1ZGHA

Methionyl-trna formyltransferase from clostridium thermocellum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
227
Chain Sequence
LMNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEYILFPHWSWIIPKEIFENFTCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRASMKNGKIIADVEIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methionyl-tRNA formyltransferase
publication title Methionyl-tRNA formyltransferase from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
total genus 58
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.20 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 1zghA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zghA01
2GARA 4ZYWA 4ZYTA 1MENA 3N0VA 1GARA 1ZLYA 3O1LA 4ZZ2A 4ZYYA 3DA8A 1CDEA 4EW1A 3P9XA 4R8VA 4ZYXA 4ZYVA 4Q12A 3AV3A 3DCJA 4ZZ3A 1YRWA 3OBIA 5J9FA 4QPDA 4YFYA 1RBQA 2BLNA 4TTSA 3LOUA 4S1NA 5J63A 1RBMA 3W7BA 4EW3A 4IQFA 1RBYA 4PZUA 3TQRA 3GARA 1NJSA 3Q0IA 1MEJA 2YWRA 2CFIA 4TT8A 3AUFA 1C2TA 1ZLXA 2FMTA 1FMTA 4ZZ0A 2BW0A 1JKXA 1RBZA 4NV1A 1RC1A 4EW2A 1MEOA 3KCQA 4YFVA 4ZYZA 3NRBA 4DS3A 1RC0A 3TQQA 1GRCA 1ZGHA 4ZZ1A 1S3IA 1C3EA 4ZYUA 4QPCA 4TS4A 3R8XA 5CJJA 1CDDA
chains in the Genus database with same CATH superfamily
1NBHA 1QSGA 1IPFA 4R7GA 4UQPA 2GJAA 1VJTA 5TE9A 3WB2A 4D1YA 2YXLA 4ND2A 3W2HA 4HPWA 1I10A 2HBYA 2Q2NA 3A6ZA 2OCBA 4OBXA 2C7OA 2I2WA 5AW0A 3LT5A 4FGSA 3VU8A 4PZLA 3RCBA 3RVLA 1Q84A 1JZQA 3MUOA 3FY4A 5T8KC 2NIPA 2VDOB 5IH7A 4IJUA 3UK0A 3M6WA 2ZATA 5FO0A 4ZCSA 4EB6A 2HLPA 2X4GA 4WKOA 1TTTA 2VAVA 2DFDA 3E6AA 3VR5D 4TWJA 4ZOCA 4G1MB 4IXWA 3D8NA 4XSGA 4PINA 1CDEA 3VR2D 3HCDA 1Y8AA 3DV0B 2QRUA 4UM9B 3A36A 3ROMA 2IXAA 2P2LA 1KJYA 3FTQA 5TT1A 1R6VA 1IY0A 1X1CA 3GZ4A 4HGZA 1N3BA 2XGJA 4I8IA 2CJXA 3ORHA 4HD8A 4YA6A 5KNCD 4GWKA 5LYJA 3VUEA 2PRZA 5AD1A 4XVQA 3BL8A 4R6WA 1QK5A 1LPPA 1OIXA 4MWDA 4R7TA 2GTHA 3NAZA 1CY6A 1RPZA 4U7FA 2JKVA 1CR0A 4CFSA 1XTBA 2QTLA 2V7TA 4ZJUA 4RCVA 4I1OA 4UDYX 4HWSA 4MUYA 1EHIA 3LXXA 4TXNA 3T5CA 1M67A 1P9OA 3MXOA 4NCXA 5ALSA 2GSDA 4UVDA 3ESRA 3N9IA 4PSDA 3BS4A 3RUPA 4JLAA 1QRUA 3QRWA 3K1YA 5SYAA 1ULZA 2JVKA 3AP3A 3STXA 5K7SA 1C0PA 2DE0X 2JNWA 5IAEA 3LXMA 3W90A 3LX4A 1WXGA 3TLXA 5CG2A 1WPQA 3ROPA 4BE4A 5IKEA 2O2XA 3GX1A 4Q7JB 3ZYCA 3RKRA 3QLEA 1VGVA 3NV9A 4P4GA 2BBSA 4FS8A 4LTMA 4TMXA 1R0WA 1HH4A 3QKSA 4HDQB 3FLEA 2FW1A 1R3UA 4CG1A 2EHJA 4BFSA 3HB1A 5F5XA 4Z51A 2F43A 3R3HA 5AVJA 1XRQA 4HFJA 4L8VA 2PIDA 3CEPB 2HRCA 4BVHA 4X1IA 1H94A 1WKCA 4IDCA 4OTZA 2XZOA 4B71A 3QVJA 2J09A 2GK6A 2H29A 2O23A 2OMKA 3WTBA 3LRTA 2IC5A 1KAOA 2AFVA 2Z56A 2H4YA 1EQ2A 3D1LA 1RQPA 5IKPA 3TCXB 4BLOA 1T35A 4WNIA 4HQ6A 2XNCA 2COUA 4PLTA 4QGGA 5AKGA 5CA1A 5ES3A 2P78A 2YR0A 1YTLA 3NAMA 5J4VA 2GPJA 2WHQA 1NF9A 2FN8A 5ICEA 1Z5UA 4RZUA 4B6PA 1NE7A 2EFCB 4WGFA 1EP3B 5F1KA 1YU6A 4LRYA 3RDPA 3W3AA 4E11A 4Z1MD 1EK0A 4ASUD 1HETA 2HIHA 3AETA 4BUCA 4DUGA 4OI0A 3CB2A 1FMCA 5J5VA 2HK7A 3C97A 3KEFA 4M9QA 5DB4A 4XX0A 4TM7A 2CLDX 3H2GA 3L7IA 1PJZA 5EPUA 1C3EA 4YP9A 1GU7A 1LLUA 1WQ1R 2Q8PA 3AKDA 3BH7A 3E4CA 3TLBA 4DNFA 4ESOA 1PJCA 1W2GA 5JW6A 1JG3A 1JU3A 3P4YA 3MHTA 2HUNA 2Y27A 1Z4MA 1WA5A 2FR1A 3AIOA 3DC2A 4KGDA 4XSHA 1DBIA 4N3NA 3RU7A 4ZCIA 3O0DA 3UUFA 5IFKA 1L5FA 3GB9A 4D8XA 3HVJA 3G5MA 3LO8A 2DBYA 4P9NA 4QOEA 4YT4A 1VB3A 2FXVA 5JAIA 3OHSX 1IM2A 1EB8A 1JECA 1FDWA 3WXBA 4Q39A 1J0DA 1VPVA 3TXYA 1KH1A 5K2MA 5ELXA 1DINA 2I71A 2P8SA 1HI9A 3QWFA 1U3DA 3UAZA 3G0HA 5AI0A 4MCHA 2ZU6A 5AJYA 2Q62A 1QKKA 3O94A 1Z2NX 2ZYHA 4WNAB 1UKAA 3FD8A 2FN9A 1XVUA 5CMLA 3R20A 3CX8A 3MC1A 3M1AA 4RE5A 2P0AA 3QBJA 1JXOA 3KKNA 2B7BA 4REQB 2JCSA 4GOND 3LUHA 3NEPX 1KK0A 4NK4A 4TWZA 3UK1A 1XOIA 2FDRA 4NLLA 1H05A 2BGIA 1D3AA 3F7NA 1XAHA 1F14A 2IV7A 3CZ4A 3KG2A 2O0HA 3BA6A 4B81A 4YY3B 1ICEA 1P2GA 4IOJA 4NQRA 5SY4A 1QPZA 1EFLA 2W2LD 5E9JA 4PAOA 1OAOC 1KO5A 1YO6A 2RAFA 3LUJA 1HZJA 3Q3HA 5I3ZA 3QX3A 3AKEA 4DSOA 2PU5A 1QO0A 2KJQA 1YVUA 3ZDAA 2HQSA 2EF0A 3IDSA 1D2HA 3OWXA 5B4UA 5P8WA 5FWNA 1R0SA 4N48A 3NLLA 4KXFB 4A0FA 1THMA 3KZXA 1QPBA 2C4VA 1XU4A 2WICA 3G02A 4BZQA 3SR4A 4GDFA 3ASYA 2GUGA 5LQUA 3ZLJA 2JA1A 3T1QA 1YQEA 4BZZA 2MIIA 2I7CA 5CNIA 4D4HA 1NAIA 3PUZA 2WG2A 3RVOA 1X8LA 1MG0A 3W6NA 3HCRA 5JZBA 2I91A 3L1HA 5FORA 1ISSA 1V8BA 2HA7A 5KYVA 4A0HA 4FDAA 3KQLA 4MMZB 5CU7A 5E6UB 1A3CA 1NRJB 4KFTA 3WBJA 1G9TA 1VHJA 5A9SA 4IW3B 4HLUA 1Z4IA 1CB7A 5ALXA 1X1QA 4V02A 1HA3A 1D9ZA 2BKVA 4KO1S 4O2LA 3CS3A 3DBVO 1MU0A 4OU5A 4E5PA 2Q3HA 4M1EA 4PZCA 4DB4A 4NBSA 2X5NA 4YWHA 1HKUA 2J87A 5EJFA 4D26A 5BXYA 1MJFA 1U81A 1Z16A 3UJ9A 3OX2A 3H16A 2VSOA 1WXFA 4JR0A 3QEBZ 5HXAA 4M1QA 4AC9A 3T5AA 1TEVA 4G6ZA 4ZD6A 1ML4A 1YZTA 2EARA 4U3JB 4X7MA 3D7LA 3FB1A 3KT3A 1NBWB 2R4UA 4MB6A 5LSAA 3EPLA 2CK3A 4JXJA 1G8YA 4MVJG 3HRIA 2RJNA 1I0IA 1CDOA 1QFJA 1USUA 1YNOA 2FZ4A 4HATA 4L0QA 1COZA 2H7XA 3UJ3X 3U09A 1IOLA 1XDDA 2IEZA 4LI0A 1RQ7A 1KEEA 2CHEA 1E4EB 3T7TA 2P2NA 2DFPA 3GAAA 4KKVA 4DTIA 4ER6A 1YVRA 2J59A 4IJKA 5LKRA 4GG1A 2A57A 4PHTA 1KY2A 1EK1A 4I08A 3Q9NA 4MKFA 3DAOA 3CMCO 1GIAA 4YJ2B 3QF4A 3PUIA 2HQRA 1UJMA 3F4BA 4H77A 5AXDA 4CMIB 4EB0A 2XJ4A 1N1DA 3ONWA 1G5IA 3MCVA 3MUEA 3WDLA 5H3CA 3I8SA 4CHGA 2GKSA 1W4LA 3E7XA 5AYVA 3BF8A 4HUTA 2QM7A 5B30A 1LBIA 1CJMA 2H8KA 2YW2A 3L6EA 5LXTF 5FTLA 2JIQA 1OH8A 3UV7A 1JEQA 3H2SA 3RR2A 2GCGA 3FGPA 1BXKA 3ONNA 4JS0A 3BOSA 1DC7A 1X13A 1Y8CA 2EQ5A 1F1JA 2WD8A 4HEQA 5DWQA 5KS2A 3C4QA 1N2ZA 3KPUA 4YAFA 1SWWA 2WWWA 2AKEA 2GBLC 4YGYA 1HQCA 3D1VA 1JZTA 2ABWA 1W0CA 3I76A 3RC9A 4QNNA 3GFVA 4WOPA 2OZEA 2FWNA 1HTWA 2RG7A 1L4HA 4PPGA 1K8RA 3FAKA 5E1DA 1I3KA 5EE0A 2EFYA 1KMNA 3AZPA 1PFQA 3BXEA 4LVOA 4R8SA 4Y18A 4JI1B 2OV1A 3KWJA 3R3XA 4IIJB 1EDOA 1Z0UA 5F5LA 4RA9A 2PSHA 5C1IA 1Z47A 5AI8A 2WV9A 3QEMB 1LX7A 1DOAA 2J5QA 2P9FA 2XD9A 3PX3A 4YO8A 2EKQA 3TD9A 3AOGA 4KN5A 4NFYA 4F6RA 1Z7GA 4YT5A 5I7WA 1H3NA 4HG2A 3W5IA 3ABSB 3NTLA 1SXJE 4CKWB 2JCGA 2A8YA 5JFGA 4MV4A 4S05A 4O8ZA 1BDBA 1WBJB 3RKUA 3VUFA 3WJAA 4QBHA 2GKGA 5CTAA 4PNEA 3DTTA 4OHBA 4KXYA 2P6RA 5DGDA 2R6FA 5FUVA 3LFTA 4W9NA 4LGMA 5HQ3A 3QE9Y 3GLQA 3LA6A 2C77A 2HBQA 4X8OA 3M6UA 721PA 1E4VA 3LF2A 1B73A 1P9LA 4B3FX 4J0KA 2EBFX 3AJ9A 4TZKA 1WHSA 1CKEA 3D0KA 4IJWA 5KNDH 1WLSA 2WJ3A 1NULA 4WECA 1I3MA 3MJDA 4WFKA 5ESWA 3D7MA 2HLDD 3D4OA 1TD9A 2PS1A 1U8TA 2OV4A 2FMTA 3IBSA 2JK1A 1UBSB 2X1MA 3A1WA 3WMFA 5KDLA 3K70D 1EFRD 1FS6A 3QLTA 3MLAA 4Q3EA 3I2IA 3K9HA 4QPPA 1JDBC 4U2FA 5CCBA 1EGMB 2BD0A 2MSDB 4HQLA 1UQRA 5BSKA 1V1RA 3LPMA 3V4FA 2VQDA 9LDBA 1U6JA 2DHDA 3QMPA 2ZAIA 4U5XA 2VSNA 3KTOA 5AKLA 5CB6A 3BAZA 3KEGA 4DCTA 1W9HA 2ZVDA 4O4LB 4B84A 3BGDA 1UEIA 2YICA 1GG8A 1XD8A 1P3DA 4LOJA 2P77A 2OUKA 4D96A 3H75A 3WK5A 3CRRA 2NTNA 2C4MA 2H4WA 1E6CA 1KZGB 1MABB 2QV7A 4NU6A 2JEZA 5KHLB 1H6CA 1LDYA 5DM0A 4AK9A 1O8BA 2X0DA 1PL8A 4FHDA 5AESA 2RIRA 4RABA 3TR0A 3C70A 3RUHA 1PL6A 4JUAA 4L7VA 1KDRA 1V3VA 3M34A 1T5LA 3DW3X 4PX2A 1VSVA 4YP5A 2YL2A 1XZDA 5FP0A 2Q3LA 3UJCA 3VTKA 1J9EA 4EFMA 1UDCA 2NV2B 3UAVA 1N6OA 4A4DA 1YU9A 3PX7A 2XDAA 4OA5A 2OP1A 2GD6A 3ROTA 4EPWA 3ER9A 1WRBA 2AN4A 1L5SA 2LKDA 2YWBA 1FBTA 3GZNA 3DPIA 3MGCA 4UUMA 4EYKA 4YRMA 2ZSUA 3K9QO 2VDNB 2R00C 4NMHA 4TTPA 4CW7A 1SFRA 2Q50A 1YH3A 1KSHA 2PSJA 4MQBA 3R9WA 4RHYA 3FOAA 4EA8A 3IR6A 3V00A 3N6VA 2GEFA 4GMDA 5KUTA 5HJ7A 4OPMA 3D7NA 1XRSB 3NT5A 2XMDA 3NRCA 3RFVA 4EL0A 2F4VB 4L95C 4JR2A 3F6EX 1XCLA 3PNBA 3EMDA 4UTNA 4O4JA 4YYZA 5LZ8A 3REGA 2KI5A 3U7QA 5HW0A 1ZQ1A 2C0PA 1R12A 3DTYA 4CODB 4P0PB 2K87A 4NBKA 3SLRA 5I9IA 2M2IA 3B85A 3GU3A 4BRZA 3HVRA 2CBGA 2VDJA 2CSUA 2NM0A 2XEDA 4Z2YA 2DX7A 4LG1A 2H2AA 2JFUA 1F8YA 2YY5A 3E35A 4CQMA 3AF6A 4TX1A 5CVEA 3NKFA 2TMGA 2OCKA 4Z2AA 3I01M 2QD4A 4H9GA 3EAGA 4JZKA 4MWSA 3RKSA 1S5PA 3FH0A 3GELA 2ZSKA 3BQNB 4D81A 1R8QA 5JNTA 4XASA 3DFUA 2A1TR 2ZB7A 3B3AA 3WXMA 3U37A 2JAWA 3OSZA 4W6ZA 4EHJA 1MDFA 2PZLA 3B2QA 3W2IA 4M0MA 2JLYA 4GZ5A 3UFXB 4EJ6A 1FSGA 1ND6A 3EPRA 1ISMA 3L0YA 4KCGA 2H4FA 2WYOA 3BTVA 7REQA 3B13B 3IULA 3A3YA 1D8AA 4GSLA 4PQFA 1WWKA 1XDUA 3DYIA 4P3YA 2C8LA 2BE7A 3WS7A 4A82A 3NV7A 1QM5A 4AYWA 1A4RA 1F3LA 4CDMA 1AKQA 1QBGA 3MLEA 4OFZA 3A05A 5ECGC 3VFDA 1X6VA 1MCZA 1ZONA 3LD9A 1N2CA 3AUTA 4JROA 4Q6BA 3JXEA 4UHHA 3EIXA 3MYRA 4YAEA 2GZ2A 2XH8A 4YWJA 2EG5A 2VPPA 1QNFA 1BU5A 4U00A 1EKXA 3G2KA 1Q1GA 4EEXA 1P60A 4X63A 1X0VA 4HJRA 4MS4A 1MKYA 3WISA 3FJOA 1SUFA 3IIJA 2PSFA 2AZDA 2OKCA 2DKOA 3HLKA 2GCEA 3VNSA 4EDFA 3VKHA 4J0FA 4L5AA 3DMNA 3B38A 4G5HA 4RK5A 3LWDA 3MRSA 4FFDA 5LMNB 2EGHA 1QZZA 1VE9A 1M76A 1X9GA 2IYPA 2JH3A 3H7AA 1WVGA 1DKLA 3AUAA 3O90A 2A7XA 2W90A 5C8VA 5CVUA 1CJSA 1FDTA 2PUBA 3EDOA 2HDHA 1C0LA 1HXHA 2P9CA 5EEGA 2ADMA 1OA1A 2JA2A 3C98A 2PO5A 3HNRA 3HDGA 3I73A 1TI7A 3QELB 4R9VA 3U81A 3I61A 4OLAA 4MK4A 4JLOA 4AP6A 2QN8A 3I9LA 4WY2A 2VA9A 3R0XA 1UBUS 3U2QA 4U2BA 1J0CA 1L5NA 5TEVA 4C2AA 5JD5A 2IEBA 1TM2A 2X0IA 1G5QA 2Q49A 5BUQA 2OILA 2BBTA 5JXHA 4F1KA 2CB9A 3L6RA 1XK7A 4E03A 1USVA 5C35A 1SB9A 2H18A 3VKWA 4DPMA 1Q83A 3AY0A 1EFTA 4U9IS 4KFUA 4BGUA 3AG6A 1OFGA 3GFPA 1QBKC 3NVMB 2IYUA 1G60A 4G63A 4LZZA 1ESDA 4RNDB 3AI1A 5CYFA 4QD3A 1FP7A 4BTLA 1KK1A 1LD3A 2HFJA 3IGFA 3N2YA 2ID8A 1A4IA 3UWPA 4BVBA 4I9GA 1R4MA 4G25A 3NWOA 4AU1A 3WKAA 2NSHA 2XBLA 4JYZA 3NAGA 1C2YA 5CDFA 4CFZA 1P1CA 3G5AA 4ZAXA 2V98A 2RGGA 2Y0DA 3ZJUA 2HIMA 1EVZA 3V46A 3LO5A 5A9RA 5LMZA 1UPFA 3DOFA 1JSRA 4QE3A 4IWYA 2C9MA 2G9RA 2MDTA 3OAAA 4AZ3A 2FMKA 3WIEA 3G9ZA 3LKZA 4RA6A 4RV5A 3RASA 4C05A 4HADA 2ZXUA 1E3MA 1CZUA 5JDCA 1YB6A 5KOJA 3O3NB 2B4YA 2WTXA 1J2RA 2AUMA 4PHFA 2JIMA 4BLQA 1X92A 3BMCA 2VAPA 4PG7A 5I9NA 1H9AA 2O7NA 1KP9A 2QW0X 5L3QB 3K30A 2W2TA 4R1OA 4TGLA 3MPOA 1Q16A 2P75A 4R8KA 3ND6A 5G40A 1DNPA 3H42B 1JR3A 4G0NA 2IE8A 2NV6A 2QQFA 4H08A 2YJ5A 5GZ6A 4B7UA 1SXJC 1G291 3HCPA 1NMSA 4MV5A 3B36A 3U3RA 4Y30A 4I5EA 5AVWA 1C7JA 3EGDA 1EP2B 1KYYA 1ID1A 3V6MA 1YDMA 3C0KA 3T1TA 1C30B 2C2XA 3AESA 3GLHE 4GX1A 2BGTA 4EPXA 1ONSA 2FPIB 5BOVA 1SBIA 2QU8A 2VLBA 3H9EO 1MX9A 2G6TA 4OQNA 3H9JA 3QPWA 5C37A 1AV7A 4JL6A 1RBMA 2Q4TA 3Q9LA 3DHNA 3G2HA 2HMAA 4J0DA 4YAWA 4Y67A 2VBCA 1RP1A 3L7MA 4U6SA 4Q9JA 5BT9A 3HSYA 4UE6A 4ZU6X 5TVGA 3IUJA 2J3EA 3QV2A 2RCNA 3F1LA 4NC9A 1AF4A 4IILA 4KE9A 2D8AA 4Q4AA 2BF7A 1AB5A 1Y4ZA 3DUFA 3H1GA 4GX5A 4RKYA 1YS6A 1Y6GA 4EO9A 1W46A 5DKFA 4KLZA 2NLOA 4ZVKA 4D0RA 4D45A 1GV0A 2WQZA 3RVRA 3VNRA 2X8WA 2FSGA 3W5JA 4DT1A 1XQ1A 4J0JA 3G0IA 3I53A 3D8SA 1OAOA 4QXQA 5JE8A 4NCHA 1Q19A 3CEAA 5TARA 4F4IA 1ILWA 1MT0A 1XI2A 4D25A 2PLFA 3RRZA 4ZI7B 4BASA 4WCFA 3EH1A 2JCBA 2PZMA 3OCWA 4YMWA 4HLCA 5EQFA 3PJRA 3LCCA 3AVTA 3W9YA 2DPLA 1I4TD 2GETA 4KX3A 1FBNA 2UYQA 2FPOA 5BWMA 5HCUA 3UT5B 4O8CA 1SBYA 1MQ9A 2WHPA 3H9GA 4TYYA 3K9LA 2V7UA 5A2GA 1NR7A 4UQOA 2GNPA 4TLMB 4K2AA 3EEYA 1UBHS 2WMNB 1YI1A 3G0OA 3KFVA 1WV1A 3Q3CA 3TD2A 4PNPA 1YZFA 2CC2A 1PR5A 2VDMB 2H9AA 4EPTA 1APBA 2GTIA 5JCPA 3KU1A 4FEGA 4H7JA 3Q10A 4BQOA 1U1GA 4S1OA 3T06B 3TLEA 5DVZA 4XWKA 3QUTA 3SEQA 1JDZA 1WMFA 2Y3IA 2ATCA 3IJEB 4IGKA 4WKNA 2FUG1 1GHTA 1QRAA 4BNTA 1OX6A 5HUHA 1KFBB 3AFOA 4FE7A 4F8JA 2IX3A 1SEVA 2JB9A 3K9CA 1GQ2A 4UU1A 1KRWA 2X9GA 5HS6A 2Q3EA 2ZE7A 4IJQA 3WE7A 1DTEA 1PJAA 3PKJA 4HH1A 3WGKA 4C4AA 3OPXA 4HVTA 1W0JD 4MR9B 1YV9A 4O59O 4PVCA 4WK2B 2XE8A 4C3ZA 3O4HA 1TDJA 4MWTA 1WQ4A 1VHLA 1W48A 2IDJA 3HKDB 8OHMA 1X8XA 2YDYA 3QMVA 3QBVA 1D07A 3V7UA 2C84A 4I6EA 3ZY2A 4JJFA 4EKYA 4CKBA 5K1ZA 1J2TA 3SR0A 1VBNA 3PR3A 4QXMA 1ZI6A 3DYBA 4L8YA 3UBMA 4HFMA 1J5XA 1SXGA 3B5EA 4M3NA 5CM9C 1GR0A 2XB4A 5KNDA 1V4VA 1VJ5A 1WP4A 5BW4A 1EYZA 4PGFA 4RPHA 2IY9A 4JJ7A 4WFIA 4ENRA 3JQDA 4QRIA 3FOEC 4B3DA 1R9GA 1M2OB 1FFHA 4JX8A 4LXTA 5G1PA 1XAGA 4L4SA 5ALYA 5G1OA 4BVAA 2DLDA 2ZITA 2OZVA 5DEIA 1E6UA 5BN1A 4C7VA 3L6DA 3V34A 3DUWA 3QWIA 4YJGA 4W5TA 1CLEA 1XC7A 1EFVB 2EP7A 1THTA 1JHOA 3EA4A 3O26A 4GM1A 2IYWA 4F2DA 2Z4RA 4BYMA 4PANA 2PSEA 4DDKA 1WVMA 4OQDA 4DMKA 2F9LA 5E2BA 4G26A 3U3ZA 4F4JA 3KK0A 3A2LA 2PBZA 3CKLA 3L0DA 4YMHA 4OHXA 5TF0A 2EATA 1ZD5A 3TZHA 3ETGA 1TVKB 2I62A 3ZI7A 3Q0TA 2G67A 1NYQA 3ROGA 3EXEB 4B3HA 1BW9A 1HE2A 2XTMA 3A9CA 5ICMA 4RD6A 1ZIPA 2OZLB 2LZ0A 4X54A 2IU4A 2ZJ5A 4II3A 1ELOA 3BDVA 4LJRA 3R7WB 1K4YA 5CFOA 3DVRX 2A59A 3BGIA 3D4PA 3PB3A 5AK4A 5FPPA 2HGSA 4K1XA 4U7DA 4F92B 1PJTA 3ABZA 5EXDA 1C1HA 3WADA 3N8GA 2QTAA 2H54A 1VSUA 5BQFA 1E9FA 3QBTA 3MMPA 2V65A 3TLGB 1OLXA 1E5TA 1AKYA 1E3WA 2PUJA 3GGJA 4GPEA 3MNFA 2J30A 2OQIA 4WUTA 3WNDA 3IQZA 3N07A 4DCSA 3W5CA 3AVWA 3O1JC 2BPOA 4IVPA 5G02A 1CYDA 3NWEA 4BKUA 4TSFA 3UNXA 1SVSA 3K0FA 1X77A 1V71A 4V24A 5AVRA 2B61A 4S1PA 3WQHA 1HYBA 2BF4A 3EEBA 5D3MB 2XLBA 4LFAB 1HYQA 5DLYA 3IEMA 4WPGA 4E22A 2X6QA 1BWQA 5I45A 3ZVKA 4FWTA 5CFLA 3QTTA 3TF5A 1U0OC 4GZLA 4I81A 1W49A 2M32A 1HE5A 1DU4A 3E9QA 4KUEA 2HF2A 1BZYA 1UXOA 2Z2ZA 1UXJA 3WHLA 5JC8A 3DJYA 3AERA 2O2EA 3K09C 1YDFA 3A6FA 4WT7A 1UK7A 1OPXA 2PWZA 1K9VF 2NT3A 3OOHA 1SGWA 4Y2SA 4AD8A 1A5SB 2QN1A 1GO2A 1XLTA 3MQFA 3QV1A 4YLYA 2R7KA 5T6MA 1AQ6A 4LJ9A 5LP6A 1R50A 4CM9A 5CBPB 4JFAA 1GGFA 2VJKA 4TOIA 4CNBA 1G9XA 3QVOA 4UUNA 4PTLA 4CZ2A 3EUEA 1PJ4A 1ZJZA 3R0VA 4Y6RA 2H4ZA 4P7FA 5FJJA 5GM1A 6CHYA 3OIDA 4TXHA 4JUIA 2W2VA 1AM4D 3OPNA 3RTBA 3VU9A 4O25A 1DJLA 1JV2B 1N0WA 4M9XA 4KIFA 4N5IX 4C5CA 2CK3D 5JHHB 2VPZA 1I3OA 5FAKA 4WRRA 1EVEA 3RAGA 4F7WA 2CLSA 1I80A 1IJBA 4M49A 4LJAA 4MV1A 1R16A 5EJAA 5EWMA 3NDBB 4ZZ2A 3VTAA 3FPAA 4M38A 4NAHA 2ZI6A 3LUKA 2YTZA 3T7SA 2WD7A 5FBQB 3EEIA 2FW7A 1BDJA 2PD3A 1YKSA 2ACVA 4EMTA 2WC1A 1M2EA 1R5JA 4K9QA 1X1SA 4E70A 3W8FA 1D09A 1B2LA 1H85A 1E18A 2H1FA 4Q19A 3GLGE 4ROSA 1LRLA 2AOWA 2SBTA 4KJXA 4TV9B 5CA0F 4KW7A 5K20A 3KOWA 5F78A 4X7BA 2BHSA 4ZOBA 3RT1A 3WGGA 5KC8A 3PGLA 4TTRA 3A4NA 3TJMA 3DQQA 4MB2A 3D81A 3P96A 5GWXA 1ZNXA 4FOTA 1SURA 1YB7A 4OJYA 4JI3B 3A7DA 3AUXA 4PC3A 2BFDB 4QAQA 1O94A 5DTJA 2AYZA 1AUXA 1FYWA 1N2BA 1NBOA 2P6OA 3HP1A 3NALA 5ICFA 4Z4GA 1IB0A 2OC9A 4X1KA 1LCIA 3HN6A 1GPNA 5HOEA 3CVXA 4GKJB 1R8SA 4LZLA 2BHRA 5SZJA 2ZJ6A 2C94A 3F49S 3EWAA 3MGKA 3MPUA 5DYTA 3UXMA 2KX7A 4C4SA 5J1SB 4KSYA 1NW8A 2R7NA 5FLKA 3WLLA 4JCCA 3DE1X 3EQZA 2QX7A 3E8MA 2HSDA 1T1JA 3DKPA 4KNWA 4C22A 4OGFA 1IG0A 3KEOA 1ZJ4A 2H0AA 4FKZA 3M5DA 5EHXA 3SHTA 3DAHA 3NUQA 4PYMA 2C5GA 2FI1A 3Q7EA 4FIDA 2JL1A 3LP8A 5AUOB 5LQKA 1H2AS 1C1DA 3KWMA 4EVQA 2P40A 1PSZA 3I05A 1XZCA 1TAQA 4FZ3A 2WVHA 3HVKA 5JZSA 1NTOA 5A5GA 3DWGA 2P7IA 1Z33A 1VL6A 4JJGA 4NV1A 2JFVA 2CHFA 2P2SA 5L6MB 4GR4A 5IT0A 3QXCA 1T9CA 3GBVA 3Q3VA 5C3MA 5JS8A 4UASA 2O2GA 3O3MB 4IF4A 1IRIA 3IOYA 3GYBA 2X8JA 3B9PA 3OIYA 2XX3A 4FSDA 4IG4A 3RSGA 3U9TA 4DXAA 2FNAA 1D4ZA 2EV9A 4OI1A 1U9JA 3ZWAA 5JC1A 4MO2A 1IQRA 4ZXPA 5I9TA 3V1UA 2VDWA 3P19A 1PFUA 1ZWLA 1ZIXA 2BHTA 2FZLA 4XJTA 2O48X 2Y92A 4Q9IA 2ZIGA 1T3TA 3LA8A 4YJFB 3BGOS 3U3MA 2O5CA 4DPLA 1MB2A 1D5WA 5KQSA 1ZFNA 3WNVA 1XZMA 3D8BA 4Z9BA 3CZCA 3RSZA 1E3QA 2FVXA 2JD1A 1BJKA 3CLTD 1U28C 2XGMA 4FMCB 1U3CA 3GPLA 1QAQA 5HHTA 1NMXA 2HMTA 2HU5A 3NDRA 1AKTA 1OMOA 5KIAA 2H6EA 2OHVA 2R48A 5ALRA 3WLOA 4MX8A 1QRTA 1IMJA 1XA3A 2ZR7A 4MR8A 5FWYA 2ZB8A 1XMQB 3NIGB 5C51B 4K9DA 4ZAYA 3LBFA 4J0EA 2RI1A 4MWOA 5E4FA 3U0BA 5LYJF 2O3QA 4AKGA 1NW3A 4Q24A 2AG0A 3W8NA 4QKQA 2Q5OA 3G5TA 4LKOA 3HL0A 4CEHA 1UP6A 2ZRAA 3LZCA 4ALMA 1XHLA 1URPA 2O8DA 4MV9A 1M6EX 4JJ4A 1T0JB 1DBSA 1KFKB 4INAA 3TTYA 1Z0SA 4BB0A 1PNOA 4QJBA 4EM6A 3C5CA 1FW6A 3PNPA 2YJ6A 1O4WA 1SKUA 4RVOA 1AZTA 4EJ2A 2QTHA 4FCWA 1QC5A 4EK9A 2GXSA 4DBZA 2CVPA 3RHTA 4F3TA 1U2DC 3KAPA 4RD0A 2G8LA 3AOEC 4M22A 5L7TA 1GTZA 2HJGA 4GKBA 4MXDA 3R3ZA 2BDEA 1O8CA 3TLMA 4CI9A 4GUAA 3QXSA 1MAWA 2IOYA 2DUUA 4S12A 1W5SA 2R6CA 1QONA 4WZ6A 2XR1A 1PG0A 1ZVVA 2ZSHA 1XMVA 3ND9A 1ETUA 1GCOA 5IJAA 1WY7A 1MZVA 1T3GA 1Y6JA 3OFNA 3L1UA 4Q48A 5BVHB 2VQFB 1E3JA 2B20A 1X80B 1XRJA 4GQIA 1QO9A 2A86A 5DNAA 3TS1A 3U3DA 5BNZA 1DO0A 1XWWA 1UOPA 4X6YA 1Y6FA 1SQ5A 3CF4A 1YA4A 1XNQB 3FDJA 4JB0A 4P5DA 4ZCPA 1F17A 1QIMA 3C87A 1U02A 4BMNA 3GEGA 2XOKD 1MOSA 4WXPA 2A88A 3TVDA 5KJFA 4I5FA 4YRBA 2IH4A 3PHGA 2E1RA 4CQMD 3VHRA 5EUMA 1SVNA 2KYRA 4OXNA 2XOEA 5EPEA 2VCHA 5AJHA 1AVTA 2L69A 4KN6A 3WX0A 5IWAB 3H13A 4ARZA 3NFYA 4JLSA 2YS6A 2V5AA 3UICA 2DFLA 4J29A 5JJIA 1ODTC 2A4KA 2PG3A 3NHRA 4ZO8A 2AWNA 2LV8A 1UXIA 1N3IA 2AG5A 2H06A 3CLVA 1Q3KA 4F97A 1K7YA 2LIVA 1H22A 4L2IA 1MV8A 1IUOA 3EWNA 4GI3A 1LBHA 4LXQA 1FIUA 5M3BA 2F1RA 2ZAYA 4QICA 3I30X 4OI2A 2J3LA 5FIUA 1ISFA 2H2DA 5FEUA 1EEHA 1H3FA 2W7TA 1XPOA 3OPYA 3UAYA 4MHOA 3HNOA 3IEUA 2J45A 4OXIA 2OPHA 1NXWA 4G85A 2FFBA 4QYIA 1BE8A 3LLMA 3OPYI 4YFVA 2AJTA 2FRDC 1DTWA 3UMJA 5BSMA 4DVJA 4CL0A 5LZ5A 3DOOA 1W2WB 2QX6A 2ZPTX 4RTJA 5FX2A 3I0NA 3JSAA 1DB3A 2BCGY 1QLJA 1SNYA 1CIVA 1EAMA 1YB1A 2Q5QA 2QZJA 5GIOE 2D0DA 1TMYA 4ZRMA 3E15A 3TLZA 4Q9HA 2Y6VA 2YZ2A 2CJWA 1BAPA 2W0MA 2NMVA 1UP4A 2ZBFA 1DKRA 2KBEA 1UKCA 4FE4A 4J0QA 1NN3A 1T9BA 3LK6A 3PNLA 3PD0A 4KGZA 2ZI4A 1RQRA 1NM5A 4BKMA 3FGOA 2PTHA 2IL1A 4YEDA 1RYNA 1PVOA 3G5LA 1ZITA 3AKCA 1EI9A 4I66A 1G20E 4X20A 2Q99A 1WP9A 2AOTB 1JVSA 1R18A 1Z7WA 2V7BA 2XF8A 3JQEA 1OFUX 2E6UX 2NU8B 2OM2A 2GESA 2PN1A 1RWNA 3VX3A 1YOVB 3MG9A 4RQTA 4WCVA 1FJHA 1GFSA 3OT4A 4OYHA 1GM5A 3H5RA 2XQFA 1EWKA 1O4VA 5BQ3A 4Q47A 3U19A 4W4TA 5C9ZA 5LQNA 4MUXA 1RVV1 2IHBA 5B2EA 4F1JA 5K0LA 5BW6B 4URWR 2C0CA 4ZVTA 3GJ8A 3PHHA 4QASA 1KK3A 4DDVA 2B1GA 1PS8A 1ACMA 1QRRA 3OQPA 1YS2X 3I2KA 3U4GA 2I2DA 4FDMA 3WMXA 3LPNA 4ZCQA 4NG4A 4JXKA 5F2KA 4DNOA 4FYPA 4R1TA 2EW2A 5EE1A 3VDQA 1VQ1A 5DW3A 4D8WA 1USIA 1EDZA 2QOEA 5JAPA 3KOOA 2MHCA 3OAAD 2ZJYA 3NHSA 4EMSA 4TVSA 4DLSA 1EE1A 1W88A 3IRVA 4NZPA 1T5HX 3DBLB 3LWZA 4WA7A 5CLIA 1QHEA 5AI4A 4CKXA 2A94A 4NE2A 3FTCA 5IKOA 3QQ5A 4FDLA 4C0KA 3FAZA 4EUEA 3V3KA 5K0EA 4ISBA 3MJEA 2HBRA 4PO1A 3E7FA 4PLCA 3NS7A 4MQMA 3D6TB 3QIVA 3WZMA 2GUWA 2QSYA 4DXDA 4Y6OA 1WMSA 2JHFA 2PH1A 2Y0BA 1DC6A 3V4RA 1D2NA 4FUTA 4JOSA 1XWIA 1BD3A 4FC6A 3HHEA 2BSXA 4BNWA 4MQ6A 2J5RA 1X70A 4UBIA 1S3FA 1RI4A 1LV8A 1NVXQ 5FTKA 4N6NA 3ZV5A 2GRUA 2ZIFA 3GEEA 3U7HB 1P81A 4JBHA 5KSOA 3Q88A 1C5KA 2R1TB 3CWQA 3DWEX 1FRZA 1HDOA 3L7CA 5TQJA 4G1BA 3OO1A 1BXRB 5IF9A 2D8MA 4AJLA 2QS9A 4H7HA 2AH5A 5KNLA 2QXUA 1H2WA 4K0RA 3FWZA 2HSZA 3DHVA 2X23A 3KYDB 1M6VB 4KXQA 1VTKA 4RYLA 2XJ9A 5DT2A 5DZSA 5ILQA 3H83A 5EZSA 4D3ZA 4I9UA 2QUZA 1I94B 3WJ7A 5BWNA 2R1VA 4LMPA 1Y8RB 2XT6A 4BMOB 2NO7A 1KHTA 2PRIA 1RTTA 1PV4A 2N1MA 3SBOA 3ZJYA 3L0PA 3TZEA 1RM0A 4S2UA 3ZHQA 2ZBEA 4N65A 3ZD7A 3AY6A 3GBPA 2CE7A 2NACA 4UM8B 4OGWA 1UK8A 3GLIE 2OGZA 1OLUB 3WICA 4W5NA 1QCYA 5EJ2A 5E2IA 5GINE 2YMMA 3OU2A 5FHQA 3R9IA 4CUZA 1ZHOA 3PF8A 3ZCRA 4ALJA 2CXRA 3A0UA 1X1BA 2P8JA 5BN3B 4ZOLB 3PGVA 3LVFO 4GPTA 3HP4A 4LFCB 3B6KA 4YPOA 2P3QA 1JAIA 2JFZA 4EUNA 4ZVSA 5CAEB 2G70A 5HKLA 3PFWO 3R4CA 1L4EA 5E1OA 2HK6A 4N18A 2P9QA 3IQWA 2FQXA 1KDVA 3U4HA 2UYYA 2LGJA 1EDEA 3LVRE 3RUCA 5K3CA 4MVJH 1DIRA 2NU6B 2JIRA 2VL7A 1PFVA 3WNCA 1JHRA 2GQ0A 2XQJA 4YP1A 5G0TA 3VZBA 5LU8A 4AFNA 2EBUA 3WKCA 4DJJA 2EOAA 2D00A 5CT4A 3L82B 3BICA 3I2GA 3BB3A 2MYNA 4MTLA 3HKCA 1U7TA 1RZ3A 3M49A 4KVAA 5IM5A 3RS2A 5K3FB 3AX6A 2HADA 2QR5A 2JW5A 1WZEA 1CNMA 3DA8A 3QXHA 3MJRA 2QMUA 4BPBA 1FX0A 2NXCA 2QPOA 3IQXA 1JAZA 1JDNA 4Z3KA 1ZESA 3M4NA 1DWOA 4ICIA 2Q5FA 4UFPA 1ZAYA 3BKWA 4ZCMA 3ZX4A 4PHHA 3HCBA 4H0FA 4I0WB 4IY1A 5LN1A 3QENA 1K8XB 3VX4A 2I76A 3FDIA 4ZT7A 4HVCA 5KEIA 1C9MA 1DCKA 1NWHA 3FUVA 4G3XA 4J2HA 3UJHA 5KYTA 3BMQA 3NTRA 3KV3O 1UANA 4BQRA 5KNDD 4W63A 3H2KA 3ICQB 4MARA 5BYBA 3RSCA 1EFPB 1RE0A 2HJRA 3P94A 1ATZA 4OXYA 4P2GA 2H3HA 4X6UA 1IH8A 3DMDA 1E1RD 4BFYA 4BN5A 2QZ9A 4EARA 5BV7A 3EX7C 1PSDA 1C81A 5AKEA 4IXTA 4IQFA 1KOJA 5TMBA 4AWXA 1C3OA 1X7XA 3KB8A 4Z7OB 1NV8A 4R83A 4FMBB 4W9MC 1KZ7B 2VOJA 5HK8A 5IULC 3TUJC 4ARCA 4YT8A 1UXHA 3H5NA 3CRMA 2JG3A 1IUKA 1KL7A 1TF7A 4KX5A 1PTJA 4ZANA 3T1NA 2C3PA 2NYRA 3W5HA 3SQMA 4QBIA 1AO3A 3GEMA 4QVKA 1F38A 4NZOA 4DZZA 4FX5A 1OBCA 1W36D 5JCJA 5KYWB 1I51A 1FSFA 3EMVA 4QTYA 1TMOA 4JEIA 5CCXA 2DJ5A 2QLNA 3TW8B 3V2IA 1EUCB 3FDZA 4H4DA 1NI4B 4KN8A 1LKZA 2AL7A 3THYA 6ABPA 3GP8A 4DJTA 4RK0A 3MS2A 4UNQA 1FMFA 4YONB 1DAEA 5H16A 4CKZA 1KZ9A 1OXSC 3JVDA 3MJFA 3PDIB 4MQ5A 3X1MA 2BMAA 1YFKA 3Q0EA 4CL2A 4FR2A 2R9VA 4LHSA 4MDYA 1CR4A 1L2TA 1QIFA 3U7IA 1VRVA 3I72A 4E2WA 4O0LA 3FHLA 1SWVA 1ADGA 3HJCA 1ST3A 3OTWA 4XUDA 4QSMA 1KQGA 4CLXA 2E7ZA 2IFTA 1WSWA 2JFGA 1BWRA 1L7RA 3ADBA 3CE6A 3G8YA 5ICGA 2PZAA 3Q5GA 1C0IA 1L8QA 5IAJA 3JATA 3RW9A 3SHVA 5BYKA 2XUQA 3L7BA 5LB4A 4BATA 4JYPA 3OEEA 3DT9A 4PQYA 1BJRE 2ZRDA 1ZIOA 3FMFA 2KPOA 3OM8A 5LQDA 1QS0B 1ADBA 3P0IA 4NECA 3TL3A 2O1SA 2B9VA 4OQYA 1DT3A 4DSTA 4IUYA 3QOYA 3MK31 4GZ6A 2XMZA 3JTMA 5TQ0A 2GF2A 1A7AA 2YXPX 1XGKA 3CT4A 3R5XA 4IIFA 4QEDA 1YFJA 2BJVA 2VZ0A 4O4JF 1DBQA 2AFIA 2PAFA 1B1AA 3A9RA 3CLTC 3NGXA 4LKRA 5B3KA 5K0GA 1I8TA 3HM2A 2ISSD 1H2EA 4WLOA 2H1VA 5HILA 2PRJA 3GJSA 4C78A 4DXHA 2UYGA 4KDCA 4Q82A 4EJSC 1QAMA 4F9GA 3IJ5A 2OD9A 2WU8A 3P4XA 4HVLA 5C7LO 5CP8A 1VKRA 1ESZA 1E7WA 1V16A 3A8TA 3O8OA 3SS7X 1E5DA 1PR2A 4EBFA 4ZEVA 4B48A 1YZNA 3ISJA 2LP4Y 2R4QA 1U28A 5I9LA 3PX2A 1W2HA 4PXSA 5JAZA 2Q6IA 1CVLA 2WLSA 3TUZC 4KO8A 3RVJA 2HPHA 2QM8A 1R00A 1NJ8A 3HO6A 4MW1A 3ZHOA 5DT9A 3PIIA 1W0KD 1L5WA 1VL8A 3HFGA 3OD5A 4B7XA 4M9RA 4JX9A 4OKSA 4KITB 1QIEA 4H1HA 4C2UA 5CUQA 2ZRFA 3AR9A 2RMKA 4MIKA 1UADA 1ZGZA 3AIMA 3MRVA 2GR9A 2QMQA 3ONEA 3E9CA 4HAZA 4P53A 2VT6A 3U1VA 4B35A 5BOSA 3VAAA 3R75A 3OX3A 1I0ZA 1VL1A 2SCUB 1XTJA 4NV3A 2R44A 1WY5A 2ZPUA 4Y2VA 3B6IA 4UTXA 5J63A 1A8HA 3WMWA 1CEQA 3TRFA 4DKXA 5LOVA 3I62A 3FWYA 4Q4JA 4KZKA 1T36B 3B8HA 4HNAB 1BWPA 2IX9A 3CQ9A 4FC7A 4M98A 5HGJA 5I4IA 1XZBA 2C7RA 1PGNA 1ECGA 1LPMA 1YC5A 3PKIA 1A2KC 1Y1LA 4OXXA 1ABFA 1E62A 2IF0A 2E6KA 3PICA 4J8PA 4JMLA 4N03A 4IAOA 4BV9A 4D5GA 1R5BA 5D2CA 1JHXA 1PW5A 2ZS9A 3DPSA 3RFXA 1BH6A 1EM8A 1NVFA 2W4IA 4IG9A 4BO9A 4JEHA 5C8ZA 5HQTA 4ZRDA 5GAJA 1SA0A 1QK3A 1YIDA 2GNOA 1XELA 1R9JA 2JBAB 2QAGB 3GDGA 1EQAA 5EA2A 5KQPA 4R9RA 4D44A 1BFKA 3R3YA 3E1KA 3NAQA 2ZTHA 1L5HB 5LYYA 1O94D 2YIDA 3ENNA 1V48A 2Z5FA 3QU2A 3U62A 4DCPA 5ICCA 3DQZA 5IT5A 4D0LB 4FFPA 2EIHA 5SZKB 1W5EA 4ALNA 1VMDA 3IERA 3G1TA 1LA2A 2NTJA 4D9NA 5DE3A 2YRXA 1AX9A 2JFQA 4V0ME 5E9WA 4H6PA 5EJ7A 3UTCA 5IFLA 4P4SA 4UPDA 2ZUDA 3GRFA 4OREX 4H1TA 2PGJA 5TJHA 3W9BA 3VPGA 5HM8A 1Q1ZA 1YBHA 5CFPA 2ZTMA 2P4SA 5LWQA 1UMBB 4FOLA 4R2IA 3RFFA 2ZI9A 4IHJB 3D02A 4GLBA 4RVFA 1YZQA 3DM5A 4Q18A 5A9TA 2NUPA 4HAYA 1HC7A 1E9VA 2ODWA 1GKIA 3HS3A 3IBCA 1GD1O 3PXEA 3TQQA 1G5FA 4LS3A 3EVGA 3SC3A 3ZDQA 4DZRA 5ITVA 1W73A 1XPRA 1ZH2A 5JVDB 3O2NA 4KQXA 5IC4A 1RHKA 2IEAA 2IYQA 2VC2B 2WMDA 3JASB 4OSPA 4I4TB 4L07A 2ZDHA 3R4VA 3PITA 1ZN7A 2QTCA 4LGVA 1QQBA 1SVOA 3IOCA 5BSVA 1PT5A 5A1JA 1HE3A 2V9ZA 1ZM7A 1XCBA 2ILTA 1K68A 1TO6A 2YRWA 5KI6A 4C30A 4XCVA 3MUFA 3LQFA 4GPIB 2W0SA 1C8VB 1HMPA 3T7CA 4BEBA 1JFRA 1L5QA 2HFKA 4P7JA 4G5FA 3QUAA 4ER5A 1S7GA 3BWYA 2V58A 4EHFA 1KJWA 2WF8A 4AY4A 1CUJA 5AIBA 3HYNA 4PYJA 1Z2CA 4UUOA 3ZY6A 2J31A 4MS1B 3T7AA 1AJEA 1KMHB 2AV6A 4KAXA 3AYXB 3RU3A 1J33A 1JALA 3GGPA 4CWAA 1P73A 4H7EA 3FLMA 4ZQCB 2OQRA 5LM3A 1WKBA 3C43A 2KHZA 4BQIA 2XCLA 2A2ZA 4NI5A 1DRWA 5DPMA 1HKHA 2WKRA 2AFHA 5K3AA 3KAJA 3OURA 3LUDA 3O91A 2IU0A 3ZEAA 1G7SA 1FC0A 2AZTA 2P7HA 3LNTA 2I6SA 2ZJZA 3MSCA 4MKIA 5ALGA 5JFOA 3LVBA 2E37A 3AF3A 1N2OA 1OI7A 3KE9A 3GD7A 2J5BA 2ZYDA 5FF9A 4CLRB 1JTVA 8MHTA 1YVPA 1UINA 4NJEA 5I7FA 1IN7A 1CUWA 1JYEA 1AQYA 1DG3A 1JJFA 2EKZA 3EFBA 4KE8A 2XT9A 1YGPA 1JLLA 3PQ7A 4EHHA 1QGOA 3LPLA 5BY2A 1BMFA 2JBWA 3QVUA 1EG7A 2OAP1 3GLGA 4FEEA 4K9RA 3V42A 2XDWA 1KEWA 1T1EA 3C3YA 3PJEA 1RYBA 4J03A 2I9PA 4C4RA 4EFDA 1PJSA 1IZZA 2DFNA 5CPBA 1PUXA 2P3SA 2AOVA 3K5PA 3LLSA 3OJFA 4I3FA 4PLYA 5DGIA 2C4KA 2DGDA 3MBIA 3ZLUA 4DCJA 4BXOB 1E7QA 1QP8A 2AC2A 2QQ0A 4DYVA 4DCNA 1X15A 4YI3A 5TRTA 5H9WA 2ZSAA 2CCJA 4FLEA 4X97A 3NEYA 5ADUS 1IHOA 3QU7A 3QTLA 2PDAA 3L79A 4OLFA 5LWHA 4RGVA 4X7RA 1GTG1 3KZ1E 4YRRA 3OFND 3MELA 4WL0A 1MEJA 1NQTA 3DLTA 3CN7A 1A9PA 3PGMA 4FBMA 4JOQA 4UBKA 1OI4A 3OU7A 2IUUA 3UJDA 1S01A 4OY3A 3AH8A 3UCXA 4M7OA 3I09A 5SICE 4EZBA 1WEHA 2FZVA 4MVJA 3SP1A 1JLMA 4XDGA 1IOWA 5AM1A 1I0LA 4IKPA 2P4EA 2ONCA 4DLKA 4MW2A 4ETWA 1LLDA 4I9HA 3ZWNA 5LVAA 1WL8A 4ZVVA 1E0SA 4O2RA 1YQDA 3HJUA 2NZUG 4MVJI 4C7BA 1ESEA 2DULA 2VSFA 5GP1A 5C46F 3MN1A 3FTFA 4F3KA 2R66A 4JBWA 1MEOA 1Z0DA 3LIIA 1E0AA 1ZJWA 2W2KB 4Y2TA 2B8WA 5AVKA 3AVVA 3HKEB 3JRXA 3LSTA 3QWHA 5I5EA 3HRHA 3GLRA 1KWKA 3NKLA 1SKQA 1L1FA 4DV7B 2KLBA 3QY0A 3IMFA 1KDYA 1ZGHA 2IPLA 3FRHA 4HWPA 1Z0AA 5KVQA 5SY6A 4E08A 2J0VA 3BWEA 3CXUA 5DI9A 5DBEX 3SCZA 1GPAA 4G97A 1DO2A 1UWLA 2L0XA 1VLJA 4NPCA 1VI5A 4Y2UA 3U4AA 5ITSA 5J58A 5BMOA 1EVIA 4K5QA 1PK9A 5IEBA 1GFZA 1XT6A 1I4OA 1VGQA 2QLTA 3DOJA 3K2QA 3KPYA 4QPZA 4TYNA 3W6OA 2XYQA 2NU7B 2DF8A 2BRUC 1CT9A 1NW6A 1G41A 4LAFA 3ZJ4A 1U8CB 1NF3A 2I1QA 3PTZA 3BVPA 4P32A 4S0XA 2FPPA 2D13A 1TK9A 3HGTA 1XCOA 3SJCA 4MUNA 2OPBA 5DLPA 3X2EA 3MINB 3OKCA 4FHZA 1D1PA 4BWGA 3U61B 1RT9A 2GXQA 4RIFA 3SVTA 5I8PA 3O7MA 3NJ4A 3FUWA 3ECCA 4YV2A 3H2JA 2XE4A 1YQTA 3ETNA 1BFUA 4PCUA 1MVOA 2O7RA 2FEPA 3JR3A 4Q4LA 3WWDA 2ZJ2A 2A6PA 3UAWA 1VYUA 4UW9A 3V1NA 1NW9B 4AZ0B 4EHAA 1W93A 4BO7A 5ENDA 1GNVA 2YIMA 2CMGA 2BLNA 2XZLA 1W6UA 2IP1A 2YYSA 1T4CA 2ES4A 1VZ3A 5A02A 2GYUA 1T8RA 3ZV6A 3IV7A 1AUPA 1AXGA 3ZG6A 1UL1X 1B14A 3GG2A 1TNDA 1PR1A 4P0QB 3FTNA 2AHOA 2HT1A 4JOBA 4RL6A 2ZIUB 4R1UA 4RXUA 2VF4X 3TQFA 2O8CB 3K35A 3RAJA 1XJWA 4M6WB 1GVHA 4P1ZA 4XM0A 5IU6A 3VAZA 1YZHA 3R23A 1CJCA 1VDMA 4L0CA 1NR1A 3PE4A 4IDBA 3R7NA 4II2A 5I4KA 1G17A 4WOJA 1VRWA 5A3QA 1JPJA 2H2IA 1D0SA 3JYHA 3I4LA 1SCJA 3PL5A 3WGZA 3GK3A 4KK3A 4M9ZA 4OM8A 3UW1A 1JR2A 4B2YA 3FNIA 3ESAA 3EXIB 4RGQA 5EEHA 3WRWA 5AW4A 4ZT2A 4D02A 3QLJA 2R11A 3G59A 2QMZA 4LN1A 1T1GA 3OFVA 4GECA 4JD5A 1OXKB 1TA9A 4UFOA 2JIZA 3VPHA 1KVUA 2G5CA 4LDQA 5G4LA 1Q0HA 1RR6A 1S8FA 2Z95A 3DZFA 2VJAA 4ITRC 1QHIA 1VIYA 3MIIA 4JC0A 4Q1CA 1N0UA 1NVVR 5AVOA 4WEQA 3C8ZA 2XMBA 3IQHX 3INRA 1WXIA 4TTJA 1CULC 5JIBA 2GVNA 1HLFA 1QR6A 1N9ZA 4IGAA 2GEBA 5GONA 2V6GA 3IPLA 4N5LA 3PVZA 1Z4NA 1RKUA 2PH3A 3B7PA 5K0TA 2WM8A 3ME5A 4YI5A 1S0UA 5LMCA 2VT2A 2YHBA 1JQDA 2ZYIA 3QU5A 1BGWA 3DDOA 2NT4A 2ZAMA 4Y9RA 3UKDA 1QP4A 3MWFA 1LDBA 1SU6A 1LUAA 1UPXA 3SYRA 2P3OA 3SG0A 5KYNA 2O3UA 4X84A 4YCAA 4HN4B 2J1LA 5IS2A 4M2LA 3SQOA 4CFYA 1BS9A 4NEQA 4M21A 2R7MA 4J6FA 3D6UA 4FCCA 1PGJA 1CLUA 2GCNA 3GHYA 1L5KA 3NORA 4NZNA 5HZMA 2NVUB 2DKFA 3D4IA 4N9WA 2X3FA 4RL4A 5AHRA 2IHUA 5JXWA 3CXRA 2FB9A 4R0VA 3OJXA 3O1LA 3KKEA 3DVQX 4GOXA 4YUZA 1WDMA 2OZKA 1DSSG 3JQ8A 3PXBA 1YRLA 4P3KA 4DUYB 4KC0A 4UVHA 4P31A 3BTSA 3AYZB 3RROA 4UBJA 1WETA 2KSQA 4R01A 2Q3CA 5ARCA 5LXTB 2VYNA 1TQ2A 3QKRB 1QGUA 3QVWA 2GK7A 1SD2A 3QVKA 1OGIA 4A0SA 3HB9A 3O75A 4OHKA 5AI5A 4BFCA 1JKJA 3WRXC 1L7QA 2XYPA 4MJXA 4RPLA 1HSZA 3EQ6A 4A8JB 2X7JA 1Y8QA 4YJKA 5E0KB 2FMXA 2R6HA 1HFKA 1KO4A 2JF0A 3OQIA 3UKOA 1J2UA 2DWQA 2FN3A 3DS8A 2XVYA 4N4AA 4NS1A 4ZYLA 3NBAA 5EIFA 2VXCA 4H7IA 5JSKA 2FFHA 2PYZA 5DXJA 3ZD8A 2JDID 3TRDA 3E05A 3JR7A 4AZTA 4ECEA 2ZJAA 1FP4B 1XZNA 3BDAA 5LLDA 1DIOB 1T5OA 2V54A 2FOXA 1QORA 3E9MA 1XTTA 3N2NA 4KLNA 1CY8A 1PWXA 5G0VA 1OYWA 3L6UA 4IEIA 2B6NA 4PLZA 4EEZA 1L8OA 1GRRA 2PL1A 1GYQA 1Y4DE 1KZYC 2FG7C 2H17A 1VG9B 1XVAA 2WUEA 3GEDA 4I14A 2GLXA 3AY3A 4TQ9A 1I4EB 2YZ7A 1M34B 4YMIA 1QH0A 2FN7A 2BFCA 4RMGA 4U6NA 4RWZA 1J9GA 2OL4A 1VDZA 5L3SA 1JYFA 1Z8DA 3V8QA 2IDMA 2WKWA 2NXEA 4OUKX 4TVOA 4KRFA 1EESA 2P41A 3OCUA 4F9FA 1BQ3A 5L4LA 3PG5A 1AKVA 4OUDB 3H9UA 1YRHA 1T2DA 3H5AA 3USZA 1LLFA 4BFVA 1XR3A 1Z6QA 2XVXA 4AB1A 3A6DA 3FWHA 1JHUA 2HAEA 4E88A 2IP4A 5A7HA 2JHGA 1SPBS 1DL5A 4WESA 3KZMA 3IVCA 2C54A 3OI7A 3OZSA 4MI1A 5LKAA 1I24A 4CXMA 3HSSA 4AY6A 2OV8A 5B5SA 3FCYA 4RTLA 3ESDA 2ZCUA 1MIOB 3FVTA 4GVXA 4NBNA 1J0BA 4OQPA 4QXPA 1GL7A 2DMRA 2QYTA 3CIFA 4G81A 3PBKA 5JISA 4X64B 1EFCA 3OMLA 3HEBA 2WWRA 4ISCA 3T8YA 3PPWA 4IFEA 4IWNA 2FWBA 2X5JO 4JWKA 5ALFA 2OFPA 1JP7A 2BELA 2VNSA 2ZJOA 3BN3A 4EB3A 3WGIA 3DOHA 4JK3A 2VHCA 5EPOA 1P2BA 1X1RA 5IT4A 1U63A 2AK3A 4ZODA 4HV4A 3AO0B 4GM0A 3DDNA 1NC3A 2OHJA 2BMDA 3MS7A 3PXDA 1B74A 4RW0A 2AW5A 1T2VA 2PEYA 4A2PA 1O0SA 2B5OA 1H0KA 1UP7A 2BGUA 1J0AA 2W48A 5ENZA 1Y3HA 2EJUA 4JIGA 4DIUA 2EZ8A 4PZAA 1JW9B 3R6TA 4FNMA 4Y1RA 5AK5A 5TMPA 1E59A 1P1JA 4LZNA 2ACKA 4MUBA 5FNVA 5LIRA 3GLIA 1TU3A 3LPCA 3PEFA 4DSNA 2WHYA 3ZTWA 5TX7A 2ONKA 3A2NA 1W75A 4QODA 1Q44A 3NWPA 3M6XA 4LWZA 4UHFA 3FNGA 3RHSA 5AJZA 1GQYA 2IV3A 3UAGA 5EKDA 2VHTA 3PLRA 1I7PA 3SIWA 3QEAZ 4OLJA 3K2IA 4NYJR 3CSUA 1VBKA 1QV6A 2JGMA 3DEZA 4O3MA 1GYRA 1M2JA 1PV2A 3G0GA 3IP1A 2A1UA 3OEED 4C0SA 1RNLA 1NMYA 2B0CA 2R62A 13PKA 3X1ZA 3N7UA 4YRQA 3CNLA 2WPDD 4C03A 2BAGA 3TM5A 1WCIA 3FYUB 1NUSA 3BD7A 4PLGA 3ZGXA 3EG5A 4FJ1A 3DTNA 5CJPA 1B93A 1V5FA 2PUHA 2Z3VA 4G0MA 1NBME 3HFJA 1Z34A 3PRKE 3B6JA 1KVSA 1Z18A 4GI1A 3QOWA 2NVWA 1O7JA 4M0LA 1KO1A 3PA8A 4COOA 2P2GA 4LPKA 4Y1GA 3IB3A 3IJRA 4WNCA 5IUNC 5ALJA 1RPJA 2XHEA 3GCXA 2JZNA 3H1AA 3ZHRA 1WLYA 5BQXA 3TR6A 4IIGA 4FEAA 1RBQA 1BN6A 3N7TA 4RVCA 3EULA 5DWDA 2ZJ3A 5ALOA 1Y3AA 1ZRHA 1V11B 2FPUA 4C4OA 2J9FB 1PX0A 1GOTA 2AOUA 1OQAA 2B3DA 3GBSA 1GTVA 3Q7IA 4WH0A 4UUPA 3SC2A 4B6FA 1RYZA 4OJQA 2C8JA 1P7ZA 3UEOA 3ZKWA 1F2DA 3VV2A 5BWBA 2JAHA 3GUHA 1F0NA 1B3RA 4OGKA 1MD9A 3LS2A 2Z5VA 3PDWA 1H3EA 3W04A 2W8BA 4GICA 4LNUB 2GPYA 2QUHA 4ME6A 2GGSA 2CKDA 3U17A 1J1UA 1JN0A 3SZGA 3ONVA 1YR1A 2X42A 2NO4A 3D3JA 1MEEA 1EXMA 1Y5IA 3VH4A 1ISGA 2DUNA 1BYUA 4AICA 4LY3A 2CB0A 2PMFA 2RKBA 1ZAKA 5KTOA 3EPKA 2EF1A 2UKDA 1DBVO 1F7UA 3K5WA 2PX5A 1YGYA 1GPBA 4EYEA 4G0ZA 3DVLA 5KPDA 4MS3B 4LJKA 1Z5ZA 5FL7D 4N39A 1CUYA 3TEMA 1CVRA 3Q5EA 2NP7A 4MI6A 1UFVA 3BCHA 1YS1X 1I1NA 1OUMA 2NQ8A 1KMIY 3BFXA 5J2UF 2A58A 5IKXA 1GZVA 2RONA 4LBZA 2W2OA 3OJCA 4M9SA 1L3IA 3VR4H 4DR7B 1G59A 1BA3A 3OZRA 5CLQA 1VKZA 2OAQ1 1PD0A 4IOMA 4YMSA 4LXUA 2CBZA 3KTAB 4AYTA 1JEYB 1QIJA 4EG4A 2WA2A 4EQZA 3K0EA 1GUZA 2VUTA 2FF7A 4BPRA 3UMVA 1GKLA 3D2BA 1J8QA 3EW7A 4K1LA 1WABA 2FW9A 4UD2A 2HT6A 1SCAA 4DL9A 1FUIA 4GWLA 4A27A 1J1ZA 2V7XA 3TLAA 2HGZA 2W6QA 1TLTA 3AJEA 3ZVLA 4RTPA 5IEJA 3K32A 4B4WA 1UFOA 2XUKA 4WMLA 3SIXA 1PZHA 5B3JC 1W4RA 3GMTA 4XUEA 1L4UA 2HEGA 5JRJA 1Y1SA 3IAEA 3PFIA 4KIWA 1UEXC 4M4SA 3BSWA 1EGVB 2Z0MA 3GFOA 1EFDN 2XCUA 3QLUA 4JUDX 2YOGA 3TLJA 5C5CA 4G1FA 5BSRA 2A9QA 5IBRA 4ALKA 2AG6A 5BSTA 3BFVA 5K3SA 4B73A 1D4OA 2WF9A 4LY6A 5H80A 1KTVA 4PZEA 5AHXA 3X43A 2A9KA 3UMRA 4GRDA 3WLKX 4I55B 1IHUA 5H9VA 5DM1A 3HE3A 1MENA 3IQDB 1JUDA 3LT4A 2BOVA 4B9AA 2C7BA 3UB3A 3C8DA 4GX2A 2C03A 2AUNA 2DXIA 2FFAA 1SCIA 1A4UA 4X3PA 4C04A 3EGWA 2Q6KA 2EEPA 2ZYAA 3AR2A 4R8RA 10MHA 2ZIAA 4C0LA 3ZE7A 4OQFA 1EVKA 4ZC8A 4RVDA 1GPMA 1PLKA 2BZSA 3PSHA 1DV1A 4IWXA 4UEOA 1GDTA 4DJFC 3GPBA 2GKOA 2FLKA 2GBPA 5EMJA 1M6HA 2WUWE 4KPGA 4BV8A 4ZFNA 3OQ6A 2QMEA 1NQXA 3HBLA 4OB8A 3OA0A 1B41A 2XMCA 4BLWA 2D5IA 2VDVE 1KO7A 3TAHA 2H1SA 2WA1A 4K9LA 1BEZA 5IPFA 5TIIA 1FFXB 3AHGA 3COSA 3C3XA 3UV3A 4G5RA 3L8EA 1B23P 2H48A 5FPYA 2R8OA 3LKVA 5A0VA 5H4GA 4PC2A 1RM4A 3Q87B 1O57A 1L1EA 3AR5A 4TYMA 4WX2B 2RHLA 5JQGB 3IO5A 3CVWA 5TB5A 4Z1OA 1ZH4A 1MRSA 2QTZA 3HV2A 4WI1A 5FI1B 4ND6A 3REQA 3S1AA 1OC4A 2VXOA 2X9LA 1H9BA 3AEKB 2HHJA 1AC5A 2H11A 4FXPA 1BYIA 1WE2A 3EIFA 3O2JA 1F12A 2ZANA 5BXQC 1JSLA 4HCJA 3T5MA 4CMAA 3KR1A 1C7EA 4BKQA 2ZBUA 3R6DA 3T95A 2NX2A 2VP5A 3F1KA 4EATA 4YRNA 4FNAA 4LW8A 4RCZA 4L73A 5BRNA 2G40A 2C2ZA 1D2EA 2C5AA 1OCEA 1B0PA 1BMFD 5DP1A 4WIAA 3MA0A 4X92A 2X0KA 4ZQGA 3SOZA 3X3HA 4YP6A 3ZGLA 1Z37A 4QECA 1V8ZA 3T3OA 1UKVY 3C7TA 1NGSA 3AF4A 3PLAE 2Z4TA 2QUBA 3AI2A 3ICEA 4LY9A 1XXHE 2BJWA 4B74A 4N3AA 1J49A 3HFSA 2WSMA 3B53X 3GAFA 4QOJA 2VTBB 1JVBA 4ZP1A 2G17A 4EKNB 2VRCD 5I4BA 2ECKA 2YWXA 1QGAA 4XVUA 4L3OA 2DPMA 2O8NA 4OCZA 1XA0A 2C97A 3EZFA 4R3WA 1NLUA 2QRVA 4KWEA 5BR4A 2FMHA 2QSUA 7AT1A 1KI9A 5T3UA 1EJBA 4QM7A 1OB2A 1ARZA 1GN8A 1VLQA 1OH6A 2WJYA 4GKKB 1KYVA 3S7ZA 5K4HA 4CLEA 4F45A 5JYDA 3FPKA 1TQ4A 2OSBA 4PXAA 4XGRA 2J0EA 3O95A 4JU8A 4V0MA 1OHHA 2ACWA 3H11B 2FETA 1S9DA 2HWWA 3ZZUA 3NEJA 4AF8A 3BAFA 1J8MF 4IIHA 3JALA 4FR5A 1C3XA 5AICA 5FI0B 4PCLA 1FTQA 1RPTA 3C8MA 3N2KA 3P9KA 2C2BA 2IYXA 3FVRA 4HH4A 1OFTA 1ITZA 4XWWA 1EVJA 3AF0A 4QQFA 3GGGA 4TS4A 1Y1PA 2AMVA 3LBAA 4LISA 2XF2A 4DHEA 5CNMA 1W87A 2ZXEA 8LDHA 2IXTA 2MSKA 2NO0A 1OV4A 2GSWA 2BEKA 4RJJA 2DBQA 4KOAA 1FS4A 2CFSA 2CLHB 2PZJA 2QE6A 3RQSA 5HRCA 3OCVA 1Y0BA 1YK1A 4JLNA 5FUWA 4ZYWA 4UM7A 4RHCA 4B6EA 2NU9A 1HK7A 4W7SA 4LGYA 4U7GA 3K9NA 2WJPA 3K94A 4LJ6A 1OH5A 4GIBA 4JLWA 3E5NA 1Q20A 1L5OA 2BCJQ 2B9EA 5BWOA 4IZOA 4E6PA 3AP1A 4EJMA 3SM9A 1PQWA 4XIJA 2XB9A 3WGJA 4HDKB 3ZDXB 2Z98A 2MSLA 3TIXB 4FFMA 1NRXA 3BHIA 1ZNYA 4G5YA 4OYRA 4X93A 5B64A 5JJLA 1EP9A 1SMKA 2PXHA 1XKQA 3F5SA 4ROTA 4GYJA 1P4HA 2JLBA 1N92A 2DWOA 2XEXA 4Q12A 3TRJA 3U48A 5CXQA 3OKFA 2HRZA 1W4AA 2QKYA 3K96A 5CW2A 1YD7A 2NSJA 1NW4A 1QXSA 4OBBA 5K3OA 4HUQA 4LHXA 5HK9A 5LR6A 3WQBA 3ZJTA 4R71A 4RORA 3AKYA 1Q17A 2EFHB 1QOPB 2G7ZA 3KSRA 1UPCA 2VYFA 2CZQA 4PXYA 5IHPA 2AR0A 2VPXA 4TWRA 4XWTA 2FPRA 1JWLA 1JKIA 5IJ0A 3U9LA 4IQ8A 3LK7A 1HO3A 1WTAA 1FL9A 2GFQA 2OC4A 1IXSB 2D74A 2GDZA 1VLLA 1HORA 4P35A 1XZ8A 2ZG6A 2MSEB 1QYVA 4DLRA 4EW6A 2Q4BA 4TUYA 1RMYA 3DXFA 3EBLA 3PFBA 5IAKA 1YB2A 2AMLA 2G8NA 3LCMA 1GTJ1 5TPWB 1W4ZA 2O1EA 2IK8A 1CR2A 3RRNA 2IUSA 5FBZA 1WZCA 2MSCB 1Q50A 2R25B 3ED1A 2VWGA 5DI3A 3BRWA 3VC1A 4K6KA 3O03A 4Q9DA 2F90A 4WSOA 5G53C 3IBFA 3TTVA 1ORIA 2QI9F 4ER3A 1R5NA 4EVRA 4NATA 3W7AA 2WVGA 3N2LA 1CE8B 3N87A 1NTRA 4ZOAA 3TI9A 1TAUA 3RK0A 2O3TA 4ZEXA 4HH0A 1GGJA 2H1WA 1TYCA 5FADA 2XRYA 4ZPJA 1ACLA 3SJZA 2J0UB 2P6NA 4Q66C 1YMVA 3D6VA 2I3BA 4DIOA 1U6IA 1I7DA 2BFFB 2FPKA 5FBRB 1OBHA 3TI7A 5EWJB 1O9HA 1QYRA 4OBEA 4BJHB 5IYZB 5DNYB 4JJZA 1JWBB 4XPIB 1P5RA 4JVLA 1DOZA 3H1PA 2JJ1A 2WK1A 3KC2A 3KKOA 5HKOA 2Q4DA 1N34B 1ZUHA 2QL5A 3V7WA 821PA 5JH7A 4KWHA 3WNZA 2BP7B 1WB5A 1VJ0A 2Q9BA 3SBDA 1N7GA 4NMMA 1I6LA 3A28A 2V96A 1F2UA 1JMVA 3VR1A 2XYVA 2OHGA 3OC0A 5B1HA 4NCKA 4KMSA 1FNBA 4IGIA 2HHCA 4LXYA 4GHWA 5C53B 3OQJA 1SG6A 4IRXA 4DG9A 4E1VA 4C7XA 3LIPA 5LJLA 4DYDA 2RB5A 4YRFA 4QPCA 1J99A 2FSPA 4KDRA 2FHPA 3FJYA 4G9BA 2JLAA 2O3RA 2PRYA 1Q7BA 2YC2C 1BCSA 4QXOA 2ERCA 1IY1A 1YL5A 5GPBA 4E33A 4F5EA 3BRCA 4HH3C 2ZSBA 4ZK2A 2ZQZA 2QE7A 2JHPA 3AHEA 3CG0A 3KOXA 4JEMA 1Q7CA 4RHTA 1B0UA 5T4EA 4C7OA 4LX0A 1FDUA 1Z3IX 2IVFA 1KJQA 3UKJA 4KN9S 3F4KA 3LQQA 3UMCA 3VPAA 4LF6B 4F4CA 2CT8A 3GFFA 4OHRA 1TCAA 3EVTA 5ECYA 1Q1NA 3GLVA 3SHWA 4C6TB 1GA1A 2IKSA 5A2QA 3GN2A 3CRW1 5CX4A 1PFWA 1QVRA 1XB2A 2IODA 2A9OA 2MSWA 3CZ5A 2ZM6B 1JIIA 4PO3X 2PKXA 4D46A 5DCYA 1DJOA 4G1EB 3JAKA 3WHPA 1U8EA 2FGJA 2GJKA 2BT4A 2IW1A 1AGXA 2H8GA 3QBDA 4LCJA 2IIVA 3VOTA 1BDHA 1NUTA 1OLSB 4OQMA 1GZ3A 3CJRA 2PCJA 2EW8A 5ALLA 5CDGA 1SK9A 3NH6A 3DYVA 3OLCX 1GN9A 4CMCA 4MH0R 2F3QA 3W78A 2R5WA 3PWTA 4DIDA 2XDQB 1RYHA 2WYIA 4OP1A 2PGAA 3H3FA 2EKDA 3QJYA 4IDHA 1RWPA 4W1QA 4JI0B 3EUWA 2F6RA 3MOIA 4FCVA 3KV1A 4YRIA 5CA0B 1X7WA 3KZNA 3T6KA 4TZ6A 2H2FA 4NDAA 2J6BA 3HU5A 2WZQA 3JQCA 3NATA 4WDRA 5GY7A 3L93A 5CIWA 1HE4A 4YDQA 1EHCA 1LPBB 2N1BA 3IQFA 4MUIA 1Z2AA 4MW6A 2G9UA 3VYTB 4CMBA 4AKSA 5FWXB 5K2OA 4NQZA 3MRXA 2YHSA 2R8PA 3DEAA 4NY1A 4AXXA 3RRXA 1PO7A 1M1NA 3KCNA 1SJ9A 2GJ9A 3FWKA 4ID3A 5EZ6B 3T1YB 1NPDA 4PG6A 4KMRA 1HL7A 1DC8A 3TXAA 1QQAA 2V1UA 3BIJA 2VSQA 3DC7A 3HU3A 3OQVA 4HEA1 1RJFA 4WOCA 5H83A 4EPVA 1G55A 1O5TA 1ZC4A 3EIWA 2RKOA 3VNAA 2GEVA 1HYGA 2PNJA 3RT9A 5K6TA 2QM0A 2PV7A 1A8SA 1HBJA 4OH7A 2ZR8A 4RJ2A 2Q7DA 1T9HA 3JQFC 1DVRA 4P36A 3V4LA 4QULA 5D5HA 2WJ4A 2Y1WA 4L85A 1IXRC 4Q3KA 4QOFA 4NBUA 4US2R 4H35A 3H65A 2I66A 1PEAA 4RCYA 2J3IA 5LPNA 5I7VA 4GI2A 2QTVB 1SVUA 1JI0A 1TYZA 5KO2A 2WIBA 1GSIA 1VKOA 3HABA 1LZLA 4OKNA 5AKXA 3U7JA 1DKUA 2RG1A 1ZOIA 4GXQA 4TTAA 3ADDA 1OYYA 4CKEB 2QYOA 4YJ2F 4CM8B 1CZHA 1ZCJA 5ALUA 2Z8YM 4J2OA 4DQLA 5TPZA 1U7UA 1VP3A 1XEXB 3K1TA 4PR3A 3K71B 2DBRA 2V3WA 1PI3A 3PRYA 4ZHQA 1RQGA 1JU4A 4G5SA 2FYTA 4YH1A 2EKLA 1I36A 3L7LA 4HEHA 2I3DA 4DQ0A 5MHTA 3VISA 4DR6B 1LQTA 2PVCA 1H23A 3NRBA 2DR0A 5L7YA 3VO1A 3SU8A 3E23A 4S1VA 3S1SA 2IZ1A 1U6KA 1SRQA 1V8OA 2C31A 3OMXA 2X76A 2Q9CA 1PDWA 2RHMA 3R6GA 5JLJA 1Z17A 2D3WA 2RK6A 2GAIA 1F60A 2VBGA 2Q46A 3CNHA 5ALDA 5EXXA 4CMJA 4EX7A 5JS6A 3CEMA 4AULA 3QI7A 1YS4A 4MR7B 3CLSD 1VL0A 5DSTA 3ZDZB 2OE2A 3QFSA 4E5SA 4E5YA 1OX4A 2HRRA 4GXTA 3PHCA 2PZGA 4LSWA 1W1IA 4EB6B 1NN0A 5CX1A 1DQRA 1TX4B 3GPCA 3JS5A 3W0LB 2YV3A 1UBFA 2JD0A 5AT1A 4ERXA 3L6OO 4J0HA 1H8ED 2PXXA 3HFRA 4Q01A 4CT5A 4LV6A 2QN6A 3LH5A 4EG7A 2W6OA 4QT0A 3CUYA 3R7SA 1WM1A 2MSNA 2CFRA 4XLTA 1S3SA 1LJ8A 2WNHA 3K0CA 4IRMA 1U7OA 1BJTA 5G0SA 3B5JA 3EH2A 2NQ2C 4BQFA 4LOHA 4LMRA 1Y33E 5LYJB 1EWTA 4MYUA 1N77A 2IXBA 4LZJA 4CRWB 1QCDA 3PQ5A 3CPJB 2PSDA 3H99A 5FLYA 4O4HF 3C8HA 521PA 4A8HA 2CSXA 2GN6A 1VPTA 3CH7A 3ESCA 1F4VA 4H59A 3BUSA 1MHPA 2JLRA 4EHDA 2BZ1A 1ENYA 2DWPA 3VSAA 5CH8A 2PUFA 4RELA 3EXG2 3KE8A 3V8NA 3GDOA 5FOVA 4FJ0A 4FCTA 4HJXA 4EA9A 5JEEA 5JRZA 4C6SA 4PIPA 2GB4A 2XTAA 4TRJA 2X9NA 3DL2A 1RSZA 3RSQA 4LIPD 3TWOA 4DIEA 1VGRA 4UE2A 1M0SA 3UGKA 2X0RA 1W4BA 4KQ6A 4LY0A 2J7PD 1NVEA 4O4IA 4Q3NA 2J0SA 3MMZA 5CXSA 2PJDA 2Q9AA 1CPYA 3P2IA 2PGDA 2QG9A 3QKSB 1IEVA 4CTJA 4F5DA 4F86A 4TSKA 1GZHB 3H84A 4O4LF 1Z63A 3O82A 5F52A 4MVJF 4REOA 1IONA 3BORA 2DEUA 3O8RA 1E9BA 2DBZA 4B3GA 2VIIA 1EK2A 3NHWA 3OCCA 5AP9A 1V4BA 1TF2A 5I48A 4UEWA 4X1IB 1CJTC 2FTKE 3CY6A 5F1OA 5BYAA 4A0GA 1Z08A 2QSZA 1BS2A 2PMCA 5TMEA 4CV1A 4G0WA 4MDEA 2O54A 4H6XA 5G3ZA 2RFLA 2XI4A 3DDUA 2I6UA 3ZPXA 1CW2B 5CA1B 5GJCA 1KQFA 4TTVA 4FILA 3N75A 5AVVA 1GRVA 1R9NA 4UPVA 2XUHA 3COPA 1MHTA 1AU9A 3AETB 5B3AA 4G0UA 2PQ6A 3PFCA 2W37A 1WDWB 4DOMA 5BNTA 2O2SA 3LRPA 4XX0B 3OE7D 3E3OA 4HXGA 5EXEA 3HZHA 1GGHA 1S7CA 4HI0E 1JLRA 2OCGA 6NULA 1CWUA 1G8KA 1FE8A 4ZYZA 2ZB3A 4HAWA 1E2DA 2FEOA 1YJAA 3O31A 2RK3A 3I9V6 2G9NA 1FSSA 3W5AA 4O08A 1FFWA 4DBVO 5CD9A 1X1TA 1Y89A 2EX1A 2QTWB 2WP0A 3AHJA 3TMKA 5KVAA 2C3OA 3G68A 1UDAA 4OH1A 3EC2A 2BMVA 1JFFB 1D1QA 1UXKA 3CLHA 3KFXA 3S5UA 1QYWA 5B6IA 4I4LA 3BIOA 7MHTA 2OO5C 2XVAA 3N59A 5IK2A 1RMQA 2IUFA 4MUMA 5K0NA 2PKEA 1WUTA 1V26A 3DVAA 5CFNA 1GV1A 4BX9A 1VHDA 1OWMA 1MB4A 4ZYTA 4DR5B 3JY6A 1L4NA 3FPCA 1H0RA 4GOKA 2EG9A 3QVXA 4RZSA 2NPFA 4JJ8A 2VJCA 3VYVA 4U8HA 3I5XA 1H1LA 5KOYA 1KS9A 5JSUA 1PWYE 2A92A 2OHIA 1IBLB 3WGLA 5F51A 2B7LA 5CITA 3C3WA 1GZ7A 3EA5A 2FPXA 4LMBA 1HLDA 1CFJA 3D7RA 1UC8A 1KAHA 4R9NA 3IAS1 2HH9A 4P4LA 4PGHA 1QHYA 2HB6A 4TMTA 1LF0A 5IAOA 2X8BA 3MEQA 5KKCA 3IXQA 1X9HA 4P4UA 3AF1A 1ODJA 1QQ5A 3VHLB 4O02B 1JG1A 2FH5B 1XZLA 1US8A 5JANA 2VK2A 5EE5B 2OENG 1QCZA 3BRQA 3UXHA 3W2TA 3WKBA 3OC6A 3DULA 1K7SN 2ZSIA 5LQRA 2IA5A 2WNIA 1L7OA 3L1VA 3QVSA 3CSDA 4OQXA 3FG9A 1NQWA 2WQ6A 2ZUEA 2E4VA 1DP4A 2HJVA 2PZEA 3JQBC 1Q92A 1ZQ9A 2CNLA 2VK4A 1P7PA 2CFCA 3L4EA 4K28A 1F5SA 1P2FA 2JFPA 1ZIDA 3NWJA 4OHMA 3WP1B 5HE8A 4S2EA 4L3VA 5A9SB 5JD6A 5GQSA 2RBGA 5F12A 3SS9X 4WBNA 1CQJA 1PDOA 1VI6A 3AB3A 3KQYA 5D01A 1FYDA 4R8MA 4RK1A 4TQAA 3K2BA 4RKWA 4ATNA 1C7IA 3ZHBA 4KYUA 2PKWA 4YS6A 5IM4A 3MCTA 3RK1A 4C1NA 4JBXA 1QZ3A 4GAEA 3U44A 3ZI4A 4LHYA 1E3DA 5K8VA 1YUMA 4ABYA 1C2TA 1FY2A 4X3OA 1UC5B 4AM8A 1JHPA 1CEEA 3ER6A 4KODA 4IJMA 4XLZA 2GK4A 2J8ZA 3WRYC 1PUJA 2QTRA 2XMQA 2E55A 1R5OA 5BN5A 1LY1A 1T26A 1ADFA 1DKMA 4M0UA 2UZ1A 4PTZA 4DWOA 5M34A 3ANMA 4IFIA 3A3NA 3MWJA 3OY7A 2AKYA 5HIJA 1BE0A 3WSTA 1JHDA 1K2VN 1KEEB 3JPYA 2AC4A 4FGZA 2Q4RA 1J8VA 5FULA 1SC1A 3EDMA 5EFOA 1RAGA 2CXPA 1AHNA 1R74A 1UOEA 4PM4A 3FIJA 3N8KA 3OT5A 4L5IA 3WAKA 4AJOA 1SCQA 4PLPA 4NE7A 3RC8A 4DV6B 4BFZA 5ANRB 2AF3C 4DCVA 4E3ZA 1XAIA 3QF4B 2RIPA 3PUVA 3C15C 1PFKA 1Q12A 4XD7A 1GY8A 1IIRA 1NVKA 4QOHA 2I4IA 4RIHA 1OASA 2BEVA 4WXMA 7ADHA 3SVLA 2QT1A 4BE7B 5JFTA 1S3GA 2AEMA 1U1DA 2VTDA 1GZUA 4DC0A 2QXYA 4L4YA 3RUIA 3RYFA 3NH9A 4U4AA 3WLHA 2Z9BA 5CT6A 2I1VB 5THXA 1JEQB 1XN1A 3WK9A 1YFZA 2YFQA 3AHHA 2J3HA 3OIGA 3K7EA 4QJIA 1UKBA 3UMYA 1ZD8A 4WNYA 4I4CA 1N5RA 3R2JA 4HGQA 5AHOA 3M7IA 4JC4A 1B15A 1NUPA 3RM3A 4ZDJA 4HZUB 4PYKA 3P0HA 2W6JD 3F97A 4O33A 5LNK6 4GSKA 1A77A 1EP1B 1HG1A 2CD7A 4MPPA 5B7NA 3HVIA 1S6YA 1GGMA 1KR2A 2OCPA 3V55A 4FGJA 1ZUNA 3R7BA 1WV0A 3ZNQA 1MXFA 2YFHA 4RA9B 1ISIA 4IJ5A 5EMLA 4BX2A 4K9OA 1RE1A 3GC6A 1A8QA 2XAUA 3INNA 4XIIA 4YBZA 1NLFA 3DCJA 5EE3A 1CVIA 3QNWA 3S99A 4KJZA 2B7CA 1QB7A 1LXCA 1ZM2A 3EGXA 1JDTA 2ZS8A 4F6RB 2QBYB 4KUGA 1WJGA 2P0EA 3KSUA 2DBVO 4PZPA 6LDHA 3K6JA 1FFYA 1M66A 4MI9A 1U2EA 4HB2A 4EO7A 2FKNA 2VDLB 4XE5A 4EJ0A 4HC4A 1OWNA 5T67A 2FX3A 4D6YA 2AR9A 2HA3A 3EGEA 4BWVA 1WUJS 2FW6A 2G9ZA 5HQ3B 3ILHA 2CHVA 3N2ZB 1P7WA 2JANA 2IHZA 2HHLA 5B57C 2JFYA 3CLKA 1X87A 2XMPA 4LJ5A 2R96A 1F7VA 2HTEA 3GHHA 1WHSB 2FR8C 4PR0A 5E4YA 3R76A 3ZGVA 1QTRA 1P2SA 1O5IA 3ONDA 1U1FA 4X7PA 4A8PA 5CVTA 4EY6A 1L7BA 3OOYA 5KZMB 1GAQA 3CINA 3NTOA 2RGCA 4R4JA 5KTPA 3QM1A 1FUYB 1LNQA 1PE0A 2G3YA 2OY0A 2HBZA 4WNAA 3EVFA 3TKLA 3VR6A 5JRDS 4X8MA 1V1RB 5LFAA 4YR7A 2W6ID 3DTVA 3INTA 4RXTA 5CVVA 5DISB 4P7KA 4EKDA 4TT8A 3SQDA 1X86B 1P0FA 3A9WA 4G65A 2ZBPA 4QDOA 5FA5A 3H6GA 3OT1B 4MV8A 3NC1C 5HYVA 3NVKI 1CETA 2VDUE 4KH1A 1RWXA 2V45A 3W1WA 2D7DA 3THXA 4Y2YA 5DYNA 3QLVC 4FEYA 5A4KA 4RIIA 2ZBDA 3L7YA 2ZYTX 4ZU1X 3HA5A 4Q3CA 2Q8NA 3BRWD 2VEDA 2BFWA 3HXOA 1N78A 3AVYA 2C3UA 4A2CA 4UUBA 1INLA 1TO2E 1WVIA 1XXHA 2XE6A 3GWGA 4BO5A 1Z2EA 5U9CA 3OVMA 2G04A 5FNVF 4IZHA 2X86A 2JLSA 3B2EA 1S2LA 4G8CA 2QD2A 2IV2X 4JP3A 1YZVA 1LEHA 3FNRA 4N7BA 2JFXA 3PJFA 1JPUA 1G7RA 2UVDA 1MJ5A 3NONA 3O8CA 3HXQA 4GPZA 3VI4B 1FZTA 3GZNB 5CFZA 3OZBA 5EMHA 3OPVA 2H1HA 4EGQA