1ZGHA

Methionyl-trna formyltransferase from clostridium thermocellum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
227
Chain Sequence
LMNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEYILFPHWSWIIPKEIFENFTCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRASMKNGKIIADVEIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionyl-tRNA formyltransferase from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Methionyl-tRNA formyltransferase
total genus 58
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.20 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 1zghA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zghA01
3GARA 4ZZ0A 3Q0IA 1MEOA 4ZYVA 4NV1A 1RBZA 1RC1A 1ZGHA 4PZUA 4TTSA 3LOUA 4QPDA 1FMTA 3P9XA 4EW3A 1ZLXA 4ZZ1A 3NRBA 3DA8A 1MEJA 1MENA 2GARA 4ZYZA 3TQQA 1GARA 3AUFA 1C3EA 1YRWA 3N0VA 3O1LA 4TT8A 4IQFA 4ZYUA 1GRCA 3DCJA 5CJJA 1RBYA 1ZLYA 1RBQA 4R8VA 2CFIA 3R8XA 4ZZ2A 4ZYWA 3OBIA 2FMTA 4EW1A 4Q12A 4S1NA 4EW2A 3KCQA 4ZYYA 4ZYTA 1NJSA 1C2TA 5J63A 4YFVA 3TQRA 4ZYXA 2YWRA 1RBMA 1JKXA 5J9FA 1RC0A 4QPCA 4ZZ3A 1S3IA 2BW0A 3AV3A 4YFYA 4DS3A 4TS4A 1CDDA 3W7BA 1CDEA 2BLNA
chains in the Genus database with same CATH superfamily
3GARA 4GOJA 1VSUA 1RWMA 3RC3A 3T7IA 1U04A 1VB5A 1JKMA 2WU4A 4KOEC 3GLUA 4G0VA 3CF0A 3IIMA 1QG6A 4LEIA 2QRQA 1ZD9A 2J07A 3H4TA 3N8DA 2UZ1A 3VR6A 3FVRA 2FPPA 3DWGA 1IATA 1D1PA 1OH8A 3ABIA 4IQGA 1IZ7A 4G25A 3SJBA 4E7PA 3HDHA 1IXYA 2H7XA 5THXA 3KVYA 4M8SA 4LJ5A 5GY7A 1SD1A 2PCJA 3UQZA 3LVBA 2DE0X 3SKYA 5LLDA 2CNDA 3A36A 4TKUA 1Y8QA 5AVJA 3GLIB 1GLNA 1CIVA 5CXUA 4CI9A 4HMQA 1XFDA 2P7HA 5AJZA 2Y1DA 4ARBA 4ALMA 1QFMA 3E3OA 4DR7B 1T9KA 4UVHA 3Q87B 3T5TA 3L8MA 4JB3A 3ZU5A 2XWPA 1NP6A 4EB8A 5F2EA 2JA2A 3HDVA 4UMEA 5LU8A 1PNOA 4I4NA 1SA0A 4JXJA 4LK3A 4MV0A 3E9YA 4NOMA 4CKXA 2PRSA 5DBFA 1IY2A 2GEUA 3EMVA 3GT0A 5IJ9A 5F76A 4G26A 5CUQA 4HLUC 2D3TA 4YT2A 3JATB 3EF0A 2R11A 3R09A 2GXQA 1X1DA 2ZYTX 1MNAA 1QE5A 3FPAA 4I5IA 1O9BA 4YJDA 2OYCA 3D0RA 3BPSA 3BWYA 1VJTA 3LBNA 5A4JA 3MJDA 3ER9A 1R12A 2CMFA 4R83A 1YVRA 4OHMA 5CR9A 3JWHA 1RI3A 5ITZB 4C20A 4CZ2A 4RHFA 1KQGA 2O3JA 3CQ9A 1NUPA 1YUBA 3CW9A 3LXRA 2JHCA 3MPUA 2QX8A 5GONA 2Z5FA 3NTLA 3VYSB 3KE9A 5THQA 2CV2A 2AG0A 5EJ7A 1XZMA 4HDKB 1DS6A 5ALZA 3F98A 4BQEA 1L7PA 1Y3CE 3K72B 4AJJA 2XUZA 3QH4A 4JLAA 1UANA 2BKLA 1KMCA 3LTNC 3A1SA 1M1YB 4ND5A 3N1UA 2Q0HA 3T1VA 2ZT8A 3HC7A 1NW4A 3M33A 2C5LA 1JQ3A 4KE8A 4ND8B 1H1TA 1KMNA 4CCYB 5F7OA 4HH4A 2PMKA 5EIFA 1FDUA 2E18A 4BB6A 2D59A 2WIKA 3F6RA 3HB9A 4S2UA 4Y0AA 4KZKA 1R6TA 4AMUA 1SD5A 1GTZA 1P5JA 2BE7A 2C54A 2C5BA 2VH5R 4PONA 3ZCXA 4CL0A 3ZD7A 1I6WA 1BEEA 1V96A 3JQBC 5DNCA 1P7ZA 1XRJA 1OXKB 1EQUA 4L0DA 3C85A 5SZHB 2BYTA 3DOFA 2RGXA 4D26A 2IS1A 4UPVA 2P4SA 3GEEA 2PQ0A 1Z47A 3IEKA 4ZEMA 3JQ6A 4US2R 1RI5A 1T26A 2DP4E 5IJ0B 5TEVA 3W8FA 2QW1A 2BC9A 2JI9A 1XEWY 4BMNA 4P53A 1ZM9A 5HIMA 5AIAA 1MB4A 4RQBA 1FBTA 2NGRA 1C4KA 3MWGA 4G9BA 5EGNA 3EGOA 3GLTA 2AG1A 4JY7A 1M6NA 2V9PA 2NZ8A 1ZISA 3A2MA 3D3NA 1MABA 3G85A 5JXHA 1NNUA 1U63A 1UCFA 3I9LA 1CY4A 3BG5A 3LW8A 1SNYA 3F67A 1S89A 2XVZA 1ZOSA 3C6YA 4WKBA 1PDVA 2IEAA 4G5SA 1IY9A 1PGNA 1MQSA 1PG0A 1EDDA 1I4DD 1QX4A 2C4HA 2DECA 3B1VA 1C3OA 2A6PA 1TVKB 2ZYHA 3QJ5A 1K2WA 5F1YA 2XMRA 3MBOA 4NOJA 1RM4A 5F73A 1B2LA 2E82A 1ACMA 2XYQA 4URXR 1ZK4A 4UHDA 3AF4A 3KQSA 5U1PA 2GPYA 5BWMA 3G9XA 4U63A 3VC1A 5HEKA 3GEDA 3ROMA 4NENB 2AYYA 4GNKA 1TIKA 4GLJA 4IMRA 4R5HA 4AS3A 1EJ6A 2HLPA 3BD9A 3D4BA 5TVGA 1Z2OX 2Y05A 2YFYA 4HHEA 5JS2A 3UAXA 4HKTA 2Z3WA 1XELA 4ZVTA 2CHEA 4MZDA 3PD1A 4Q34A 1I6LA 1VSQA 1XRSB 2V5AA 4IV8A 1K8RA 2EFHB 4IVPA 4K40A 4RZ3A 5EMKA 4C9BA 5F2NA 3FFWA 3GY0A 2IFTA 2ZIWB 3L7NA 4B7CA 3PHLA 5EOVA 5FOXA 4BY9E 4PFKA 1NMQA 2GEJA 3KJIA 1PUIA 1HG1A 1OZAA 2JI8A 3KV1A 3OFKA 4FINA 4J4TA 2GEDA 3BSYA 2OO3A 2OILA 2OXFA 4MYCA 4OXYA 5KTNA 1KL7A 2WIAA 3GF4A 3U56A 3ULKA 3PXCX 2H9YA 3GBPA 4R2WA 3FLEA 5JEEA 1W49A 2E7ZA 3I32A 4K9LA 1TF5A 3DBLB 4AJ2A 4BQNA 3SSNA 3T4UA 4II2A 4D3ZA 2Z09A 1ZBDA 3VSAA 1FCJA 3A6LA 3DCNA 3DMRA 3PG5A 4PLHA 1U8ZA 5COBA 1RHUA 4Q3KA 1K2VN 4GVXA 4NAUA 4RJKA 4FC6A 4BNNA 1H6DA 3KT6A 3EYAA 2I7XA 1MEJA 4FFVA 5CDFE 2ZR9A 2VWQA 3IKMB 4MRMB 2Z2IA 4BKRA 3JQRA 2QMOA 3LF1A 5HZGA 3L6CA 1Q2UA 1Y81A 1NRJB 1L9XA 3OBIA 5AWFC 2J09A 3I58A 2RHDA 3IMCA 3IE1A 3M9XA 1UJ4A 2VSYA 4LRYA 1RD4A 1A4UA 4ZYYA 1CVLA 4EPXA 2Q5LA 1VL1A 1UIRA 4ZI2A 1HMYA 5BPFA 3N5KA 2EJTA 4C43A 4B73A 1WULS 4HH1A 3GZNB 3JVIA 5TEWA 3B6JA 5LZ8A 3DUWA 5B4UA 1KZ6A 1WKBA 3CMCO 3P20A 4BX3A 1X9IA 4CG0A 2C04A 4K9PA 5FWYA 5HCIA 2O8DB 4Y8VA 3UWKA 1GDHA 4DCGA 2GRJA 2PSHA 4P08A 1R2QA 5KTKA 4IO0A 5LVAA 2BDTA 4HQFA 4RD2A 2FRXA 2C3PA 4I1PA 4DV7B 1WHSB 1X92A 4GX5A 3BX1A 5F4BA 3VVLA 1V26A 2FX5A 1GNTA 2PSFA 4Q82A 2ZBPA 3HE3A 2ZIZA 4KDFA 1OWOA 2PT6A 3MS2A 3RRXA 3ZS8A 2V4MA 5KSPA 2GM9A 2JS7A 4CE6A 1RAEA 3BM5A 1II8A 1U90A 2GAJA 1VE6A 3QK7A 4GE3A 1ICIA 4UNQA 3T3HA 1LI4A 5SICE 1GKKA 2B69A 1RYHA 4A26A 4UFPA 4F91B 1JG4A 4BFTA 1KAEA 2PMFA 3AUKA 4N3NA 3NIGB 1UWLA 2LR0A 3B2NA 3FYCA 3RGWS 1SBIA 2HSJA 3HNRA 3M6LA 3WMRA 5HKKA 1L8QA 5DNAA 1T3LA 2I1QA 2FH5B 4O4HB 2F17A 3IIIA 3T1QA 2Q8PA 4IZ6A 4ZZ2A 2ZAOA 2HSZA 3HB7A 5EZYF 4EBBA 2PMDA 3KL2A 2WNSA 4GZLA 4Z7JA 1FS5A 1T5OA 2B3TA 1E4OA 2BHTA 4FLFA 4C7JA 3G2KA 4RA9A 2XT0A 5AXCA 5HF6A 3EDQA 1PR9A 2ZRIA 2ZVQX 5PNTA 4NU0A 4KBFA 1CZHA 3UMBA 1UQRA 2RHWA 4DA8A 4QGFA 5LNK6 1QFSA 2W2LD 3HJNA 4NEQA 5DT9A 3AILA 1W6UA 4IF6A 4L7VA 5AKXA 2CZGA 2EQBA 1T0UA 2ODQA 3FSGD 1JEAA 2P9CA 1C4XA 3P9QA 4W7SA 3P26A 4RJTA 5JJCA 5K7SA 1M72A 2AG6A 1WUHS 3DMNA 4Y6RA 2AF3C 1EDEA 1VI5A 2HWWA 1TQ8A 3IVMA 4GLFA 2DM6A 1U11A 3ZHRA 2H7YA 5A62A 3IQXA 3HCFA 4FSXA 4OGWA 5TLSA 3BSWA 4TROA 5E3JA 3SJUA 3WGGA 3EIFA 5TQ2B 4C3ZA 4P80A 4TTQA 4EDFA 4HN4B 1FDRA 1GDTA 2BMJA 3V7FA 1LTHR 4QASA 2QKYA 3UXHA 5DX0A 3DOOA 1WHSA 4JI2B 4PVCA 5TNXA 2HWUA 1P6XA 3ZKWB 3KC2A 2JBWA 4UASA 1CP3A 2FPWA 3CV3A 4TM7A 1XL1A 2QJRA 3WGOA 1ND5A 1CY2A 5D86A 4KQ6A 1HLPA 4LMPA 4OM8A 3UJDA 5I9IA 4XEUA 3DVRX 1KEVA 5COQA 2PMEA 1XK6A 1FRFS 1L6RA 3VR4H 2Q6OA 2I65A 5FTJA 5J40A 1F8XA 3DVLA 4K9OA 5KTOA 2CWWA 2O1EA 4YP9A 3TSCA 1UZLA 4ZOQI 4JI4B 3ZGLA 3H04A 1K5HA 1XOIA 2QHXA 4FNMA 1XQWA 2JFUA 3TNFA 5J2UF 5F9FA 3ACBA 4L73A 3A7DA 1VYUA 4F6CA 2PGAA 3M4XA 4GOMD 3CCBA 1EAMA 1P4AA 1A27A 3A05A 5EZ5A 1EA7A 1ZOOA 4FR5A 3R3XA 1RVDA 3VHLB 1V3UA 3P27A 4CLXA 3Q3GE 1R4MB 3RC2A 3HYSA 2IV7A 2ONJA 1JR4A 1L5OA 2HADA 3OZCA 5A1JA 4UMFA 2R7NA 5AHRA 2BWJA 1WV0A 4P58A 4P9NA 3EOAI 3CM0A 1U8AA 3MCZA 4E2FA 2BCJQ 1JP7A 3E70C 2GPJA 1W4LA 2CLIB 4FMPA 4HGRA 2I9PA 2WFLA 3H0EA 3O7WA 4CIVA 4UFNA 1PE0A 5CXSA 5E8RA 1M33A 3Q72A 3LP8A 1N0IA 3FHCB 3HVKA 1C30B 2HCFA 1EKXA 3D7NA 3K1ZA 2A9PA 2NPIA 3OD1A 5EXXA 3VAAA 2BGMA 2C77A 2ZRFA 2G9VA 2ZP1A 2ZYGA 1OYWA 3OOHA 3VC2A 3G0DA 1Y4ZA 4ZZ0A 1Z5NA 3L7YA 3RE1A 3PRHA 2OFXA 3V48A 1G98A 2G17A 4PICA 5DHRA 4KV7A 4WCFB 4UOEA 3QENA 5LP6A 1JH8A 3GJ8A 3Q85A 1EB9A 2QMHA 3AF0A 1KSGA 2DSTA 3H8JA 4MW1A 2JGNA 3UGJA 3P1JA 2MHCA 2PBFA 1TTQB 2CFIA 1BMFD 2AJCA 2C1XA 1BU8A 2YV2A 2IHUA 3AXTA 2ATVA 4G5HA 4S35A 4D1YA 3TFOA 3BOSA 2MSNA 3HADA 3ELBA 2JAWA 3GPDG 4QGGA 1F8FA 3CLVA 3GDWA 1WMDA 3ZDCA 5LDGA 1BS1A 2MINA 2WF6A 3CRMA 3NVDA 4MPJA 1KMIY 4RD6A 1IUOA 1X1TA 3M34A 2H1SA 3JRWA 3QU4A 2TMDA 5AVKA 1WRBA 1MG0A 3EGXA 3WGYA 4DBVO 3T1YB 1RCUA 1TAHA 4GGOA 5HBGA 3W9BA 3PKZA 4NDAA 4MQEB 4MHTA 2ON6A 2AOUA 4QYIA 2H4YA 1CR0A 5TS3A 2GNAA 3B7WA 5BVHA 4FCVA 1YF3A 2BONA 1GGHA 2TSYB 1WG8A 1XAHA 1PTKA 2GF2A 3H8SA 3ACDA 5G3YA 4LY3A 2PMCA 2QYSA 4F56A 2O05A 2HDHA 3ECCA 3I5YA 4UZSA 4D9IA 4A15A 2LVBA 2QXYA 1U4OA 2Y67A 3BB1A 1Z4PX 4U39A 2C9OA 5JISA 3U3DA 2C7PA 1TD9A 2QTWB 4W5JA 3FYSA 3L7LA 4NMHA 4CVNA 4IVRA 1QGYA 1J0XO 4OP2A 4RJIA 4F7WA 3UGKA 1AG9A 3FWNA 4Z7NB 2OZPA 1T9GR 3QVWA 3BWXA 4HG2A 3RCBA 3SZLA 2WDZA 1I5OA 3DCJA 4KXVA 4RLHA 3WKBA 4BTVA 4I08A 4DHWA 2JAQA 3O6VA 4XVCA 4L50A 1WNFA 2QT9A 1FY2A 3FPEA 5A7GA 10MHA 1WCIA 4F3RA 1XZEA 3R5JA 3W5CA 3LP6A 3CLUD 1BC5A 1LRLA 1HQDA 2DTXA 4LWQA 2OE2A 3GZTB 1OZFA 2H8KA 5JT1A 1KDVA 3VU0A 1E0AA 2W58A 3DBRB 2GO7A 5I9MA 1E1KA 4JX9A 4EHJA 1M1YE 4KQ9A 4F2WA 3NOOA 4AURA 1GTRA 2Q3LA 1CDDA 3LL4A 3ODPA 3TD9A 3FGOA 4J4HA 1FUYB 3QJGA 3W2HA 13PKA 3LUGA 5C8YB 1I2CA 3I9NA 1DRKA 2GN2A 2P1DA 4ZU1X 1NQTA 1EEXB 2V98A 4EECA 4COOA 2HFKA 5HIKA 1BS9A 1EWTA 3I2GA 3ONNA 4R2LA 1RRFA 5KVVA 3ESXA 5EUQB 5AVXA 5JQWA 2CNBA 1Y63A 3L7MA 2WUEA 1J5PA 2B94A 3NHZA 3ANNA 1KIMA 4JLPA 3TG8A 1ZA1A 1TYAE 1FU8A 4R2IA 5ALHA 1V11A 1S5PA 3OJXA 4EBFA 1VPLA 4UHFA 4BRUA 2VQEB 3R3UA 1JR3A 2WABA 5AJHA 1EGHA 2YHSA 2VJDA 1IZYA 2F4NA 3B9BA 3QXGA 2GPBA 1Q21A 3RB8A 4WERA 5JSHA 3EZXA 3HY6A 1FNSA 1RBZA 1UPBA 4NX2A 4LXTA 5A4DA 3ZKWA 1IM8A 2ZUWA 1UDAA 2YWBA 5LL6P 3DLAA 4KGVA 1DE0A 4MLZA 1KP2A 2C7QA 2JFZA 1QYDA 5FA8A 3CXUA 3IAHA 4NYJQ 5HZMA 2V9CA 4QL3A 2YZGA 3SHOA 1C8BA 4Y1RA 4AKSA 4CQNA 4DR5B 2I2FA 3OE7A 2LCQA 2C4VA 2I3BA 3DDZX 5H3CA 2WUVA 3RR2A 2W2XA 4WWHA 5K0CA 1JKIA 5D3ZA 1JHQA 1R64A 2V7XA 4KG7A 3KFLA 2SCUA 2FEPA 2JH3A 3EZ6A 5EQJB 4C0JA 3FX2A 4OVKA 5AIBA 1R9NA 2BJHA 1E92A 1G9XA 1VXRA 3G13A 2NUTA 1EWKA 3TI7A 5JMWA 1N0HA 1ILWA 1OXTA 4LSWA 5DJ5A 5IKXA 1DB3A 1E3JA 2B1QA 1P1RA 4ZV4A 1M6WA 2DOKA 1OXVA 4HAXA 1KE1A 4E12A 2JFPA 4DSUA 5TF4A 2HBYA 1B43A 4YRMA 2QBYB 4U4AA 1RM3A 5HCUA 3AF2A 4PW0A 4FYPA 3N2ZB 5KVQA 4BU1A 2CHGA 4Z3DA 4FM9A 2X4LA 3HJHA 1RYEA 1LS1A 4CLHA 2YWFA 3KDPA 2WM3A 4EMTA 1NQOA 1P7YA 2P1ZA 2VRNA 4TZTA 3DS8A 4LF4B 4LZAA 2EJVA 4O4HA 5HFAA 1Q2XA 1QAOA 1T2UA 5J1TB 5EKDA 1N33B 3J7TA 4G81A 4HS4A 4OMUA 1QB7A 4GVPA 4ZODA 1NVGA 4QOGA 1O6FA 2JEYA 5CT6A 1CYDA 3MT0A 3VJKA 2C7OA 3T35A 2J0VA 1RWWA 2W6NA 4LE0A 1M75A 1K8QA 2DR0A 4P5PA 4KRYA 2ZRHA 3PKJA 1Z28A 5A0FA 4YO7A 4CU5A 4DLTA 3BWVA 4OMDA 1QGAA 2ASEA 2B4QA 5ALKA 5KYUB 2JJ2D 4IDQA 2RJ3A 4XD7A 5KIAA 1XN1A 2HMTA 1J8DA 1O5IA 2V54A 3AGPA 3GFRA 3ZE7A 1I30A 3F7TA 1POWA 4ISCA 4PYNA 1NJ8A 1TM7E 2JCVA 1BN7A 4NYMR 3AR5A 5GZ6A 3ZYZA 1E3TA 1K7SN 1ZVQA 1ECLA 3C5VA 5DW0A 2JCSA 4NBRA 4ZHQA 1TMKA 3D0OA 1AQ6A 1KVRA 3L41A 4WXEA 4BZXA 1LZLA 4XUCA 3WYEA 3QVVA 1Q74A 3GUCA 1GU0A 4EY4A 5BNFA 5FAKA 2WHEA 3RHSA 5EQDA 2Z8XA 4ZO6A 5K0LA 1AO3A 3GZNA 3P9IA 2V6GA 3UUFA 1N2SA 1SXQA 1KMHA 2YHUA 4IWYA 4INAA 3LPMA 3HKBB 1A8QA 1U2QA 2DJ5A 1Z74A 3QELA 4IEIA 1EX6A 1YB6A 2IU0A 3TLBA 3KQTA 5A03A 1YTUA 1G2QA 1DUVG 3KQWA 2BEWA 2O1SA 7MDHA 1KBQA 1L7DA 1UBCA 4H7PA 3ADKA 3ZJUA 1JUDA 2EW2A 3UN1A 2YICA 1ZM3A 4C5AA 2MYTA 4CCWA 3FB1A 1BG6A 1OXMA 1X2EA 3FDXA 5E6SA 5FRDA 2P11A 1YKFA 3IXLA 4IRUB 3OQJA 5CB0A 5KKCA 2CNOA 2V5UA 2ZAGA 2FR8A 2XKAA 4U9HS 4UUPA 4U5QA 4FWIB 4U2FA 2ILVA 1K75A 2GILA 4FFRA 4X62B 1YZKA 1XU7A 1I3MA 3D7RA 1G8FA 1RS0A 1T1IA 3ILYA 4I4TB 2MDTA 2ZDGA 2C99A 3HB0A 2OCDA 4OHVA 2FLWA 2EYUA 4XTRA 2PPLA 2YJTD 3BK1A 3AR4A 1EUCB 3A3YA 3EULA 4GGMX 1EX1A 4X95A 2YNMA 3N39C 4PQRA 3FOCA 4DQUA 1SKAA 2ID8A 1N2JA 2WVGA 4L72A 3VR6H 1GHTA 2QQ0A 1RJWA 3JAKB 3JVUA 4MRVA 4QHYA 4CF5A 1KI6A 1T0PA 3VRHA 3I62A 3G23A 1OAKA 4IHKA 1CY8A 4Z0NA 1JG3A 2YCLA 5E6RA 4WBSA 4R51A 2IUSA 1O94D 3FGNA 3V2HA 5KDLA 5T3UA 2HRRA 1XDWA 2FUNB 3U1VA 3S3TA 5GIOE 5ESWA 1G1AA 2NNLD 2VXBA 3KXIA 1S2GA 3HZOA 3OBBA 1M8PA 4GDMA 4MVJM 4RZSA 4ZYZA 3WRXC 1A96A 1PWEA 2C78A 2J41A 1DDGA 2LW7A 1NVWQ 2JDIA 1JEYA 3GJSA 1HRKA 2WD7B 3H5IA 3MC1A 1BYIA 2IV2X 2XZPA 2JARA 4PFJA 1YR6A 5ALQA 1EBFA 3UWSA 3H1EA 4M99A 3RFFA 2GPWA 2MJLA 3RBXA 3U9TA 1JF8A 2BFDA 3JZDA 3HHPA 4W8GA 1IAQA 4ZZ3A 2AXQA 2AEMA 3HCOA 4N12A 4BFLA 4GQBA 3BBPA 2BH2A 1IQPA 3MELA 4UNRA 1UXKA 1QU2A 5K3AA 1QTNA 3ADCA 4QLBA 4IH1A 5C52B 1NUUA 3E8MA 5AI8A 5AJVB 5BNTA 1A5TA 2WILA 3E9MA 5C4MA 2Q5IA 2X19A 1E3WB 1E60A 1RPAA 1SUEA 1YBMA 3RSGA 3BZBA 3PIIA 2LGJA 3FBTA 3KKKA 1BFDA 1KDZA 1JU3A 1MPXA 1CEXA 1B8NA 4OQXA 1A2KC 3O8OA 3JR7A 3QM1A 3QRWA 2J9YB 4N82A 5BQ5A 4BGUA 1KDPA 4YRBA 1KK2A 2WZQA 5GAJA 4FPXA 2BZ1A 2C92A 2OD9A 5DDIP 3M6WA 3ISJA 1M2FA 3C97A 3LKBA 3NWJA 2H29A 4WD3A 1AD2A 4WEQA 1GG5A 2YXDA 4MQBA 5E9QA 4D9KA 4FS8A 2ZI4A 1Z4IA 2DAPA 3UMSA 3TL3A 1VIAA 1NYRA 2B9EA 5CX1B 3C45A 1JIUA 4PHFA 3RDPA 1G3RA 4LSMA 3LRTA 3SXJA 1P73A 2QRLA 2LP4Y 1SOVA 3ND8A 1QRUA 3G2OA 3L1VA 2Q0QA 4MO2A 2VQ3A 4F38A 3QFFA 2YYSA 4QPJC 4YLGA 3KAQA 4EGCB 1U2RA 3F3KA 1AQLA 3ZJVA 4JYPA 4JU8A 1MQ9A 1WR8A 2A0YA 1Z36A 2QTVA 5GONF 4BJ6A 5D3MB 2ST1A 3Q8WA 3K4HA 5EJ4A 1OFHA 1K7FB 4JJEA 1A9SA 1JPVA 1MB9A 2P9FA 3PNMA 4G67A 3ZV4A 2F1JA 4DCSA 4FWTA 1ZYUA 1QVVA 4G0OA 4RY0A 3UENA 3RAGA 3WB9A 3FTDA 4D25A 1WETA 4YP1A 1DUSA 1U0BB 4YUXA 3KCNA 2YFQA 3CKYA 2B20A 4YDHB 2R0QC 1DIAA 1PL0A 3SM3A 4AROA 4KXMA 1OX5A 4AZ3B 1RQRA 1D6SA 1IMOA 1A95A 3HLTA 3NCTA 2HJHA 1M54A 2EP7A 3BSFA 4GQAA 1WBBA 3SIWA 1ZBQA 1UP6A 3W3AH 4BX8A 1DKLA 2JBHA 5NULA 3IULA 3NGXA 2W8ZA 2WSSA 3FFAA 2ZSBA 3L0OA 1F2VA 4TMVA 1HZZA 1KVSA 1AKNA 2NVWA 4CTMA 4EZEA 3FE2A 1D04A 2JGLA 3ILXA 1EE9A 4Q7JB 1U7DA 3RVBA 4BNGA 3QJYA 1L0BA 4GMFA 1G55A 1R8XA 4MYTA 5DIFA 1G4AE 1QS0A 1WO8A 2ACVA 2HLDD 2QVZX 3L5OA 4YGYA 2AN9A 4WLFA 4YFYA 5BSRA 3HU5A 3R7FA 3G5MA 2JLWA 4DQ0A 4C0XA 4RKFA 3LOPA 5B7QA 4IQ8A 6PFKA 4OI4A 1P1HA 3DHEA 2VRWA 1FW6A 5K0ZA 4YP6A 4JB0A 1T1RA 2HO5A 1R6XA 1DG3A 2JJYA 4GZ5A 4LY9A 3YASA 4D8YA 7AT1A 3F74A 4I50F 4ZREA 3O82A 3OY7A 3VJLA 3GLIA 2CMHA 1FFYA 1T5BA 4DQVA 5K3FA 3T5AA 3MSCA 4QJ5A 1N5LA 1X3SA 3LKDA 4DM3A 1G9SA 4IIFA 4WZAB 6NULA 1V45E 1J9EA 1JR6A 3NB0A 1GWNA 4GZMA 1PAUA 4RPCA 2BTQB 3S5JA 4J49A 1F4VA 4ASUA 1J2RA 4MRNA 2RG1A 1DIOB 2VDMB 3CJTA 1KFEB 4UUBA 2EG9A 2GAIA 2GXAA 2ZG6A 4EVIA 2WHYA 3AOGA 4K6HA 4CN8A 4EH1A 3L7BA 1MEOA 4LDQA 2H2FA 1VLMA 5FP0A 1B42A 1MORA 4RSMA 5HDQA 3JZFA 1VCHA 4A6DA 1Y6GA 4GC9A 3LY8A 1YHZA 3M6AA 1E9AA 1KK3A 4N6NA 2ZDQA 3ZV7A 2FE4A 3BVPA 4LPKA 2BHSA 3QKSB 1WM1A 4ZRNA 1RWPA 1W581 3IQZA 3JQ9C 3I6MA 2ANBA 2WYWA 1TU4A 1UT6A 2XNHA 4IF4A 3K0KA 2BFWA 5DN9A 2GKOA 4PQEA 1RQLA 3OQVA 1QF9A 3IUSA 4H7DA 5HF5A 3QU7A 4ZDJA 3HJGA 4D0SA 1IH8A 1NOIA 1G21E 2QTMA 3B51X 5K8JB 4JJ7A 1PT5A 1SC6A 3DEAA 3AOEA 5DE3A 3UBTA 4BUCA 3OO0A 1ZD4A 3U80A 3KB1A 1NKTA 1K7CA 4Q3AA 2XMSA 4WFJA 2FWNA 2X7JA 2V6FA 2ZYIA 3SG0A 3K5PA 2FSVC 5JWOA 3P9YA 4PSAA 4J3NA 1ULTA 4HWGA 5EJ5A 1M9NA 4DQKA 1F60A 4DQXA 1M8FA 3Q10A 2F43B 5JY1A 3KUKA 3ZJTA 4EF6A 5KQPA 3RJZA 4BMSA 2BEKA 3KVOA 5B6PA 3N2GA 3KT3A 1Y48E 3GZJA 2ZZNA 1I6KA 1CEEA 4MIYA 1VLVA 1C5KA 2Q1YA 2Y76A 1R66A 4OQEA 1L5ZA 1UDCA 2Q1SA 3G8BA 3DFUA 1LSOA 2VPIA 4MUGA 4BLSA 2YVQA 3OZXA 2OCGA 2AYXA 3DMDA 3FCYA 3H11A 4PZ9A 4CFSA 1Y1SA 3PGXA 3EIEA 4U9UA 1TCUA 3ZHOA 4ZI7B 3BCUA 4NDNE 4F9EA 3NHFA 4L57A 3T1OA 3ZWXA 4E2YA 3M2PA 2YVUA 4B7ZA 2I4TA 4LQCA 2P9YA 4ZQHA 3SIPA 2ZJFA 3WL4A 1ODJA 3L7KA 2V03A 2I3ZA 3GPBA 4LFBB 3F6BX 3KD2A 4RANA 4F46A 3VU9B 4ZFNA 2AC4A 5TRTA 3JZIA 4V0LA 2H48A 5BSTA 3D6VA 3GPLA 1D0IA 3C3EA 1DV1A 1FMJA 4KMMA 5KQGA 4C21A 1WZEA 2VQDA 5EIAA 5ARDA 5BSHA 2NMVA 4NBWA 1J2TA 1MC8A 1O77A 3JQCA 1TI7A 4RELA 2CBZA 2FHPA 3ZWCA 5A9RA 1R6DA 2DBZA 3O9ZA 4OTZA 1ODFA 3G9QA 4X1KA 1G0OA 1ONPA 1P0QA 4I8XA 2NQ8A 1BZYA 4PLVA 4N41A 1PW7A 2CCJA 4D8VA 4DMHA 4RZHA 5IYZF 2BGKA 1H5NA 4ZOLB 5BSUA 2AQIA 3CBQA 4FNOA 2BKUA 4J90A 4N6OA 5YASA 5BQFA 1FS6A 2HWYA 1HDXA 1QRAA 2XUGA 3E8SA 4BVHA 3KKMA 4Z4GA 3N8HA 3OKAA 4RF4A 1FYFA 3AEUB 2XDWA 4MVXA 1K8YB 3G7SA 4PN3A 1TK2A 2GEBA 4IZOA 1AXEA 2FWAA 2QLJA 4EFDA 1V47A 1N9GA 1RMYA 3DTTA 3OLQA 3ZHUA 1VRCA 3H2GA 3VKUA 3OQOA 5DHQA 4E2ZA 5JHGB 5ES4B 3VPFA 1VRWA 4KQ2A 4MP6A 1F0KA 3OEEA 1S2MA 4URHA 3FVVA 3ZW9A 3AEQB 3L8ZA 3PC8A 4AJNA 2WQ6A 1CLUA 5HM6A 5J4HA 3ZEAA 4MIKA 3GLVA 2R48A 5EXDA 2EIHA 2XV1A 3LX6A 3NDJA 4IL5A 1JL3A 1GPAA 3BREA 2PRJA 2C31A 3DULA 3EIHA 4Y2SA 5HRUA 3KYDB 2P6RA 4QUKA 3GN1A 3KBOA 3R9XB 1Z8DA 1ONNA 2NOAA 1ZIOA 1PJLA 2WG0A 2OV8A 4E32A 1YDEA 4M53A 4E5VA 5BRJA 1F2UA 2FNAA 6YASA 5LFAA 2QT0A 2VT2A 3CG4A 4QE3A 5EJ8A 5KOHA 3U16A 2QX9A 2XE8A 4P4UA 3VR4D 4WGFA 3GNTA 1E6EA 4UD6A 5EHIA 3RFUA 2OWEA 4ND3A 2Z2XA 1SU8A 3P96A 2UZAA 4BNUA 4EO4A 4RULA 3HA3A 3FUVA 4B2YA 4BEJA 4PO3X 2BFCA 5FA5A 5G53C 4JP3A 1YS4A 2NO7A 5FTNA 4TMZA 3NT2A 5U4QA 4LHVA 2R6JA 3PITA 4DSAA 4I1VA 4DWJA 1ENPA 4O2LA 4D9BA 4C6TA 3K09A 1CUGA 1L5VA 4JUAA 1P4SA 2AKEA 3TZHA 1GZ4A 2ZIAA 4YJ2B 2G28A 1TO6A 3NT5A 4U00A 2B2NA 3HZHA 3BORA 5EI5A 1HFWA 4Q18A 5A1TA 2DR3A 3PQ3A 4ZAXA 4RCZA 1E7WA 1DTWB 1JHAA 2GJAA 2AFHE 3BCSA 3EZYA 1P9LA 1QWOA 3DMTC 3DL4A 3DYBA 4GP7A 3ZBQA 1VLHA 2HPAA 3SNKA 1QXSA 3RSLA 2A78A 1DMRA 3ZW8A 5I7VA 2BY4A 3THSA 3UW3A 5KEIA 3P9ZA 4XSVA 3A9CA 2AOXA 3A4NA 3A9RA 5ADHA 2JI4A 2IU3A 1U5BB 1ZNYA 3MAGA 2IZ0A 2JDID 1WU7A 3AHHA 3SZOA 3DBOB 1TEZA 1UPFA 3E9ZA 3A31A 4CMBA 3ABZA 3UBMA 1A9OA 4GKVA 3EX7C 5LYJA 3HEMA 3Q2IA 1XZFA 2IEDA 5DGTA 3WIBA 1SQSA 4WN9B 1WJGA 3RHFA 2POCA 1J0BA 1I9GA 4URUR 5FUQA 3ZHQA 3Q40A 1CY1A 3E2IA 3KZKA 3UJ8A 2PUEA 3EF3A 3QPDA 1NJGA 1QR6A 1MO3A 1E9EA 1GFSA 1XA3A 3IT2A 3LAWA 1WXWA 3RFTA 4LJ7A 1EGVB 1V1JA 4JENA 4FOOA 3Q2KA 3VI4B 5K0EA 3B7PA 4MGHA 5IS2A 2DZDA 4KGZA 5HF8A 4LPSA 3WGQA 2V7TA 4OQQA 4BQPA 5IULC 5JXIA 1QIHA 4B2PA 3L06A 2F2TA 2QN8A 1G8GA 1R0RE 2OQIA 3IV6A 4YJ2A 2D5BA 3BBLA 4DABA 2OKGA 1WMEA 3IX7A 1JPNA 4FXPA 3GEIA 2R6CA 4RVFA 1WSAA 3O94A 4M9SA 2NV2B 4QXPA 1W94A 1ZH0A 1US8B 2C7GA 1U3GA 2VJMA 3FNRA 4I4LA 2DPMA 4JI5B 4D42A 4DDKA 2ZUEA 4AKHA 2X22A 4DDTA 3NLLA 4AO8A 2P5SA 3BFJA 2A86A 3RS9A 3C43A 4R9RA 2XE4A 2NU7B 1DGQA 4U7HA 1LDYA 3EXFA 3AUJB 2C82A 5BYJA 1J25A 2VF4X 4EK9A 2C7VA 5AKIA 1XMOB 5IU6A 3EHDA 3GC6A 5KX5B 1KPHA 3IL2A 1PR0A 3CUTA 4QBGB 2J6CA 1GSIA 1VBNA 3T7KA 4ND7A 1UJBA 1W2HA 4G0ZA 4TRMA 1W52X 4LXUA 2VQSA 2REXB 5FWXB 4FFDA 3M3DA 1SVNA 4HPWA 4YYZA 1E7YA 1WOMA 4PNEA 2I6XA 4XVUA 3JU3A 3KFXA 2NVOA 2O2GA 1XDSA 3R6DA 2V3WA 1VE1A 2PX2A 3Q0IA 3S1AB 5FF9A 1SCKA 4JBNA 5BWBA 1I94B 3IR5A 5K8UA 3KHKA 1U3FA 1CUXA 1ZJ6A 2XE7A 1L5GB 4CM1A 2JBAB 4C88A 1CP2A 1R0KA 1VHJA 2PU7A 3A4IA 2IGBA 3CH6A 5EE9A 4JOQA 5JAQA 2Z04A 1XA0A 3LYUA 4RK4A 5CLIA 1X14A 1CY0A 1T4CA 2YXPX 4YT5A 5K2MA 1BW9B 1CSEE 5FI1B 4JT8A 3AERA 3IP8A 3OD5A 2J3LA 1DBIA 1HM5A 4R7TA 5HYVA 4B9AA 3V1NA 4TLBA 2ZSJA 1D3AA 3ZTTA 4QXOA 1RRKA 4JLVA 1FTQA 1N2OA 3PFHA 3K6JA 1YK0A 4BWVA 3B6KA 1L5HB 2FRVA 3EAQA 1ORVA 3FMVA 4D9HA 4ILKA 1DC7A 4J76A 4DRXB 3QWFA 2FZWA 2H1IA 4XWGA 1Q6YA 1OAOC 4HDAA 2BL4A 5B3AA 2I80A 3FAKA 5AM3A 2L42A 2F59A 3DSRA 1PQ4A 3R3JA 3DCIA 3FTEA 1FSSA 1O0SA 1QV9A 5H1YA 1FVXA 3FUWA 3O2SB 1DCKA 2JHAA 3OP1A 1TQ6A 4JJGA 1OILA 5BNWA 2QQEA 1N36B 4W1RA 2IYTA 3EZ2A 2RCNA 1JA9A 2IOFA 2Q5JA 2Y68A 3N75A 4TQUS 4ZVSA 3RFCA 5LPNA 2JRCA 1C7QA 2H0RA 1I6MA 3A6JA 1QX3A 3OZEA 4IWNA 1JTFA 3R6GA 4L51A 1QJCA 1T6BY 2HTFA 1XNRB 1WXDA 4P2BA 2FB9A 2DCMA 3BS4A 5CTJA 2MMCA 5ITSA 2JFNA 1IVNA 3KZNA 1D2CA 1JXOA 1N6HA 2IUYA 3ZDFA 4JGIA 2VF8A 4JOBA 2QP3A 3DFFA 3G9UA 4UEQA 3OSZA 2RAVA 3CUSA 3L6EA 1DRJA 2IIBA 4OQLA 4Q66C 1GAEO 1UC9A 3LIPA 1IBKB 4JR1A 1R6AA 3MMSA 3A58B 4BXOA 4BBJA 4HDSA 4WOPA 4KO8A 2WPNA 2G1PA 4UU7A 3AHEA 1IUKA 3DEFA 4HB4A 3ZLTA 4XVQA 1E6CA 1LPPA 1MIOB 5HZHA 4OHOA 3OPYI 5CM2Z 4RDXA 3AHGA 4BXOB 2FPXA 1Z75A 3ILSA 3U49A 4ZZIA 2AX4A 2P3OA 4V0ME 2PH5A 1E1NA 1JG1A 1E59A 1QMPA 3C48A 4M22A 1AQUA 3LQ4A 1QNFA 1RCFA 5HW0A 4NBVA 3ESBA 2VC2B 3KZCA 1LVHA 1M6YA 1KPGA 2NUPB 4H4CA 2QZSA 1YZLA 2GK6A 1GARA 1IPEA 1WPXA 2Q7XA 3DAYA 3AI1A 3DQPA 4U8GA 2P91A 2GD1O 2BLLA 4N3GA 4MR8A 5IM4F 2H9AA 2WSYB 4XWWA 1BTOA 3RT9A 5BOSB 4M0UA 4DVGA 4ZAWA 5ELMA 2WJYA 2Q5QA 4UTZA 3ED1A 4MMYB 5FBHA 1NURA 1PGOA 5T67A 1CJTC 2QUHA 4J2HA 2Q62A 3C3DA 1YQ9A 4YP0A 4BX9A 1T24A 1YS9A 4AKTA 2WT4A 3ZBTA 4QOJA 5CJPA 1X80B 4E3WA 5KDDA 1G8SA 5KUTA 2DVMA 2NU6B 3CKMA 1GXSA 5K3DA 3V4VB 4CKCA 4BQIA 3AK4A 2WC1A 1V1MB 5P21A 1Q0LA 3R5FA 2XIJA 2WTEA 1W2WB 2AMLA 2JCGA 2JGDA 3CVJA 2Z0MA 3ETNA 3FDIA 4IDPA 521PA 1RE0A 4ML3A 5IKPA 1G20E 4MVJG 4MROA 3U7QB 2O59A 1PIWA 1LXCA 3NBMA 4EVQA 2XB9A 2WZBA 2QAIA 1UM9A 4RTKA 1KOJA 2GK7A 2PUTA 1UMBB 4OF4A 3CPEA 3RUPA 1GUYA 2YWJA 2L82A 3TSZA 5CA1B 4KX3A 1IK6A 1Z8HA 3M5PA 3NBAA 4CFZA 4XR9A 5CG1A 1R5BA 5KNCA 3G02A 5A6SB 4FEEA 3TIVA 5B5SA 2QB5A 1BH6A 5JSQA 1RDFA 1G6HA 3DEZA 4MUXA 3HVJA 4DY4A 4FKZA 1T6ZA 1DXYA 1R9JA 1DEOA 1Z2NX 2OPBA 4D8TA 2AUNA 2TRSB 1EK6A 4A36A 3NOVA 2QUBA 2QN9A 3PWTA 3I04M 2PXXA 3OMLA 3E8XA 3SFVA 2NXEA 1R0LA 2YUIA 3N6XA 2G9RA 3DYIA 3WV4A 4WK2B 2G77B 3MD0A 2PH1A 1E98A 4IBOA 3QG1A 2DFNA 4NZ9A 4OJTA 1HG0A 2R96A 4LKOA 4RPJA 3TIFA 5CEEA 4YASA 2V0GA 1LQ2A 3WMFA 4TWZA 4R3WA 1ZPDA 4XGNA 4D79A 1PJSA 1W96A 3CF4A 1DAPA 4DOMA 3PNBA 3REFA 1TT7A 4LOLA 1WY5A 2C94A 4ITUA 2Y1OA 4FDVA 4JYBA 1RJDA 6AT1A 4K2HA 3HKEB 4EUEA 4RMNA 1K0UA 1QG0A 1UXGA 4YN3A 5CNKA 4L08A 1E1CA 5CPFA 5AHKA 1XYVA 1ZGBA 3L18A 5ICFA 1HFKA 2VP4A 1LJLA 1G3MA 1DOAA 2ACEA 2EV9A 1J5EB 2OBBA 3F6EX 1WQ3A 5JSZB 2FQQA 4MUYA 1EH5A 5TIIA 1URPA 4ID3A 4LSGA 3GWGA 4Q9AA 5FCDA 1O8BA 3E0XA 4IKEA 3EQ6A 2OHOA 2YW2A 4BNZA 2VJOA 4ZCIA 3TCNA 4P7KA 2IYZA 1P7VA 4KH0A 2FN3A 1Q3KA 4M6WA 1TX4B 1Z5UA 4GF5A 2AFIE 1PYDA 2J85A 4MIEA 4ECAA 1X39A 4OSEA 1Z6GA 4DSTA 4J91A 1FX1A 2WUGA 3IUEA 4B35A 3C6BA 1GT91 3WVNA 3NXSA 1KI4A 1YO6A 1KQOA 1AF7A 4MJXA 4EB0A 5K0GA 1ZUNA 4ZO8A 1Y4DE 2JHPA 3NBZC 2IL1A 4OLJA 3JQ8B 4FONA 4HVAA 2VJNA 2QMUA 2AYZA 2GA9A 5A3RA 5KINB 4ANFA 2NP7A 3EXHC 2E4ZA 2V4UA 1FSZA 3UPTA 1SA0B 3AF5A 1REQB 3SXUB 3NTVA 1Z0IA 1CETA 2ZIXA 3DL2A 2REBA 3IBCA 2P6NA 1TU0A 5FADA 3A6PC 2D5IA 5HOEA 2VP5A 3JALB 4EKIA 5AM0A 1FFWA 5IK2A 1JVBA 2CLSA 1BE8A 1RZVA 1V5EA 2VUIB 1JDBB 3H5NA 1HPLA 3N0VA 5EGSA 4ACAA 3BL8A 1GPBA 4DLSA 5CBPB 2AS0A 5JATA 5KAMA 3DE6X 3G89A 5EJ9A 3Q8MA 4LYEA 3QF4B 2G70A 4QX6A 2GOYA 1JIKA 4HQ6A 4HNSA 2UYCA 2J0QA 3D64A 1AX9A 1OREA 2CB0A 3RV4A 3UIEA 4IP0A 3GFPA 5E38A 1Q0ZA 2D2XA 5HGXA 2NT4A 3V3KA 4O3FA 1CQIA 3WMXA 4D4LA 3QXSA 4IDDA 5C5CA 3ZVNA 4TRRA 3VC7A 4JR0A 4W6QA 2HRZA 3IAAA 3QKWA 2H2WA 3OFVA 3N3AC 2HCJB 3Q7IA 2Q6TA 3OETA 1KAHA 5L7TA 1F3OA 3ESDA 1DAFA 1UKYA 4H2DA 4JZYA 4UUQA 4XQCA 4ZKDA 4D7AA 1YMUA 2WV7A 4NBSA 2J3JA 2ZTHA 4UE6A 4EI8A 1NBAA 2L17A 2BUBA 2UZ3A 3KJXA 4P31A 5BV8A 5KWJA 1IHDA 2BEVA 2VJLA 4UCWA 4W6ZA 4GXQA 4CM6A 1UP4A 3VSCA 1TMYA 3NQ41 3EEFA 2GFHA 2WD7A 1R4AA 3LDAA 2R8XA 2R751 2W2NA 3CNHA 3DM5A 1W1UA 4KPGA 5SYAA 1P9RA 2RGAA 1BS2A 4GOXA 1ZK2A 4CF4A 4U6QA 1G5IA 4DMGA 1P1KA 4YRPA 2ECPA 1D2MA 2GMWA 2QZJA 3I53A 5IHXA 1NVEA 5A3JA 4L3WA 3L6UA 4OQDA 5M5BA 2WJVA 2VHVA 2WMOB 1IEQA 5HMLA 2GEFA 1Q3HA 3WGIA 3LI2A 2HMWA 4GUDA 4TUYF 4MVWA 3EN0A 4EHFA 5BW5A 2BSAA 3NEJA 5AKYA 2B4TO 4HAVA 4KMOA 1KO1A 1ESDA 3HP4A 4FMCF 4HZUA 1XXLA 4WZBA 5G0TA 1N2XA 1FE8A 4IDGA 5K0NA 3O2QB 4O2BB 5FUWA 1IHPA 4LAFA 3ZTWA 1T1GA 2C2WA 4KIFA 4RYLA 3JWIA 1N6KA 1QZTA 1GNQA 1XZQA 3UWOA 3K71B 1CIJA 1XCOA 5EYPA 5AJYA 1W29A 3QVXA 2Q2NA 4O63O 2IHNA 1LCIA 4DZRA 1DQYA 5MN4A 4BEWA 2YN0A 1E7MA 3QXJA 2QUZA 5JVDF 4W63A 3R3HA 5JADA 4UAJA 1IB6A 4RK1A 4V0NA 1XEAA 5C1IA 2H2IA 1C1YA 4CMEC 1GFIA 1BXRA 4H3HB 2JGMA 1YZFA 4POOA 3WAJA 2FUEA 1LPAB 2HLNA 1V9LA 3ZWNA 2XOEA 3TD6A 4GI5A 4Y9DA 1HDCA 4PEVA 2WQZA 1Y8AA 1KJZA 3JASB 3ZIAA 1V5IA 1X87A 2ZS8A 2FA9A 3PWZA 1XFAA 1UZAA 2ASVA 2KMLA 3I8XA 2FXVA 5JMTA 1JQDA 3TJRA 5K0BA 4QU0A 1JE1A 5IDQA 3QTLA 3OWOA 4GNRA 4ALNA 2C2BA 2PS9A 3H19A 1GPDG 2OEPA 4AUMA 2HIAA 1JG7A 3KQYA 1GPWB 1NASA 2LIVA 5IEBA 4B32A 1QYIA 1XRMA 3BMCB 3KK0A 4QZVA 4PR3A 4WZBB 4MV3A 2JGIA 2QX4A 4MUIA 3SHQA 2HHHB 4FYXA 4PLYA 3NU1A 4QDXA 4WJZA 3TM5A 2JZNA 4NICA 2Q8NA 3FBWA 1RWXA 4LSZA 2OLJA 2GN9A 2P2LA 2YJ6A 3LLSA 4RDIA 3TRFA 1JLLB 1UF9A 4QJBA 3NTXA 3VH4A 4B80A 5JMOA 2TECE 3W3ZB 1OCEA 4OQFA 2ECFA 3STYA 5BV7A 3TFQA 3Q5GA 5A05A 2C1ZA 1GPLA 3KDSE 1X9HA 4NFLA 2X8WA 5E0OA 4REQB 2OSBA 3VTFA 3X1YA 2GD0A 3SMVA 5FHQA 2EX0A 3JD3A 4AY3A 1ZNZA 1UBGA 2AZDA 4LYYA 1HNNA 3IC5A 3KB2A 4PAMA 4YA6A 4CIDA 4MIOA 5KOJA 2UUPA 4ZEWA 3A4VA 3JD1A 2FPIA 5CFOA 2E2WA 2NO0A 1OX4B 4MULA 4BEBA 1ONBA 2KX7A 2A1TR 3DMYA 4GPBA 1MD9A 1NVAA 3X1ZA 4EVRA 5I7AA 1HSZA 1Y82A 2IE0A 2D0OB 2FG5A 1IHOA 2C3YA 3V8BA 2FVXA 1Z4JA 4CT0A 1MH9A 4GAEA 3PYLA 4TS3A 4ALIA 2PYDA 2VNKA 3QUTA 3FCSB 2ZJ1A 5CFNA 5LP6C 4WLVA 3EC1A 1AKMA 4HDCA 4NVRA 5LZ9A 2YN4A 2HF2A 5AD1A 3OLWA 3OUTA 3WO0A 3PTAA 1DJOA 3ORSA 2XDYA 4F2DA 1JB1A 1DUIA 1EZZA 1W30A 3OT1A 4GYKA 4AJOA 4HN9A 5JD5A 1ENOA 1OGJA 2EL9A 2N0SA 4UU1A 1C9MA 5DYGA 1LZKA 2BZSA 2W48A 3EG5A 3MJTA 3BDIA 4P22A 1HDOA 1XTVA 3P0EA 4PHHA 4QOSA 4AP6A 3U6BA 2R87A 2GN4A 1C14A 2FN7A 2BR3A 3CSSA 3NKFA 1VZ2A 3OH8A 4KOAA 1A8UA 2F62A 3R9IA 3U13A 3NKVA 4EGAA 3CPJB 1NV9A 3BJEA 1XPOA 3PLNA 4RXMA 3NPMA 3ZK7A 2PWAA 1K6EA 3GIWA 3HCNA 3NYWA 5BSKA 3PC4A 3DLHA 1EB8A 2PH7A 4HATA 2Q1UA 4KLRA 3WZLA 2A5DA 1NF8A 4L28A 3ZNQA 1L7AA 1NRWA 2DWPA 5K8VA 4XZ3A 4YJFA 2E1RA 4JJIA 4JLSA 1W36B 1ISHA 1FUIA 1KS2A 3EZFA 1ZP6A 4X45A 3SYMA 5ITWA 4I9FA 4AIIA 3ORFA 4HGNA 1XU4A 2W2QA 2JLRA 3RIGA 2QEQA 3G5AA 1G8JA 3T9AA 2XB8A 5JQGA 2C8LA 1FVOA 2C03A 2ZLBA 1OUMA 1RXYA 2OY0A 2P4QA 3R40A 4ZA2A 3UB2A 1GRVA 1XTPA 2GCOB 1OGYA 1SQ5A 2IBMA 1M2EA 4CKBA 7GPBA 2G6TA 4N01A 3IS3A 3M5CA 2RDMA 5L45A 1O54A 5CW2A 5LQJA 2WQ7A 3H1BA 1TKCA 1E0JA 2W9XA 5JD3A 2EDAA 2WTAA 3D6UA 4YCAA 5CA0B 3RYCA 4Q6BA 1B6SA 1ZVJA 4G0YA 4C4TA 2DLCX 4J16A 1BKSB 1SXJA 1R4NB 2ISCA 4B40A 4CL8A 3L0ZA 3RT1A 4TXLA 1O0BA 1TUBB 1Q7TA 1V1RA 4R2MA 1JHZA 2BGJA 1PR3A 2HEGA 2WV9A 4UAVA 4WK6A 2ISSD 1LH0A 2QU8A 3AVPA 1L8AA 2C42A 2F1IA 2CSXA 3ICEA 2HNAA 1JLMA 1T36A 3W1WA 2B8EA 2P3SA 1VKZA 1IBRA 2P67A 1IG0A 3UK0A 1MLDA 2PUJA 3ET5A 3E5HA 2D1FA 5LA6A 2BMAA 4N3CA 1R10A 3ZOZA 3KQQA 3NPAA 2QD5A 1CS4C 2P9HA 1KKUA 1Z13A 1SGWA 1NQVA 3BXGA 3HXLA 1POXA 1YRYE 3Q0TA 4HDMA 3RVOA 4ZQEA 2M6SA 3T3GA 1OI7A 1JSLA 1Y3AA 3U4AA 1M7BA 3PX7A 5LQAA 421PA 5IT4A 3O3OB 3W5HA 4G0NA 2K2WA 2V5VA 1TOAA 1VOTA 2AR7A 2O07A 3OI7A 4GSKA 1OWMA 1JI0A 2VDKB 3I37X 3SFTA 2UUAB 1STOA 3LDGA 2VDQB 1QHHB 1ITZA 3LRXA 2DBYA 3DO8A 1XNJA 2BGRA 3QWIA 3OHPA 5D3MA 3N7AA 1V7QA 2YJZA 2OC4A 4ZVKA 4F8EA 1UMBA 1L7MA 1E2QA 1FL9A 3TR5A 2BZ0A 4A16A 2E5FA 3P0RA 1U98A 3DV2A 2O7RA 1TKBA 3D3WB 4WH0A 3IEVA 4BUZA 1PKEA 4O2BF 2DX7A 2CK3D 1LPMA 2CCGA 2N1BA 2YZKA 2B1IA 3DOIA 4ME6A 2P6UA 4NOLA 5BT9A 4QJ3A 5BVHB 4LCJA 3PUXA 3A3KA 1JDNA 3IALA 3PGA1 1RRVA 3HGQA 4LNUB 4EENA 4ALLA 1QIEA 4H9GA 3ZD8A 5F35A 4P4LA 2WAOA 5JR3A 5CJJA 1P8JA 3FHJA 3M9WA 5E9JA 1I0ZA 3KBBA 4C29A 4ZIRB 1RFLA 5HQJA 1QG2A 5LWQA 2GM4A 1KOLA 2ZJ5A 1X6VA 1G41A 3IR6A 4LMRA 4WEOA 3GP5A 3RC7A 3MFYA 3I9JA 3BH6A 2PJZA 1VMIA 2I4RA 2OZLA 5FQNA 4DYDA 4TYMA 2XNCA 4IUYA 2O3SA 2DFPA 1ZCAA 1Q5PA 4XTCS 1PYOA 3O4HA 3ZZUA 3OKCA 3PZRA 2DPGA 4J0CA 2WUWE 3ZHZA 1FMFA 3FBGA 3R3SA 2ZYDA 5CTAA 4EG7A 2H1FA 5DTIA 2PFGA 1P5RA 1G8KA 5FPYA 3HWRA 4YTEA 2F9LA 2HRBA 3DLTA 2OECA 4FYVA 4OJNA 4JC5A 1B23P 4NZPA 4E5NA 2GETA 1AGPA 4OATA 1MFZA 1R8YA 1U81A 2J3HA 3AUSA 3ZWOA 3K96A 4GS5A 2YTZA 3T12A 2IK8A 1ZI8A 2PVCA 4G41A 3OCCA 3WKEA 2D7CA 2PKRA 3AFOA 3B3AA 3MNFA 3HNOA 5JNSA 3LUKA 1Y1PA 2FKNA 4FFSA 2VTVA 4M76B 4WACA 3ROFA 1GD1O 1N32B 3OJ0A 4OD0A 8ATCA 3M4ZA 4Y6LA 3A6GA 2OD2A 5AW9A 3IP6A 4MDEA 1MOPA 3WGTA 1TZCA 4FOTA 1NC1A 1FP1D 4WBXC 4AUNA 2INGX 4ZDIA 1VQ1A 3IRUA 1UFRA 4LDPA 1H94A 4FC7A 4V0SA 1X38A 4O4IF 5ENVA 5B6IA 2E55A 4DJ5X 1GO2A 3L01A 4FDMA 2FFHA 3AP3A 3W6ZA 4Q9IA 4YP7A 3ANLA 3WNZA 2VNHA 5F2KA 3D6FA 4A27A 2KWIA 4J1QA 4JFAA 5HKAA 1A8IA 2OYSA 3I9V1 4FJ0A 2MYPA 3OKFA 4RMIA 3GFTA 2FEAA 2WKPA 3ZWWA 1Q7RA 4F5ZA 5FL7D 2I22A 4NH4A 1DX9A 4G5QA 4LCEA 1MB0A 3I64A 2C20A 3B60A 4K26A 3UGTA 5AM4A 5ICGA 3LWDA 4F6RA 3J81k 5GVRA 1FMLA 2LZ0A 5CB8A 3AF6A 4Z4QA 4UJ3A 2CYAA 3AIKA 2Q7DA 3TD2A 4MR7A 2WAMA 1KQ3A 4OJYA 1SXJD 3NGMA 4R9UC 4TWJA 5G1OA 2EFEB 4BLVA 4X8LA 2DPYA 2PCLA 4I9HA 4BP1A 4W9NA 1IHUA 3LQQA 3H2IA 4GECA 3FVQA 1DVRA 2A7QA 2GPNA 4W9RA 2WBLC 4AP5A 3UMVA 5EC8A 1S2LA 1W76A 2WHRA 1E5DA 1T4CB 3PRKE 3FTCA 3WOVA 3QF7A 3W5BA 3HKBA 2YDYA 4M1QA 3ENWA 2XITA 3Q3VA 3NETA 2W5UA 4ND4A 2QF7A 4PXAA 2NO6A 3NRJA 1K4YA 1UPXA 3VYVA 3K0AB 1P2BA 3S6JA 2D3WA 3DZJA 4DR4B 1ISSA 1EBBA 3PXDA 3VX4A 5KBYA 1N3YA 1RZ3A 4JC4A 1DJMA 1P0CA 4Z8XA 3MQ4A 1S8OA 3QEKA 1OFUA 1S96A 1Z0DA 3EB9A 3D3JA 3NWOA 3QVUA 1RHMA 4FN4A 3QEBZ 2JJ2A 3EXIA 1IONA 1X7XA 1K06A 5CT4A 1KWGA 1CZUA 2ZVPX 3KKEA 4CR6A 1FMCA 1KEZA 2ODPA 2K2QB 3FPLA 4YY3B 2EWMA 2R7AA 4FOSA 4LNAA 1L1EA 4H1TA 1H2HA 2WJ3A 2G0NA 2W8BA 2ZWIA 3QYAA 1H2WA 1IXSB 3K9CA 1TAQA 3QTTA 1SKMA 1ADJA 3KM0A 4ARVA 1YB7A 1FXWF 4MEAA 2NUTB 1KRHA 3ONVA 3WFIA 2QS9A 4V24A 2ZJYA 3O8CA 3DR3A 3H75A 3N2LA 2QRMA 3N58A 4Y1EA 2W90A 3UXEA 3I6QA 1QONA 1AN0A 1JRLA 1XZGA 3T5GA 3A9TA 5F5NA 4D81A 3AZPA 1IHXA 2R8PA 5ALDA 3C6XA 2V65A 2GKGA 4OHYA 2VHCA 1Y89A 1G8HA 2AI1A 2ZI3A 1KH2A 1UUFA 1P7CA 1VKOA 1V5WA 2H3HA 3HBLA 3OEYA 3ROKA 1PVDA 4I36A 4Q4HB 3WIOA 4BN0A 1S2OA 4EY5A 3L0DA 3SEZA 2H63A 3AV0B 4G5RA 4O2AF 1ISFA 3RJTA 3I2FA 1XUOA 1M7GA 2NNWB 2Q3DA 3V1YA 5CFZA 4RY9A 2WHPA 2D2VA 5DN6D 2X0IA 4ZGBA 2A1IA 2SHKA 1GCIA 2WJ4A 4IDAA 4PX2A 1AUQA 1Q1EA 2C9BA 4MUJA 1Y1RA 3RJ5A 4UXHA 3TIXB 1D2EA 2ZB3A 2DHDA 1ST2A 2SKEA 2JLSA 3AONB 1SBZA 3LECA 3BGOS 4TS9A 1SKQA 5EP2A 4EJSA 1WXFA 4K6KA 3WNDA 2H00A 2CFSA 1FSFA 1RYDA 2L0XA 2WE8A 5JW6A 4JMPA 4RGYA 2B0JA 1MA0A 2H7CA 2NU9A 3IQWA 1HV8A 2VYND 4ZPXA 1NJSA 3CLRD 4FYWA 3ZE1B 2J33A 5CEFA 5IF3A 1SD2A 2FZ5A 1LD3A 1RZRD 2HSEA 1XN4A 2YXLA 1NW3A 1XO1A 4G8CA 2ZUSA 1KJWA 3D8TA 3KLBA 3DV0B 4M1SA 1WZIA 4WA7A 1QH1A 4BB9A 4DJTA 1E1CB 2OBMA 2Q5FA 1OV6A 1IJKA 3PVCA 4J2OA 1W35A 4X20B 4TTVA 2PWYA 3TW8B 3RS0A 1SG9A 1UMDB 4FIDA 3EE6A 1WMFA 2Y9PB 4TMFA 4EPRA 4AJKA 1NFFA 2D1RA 7YASA 5IWAB 2CK3A 4FR2A 4R1MA 2C88A 2VBFA 3CTMA 4KWIA 4ALKA 1JDBC 4H7HA 5EJEA 5I7OA 2XXAB 2YJ5A 2XSZD 4HXYA 4RETA 3BMOA 1VIDA 1WCIB 4F5WA 2XTMA 5MF6A 3BMQB 1J8MF 2R5FA 5J5AA 1EHCA 4FQ8A 2OYRA 1TM5E 1YDFA 1OIWA 2WINI 3Q0EA 5LBTA 2FEWB 3G2PA 2JIZA 4R8RA 4CV1A 3FNBA 3VR2A 3RF7A 1C2YA 1LK5A 1R8QA 1T0JB 1WTCA 2C1EA 3GCZA 3KAJA 3GJ7A 1GL3A 2PK3A 5EZYB 1OIXA 2PX8A 3ZY5A 3UPDA 3ZPXA 1IQUA 1UXIA 1IWPB 1U2EA 4I5GA 4NZMA 1I1NA 4TQAA 5C8YA 2FWMX 2GTHA 3WFZA 1T1EA 1NJFA 2V55B 3BJMA 1TPZA 1H8HA 3QA3E 4HI0E 4ATNA 4KWCA 1IAVA 2G76A 5AOBA 3TZ6A 4DCTA 3GRAA 5IT5A 2ZYAA 1Z82A 2AF4C 1M2WA 2ATXA 2H92A 2X4IA 4G07A 4OGKA 4ZQCB 4EO7A 1SIBE 3ZLJA 1M1ZA 3UPUA 1U0NA 1Y3DE 3FIUA 4GIBA 4ZRMA 3RKRA 5HJEA 1QIIA 3PFKA 2GQ0A 3DAGA 3VTZA 4GICA 1PGQA 2AJ8A 3WKDA 1ECPA 1YR1A 3QWAA 4DILA 3WK5A 3ZE8A 5K05A 2VF2A 1E3LA 3NAMA 2B6NA 3QBEA 4OP3A 1ZJ5A 3NH6A 5FBLB 3TQTA 4L75A 1ATIA 2JLQA 4JBXA 1L1FA 3JRXA 3SZ3A 3WK6A 3HBMA 3D5TA 1R9MA 3ORYA 3TAUA 1G3IA 2AGVA 5JZBA 3QMVA 3C6KA 1M34B 2VJQA 3B1FA 1SXJE 2MINB 2EW1A 1N9GB 1DAEA 3ZD6A 1Z6YA 2NVUB 4GP9A 1E2JA 1RHQA 1SHUX 3OX3A 4H18A 3GB9A 3CCFA 3M6IA 1NAIA 4J0GA 1CRPA 1U1CA 3B85A 4WKNA 4CM7A 4UTNA 5KMGB 5KTPA 4YONB 1T4DA 1SUWA 1DV2A 3PQ5A 3W2IA 3TG2A 2EARA 2AHOA 3PTZA 2J0EA 1N2IA 2WAYA 4FFBB 4BKUA 3V34A 2W4QA 3IOMA 2IY7A 2PZFA 4HB3A 1YQEA 2NM0A 4QXMA 4RLFA 2J1LA 3MGGA 2AD5A 2JF0A 2BV3A 2FRDA 1BVUA 2KE5A 3NBQA 5DHFA 3Q3CA 3SCZA 4B45A 4IQ0A 4QU9A 4FUQA 1D4AA 3NTUA 3R3VA 1IZ8A 1A50B 2PSSA 3OIWA 3PDIB 3VBCA 3ZZ0A 4TSRA 5I3CA 5B1YA 3MILA 1M5RA 2WMNB 3X2EA 2IDJA 3BJRA 2NZJA 3UA3A 5CDGA 2WP8J 3K6SB 1KYYA 3UUWA 1DXHA 4HQRA 3PJEA 1VG0B 3OAAD 1PFGA 2X1HA 3EUWA 2H0AA 2ARKA 3HU2A 3LYLA 3ZU6A 2ZWAA 3BICA 1Z4MA 3TLKA 5JS1A 2Y92A 1HY3A 4UVDA 3ZDEA 4XPIB 4CKZA 5DYWA 4KDEA 3VU9A 3HU1A 4JKYA 4ZI5A 4D4KA 4XRGA 1UFQA 2IF0A 4J29A 4Q00A 3TOVA 3DBVO 2VK4A 3CB2A 3GG2A 3VYTB 3WO1A 2Z56A 2JLZA 4G0QA 1U8EA 1PR4A 4XRRA 3S5UA 5FH9A 3KVVA 4OFZA 2EBFX 3NYQA 4IICA 1Q50A 4OJQA 2WUDA 4ABTA 5JECA 5A3VA 3IQEA 1XJQA 3FMIA 4RK7A 2X6RA 2LV8A 2R97A 3WGUA 2ZRMA 3FZNA 2OFFA 4BIMA 4OHXA 3S4YA 3AU8A 5FO1A 2R86A 4FD3A 3ZQKA 1TUIA 3AUYA 2XTAA 3OQ1A 1RYYA 3RUDA 4AZSA 3HKDA 1QK5A 1XZIA 2HJRA 2X76A 2SECE 1SBHA 4GX2A 2DWOA 1DJNA 1T9ZA 2D7JA 4FKBA 4B47A 3F5DA 4ID9A 1PQUA 2LXNA 3ONWA 4RF2A 1P62B 3E5NA 2ZKIA 3GEMA 3RYFA 3RS4A 2MSKA 3SR3A 2PAAA 5AVSA 3UMFA 3P2EA 1NMYA 5FT9A 3GOQA 3QNMA 2OSVA 5EAIA 1VL6A 2HA7A 2OQRA 3A3NA 2RGRA 5D84A 3PF9A 1S7CA 4DA0A 1ZLYA 3D5EA 1KZ4A 1W87A 1LC0A 2A5LA 1U4SA 3FOAA 2YKGA 1E32A 1UBNA 3DAPA 4NJEA 4RX1A 3SBOA 2ZKLA 2R6GA 1O0CA 3L8GA 4Q5IA 3ZWAA 5DNWA 5D5QA 2CYBA 1SK8A 3BXHA 4LGYA 1XXHB 1KZ7B 1GEGA 3HEAA 2JAOA 3TRIA 3RI3A 3R5HA 4ECEA 3FB4A 3HSYA 2JIZD 3T7CA 4ZT3A 2V9ZA 2XPCA 4REMA 3OIUA 3RVQA 2YOHA 3M89A 4FILA 4DPKA 1JKFA 5I47A 1ZMBA 1BVYF 5GP1A 3KX2A 3QPUA 3ECAA 2X14A 4JIGA 1PWHA 2KSQA 4CV0A 4KXYA 2B61A 3KDAA 4U7JA 5KPJA 4POAA 4KXXA 5DBGA 1SUPA 1JBQA 4QARA 1CR1A 1Z35A 4MKHA 5AKZA 4B3DA 3U44B 1N0VC 1YRHA 4O4LB 1ZW1A 4LXYA 2HDNB 3L2OB 1C8VB 1NJ5A 5L40A 2UU9B 4JI0B 1AKQA 1LLQA 4QQFA 4TQGA 1V9CA 1VC2A 2BRUA 2Z9BA 3LLMA 3PUJA 4L85A 4OBWA 5WRFA 1UBLS 3TOZA 1KOGA 1T4GA 3VMMA 1DKQA 3DDOA 8OHMA 1BA2A 1GCOA 3PGLA 3EQZA 3L6OO 3G8AA 1T2VA 2PRIA 3MAJA 4DANA 4GL2A 1WQ4A 4I14A 2BAGA 3FJYA 5TPZD 1ULAA 1H2FA 3HMKA 4FFLA 3SBEA 4GXRA 2VT6A 4OL0A 5K45A 4Y2GA 4X1IB 3C8HA 4D4GA 5LJLA 4NDZA 4PR0A 3RGGA 4AD8A 1QANA 2XKKA 3L1UA 1KP3A 1ZH8A 2ZTLA 3QPVA 2HJSA 1J2EA 2PX5A 4IO1A 2BMDA 2RFLA 2NO9A 3SMQA 3WGKA 1LY1A 1QZUA 5SY4A 4O0MA 3T1HB 2D8MA 1E2HA 4DEYA 3GGJA 3S1LA 3D0KA 4JLMA 3C5CA 4LX8A 4M9CA 4NV0A 3WLFA 5CYGA 5FWYB 5BXYA 1ECGA 2CLCX 4YYEA 3A4LA 1QK3A 2IELA 2VJBA 2WWTA 2W98A 3ZXXA 4IXTA 2R4UA 1QPBA 3W4JA 3K7EA 4BFYA 4R2XA 3ZY2A 3T9CA 4B74A 1E69A 1T5SA 1ZSVA 1XF1A 1H05A 1V2GA 3FXAA 3NYIA 1INLA 3K0BA 3QE0A 4IJ6A 3EUFA 5CGQB 3TNDA 5IEJA 3AJEA 1NIPA 3D7LA 1L5LA 2I6GA 2XMCA 4ZT7A 2Z43A 1SOAA 2Y3IA 1WNTA 3GFSA 3DEJA 1UOPA 3HHEA 1HYBA 4EA9A 5JXJA 5KNBH 2QNRA 3C6MA 5PGMA 5K4AA 5FUVA 3IEXA 1GV1A 4R05A 3TNLA 2H06A 3TW0A 2P69A 2H1RA 1SKYE 4OKNA 5AVOA 1SURA 3X2FA 2RK6A 5JFGA 2UYHA 4KSCA 4Y0VA 3V1TC 2O0MA 2PRYA 3UHOA 5BURA 4FQ7A 5C2JB 3AR7A 4C4SA 3P45A 3R7DA 3OFSA 2DRIA 2YV5A 1G18A 2AZMA 3KT0A 4LF8B 1KAMA 4AY4A 2W11A 3MXTA 3Q3JB 4QDKA 1NXOA 1RYMA 2XUKA 1PEKE 3HRHA 3MJ4A 3ZJ4A 3ZCSA 1NW8A 5FL7A 5HQTA 2JGEA 5EWLB 2V0NA 3EVBA 2Z2ZA 4G5FA 1GOTA 2XQVA 3KPUA 1RJEA 4ILEA 2AE1A 3OC6A 4QO8A 3B9PA 4O2BA 1SHJA 1IMJA 1P4GA 5E3IA 4GKKB 1RJ9A 2KS6A 4DMFA 4IHJF 3CZAA 4XJVA 3LZ6A 3EXEB 4UDXX 1XTUA 2C8VA 2B30A 2FX2A 4HSGA 3Q6IA 4K0RA 5I7FA 2RGUA 3I0ZA 1J4AA 3BAFA 3GVIA 2PKQO 4CTNA 1X7WB 4IGKA 1MB3A 5DCUA 2QL5A 4BNTA 1YKGA 3RK4A 3ZHYA 1FMTA 1U3VA 1T25A 3JQ7A 4BNVA 2AQ8A 1EVJA 2IRWA 2J9RA 2JD1A 4RVSA 3S27A 3VA7A 1TE2A 1E6UA 3O74A 1T1JA 5DLYA 1N1DA 3UATA 1H6CA 1AHNA 4PGHA 2PT5A 4BIIA 1LWNA 3IB3A 2IBSA 5KTMA 4XX1A 2YY5A 4C01A 3SZUA 4JJZA 1U7UA 2CHQA 4Y2UA 1V8FA 1NSTA 1DOZA 2C9YA 2RC5A 1A9TA 4ZDWA 3WWOA 4DAOA 6GPBA 2ZSIA 2OHXA 3FOWA 2P3QA 4XWAA 1YSCA 3IOBA 4LDZA 1YS2X 2XF2A 4K5QA 3ROEA 4RVNA 3GWZA 5ERGB 5BR4A 3KYCB 1ICEA 4EG5A 2R7LA 2J31A 3V6MA 4DTIA 1ES9A 1CDZA 1Q20A 1XCJA 4TTPA 4B17A 1TL7C 2ODTX 3EGWA 1E7QA 1W6RA 3OX2A 5BT8A 3AEUA 3DUFB 3KRTA 5JLJA 3D2AA 4IOMA 3DFZA 4HGPA 3O47A 4N65A 3S2EA 4XWOA 3E1SA 4ZGWA 3EXEA 4DLAA 5AKHA 2DERA 3C0KA 3BIXA 5JH7A 1C3LA 3PKIA 3OLCX 1UWKA 4M4SA 2GUGA 5CA1F 4WNAA 1NBMA 1T3SA 1DI0A 4AXXA 2JIRA 2NZYA 3E22B 5A4IS 3UWMA 5I9TA 1QTQA 2ZBEA 4UPDA 3RUFA 3IV7A 4NMXB 4IGIA 3S8MA 1CKEA 2GGSA 3ROTA 5EZ6B 1U4NA 4Q3LA 1NOKA 2HMSA 1LNZA 1RZUA 3VZCA 4D3XA 3QVMA 5FTLA 2XBLA 2G8LA 4MCAA 3GLHA 3I09A 1XHFA 2YMLA 4YK7A 3FMOB 2X0FA 4E2XA 5J43A 4I46A 3QI2A 4CM4B 1HQCA 3ST7A 3GNQA 4A6PA 5HUHA 2ZIXB 3EMKA 3KTAB 1BMFA 1E8DA 3A9SA 4PCUA 4DDUA 2R5NA 4FDAA 5U9CA 4GW3A 5EHNA 4ZOCA 1KY5A 1QYCA 3K15A 1O9GA 3DZFA 1CJSA 2Y71A 2CMKA 1ADFA 1C9YA 3FCUB 3I3SR 4Z86A 2XA9A 3TTVA 1NDQA 3VO8A 1JSZA 3F6SA 3HB1A 821PA 5EIEA 2RARA 1NM5C 1YOVB 3R3WA 3ZZTA 1PR5A 1U02A 1U1EA 1YS1X 4QD3A 1MA3A 3MJRA 3RTDA 4CGYA 2B36A 3CRQA 4M6WB 2NYAA 4W8HA 3QVGB 2WLTA 3RAFC 1S4QA 2HUNA 2F3SA 1OKKA 2J4FA 3PFBA 5J2TB 1RU3A 5DULA 5KC9A 5JCOA 5GOTA 5CD1A 1QYWA 3QV2A 1T6NA 2I4LA 1U2GA 3H0KA 3R9WA 4JLNA 1EM6A 3IJPA 2XTJA 3L8EA 3N0RA 2VUUA 5DGIA 4DLXA 1W0JD 4FZ5A 4ZALA 1OXXK 2WTMA 3K0FA 4LGVA 4L9SA 1ZDMA 4Y98A 5KYWB 3F90A 3I4FA 3PUYA 3E1GA 5FJIA 4EO9A 3Q5EA 1JA0A 4HNHA 2NSLA 1OIVA 2XCRB 1Y37A 3SFZA 2H4XA 1JJFA 1GZHB 2VWHA 3P2YA 1U9CA 4X93A 3T3IA 4BFUA 4HVTA 2ZVDA 3KEQA 1F2TB 1L7XA 3LFUA 3NHSA 1BJRE 4UKDA 2X58A 4M2LA 4L6CA 4YDQA 4QPPA 2WI8A 4O0LA 2ZATA 2BSQA 2J67A 1U9ZA 5LQCA 3HDYA 2CVFA 2JD0A 2HU2A 3OJFA 3A3OA 3ZHCA 2Q2VA 4EA6A 1OJ7A 3UJPA 4WV3A 1UMKA 3C7KA 2ODNA 3MD9A 4Y2XA 4P0QB 2J9ZB 1Y42X 4G0MA 1ODLA 4FEAA 4F5YA 5LA6F 2EF1A 3X1JA 3HN6A 1K63A 1HFJA 3QMPA 1ODSA 5CURA 3TFWA 3UM9A 5SYNA 4ES6A 1QGZA 1A5AB 1B3RA 3DO5A 5C7YA 1WUIS 3U7HB 1H2BA 4FP9A 4Z4CA 4J1TA 5T8KC 4ER5A 1G5FA 1W46A 4NPCA 3HFSA 2QY6A 2FCAA 4KAJA 3T7SA 3ONDA 4I6JA 1QIMA 1Y4AE 1MO6A 4BV9A 3V9AA 3OZAA 4BNLA 1RC8A 2CJXA 3D4PA 4BJHB 1DSSG 3DNMA 2WTBA 4EHNA 3NHMA 3NUQA 4YPOA 3TZQA 1A4RA 3BWEA 1VKNA 1XXHA 1I5RA 4CKYA 1MX9A 1NBOA 1UM8A 3CX6A 4GT1A 1I1HA 4H0NA 1BIFA 1HTTA 1D6NA 1R0BA 1U0JA 2E5WA 2VKQA 2ZITA 3GCXA 2AX3A 1QE0A 3O38A 4JVNA 4EW2A 3I6YA 3QYFA 4QM6A 1DP4A 2IDMA 1PSWA 2YRXA 9GPBA 4QUAA 1KP9A 4W4TA 5IUNC 2CV1A 4OAPA 5AMXA 1KQFA 4NL4H 4BNDB 1B76A 1QRRA 3FTFA 1Q19A 4JBWA 5EZSA 2HD4A 2E5LB 2Q21A 2XOXA 4GSLA 4HH0A 4XLZA 4A9AA 3ONEA 1M5UA 3TOXA 4DLBA 4AYXA 4OXQA 4C7OB 4PSDA 5AM5A 4BZZA 3HBFA 2EBUA 2J5KA 5DIZA 3ZKAA 3H5TA 3L6RA 4LDNA 3C8UA 5JCJD 1SHTX 2W2PA 5DF1A 5JNVA 3O8NA 3GJ4A 1AQJA 1I2MA 1O7JA 4LIPD 2XUFA 2IF2A 1SKUA 3RSFA 721PA 4CIBA 3U3MA 4ENTA 2G63A 3N8GA 1YRLA 3AINA 4KIWA 4EAQA 1U1IA 4UXIA 5CEJA 2X0NA 3CY6A 2BI8A 4L8YA 5MHTA 1XDGA 1T5TA 4UCQA 3TEJA 1B26A 3IE0A 3SZGA 1ZSYA 1LTQA 5FIUA 1K3TA 1V16A 2K6GA 3DOUA 1Z7GA 4LE1A 4NI5A 3H65A 3RRNA 3RYTC 3Q8LA 4HOYA 2IYYA 1FPMA 4NMMA 4RMGA 5FEMA 3E7FA 4TKLA 1V4BA 4CEHB 1I4LD 1IJEA 4Q48A 1A1SA 3WK4A 3G1TA 2CLKB 1LK0A 2CHVA 3EAFA 3TTWA 1YRAA 1EX7A 4ZVQA 4URFA 3T4XA 4C0WA 4HQKA 1A3CA 4CMCA 5LQNA 2O0HA 4D9FA 2E4VA 4IXMA 1DWPA 3EQ7A 2VH2A 2TYSB 2Q28A 4X90A 3BC1A 1BWSA 3GBVA 4LOAA 4BJ5A 4Z49A 4BMZA 1PJZA 2WHXA 4MB2A 1PDWA 4K81B 1N25A 5ILGA 1V8DA 2Z83A 4YCJA 4G97A 2IOQA 4O8CA 2Y4OA 1NW6A 3UYLA 1CZNA 2B0CA 2XECA 3WGHA 5JROA 1ID1A 1CBUA 3CJQA 4YMTA 3UNXA 3E81A 2BUCA 4B6JA 2YCBA 1FIUA 4UQOA 4FMDF 1CJCA 1N5RA 1R0WA 1XD2B 2CXRA 2J9FA 3HZZA 3O4IA 4N8DA 4PPGA 5HKOA 1EVIA 2ZBRA 4RHYA 4WECA 2JGKA 2WIGA 1ZN9A 2JVJA 1U99A 3OUZA 4IIJA 4FHDA 3QITA 1NTRA 4PHGA 5JD6A 5KSWB 1M0WA 2XNDD 2PKYX 3AR9A 4CLOA 2NP6A 3RAPR 3EXHA 4AQ7A 2Y2UA 2P0EA 1UEXC 4CGZA 2P2DA 5BQOA 3M81A 3ZHXA 3M1LA 2PFSA 2GB4A 3QX9A 5KYVA 2AK2A 1GDDA 2YBDA 3VZQA 5FPKA 1GPJA 1XQ9A 4MQEA 4F21A 2IZZA 1EFDN 1DKRA 3PT5A 1QGUB 5LZ5A 2CKDA 4E2WA 1L4FA 3QLVA 2KLBA 2YQ5A 4FMCB 4OSPA 4YJKA 4YCDA 1JECA 4RIHA 3F97A 1FK8A 4PRLA 3LBHA 5IXYA 4HPJB 4IV5A 3TKYA 2IHTA 3PU6A 3ZLUA 5C7OO 1KSHA 3G88A 3R0QA 1WDWB 3B13B 3N6RA 3P52A 4Y67A 4NY1A 4BWGA 2ZGVA 4N0QA 2FSGA 1J8VA 1NG1A 1ZI6A 2ERCA 2MYUA 3BMQA 3F7MA 3FDZA 3K1AA 5D85A 4HTFA 3BSSA 2XGSA 3CG0A 3FFBA 3HCBA 4UNNA 1F17A 3WSVA 3ZH2A 2IOYA 5IXSA 3COJA 2JFYA 2YVLA 1ONOA 2D1SA 5IKOA 5AW0A 2HWKA 5IJZA 4NJOA 3GW8A 1E99A 4UBJA 4IFTA 5IAOA 4LRXA 3EWAA 1VTKA 4WCFA 1RI4A 4DWWA 3MCAA 2D7DA 1VCMA 2PVPA 4ZJUA 3NANA 1CF4A 3CZCA 1ODCA 1LLFA 3PXXA 1W34A 2W37A 4D9JA 3W6OA 2PJRA 5KYYB 3NHRA 3OZTA 4KN5A 2ZK7A 4PQYA 1DKMA 2PYIA 2PGJA 2VBCA 4C30A 4GR5A 2Z1MA 4FSDA 3BL5A 1E0DA 3ESCA 2YNMD 3LXUX 4FGLA 4G89A 1LB1B 3D3KA 5LB2A 4R41A 2V6JA 2BHNA 1NJ2A 2PU5A 3ANTA 3CIFA 4J0JA 2PL9A 5EUBA 3A6FA 2CBXA 4CG3A 1WCXA 4BOYA 2FZVA 2YFHA 3QLVC 1Z2CA 3UK7A 3ML1A 1PT7A 1KMQA 1NLZA 4WTOA 3DMGA 4NNOA 2PUGA 4P3KA 3ITDA 4KQXA 4OLHA 2A67A 3FYUB 2TMGA 1M8GA 2O5RA 3OTHA 3P2JA 1NLFA 2YC4C 1CYEA 2WJIA 1DKOA 4BZPA 3B5EA 3QE4A 2Z6QA 1E66A 2A9VA 3A4YA 4DIOA 2PX3A 4NK5A 3SK0A 2FEOA 1S2DA 3TEMA 4F5DA 4JYZA 2WJHA 3LUPA 4FDTA 4DPLA 4JVOA 1KNQA 4QNMA 2HEIA 3CCCA 4YCBA 1U3DA 3HM2A 1ZHFA 4UOQA 1SULA 4WXRA 4WCFC 2EX4A 1VG1A 4URVR 4GZ6A 3GFGA 4MTLA 2YWHA 5FNVF 2VDOB 4ESOA 4YMVA 6Q21A 3G0GA 5H4HA 1ZN8A 2CXTA 4U0JA 3WRXA 3CIOA 4QUDA 4UU0A 3ZDYB 1R0YA 2PS0A 2BCGY 5HZKA 5ELXA 3D59A 4UEJA 4TOIA 2HK8A 1I7QB 4MDFA 2VP6A 3R23A 4S1TA 4CBVA 1FZQA 2IH5A 3LCMA 1J42A 3P32A 3O1HB 3DV9A 1WY7A 3AEKA 3JW8A 4IW3B 4KAAA 4Z2YA 2EW8A 4X1IA 3JQFC 2CSUA 4HMOA 4OP1A 5HJ7A 1GGEA 2LKDA 1Q0TA 3I30X 3PL5A 3K4PA 4WZ6A 3VPDA 1B7GO 2W6CX 4OBEA 3EIQA 2JCXA 3R2JA 4G5XA 4YH1A 5ER6A 5ALNA 2O20A 2IS6A 4LFCB 5HNKA 3OJLA 3OJEA 2OO5C 3BUSA 1SUFA 2YL2A 3EH2A 1J99A 1KHTA 1U8XX 5CGZA 5DHUA 3L0PA 4NAVA 3TE7A 2QUKA 3P8ZA 2HR1A 1OA0A 1QIGA 1UZMA 3FKQA 4LBWA 1AUVA 4HAWA 1LVGA 2HNKA 3BD6A 3U0BA 4D96A 3L7CA 2PLAA 4JLOA 3TQSA 3PQEA 4OYRA 5JAPA 1MO5A 1Z07A 4UHKA 3TMYA 1S9HA 1I2DA 3W9SA 3AQ4A 2NXJA 1RAGA 1F2UB 1R9GA 4GWGA 2QBYA 4DCCA 2RHHA 4JP5A 2QMEA 4MEBA 5H9VA 3JVVA 4DDHA 5BWNA 3KWJA 1KC1A 5T3YA 3I6IA 4IX1A 3LL7A 3BE6A 3D7MA 4Z8YA 5ALOA 5IC4A 3ZVRA 4YPVA 2FK7A 3DPSA 4KQKA 2J3IA 3KLNA 3AIOA 2VHEA 1ML4A 1SUDA 4LI0A 5HGJA 1ZGGA 3GOHA 2RHMA 2OP1A 2QPAA 4DM4A 2CXOA 1PJTA 4P3PA 3BWCA 4ZO7A 3IIEA 3AKEA 2PPVA 3EODA 1A1VA 2ZJ6A 2O8EA 1QGUA 4UHBA 3B6ZA 1VG8A 4J0KA 1L2TA 3TLMA 3EMBA 5KNCH 3GN2A 1KK0A 3QU2A 4FX2A 4BTEA 5DK6A 4E30A 4RMHA 4DM7A 2YY7A 3DH0A 5AW1A 1LDBA 2G1KA 3FRHA 1HF3A 2WJJA 4K86A 4U3JA 5K4HA 4W5OA 2G7ZA 1P9WA 5BOSA 3ITEA 2W0MA 1JDVA 4MI9A 4PZYA 3G7UA 3KJFA 5DLQC 2FVYA 3OF2A 2R85A 2BJVA 1R00A 2W83A 1GCAA 2BW0A 1U94A 3E03A 5TVKA 4ZTUB 3DXFA 1Y3FE 3H3XA 1A9XB 4D3SA 3NTRA 3VO9A 3ER8A 4OO3A 4ZOLA 4I4TF 1HBJA 5L6MB 5DTJA 4KQCA 3O8RA 4HAUA 3P4YA 1I01A 3ABRB 5INTA 1B6RA 5HQ3A 1P5HA 2BISA 4F6RB 1ZU4A 1PWXA 3AO0B 2CXPA 1B0PA 1X7GA 4ZYLA 1XRPA 1DFIA 1R0SA 3LPNA 4DLZA 1YMVA 5GTDA 1IVYA 4I99A 3GVHA 3WRVA 3SSOA 2REQB 4BGIA 3T3OA 3C3WA 3A70A 1M7HA 3CLSC 4AAYA 1TZMA 2IYRA 3M49A 3UJHA 3LT4A