3TQTA 2P5YA 3MUEA 5CURA 2EKZA 1OF1A 2OXIA 4RD6A 1L4UA 4QJIA 4WCFC 4D6XA 3GJQA 4RWZA 2JK0A 1QGAA 1S8NA 3IBCA 4QYIB 3LBIA 1XFDA 2UZ4A 4AN4A 2ZJ6A 4Y6PA 5JSQA 1MX9A 1H2WA 1KEUA 2W0SA 2DOKA 3AVQA 2ZRAA 5AKZA 1L7AA 5JAHA 1HMYA 5KNLA 1QRUA 2HO4A 1HE8B 2HRRA 1X1CA 1W75A 721PA 1E2KA 1G2IA 3DCIA 2AHRA 2Q5LA 2E5LB 4NOLA 3ANTA 4IJ5A 2BEUB 1UBCA 4NBRA 2Q6LA 1JU9A 2CVPA 5LVAA 4I99A 5EVJA 3HWSA 3LXMA 4CIVA 1ZH0A 3SPXA 1J9GA 5K6TA 2LDXA 4I50A 1A0OA 1TVKB 5CVCA 1IM8A 2H48A 3PQ7A 1QYDA 4OH1A 2J6CA 3N74A 3QRWA 3AIOA 3KFXA 2Q5FA 3G02A 3OCVA 4CE6A 4CNQA 4XGRA 4QXPA 4FEGA 1ITZA 3SJZA 5IDXA 5LP6B 5DM60 3O2JA 4TV9A 1FDRA 1MB4A 1R16A 5TMBA 3FWZA 4P33A 2GPYA 1QTQA 1XB2A 3H7IA 4MPRA 4S0XA 4GYKA 5KAPA 4L27A 4IFTA 3DE7X 1TYEB 4FJ0A 3DO5A 3BSSA 4P36A 4KIGA 4QIHA 3CFYA 1W581 4DNQA 4ODIA 3GLGB 3NTLA 1Z0AA 4TMWA 1YK0A 5LA6B 4ZHSA 3SSOA 1TCAA 2Q3CA 4N49A 1J06A 4H16A 2RGXA 2W6JD 4IRMA 3ELUA 2O8EA 4DT1A 3T0IA 3B60A 2R2AA 2P2DA 5FT9A 2WJIA 2XVMA 3HCCA 3L79A 3K8QA 3OQIB 4MEJA 1XVIA 3CRQA 3LXXA 5ED0A 3F73A 4LDRA 3A2KA 2J4DA 1E5XA 1B6RA 1A5SB 1WZUA 1E6WA 4X60A 4F85A 3H87A 5ALMA 3I58A 2GMWA 1KI1A 3I9OA 3N39C 4BMCA 3M4ZA 1OFGA 1XQ6A 4QX6A 4LQCA 2O6HA 1UC4B 1MP0A 3UENA 4Q4JA 3WLEA 4D3XA 2NZWA 5ESWA 3REGA 3CURA 3WIBA 2LV8A 1GO2A 4QOHA 1C8LA 5D3KA 2JLYA 2PEYA 1SBTA 4ZAZA 3DZJA 5CB6A 2CV2A 3E1GA 3AM5A 3I1FA 1C7RA 1KI7A 3U2QA 2XYVA 4QDUA 3W6NA 5EHXA 5KTKA 1WKCA 3JWIA 1IAQA 1KKMA 1EB9A 4XPZA 1YASA 3H9UA 1FDOA 1S8AA 1SZDA 2H11A 2J08A 1FNBA 5EZQA 3AR8A 3FSEA 1BZYA 3R5HA 5FFNA 1KK0A 2R8BA 2J09A 2TMDA 1LBSA 1SVSA 2I5PO 3OJXA 3H17A 1Y1QA 2BGNA 2JCYA 4J29A 4UVIA 4KR9A 4ERXA 3FNFA 3JASB 5A6VA 2VP0A 3KPJA 4E2YA 4KRYA 3SY8A 2YHIB 3N7AA 2V8OA 2IOFA 2IJGX 3C3AA 1CFZA 1LDGA 4DPMA 1YJBA 4MCAA 5C1OA 1R9JA 2H51A 2R1TA 2JLVA 1S6YA 4RC9A 5EXTA 1QP8A 2XLCA 4OP3A 3IVMA 4KMOA 4MO9A 3FTFA 2P91A 1Q1NA 2O3SA 1Z6GA 5EJ6A 2ODPA 4CTMA 5JC1A 2C1XA 3QVUA 2C7QA 5K0EA 3HWRA 4LOKA 4I55B 3E9CA 4YPOA 5I7FA 1JQLB 1VC2A 4BRUA 3AUTA 1CK4A 4L8LA 3MUOA 3DGEC 3HM2A 3GPBA 4BNUA 1C8VB 4LXXA 4ND2A 2QM0A 3MTQA 1W4CA 2GCNA 4K26A 1LSUA 4X84A 5LBTA 1XR3A 2BR5A 2W2VA 4TS9A 4CM1A 1SUAA 5LZ8A 4HO1X 2HHJA 4IJMA 2FZEA 1RJ9A 4AY5A 1YA4A 4EFLA 1FJGB 4JXKA 4TXLA 1KZ1A 3TYXA 1AQUA 4G63A 3R6LA 3EG9A 4M3NA 1VJ5A 1Z0UA 2XT6A 4RS3A 1JI0A 2LVBA 5EY5B 4GLLA 2YJ4A 3TGPA 3PGLA 2ZSKA 2CBXA 3DZ8A 4GOJA 4KO2S 2ZRDA 3DT6A 3GCXA 4TL6A 4UM9B 3OJ0A 3S8MA 3LC1O 4B3CA 5LD2B 2BI8A 4NCBA 4DRZA 2VO1A 1E0JA 3I8SA 1D6MA 1T13A 4PRLA 1CJUC 1FP2A 1V26A 1L7MA 3IBSA 3NVMB 4D4GA 1F8FA 5EFOA 4MYHA 4GLJA 4EJSC 3T1TA 2QX4A 2Q6OA 3GG9A 5FBQB 2VYQA 1R0WA 4DIKA 1XTTA 2QUKA 3ORHA 5A5GA 2WUGA 3OY7A 1ULUA 1HDGO 3ZDAA 4LBWA 1XTUA 4HG2A 3T9DA 2P9BA 2PSDA 1XU7A 1E0DA 4EG4A 2G6BA 1H85A 1O6FA 4CKBB 1TLFA 2C2BA 4ARVA 2VK4A 1A95A 4RZQA 4IGAA 4E5SA 1T9HA 3IHLA 1CG6A 3DEHA 4URYR 4B31A 2W9XA 1WSAA 1DAHA 2DPLA 3QVWA 2ZWIA 4LTDA 3E0QA 4CMKA 4D3DA 4EB8A 3BRQA 5AI0A 1VDZA 4HC4A 1SQ6A 2OKGA 3QVGB 2CY0A 5FWNA 2MMCA 4Y2PA 1MT3A 3UJ7A 4WESA 1P9WA 2C8LA 3TMKA 3H3XA 3I2HA 2UZ1B 5FFMA 1VHQA 4XFKA 4EM6A 3N05A 2WJVA 5LXTA 2RC5A 2ZTUA 3EGXB 4MYSA 1CQPA 1NQAO 1VI2A 1AUQA 2NUTB 2Z98A 2ZJAA 4K81B 4NCNA 4U2FA 3O31A 3NUGA 5FBWB 4JMPA 3ASZA 3JXEA 4J0IA 4YC7A 2QTWB 3L43A 3SC6A 2OR3A 1R0BA 4OUDB 1NXVA 1DC4A 2QHXA 4RY0A 1WW3A 4AP6A 4XWTA 1U5CA 2W4QA 1FQWA 1UC8A 4FGSA 2RGWA 2QZ9A 4RXTA 4HGNA 1YVPA 1QMPA 1VPVA 3CIOA 1INLA 1U2DC 1O0BA 3OSZA 4G0XA 1TMKA 4XXHA 4BB6A 1A5ZA 1S4MA 3S8YA 4QOSA 1F8UA 1Q95A 2VP5A 3WL7A 3MAGA 1NXTA 2L82A 3VMFA 2QLTA 2Y2UA 5KNBD 3RTDA 4DSNA 1KTIA 4MYUA 1T8WA 4QYSA 4BJ5A 1ZBQA 3ZE1B 4HV4A 5C80A 2DH6A 1CQIA 3KX2A 4RADA 3U7GA 1D7AA 3Q7IA 4AJHA 3DOOA 4LJYA 1SZCA 4CUJA 1J09A 1O58A 5ALJA 4DUPA 5FR1A 3NBFA 3NBMA 4WACA 4X20A 4I46A 3D7KA 1QHSA 4PIPA 2Q46A 1EJ6A 1IQ0A 4G89A 5REQA 1CUHA 1EBUA 1KXJA 1HT1E 1K5PA 1KVRA 4N5LA 5CT8A 3UUEA 1ZK0A 1D4OA 4DLVA 1QB7A 5BN4A 4S1PA 2H4FA 5K3OA 4YRDA 3SQLA 3UT0A 1SG6A 3CLRD 2PH3A 4X61A 1VP9A 3CBQA 3DDOA 3G0BA 3FPBA 2HYIC 3WMRA 1TT5B 1PDWA 4CR6A 1DBSA 1S89A 1R9NA 1SCBA 4MMXB 3EFHA 4FS8A 3UHPA 3ETHA 2Z3ZA 3IIEA 2ZI7A 1JLSA 4L4ZA 5IVPA 3VVBA 2PUFA 1K7FB 2FSPA 2VK1A 3ZVNA 4E4YA 5FDFA 4JOSA 3BDVA 1U7PA 3BXZA 4UBKA 3VR5H 1BMTA 4YH1A 2AMFA 4XSHA 4MV3A 1G17A 1TB4A 4KTVE 4IJQA 3AB8A 4XD7A 2CFTA 2WKSA 3KR9A 2B37A 3AWIA 1HYQA 1R88A 2J6HA 1LNSA 3KKMA 2CYBA 3SS9X 3I01A 1G8HA 3G5TA 4LOLA 1A7AA 1KHHA 3OLCX 3H6HA 4LS3A 2RGDA 1ZRNA 2VNHA 4U02A 3EEIA 4LDPA 3HWX1 1ZAYA 4YJ3B 4L3OA 3GVHA 4X93A 1R8XA 2XMDA 3ZOKA 1VHWA 3TWOA 1K06A 4CM5A 4Q21A 3TL6A 3PFBA 3KU4A 2OHXA 3F90A 5BR8B 2F9LA 3AP2A 4BMNA 4YMTA 4AKHA 2LD4A 1TQHA 2GDJA 2B1JA 4KV9A 1D5WA 4TROA 5ARCA 2X6QA 1SC9A 3C3JA 1CB0A 2BFBB 2H52A 5DB4A 3VJMA 2PT5A 4C21A 1SD5A 2VP2A 1TA0A 3DLAA 4ONEA 4L6AA 1XXHE 3K9FC 3OQ6A 3R24A 3ZIDA 5E4TA 1LC3A 2HA2A 1HOTA 1N9GB 3LLVA 4G5HA 4F3YA 2R751 2O1XA 3K1TA 1FVXA 4G1MB 2GZSA 2IF0A 2QRZA 4N8EA 5E6UB 3RSQA 3TM4A 1GL7A 4JL8A 4ENTA 1FSSA 5JHHB 2ZJOA 4ZT4A 4EVRA 4G97A 4DOMA 3J7AC 4RSRA 2F3PA 4DJDC 4GPBA 4MHSA 4G8DA 5AIBA 3LUPA 3RSFA 2PLNA 1TIKA 4RZHA 3CUEF 2VJBA 3Q15C 1EJ0A 5F7XA 4NCIA 1K97A 2AMYA 3ND6A 4GO1A 2G08A 4KH0A 1DJQA 4ARZB 5G02A 3LHSA 2HSDA 3ENWA 4BVLA 2RBKA 2O7QA 3E3OA 3LO5A 1RFGE 1YC5A 2HJHA 2B94A 2OCXA 2FPRA 1IHUA 2B78A 4HDMB 4NOKA 1SXIA 3T5TA 5L3SB 2CE2X 2IUYA 2BI4A 4U0KA 4WOJA 2A0UA 1Q0SA 2G5TA 2CZCA 3K3PA 1UJBA 3HEMA 2NPFA 3ZS9A 5AO9A 2X5OA 3NOVA 5DGHA 1Z5GA 3GFQA 2BFFB 2BT4A 2HLDA 3LY7A 5FRDA 3SX0A 4D2IA 1T43A 4LYGA 4CN9A 2JZCA 4HQLA 4YDHB 2OBBA 1V3VA 3OAAD 2ZB2A 3ACCA 3VU8A 3ZDRA 3EQ9A 1ZIPA 2W6MA 3PUXA 2ST1A 4OF4A 1UL1X 3ZY4A 1C0PA 1V5EA 4MR9A 1YA8A 3I9JA 1DRWA 3OT5A 4IX1A 3U9SA 1W6RA 1QBGA 2QGNA 4S0ZA 3QEAZ 3MLAA 4INZA 1QJCA 4IX9A 5J4LA 1K7YA 1UZAA 3DA8A 3GPLA 1H1TA 4Y1RA 5MN5A 4DGQA 3AIMA 3ANXA 3AEUB 2CYAA 2IE0A 3D5EA 4ZQBA 2VYVA 1LF0A 1V8PA 1ZD4A 3JCZA 4M1WA 3ITKA 4MV6A 4PHCA 1XQ9A 2FPIA 4CF4A 1JH9A 3UWMA 2MYNA 4J16A 1QK4A 4X1YB 5AESA 1I3OA 4NYJQ 4BN4A 4DQXA 3LQ1A 1V8FA 1SU4A 4RD0A 4XLZA 1XNQB 4DA4A 4HEA1 1GG5A 3IUMA 5C18A 5EL0A 1JG3A 4FYXA 1BDMA 4XI9A 4GP9A 1VRWA 3GFTA 2BGIA 1VLVA 2QN6A 3M0EA 2G5CA 1I9CA 4HAZA 2UAGA 1QKIA 1Z68A 1M2JA 3OOSA 3LW8A 4UQOA 2JFWA 3DVRX 2B7CA 4R1QA 4KQHA 4HJRA 1T9KA 2XITA 2Z56A 1Y6JA 4P4NA 4P3KA 4JNKA 4RVNA 2MTBA 3WRXC 4M0KA 2CV0A 5BYBA 2IH2A 2PPLA 1R50A 3FR8A 4NMMA 3DXXA 4CODB 3OTIA 3H1AA 3FI0A 1J20A 1JYSA 1UINA 3II6X 1QCCA 1SVKA 4AYWA 4XA8A 1ZUNB 1KXZA 3U39A 1QO0A 2PA0A 3WNDA 4XDHA 2D06A 4F9GA 2OUIA 1LTQA 3QPDA 4OI4A 3WWCA 2QPOA 4DWOA 5EIAA 3S1AB 5B7NA 3U1BA 1ZD9A 3FLEA 1G4UR 4MV1A 3K71B 2OCAA 4BWVA 4Q3LA 4O4HF 3WL3A 4K9MA 1YQQA 1ZJ5A 3ZX5A 1GSOA 2V9CA 3I6IA 1G6HA 2I62A 4QARA 1TVEA 3IPLA 1OU4A 3L82B 3PDUA 5EUCA 5LBIA 4Z4EA 2BISA 5JRJA 1EM8B 1DJLA 2AOUA 4B79A 5HE9A 1Z3IX 1IU9A 1WUJS 2QTCA 2HQSA 2K5UA 3LBAA 3QVMA 5A4MS 2ZUVA 1YQGA 3H0KA 3VNSA 3I12A 5IK2D 1E0AA 2QN8A 4X8MA 1QWSA 2AYXA 2PAFA 3UANA 1Q7EA 4QC2A 2EJCA 4F2WA 1GAQA 4IFIA 4FFMA 3LKVA 3D2AA 3FVRA 4IWYA 1JXAA 4C06A 4DADA 1F1BA 2VT7A 3AH8A 3PFWO 4CQMD 3GLFA 2J3IA 1SKQA 4P34A 5FXMA 1GQYA 5HOQA 2E9SA 4EHHA 5HSGA 1H6DA 2JKYA 4HN2A 1KBOA 3HH8A 4AZTA 5TGZA 1HE5A 2FR8C 1MC4A 1AQYA 1BRTA 1XJ5A 3BK7A 2F1OA 2H3EA 5JSFA 4TWBA 1TJ3A 2QTVA 4E4TA 2ZVQX 4EEZA 2ETXA 3A14A 3SD7A 2HA4A 3OHSX 4TKUB 4CYMA 5ICMA 1I6LA 1NTOA 4MUAA 4EUSA 1NBMD 2JBAA 1EXDA 2ABWA 2PJDA 2IEBA 1PT5A 3E35A 4XLTA 2B2CA 3A3NA 1XEWX 2QW8A 1MEEA 2C8KA 3LK6A 4OBBA 2X15A 3HKBB 2J3KA 4PO1A 3PD1A 3UAZA 1BKSB 1P0FA 4BP9A 2H2WA 2ZSEA 3QLEA 3VNAA 2X2PA 4DRXA 5BWCA 3P9XA 1DC5A 1KH1A 4L5CA 1O7JA 5YASA 3GLGE 1J0AA 1SIBE 1F17A 1SIUA 1U8ZA 1OC2A 2NG1A 1Q50A 1UPXA 2I7VA 2Q45A 3AL2A 1BO6A 1D7OA 3LX4A 3GJ7A 1E64A 3P9QA 4HDSA 2WW8A 4RLFA 1Q7CA 1BXRA 1Y4DE 1YL7A 1BJTA 4L0QA 4LJSA 5AH0A 2JHAA 3AEYA 3NIFB 3IJPA 4GX5A 4IINA 4YMWA 2C4MA 3JQEA 1G0NA 4KVZA 5E8RA 3SAJA 2OHVA 4QICA 5JS7A 1II8A 1JDNA 2UYQA 3T5CA 4XWWA 3OURA 3CR8A 3UZUA 2I80A 4L95C 5BN3A 5HUQA 1M7BA 3TJMA 2CMDA 3B1WA 3AHHA 1N2SA 3IALA 5TF0A 4BX3A 3LP8A 3MJDA 2C4HA 3U4MA 3BEOA 2XQIA 3K9HA 3WHLA 3A4MA 3FPFA 1ZR2A 3KPWA 4WH0A 4B47A 2G9UA 4ZJZA 5ARDA 2GRAA 3HN7A 4V0SA 3R23A 1U0NA 3HKEB 3Q2OA 5JSYA 4EGAA 4HWTA 5DHTA 5T41A 5GIOE 1REQB 1JHQA 2P4UA 2VQSA 1EGHA 2V7GA 2IHJA 3CUTA 3O26A 3D8TA 4I9UA 1S8FA 3ETDA 3THWA 2H2GA 3RLFA 5CJJA 3GLIE 3U4GA 2FY8A 3E84A 3BAZA 2E6KA 2IOHA 1BEEA 1UZLA 1D5CA 3M9XA 4FOPA 5BWLA 3A7DA 5ICSA 5BUZA 3QI7A 3TNLA 4DMHA 3C3CA 1TO6A 1D1SA 1WXWA 1ZC3A 4LY3A 3TOSA 4JYZA 5LUBA 4O33A 5CFQA 1PJAA 2VJKA 3D7SA 1UJMA 1HNNA 2QVYX 4BPBA 1N2BA 3HTXA 1MOQA 3LVFO 3PFFA 3TLGB 2CL0X 1P62B 4Z7QB 1H4TA 4DY6A 2GXSA 3GT7A 1E1LA 3AI2A 2PKCA 4AY6A 1U1DA 4ZVUA 4HLUC 2OHJA 4EELA 1G63A 4QWMA 1A9OA 2OZLB 2PRIA 2RHOA 2IS6A 3L1VA 4MS4B 4ZCQA 3RTBA 1ZSYA 2VUSA 1VHDA 2H2DA 2XDQA 4F6RA 2XQFA 5I4BA 1ZD2P 2JI7A 1Z8DA 3PEUA 4HMPA 4O4LF 1DB3A 1V11B 2C5HA 2PU5A 3JQ7B 5L4SA 4KKXB 5FBHA 5THKA 2FK8A 3NT4A 1NT4A 5B1HA 3BWEA 4M2LA 3FLAA 1K4KA 2Q2VA 1JV2B 1C0LA 3AONB 1PHRA 4MLDA 3VDQA 3ABIA 4O1IA 4OSEA 5JSZB 2JIQA 4GHWA 3X1DA 2WPDD 5DBIA 2BEWA 1KO7A 3ZGNA 4JFRA 3DHYA 2IQ5A 3G59A 3L4BA 3LUHA 1VG8A 5DKFA 2XCUA 2AKAB 1TGYA 4IIEA 1NA5A 5JE8A 4KAXA 3R0QA 4IKOA 2F3TA 3O6VA 2AVNA 3BWXA 2VZ8A 3QTTA 4KYIB 4M4SA 1H2EA 5GJBA 3DZBA 4WKBA 2MYPA 3DR3A 5ALSA 3CUVA 2NVUB 3ILYA 2CZQA 4K6KA 4NPAA 1E6EA 3CF4A 5PGMA 3UMGA 5EWJA 3T7SA 3AY7A 4LXGA 1IXYA 1P9NA 3NOOA 3MYYA 1SCQA 4F4UA 1IN7A 2H1LA 2XYHA 4GDMA 3RUFA 2PUHA 2V3VA 4YTEA 4A36A 3INYA 1OC4A 5DW3A 3E5NA 3RQSA 3GRAA 1SXJD 1QUFA 4YFVA 4ENVA 5IJZA 4DZRA 4NXMB 3NJ8A 4LI0A 4BVAA 3OF3A 1BDBA 2HQOA 2YYAA 1AG9A 1VM6A 3DW3X 4QFMA 3L8YA 1R9MA 5DASA 2LZ0A 4NWIA 3B3JA 4PPNA 4QU8A 4XSGA 2B0CA 4M55A 2PZJA 4ESEA 3NDJA 5BSFA 4GG1A 1UKYA 3KYCA 1K8ZB 3DEIA 4BGEA 3WRYA 4TT3D 3F7NA 3CUUA 5BW4A 1GN8A 3MFYA 1V3QE 4LAFA 3BK1A 4MCIA 4Y9TA 4EA7A 1GFSA 2ZE6A 4UVEA 1WMBA 4LJ8A 1IZ9A 4IDGA 1ZGHA 1V47A 2OXTA 1I33A 2FKNA 3AF4A 2YJ5A 4Y0VA 4ETIA 4DUYB 1C4KA 1DV2A 1ZUHA 1C9NA 2OFPA 3FY4A 5DIFA 1ZHFA 2FWAA 1U6KA 1S5PA 3IOCA 1U8CB 3IOEA 4ZCSA 3UHOA 6YASA 1PEKE 1VL2A 3FVTA 1GPYA 2QYOA 1RWPA 2QLMA 3ETLA 4FIDA 3RWMB 3LJKA 1M5RA 4R7TA 2CUNA 4JN6B 4N0MA 3UWKA 1GQFA 3DONA 2CMFA 3OKFA 1MLDA 1GDHA 1QIKA 2B6NA 1GTG1 1DWUA 2HJGA 2HT6A 3BXXA 4K28A 4KLZA 2VP3A 2WDPA 3FHLA 2QRNA 4FC7A 4AFNA 5DOVA 1Y3BE 2VPQA 4H31A 4N3GA 1GQSA 1VLHA 1OI2A 2V7QD 2Q28A 2VZ9A 4MO2A 2WZBA 2FZ4A 3L7NA 2FPKA 4H7KA 3SC3A 5JAPA 2KLBA 3T4PA 2D0DA 1GNVA 4BQFA 2V6FA 3TLYA 3BL5A 3WIOA 2QU7A 1ZC4A 5DLQC 4V03A 5EJ9A 3CSDA 3KHTA 1P5JA 4Y9SA 4XVUA 2PA3A 4UE3S 4IYJA 2FPGA 2HOQA 3MMZA 5KWEA 1P4GA 1GIAA 2I8CA 2Z30A 4YT5A 5C8XA 3PR1A 1EJBA 2GASA 5F7JA 1H93A 1T9CA 2FWIA 4WXPA 1QGDA 3VR6H 3CONA 1ZVVA 3EIQA 1MVNA 1GAJA 4Q7MB 2EZ9A 3ZIAD 4B81A 4BRSA 4DUGA 3B6KA 2OCGA 3GUCA 5JI3E 2IS4A 1DIBA 2O50A 2AN3A 3M9WA 4RNCA 4D97A 1LX7A 1C0EA 1CQWA 1S2DA 3IGFA 4EEKA 2GKGA 5EE3A 2CMKA 5F78A 2JG3A 3NXSA 2ZIZA 3WYDA 1W4LA 1HDXA 1RM0A 4QU0A 3V48A 3GI1A 1RWNA 3CVXA 2XSZD 2IYSA 4PW0A 2ZTLA 1U5BA 2PQ6A 1L7XA 4N9WA 1Q0QA 4PHTA 5FTNA 1KHTA 2NZVG 1Q1ZA 2KS6A 2OCBA 2X2EA 3U19A 2XIQA 2KQUA 2O6LA 2A9RA 3DMPA 1DAFA 3HFSA 4HEQA 5C8YA 3UH1A 3QLVC 2XE8A 3EPRA 4R8KA 4QOEA 2P4EA 1WUKS 1JRLA 2RH9B 3W7BA 2FPPB 5A7HA 1M2HA 1YZQA 1GRVA 4FMCB 1DFIA 4QGSA 1XZIA 3EZLA 6ADHA 1URPA 2YMMA 1ZD1A 2I1VB 4GVPA 5ICGA 1W0JD 1VG0B 2IOQA 2Q5JA 4MHTA 1Q22A 3PPIA 4JFAA 4JI4B 3D4IA 4Z0HO 3OZGA 1V5WA 1A76A 3CTMA 1LRJA 3QEJA 4Q4AB 3ST7A 4Q01A 5KOHA 3PFIA 1KOGA 2BH9A 3AY6A 1X9IA 1R00A 3EXHA 1UAGA 4I5FA 5CEEA 4BQNA 5L6LB 1ZRSA 2PSJA 3ICOA 4LV6A 3L7LA 4KMRA 2QN7A 2R8PA 1E98A 2WHPB 2XBMA 1J25A 4PLZA 2YOHA 4MUJA 4OXKA 2EF1A 3TFQA 1OYOA 1A2QA 2FUG6 4GOXA 2FXVA 1EDEA 3AB3A 1E6UA 3R3VA 2W6OA 3M81A 1T4MA 3HG7A 5BN5B 4MWZA 5CVUA 1NVEA 2P3SA 1Z4IA 5BV8A 2I91A 4RV9A 3ENQA 1Z82A 4C78A 1K3TA 5BSKA 5J2TA 3G2IA 1Y7HA 3QUAA 3C3WA 4WNIA 3IEMA 5I7SA 2G63A 4QEZA 1NJ6A 4YJHB 4FFBA 4M1TA 5ALEA 3W9UA 1XVAA 1LDYA 1Y8RA 3RADC 4EOGA 3GCDA 4I2NA 1Y8CA 3RSLA 1GCUA 1MAHA 2VXCA 2FZLA 5H3CA 5EZYF 1TXGA 4OJQA 2X5KO 1QDUA 1GL9B 2G80A 2Z8ZA 2HGSA 3H2KA 3P8ZA 2JIZD 4PQYA 3O8QA 3ZU3A 1QHIA 1XCPA 2GEUA 2H16A 1RABA 2LNDA 3EZGA 3KB6A 5DM0A 5FBLB 5LFAA 1U3VA 1Y48E 3SF8B 2PRYA 1RC8A 1H8EA 5CA1B 2J6IA 3JVEA 4WZBB 4RTSA 4DV3B 3HVUA 1OFHA 1A9ZA 3CLVA 3KDAA 3CE9A 4GMFA 1CC1S 1VKNA 4NFLA 421PA 3F6SA 5TRTA 5AVUA 5B4UA 1T25A 1Z9BA 2BEVB 4FNAA 1H2YA 3DMYA 5C32A 3ER9A 1QE3A 1M6YA 4L57A 3QXSA 3L4EA 3WWEA 1U0RA 1Z08A 4PQRA 3BXPA 5EXEA 1U7XA 1DTWB 2P3LA 3QLTA 2VJPA 5FNZA 5CDFE 2OO5A 2LCIA 3I2IA 1W4ZA 4EI2A 1U0HC 3DAPA 5AW8A 3IOBA 2VRCD 3GGSA 3IE0A 2ZRFA 4FDMA 1I5RA 4NULA 1WG8A 5C5EA 1DCTA 2CKMA 2M9MA 1CRQA 3K4HA 3C7KA 4HCJA 5CTAA 1P2DA 1O9BA 3OPNA 2GZRA 1QO9A 1C9KA 4F5EA 1YCFA 1HG0A 2FSSA 1FQKA 2H59A 4JUFA 1WOYA 4AMGA 5B4TA 5KSYA 1YIDA 1USGA 4L02A 3VV3A 4C03A 1VL8A 1F6BA 2D2EA 3TR0A 4L0CA 5FBZA 1U4SA 1DQZA 3C7TA 3Q88A 1FTSA 3L7JA 2VDJA 3JQ8B 3T9EA 4NBTA 4A2QA 2OP0A 4DLBA 1YKFA 1OUMA 1ZOIA 2B61A 2XX3A 4ECAA 3CJQA 3FYCA 1FPQA 1X86B 1V4VA 2I6SA 4RS4A 4YAWA 3BX1A 5DBFA 4W5TA 2IS2A 4TRJA 3CF4G 3UUWA 1KOFA 4XWYA 3GROA 3TIXB 3KD2A 1GDTA 2W90A 2WLSA 5JYEA 5CH3A 4CEIA 1XJ0A 2PSFA 2HM7A 4OA5A 2IW1A 1MT0A 1P3DA 1FFBA 4N6NA 4BLPA 3HUFA 3ZVMA 4HQRA 3TPCA 2O0JA 3THYB 3H2YA 1W7AA 2QQGA 2OXCA 1YE5A 1CZKA 4GZLA 4MW6A 2HXYA 2VAPA 1I2MA 5AVKA 3NTQA 3Q87B 2AOTB 2GTPA 1OX6A 3BGDA 5IW8A 5I7OA 2I99A 4KYTA 4R0MA 3JWEA 1JLRA 3WNBA 5I8WA 3F6PA 4Z9FA 1O2DA 5FPPA 2XVXA 1S02A 3LPLA 5BMVF 4Z4CA 4AKGA 3L7KA 4YJ2A 4CLXA 1QM5A 1U8XX 4GBMA 3KALA 4NBNA 4OQLA 1A8IA 1DUIA 1NVWQ 1R0LA 4IJWA 1JJIA 4I1UA 1PWXA 4ENUA 2I2AA 5FOXA 4W9NC 5ALPA 2NQ8A 3ZS8A 3K0AB 2AG8A 6PFKA 3K05A 3DAYA 3KOUA 4M0UA 4O1HA 2FW9A 2Q3JA 1QS0B 4OQFA 1VDMA 3R0IA 1GRRA 5AI5A 2LPMA 5C2JB 2C7PA 4A8JA 4Q3KA 3HY6A 5D51S 3TLZA 5AM1A 4KFSA 3SDSA 4DMKA 2OD2A 3N8IA 4RELA 1S01A 3DNFA 4M83A 1IDOA 1XDZA 2XUKA 1YZVA 2HMWA 2CJWB 2W2LA 4BY9E 4B3GA 4D42A 5AOBA 3VTAA 1Q0UA 3GAMA 1XF1A 3OIGA 3H2BA 3V8VA 3M6FA 2JFFA 1SHLA 3HCAA 4OGLA 3DTVA 1Y37A 1RIFA 1Z38A 3B9QA 3NTUA 4DLNA 2F62A 1JA1A 4Q3AA 1J5XA 2JFVA 3NNDA 2FEAA 4XWOA 3WI7A 3VKHA 1EB8A 3FUTA 1Z5PA 5ESDA 1U0JA 2G9VA 2PT7A 3MBKA 1XD2B 4OQPA 3BMQB 3AF6A 1HNXB 1L5RA 3NNNA 1XZKA 1SWVA 2KWIA 5CYGA 5HM8A 5CBKA 5CXUA 1SU8A 4BMYA 4ZVQA 3JQRA 2TMYA 2IUTA 4CMEA 2VRNA 2QX6A 3WGLA 4AUMA 2BCEA 1ORRA 3PQCA 2YV5A 4OEHA 2ZDQA 1BKDR 3DOIA 1LPBB 2YIMA 2A57A 3KCNA 4CDMA 5L40A 2A1TS 1DC3A 3AEZA 3JTEA 1DRVA 1YS4A 3OHPA 4OD0A 3C6ZA 3U7HB 1F7VA 3IPAA 1HRDA 4UZEA 1OLUB 3BL8A 3N70A 3DDNA 1P61B 2VNSA 3FPEA 4FQ5A 4XB1A 1XZEA 3LAWA 1FUEA 1AKRA 1XDBA 4JB2A 2LR0A 1E7YA 1N6LA 4H77A 2X2FA 2ZU6A 4JROA 2EL7A 5DHQA 5FI3A 4ZDWA 1RU3A 1W88A 1ZGBA 1ZICA 2OORA 3K7EA 3GQBA 1TGVA 2WD9A 4Z49A 5KTNA 5EHZA 5CLQA 4F4DA 1VLJA 5TMPA 1JR3E 2HNBA 4BLSA 1OH6A 1ZQ1A 2BKUA 2D8AA 2Z4SA 2VEDA 3A58B 2IT1A 3W5VA 1P19A 3PQ5A 5K99A 4BJ1A 2WYIA 5JVDB 4HL6A 5IYZA 1PJQA 3HB5X 1XBTA 5JC8A 1S8OA 2V0CA 1ECJA 1VL1A 3WGHA 4Y7DA 2ZW9A 4I4TF 2GFHA 3GELA 1OW3B 3DT8A 4FILA 4H6PA 2IW3A 3I30X 5EP4A 4HH1A 3WQRA 4EBFA 4CXMA 4DC1A 1T4DA 3IJ5A 3W90A 4AKIA 1YRLA 1CTQA 3FDJA 1HFJA 2IUFA 4BFSA 3RUCA 1F5SA 2V55B 5ER9A 3RU3A 3BZBA 5HZGA 3V8NA 2PR7A 2GJSA 1IBRA 1YUMA 3PQ8A 4IJUA 5KYWB 3TNJA 4RZ2A 2V7BA 4KVFA 4M7RA 5AW2A 1ZCAA 3A6FA 1ILEA 5DM70 3FCCA 1LX6A 1Z28A 2OOKA 4HDNA 1GG9A 1RLMA 1TW3A 2WIBA 1EGMB 1DPFA 2SNIE 3RV4A 4HFNA 4F5WA 1I14A 3EDYA 1CUIA 2OTCA 4ZI7F 3ILXA 2EEPA 3D3QA 3TX2A 3ZEIA 3Q7RA 1TIPA 3UATA 4F6CA 3DE5X 4R1PA 1NWHA 3QHQA 3H5TA 4WJZA 2VJQA 1RACA 3OD1A 3T1VA 2AR7A 4F9EA 5KSWB 4IRUB 4BNGA 1ZN7A 3IDQA 1S1MA 3OSUA 4M9UA 4MA5A 1NIJA 2BMDA 2NV6A 2NU7A 3M6WA 3TJRA 1J9ZA 2YHUA 4IG4A 4RANA 1FRZA 1WIWA 2GN1A 2R6FA 3OIYA 4U9HS 2WMNB 2AQHA 1BWRA 3OZXA 1IXKA 3PR3A 4HDQB 4TYNA 4GICA 5CIWA 4EHDA 1VE7A 2R1UA 3QG5A 2ZZKA 1Z4MA 4HH0A 2PUGA 1D2MA 3IKLA 1RFLA 1DCMA 4ZALA 1SQSA 1KAEA 4IHAA 4NJEB 1ZVKA 1FIUA 3KVOA 5A4DA 1GKYA 3VM6A 2YC4C 2O2IA 3FDIA 2QTMA 2BZSA 4A6EA 3D4BA 3LT0A 2OAGA 3EGOA 3D3EA 3CE6A 2CBGA 4KNVA 5LQNA 3I37X 1JPJA 3VR1A 1UMCA 2GN9A 2NO1A 1OKKA 3LQQA 2ZQ5A 3A1SA 3W9YA 1GZ5A 4DC9A 4PFKA 3UQZA 4DMLA 1DOAA 2DEUA 1MB9A 2X7XA 3AU9A 1K7SN 4DWVA 2PO7A 3QLUA 2F3UA 1L4MA 2WAOA 4RQAA 1Q7GA 1XJCA 2E4YA 1SFRA 3DMRA 4DCPA 1CXZA 2WTEA 4V2UA 4MRMA 4DR3B 1ZMOA 4KXQA 1WP4A 4KKVA 4GPD1 1WS6A 3NC0C 4QTZA 4HDRA 4LCJA 4A0SA 2XMRA 3ACDA 1U0FA 2NTJA 3B8HA 5DNWA 1UOPA 1BVUA 4K6FA 3LL4A 1ISMA 1OWPA 2V97A 1U6IA 4RTNA 4CUKA 3UAGA 1EE9A 2CLFB 3ETEA 3RFVA 4TVOA 4UNSA 2BFCB 5A5EA 4O3MA 4W1RA 3QKRA 1WZ2A 3FH0A 2R00A 1GKLA 4YCSA 2B7LA 5BRAA 4XIGS 3MJSA 1OGIA 5ALOA 3VDRA 5FOVA 1VSUA 3H2IA 4GE3A 4QLOA 1RM4A 1UMKA 1YBVA 3UWOA 2GAFA 1AUVA 4CN8A 4E5VA 5EWLB 1P0QA 2C4TA 1DXYA 4I3FA 4RHCA 4RPHA 5B4VA 3AHCA 4H4EA 5A2QA 1CDDA 1M1NA 4D9FA 4Q3CA 4CM4B 1PFWA 1TZKA 3KLOA 3JW8A 5A0TA 1I5OA 2IQIA 3SQXA 4XRRA 3QEMA 2EOAA 3QMWA 1ENOA 4GPAA 2VTEA 3F78A 2QBYB 1Y7PA 4BO0A 4CCYB 4NESA 2WB2A 4MARA 1M34B 3EISA 5J59A 1WE2A 1GCAA 2E4UA 2G28A 2YFQA 2GETA 2AFVA 2WD7A 4BN0A 2V5VA 5FL7A 2QL5A 3UGKA 3Q5DA 2OENG 2YNMA 3BYZA 5CGQB 4B4WA 4D9KA 2H1IA 2WQ6A 1Q1GA 3HEAA 1RWVA 4YJDA 2H0RA 4MJLA 3ON5A 2QS9A 1B23P 2B82A 1Z56C 3PQ2A 4MEAA 2AG0A 3OFJA 5E38A 3RJMA 4E6EA 3KL2A 1D2GA 3VXKA 4FXOA 4XD7D 2DXIA 1P5RA 5GOTA 2XMCA 3ADPA 3P52A 4G4GA 3ENNA 1A8HA 1DBIA 4X95A 3SZMA 3W5UA 2RHGB 2WEKA 1SUIA 3KTDA 3BD6A 1K2WA 1T2NA 3SZGA 1IEWA 1F0YA 3R3YA 1TAGA 2CD9A 1XRSB 5FNVA 2YWXA 2YV1A 1MC8A 4BB9A 2DR3A 3K9LA 2FX5A 2NGRA 1E94E 3CIFA 1OSNA 5K8CA 3DHVA 4KJZA 2O3TA 4YHHB 3PEFA 1MNAA 3U3ZA 2OWDA 4ITRC 4W9RA 4E5KA 3O4RA 2O8FA 3E1KA 2IFTA 3G0GA 1LXCA 2JVJA 1QP0A 3E70C 3SBOA 2C9BA 3TLXA 1NI5A 3UFXA 2POQX 1QHNA 4QJBA 4TQAA 4RTJA 2ORWA 1QF9A 5FUYA 1FLAA 4LF4B 4EB6A 3A28A 1NG1A 1FRQA 2Q8QA 2RKBA 1YJCA 2CHGA 2AW5A 2JB9A 3T1HB 1OB2A 3UJDA 4JI6B 1QU2A 2IEAA 4Z2YA 4Y2JA 1GGMA 3ESYA 2KBEA 1P1FA 5IJXA 3JD0A 3KD3A 1G18A 4HMOA 3KZXA 2VHCA 4ER3A 1XK7A 3MJHA 4TV8A 2JBWA 1JHVA 1BE1A 1T1JA 4D0NA 4EPYA 2WHYA 4N0EA 3I0MA 3LECA 2BFWA 4EHFA 4UHEA 1XMIA 4CGYA 4XARA 3CPEA 4TS1A 5CBPB 4ZODA 2ZCVA 5FFFA 1OGJA 3AVOA 2EC5A 3P9NA 3F6CA 4PZEA 3AR5A 3QPAA 5DYWA 1EAYA 4RYDA 3S7TA 3WGIA 4B6RA 3H11B 1CS0B 1FOEB 4YT2A 2PX6A 4GM1A 3CZ5A 2C3OA 3DO8A 4QUGA 1PL8A 2QX8A 2BEKA 1ELOA 1X1DA 5H9WA 2HJWA 4PG5A 1UBLS 4U7JA 2FETA 2XRYA 2HDWA 2VNIA 4FFRA 1DSSG 5K09A 1M0WA 3JQGB 4EH1A 4H1HA 9GPBA 4P0QB 1JNYA 1HDIA 2E49A 3HGTA 2HLDD 1Q0ZA 3LGAA 1WCYA 3TKAA 1I01A 4PCVA 2GJAA 3EARA 4DJTA 1KK1A 1QYIA 3ZVKA 1EWKA 4HATA 2D59A 1V95A 4LV5B 5TEWA 4LZJA 5CH8A 1ZH4A 3PF9A 4KQKA 5FBRB 3T4XA 2I6TA 5CG1A 2GCOA 3WMEA 1W6UA 3FETA 4Q6WA 5CCXA 5K3EA 4XD2A 5AJHA 3WK4A 2FSVA 1ORVA 3ZZNA 1EDBA 2ZRPA 3DP7A 3F5QA 3HFGA 2VHTA 4WZBE 2DCUA 3DMGA 1RRGA 3FCXA 3IHKA 4HAVA 4DMMA 3HKCB 3WIEA 2VYVD 5I4IA 1WQ1R 1RCUA 3A06A 5E1BA 5G0VA 3RRZA 4A6DA 1G60A 3GRFA 5IKEA 2QJRA 5B7QA 1F2UB 1ZOLA 1Q91A 2HIAA 2PUVA 4DYVA 1M10A 1A5BB 1OIVA 2CVZA 2ZREA 4RLQA 4L6IA 4F8YA 4Z4GA 1TZCA 4JBLA 2F64A 5CU7A 4AMYA 1DX6A 3E8XA 1POWA 1IVYA 3P5SA 3ZDYB 2NT4A 4RTKA 3PEYA 3U4CA 4FFDA 2PRSA 4GZ3A 3AO0B 3I0ZA 4JGGA 1F3LA 4P4LA 1PG0A 1YB5A 3BC1A 4PWZA 3FBTA 4G9EA 3WGJA 2DERA 5E1DA 1DUVG 2QQ5A 4D9BA 1U98A 2CDAA 4LX8A 3KLBA 4EG3A 5CEJA 3LS2A 3L06A 3WVNA 4G5XA 3H5LA 1XXHA 2B9VA 4IXMA 3OFVA 2FRDA 2PS1A 4OHFA 5HIAA 2JAHA 5D87A 5SY6A 2QUIA 5TB5A 4YRIA 2AS0A 4LYYA 3UXHA 4AU1A 1H23A 1E18A 4H3HB 5A9SB 3BULA 1QUEA 4RIHA 1V5GA 3A10A 2VF8A 4NDAA 1T1SA 2PBZA 5J2UA 4G4IA 2GERA 4G1FA 2XTNA 1EQAA 4XLLA 1JB1A 1QO0D 5BV7A 5TE9A 3FD8A 1KZ4A 5I51A 3W6OA 3DVAA 1E5LA 2VP6A 1DIGA 1WLYA 1EFPA 4JLAA 1LLCA 4ZK6A 2YCLA 3ODGA 4WK6A 2G7ZA 2LDBA 2QGZA 2FJPA 4UHFA 3AJDA 1N6IA 2ONZA 3K30A 5CNKA 3SHOA 3Q10A 2Q6VA 2BTQA 4LDAA 5EJFA 3KQTA 1SOMA 2NSLA 2O2HA 4D8YA 1DG9A 5HNKA 1QWOA 1TF2A 2QTLA 3D7LA 2A1TR 3SHFA 3U7JA 5LNK1 3HXQA 1YGYA 4GWGA 2OHHA 4GBGA 1RPTA 2HNAA 2ZB4A 3DUFA 1WWKA 1JSXA 1VCNA 1U7TA 1W87A 2AQ8A 1Z5UA 2XADA 2XVZA 3GT4A 3KJQA 5BYJA 1P1BA 3W3AH 5AW3A 5T8KC 3A3OA 4HN4B 4UAJA 1GVHA 1VRVA 2O8VA 4OX9B 2HCBA 3JQDA 5F5NA 3LY5A 5K6AA 4FWBA 4FTWA 2IHNA 3M5WA 1GZVA 2AXPA 2XNCA 5EJ5A 4U0JA 4JEMA 4MV5A 4US0R 3RSZA 3SQOA 3LT1A 4NV1A 1IJFA 3DBOB 4YIKA 3VDMA 1P3JA 2DLDA 4UEOA 4B33A 1GNTA 1CE8B 5B6PA 3P0JA 2QUAA 4IIBA 5EP1A 2EG5A 3EXFA 4HNAA 1GKIA 9ATCA 4QGGA 5BUSA 4R2JA 5J40A 2OXEA 5JMPA 4YRSA 4MRPA 3OLVA 3NWPA 4EG7A 4IDOA 3DQZA 4FK8A 1JDZA 2FOLA 3OFSA 2YHBA 1TM5E 1E9RA 2B2XA 3WC4A 3WWOA 3R20A 1H9AA 3SLGA 1AKEA 4QRDA 1HORA 3G0HA 3LDGA 1BXGB 1UMDA 2VF5X 2CXXA 3KYDA 3A4NA 1XMOB 2A2ZA 1DMSA 3D7NA 4MVJE 1MW8X 1V45E 1SUSA 1E9FA 2E4XA 2EFEB 2PFSA 3ZV6A 3GJSA 5AM0A 3OEWA 2QMUA 4ZHQB 5KC8A 1YMVA 4QU9A 5EJ4A 3QVVA 3JQFC 3S7ZA 3R6GA 2VQFB 1TYBE 3KOZA 2PH7A 4NFHA 3GF4A 1JR4A 3ITNA 2H08A 3QFSA 3TLAA 2P2CA 1IOWA 1X0XA 1IK6A 1LPSA 3L0PA 1JTVA 3NLLA 4FLMA 5C5CA 3O83A 5DX1A 1SOUA 1IY0A 3L04A 4EHIA 4COKA 2VYNA 2P2ZA 5BRJA 4UULA 5AW7A 4LN1A 1B3BA 4MEBA 1G8GA 1OV6A 3H75A 4LX0A 3UK7A 2FZKA 3G0IA 4LYAA 5F23A 1KJZA 3P0HA 2F9FA 2EG9A 2I1WA 3BJMA 3JWJA 4Q1BA 2B1QA 3IAM1 4QYIA 5A6SB 1FLVA 3S6JA 5JT1A 1B8PA 2BGWA 2IBSA 4TMYA 4IM7A 1CNFA 1LFDB 5HE8A 4DV1B 3A4LA 4INOA 2Q62A 1EKXA 4UTPA 1JA0A 1CIPA 2FWRA 2WJWA 3EIXA 2ID8A 3D3WB 4F4FA 1MABB 2J59A 2RHJA 3FJYA 4MLPA 3MG9A 5GJWC 4AG6A 1KAGA 3VAYA 4XIYA 1E1CB 3GNSA 3JYNA 1T1RA 1Z4KA 2HJ9A 2YH2A 4F5YA 1MJFA 4YJKA 1W1UA 3IMGA 3SNKA 5CRIA 1KZGB 4F1WA 3TZCA 4X9XA 3C5EA 5JWOA 3EULA 4HH4A 3RTGA 2ILVA 3LWBA 1G8JA 1SZPA 4XSVA 4X1IB 4BNKA 3DPUA 4UUNA 4Y9RA 3CEHA 1L1QA 1OLOA 1TJ4A 3CNHA 3VPXA 3PFHA 1KY2A 4XYGA 5LP6A 3ESRA 3IUEA 4UCFA 1RRMA 2VS1A 1PR9A 1EP2B 3GDGA 4M0FA 2HWWA 3RS5A 1UC9A 4OKNA 3PSHA 3UGJA 2PBLA 1FFHA 3ZCRA 1YZKA 3C4JA 3HBLA 2G4VA 4NH4A 5A4JA 3QJGA 2FX3A 4MWEA 5CK5A 3CNEA 3TEJA 2PGNA 3V8EA 3VHRA 4D80A 3HYRA 5E6SB 1FJHA 2WFLB 1AK1A 3GLGA 3QMVA 4GIBA 1K88A 1IQPA 1RHKA 1F20A 1R8YA 2BHLA 3FG9A 2V74B 5D8DA 5LA6A 1YRYE 3FCOA 2QENA 4BZPA 2JLCA 4AMUA 2PJUA 2J9XB 5A7GA 4Z54A 4ROSA 5HOEA 1JWBB 4TVBA 5B3LA 3O1JC 2F55A 5KNCH 1JR6A 5LDDC 2Z8YA 1I5EA 1F9EA 3GHYA 3KTAB 4I9FA 3RVDA 4H3SA 1QB8A 4YP1A 2P9FA 2ZROA 2RIRA 3CRRA 1I4DD 1CETA 3IE2A 3KAJA 1BFDA 3R09A 4JQOA 4MPDA 4REOA 1BJKA 1XT6A 4IWNA 5KYUB 2Q1TA 4ZPXA 4YMUA 2RC6A 2RJOA 1EQUA 4YRJA 2RFLA 4U8HA 1BIFA 2QL6A 4G0PA 4NZNA 3O74A 2ZSIA 3OPVA 2XMPA 1LSOA 4XB6B 4DDWA 3IAS1 3OM0A 1UXHA 2W98A 3RSOA 4MGIR 2JEZA 3I73A 5GTDA 3OUTA 8AT1A 1HDZA 5AW1A 3O8CA 1D1QA 1GGHA 2ONCA 4BMOB 4PLVA 5BWMA 4QGAA 3LTNC 4EKNB 5K3FB 1A4IA 4JP8A 5DLPA 4EFNA 4J1SA 1G9TA 4JT9A 1ZAKA 4FYJA 4HX5A 2JF0A 1TQ2A 3FFTA 4RDHA 1VGVA 4WE3A 3D2CA 3WNVA 3I32A 3WYCA 4LMAA 1GZ6A 1N5JA 2FP4B 1ZM2A 3QLJA 1T4GA 3JASA 2VHYA 1SHZA 5G0TA 5C1IA 4BFVA 3W2GA 1CJVC 1OHHA 2GUWA 3WLLA 4EB3A 2HA6A 2UXCB 4S1NA 3B89A 1NVTA 2ZZMA 4IXNA 1I6MA 5B30A 4OQEA 1T3GA 2Q49A 3CHYA 3LPCA 2O14A 1W4RA 3AJ9A 5JAZA 3FSJX 2OBNA 5CT5A 1S9HA 2ACEA 2H17A 1QDEA 5D00A 2X58A 3E03A 2FW0A 2OK7A 1EP3B 3D81A 3MT8A 2C1EA 3N8DA 4I55A 4WXRA 3DQQA 4RKRA 4F0JA 1G38A 4G0WA 1C50A 1JKMA 2DG2A 2PMKA 3ZBQA 3D8UA 3I4FA 5A3QA 4G24A 4CPDA 1GUDA 4ZU1X 1R12A 2GR9A 4E30A 1XGKA 2QMYA 2JGIA 5C8DA 3MWFA 2JJYA 5JECA 2RAPA 1O4WA 4DUGD 5K0TA 2AOVA 1PUIA 3JZAA 1H6CA 3AESB 4IVRA 5FYDA 3V7FA 3HO6A 4B46A 5K3BA 4M98A 4XX1A 5DWVA 5AXBA 2HN9A 3EVAA 2Q4DA 4O25A 3VKVA 4L75A 2YMQA 3MCAA 2YTZA 4LBZA 2OXFA 5CX1B 3RRXA 1OXMA 4M1KA 4ZMSA 4MWOA 1Y4AE 4ND6A 2F8SA 2J5QA 4AJIA 2P9HA 1F0KA 4BLUA 1O54A 4UDXX 1DQPA 3D8BA 3G88A 3HP1A 4FZRA 3IUNA 4H4CA 1T3SA 3Q8WA 5FUMA 3EPHA 1EX7A 3E1SA 4QVGA 1ZLYA 1ZYUA 3F71A 5EJIA 3ZY2A 4F4HA 3PXCX 4BTVA 3FA2A 1HQDA 1J9EA 2FP3A 3HXTA 3UGTA 1BROA 2HCTA 5KS2A 5ALDA 2BTOA 1M34E 1YZYA 2VDPB 1MVOA 3AUKA 3UB4A 1F1JA 3WJ1A 3IP1A 1E2FA 3IULA 3TSAA 2ZI6A 3WK9A 4OB6A 3LX6A 4TXHA 1EFRA 4FKBA 1P2VA 3EBPA 2ODEA 3RVSA 5BQPA 1IPEA 1QJ4A 5U1PA 4C5BA 1MV8A 1HDOA 1AX9A 1U7WA 3A1VA 3DC2A 4K9LA 2HJSA 4MAFA 3L6UA 1BWQA 1EM6A 3ILVA 1ZKDA 6ABPA 1I0LA 1YR8A 2RBGA 1HDYA 4J4BA 2Q7OE 2WWYA 1BQEA 4M53A 1B15A 2WNHA 1GUYA 4MKRA 4TMTA 3MJVA 1VYHA 1T2FA 2XUQA 1QIJA 4UTNA 1SVMA 2QRJA 3EB9A 4Y6LA 1GY8A 3LOPA 3WE7A 2HU2A 2VHUA 4CQMB 1GLGA 3T61A 1VG1A 4LSGA 4QHTA 1YIOA 1NBOA 3LX8A 2NP6A 1XN4A 2UZ1A 1HT2E 1KU6A 2OESA 3DULA 3BL6A 3RODA 1IY8A 3EGXA 3P0IA 1Z0KA 5KOJB 3FROA 3QG1A 3KQHA 1Z2NX 4UXHA 3KE9A 3SE0A 3OCJA 2WHXA 4OUDA 2FW6A 4TLLB 3E22B 2FPMA 3P26A 4FMDB 2WG2A 3N75A 4HLQB 4LBYA 1KPGA 3U1TA 3ZQ4A 5ELLA 4FDLA 1XNHA 5IKPA 5HW0A 4JX8A 4PTYA 1OI3A 2Y0PA 4X24A 5AXAA 2VQEB 2IYYA 2VWGA 4DWWA 4B0OA 4NJMA 2OC4A 3BRWA 3ZWAA 1U7UA 4LVOA 4F3KA 4MIYA 1PNQA 3K9CA 3WYFA 4DQLA 4OGGA 2ZJ0A 3CMMA 3ZLTA 3KRTA 4K46A 4PXAA 3ZI7A 3P2KA 3W8DA 1MTOA 2IXEA 1AA9A 4I1SA 1B16A 4OHPA 3BE5A 2Q1WA 3N8GA 1Y8ZA 4FR0A 1L7NA 1XEXB 2GGSA 1I4EB 4RA6B 4RVFA 3FNQA 4YXWA 5LLDA 2A0XA 3I62A 1H8ED 4EUNA 1I51A 4MINA 4FU0A 1E77A 1UK8A 4K6HA 3JV7A 5CIYA 5CFNA 3V4LA 1L4FA 2H6EA 2XQGA 5DULA 3AGQA 4EYSA 1TF5A 1ZD5A 2EX4A 5AHKA 1Y5RA 4OBEA 4H18A 4PCLA 1L7QA 3B53X 3KHSA 3RVOA 4HUTA 1G8KA 3WIUA 2WYUA 4HQ0A 3VU9B 4ZVVA 3SIWA 4V0KA 5JROA 2YRFA 3JATB 1VKOA 3NONA 3ENVA 4FFOA 2DPXA 4QQ8A 1E0SA 4BWYA 4CKEB 1RTTA 3TAXA 2OC9A 2IF2A 3KQYA 4YY3B 3EIOA 5HS4A 4GF5A 1DWOA 1JQEA 2M98A 1VKJA 4YV1A 3HVRA 3AC0A 1RW4A 5HFJA 1Z4OA 2ZP1A 1PVDA 1EDDA 1NW6A 1P9LA 2J3HA 1W5FA 3L8ZA 2EZ8A