1ZGHA

Methionyl-trna formyltransferase from clostridium thermocellum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
227
Chain Sequence
LMNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEYILFPHWSWIIPKEIFENFTCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRASMKNGKIIADVEIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionyl-tRNA formyltransferase from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Methionyl-tRNA formyltransferase
total genus 58
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.20 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 1zghA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zghA01
2BLNA 3W7BA 3NRBA 4ZZ0A 3KCQA 1RBYA 1S3IA 1ZLXA 4ZYYA 4TS4A 3GARA 4Q12A 4ZZ3A 1RBZA 1JKXA 1MEOA 3R8XA 3O1LA 4NV1A 4ZYUA 1GARA 3TQQA 3DCJA 1MEJA 1FMTA 1C3EA 4ZYTA 4ZYXA 1CDEA 4ZYWA 2YWRA 1ZGHA 4ZZ1A 1RBQA 3OBIA 3LOUA 4ZZ2A 3AUFA 1RC1A 5CJJA 2CFIA 4ZYVA 1YRWA 4EW1A 5J63A 5J9FA 4QPDA 4TT8A 3P9XA 4DS3A 4S1NA 4EW3A 4PZUA 4YFYA 4EW2A 1C2TA 2FMTA 3N0VA 3Q0IA 4YFVA 4QPCA 1RC0A 2GARA 3AV3A 3DA8A 4TTSA 4ZYZA 1MENA 1ZLYA 1NJSA 3TQRA 1CDDA 1RBMA 4R8VA 2BW0A 1GRCA 4IQFA
chains in the Genus database with same CATH superfamily
4DLNA 3GV0A 3ZGVA 1X14A 2D59A 2FSSA 3QVWA 4PIPA 2C83A 3ROGA 3SSNA 5H8WA 2GAFA 4QODA 3U16A 4P5EA 1JBQA 1Q0PA 1QS0A 3N2YA 3DFUA 5CH3A 2I2BA 3VAAA 3C5VA 4BZXA 2YVAA 1V8FA 3MMPA 4ARCA 5JZBA 3NAZA 3W2GA 1B4DA 4DA8A 3CM0A 4IOJA 1Q1AA 1GN9A 4EIWA 2JEZA 1JU4A 2Y2UA 3DZKA 1E3DA 4ZVNA 1RKQA 2PDAA 1USVA 2WDPA 4L76A 1Z0AA 4LRQA 2WG2A 4QJ4A 2QUHA 1T5SA 2PKQO 4I5GA 3ZHOA 4YUZA 1X87A 3DR5A 3LLVA 2FCRA 2PT9A 4BMZA 4CWAA 1MO6A 3EWSA 1LBQA 1UWCA 4M8SA 4E2ZA 4EBBA 2P8JA 5BQ3A 5E6SB 5C1BA 1VLJA 4B8ZA 5CBPB 3LPDA 5JYBA 3D5QA 2EVWX 2C4UA 4U7GA 4ZT7A 3ZHQA 4BKRA 2WNSA 2F48A 2VH1A 3E84A 4GM4A 4ZZ0A 3A31A 4QDOA 1PL0A 4HSEA 5G4KA 1T0PA 2LE0A 1YRBA 2R7AA 1GT91 1G8GA 1EGQA 2GH1A 2HUPA 3GEBA 3UH1A 3SDBA 4Z99A 1TKAA 3W3AH 5H9WA 3P9IA 2QDXA 2YFHA 4QNMA 4JVLA 3NTUA 4HYTA 1CJCA 3ZS9A 4EX7A 2WUWE 3WO0A 3OPXA 1UFQA 3ZN2A 4EPTA 5LCXA 1VMIA 4LDNA 5I45A 5ALGA 1SULA 3U7JA 3SZMA 3AMVA 1H1LA 5I7FA 3JQAD 1ZHHA 5TIIA 1UPXA 1IPFA 5DO9A 3T5TA 1XPUA 1RP7A 2PJRA 4YA6A 1P1CA 3BWYA 3X1JA 5BOSA 1O0CA 3D8NA 3NOXA 3UMSA 2PJDA 2V3VA 3EFHA 4RKYA 4LHWA 1NMYA 1UZUA 1XALA 1SC4A 3GZTB 1I14A 1QE3A 1KEUA 2QRKA 3UFBA 3E5NA 4O2LA 3AZOA 3HP7A 4CMJA 4DLBA 4OMUA 1EJ0A 2Z5VA 4KR6A 3LVQE 5J5VA 1DMRA 3PHLA 1LDGA 1KDYA 4IWNA 2PBZA 2AI2A 5H80A 1BA3A 4G0NA 4P7FA 3KV3O 3UAWA 3QMPA 2R7LA 4B17A 4KAAA 1XXLA 3CSSA 4N3CA 3V8VA 2PSSA 5DLDA 1W36B 3HUFA 3PCTA 2HA3A 4PY2A 5FLEX 1JJBA 3HXPA 3TVDA 1M75A 4AY4A 4GU5A 4FZRA 1FU7A 1GZ7A 1Y9DA 1YJAA 1DIHA 1GRRA 2HDOA 4JXZA 5C9ZA 1DPGA 1UJNA 1TUBA 3VXKA 1QTIA 1X9IA 2FRDC 3P52A 5IUNC 5KNBA 2G6TA 4H17A 5EZYB 4D4JA 4ZYWA 3NIDB 4H77A 4EG5A 1UBSB 5CB8A 1I4TD 4Q7QA 1L0BA 2ZSUA 4HF7A 4LZPA 1VE3A 2HHJA 4H08A 1IJFA 4Q7EA 5C37A 5GIPE 5BSVA 4UW9A 1AX9A 1T4GA 5LBTA 4I9GA 2VF5X 4DAEA 2UUOA 1XTPA 5TF0A 4EL5A 5AUNB 2TMKA 3I5AA 2NYRA 3AB8A 5JFGA 1PR3A 1DBWA 1IY8A 4CF5A 1VJTA 7ADHA 1AS0A 3R0QA 2B37A 4KQCA 4HRXA 4N5NA 1NBME 1KEEA 4N39A 1BSVA 5I3ZA 1J1ZA 1VLZA 4MKIA 4HYYA 2OYCA 3U4HA 1MA0A 4XM1A 3RV3A 1VM6A 2H9AA 1JHXA 1QK5A 2CNWA 1KQ3A 1PJAA 4DC9A 4FFMA 2OV1A 3E27A 3N1UA 5LQCA 3VZPA 3THYB 2P6OA 1DWPA 4EQ6A 2BF7A 4PZ0A 3VHXA 1G4AE 3G0OA 1W0JA 4RGYA 2P6MA 1GAXA 2CWWA 1JR4A 4KVGA 1QH0A 3DM9B 4NCNA 5KVSA 2F1KA 3HN7A 1C5KA 4JJZA 4LVNA 2YHBA 4PIVA 3HJTA 5SYNA 4A0HA 4CMIA 3U7GA 1C9JA 2EJWA 3BL5A 2NO7A 3AILA 4XJVA 4DY4A 3G02A 2X22A 4MPTA 4XSVA 4JL8A 1EYZA 1JNXX 3T1OA 1VDZA 5BUZA 1D2NA 1L5WA 2G40A 4IJUA 1Y6FA 2WM9B 2W90A 1N5LA 3QJ5A 4Q7MB 3WJ2A 3COPA 4HUTA 1KP2A 1V5GA 2PGNA 3I2HA 3NUZA 4K6MA 4KXXA 2HSZA 5H1YA 2DEUA 2PUCA 1PJCA 1E8NA 2AEEA 2F1HA 2JI8A 4LVOA 4WMLA 5FWDA 5NLLA 1D2RA 3GLTA 3DBRA 3DEFA 4B3CA 1NOKA 3QIAA 3CO5A 3ZV4A 1WMDA 3O95A 2EP5A 2Q8QA 1Z5WA 3C14C 4YDRA 2XYHA 4J9VA 4B6JA 3EYAA 4KDRA 4KBYA 4XKJA 5BSWA 4GVXA 5FOVA 3DPSA 1PN3A 3E48A 2VWPA 3EIHA 4GZ6A 1MPXA 1QLWA 4ZRMA 3KB6A 1XL1A 5MHTA 1LBIA 4WLNA 4B3GA 3NBMA 2IZZA 4PVDA 2H4FA 4PIMA 3MWEB 2JKZA 3ZC3A 2BRUA 1MHTA 4OV6B 2FPGB 2A9JA 4POAA 5L3QA 2VPXA 5A1TA 1TYBE 1Z0FA 1AHPA 1EP9A 3I9MA 1SHJA 4KE7A 3ZS8A 2WA1A 4KK3A 2IP2A 2Y1CA 1SZCA 1U9CA 2IDKA 1EQ2A 1OE0A 2ZJ8A 3L43A 3DZJA 2FMIA 1UIRA 3ILXA 2D3WA 3BTOA 4MAFA 4WOKA 5DB4A 5ALTA 3WLIA 4AZTA 1SN7A 4OLBA 4IKEA 1B2RA 4ZK6A 3KEFA 5KQLA 4KH0A 2HH9A 3GGCA 4FHFA 1IZ8A 4DJ5X 1USKA 2VKQA 3S44A 1JHRA 4TKVB 1EBUA 4ZO7A 4OX9B 3T7JA 1MBZA 3VNRA 1OOEA 1QGDA 3NZEA 1KQPA 1MRZA 2F3TA 4PQGA 2IQIA 5E4YA 5AIAA 3F0TA 5ENZA 2RHTA 3HKEB 1Q77A 5DGIA 4MQEB 3QPCA 5HQTA 2EW8A 5LZ4A 2Z5FA 3GARA 4YP1A 4EB0A 3JQ8A 3VPGA 2NVUB 1GPMA 2EG5A 5J3JA 3EX7C 1DAHA 4NKRA 3L4BC 5HHTA 2ZRDA 5J2TB 4YQEA 7AT1A 3DMNA 2Y27A 3A3OA 4ZCLA 1UFOA 3GG9A 1BMQA 4CMHA 3N2NA 3VR6D 3L18A 1PIWA 1VIAA 2VDUE 3G2KA 3GNLA 4PHFA 4YP5A 2HX1A 3VU1A 1JLRA 4E2YA 2L2QA 4B6RA 2E87A 4E5NA 1A9SA 1QTRA 5D3QA 5LNK1 2ECKA 2IJGX 4B3SB 5CA0F 3OMWA 1ATZA 4E6PA 3RU3A 2H59A 2AMVA 3ZJ4A 2AF4C 4MKRA 3D6FA 4MV6A 1YO6A 2OUIA 3HB5X 3H5LA 1E3EA 2GTHA 1W49A 5E9WA 4L72A 4XYEA 2OD2A 5JNUA 2DBZA 3BXOA 3GD5A 4LGCA 3TLBA 3FNFA 2CEKA 4XM2A 1EFTA 5LDHA 1FDTA 2BMVA 4YIHA 1B8OA 1RRGA 4ESEA 2FDCA 4G5RA 5IM5A 4X85A 3S68A 5DKFA 4IFBA 3T7SA 3DBVO 4CR6A 2GK3A 3VPXA 3QEAZ 2YHSA 2QTLA 2WR8A 3EEIA 4PZYA 3UMBA 4E5YA 5H4GA 4EP1A 1NMQA 1UBOS 3SPXA 3TZQA 4R16A 1TAHA 1YTLA 2A5LA 1FDWA 2FMKA 5ICEA 4R1SA 4WH0A 2G71A 1FQKA 2QN6A 1XU9A 2B99A 2AG1A 4G41A 1YQQA 2CXUA 4MQFB 3QE3A 3OQMA 2NVWA 3I37X 3W6PA 3L5KA 3RVPA 4ZT6A 2NSYA 5DN9A 1XMQB 3FTPA 2C7VA 5CUQA 5H70A 3TLGA 3HL4A 1ZX1A 3K1YA 1RE0A 1FDOA 1R8XA 2GZ1A 3IKJA 3DONA 5ECGC 2Q28A 4RJJA 5ALIA 4LTMA 2YV2A 4WA7A 1O08A 4QUGA 1RHMA 5DU2A 2PIDA 1D0IA 3PDHA 4V2UA 1EUDB 1RE1A 3O3OB 4EYSA 4D0NA 3HP1A 4EHBA 4J0EA 3ANMA 4B6SA 3P96A 3PVCA 5AO9A 5CB0A 1FVFA 1GPAA 5TGDA 2RBGA 4DMLA 4J16A 2H2FA 1E1RD 1BKSB 2QW0X 4LJ5A 4KXVA 5D85A 1E4EA 4MNTA 4NL4H 4D0LB 2YV1A 4AS1A 3BERA 3AP3A 3QHAA 2OTCA 1Y1QA 3DBOB 4JSRA 4E03A 4FB5A 1JPNA 3EPRA 4HGPA 1VQ1A 3H97A 3EQZA 2YMMA 1X7ZA 3S2EA 3CEAA 5EUMA 1VPWA 2IX9A 3A1EA 3BS4A 1EFPB 3OEHA 4K9LA 4R2LA 1IQUA 2BEVB 4IHKA 1QDEA 3GRAA 5K3OA 1OFUA 1QLJA 1U0HC 4I1IA 1VHQA 2P27A 3GZNB 3MQFA 5BWMA 4Z8YA 1R9NA 2NADA 3ENQA 3N2IA 3OIWA 5EEGA 5AW9A 4C01A 1CUDA 4YN3A 1KEVA 2OKCA 2ORVA 3MMZA 4NZPA 4YJHA 3RNLA 3ANSA 3U4DA 1KK1A 1UQUA 2A9KA 1IHPA 2WIDA 1K08A 1XN4A 3G0GA 5C31A 2CV2A 1BW9A 1T5BA 1P6XA 2PV0A 3G82C 5JD6A 2CV1A 1EUZA 1ITZA 4PGGA 4MKGA 3PLRA 4QFCA 2E4UA 3UN1A 4MDEA 1QGED 3EUFA 1DKRA 2IXFA 4ZA2A 5IUKC 4ESVA 2HA7A 2XOKA 4U39A 4K9MA 4U2KA 1C3XA 1MAVA 1C0PA 2QGFA 5HUHA 1E0AA 3H8WA 1W94A 3AI7A 1X70A 1PHPA 3NP9A 3PJGA 2MR6A 4B6FA 1A9YA 4LF9B 3JD4A 3IEXA 2X0JA 2V6MA 3FCXA 2FPMA 2RHBA 4FJ0A 2AQIA 3F3SA 2XE7A 2G67A 4Q48A 3TTYA 1E9FA 5EMHA 5A9SA 3BXGA 4KIWA 1KFBB 2A92A 1K3UB 3OE7D 3BWCA 5ALKA 2P2SA 5FFMA 3T1YB 2UVPB 1UC5B 1F8XA 1CUCA 1NVBA 3Q3EA 4YXWA 4EB3A 3CSUA 1KBOA 1FMLA 4HJXA 2ZI5A 3IR6A 1GSAA 3FAKA 3CLRD 1WP4A 3L77A 4N18A 2GPWA 2RGNA 3ICCA 1KAEA 2FR1A 3IP1A 4TZKA 1M74A 4XPIA 1NN0A 3FYCA 5M29A 3S8EA 2PU5A 1KBQA 3U6KA 2FHSA 2PQ0A 3GA7A 2F00A 1Z8HA 4FW8A 1EB8A 4UNPA 2H7YA 2IW1A 2PRZA 1Q1EA 1SCBA 2WV7A 4KI7A 5I4CA 2P6RA 5ICFA 3LOUA 3ITNA 2BTQB 3OSZA 2O8CB 3LX4A 4NK4A 4PLCA 4QPJC 2RK6A 3NXKA 2V6IA 2GA8A 4DWOA 3I2IA 3ZWMA 3WNQA 1DKQA 4OHPA 4O33A 3CWCA 3FYSA 4NAUA 4TXHA 4MWSA 2FMTA 1W19A 2ZAYA 1XEXA 1PQWA 2GARA 3RC7A 3COJA 2QAGA 3I1YA 1DUSA 2J4CA 4OQZA 1IHDA 3C3JA 4B3MB 1BE8A 2OOKA 5CH8A 4MICA 3E7DA 1FXSA 5CMLA 3PD1A 5JD3A 3K6SB 1ZJJA 3GGSA 1QB8A 3GAFA 3RFCA 1T9HA 3JQRA 2PMWB 2F3SA 2P9GA 1S3FA 4OF4A 2DPHA 1X8JA 2XMCA 3DDWA 3UBTA 3ZGXA 3ND7A 4CW7A 3B3JA 3G68A 1TADA 3T1TA 3EZYA 5EJ9A 3AUFA 3AVQA 2PA0A 4HLQB 5HK8A 2WAOA 5J63A 1QGUB 4B3FX 5A3RA 3ZLUA 1PW7A 2WAAA 4RPJA 5KYKA 2VHXA 1MC8A 4PZUA 2ACEA 1CY0A 1Y1SA 4J0DA 4ND8A 2GHRA 3UBMA 1ZP6A 5J1SB 1ZZGA 1ZK4A 3GU3A 1SBIA 2DP4E 3C4VA 4RIHA 1T6ZA 2IWRA 3IDAA 5L4NA 1K7CA 2X9LA 2Q46A 3FOBA 3NKVA 3QKTA 4LOIA 4I1OA 5KTMA 1YJBA 5GM2A 5THQA 1P0IA 1DJQA 2XB9A 4D8VA 2YHAA 4RK6A 4YAUA 3WYCA 1CUSA 4PPQA 4AMUA 1VLVA 1BO6A 4PSCA 4HN9A 1BHO1 2GKGA 3NC1C 3RVMA 1P2DA 3U4QA 3A3KA 3HBNA 3OICA 2HT6A 3KJEA 1BE0A 2EC5A 5DK4A 1LUAA 1E69A 1T5TA 2GUWA 2R4TA 1ZUHA 5JLAA 5TS3A 4BE4A 1JJFA 3N9IA 3UMCA 1NW7A 4RQUA 5L4LA 1NW8A 1V8DA 4NS1A 4FDAA 3GLIE 1GADO 1BDIA 4XWAA 1WLYA 2FZLA 2PAFA 1V25A 2K7FA 1EAYA 2X2OA 3SGLA 3ZQUA 2ZTVA 3PWTA 3HR7A 4MIOA 4MGHA 4G1VA 3PDJA 3JQBC 3HUTA 4HDNB 5ILOA 4N65A 5EE0A 1LS1A 3BA1A 4GKBA 3VPHA 2XCUA 4YIKA 2B78A 3QWHA 4LF8B 2V0NA 3PNYA 1KYTA 1GRCA 3C6KA 5DSZA 1MLDA 2YIDA 2G4VA 3ORSA 4AM8A 3ANNA 4LZNA 2CHQA 1Q1QA 4C4SA 1TAQA 4EB6B 3L0BA 2VK2A 2HJ9A 1THGA 2HBZA 2CF5A 3KZXA 2GHIA 4R1NA 1IJEA 3ZWPA 1RDFA 5HIKA 5LR6A 3VSCA 3KETA 2G9NA 3GPDG 1XNHA 5FL7A 4C78A 1UM8A 2QLMA 4F96A 2OHVA 3I23A 4MPPA 2CUZA 4F3NA 1HV8A 3LY8A 3NX4A 5DCUA 2G1AA 4CDRA 3ESCA 4DEXA 3PJRA 3JZAA 4HXEB 1JILA 1WMAA 2NYUA 4KRXA 1N2BA 1NTRA 3BQMB 4S1VA 4TTSA 3EHEA 4WUVA 5A7GA 3RS0A 3W6OA 2JANA 5HS6A 1SAYA 2WWTA 2NZUG 3LM8A 3OFVA 3TJRA 3MYYA 2JFPA 3WSWA 2ZR8A 2C3PA 4UE6A 3RTBA 1HA3A 1GPBA 5KTPA 1BROA 4RS3A 4DPKA 3O1JC 1ZISA 2X5NA 1SIUA 2ZTSA 4FE3A 5DLEA 3UEOA 5CCBA 4FTWA 4CKEB 4P4TA 1ADBA 4M37A 1OWOA 4PCVA 1OFIA 4MJ7A 3J81k 1UQRA 1J5XA 3WAKA 4M53A 3R8FA 4ZOAA 2PL3A 2CMHA 5JNTA 1HLGA 3B6ZA 3FFXA 5LQKA 2KMLA 4CEHB 1ZAKA 3OE1A 3GLHE 2CLDX 4HGRA 4I50B 4WXRA 3I01A 2B83A 2A78A 3NI2A 3VNAA 1QIFA 1T6YA 3W3AD 4R8KA 1BG6A 2DFNA 2JFGA 4PF1A 1GKYA 4RZSA 2W6PA 3B6EA 3DTVD 3GP3A 1KTVA 3NWOA 4X8MA 1GCOA 4X6LA 3ZJ5A 3C3WA 4R3NA 4HLCA 3DULA 4ISBA 2IYAA 3NYIA 3HKEA 1CLEA 3X1WA 1GZUA 4UQOA 2GN8A 2NZ8A 5BUCA 2BFWA 3K5WA 2GBLC 3F6PA 3AR7A 3A6ZA 1IXRC 2C54A 2VA8A 4GVPA 5L7TA 2P68A 4N54A 3UJAA 3FDZB 5FWXB 3C3MA 4ZOEA 5J1TB 1TM1E 4K87A 2HCRA 5GONA 4JLJA 3PGJA 3JTEA 3ZGYA 3QVXA 2JGFA 4K9OA 1PT6A 1EUCB 3FWZA 4TXJA 1NW5A 5KC8A 4MGIR 1PK8A 3QVGA 1U5BB 1GNQA 2H07A 3S5JA 2ZKIA 4B7ZA 1XF9A 4A27A 1G8PA 3T1VA 3UNXA 3I92A 2ONZA 2AUMA 1QIKA 1RFGE 4PCLA 1WV1A 1PWEA 1GV1A 1N1DA 1WCV1 1L7DA 4CUJA 5CPFA 4G0MA 3K70C 1KC3A 3TQQA 3CX3A 3GUCA 4Q18A 1FXWF 1A69A 1CE8B 1UWKA 2B7BA 4FGUA 4P4SB 3HGMA 4YMVA 4DV7B 2I91A 5AJVB 3A2MA 1PTJC 2XKJE 3U17A 3GLFE 3NBUA 3LUKA 1AUQA 1ZK1A 2GN4A 1GLNA 1FVOA 2M6LA 8ADHA 2HMUA 1P6QA 3C85A 2HBQA 2PXHA 1YOVA 4I4TB 1IVNA 3V2IA 1VL2A 3DF9A 3DVSX 2NP7A 4AO8A 3TGLA 1L4LA 3EEFA 4Y0VA 2VYQA 5GOZA 1HM5A 7REQB 2GAAA 3QWAA 2ZIZA 3FSRA 4FWIB 1U0GA 4ZVLA 1J6UA 1SBTA 4UOQA 3EVDA 4QKQA 3SVTA 1PHRA 4A91A 1ZUD1 1C7EA 3IGFA 3K0HA 1X13A 3B36A 4PQYA 1DEXA 3HZOA 4RD4A 1MW8X 3AR2A 4UEJA 3TKAA 2IC5A 2J0EA 2G5GX 1VKHA 1KXJA 2IVFA 5A3JA 2R1VA 1Z6TA 3GXOA 1DFIA 4X65B 2OAEA 1L8OA 2VWQA 4M1SA 4CMKA 2HEGA 5TXGA 2JFNA 4RO0A 3DAPA 4OQYA 5FXMA 2G8LA 2JASA 4KV7A 4AZ3A 5CGQB 2XXAB 3E9EA 3K5PA 3N5CA 4RC9A 4C1BA 5LOVB 2BFFB 2WFMA 4Z54A 3D6UA 4S2UA 1V4VA 4Q4HB 3IV9A 5LXTA 2CCKA 1PSZA 3HJCA 3MM4A 4O4JB 4A15A 1C8LA 3SI7A 4ADSG 4FXPA 1YRYE 4XB1A 4Q0MA 1RQ7A 5KCMA 4H1WA 2RHRA 2VDMB 4F4UA 3CNOA 3BD9A 5B7QA 3URKA 4MR9B 1XZ8A 2NZVG 3G2MA 1KZHA 3S2IA 2XMQA 1W5SA 3CJRA 3HGTA 4E3WA 1E92A 3WLSA 1NW3A 2BFCB 3G9XA 1YB2A 4CCAA 4DSOA 4EBFA 5A6SB 1YUMA 1YULA 4GLJA 1Q0RA 5CIQA 5JDCC 5BRJA 2OAQ1 2V6FA 4Z6KA 2OCDA 3JYLA 3CO0S 3H2GA 3RFUA 4M49A 3W1EA 2HHCA 4BKPA 5FHRA 5KWSA 1GAQA 3T8YA 3OD1A 4DCMA 2I2CA 1UPUA 2A1IA 4BFCA 1EX6A 2FXIA 1BTOA 1RWBA 1LSUA 1VECA 1YIOA 3FPJA 4Q9NA 3FAZA 4IMRA 2R85A 4WKPA 5EHQA 3PDCA 3DG9A 3V32A 1ZGJA 4YRPA 4NMLA 1EFKA 3CLTD 2QD2A 2R66A 4JBGA 4UFPA 1XVUA 4C0KA 1XR3A 1UK7A 4D8XA 4Q37A 2OXTA 2B34A 2OGUA 4DQUA 2IDZA 1SCQA 1UKEA 5CK4A 3RHZA 1ZRHA 2H0AA 5KWEA 4KDFA 2ZVPX 3D3NA 1CG6A 4GI5A 1JAIA 3S5UA 3NHAA 4F9EA 4P5DA 3UB4A 3X1YA 2ATIA 5H7XA 3TRHA 3L2OB 1C7FA 1XK7A 3DBIA 1T0HB 2ZIWB 1P7YA 4BGUA 1V11A 2P9EA 5ITZB 1EHIA 3SXPA 3S8YA 3LQQA 2W2QA 5B3LA 1XKLA 2PGAA 4Q3OA 5FOSA 2GKOA 1NJ1A 3LBYA 5JSUA 5H9VA 1DBPA 1E5XA 4C30A 4EPYA 5LYJF 1KHTA 1Y5NA 4CVNA 2YHIA 4BB5A 1GILA 1S8FA 2HMVA 4RHTA 2GF2A 4X1KA 5GTDA 3WBBA 5LU9A 3UG7A 3IIIA 1LJLA 1T5IA 2FR8A 2Y05A 1KDVA 3PQFA 5CDSA 1QZTA 3NYWA 2WKWA 3ASUA 4XVRA 4ETWA 1YNOA 3MB5A 3L0IB 1T1RA 1M1NA 4ITVA 4PLHA 3UZUA 4ND5A 1JU9A 4UAUA 3ZCXA 4EITA 3FCYA 3ZOKA 4CGYA 4GYJA 4U7PB 2WYWA 1UBFA 2AN1A 4CF4A 5K0CA 2GZ3A 3BMQA 4PN7A 5C8YF 1DG3A 1HL3A 1XEXB 5AESA 5ICGA 2EFEB 4PLTA 2H3HA 5LBIA 3Q88A 4TPKA 1T2EA 1DEOA 3AM1A 4O2BA 3D0QA 1F48A 1JGTA 4I46A 3MELA 2X4DA 3ILYA 4HX2A 5FPHA 1U1FA 1L5HA 2XMDA 3OCWA 3GFRA 4ROTA 3THOA 3ELDA 4DDTA 1P1JA 4YH1A 2GJ4A 3CVOA 5CLLA 3T1NA 4K9PA 1P73A 3P2KA 4MP3A 2E6KA 2C7PA 3VOTA 1MVNA 3EZ2A 4MX8A 5AKLA 4NQZA 2J0SA 4M0PA 1E1LA 4QUAA 4V0RA 4C4TA 3LBFA 4YRTA 1Q7EA 5FPKA 1UBMS 3SZLA 3JQ9A 3AH8A 1RWWA 1O03A 1R4NA 4XQ0A 3SHQA 3Q3GE 3TSAA 5FNVF 3BMXA 4G5SA 4FR2A 4L3VA 1J0EA 1ESCA 4Q00A 1NL3A 2FRVA 1N6RA 4DL9A 1UMBA 1TD1A 2YBEA 1LLDA 1VSQA 3LC0A 3T1HB 4A0QA 4L6CA 4EY8A 2H4YA 3GDWA 2I4LA 1RKUA 1T5DX 2XUDA 2O2DA 3DO8A 3B6JA 4D4KA 4F38A 4UM8B 3MGKA 4RDXA 2PS0A 4UHHA 1G66A 4Q1FA 3DMPA 3FPHA 4N8SA 3UUEA 3OQOA 2G70A 2HJRA 2OBNA 1FFCA 1ZINA 3I45A 4TTPA 1PV2A 4A5OA 5IT9A 1U0LA 2AOTA 2B0JA 4ZT4A 3GX1A 2VUUA 5DHQA 4ZEOA 1OI7A 4E4TA 2ZYHA 2W2LD 3KLMX 4UPDA 5IPFA 4D3DA 2I71A 3ZW9A 3TEJA 3MTIA 3SOZA 2QSZA 2ZWVA 3WB1A 5IU6A 4KXFB 1SBYA 4UBJA 1N2CB 4KFUA 5A62A 5KNCA 3WGLA 2YNMC 1A98A 2ZQ5A 4QBGB 3OZXA 4N03A 1LLCA 3PQ4A 4CUKA 4D4GA 3F6YA 5JATA 4HMQA 4NXNB 4AN0A 4HNTA 2CUNA 2M32A 4H3SA 3QVSA 4KFSA 2REBA 4QDJA 4YK7A 5DRYA 5IC5A 4R7GA 1RADA 4EJSC 1A5ZA 5AICA 3TPCA 3M6WA 3RVOA 4QRDA 2A94A 2VFAA 1Z2EA 2ASVA 5CX4A 4KPGA 1X42A 2AMYA 4IQ8A 4P3OA 2J08A 3TGPA 3RYCB 4BNHA 2A33A 3THSA 3C3BA 1ECGA 2QW8A 1WD7A 3DKRA 3W5DA 2JAPA 4HTFA 2NT4A 4MUKA 2GXSA 4DDMA 1VG8A 2DR2A 1MJHA 4S2EA 5JADA 5MFZA 2VSNA 4W5OA 3SKXA 3M9LA 4DIKA 4K7JA 3KT3A 3R5XA 4ND3A 4QGBA 3MTDA 3SBXA 2H2WA 1RAHA 3JZIA 3AFHA 3RU7A 2F7SA 1NOIA 1NLMA 3UHJA 2X1VA 2AD1A 2JGRA 3GI1A 3WJ1A 4Z3KA 1C1YA 2JCXA 4V1CI 3BYZA 4RPHA 5J2TF 3KBBA 4CLOA 2CDRA 2ZIEA 3HBMA 4E22A 1SC6A 3TIFA 4E5MA 2GJ8A 3TRKA 2J31A 3T54A 2O8FA 4HDRB 1OXXK 2ZSEA 4RJLA 2VQ3A 4UU8A 3VBEA 1MD9A 2IKSA 3ZE1B 4CR7A 5B2EA 1Y8CA 2HADA 5D6OA 3U4MA 1C1DB 1P3DA 4OXIA 3UJ7A 4F04A 4GWKA 3P9PA 3W7VA 1Z8FA 1RXCA 5IM4F 2ZUVA 2LZ0A 3QHPA 5CYPA 1AGNA 5C0OE 3QSGA 3U39A 4RCVA 1MAAA 3SYNA 2JLAA 4JELA 1K5PA 1LX7A 3KQOA 3ZCRA 3OHMA 3QEMA 4HV4A 4Y1GA 3ESYA 4WLFA 2PX5A 4KIUA 4G8JA 3EXG2 3TAUA 2YIMA 4EYKA 1Z5OA 1KOFA 2C20A 3GVPA 5AOVA 3ESQA 3LXRA 1TW2A 4TLEA 1H2EA 4QFDA 4IVPA 1PL6A 2BHSA 1BHSA 3PC3A 4HPJB 5L3SA 2D54A 1QZ3A 3WG9A 5B7NA 3M1AA 4MS1A 3RRYA 4XJTA 4ENUA 4G25A 3JASB 4P58A 3PUJA 1PDWA 4IIJF 4DMRA 4ZT3A 1J07A 3TZ6A 3H04A 1KR5A 1B76A 4KDCA 4UVDA 3W2TA 3U4QB 3JPWA 4F6CA 2FHPA 3OOEA 3SX4A 3FN4A 3EW7A 4MIEA 3G7NA 4N7RA 3QLTA 2B36A 4TMYA 2X0FA 5A06A 4GKVA 1JR3E 2EL9A 3LNCA 4RE6A 2AKEA 1NRXA 1Y7PA 2A7QA 1WU7A 5FI3A 3MF4A 2X1LA 4Q93A 2CGEA 2WVGA 3U49A 1VB3A 3KO8A 4AJ1A 2R8BA 2QP9X 2AKAB 1NG1A 3T4PA 3LUPA 3HFGA 5LD2B 3QWIA 4HNQA 1DQPA 1THZA 2QKYA 5AWFC 5YASA 3OQIA 1DEKA 3V1TC 1LLFA 5HKAA 2QTFA 3ED1A 3AF6A 5GINE 1MENA 3BCUA 3BEDA 3GEHA 4I55A 5H59A 5C34B 1XNJA 2HXYA 4TKUA 4BWVA 1U2DC 2CCJA 2XRYA 2NT3A 3CCCA 3K30A 4GQBA 5BWBA 1DKPA 1XKQA 3CKYA 5CEJA 1M83A 2PPVA 3K7EA 4YAOA 2ZRMA 3X0DA 3PNVA 1PYGA 5L40A 4ZZ2A 3UCFA 1EI9A 3PDIB 3UCEA 2YCBA 4YT5A 4ZJUA 5HE9A 2I34A 3H9EO 5BRNA 4ZCTA 2VH2A 4HWGA 5ISMA 4OHYA 1CY2A 1MXFA 2VHVA 4RFSB 1PR4A 1KJIA 2VYVA 4K6GA 3CW8X 4LGMA 4L95C 4DG5A 5ALYA 3MTJA 1WDMA 4BCBA 1ZG3A 4IV8A 4P83A 5LOVF 3N2LA 2ACWA 4IQFA 1TTTA 3BKXA 3PDWA 5A9RA 3IMEA 5FOQA 1W0CA 4JOSA 1M3SA 1XTSA 1Z6PA 4IILA 5CW1A 2IHZA 1X74A 4Q3KA 5ELLA 1CUGA 4M99A 4DMHA 3IH5A 4O4LB 5HK9A 2CJYA 2EGHA 1H0KA 3H8VA 1CUVA 3AJDA 5DFAA 5KSOA 1ZIYA 3N39C 1V43A 3LQ4A 1O6GA 2R5WA 5B12A 1U7TA 3IAS6 4L5IA 3RO7A 1JYEA 4KQIA 4YVFA 5IXYA 4XYLA 3OOYA 2FE4A 4GZ5A 4IH1A 2MU1A 4RFLA 2VF7A 3VI3B 4C4XA 5FPQA 3T4EA 5TE9A 4M46A 4B6PA 5A6SA 1WA5A 3A0UA 2HLHA 3QKSA 1X1TA 4PBRA 4QHSA 1NVGA 4HAWA 1WUJS 2O06A 3ENKA 1UBHS 1H85A 2OXCA 4TT3D 2W2XA 5KYXA 1WDLA 3FDZA 1SU8A 5FWXA 1P0CA 2HLDD 3ZCSA 2H1RA 2I6QA 5FOWA 4AULA 4FXOA 2R1TB 1FP1D 1Z26A 4KJZA 1TUGA 2QX4A 1NX9A 3FPEA 3ZHSA 1QH8A 5CG2A 4MA4A 3WB0A 5A4IS 1A5AB 1D2MA 1NN5A 1ZK0A 2GK4A 1DEAA 4P2BA 2FPPA 2HFKA 1W25A 3DT8A 1VOTA 4OVKA 3KQTA 4OYHA 3TMAA 5CHYA 3VHLB 3ZY5A 2EDAA 2OMEA 5DWVA 3SIXA 1Y4ZA 2BR4A 3RYIA 1LBHA 4O4LA 5CT4A 4YAEA 2XCQA 5HZMA 2XCTB 1YIDA 3V8MA 4IXDA 5LQNA 2FP4A 4LQ4A 2XBLA 3IEKA 3K9HA 4NRDA 2NUTA 4AFNA 4BNUA 1DCTA 5F2OA 4CLHA 1V3VA 4L74A 2CV0A 3IX7A 1PJSA 2WZBA 1J25A 1E9AA 1R3UA 1VXRA 4GDMA 5THXA 3SMQA 3SX2A 4EGJA 1CB7A 1OLXA 4RJTA 5KNDD 1RAGA 3REFA 4QUBA 4C4AA 3QY9A 1IBCA 4I4TA 3BL6A 2NU9B 3PIRA 4NCXA 4WY5A 3KWLA 4V24A 3WIEA 5JCZA 2VQDA 4UNQA 2Z57A 3JQ8B 4IIJA 2R25B 4YFVA 3QTLA 1K92A 4L9AA 4WESB 1NFFA 2VL7A 3KK0A 3MINA 1G8AA 1SRRA 5IKEA 2OZKA 1P0MA 1EGHA 2Z2IA 4DV4B 2PRSA 4JROA 3EGEA 3W6ZA 4X90A 2MTBA 4EHFA 1L8QA 3HLYA 2DETA 1GKUB 3HXTA 4ES6A 1JAZA 4JITA 5CFOA 4I8XA 1XWFA 4FJ1A 4LN1A 2P78A 4OMDA 4OJMX 2YY7A 5GV8A 4GOJA 4NG5A 5KU7A 1JQEA 5K4GA 2QJFA 4UTZA 1JMKC 5JY6A 1GPKA 1LPSA 5KWVA 1FQOA 4NULA 4Z7NB 1YCDA 2VYCA 1KH2A 1MIOB 2HREA 2IBSA 1W96A 1PWZA 2ZATA 2P9YA 2PL5A 3A3PA 3IVRA 3KNZA 3W4JA 3I9V1 3MXOA 1E20A 1MFPA 4TV9A 1FDVA 4BO8A 2SECE 1LBSA 3ZU5A 2EG9A 1D1SA 4G5QA 1C1XB 2IUSA 4HDNA 2I6GA 3SM3A 3PGXA 1YRLA 1Z36A 1ZD4A 2KSQA 2ZYTX 3ST7A 3PUYA 1FRZA 1KIFA 1OI4A 2F64A 2Y1WA 4GM0A 1RSZA 4AUKA 4AWXA 4B71A 1HBJA 4GSKA 2VZLA 4AZSA 5JBNA 3K6JA 3L7AA 3NEPX 1NJGA 2BZ0A 2N75A 3KKZA 3LG2A 3K1JA 3CIOA 1U1DA 1UODA 3N07A 1JLHA 3GGGA 3VOSA 1CS0A 2VBFA 2DSNA 3Q7IA 4GLOA 4YYEA 1NWCA 1WZEA 2QW1A 3EULA 3GD7A 3KZNA 2ZRCA 3F6CA 3X1MA 1P7ZA 1X8XA 3IVGA 3N2KB 4RV4A 3BORA 2EYUA 3NBKA 1YHYA 4KW7A 4KPFC 3E6AA 3KDAA 4NFYA 3VR6A 5B5SA 4WJZA 2IPLA 4GL2A 2FQWA 2O3TA 2V9PA 1WUHS 3INYA 4DJTA 1GFZA 1NSFA 4FDLA 5AJHA 4IX1A 5IG2A 3ABOB 5FA8A 3B7PA 1XLTA 3PUWA 2IOFA 1ZL2A 5KSWB 4Q7LA 4U5XA 5HS4A 2OD7A 2BJVA 3U7IA 2ZRKA 4BLRA 4P4GA 3QFSA 3UMJA 1CB0A 1PTJA 4P7JA 1OIWA 5CNJA 3QTTA 4RSGA 4X1IA 5FKJA 4COKA 5LM3A 5A7FA 2HQBA 3SNHA 4MR7A 1RHRA 3L0OA 3AFOA 3LKZA 4XI9A 4AW9A 1ZESA 4Z0HO 3D7MA 2QYHA 5AI4A 2EWWA 5F7ZA 3SQOA 4DMFA 4YRZA 1BDHA 3LRPA 1YQUA 4UPEA 4RELA 3WGIA 1JVBA 1NYTA 4M1YA 4O1MA 4OYRA 1F1BA 2QD3A 3WO1A 2PLRA 4ZVSA 2P4HX 2X5KO 1F17A 3EAGA 1INLA 1KH3A 2IEAA 3NTOA 3DTNA 1OSNA 3IIJA 2VI5A 3NM5A 4NOMA 1T6NA 2GZHA 5H82A 1QG4A 1HE8B 4CG2A 1XYGA 1KYYA 4BLTA 4DV2B 1FU4A 1CEEA 3C0KA 2W83A 1R74A 4RESA 4BUZA 2BEWB 3LO5A 4DR4B 2WUVA 2OGWA 3NDPA 4EO7A 1W5EA 2JGAA 2GFIA 4CNQA 5B4UA 5IHXA 1N2SA 2AYYA 1ZH0A 2AZDA 2XTJA 1IC6A 4JB0A 3OQNA 2F4NA 4JR1A 4CFZA 1QFMA 1Z16A 1YL5A 3A2NA 3C7KA 5HYVA 4BE7B 4INPA 5K3BA 1EH5A 2AN3A 3DDHA 4RPCA 3FYHA 3M6XA 5JSQA 2ZE6A 4MEJA 1OLXB 1P8JA 2DBYA 3DDOA 1L5HB 4FINA 3ZGZA 1APBA 4Q9AA 3X2FA 4LNAA 3FUTA 2CJFA 3JSXA 1F1JA 3W04A 4JD5A 1VE1A 2DULA 4R1QA 2RHDA 4DY6A 4I9FA 2X3YA 4NFHA 4OM8A 5AVJA 1N5KA 2OM2A 1LQ2A 2W2KB 2JGLA 3GCDA 2J6BA 5GONB 1GPYA 2X40A 2A4MA 1EVLA 2FPXA 2QX8A 3L4JA 2JATA 5CG1A 2YFYA 4NV3A 3X2SA 2YJZA 1T3GA 1VJCA 3IDZA 3N6VA 4UUPA 3KUKA 3OEHD 3RRMA 2GDZA 1U4SA 1I3CA 1WHTB 2E21A 3D8UA 3P0EA 5D51S 4MRNA 1GCIA 3LXUX 5ER9A 4I1SA 1T29A 3L8MA 4NBVA 2FMHA 3LVFO 4Z7QB 3EGIA 1Y80A 3GL9A 1F14A 1U6KA 3BX1A 2D06A 2VPYA 1PZMA 2B0CA 4NF2A 3OTGA 3Q0EA 4UEOA 1ODCA 5DF1A 2R00C 4QM7A 1QYWA 3KKOA 3ZWXA 1U9IC 2JJ1A 4IDFA 3L79A 3CRVA 4PR0A 4MSUA 4FZ3A 4LZOA 1JMVA 1IH8A 2XWQA 3K6SA 2FX3A 4AMYA 2A0WA 3AW9A 4K81B 4TV9F 1JKMA 1W88A 4CKXA 1YACA 3A1CA 4KYVA 3KQLA 4RHEA 3EOZA 4F84A 4KGXA 5C7IO 3LYAA 3BCRA 5TSDA 4EABA 1EX1A 1JDBC 1PNQA 1P80A 1AQYA 3D8RA 3H11B 4FI3C 4L8YA 3T0GA 1Y5RA 3AUAA 3V2GA 4K5QA 4BN4A 1UOOA 2B3DA 4UHBA 3K0AB 5BQXA 1I7QB 4HFJA 1AD2A 3CPJB 5DGTA 5ADHA 1E2IA 2C2BA 1KXZA 1F6WA 1JH8A 1QVVA 2DU8A 3ANYB 3PJEA 4RLQA 3SC2B 5BOVA 1RWNA 2GMWA 1FA9A 3DE4X 2NMVA 2NU8B 5CITA 3EOAI 3ZCUA 3DOUA 1RPZA 2C2KA 3D7LA 4LF6B 4DT1B 4AS3A 2HK8A 1K6JA 2AEMA 2WD7B 1JQBA 5CCDA 2GZAA 5A6VA 5M2QA 2I4TA 4W9MC 2IYFA 3WICA 4CF7A 2ZRBA 4M6WB 5COBA 4RJIA 2L42A 3QMMA 1OH8A 2VQEB 5K8CA 5KKNB 4JLUA 5EI5A 4NU6A 3DOJA 5JRZA 1RBQA 2CWDA 4GX5A 1W34A 4GXTA 2FFQA 4QYMA 3G9UA 1BHJA 5AXAA 4ZVQA 1W30A 1KI6A 3H5TA 3G88A 4MUJA 4HHEA 2Z1DA 4C7XA 4BNJA 2VF8A 4ER6A 2R6FA 2FMUA 3IUEA 3MMSA 2XDYA 4EFKA 1OT5A 2G06A 3RW9A 3UHAA 3KG2A 1TAUA 5K3CA 1AKTA 5CP8A 3B1JA 3LE8A 5G02A 1PI3A 2CJWA 2RH9B 5EIFA 1TCVA 1QZXA 4M7WA 5FORA 1TCAA 3GGJA 2WI8A 3SXUB 3WIVA 3IE1A 1O57A 1C3VA 2DKFA 1G21E 4LWQA 4BU1A 5BN3B 4QC2A 3A2KA 1X1BA 3FGOA 3IUPA 4PAWA 1ONPA 3PG5A 1M7HA 4TUYF 2EFGA 1SBQA 5IANA 1Q20A 1DLJA 3CW9A 3UCXA 2Y9MB 3KWJA 3V8QA 1P81A 2J3LA 2ZYVX 1SHZA 2RJ3A 3H7AA 3R0XA 4YMSA 1XV5A 1GTRA 5CLQA 3Q5EA 4RXUA 1G3MA 2I22A 1B73A 3WKDA 3ZHVA 1HEIA 5IZCC 3ER9A 2ZJ3A 2XT9A 3BSSA 3QOFA 3CN7A 2FFBA 4XUGB 1I36A 1RWVA 3KAKA 1B00A 3IMKA 3IEVA 2O3JA 2RGNC 3BRCA 4CCYB 3QF4B 4HDSA 2QT9A 2VYVD 3KHTA 2VJNA 1FYWA 2HWYA 4O2AF 5SYMA 4HZIA 1GGJA 4YCAA 2GN2A 5BQFA 4CM9A 2YJ5A 1Q0ZA 3PVSA 4DAOA 3W2EA 1ICIA 3M1LA 2VP9A 3OE7A 1FMTA 3QVOA 1ZXBA 1Z2AA 3D2CA 1IDOA 3EJWA 5EIBD 3NNSA 4P0QB 4JEMA 1JWLA 1UXHA 3SXUA 3ZY4A 1QHHB 3QNWA 4LF7B 2ZVDA 3QU2A 3H2JA 1UXIA 4HLUA 4BNFA 1N8NA 3WLTA 2F8TA 1HT1E 2A1UA 2Q45A 3IJPA 3O73A 2HTFA 1DOAA 3AI1A 3K4QA 4FKMA 5E1OA 1FYEA 4NCBA 3GC6A 3L6RA 2UKDA 5JO9A 2OHOA 2QQGA 3I2YX 3NW9A 4D9IA 3MLAA 1PEYA 1MB2A 2CVHA 3BMQB 2CNBA 2CXSA 4P31A 4BNKA 4Y1RA 5HUQA 4Q15A 3RVLA 5CD1A 3LKDA 3CTMA 1FMFA 1M2VB 1Q92A 3PHCA 3RU9A 4BRSA 4G1BA 4F85A 4U3JB 5TVGA 3JYNA 1E2PA 2AXNA 2OXRA 5KQMA 5B1IA 1CFZA 1M2GA 2Q2VA 3WGJA 1FJXA 5FWAA 4R0VA 1DB3A 1PP4A 4JJ7A 1KPIA 2E4ZA 1CZLA 4DNFA 3UY4A 4IVNA 3LDGA 2JCSA 3K1ZA 5LWQA 4KFCA 4WZAE 3Q8LA 3IDOA 4IV0A 1FNDA 5LL6P 1LSSA 1R6AA 1TGVA 3BSYA 4F3KA 2QQFA 1UDBA 5GJBA 4BS9A 5C1DA 4CM8A 2ZJYA 5KU1A 2W43A 5HRAA 2WYHA 4IRUB 3IHLA 1EM8A 4IJVA 3W8FA 4F6LA 1N34B 5IMSA 3L8HA 2LTAA 2RHCA 4GW3A 5G0UA 2AOUB 1UAAA 1A9ZA 1GRQA 3FOZA 3C3DA 3SJCA 1YOVB 3OF2A 5DOVA 1X1CA 3BGVA 4LXQA 4RTNA 2MIIA 4RSMA 1YZQA 3CR8A 3H1PA 3IR7A 2RKWA 3CV3A 3OLCX 2Q50A 2VAWA 3HFRA 1DQZA 3N2GB 4RXTA 2JBHA 4Y6RA 1F0YA 1MV8A 2XVAA 2D1QA 2B6NA 3OCJA 1NYLA 1SK8A 1Z2PX 1XVVA 1N25A 4KZKA 5AM1A 4ZC1A 2QDKA 2Q1UA 2D0OB 2VP5A 3CRMA 4FDVA 1N3YA 1SIWA 3AEYA 1Q91A 3GFFA 4R5MA 4TVKA 3T5BA 4D97A 3PZRA 1GNVA 2IOFK 2W6ID 4YAFA 1E79A 3GUUA 2NTJA 4S24A 1EIWA 1RVV1 4FCTA 3ZVLA 4DUYB 3C4JA 1PV4A 1HFKA 3E3MA 2C9OA 3DT6A 2R1TA 3F47A 1EFLA 3UJ9A 1UWVA 1BN6A 3KVRA 1YVRA 2EGUA 2BFFA 4CIXA 2B7CA 3OOSA 2GLTA 3OIGA 2B4YA 4MUNA 4NIMA 1YV9A 1EX9A 1U2QA 2JGIA 4L7VA 5BXYA 4YPVA 1SQSA 2RIRA 4KHPB 3ZD6A 2Q6IA 3C87A 5HF6A 4NBNA 2AHRA 2CVZA 1R16A 1G3IA 5I9SA 2O48X 3V9PA 1OX4B 3GXBA 1X38A 1RI4A 4D79A 4RK4A 4DCVA 5J4LA 3SLGA 5IM4A 3DFKA 5E6UA 4B4VA 3GGOA 1GQSA 4KYIB 4AUMA 4LZLA 5BY2A 1TJPB 2QTTA 2ZIUB 4CIAA 4P3NA 3G0CA 2EERA 2RK4A 3D4BA 2WIAA 3LD9A 5AK3A 4IMPA 2BP7A 1OY1A 2ODWA 2W0MA 3AERA 5K2MA 2NU9A 1E1YA 1EDDA 1K5HA 1V8PA 3U13A 1AQJA 4TKLA 3DPUA 2WSYB 1ZU5A 3KDPA 1LPBB 1I7NA 4JJ4A 5AI8A 5K3DA 4C0JA 3HDHA 2HOQA 1WB5A 4OB7A 4UNIA 1B0PA 1Q6YA 2KBEA 2BMAA 5EYPB 4Z49A 1DG1G 4FEYA 3GELA 4FE4A 2XZTA 2D6FA 3RUAA 1UEJA 1UC4B 4AC9A 2GNPA 2QRVA 1IWOA 3ZDXB 1Y3IA 4LNUB 3W3ZB 4AG6A 4XGIA 5EXEA 3GLFA 4ZIRB 3HDGA 1ZI6A 2C88A 5HFJA 1M1UA 3M9XA 3C7TA 3OFJA 3OFND 2ZAMA 3Q7QA 4GVLA 4NDNE 4MHTA 1P4GA 3DZIA 3OZUA 1VCMA 1R18A 1DARA 3UGJA 1SVOA 5L3SB 1OUMA 4KWHA 3MTAA 5D87A 4BN5A 3R5FA 1JKFA 1WPGA 1B6RA 1D4FA 4JQOA 3JV7A 2GQ0A 3W78A 1JHOA 3FYUA 2QGNA 5HA5A 3M89A 3S2UA 4A8JA 3QTBA 3S55A 2JJ8A 2V7VA 4NJEA 3L8GA 4KNWA 2XE6A 2IOYA 2ZITA 4NCJA 4WKOA 1KJ8A 3ZWVA 4UUNA 3GQBB 5ALHA 3RS4A 2BGJA 4G1CA 1UXJA 4IIXA 4XVCA 3LQRA 4D9NA 1M1YE 4S1TA 1H8ED 1SELA 3JQAB 5FH9A 3KQKA 4BLSA 2BR3A 4AQ7A 2G7MC 4JOQA 2ERXA 3LVBA 4F6RA 4HGQA 3JWIA 1OB5A 1NW6A 1V48A 2Q29A 3EUEA 2OOSA 5C52B 5AKXA 2JEYA 4CTKA 1L7RA 3PPIA 1JHUA 1RPJA 4HWKA 3G9TA 3KX2A 4G0VA 4YXWD 2Y4NA 3PWZA 3TB4A 3KD3A 4Q4JB 3KQNA 2VJLA 3PIIA 3LWZA 1RRVA 4GMKA 4E0BA 3UWSA 2PNFA 1J8FA 4G84A 4EG7A 1MH9A 3U80A 2RHWA 2ZRPA 1XAIA 4H6VA 1O94A 1ES9A 1U8UA 1YZ3A 2DUNA 2C4KA 1NR1A 1L5LA 4F3TA 1CRZA 2KM1A 4RY0A 1W4ZA 5THKA 1BQ4A 2DCUA 3O8LA 4R83A 5JNSA 1GUDA 5EXSA 5D3ZA 3ROXA 2RGGA 5HG0A 5FTMA 1K4KA 1QYIA 1V6SA 3RJ9A 4E5KA 1UFRA 3E9DA 5K3FB 3C1UA 3TVYA 5CX1B 3P9ZA 3T6KA 5KZMB 5T7BA 3DMTA 4M9ZA 4UUBA 1UT8A 5ITVA 3OBIA 4Q5IA 2OQ2A 3FUWA 2X5OA 1RI1A 4OB8A 2Q07A 3RANA 5ARCA 4F3RA 4BPBA 4RAQA 3UO8B 4EM6A 1O9HA 2WJVA 4RMJA 3ESDA 3D7NA 3MHTA 4U7DA 2EFDB 3V55A 2VZ9A 1V41E 2ZSBA 1C29B 1R2QA 5H83A 3L1JA 1NATA 3PRYA 1YU9A 1M0WA 2C58A 1HZZA 4UMFA 2O7VA 5JJ5A 1T5HX 3SLRA 3BREA 3EHDA 5IKMA 1U81A 5I7UA 1EFRA 5AVSA 3WGGA 2WMDA 4P82A 3O3MB 1N2CA 3AUUA 3H9JA 3G1TA 1NMEA 1BCSB 1O96A 4G5HA 3VR0A 4QWWA 4G9GA 4OK3A 3ZHBA 2NO9A 3R9XB 1U7ZA 4FS3A 5B3KA 3NYRA 4MWDA 3TLKA 3H8SA 4ESOA 1UBEA 3I2KA 1GRNA 2JI9A 1ORHA 2HLNA 1B43A 5TDHA 5ILGA 2VOEA 1G60A 2HM7A 2VTDA 4Q9KA 3HR4A 3AHCA 4KLAA 2FFRA 3GEPA 2OCXA 1HQYE 2F1OA 4NNPA 1RLUA 3VZRA 1U3FA 2L17A 3PL5A 4HAVA 4OOFA 5J4VA 3I9KA 1ZWLA 1DZIA 4AWAA 4LTNA 2JARA 3V34A 3WLAA 4YMLA 4DMCA 1Z6AA 1FFAA 4US1R 4WFJA 2GM5A 2QLFA 2PSJA 4MRSA 1LCIA 1KEPA 1X15A 4C04A 1FMCA 1BVHA 2BE7A 4KG7A 5DYIA 3SEQA 3VKGA 1SEVA 1VRVA 2FPPB 3GAZA 4JJIA 2AZ4A 3ZY2A 3WIBA 3WOVA 2CD9A 1KI3A 5HF9A 2IF2A 1ABEA 3CZRA 1QRUA 4LGYA 4D80A 4LHVA 1E1CA 2AWNA 3WYGA 3F98A 5AJTA 3EGVA 4IIHA 1H05A 4TQUS 4CF6A 5LP6B 2AE1A 1C1DA 3I0ZA 1L7QA 4YO8A 4IMIB 2QUKA 2K4MA 3EWNA 5TPWB 1VIDA 1M1ZA 2G1JA 3D6NB 3DVQX 3ESAA 3FDIA 3KVOA 2E5LB 3KXDA 4GKAA 5HIMA 3I5XA 1R6BX 1GCAA 1Y4AE 4C2BA 5JC8A 2O1SA 2FRDA 4ML3A 3BE4A 5IVDA 5HR5A 1JPVA 2FPLA 5KTKA 1I3LA 2IYLD 2I3GA 4X54A 1SXQA 2QPTA 3DM5A 3PC6A 4MUHA 4DJEC 2N46A 1QHHA 4ICIA 4B0OA 2QLBA 4J2HA 2TMYA 4ZT2A 5TF4A 1PT5A 4KGVA 4D3XA 3N0WA 3DMRA 4DA0A 1WBJB 1R88A 2H65A 2YZKA 2WWRA 3NC4A 2HF8A 2GVZC 3BF7A 5EINA 4FQ8A 5EJEA 3CE6A 4IS2A 3HE3A 5LUBA 4YO7A 3SICE 5IHPA 4L7QA 2WSSA 1L5SA 3IIMA 4HZUA 3RVQA 1ZGAA 1ZGBA 3QVVA 2G80A 1MMFB 1TTQB 5HFNA 2Z8XA 3QPUA 2P90A 4GGOA 2ZJ5A 4HQKA 4Y98A 4YB8A 1R64A 1L4NA 5BWOA 4XW2A 3GPLA 1EVKA 5AKEA 2JJYA 3H4VA 4LSZA 3AVUA 5AK6A 3BULA 1J0CA 1LV8A 3RJ5A 1VRCA 2QI9C 2KS6A 1B14A 2CZGA 2GXQA 3VBCA 4FUQA 4C5CA 4WD3A 5FBHA 1EUCA 2WJHA 2J3QA 1PSDA 4N48A 1KK3A 2FWMX 3PL1A 1G0OA 2P2NA 1NU6A 1E3SA 2IU3A 3KUDA 2ADMA 4EHKA 3OI7A 1UBRS 1LRKA 5L3RA 1J09A 2GEUA 2NSDA 1XU4A 4DEVA 2UYGA 1IY1A 5BN5A 2SKEA 2H17A 2ZLBA 4BRWA 3WJAA 2BGRA 4N5HX 1FUKA 2CLMB 2ZB4A 1TK9A 4LVCA 2WUDA 4MZDA 2OHXA 4RPGA 3WIOA 5DW3A 2FN3A 4X7PA 4I55B 3SFVA 3LQ2A 2OILA 4TZTA 3B85A 1MZVA 1U99A 1IULA 1KAHA 3MJ4A 3HZRA 4NARA 4J94A 1ATIA 1E96A 3HVUA 2OCGA 3O93A 4BLWA 1Q6ZA 3AU9A 4HB3A 1E5TA 1JDPA 1V26A 4G1FA 5CVDA 5HRCA 4YONB 5KNCD 4OI4A 3CRQA 2PBFA 2QYTA 2GLUA 2GO1A 1O9GA 4ZCQA 4ALJA 3DFMA 3IQWA 1FUUA 2PMCA 1XMSA 4UE3S 5U4XA 1NSTA 3PXEA 4DKXA 2A35A 4LCEA 3JZDA 4EHNA 1PFUA 3FNIA 4MB6A 4HB4A 4RTJA 4BP3A 5F9HA 1O4WA 1DT3A 1SQ5A 2Q99A 4ERNA 5A02A 1JDZA 1K98A 5D5QA 1B15A 2XYVA 2H1HA 3IUJA 2R11A 3KJNA 1EWVA 3LW7A 2JGDA 5FL3A 4II2A 5E6SA 3ORYA 3KPWA 1KO5A 1BMFD 2DCMA 1UQTA 4LY9A 1Z4OA 1EJ2A 1I0IA 1N2IA 1Z4MA 1QPGA 1C9NA 1TMKA 3QLVA 4K1LA 5B36A 3GOHA 4PLGA 1AGRA 4YQYA 3WXMA 2EZ8A 4FZJA 1DC8A 5JH7F 2Y1OA 1R9MA 1GYPA 1C0EA 4L08A 4MINA 4JUCA 5BORA 5ELXA 2VS1A 1VI6A 4B1FA 2FV8A 1ISPA 2VDOB 3DXXA 1ZI8A 3IPXA 1UK8A 2XQFA 4TTQA 3AM4A 1LTQA 1SD1A 3FWYA 1SCDA 1MAWA 2CBXA 2PN1A 1X77A 2I6SA 4I2VA 4LECA 2LIPA 5TJ9A 1DBVO 2JAWA 5JSZB 5KJEA 4DLLA 3RC1A 3UTCA 3ZDYB 4YRCA 4CM4A 3UA4A 4BUCA 1Z33A 3U7QA 2A5YB 1GAEO 3I5UA 1U8TA 3I9JA 4K9QA 3IULA 2CNNA 2GBGA 5I5GA 3TBFA 3WGOA 3PI6A 2R00A 4TQ9A 3VTFA 1WF6A 3AHHA 1CFJA 1HKUA 1U0BB 1EZ4A 5K0FA 2INGX 4EA8A 1AC5A 5KKAA 2YVQA 5IKOA 3BGWA 2F1JA 5IS2A 2CDAA 3D64A 5EIOA 3RC8A 4ZJPA 3BK1A 4GF5A 4XIFA 4J91A 4IP0A 2CSXA 1UZLA 4JU9A 2IW3A 3VMFA 4EG1A 1M7GA 2FX5A 2POCA 3P9SA 5LZ9A 3O92A 2YOFA 2DQKA 3DLTA 1XFAA 2W11A 3ROZA 3U81A 1RYFA 1FTYA 4BNWA 1E6CA 3Q6IA 4ZCRA 2I03A 4ZYLA 1Z5PA 3KSDO 4IL5A 5A3QA 1G4HA 2JZCA 2VP6A 3BH7A 4HLUC 5JZOA 3J7AC 1TECE 4UTNA 1ECPA 1O1YA 2CHEA 5ED0A 3BIOA 3UAZA 1RKBA 5MDHA 5IVKA 4AY2A 5BW8A 4QPDA 3SE0A 3U7RA 1XAGA 1CVRA 3IVMA 1Y1RA 3RS7A 1VIYA 3T9BA 1UAGA 1G5FA 1XOIA 3O4HA 4V0MA 4A4DA 1TKRA 2AC7A 1L5OA 3NJ8A 2CLLB 3EPKA 5JJIA 1E1DA 5L4SA 3OA0A 1PQPA 1ZVJA 1EZ1A 5I7HA 4EZEA 4JLAA 1QQ5A 3OQVA 2I29A 5E4TA 5EJ5A 2JJQA 3QKRA 3NBXX 4KVZA 1Z3IX 4UU0A 4C76A 2R8RA 2VK1A 1YZUA 2CXRA 3FJ1A 4GECA 2IS1A 3MRXA 5EVJA 3OSUA 1DTEA 5HKLA 4C89A 5B58C 4WBNA 3V1KA 4AF7A 2ZT5A 2EBFX 1K4YA 4G2NA 2I65A 1BJKA 2WUEA 3CZQA 4EY5A 6GPBA 1YRWA 4CBVA 1FLVA 3LUAA 1KKMA 5CFLA 3G6WA 4HC4A 4KMRA 3VR4H 4B0PA 4AKTA 3KYJB 1LZKA 2O14A 2E3JA 1HFWA 4OGLA 4D56A 2B25A 3EEYA 2I2FA 2FR0A 3GRYA 1SPXA 3SEAA 4G0QA 4TYQA 1GNSA 1LPOA 3GN1A 5LXTF 3TBKA 2PRJA 3QM1A 3CUKA 2QOEA 3H75A 3TD2A 2WYUA 2AJBA 2BMJA 3OESA 4J1QA 2J3KA 5JOQA 1U2PA 5GWXA 5KTSA 1Z63A 1EE1A 1RI2A 5FUBA 4YT4A 2Q0XA 3T5MA 1NQUA 4G8BA 4OMCA 4JI0B 5AVOA 1BVYF 2WQ6A 2H1WA 4DVGA 4EEXA 1QM5A 3IS3A 3WSVA 2XZPA 3OQPA 5ICSA 1K75A 3FNHA 4ILEA 3V4PB 3GEGA 4D0GA 1G38A 2VHCA 1QUEA 3QYPA 3KZMA 2JAUA 3OY2A 1XDSA 2M6RA 4IJ5A 1I6WA 4I66A 4JFRA 4W9RA 4KNVA 1LGYA 5BYAA 5D6NA 1K86A 2ZPTX 5GAJA 4UBOA 3P9QA 2HIHA 2YNMA 3N87A 2FWNA 2C9YA 5DHTA 1TM2A 3U3JA 3HDTA 3QX9A 1K6IA 3VNBA 2C9CA 4XOUA 1D9ZA 1KPHA 3H87A 4RA9A 1V4NA 3F4KA 3V1LA 4GR4A 4EA7A 3UT0A 1DDGA 1KEZA 3EXHA 3ESRA 1QIDA 1XNRB 1AKWA 4XSGA 2QY9A 3HA5A 1Y3HA 3OCYA 1DEHA 5LLSA 5C81A 4O02B 1DRUA 3P2OA 4ZMRA 4JYZA 2VO1A 4DV1B 2ZQYA 5JC1A 2WKQA 2GPJA 4TWBA 2BKXA 1LK5A 1PWYE 5FA5A 1U1EA 5PNTA 3T99A 5CJPA 3BMCA 2QMHA 3JQ6A 2FW9A 4YBRA 3REQB 3KSMA 1Z82A 4BLPA 3TSYA 3TK1A 1H1TA 1GZ4A 3GQVA 2XMPA 3BFJA 4F8EA 4OHVA 4IDEA 3K16A 2L19A 4MW6A 5TLSA 2AS0A 2WILA 5HF5A 3SZGA 4OO3A 2X5JO 5K8TA 1KMHB 3DNFA 2FP4B 4IRMA 4LSGA 4H3KB 4ZAXA 3E9NA 2EJBA 3GPIA 3X2EA 2ZRNA 1PBTA 1KC1A 4NZYA 1KAQA 4DJDC 2PLWA 4OREX 3PQCA 4X95A 1GO2A 4ME6A 3EARA 5GOTA 4HYQA 1X1EA 4R40A 3FWHA 4ZEWA 4DA9A 3KAJA 3W9UA 3CR3C 3CTPA 2A0FA 1S3IA 2OFXA 2W2LA 1YZGA 4M55A 1FFHA 2FFAA 1KWGA 4RTRA 5HBRA 1JUDA 4BVFA 4DQVA 1RAEA 2TS1A 5A5VA 3I8XA 1YFLA 3DHNA 2HPAA 1E6LA 2J4DA 3OC0A 5ENDA 3DZ8A 5DRTA 5F7JA 4G5FA 1FFDA 2H0QA 4CQLA 5GM1A 4CKZA 1SG9A 1I51A 1QIIA 2VTVA 3PGLA 1AKEA 4NX2A 3SQMA 4MVJG 2PLAA 2QG4A 3F49S 4IIDA 3L7KA 3MCTA 4O4HA 2UZ3A 3N8DA 4BGIA 4V1CA 4R31A 1NKVA 2BL4A 2OGSA 5A3SA 3ME5A 3UWKA 1VL1A 4FE7A 5DI9A 2FU5C 5BNIA 4LRXA 1IUOA 3K94A 4EI2A 1K06A 4P35A 3E9MA 1QHGA 2GRUA 1EIZA 2I7XA 4OJKA 2EZ9A 3KKPA 5EE1A 5ESWA 4RTOA 2CCGA 2RAFA 1P2GA 4JS0A 2DXIA 1V39A 2ZZMA 4QYWA 3IIEA 1QV9A 2P2GA 1DAFA 1VCNA 1XCJA 4FU0A 3I5YA 5KTYA 5CYOA 1MORA 4OXRA 2QAGB 1GA6A 3TMYA 4Q39A 1CY7A 3P45A 2BMEA 4RKFA 2IEZA 4KO4S 4YP9A 1B3RA 4ABTA 2IY9A 4BNDB 3AL0C 2YWEA 1VYVA 4IH4A 2VJKA 3W4IA 5ALNA 5JWHA 3VJMA 3NVMB 1KR2A 1IUKA 2HGSA 4COOA 3RM3A 4UHFA 4UTOA 2FPIA 4DTCA 3PU6A 4TYYA 1GFIA 1MDFA 2A9OA 2XYRA 2YZMA 4ENTA 1YCHA 1DS6A 3B9RA 1YVDA 2GN0A 2VEOA 3GGDA 1DJLA 2HRZA 2X5XA 4D9MA 1H8HD 2OYRA 1TF2A 4D57A 3AHDA 1A4XA 1E18A 1T3LA 5K0JA 3BFKA 5G53C 3LU1A 1XPRA 2FZ4A 1I5EA 3H2SA 4C21A 3VSBA 4RIIA 1QYVA 2IU0A 1NJ8A 3ZK9A 4JWKA 4YCDA 4B3JA 1U28C 2JHAA 1U2RA 1XEFA 2J3EA 2CFOA 2GB4A 1XP8A 2W2MA 4HX5A 5H3CA 5BNFA 2ASEA 5DNCA 3NANA 5JHHB 4J3JA 1JHZA 4LXTA 2DRIA 2FEPA 4PFQA 2ZSAA 1G5QA 2IYUA 3KQUA 4Q4LA 4Q9DA 3A3NA 1V7PC 5BSEA 3W1VA 2RGRA 4ZVKA 1AV7A 3I8OA 1KOLA 4MPDA 3RAJA 3BGIA 1IYZA 5TV2A 4WXEA 3KZOA 2E7ZA 3R8CA 3WYFA 3NRBA 4HEA1 4M7OA 4IJQA 4BAUA 3FNBA 2GO7A 1SB8A 3OE4A 2CFRA 1E4OA 1G7TA 3RJTA 1K68A 1NW4A 4XASA 4DIDA 1IUNA 4QULA 2VN8A 1NAHA 1NT2A 3CF4G 4FT2A 3FPKA 1KY2A 4QBFA 4XQ9A 5DX0A 4B82A 3THYA 2I80A 4DBVO 2OFFA 4ZAWA 5EIAA 4N41A 4HY3A 3F9IA 4MB2A 1FOEB 2WWGA 1ZZEA 4AS2A 3QVLA 3DEKA 3KELA 2WTAA 4M1QA 2NUAB 5JVDA 1E7MA 5L7WA 3ETJA 1M6WA 4E3ZA 5FWNA 4BX8A 4YS6A 1SVWA 1CNEA 1NVEA 3EEBA 1TTHA 4DDVA 4HAUA 4WZAA 4UNSA 1IM2A 4V03A 2XBUA 4DKJA 2VRWA 5I01A 5KYGA 1XMXA 3PIDA 1JFVA 3WGTA 4XRGA 4Y6GB 2XR1A 1IBSA 4AF8A 2GK6A 3GZNA 3OT4A 5AKHA 3VR4D 1FJ2A 5JSHA 1Q3HA 1TIKA 3TE7A 3H2IA 4YALA 5KYWB 3QPAA 1REQB 5K8LA 5B1DA 3NEJA 2XUAA 2ZIVB 2C4TA 3SYRA 2AZMA 3AIOA 3S27A 2O2XA 2Q9BA 1ZSVA 5L6LB 4GQAA 5K3SA 1E2DA 2NACA 2O6HA 1YA8A 4Y2SA 4F5EA 1G9XA 1X86B 4L85A 2OCBA 1JN0A 3HEMA 2AC4A 2D5BA 2XJ9A 1P0QA 3JQGB 1LFAA 4G0YA 5CTJA 4S35A 5E4JA 1M1YB 2PWYA 5KWIA 1HDGO 5ESXA 1NVDA 2JJ1D 2FZGA 2VUTA 5I8ZA 4A8JC 3DE2X 5A4KA 2VQ6A 3KKNA 4BOYA 3VTZA 1PT7A 1DKNA 4AAYA 4UM9B 2XUIA 5GY7A 4FHCA 3WLPA 2VTBA 1TKCA 2EHDA 2OC4A 3AI2A 5H5JA 2ZCJA 4EG3A 3HI6A 3QP9A 3A25A 5BV8A 1SCNE 2WHQA 1TPYA 3CU5A 1YZHA 4QDXA 1XPOA 3I32A 2AXPA 4CM1A 1WB6A 4PRZA 4EW1A 3ICPA 5J9FA 2I54A 3AHJA 1QB7A 2XUJA 3ZX4A 4U02A 5B6PA 5GP1A 4NBRA 1E3JA 2E0IA 2A58A 4FMDF 5E2IA 1T9BA 2Y67A 5A71A 4QDTA 3SJUA 1ODLA 4D43A 5L7YA 3PXCX 3OIVA 1TMOA 3UJ8A 1ISIA 2IP4A 3WK8A 2NSLA 3PGKA 4N3GA 3BFVA 1WZUA 4NYJR 3ZNOA 5C53B 2FK7A 2NG1A 4GYYA 1NG9A 2Y0BA 1X19A 5TEVA 1Q50A 3ZDZB 1W4LA 1A7UA 4LUCA 4WZBE 4C0AC 1HF3A 3NOVA 2B5OA 2FTKE 3LWBA 1X1SA 3O9VA 3HWWA 2XTZA 4H4EA 4K26A 2GNOA 1YC2A 5DWDA 1XQ9A 3GDGA 2NPFA 2Q2NA 1V1RB 4RFSA 4Z0PA 5CDUA 2XYPA 2EEPA 3HU3A 5E1BA 4QXMA 3PFKA 3TQSA 4KXNA 2DPGA 4A16A 4BO2A 2VT6A 3AVTA 5DXFA 1TZMA 1DAMA 2CXXA 1EE9A 3OZCA 5A04A 4HYEA 3KJGA 3EAQA 3PWKA 3ZE2B 4CTNA 3C2QA 4S1PA 4C4PA 1HETA 2ECQA 4BQFA 2ZWMA 4FSXA 5FBLB 3F73A 1P5RA 3OJOA 1KYQA 1SXJD 3RSCA 3WMGA 1B8UA 3BGOS 2YXDA 3CG0A 2GI4A 2PGXA 1IZ7A 1X1RA 3N76A 1MO5A 4KREA 3ETDA 3IJ5A 4NOKA 2O8DB 3I1JA 1Y8RB 1G1MA 3R6WA 1C4XA 1NRIA 2BM9A 2XVXA 1EFRD 4OIFA 3OQBA 3T1QA 1QP0A 3VKFA 4YUVA 4BEWA 3OZAA 2Q3HA 2BGMA 4HB0A 3GBSA 4G07A 3TEFA 2YWXA 1RZUA 1ORDA 3CB4A 1AQUA 1N3BA 4QUJA 4C0LA 3FTCA 1IEVA 1J24A 1WXXA 2X58A 2QZJA 3MOIA 1ZMXA 1FUIA 2ZIGA 3QKSB 1DX9A 1D1PA 1VBFA 2EFYA 4F2PA 4OU5A 1N92A 4BBAA 3LFHA 3DMYA 1J0XO 5ALMA 3S2YA 3V1UA 4F1WA 4F4HA 3ZDEA 3QU7A 4FGZA 3SBOA 3QX3A 1DBIA 1K63A 1W4BA 3HA2A 3FCSB 1BFKA 2I87A 3H9GA 3K92A 3MWDA 4PRYA 2BI4A 1NUPA 4I4CA 4IG4A 5JMPA 1IG3A 1J20A 4FC7A 4PZZA 5HJ7A 5ICMA 5KYYA 1ZH2A 3M3DA 2EFCB 1PZFA 2AEFA 5D7BA 5TMEA 1IRXA 1ZBQA 4KQJA 3SYKA 1MC1A 1Y5LA 2QM0A 5HX7A 4O4LF 2IEGA 1JSLA 5KDDA 2YCLA 3ANXA 1G2QA 3BMOB 3K05A 2JIMA 4OA8A 4FKBA 1HT2E 4OGGA 4RD1A 2VA9A 4GPEA 3TIIA 1E94E 5BN3A 4Y2QA 1NX6A 5TT1A 1IG0A 4BLOA 1Q7CA 2WDZA 3STHA 2X14A 4DHEA 4JCCA 2PBRA 4CFSA 2WG1A 3G13A 4I6EA 4MGEA 4QTXA 1J2UA 4OY3A 4D9JA 1OBVA 1TLLA 4X66B 1DNPA 5EQJB 2A0XA 4GH5A 5DGXA 5BP7A 3O1LA 2ZW9A 4KJXA 4WLEA 1GQYA 5CT9A 1PJRA 4WASA 1FDRA 5ERYA 4DSTA 4E5DA 4LE2A 4BIMA 1R00A 3JARB 3N7AA 4DR6B 3DV2A 3GJ3A 2IWHA 3RS2A 1EESA 1PD1A 4D2IA 3FGPA 3AUJB 2HU7A 1JLLB 1JMYA 3KOWA 3Q40A 4A73A 3PX7A 1EGAA 4EOGA 3OZSA 5DX8A 3ASVA 1JEOA 3T4UA 3ESBA 5C8YB 4BNNA 3ZR4B 4BLUA 5IJ0A 3MRVA 1VMKA 1Q2XA 3OCVA 3EQ6A 2WSMA 2I6TA 2WD9A 2DFPA 5B58T 3WE7A 2C59A 4XUDA 2VHWA 2YYZA 4MWEA 3EDCA 4MW1A 1PJBA 4B09A 2PU7A 2K87A 4QD3A 3UV6A 5FUXA 3ELUA 4PYOA 2CZCA 3EZ6A 4DZRA 3R5TA 4GXNA 1ZMRA 1EG2A 3ADPA 2NO0A 1P5ZB 4R0NA 3R6LA 4AY5A 2D00A 1YXMA 4KO8A 3Q2IA 1S0UA 1RCFA 1ULHA 3VVLA 1D8TA 4JP5A 2CHFA 4RD3A 4URUR 2Q3BA 1QTNA 5A9SB 1ISFA 1DAGA 2Z56A 3E7XA 4XWTA 2Z30A 3UMFA 2CE2X 3WKCA 2JKYA 3OIYA 4YRAA 4JLDA 3IQXA 1WEKA 4PX2A 2CBZA 2QRNA 2AL7A 4YMIA 3B13B 3N74A 2WU1A 4YV0A 1N0HA 2FX2A 2HBRA 2JS7A 2IIBA 3G85A 3HYCA 3JALA 2QQ0A 3PNQA 4JKYA 1N2XA 4XX1A 1WB9A 3L6BA 1D2AA 2GYWA 4HRVA 1YBVA 3H1FA 1BEEA 1S7GA 2Z4SA 4IIYA 5ALJA 1EMDA 4JQCA 1G5HA 3EBOA 2QTZA 2CFIA 1XJ0A 2K5UA 5AIBA 1IMJA 1SQGA 3Q8XB 5AR1A 3I3OA 3WYEA 4KPUA 4OXQA 4UNNA 4DW8A 4RX1A 5BVHA 5FO0A 4AX8A 4AMVA 3DBHB 2HMWA 4LV5B 2WNIA 1JG2A 3DW1X 3MOGA 2OORA 2HHHB 1YH3A 2ZAIA 3F46A 5I7SA 4L78A 1SBHA 3WHPA 4BQQA 1E2HA 4FCVA 2DUUA 4TYWA 1E0JA 1NXTA 2I2XB 2HTEA 3JWEA 1FMJA 3PXUA 3O8DA 3RFVA 4E94A 3HTXA 3UOAB 1F51E 4DZZA 1I1NA 4ZDIA 4IGAA 4PYQA 1BU8A 4PG7A 3TQCA 4DE5A 2D2XA 4LI0A 1AMNA 1R4NB 2IY8A 5C2JB 4PEVA 5IVHA 3DL4A 5T57A 4H1HA 1BEUB 2FWRA 3BEOA 3A9SA 3N8KA 1IY9A 1ISHA 3CF6R 4LHSA 2W2VA 4QJIA 1DAPA 3R4VA 4Y9DA 4EG0A 2JLXA 1ZW6A 3MJRA 3KHUA 1HEUA 1IHXA 2BSXA 1EJ6A 4ZCPA 3FVRA 2PUWA 3MS4A 4PANA 3FMOB 1Q57A 1OLOA 1PVDA 1AIPA 2NV6A 3FA2A 4LC0A 1TA0A 2H9YA 2Z5LA 4DM7A 4DT1A 1J8YF 3RYHB 3R74A 3A1UA 3AR3A 3PXGA 5DHPA 5AUQA 4KWCA 5DXAA 3S0JA 3WL5A 5CR9A 4AKIA 3LRXA 3HJHA 1BQEA 1TJ3A 4BX3A 1XZMA 1ZCJA 2QG9A 1ESNA 3U1TA 2C1XA 4HATA 4OFZA 3D9QX 4OKSA 1Z56C 2QF7A 3H9CA 3L8EA 4FQ7A 4D74A 4R1LA 1Q1GA 5K3EA 2C98A 5AM4A 3TZKA 1XQYA 2NU6B 3VR5D 1NZFA 4V02A 2JFQA 2XRZA 2H8GA 3JQDA 1KERA 3H9BA 4KUGA 1FL9A 2Q5JA 2M1ZA 2IYSA 4IVRA 2YWHA 1H4VB 3QPWA 1QO0A 1DDIA 4U9UA 4EHAA 4IXWA 1DELA 1ZNYA 2J85A 4FGWA 4Y2JA 4BFTA 3GEEA 2DUMA 2XWPA 2ENUA 2ZI3A 3FUVA 2AG5A 3UJ3X 4ER0A 1ZGGA 1QRRA 2O52A 3KQQA 3MSCA 1Y7TA 3DQPA 4CE6A 4G0XA 5JAHA 5DM4A 3ZV6A 1N8SA 1V35A 1C3EA 3IAM6 5DTRA 3FVWA 5F5LA 2G63A 2O1XA 3AHGA 4LCJA 1MX1A 5AHKA 4XCVA 1HTBA 5CIWA 2UVQA 4RVSA 2OLEA 4XYBA 1MRNA 3AHEA 3RT9A 4ENRA 3AOEC 1ODSA 4HB2A 1UJ2A 1KHHA 3TW0A 3JQPA 3X1XA 3A4NA 4L8FA 1G5PA 3VYTB 3LUJA 2KYRA 3OJWA 1N9KA 5FBQB 1Z06A 3RLIA 1M2WA 3FUUA 3IE2A 4OB6A 4W1RA 1JFSA 1FFBA 4OQQA 3B1ZA 5K0BA 4K0KB 2VUIB 4GLLA 5GVRA 2XBMA 2NU6A 1S5PA 1OWPA 1II8A 4I8DA 5F77A 1Y6QA 1YR6A 1GDDA 2ZE8A 4YX9A 1P60A 2GEKA 3U3RA 4TL6A 1YAJA 2XA2A 2I7CA 3OPNA 1QMGA 1E0SA 1UP4A 3PGVA 3M5DA 1P1HA 2JD2A 1HDIA 4XE5A 2C42A 5EJ4A 2M6KA 1MNAA 4BASA 1AMUA 2VNHA 5CXQA 3SVLA 3KAPA 3CINA 1FTSA 1I30A 2DFVA 2E55A 2FF5A 3DA8A 3IMCA 1XHEA 4I7EA 5EUCA 5P21A 5AVQA 3H6HA 1X6VA 1Y63A 1C4WA 2HDWA 2J46A 4JBLA 4E70A 4DS3A 4HXGA 3HN6A 4QQKA 1LDEA 2VHZA 3EDRA 2FLVA 3F6SA 1RI5A 3C4QA 3QELB 1XZJA 1LFDB 3HM2A 3IR5A 3GB9A 2NZ2A 2QRMA 4X94A 3SIRA 1HE1C 2JJ2A 4L9WA 2PUDA 3D31A 4Z9AA 3VRHA 2GCIA 5CA1A 3Q8MA 2YN2A 5IXSA 2XGMA 1J8VA 1T3HA 2H5JA 1FX0A 1U3DA 1UMDB 1CY6A 2ADOA 2YMPA 4PX5A 5BV7A 1XDUA 1SXPA 4X7MA 4BEVA 1BXKA 2ZBVA 4EFLA 5LP6A 1X3SA 1RI3A 2BT4A 3D8SA 5EJIA 3OTWA 1U94A 1RM4A 1Q12A 3N0VA 1YB4A 4F4JA 1S4QA 5IWAB 3OFNA 1RNLA 1N78A 1DWOA 4F91B 3HCFA 3NALA 3M4NA 4NK5A 1ILWA 5J5AA 2CLHB 5TEWA 4CMAA 4YRNA 4K03A 1YU6A 5CLFA 1IOVA 3W5IA 3V4LA 1E8MA 2XOXA 5JS1A 3FIJA 2B4QA 2XE4A 2PGJA 4TL7A 1RBZA 3OQIB 1RTKA 3P20A 2LPMA 1L7AA 4JOCA 2P6UA 1FNSA 1NASA 4A82A 2FVYA 4WL0A 3UPTA 4S05A 2ZAOA 2YC2C 4P7BA 3RIXA 3RSLA 2C9BA 5FTNA 5FNVA 1CS0B 3W5SA 4UTPA 1W5BA 1GSHA 4FFSA 5AKGA 1F7VA 2XVYA 1XT6A 3FNEA 4DN6A 3M6IA 2OWEA 3O75A 4B4UA 4DZTA 3BB3A 1FNCA 4YASA 4C7BA 5AW6A 2DC1A 2JD1A 1WHSA 2GRJA 2NTEA 3N2KA 3O7WA 4C3ZA 2JI7A 4U2BA 7REQA 2O50A 2PKEA 1IB0A 2QN2A 2QQ5A 3C15C 3QE2A 4JYPA 3F2VA 4N12A 5CTAA 3KL4A 1TGYA 1F12A 1HYEA 3CPHA 3SKVA 9ABPA 1U28A 2ZXUA 4MDFA 4D92A 4BFZA 4CT4B 3D6MA 3ZD7A 4ZV4A 4YBZA 1Z7BA 3WWCA 5B7PA 3VR6H 4FFBB 3IMGA 2GUGA 3V6MA 2C8VA 3ML1A 4HN4B 3V48A 1G6HA 5CBPA 2VOJA 3IC5A 4NCHA 4B84A 4PGMA 3Q5DA 4M89A 4AP6A 5HM6A 3EF3A 3R3JA 5ITSA 1ADCA 3K8QA 3QXJA 1SRQA 4KWTA 4RANA 1TVKA 2ZR7A 4K28A 4MB0A 3WL4A 4E5UA 4QYIB 2FEKA 3QEMB 2AFIA 2HBYA 3KB2A 4RMNA 4J6EA 5CVCA 1QE0A 1BVUA 4HQNA 1V3TA 5ALUA 1N6LA 2ZIAA 3IAM1 1W75A 3N0RA 5A9TA 1ULTA 4XPIB 5AVVA 1U2EA 3JQBA 3NGXA 4QBIA 1EFCA 2H4HA 1ZM3A 4JQYA 3ZBQA 5I8PA 3ZCTA 2O8EB 5L95A 1I32A 1U9IA 1BH6A 1PX0A 1HSZA 1QANA 2I78A 1C9YA 3I2GA 4IIUA 3O26A 2XCRB 5TQ2A 3I64A 4OLJA 2IZ0A 1KY4A 2ZM5A 3F1KA 1QRTA 3WLQA 3FTEA 2A5GA 1WZIA 2R6HA 4S1WA 4DIUA 2E4YA 2PX4A 4W7IA 1KI8A 1RQGA 2JHGA 5D01A 4F92B 1AKMA 1AQNA 2Q21A 3DE7X 1ETHA 4JA0A 4K3UA 4QDKA 4OOEA 3BZUA 2J6IA 3JD0A 4L3OA 4DANA 5KOJA 1Z75A 1XBTA 3IAUA 2ZBPA 1TU4A 3K73O 1B8PA 3Q7PA 2HCJB 3RUIA 3EBPA 3R9IA 3TFWA 4YI3A 3BWEA 3MUOA 3IUNA 1GPNA 1RYEA 3W7BA 4LJAA 2R8OA 2ERCA 4I81A 1E9EA 3QNMA 1NKTA 1QVZA 2FY8A 2Y0DA 3RBZA 1WTAA 4W4TA 1C7IA 3C5WP 5FQOA 3U9TA 1JXQA 4EK9A 1AK9A 3VJLA 1Z28A 3ER6A 1T8TA 3IPAA 2D5AA 1E6MA 2FJPA 1CVIA 1UP6A 3LCVB 1JWBB 3AUTA 3NHLA 4FVTA 3NNNA 3VPSA 3WYNA 4JVNA 3A37A 2EKZA 2KQUA 3LSTA 3IKVA 3PR1A 4KO1S 1JEJA 4OYYA 3ZHZA 2WWHA 2Q4OA 1U98A 3AR8A 5HBGA 5IBCA 1BKYA 3MTEA 4OHMA 4PBSA 5GJWC 2UYCA 1WPQA 2DY0A 4EY7A 2NXJA 4KR9A 3NHUA 1M0TA 1Y1KE 2P67A 4EVSA 3CIFA 5FQNA 2WZQA 4DBZA 2VAPA 3U4AA 5JAMA 4RDHA 2FW8A 4BDSA 4C08A 221PA 2DZDA 2PUBA 1K6MA 3ONDA 4PZLA 1H0RA 4WN9A 1NHGA 2CMKA 3WRVA 1Q44A 1COWA 1T0BA 2BPOA 2H57A 1J23A 4DCSA 4KQ2A 5JS6A 4PG5A 1C0KA 1XRSB 3L0DA 5BV1A 3GWGA 3NHYA 4RQAA 1X80B 2ZU0C 1A1SA 2CUTA 3AFMA 4Y2HA 4W5QA 2Y9PB 3NTXA 1Q0UA 2JH8A 3D2AA 2BGLA 3OZGA 4JP3A 3AVOA 4IY1A 1F38A 2CFSA 2QE7D 3BHJA 4MV3A 4BO9A 3ZVMA 3GLHB 1X7YB 5FI5A 3O82A 2JIOA 2XVZA 5IYZA 1IAVA 1M8GA 5HTOA 1XYYA 1L7OA 3PRKE 4ROSA 4N0DA 2F9LA 4HXFB 2BAGA 2OE2A 1SUFA 4BGVA 1EWTA 4OFWA 2PFGA 3W5VA 1GKLA 4DC1A 2IYZA 5IT5A 3OZIA 3I6QA 1B0UA 3EH2A 1M72A 5BNWA 3FSEA 4JGIA 1KE2A 1WHSB 5IFLA 4FGKA 3LO8A 4ZJZA 2PKWA 5FUYA 4YRRA 1N6IA 3O03A 4M0DA 1SCAA 2ATEA 4N40A 5IDQA 5C5DA 1XE3A 3MJTA 3F8WA 3VYSB 5BMOA 2ECOA 1DLIA 1UJCA 3Q12A 4RJKA 2XIJA 3FGZA 2RGXA 2G77B 3NLLA 4J8PA 5B57C 3DR3A 5FOXA 4W8HA 4CEJB 5KX5A