1ZGHA

Methionyl-trna formyltransferase from clostridium thermocellum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
227
Chain Sequence
b'LMNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEYILFPHWSWIIPKEIFENFTCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIFMRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRASMKNGKIIADVEIIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA formyltransferase
molecule tags Transferase
source organism Clostridium thermocellum
publication title Methionyl-tRNA formyltransferase from Clostridium thermocellum
rcsb
total genus 58
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.20 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 1zghA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zghA01
3GARA 4YFVA 3W7BA 4R8VA 3AV3A 3TQRA 2YWRA 1MEOA 3R8XA 1GARA 4TTSA 4ZYXA 3DA8A 3P9XA 3N0VA 2GARA 3KCQA 2CFIA 3NRBA 1YRWA 4Q12A 4ZYYA 1ZGHA 4EW3A 4DS3A 1MENA 4ZYUA 5J9FA 3TQQA 4EW1A 4ZYVA 1S3IA 4ZZ3A 2BW0A 1FMTA 4TT8A 1ZLXA 3Q0IA 4ZYZA 4ZZ0A 2FMTA 1RBMA 1ZLYA 4NV1A 4ZYWA 4IQFA 4ZZ2A 1RC0A 1GRCA 1CDDA 1RBYA 4QPCA 3OBIA 3DCJA 1RBZA 2BLNA 3O1LA 4S1NA 4ZZ1A 4QPDA 1MEJA 1RC1A 3AUFA 3LOUA 1CDEA 1NJSA 1C2TA 1JKXA 4PZUA 5J63A 4EW2A 4ZYTA 5CJJA 4YFYA 4TS4A 1RBQA 1C3EA
chains in the Genus database with same CATH superfamily
2RGAA 1U1CA 1UZMA 1PV4A 5TS2A 4YECA 4ZK2A 1P0CA 5MHTA 2WZDA 3DO6A 3M1AA 3P1JA 1TD1A 4BGIA 3VI4B 3OKCA 4YBRA 1N2CB 2JCXA 1LW6E 2ZRHA 4M37A 3STTA 3VU9A 3EG9A 3QIVA 2OWDA 2HK6A 3NVAA 3OFKA 4AX8A 3H65A 2OTCA 1XX6A 5C5IA 4QULA 1QHNA 1WMDA 1P2BA 4UFOA 4LWOA 4CLEA 5HBGA 2GAJA 5ELMA 3BQNB 2Z83A 1F5SA 2G07A 1KI3A 2PV7A 1X74A 2VNIA 1BGWA 1KRHA 1L4LA 1K6JA 5CLGA 5K3BA 4YVFA 3VNAA 4NQZA 1VP9A 1KOJA 5K7SA 1J0EA 1UC5B 2RGCA 3W5BA 1ZBDA 5JO9A 3LBAA 2LKDA 1OIXA 2EWMA 3RVLA 3VJLA 4YY3B 2IPXA 2W0SA 2JF0A 3C3YA 2QAGA 3ESYA 5KAMA 5A62A 1MENA 1TL7C 4NCHA 1A72A 1E4VA 3URKA 3ZWYA 4M83A 2R00A 5C7YA 1DQNA 1A95A 2FWPA 1FNNA 1DC7A 1NYRA 2GHTA 3AUTA 3OJFA 3L8CA 4JP3A 5G0SA 5BUZA 1R0RE 3FYSA 5CVCA 2WJ4A 4G5RA 2OZVA 4DUGA 4LRYA 3O31A 5A0FA 2X42A 4OQLA 5GOZA 2B2XA 5KWIA 3O38A 1E96A 1B3BA 1WUTA 2BRUC 4NP6A 4WL0A 4P7KA 3PICA 2I3GA 5DT9A 4YCAA 1JJFA 1RKBA 4S2UA 2IS2A 5BPHA 1Q1EA 3KQQA 1LW7A 1PK8A 2CEAA 1TJPB 2P5TB 2YBDA 2ZRMA 3FMGA 4HAIA 4KI0A 1LSUA 4O2BF 5GV7A 2ZJ4A 4IX9A 3TZLA 3WRYC 1WDMA 2ETXA 2B94A 4AJEA 4YMTA 5AJTA 1L4KA 4ZPXA 4ZT2A 4HDRA 3UJAA 3ZQJA 5LZ5A 2AMFA 1WMAA 1EBFA 2LDBA 3BICA 3IJEB 1V1RA 1LDEA 2CVHA 1FP7A 4H6PA 4BUZA 3SIXA 4NH0A 4BNHA 4EYKA 5JJ5A 5TQJA 4EW2A 1I6WA 1DC4A 4ICIA 3VM6A 3ZGVA 2GNPA 4LRQA 4YT5A 4CLXA 4R31A 1WB6A 2EZTA 3UAZA 2XQFA 2DY1A 1QGUB 4GZ3A 5L8VA 2X13A 5BMOA 3EIUA 5TMDA 3MMXA 4NMXB 3VMFA 2QN6A 2ZRQA 3TL3A 4S3MA 1MF7A 1MX5A 1U3CA 4FX5A 4YN3A 5ED0A 1U80A 2IU3A 1GUZA 1OW3B 1DAKA 2JIDA 1G5RA 1G3QA 1E6WA 2OHHA 2V8OA 3IBSA 4H15A 5IJZA 3VYRB 4ED9A 1PJSA 1JHXA 2G70A 3B2QA 3LWNA 2C3MA 3TKYA 1YO6A 2FWIA 4DMUB 1PW5A 1UMBB 2OV3A 4G1EB 3W5IA 2OGTA 4QO7A 5JANA 1R6BX 1VIYA 5T3UA 3S7TA 4ZRDA 5LOVF 1ZVVA 5IABA 1D9ZA 4N41A 3UMCA 2R1TB 1UDBA 3RRYA 4B32A 3WNQA 3PB3A 3PP8A 2UKDA 1UPFA 4HB4A 5E2IA 1X1SA 1OKKD 1ZCZA 3N7TA 3FTEA 1EFRA 2Q2VA 1HFEL 3QELA 4W8GA 2ZPAA 1JEJA 2X8WA 1Q7CA 2VFAA 1DUSA 3VDQA 3NVMB 5HF8A 3IESA 1VI2A 4GZ6A 3CVYA 1CUAA 4M1ZA 1XLVA 2OC4A 1IIBA 4LDZA 1K8RA 3F98A 3IUNA 4D74A 2QUAA 5MN6A 5E6RA 1G4HA 1ZN8A 4ECEA 3D6UA 3HB5X 4P34A 4U7HA 1CWUA 4NCXA 3QLUC 1PEAA 5ILGA 2XUAA 2G80A 4N9QA 3WB2A 1W87A 1UFOA 4R81A 5SY4A 3JASB 1ZWKA 4MROA 2LPMA 1J2JA 3KYBA 1SCBA 2JHCA 1L7OA 3OIDA 2OLKA 2WMDA 1KI6B 3KBBA 5DRTA 2B1QA 2C92A 4ONEA 5LR6A 3J80A 2O8FA 3HWWA 4Q7EA 2V5UA 3ADDA 5HKLA 1KI1A 2XE6A 4R8SA 2BDUA 5LQSA 1ZUHA 4FQ7A 3KL4A 1KJZA 4HTFB 3CSDA 5EN4A 3BQ9A 4EGCB 3EGVA 3IL2A 3IO3A 3W4IA 4IIBA 3RGWS 2EBWA 2JJYA 4YAOA 4U1RA 4TWBA 3SS7X 4MJ7A 4U7WA 3CIOA 1TECE 1OHHA 2DT8A 3HTXA 1N8TA 3WS7A 3BE4A 3O8QB 1DGQA 4TLLB 4H1TA 3RBAA 3QXHA 3K70C 2X86A 1AKMA 1OFHA 3AC0A 3ABQB 1TM1E 3BD6A 4I4NA 4XQGA 2XKKA 5A4JA 3KSBC 4H7EA 1DT3A 2B8TA 4KU4A 2XZLA 1XJ5A 2D59A 3I5UA 4R3WA 1JHPA 2DSTA 5JW6A 2PD4A 3B36A 3Q0TA 3CN7A 4ZC1A 5JATA 3GUZA 4OA5A 4JWTA 1RPZA 4G0PA 4ND7A 1E2GA 1Y3IA 1DFIA 1VLLA 4CMKA 3ZTTA 1J06A 3MJFA 5DH9A 1YBVA 1H4SA 3MG9A 2XDQA 3F6BX 3WR5A 2WJZB 3QBEA 3D5QA 3H5WA 3ZV6A 3OZWA 5J2TB 4CEJB 2VF2A 3N2EA 2ZRCA 2ISSD 3PA6A 3QELB 2WILA 1F38A 1ANKA 1YJBA 2A0UA 3FDFA 1P3DA 3AUFA 3HJTA 4NBTA 2BIFA 3BOSA 5AP9A 5JQGA 1K2WA 3N7AA 4IDGA 4IZIA 1BMFA 3A6FA 2QTVA 4MKIA 4KAJA 5HR5A 1DQPA 3CZ9A 4NZYA 4BIMA 4JASB 3EDMA 1DFGA 3U3XA 4UCWA 3VYVA 4BVEA 2AH5A 2QJFA 2HIMA 1OI3A 3ZWNA 3LF1A 3E2MA 1UK6A 3EOAI 4QTTB 4OQPA 1QMGA 1C1DA 4P36A 1D1SA 1CC1S 1BDJA 3MS7A 1RC0A 3P5BA 1K08A 1ODLA 4LE1A 4Y9DA 2O8FB 1U81A 4NBKA 1PFWA 1RWQA 3E27A 1CVIA 4MQMA 1PNOA 1I4WA 3VPXA 3GPDG 3CEHA 3C8UA 4ZDIA 3FDIA 5EIWA 1ZO8A 3EWNA 1YSCA 3PD0A 4DDKA 2ZW9A 3AHGA 3LDHA 4ROSA 2D1RA 1J1ZA 1EVZA 2IOHA 3HMKA 2Z1DA 3EZLA 2EG9A 2MSLA 3JQGB 1RI1A 3F78A 3GPIA 2ZBFA 4IJUA 4L4UA 1CEQA 1SBYA 1ZD4A 4LCEA 4LOHA 4NYMQ 3IRVA 1SCIA 4Q7KA 1CY4A 5LBTA 3UUFA 4A0FA 5IJ9B 3RJZA 3K8YA 1NAHA 2C1ZA 4C0LA 2C0QA 1I14A 1CY2A 1SQFA 1Z22A 1ZOOA 4US0R 2JGMA 1GL6A 1PZNA 4NE2A 4XRGA 1Y8ZA 2BKAA 3HACA 3W8NA 4B7CA 1UZNA 4LXYA 3RGGA 4ALKA 5HTOA 1NIJA 3RVMA 3HPRA 2FMIA 1MG5A 1OASA 5EERA 2VJYA 3IE1A 3T4UA 5KDLA 3UC5A 3EQ6A 1MJNA 2P2NA 1DJOA 1VSBA 2IVZA 4IG4A 3GAZA 1DAHA 1DG3A 1C7EA 3SFVA 4E4TA 2SKCA 1UUFA 1RW4A 2FP4A 3KJEA 1RHUA 2OESA 2H52A 4P35A 3SFZA 3GDOA 3CLRD 5AVWA 4HNVA 3ZU3A 4B8YA 4Y2TA 1IBCA 2BM8A 2IF2A 5HIMA 3Q9SA 4TTAA 4E3WA 1OYWA 3ECCA 1E66A 3H8VA 4FFLA 4ZQBA 3TMAA 3ZIAA 5BVGA 1R5NA 2VQ3A 4NOMA 2P1ZA 2VNAA 4YRCA 5HE8A 2CZGA 2BUAA 1XVIA 2PGLA 2V7VA 1QC5B 3HS3A 1YR2A 3DQQA 5FA8A 2Q5FA 2BGLA 5FFMA 1GUYA 1KJWA 2VDRB 4LBYA 1XCJA 3U13A 4IIJB 2KYRA 2C84A 2ESRA 2YUTA 1IYZA 2OR3A 3ELWA 5KX5F 1XMJA 4RVDA 2ADOA 1V25A 5MF6A 2O6HA 5FF9A 1OLSB 2IRWA 1ECFA 1VMIA 1Z2PX 1KE2A 4QXRA 4XUDA 4RSGA 2NSJA 3M7IA 4OJQA 2BFDA 3LX4A 2I4IA 4LG1A 1BEZA 5HZGA 4H60A 3N5KA 4MWBA 4I1YA 4YRNA 4B8ZA 3TW0A 3PE4A 1ORIA 2WU8A 5JE8A 1CKEA 2VXOA 2HRDA 1K5PA 1N3LA 2RB4A 3NHPA 1FQOA 3LLMA 4B2YA 3SZRA 2VQEB 1SCDA 4HH3C 3UOAB 3LGXA 2HA0A 3EEIA 2EU8A 1TEHA 3HEBA 4MYTA 1E6EA 2RG7A 1EXDA 1XKQA 4KVFA 5B64A 1PNTA 4F2HA 4BGDA 2JHAA 3U9TA 2CNWA 5BQ3A 1EP2B 3AB7A 2ANCA 4RIIA 1FCJA 4C01A 1XG5A 2OV1A 3IB6A 4CHGA 3FCEA 1GUBA 2AG0A 4NDZA 1IZ0A 4HSEA 3RCBA 3EYWA 1SH7A 3IP1A 5BR1A 1RQNA 1C9MA 1E1NA 2F8MA 3R3ZA 3RFUA 3RUIA 4AZ0B 3HKCA 3ZHTA 1AMUA 4J3JA 2QTMA 3C7TA 1CF4A 1YB1A 3VYUB 4PY2A 4NQRA 3C70A 1A5SB 1ORHA 1K27A 4LHYA 3RT1A 4A8JA 4CQMD 5I7EA 2NPFA 1X70A 2G25A 1OUMA 1HDCA 1P5ZB 2ZBUA 5G0WA 5KU1A 1KZYC 1NBHA 2PVCA 1FFWA 1NRWA 1JYEA 2UZ1B 1T0HB 4RK4A 4DZRA 2H1LA 5EIAA 1KBZA 2VLBA 3KTFA 1LU9A 4L4YA 3UGKA 1QKKA 5ELLA 5HZKA 1Y4DE 5F21A 3DZGA 4XH9B 3B6ZA 3OTQA 4HDAA 1S4QA 1IUNA 4L0CA 4QLAA 4WN9B 3TRIA 3EUAA 4OGLA 5A5DA 1LPBB 1JNXX 4ZVSA 5GONF 3O8NA 1IY8A 1IZYA 2JFUA 4GXTA 2VDJA 4EYEA 1KI4A 1WP9A 2OK8A 1VCNA 2W2KB 1CR4A 4DV2B 1AKYA 1NT4A 4QPCA 3Q9LA 1LX7A 2A0FA 2RARA 3R7WA 3TIFA 2I2WA 4OIMA 3EG5A 3N8GA 4RZ2A 4V0KA 4DA9A 2YC2C 3ESCA 1OWOA 4DUPA 1JRLA 4BO7A 4PZ9A 3N0XA 4QTXA 3HDJA 5AUPB 5K6AA 3V1MA 4L4RA 3OMWA 3LUHA 4PX2A 4XWTA 4EEZA 5I01A 3U7GA 1JEEA 2DHCA 3F5SA 4FDUA 5JRDS 1O5IA 3M1IA 1EUZA 1MUUA 3E58A 1ZK0A 2PGDA 3FCYA 3IPAA 4IH1A 5CBPA 5HGXA 4B17A 4E5YA 5K09A 5FUXA 4LF7B 1AKWA 2J3MA 1NQAO 4ARVA 1A71A 1U2QA 4KVZA 1M8FA 1UMCB 5FIUA 1JDNA 1MNAA 1O0SA 1PDVA 5JS8A 4MO2A 5BVGB 3IH5A 2R62A 4WLOA 3SF0A 2X5OA 4HDMB 1T34A 2BJWA 3SSOA 3V34A 1X19A 4KC0A 3OJWA 3HCPA 3NC4A 4ZEWA 1RRGA 3FWPA 4ZI7F 5C80A 3U5ZB 2OGSA 2P91A 4ENRA 2A59A 1P60A 5F7JA 1JFSA 4KR2A 1DKLA 1LX6A 1Y9JA 1T0UA 3RVRA 1NYQA 1MGPA 2DBVO 1JB9A 5CYPA 3RUPA 3D3EA 1VJ5A 4EJ0A 4X95A 4X3CA 4TKVA 4QXAA 1NUAA 3OY7A 2WR8A 4HZGA 1EBBA 2CXQA 1N75A 1RPTA 2X1MA 3GWGA 2R11A 3QSGA 5I7VA 4UNIA 1N92A 3CRQA 3JU3A 3SZ3A 1FJXA 4ZOLA 5WRFA 3STXA 5C35A 5I8ZA 4BNYA 1N57A 3DS8A 4H3SA 3UKJA 3O74A 4J07A 2ZAMA 2PTGA 2O8NA 1KPGA 4WINA 4B3SB 2QTZA 2FW0A 4ETMA 3AEZA 3PQ3A 2FRXA 3HV0A 1IPHA 1H8HD 1DARA 1W96A 4LI3X 4F85A 5JI3E 1EUQA 5CG1A 5IC4A 4D80A 4JXZA 2HD4A 3FJOA 4FTWA 1T6NA 5CHEA 4F04A 3WLQA 2DUUA 4W9NC 4DA7A 4Y6SA 3VDNB 4ILKA 2IS4A 3FFBA 3MQ4A 4RJTA 2I8LA 4ZYWA 2FFJA 1DEAA 4RANA 1KDTA 2W4IA 3VPHA 3S27A 1N0UA 1QMPA 2M1XA 1CUDA 2JCSA 1ISPA 1NVMB 2VYQA 5JLAA 1XD2A 3R3HA 4J0JA 2XD4A 4WZAA 1PJ2A 2QI9F 1ODJA 3MFYA 4L5AA 4Y9RA 1UM8A 2O1XA 3WK7A 4BNGA 1RYFA 3AVUA 4IQGA 5REQA 2PXXA 4DLNA 4Z0NA 2JGDB 4MR7B 2R7MA 1N1MA 3F96A 3Q6MA 5KYGA 4YUYA 3LHIA 4LYHA 1G60A 4PC6A 5COQA 4CIBA 5JSQA 1L7EA 3GYBA 5AJXA 2HWKA 4G07A 4IRMA 4BX0A 4P7FA 3C98A 3QUBA 4PSAA 4QU8A 4YCDA 2PKEA 4OHWA 3AFHA 1OZ0A 3WNVA 1DQRA 2J9ZB 4ZVKA 1GOTA 3ZXIA 1PT5A 1A3CA 1ZD2P 3EGWA 4DLSA 3EGIA 1SZJG 3EDYA 4KE7A 5CJPA 5EIHA 4EYGA 3R2JA 2QAIA 3PJGA 1IJBA 1ZHFA 3JZAA 3RS0A 4B2IA 2J31A 5THKA 3NW9A 2VA9A 2R7AA 4RKEA 5D00A 1CJMA 2CFOA 3A3OA 3IJRA 4WBXC 1ZD8A 4HNRA 2IW1A 1QRRA 4US1R 2O8BB 4BUCA 2PZFA 2PA3A 1Q1QA 1CJCA 2JVIA 4YHBA 1BX1A 2NTVA 4PQGA 3LU1A 3SQLA 5AUOB 5ULLA 3HXLA 3A7DA 2ATXA 1I9CA 4MQ4A 4PHGA 1E4OA 4OIFA 4LF6B 2HLDD 3N5CA 4YMSA 4REMA 2HSEA 4WZZA 2GD2A 4B79A 3N0RA 4BLSA 2QY6A 1EK5A 4RGYA 4OQNA 2GF0A 4IILA 3VPGA 5BQXA 1BTOA 4JI4B 4JHXA 2HBRA 4RAQA 3ROGA 4WBNB 2A0WA 3R44A 1UDRA 1UC8A 1NXXA 1ACMA 1U11A 3LTNC 3WRYA 3CZ4A 5BN4A 1XZPA 3CW8X 3OIVA 2C3OA 2YYSA 3IVGA 3OQJA 3IV6A 4RPGA 3LKVA 4FFWA 1L5LA 4CI0B 5E0OA 1XZQA 2WFLB 1DTEA 4B6QA 5FHQA 1HE1C 1M83A 1Y48E 4FOOA 5DSXA 2DR2A 1QZ3A 3NMUF 1NLFA 4TTJA 3WLTA 3CVVA 2EKBA 4G41A 4L6IA 4ZAZA 4EY8A 1L7NA 1PI3A 2VHUA 3G9TA 4F84A 2W6PA 5IEJA 4DY4A 4AMVA 3C45A 3HP1A 4X45A 4A5OA 4D57A 1FXSA 2WIDA 4MV7A 4QNNA 2XSZD 3IDAA 5J9FA 1JAXA 4BQPA 4A0QA 1ZJZA 2GEKA 2PSSA 1M1NB 2WRZA 3HKDB 3OQBA 4HN2A 4M6WA 5G40A 1I2BA 1OLUB 2NO7A 2NV0A 2QPAA 2R00C 3COWA 3O4FA 4O0LA 2V0GA 1FUEA 1N33B 4IGEA 5KQLA 1F4VA 4FGKA 2QAGC 3WHIA 5IJ9A 4BIIA 1VBMA 2B5VA 3PC3A 3VJRA 4HLDA 5EJAA 1LRLA 1ZOPA 4GE3A 4P3PA 1D0SA 2WWWA 3N7UA 3PWKA 4XIFA 3DE2X 4KXNA 4AN4A 4R6WA 4S24A 1OE0A 4RVUA 2L69A 4B76A 2I6GA 2IDKA 2LIVA 2B8JA 1ZUD1 2QX9A 1LZKA 2V7UA 1HE2A 4IV0A 4Q3LA 1S7GA 3RV3A 2X7HA 1HNNA 3NJ8A 4I8DA 4MUHA 3TN7A 2LCFA 4QEKA 1G19A 1GGKA 5DHQA 4R05A 3C6ZA 4GZMA 4KLZA 2OUIA 2AQIA 5ALEA 4QFCA 5IDXA 4BCCA 5KYNA 3B3QA 2IHYA 3CMCO 2P5YA 3KKZA 5CTAA 4ZZ0A 5T64A 3OFNA 4E2XA 2BTEA 1NI4A 2C9CA 1JH8A 1NWHA 1P0FA 2BTQA 2VDMB 4INZA 5DK4A 2ZIWB 3RYHB 1EX1A 1W94A 2VBIA 2Z8XA 3EOZA 5LU8A 2Y0CA 4RFLA 1N2IA 4DSOA 4EJ6A 3LBIA 4BGEA 5KREA 1NQOA 2ZT8A 1CB7A 2NU9A 4JZYA 3RE1A 1QBGA 1OI7A 2YHIA 4FLEA 1FUKA 5AKHA 2AN4A 1XD8A 3O7MA 2OORA 2RGYA 4BB5A 4KWIA 2V6MA 2DR3A 1T9KA 2Q28A 1GO2A 4LI0A 1XFDA 1DX9A 5FNVA 1TX4B 3R24A 4BNFA 2ZRNA 2WKQA 2A9KA 2DRIA 1K7CA 3RIMA 5D01A 5C32A 1N1GA 3JQCA 3LG2A 2DFVA 3HU2A 3Q7IA 1HNXB 3K0KA 1UXHA 1C4XA 3E3MA 2ZYHA 2E0IA 4OOFA 1YDFA 3ICEA 4GOXA 4OXRA 2RJ3A 5D51S 2WF8A 3UT0A 2HWYA 1RRCA 1VC2A 3VR6D 5ELXA 5D3ZA 3B7GA 2GZ2A 2R60A 4JWKA 2HTFA 5CB4F 1GXSA 2GCNA 1IXYA 1OVGA 3ME5A 2R87A 3RSSA 3LSYA 3A37A 3GJ7A 1KEWA 4LFBB 3TX2A 3I5YA 1Q6ZA 3HWRA 3P9RA 3Q2IA 4L50A 4RORA 4YAGA 4CVNA 5LIRA 1XJCA 3GGDA 5JS7A 4RHEA 1KVTA 3G1TA 1TJ3A 4MWEA 3EMKA 5FP0A 2VSOA 1VLZA 2DUWA 2R8XA 1ULUA 2R1TA 3PLRA 4KO4S 4OD0A 3UJ9A 4AJ4A 5BT8A 5KX5A 1MB3A 2HU5A 3AR3A 4AIIA 2P4SA 2XNDD 1G8SA 3D8UA 2FN9A 3ZJTA 1Z8HA 1SG9A 1SC4A 5ALUA 1FXWA 2ZWMA 2NU8A 5JCZA 1GG8A 1G21A 1BU5A 1N2XA 3ZUGA 5F5NA 4EHLA 1JHVA 1X15A 1A9SA 2A0YA 4F3NA 3K9CA 3LHSA 3OE7D 5G1OA 1YWGO 5D86A 1FS6A 4CODB 4HZUB 3LH5A 4F91B 1MA0A 4D9GA 1EZ4A 4KUGA 1KK1A 3IC5A 4O3MA 3K32A 1PKEA 5LL6P 3SXUA 2CD7A 1SHKA 2JH9A 1MRZA 3DL0A 5LLSA 2NO1A 4HD8A 3SZUA 2IIVA 2XYVA 1SZPA 4ENSA 2DETA 4Q5IA 4ZT4A 5JDCC 5K51A 4IIHA 3STUA 3LPNA 1LBTA 5EP2A 3S2ZA 5JH7F 1I0IA 3CNBA 2YCBA 3SQMA 1XCMA 3ABSB 3EY4A 2RGDA 4P81A 1RWMA 4C7KA 3CPEA 4ZO8A 1U4OA 1P4JA 4K9SA 2YC4C 1DUVG 1XA0A 2I2BA 5BSWA 3OCZA 1WBDA 3L9WA 1JYFA 1ZD9A 2I80A 3PQEA 1Y4SA 1QQAA 1VJCA 4U5QA 2I22A 2PN1A 4GYWA 4UMVA 5TXGA 2G5PA 1QRUA 2FWMX 1MQ9A 4JDUA 4BTEA 2JLWA 1D2HA 1KNXA 4JBIA 4UXIA 5BNTA 1VI6A 5CFLA 3O8QA 3W79A 3T4XA 3BXGA 4FLMA 3FVRA 4UUMA 3BIJA 2IC5A 2YZGA 1N6KA 4N7BA 2JZNA 2YNMA 4UDOA 4Y9TA 3DULA 4ZVVA 3T9DA 1DJPA 3WV5A 1RCTE 3C3AA 5IVHA 2O3TA 2RH5A 2HJWA 2A1TS 3AI3A 3HBMA 3KHUA 3KX2A 4TL8A 2SKDA 5B30A 1FK8A 3GJ0A 1PGJA 3TUIC 2XUKA 5IKXA 2LVBA 5CYFA 1H1LB 5EXDA 5F1PA 3SYTA 5IZ4A 2B37A 5L3VA 1FMJA 5JNRA 2UDPA 3I2FA 5ECYA 2V4MA 3KKLA 3O4VA 5KDOA 3OA0A 1SB8A 3ORYA 2FG7C 3QNWA 3FZYA 4LCBA 4XPZA 1P39A 4Q3DA 4PGGA 4RELA 2YIVX 2J9GA 5E3JA 4B46A 2FE4A 1JJIA 1G4UR 1XF9A 2PT9A 2WD7A 4Z3DA 1QYDA 1EZZA 3LRTA 2O0HA 4DYHA 2M98A 3RQSA 4C5BA 1GDTA 1NUUA 3PTAA 1WXXA 2XT9A 1CRPA 3O75A 1YAJA 2WSLA 4XOIA 1SPBS 1E2HA 2BDTA 4G97A 5AI5A 4G8CA 4OFWA 3HHPA 2XXJA 1VXRA 1XD2B 2QTAA 3TLKA 3UK2A 3GPLA 2PKQO 3S2YA 2OCXA 2FMHA 2AZMA 4LTNA 3O84A 4ZP1A 1EGVB 4ZD6A 4ZDKA 3T1YB 1XPUA 1PD1A 3MUOA 4OLFA 3FNFA 3W8FA 5CNKA 1I5EA 2FFBA 3DVLA 2W4MA 2Y1FA 4YGYA 3ZIUA 3KR0A 2BI4A 3D7MA 3BMCB 1ZGJA 2BM9A 3TBFA 3UTCA 3DZDA 3QK7A 3WK5A 1E3SA 3GJRA 1RJ9A 1PJ4A 3F6SA 4IHKA 4V0LA 4CF3A 1CPYA 2WTEA 1XBTA 4ZREA 3L40A 1SXPA 3IMGA 4BASA 4X94A 4FM9A 3OT1B 1SA0A 4HAUA 2PGXA 5FULA 4RZUA 1M0SA 4M7RA 2Z58A 3RODA 1DKUA 3KSRA 1FMFA 2LBPA 3IV7A 4HLUA 3V6LA 1PJRA 4GE0A 4X24A 3B53X 1GILA 2WWHA 1QDLB 3R7FA 1P2FA 3RC8A 1CUJA 3OZ7A 2OZPA 4R4JA 1P1BA 1Z39A 2G71A 1XJQA 3LW7A 5EIOA 1YHZA 1JR3D 1EHYA 4YJ2F 3W7AA 1XDZA 4JA2A 3UCXA 3R9XB 2OXCA 1RLJA 1Z82A 4LC1A 2EX4A 2XAAA 3EXAA 5EZYB 3VNBA 4V2UA 4Z0HO 3MWYW 1Q22A 4R2HA 2GN6A 2XZOA 4BZQA 3H5AA 3RS8A 4AQ7A 3ETHA 5KKCA 3S81A 4TOIA 1X92A 5FFFA 2H2WA 5E1MA 4ON9A 1QB7A 1T10A 5G53C 4JCCA 3CLSD 4D5GA 2QRGA 2GJSA 3OO0A 5C0OE 3GFRA 5IBPA 4D3YA 1R0SA 1QRDA 5MN5A 2BYTA 1OTXA 4ZOAA 3IUSA 3U6KA 5D6NA 1UWCA 1ESCA 3UFBA 3M4ZA 1E79A 1HGXA 1UJCA 2VS1A 1HDIA 3VVBA 4RTRA 1OXSC 3NBYC 2JAQA 2XXAB 3WMEA 1U0NA 1MW9X 4WXMA 5F35A 5IDVA 5BN5B 5MGNA 3FE2A 1QE0A 1O94D 1OY1A 1WDTA 3GLVA 4MDYA 3WZMA 1E1YA 1W85B 3FNHA 1L6RA 2QI9C 3FMFA 5DBGA 3E8MA 5DNVA 1NMSA 1GQSA 1NPTO 1YKFA 3ACBA 3FOWA 5TPWA 4UEJA 1LS6A 1XHEA 5HBRA 4WBNF 1GRRA 1U9CA 2G1JA 4Q02A 2FW1A 1P72A 5GINE 2H7XA 3M3PA 4D9HA 5HF6A 4CUKA 1UL1X 1AM4D 3P2IA 1OX6A 1K97A 4FMCB 4YRSA 2HLHA 2P9EA 2AJCA 3ABRB 4IEEA 4QT0A 5IVDA 1EI9A 3ZH9B 1VZ3A 1TM4E 4TSKA 4JL6A 3V3KA 3OE5A 4YRKA 5A6SA 1EDEA 4IBOA 2FUKA 2WFMA 2HOQA 4NEGA 1RTTA 3ASVA 2QXTA 3NIWA 4XE5A 3TVDA 3I04M 2W00A 3NDIA 1GAEO 4WFIA 2OQVA 3L4BC 4CMHA 2SECE 1T43A 1QAOA 3SP1A 1YT5A 1OBCA 1G1AA 1Y1PA 2TMKA 4CXMA 3EBOA 3G2LA 3LY9A 4HGOA 4N6GA 4CR8A 4RE5A 1UXIA 2ZYVX 1CJUC 3E9RA 5JD5A 3WDSA 4DIFA 1AKQA 2PUFA 1DKRA 1IEQA 3PT9A 2CXOA 5EIBC 3S2EA 3VR4D 4B3FX 4F8YA 2HMYB 4RQUA 4Z0TA 5TEVA 1XDWA 2PL3A 5BR4A 3MPUA 2IELA 4AMUA 3UKDA 5C37A 3PGA1 5EZYF 1VOTA 4C0XA 1E99A 3ST7A 5HFNA 4IIFA 4TYNA 4YV2A 3PI7A 1Q0UA 3H0KA 1H0HA 2QT1A 2XJ9A 4NFHA 4OHPA 1GPWB 2I2FA 4HNAA 1KDVA 3LT0A 2NZXA 3KOWA 2ZBPA 3G1UA 4EFMA 3BEOA 5A1JA 1DMSA 4N7RA 2YVQA 3P2JA 1B7GO 1NVEA 4O2BA 2EG5A 4J1TC 4RLSA 3VKFA 1QGED 3U1TA 1G6KA 5HYVA 1A8HA 4KNYA 1KFJB 2GA9A 2P5UA 3GROA 3QX8A 4JROA 2BWJA 1O5TA 1IC6A 2HXYA 1OH6A 3TZKA 5HJ5A 3D3QA 3ETLA 1XAGA 3U4DA 2JC3A 2C2BA 4AMYA 3O94A 1E7QA 1NV9A 1QCYA 1GADO 2GYWA 4MQFA 1Y8RA 2I91A 4KODA 4QYTA 4HAVA 2WTUA 5C34B 5IU6A 1NN0A 4IHJF 4DMRA 4QYXA 2MYPA 1FNDA 1W36B 2VEDA 1NBOA 3PDIA 1WABA 1YBFA 2JDIA 4MRVA 3ZWMA 3VKHA 4LE2A 4F3KA 1XZGA 2AJTA 1J39A 1KFCB 4O33A 1UMDB 4WFQA 1JH9A 1GEEA 3OZUA 3PUYA 5K6TA 3L1VA 4FYKA 3JZIA 1HL3A 3R7BA 1XVLA 4KEAA 2OHVA 1PNQA 2WB4A 3LVFO 4ARCA 5TGDA 4BNXA 2Z6UA 2C9OA 4R41A 1U8AA 5B36A 3LZCA 1HV8A 2OO5C 1Y6RA 2TMGA 4I5DA 8ATCA 3IOYA 4RABA 3FA2A 1LLCA 1RSZA 2JBAB 2XH8A 3SJAA 5FTLA 3IILA 2OQRA 5CLLA 4D9CA 5BN1A 3NRJA 4RK6A 3KVOA 3KXLA 3QWBA 5GGXA 4Y8VA 3RLFA 1VHWA 2E1PA 2BFPA 4QFMA 3T3MB 1JEYB 1M6VB 2FZWA 4FCWA 3BWMA 4RCYA 4OQDA 2H2AA 5SZJA 3I1IA 2QHXA 4FPXA 1RKVA 2FU5C 3ZNPA 3IP3A 2R68A 3PLAE 1YCDA 3A32A 4ZZ3A 2WT9A 1M7GA 1U9ZA 4KRFA 2ZR9A 3GN2A 2V5VA 6NULA 5EUCA 4FINA 1NT2A 4L8YA 4PIMA 3AIIA 1TU3A 5KYXB 2FSIA 2PLRA 2BPOA 4C7OA 4DXDA 1UKZA 1WXHA 2COUA 3KKQA 4KYTA 1YS7A 3I1JA 2ZRJA 1YDEA 2VYVA 3PL5A 4XYMA 3SX0A 4U5XA 1QFJA 3QMWA 4IMPA 4TT3A 3A05A 4WY5A 3SIWA 1OBOA 1FOEB 1WZNA 3X1JA 1IOZA 2C00A 4MITA 2CL6X 5C1BA 1PV2A 1TVCA 5EQFA 3UPDA 1DBVO 1JEQB 1PGOA 2CFRA 2W7TA 2XJ4A 3FBGA 3KLNA 4OFXA 3ZDFA 2PJZA 4L08A 1A5TA 3HRKA 2P0AA 5DWDA 2GK3A 3OLWA 1VA5A 4E12A 2OYCA 4U3JB 2OLEA 4FD3A 5CIQA 1G0NA 3C6YA 3DDZX 4H4DA 4GP9A 4NY1A 4P6VF 4MP6A 1CRWG 1OA1A 4FIZA 1HMPA 4MQEB 1SD2A 3DOFA 3SC4A 4J3FA 4QASA 4JVLA 1J2YA 3FD8A 4JI1B 1THZA 2Q29A 2VJMB 4NABA 5PGMA 1PJQA 2WJHA 4IOKA 4BEBA 2IHTA 3B2NA 2WIGA 1J21A 3VV2A 3VZRA 3FDZB 3HM2A 1F2TA 2C59A 3HU5A 4XVRA 2ZT5A 4B0OA 4BEJA 4NJMB 5HUQA 2Q27A 4QEDA 2OFOA 1DCFA 4XX0B 3N70A 4KIFA 4X1IB 1EFAA 3AIMA 1Q2XA 3PXXA 1KYZA 1BEEA 1SOVA 2HV8A 2I67A 4BO3A 5KTRA 4CCWA 3KYDA 4MS3A 3ZS8A 2OBMA 5FA5A 3AUYA 3KXDA 2ZKLA 4MMYB 5EQTA 4Z3OA 3I52A 3VKVA 2G06A 3QBTA 3SEAA 3ZY5A 1WY5A 1Y0BA 4Y6PA 3IIJA 2A2ZA 4UZFA 3ANTA 3TRKA 4KDCA 1YTUA 1M34A 5KC8A 4CKXA 1CFJA 1MH9A 2FMUA 1ZUNA 4P33A 1VKOA 3QF7A 3T9EA 3AM1A 1OXKB 2FEXA 1Q92A 3ROQA 1V8DA 1YOVA 4LMBA 3R75A 1FUUA 3QNMA 5JDIC 2XGJA 2ZS8A 3N0WA 3T1VA 4AAYA 4YV1A 4OGGA 3NQ41 4ARIA 4S12A 2GN2A 4GI5A 4R9NA 3WIDA 5LP6B 3LBNA 4XDYA 4OQXA 1P7CA 2AR0A 2GCEA 4L6CA 4DRXB 3TD2A 1H2RS 1YGPA 3IEUA 5JVDF 1TK3A 2NV2B 4OI1A 1U9IA 5H7XA 3G0IA 4IXDA 4TYYA 1MW8X 4TT8A 2RMKA 3HDGA 1ZLXA 3WGNA 2AXPA 1PGNA 1P33A 3RJ5A 4E2WA 4YT8A 4ID9A 3QWFA 1IN8A 5JCOA 3TDMA 2M6KA 1JVNA 2FJUA 3HUUA 4GL4A 3UNXA 4YUWA 3NM6B 1D8AA 2PNFA 2ZQ5A 3PEUA 4KXQA 1H8ED 5JD3A 1TQHA 4BO4A 4YI3A 1MKYA 3IODA 2J09A 2Q8NA 1H8HA 2EGHA 2GN1A 3DUWA 1W88A 3S8EA 3IP5A 2DFKB 3IHTA 1WSAA 1U28C 2I4TA 4CKCA 1MABB 1P2TA 1YDHA 3P71T 1I3NA 2OP0A 2IYZA 4PC1A 1A5AB 4WJKB 3TF5A 3I6BA 2NLOA 2O50A 1SUDA 2Y6UA 3KB2A 4L0DA 4CMGA 4IGFA 2QQ5A 2WJ3A 1ZNXA 4IDDA 3GNSA 1QH8A 1S2IA 4CW7A 4F2DA 1GFIA 1KZHA 3D7SA 1V48A 4X3OA 1M2JA 4NDNE 4NEQA 4IY1A 1JSXA 4C87A 3FN4A 2I7XA 5CFZA 4Q4HA 4E6EA 2I55A 3PNVA 1IY9A 5BQOA 2A0XA 3COYA 1VE5A 2KB0A 3AFIA 1G8PA 1NJSA 5EJ5A 2YR0A 5C8XA 1M0TA 5EJ6A 3DEFA 2O2DA 3JWPA 1NG1A 4I9FA 7REQA 1J0XO 1XGKA 5DMHA 1OILA 1K06A 2QE6A 4AJ1A 6CHYA 3DFMA 3HJBA 3N6RA 2R6FA 2HSZA 3NHUA 3TXYA 1HG1A 4D4MA 1Y81A 3H0EA 3JAWA 4P3YA 2NQ8A 4EPWA 2ECOA 2JGFA 1NBAA 2ZYGA 5DYGA 6AT1A 3E22B 3JASA 4A3SA 4PSDA 3KWMA 1W4AA 3WLHA 3JQPA 4NZPA 1H65A 2GPWA 5E1OA 3VMMA 1V45E 2GESA 3F5DA 4L22A 4WFKA 1TF5A 4Y2YA 4BXOB 3F74A 3QX7A 4L78A 4RY2A 1I1QB 3PQCA 3RARA 3U56A 3KP1A 3MBIA 2A57A 4KE6A 2OCKA 5LP6A 3D4PA 4IIJF 5E8RA 3BFPA 2RGEA 5DHFA 3D5TA 1IBKB 3RTDA 4O8ZA 2WJJA 1GU7A 4U9IS 4FYMA 5KX5B 3WFJA 3TM4A 3PCXA 3BJEA 2XI4A 3SHVA 1MO3A 1FRQA 3I2KA 4O4HA 3BH6A 1RYEA 1ZISA 1OPRA 1P7PA 1KTIA 4HEHA 1CUZA 3HN7A 3LV8A 5I3CA 1X9GA 5C8VA 5JRJA 4G23A 1H5QA 2FLWA 4ZCQA 1P5RA 3J7TA 4JEUA 2GX6A 1AX9A 1LJLA 1IIRA 4MJLA 1N9GA 4QUGA 3BFVA 4KYIB 5B7PA 5EIXA 5JZ9A 1IHOA 4MEAA 2UUOA 3ELYA 5SZHB 4I14A 4LK2A 3I9OA 4DIOA 3G0DA 3RADC 1YRQA 3H1PA 2ORWA 3RTGA 4MR8B 3TCKA 4YAIA 3G02A 5JPCA 1G59A 5KQMA 5LQCA 5C51B 1OB5A 4MS1B 3H2HA 4UM8B 3BRCA 4B6JA 3REGA 2O19A 3NHMA 3Q7EA 1QYXA 1I80A 1N7HA 4JGGA 3H2KA 4O0MA 5M7EA 3JAKB 3NZEA 1GYRA 3UAXA 1FVHA 3BMNA 3UWSA 3PUZA 5JWHA 3PIIA 2HK9A 3QV1A 4BHTA 2ZT6A 3RSQA 2VHQA 4YJHA 1JPUA 2G5TA 1UXOA 3EC1A 3G0GA 2X9QA 2DGDA 3IEIA 4GBED 1R8XA 5A3VA 2ENWA 1Y63A 2ZWIA 2P11A 3G49A 2W4QA 1I2MA 2ATCA 3DAHA 5EC8A 4UTRA 4J0FA 2G28A 3HCWA 4EM6A 2WSSD 3DHVA 1NVXQ 1NI4B 1QG4A 1ZEMA 2YJNA 3FFWA 3IQDB 2YVLA 5H83A 3UK1A 3VJKA 2ZJ0A 3D4NA 4WECA 3QSYA 1YE3A 2JJMA 1SXJB 3I0MA 4I4CA 4TUYA 4FIDA 4LY3A 2XB6A 4BFWA 3DOOA 5KYXA 4FW9A 1JMVA 1VQ1A 2I7TA 1MPXA 4EKIA 1HYHA 3VH4A 3FZEA 4YMUA 2FMTA 2J9RA 1LPMA 3AERA 4RXTA 2HBZA 2VPZA 3MVEA 3JV7A 1UC4B 1VPEA 2GBCA 1JB1A 2Q99A 2IL1A 2D1FA 4PYRA 1QVRA 4N0PA 3UQYS 3MK31 3I39X 4D9KA 4D4GA 3HGMA 4DF3A 3QFRA 3TLJA 2R1ZA 1LTKA 1C8VB 1ZW6A 2ZZKA 3UZUA 5JU6A 1NR1A 1HOXA 4IUCS 4KXUA 5ES3A 3T5AA 1QDEA 3ELDA 2PLAA 2RI6A 1OLUA 1YK0A 2JBAA 1DLJA 2NVUA 3EASA 5DX1A 3VKWA 4DLRA 3ZGXA 2HMAA 3D6NB 3ZVNA 2YICA 3K0CC 2O8DA 4FNAA 4AMZA 2WHPA 4DT1A 4B34A 1XB2A 3B51X 4KLRA 3G8BA 3I12A 3LQRA 3L7DA 1G20B 3BTSA 1DQZA 2JVJA 4BO1A 2FEAA 4EJSC 4P4LA 1PCXA 1SMKA 3IP8A 3E7FA 1II0A 1L5VA 2HMSA 3TB4A 4EPXA 4EY4A 2ZRBA 5AW2A 2YWEA 4B5LA 4TYQA 4GX2A 2FQ1A 3U7EB 4HXYA 3W8DA 1SCNE 1BD3A 4DSZA 1RRFA 3TZQA 2RK6A 4CT0A 1TC1A 2EFCB 3UK0A 1X1AA 2X8JA 3UG6A 5KYWB 4RTOA 3R7SA 3ZX5A 1J00A 4UC0A 1G66A 2A9RA 4JBWA 1EHCA 5T8KC 1QTQA 4QBIA 2QM7A 1CE8A 5CA1F 5DM4A 1QP8A 1HLPA 1TMKA 3W90A 1TW3A 1M8PA 1WOYA 4NZZA 2C99A 4MICA 3MA0A 4DG5A 5L3QB 3TFOA 3W3ZB 2FMFA 2IY8A 3DM9B 1YE8A 2O2YA 4OQEA 1HM5A 4F60A 4ZYYA 2G1PA 3GFTA 4ZO9A 4BTLA 5K8JB 3GFFA 4HFJA 1AT1A 3F6RA 4JA0A 3COJA 5F73A 2XNDA 5CUQA 5CEJA 3PDUA 1NRJB 1LVGA 2X1HA 4DQ0A 3DAGA 3TI7A 1U2RA 1DHRA 4RK5A 4BMPB 3BDAA 4OGFA 2GN8A 4GKJB 1FLDA 2ZJ1A 3EQ9A 1PDOA 3IAS6 1VPDA 5AQEA 4DSAA 1NN1A 4JJFA 1OYVA 3OE7A 1NXTA 1JR6A 3D6FA 1E9CA 3PNBA 1PR2A 4X97A 3WL4A 3I73A 3CGWA 1KOLA 3V4PB 2VP0A 4I3GA 4F11A 5JTTA 5FAXA 1K3UB 4AU1A 1FVOA 3OI7A 1X7XA 1KAEA 4UHEA 4BQIA 4H7HA 3ELUA 1PD0A 1RWPA 5IBCA 2RKWA 1IB6A 3HMQA 5ALZA 2W70A 2BEVA 5DYTA 1M2FA 3D64A 3OEHA 4G26A 4WN9A 1H9CA 1CZKA 2Y0BA 2IKSA 1C9EA 1G38A 4DDVA 1V41E 1GCGA 2J87A 2Q3FA 2C7RA 1R4NB 3V8NA 3FPCA 1ACJA 1XTZA 4D8WA 3OOWA 4MV0A 4AY4A 4XYEA 3BWVA 2ZROA 4R54A 5JIBA 3DTVA 2IH5A 2PWYA 3TMKA 3NKVA 3B8HA 3DKVA 4PLGA 1FJGB 4QUAA 3GHHA 4U0KA 2V6GA 3ZQKA 2VNJA 1TLLA 1XZDA 2WHRA 1ZN7A 3TSOA 1IN1A 4UU1A 1LDBA 3BXOA 3PEVA 1U90A 3KPYA 5IM4A 5DFAA 3GLUA 3FB4A 4CQLB 1QTNA 3PG5A 3RC2A 1EFDN 1HFWA 4EVQA 1KZ4A 4OGKA 4E5SA 1N4DA 1SBIA 2JJ1A 2JJ1D 2ZAOA 3O3NB 2BGKA 3EZXA 1XTRA 3DOCA 1XELA 1SUBA 1XFAA 2P3OA 2X1VA 1YMVA 4XQCA 1JKMA 4JBGA 3WYBA 8ABPA 1SC9A 1SXJE 1T6ZA 1PG0A 2Y4NA 5ALRA 1GTZA 1UFVA 3FDJA 1KSGA 4D9NA 2BFBB 3GEPA 3IAM6 2DJ5A 2OBFA 1U1EA 1DPFA 4W4TA 4QBKA 3B12A 4BJ3A 3ZVKA 1RKXA 2AZDA 3BXPA 1GKIA 3AXTA 4KQGA 4MRNA 3N6VA 4P58A 1YQQA 5AOAA 2VH1A 4HLNA 2HRZA 2WU0A 4TQGA 3E05A 5JWRA 1MC4A 3A1NA 5AK5A 2XB9A 5EHNA 4S05A 1Z4KA 2GAFA 1DG1G 2VKTA 3AJAA 3NVDA 4TV8A 1QHEA 4ENPA 3FUCA 1C7QA 4EGAA 1OU0A 2OGWA 4KPGA 1P4RA 2W6MA 3AR5A 2QJRA 1H5NA 3G88A 3TLBA 4ZOEA 1WV0A 1FDSA 2C4WA 13PKA 4S1NA 2Z04A 3RFFA 1PJCA 1A2BA 3QEMB 1ILWA 2Y71A 2BKEA 2ID8A 4FX2A 4RIEA 1CIPA 3JYOA 3GO4A 3WIOA 1XTJA 4WOJA 2GZMA 2REQB 1UBMS 4GVLA 2OVBA 5DTQA 3V4ZA 2G9ZA 2P65A 2GKSA 2UZ3A 3N05A 4QYWA 3C4VA 3VPCA 5A4KA 1YZGA 3ZCVA 4GLLA 1XHFA 2CJFA 2FK7A 2VBGA 2ZE7A 4ND3A 1G21E 4QBHA 1TOAA 4P0TA 3WLEA 1ODCA 4WKCA 1I10A 1VBKA 2C3UA 3DBIA 4RL4A 4C5CA 4W6ZA 4HN4B 3DTVB 4ZKDA 4BVJA 3TSWA 4EFNA 3GLIB 1X7YA 4XGRA 4B71A 3K6JA 4TL6A 1PTKA 3O1HB 4KQKA 2DH5A 4MO9A 1X1QA 4MVJP 1MVOA 1Q11A 1C3JA 3N39C 3QEOA 4B3MB 3O2QB 1K7FB 3OVMA 3I62A 3IA7A 1QWOA 1IPEA 2CHVA 3UGTA 1OWMA 3B70A 5C8DA 3FGOA 2LCQA 2O8CA 3NTXA 1NYLA 1DZIA 1NXSA 4KGVA 1B4DA 4H17A 4XD7A 5K5EA 2L19A 5GJWC 621PA 1E92A 4L95C 3UMSA 4D43A 2RGXA 3K8QA 5FBWB 1E2UA 1BWQA 1C14A 1ORDA 2N9UA 3CPJB 2XITA 4EA7A 1TD9A 4BC0A 1AH2A 3GA0A 5CVUA 1N1DA 5C1IA 1BIFA 2EZUA 2I65A 2PA0A 4WI1A 4BNZA 1IUPA 2QD5A 3OD1A 3BK2A 4NS1A 2OXIA 4BNIA 2GS9A 2QEQA 2HWWA 4TV9F 2Y0DA 2JGEA 2AD5A 5T67A 1P62B 4K9LA 4R69A 4E4YA 5B7GA 1NQXA 1REQB 1Z0ZA 2WZCA 1KQGA 3MXTA 3CX6A 4ZCMA 1Y80A 2EP8A 4P0QB 5BUCA 2J41A 2AOUB 4KGDA 3BTVA 4F96A 4MMZB 2JANA 2CXHA 4MR9A 3CR8A 4NH4A 4WXEA 2DHEA 2B78A 1U2GC 5A02A 3VNRA 1JDJA 5CX1A 1RXSA 4K0RA 3ZOZA 1XTBA 3NC1C 2JH8A 3IHLA 4DJJA 3E7DA 2DCMA 4D41A 1QFXA 3G89A 1LC0A 3GVCA 4J0EA 1OF1A 1ZRMA 3ZVMA 3OM1A 2AJLI 2ORIA 3L0ZA 4AY3A 2HADA 2N3ZA 1Y5RA 3E9EA 3RTEA 3H3JA 3IX7A 2MIIA 2R66A 2BMWA 2ZSFA 4ARBA 2WD8A 5EKSA 1JPNA 1PGQA 2NPIA 2X0NA 3IPYA 5I4CA 4MRAA 5MDHA 2YXLA 2EAUA 3CNEA 1GTMA 1JHYA 2GH1A 4JEMA 4RYDA 4F4IA 1EKXA 3BE8A 1LNZA 2WIBA 4YCMA 1OT3A 1RR6A 3AUJB 4PLFA 4GT1A 2BVNA 1KO8A 1J5XA 3EDQA 3MTEA 5ALQA 4KAAA 1PU2A 3OKPA 4XQ0A 3GRRA 1XDBA 2Q5JA 5IAEA 1YVPA 4LMAA 4MH0R 2LDXA 1EHIA 2P9BA 2FXIA 2PZ8A 5DTJA 3KAKA 3DG9A 4YLYA 5L3RA 3R6DA 4A0SA 4C4AA 1CBUA 4QHSA 1WR8A 2W83A 2X0IA 5HOEA 2Z6QA 3A0UA 3ZQ6A 1Y9ZA 3FXAA 3PC8A 3T1QA 1PQYA 4UVIA 1QU2A 1CRQA 3U7HB 3KLMX 3FVQA 4JLSA 2ZETA 2CXRA 2QRUA 3D1VA 3UOGA 3SBEA 2ASEA 1NQTA 2IWHA 1T8YA 2QZPA 5C5CA 1JXQA 2ZXFA 1YIDA 3EZ6A 3OTHA 2F43B 3I01M 4FGWA 4FYPA 2X2OA 1GG5A 3C3KA 4TV9B 5AXAA 4KQCA 3EOBI 3NEYA 5B3KA 3FGNA 3EDRA 2OT3B 2QM8A 2PXCA 2Y66A 3LIPA 3DE3X 5KYVA 1U8FO 1TRKA 3Q85A 4N9WA 2JLXA 4XA8A 4BP3A 1XP5A 3PDJA 3D9QX 5HTKA 4II3A 1K6EA 1N2BA 4D79A 7AT1A 4RM3A 1OHHD 4FOPA 5LP1A 3FGZA 3ICVA 2H4FA 4XPIA 4R1SA 1Y7TA 1FY2A 2EV9A 2XNHA 2ERCA 2A1TR 3HV2A 3IQZA 2DQ4A 4J7XA 2NZ2A 4G4SO 2WDZA 2HL6A 2W2TA 4P86A 1E9AA 2AMJA 3HU1A 1I7QB 2AXEA 2QPLA 4N49A 2DFPA 2BGJA 4WERA 1UJBA 5KYUB 3ON5A 3KKNA 1T3LA 3JZFA 4OP1A 5IAJA 4RDIA 1XTTA 3KWFA 3H1FA 4G0OA 3WYFA 2J3KA 3LPAA 3E0XA 1Z36A 3WGQA 5ALLA 4F45A 4FSHA 4BDSA 2Y1LA 1T8PA 3N8KA 3PXGA 1T2AA 2IZ0A 4OATA 1B8PA 1OD6A 3DZCA 4EUKA 4G1MB 2FW6A 1XZNA 3PXUA 1XZAA 1V16A 1YUBA 1F9EA 2BL4A 4P4NA 1R00A 1WOMA 2Q49A 3HN6A 3FSRA 1H94A 1H2XA 2QGNA 1WZIA 2GZHA 4PSVA 3BXFA 2H6EA 2JS7A 3WWDA 5AK3A 4PCVA 2VJAA 3JCZA 5FH9A 4L15A 3VA7A 3DM5A 4ERNA 1R6UA 5CA0F 2ZE8A 2P67A 1XC7A 4RMJA 4RTPA 2BTQB 4LHSA 4PIPA 4DAEA 4Z4HA 2JNWA 1HK7A 3PT5A 4KWEA 4S0XA 3K0FA 1S89A 3EIEA 2V4UA 1D2CA 3MTGA 4JLBA 1EYZA 2HPZA 1IM8A 3LTEA 3N2GB 4NONA 1NOKA 5L53A 4F2GA 4FJ2A 3WSTA 1MR3F 4YP6A 1YA4A 2UYQA 4HC4A 2QRJA 4UHCA 1GGJA 2ILVA 3TR0A 1I2AA 3K3PA 3LC7O 5DP2A 3WWOA 4E13A 2A14A 4BB0A 4O2RA 3H1GA 1WTCA 5FWNA 1KO1A 5K8IA 5KCMA 3EGEA 1PFQA 3M8KA 4QDKA 3KJNA 1IOVA 3CV3A 3Q1KA 2WNHA 3G2MA 1HZZC 1VYUA 1GCIA 1I4EB 3BPSA 4RZSA 2JIMA 4J9VA 3RHFA 3SJBA 4KITB 4C7XA 4CKWB 4DJAA 3P52A 2W2VA 4DB2A 5E9JA 2YWHA 4H16A 4BLTA 3FWNA 5A5FA 2RAFA 1Z37A 3BFJA 1CIVA 2HIGA 4X65B 1XQ9A 4P80A 4HT3B 2VYNA 1BKYA 2GYYA 3QYPA 4KLCA 5K3AA 4GOMD 3G2KA 3IURA 2A58A 3ZHBA 1K68A 1WDWB 3RYCB 4Q1VA 4B9AA 3B5IA 4BLUA 4KR6A 1YJAA 1M2OB 2IA5A 1E5DA 2EZ9A 1PIWA 3EGOA 3LLCA 3W34A 3GGSA 4U7DA 5AI4A 3KQVA 3WP0A 3ENKA 4P93A 5BURA 4RZXA 1JWAB 2E87A 3DKIA 5HFAA 3U44B 2ALJA 5CVVA 1H1LA 2R97A 3SHQA 5LD2C 3MCAA 5BN4B 4ND4A 4CM1A 1UBSB 2O05A 5AKLA 2Z3ZA 4F12A 4YPOA 5KNCH 4K0KB 1JLSA 2HDNB 1WXIA 4EMSA 2FRDA 3INYA 4GWGA 4DA6A 5HK9A 5DASA 1A97A 4WEOA 1V35A 3PGMA 5DEOA 2VRCA 3UV3A 1HLFA 5J40A 4TL9A 1OTYA 2ZBEA 4B81A 1W0KA 2W2PA 1GA1A 3K1AA 2HHAA 3RFCA 3MT9A 1W9MA 3UANA 4DUGD 4EW3A 3S4YA 3DPSA 2Q0QA 2HEGA 4KZKA 5JXGA 5LQRA 4MS1A 1CQIB 5KTKA 3A6GA 2W43A 4EB3A 1WWKA 5AW8A 3INNA 1XA4A 3ETCA 3O8OB 3L82B 1NW6A 3A04A 3PHCA 3RYCA 3GGCA 2F8TA 3SEQA 1EXWA 1KPHA 1ULBA 4XCQA 2VP6A 2PMFA 3LQQA 3OF5A 1OREA 5HKKD 2N1BA 3FYUC 1DIOB 2G9QA 3EXHC 3LWBA 2BFMA 3M6AA 4L8GA 4BNTA 4UBMA 3KZ1E 3DVSX 2AFIB 3MJRA 2YMQA 1RPNA 3KTOA 3OWOA 4LVUA 4AZVA 4EDFA 2WU3A 4QIHA 2FLVA 3UO8B 1V7CA 4JI6B 4WEQA 3WISA 5ISMA 3KYIB 3WO0A 1BW9A 1FFXA 3IT0A 4ZANA 3I6QA 4HYEA 2FZKA 5LA6F 3D6JA 1DC6A 3RH0A 2F64A 5EESA 1GTVA 1UC9A 2CNLA 3QFFA 4HATA 4JC5A 4QRHA 3OTIA 4WLFA 3TOCA 3LXRA 3RO7A 3OPVA 3UK7A 1AURA 5B5SA 1SIBE 1PUIA 3N1UA 3HADA 4OYYA 3H5TA 3ER6A 4K03A 4U2BA 5TMPA 2I6XA 1W4BA 3FCUB 4WZAB 4R2LA 5CDFA 2QD4A 2MYNA 1PK7A 2O20A 4MS4B 4U7JA 3ZDQA 2Y9PB 4QOGA 2ZCJA 3T95A 5AQ1A 1MHTA 4H59A 3OLCX 4B4VA 3KQHA 4YMHA 2B25A 3GA7A 1IK6A 5BNFA 2VPIA 2CT8A 1EFVB 3HI6A 3A1VA 3P27A 1II8A 4D9JA 1CS4C 2NVWA 4WLUA 5KYKA 5KOYA 3LQ4A 4PZDA 2P2SA 3K6RA 2FR0A 4FYXA 4MQUA 5LYJA 3TW8A 2GPNA 3V2UA 3M6UA 3ZGNA 4QJ3A 3REFA 2RC5A 4YJHB 3UCEA 2PH5A 3RFVA 5DOVA 2WSSA 1I33A 3DYIA 3E8SA 1REQA 3MILA 1USKA 2JLAA 3TPZA 3I58A 1DELA 3MHTA 3MMPA 4PZLA 2GILA 2I3AA 4Q4DA 3VX3A 1Z5VA 3OM9A 1PSDA 4GLFA 2RGUA 4UPVA 3IMFA 4BMVA 5JADA 4JEHA 1JQAA 1ENYA 1B8VA 1DC8A 2QLMA 2Z5LA 3K8OE 4TKVB 1XAIA 3C0KA 9ABPA 2HA6A 1GZSA 1C4KA 1JAHA 1JJBA 2GNAA 1K6MA 4L4XA 4R2MA 4DABA 2I2AA 1L5GB 1WIWA 1KQPA 3L05A 2QX8A 2P2CA 4IVQA 3STYA 5EFOA 2P4UA 2XCIA 4FP9A 4QAQA 1WXQA 2J6CA 4Y2SA 5DYYA 5EYPA 2Z8YA 2EFGA 3D7RA 3HJCA 4CTJA 1WS6A 5KHOC 1M34E 5EG5A 3GPBA 4QT4A 1LK0A 2GRJA 4R0VA 4QPJC 4E5DA 1ZRSA 4JOCA 2FN8A 5M04A 1KAOA 3HVIA 3OZDA 5K8UA 3UAOA 3PEYA 3NGLA 3WWCA 4HWOA 2ZJ8A 1ILEA 4GQBA 4ISCA 1RU3A 2OA0A 1JTEA 4GM1A 1N2SA 4UE6A 3ACDA 2UZAA 4QX6A 4UHDA 3II6X 2DQSA 2QLBA 2Z08A 3I2YX 4NV3A 4PZUA 4GLOA 2F6RA 3CJTA 2J9FA 5M3BA 1L7VC 1COWA 1VL8A 5G4LA 1H93A 4MCAA 4BFSA 1YKSA 3K5PA 3GLRA 5B4VA 4HEA1 1SQSA 2PL5A 3CW2A 3DLIA 1PQPA 1UBLS 2PMBA 4DCMA 3JQ9C 4R2KA 5JQWA 2ZUEA 3LS2A 2J67A 3VVMA 2WKPA 2I4NA 2HPAA 3D1JA 1BYIA 2WLSA 2G08A 2WQZA 5JAZA 4H7FA 3E70C 3CURA 3DAFA 2J7PD 2Q4BA 1RIIA 4FOTA 2YWXA 3TNFA 2BD0A 3CC8A 4N0EA 4UBOA 3V5NA 4EX6A 5BXYA 1LBSA 1LV7A 3OAAA 4Q15A 5G1PA 3QPVA 4PVCA 4WN3A 4DCTA 2C88A 3K31A 4CCYB 3U7QB 1VJTA 4G84A 2EIXA 2WJVA 2ZWVA 3D43A 4E6PA 4Q05A 2DEUA 1M5UA 2FZLA 5D5PA 2WV9A 4OSPA 4DQXA 1DEKA 2PQ0A 4MP3A 5AWFC 4MVJI 1B26A 1KHHA 1PZEA 2JD0A 1FNSA 2VQSA 2VZLA 3MQFA 1FDTA 1XMIA 1L5NA 3MWEB 1O9BA 1AZLA 5ITZB 1QZZA 3B3AA 4E7PA 5EMJA 2HSWA 4GI3A 3W1WA 4BU0A 3O8CA 1UEIA 5CR9A 2PJRA 2PE5A 2IZ7A 2J6BA 5EE1A 4H7KA 1VJDA 4IQFA 4WWHA 3NEJA 1EP3B 3CO5A 3F1LA 4MGKR 2VPPA 1P0MA 3B1JA 3H8WA 1Q0ZA 4EHKA 1A9YA 3ZV5A 2QD1A 4M7PA 1Z47A 3T5PA 3CU5A 2CMHA 1NQ5A 1Z8NA 2IYAA 3NB0A 3PF9A 4ZEXA 3ZUPA 5A03A 3HGQA 1ODSA 2FUEA 1E7MA 3K4HA 4DCPA 2XW6A 2G3YA 5AM0A 1AO3A 1OWLA 3NWEA 1PZMA 4Q7MB 4M49A 3K5IA 3PD7A 5ALSA 3RIYA 4CCYA 2CNNA 2QYOA 5KKNB 1WTAA 3B9BA 5AVQA 2C5BA 5IMSA 2HHJA 4TSRA 3VJMA 1GTJ1 3JQ8B 3M81A 3UJPA 5K0CA 1DRKA 1X1EA 2IU0A 1IJFA 2RHOA 2FVXA 5JSYA 4DILA 3KQKA 3D3WA 3OIGA 3SX4A 1G41A 2GCGA 4I81A 2BE9A 1AGPA 3Q4GA 1PQWA 3W5AA 3HYSA 4FFMA 3RR2A 1IL0A 2ID7A 3KL2A 4LE0A 3I1FA 3C5WP 4RK7A 5AJVB 2NU6A 5EWLB 1GU1A 4P2BA 3ND7A 4Z4FA 2G8LA 4J90A 1YL5A 3DZHA 5A7GA 3ZLJA 3L01A 4X84A 4LWPA 3BULA 2D7DA 4FS8A 1H6CA 2BFNA 3BWDD 1F20A 3B78A 3O1JC 4L57A 5JVDB 1UPUA 4BDTA 3WWYA 1B8UA 3DB1A 1HWYA 4EKYA 2H92A 1UJ2A 1Y98A 3Q3CA 4D4KA 4G4GA 3EVCA 4KH1A 1AS2A 3UATA 3WOHA 1P7YA 1Z5OA 2Q62A 5CK5A 2A5JA 2ONJA 3A6DA 2IBTA 1DX4A 3LHFA 1I94B 2LRHA 3SJUA 3WRXC 1E60A 3LI2A 3HUFA 2B3DA 2FPMA 2QP9X 1PTJC 4HQ6A 4D0GA 1KVRA 1TEVA 3PDIB 1MEEA 4CMIA 3VH3A 4UD6A 1S2NA 2Q3LA 3C15C 4MVXA 2BF4A 2QE7D 3ZE1B 1T36B 4JQYA 1W2WB 4BQSA 2WJPA 2XVAA 1ADFA 1E1QA 3DSRA 4UE2A 3L7IA 4QU9A 2ZTHA 3AGQA 3P2OA 4RHFA 5BSGA 5LIPA 3QWAA 3NTRA 4MV6A 4POAA 4EW1A 1U7TA 2PDAA 4OM8A 4UREA 2OZLA 4IS3A 4GR9A 3PVCA 4HEJA 5F51A 3CZ5A 5FOSA 2A7QA 3EYAA 3WQQA 1YFLA 1Q0TA 1KU6A 1H3FA 3CKMA 1I7DA 4JT9A 4YCSA 3V42A 1Z33A 1AKUA 1GZUA 3FOCA 3SFTA 2FFQA 2FSVA 4P3NA 2FPIB 2IUTA 3R6LA 2Y2VA 1BC5A 2FW8A 4NG5A 2JIOA 1IHUA 2R6ZA 4PQFA 4XYGA 5DRYA 2H1VA 2W2MA 1MOQA 1RQXA 1WQ3A 2WINI 4J03A 1AF7A 3UAYA 3KKMA 5H80A 2YFKA 4YMIA 2P41A 1P31A 3CE9A 2QSZA 2ZULA 1EFUA 1KZGB 2XOKD 1NW5A 1VYTA 2PRYA 1K2VN 2XOKA 3IFSA 3V00A 4Q1EA 4ZXFA 3BWCA 1YQEA 3B5EA 2W37A 4DKJA 1FFHA 1T5BA 1ZI8A 2JFVA 3R0VA 1ECPA 4YXFA 1GPYA 2WM8A 2XWBF 1R8JA 1ZINA 4V03A 1TMGE 4OHBA 3I5AA 1QK4A 1YS6A 2IODA 1T4CA 4KSBA 1HKHA 4Q0MA 3K9GA 1G2QA 3C85A 5TGTA 1D3AA 3LE8A 3R5SA 2DF8A 4PYQA 2YIMA 1W75A 3LT4A 3HZHA 4P38A 5H5JA 3X3HA 4ZHSA 4HRVA 1U94A 1YBAA 1CP3A 2TS1A 3RU7A 3MCTA 5CJJA 3HNRA 4EVIA 3DP9A 2AE1A 2OYRA 4XGIA 1GA4A 2R47A 3SBOA 3KXIA 3P9IA 3A9TA 1IRXA 1T8WA 1UINA 5A9TA 2XDAA 1LB1B 2G7MC 3ZU4A 3EQ8A 4KQHA 1DKPA 1BXGA 4IM7A 3OCYA 1Y7LA 2RH4A 1T25A 1NJ8A 5F7OA 1ZDMA 2Q5HA 4MKFA 1Q1BA 1WU7A 4Q9KA 2AYZA 1CERA 1MO6A 5K3DA 2FPUA 2VXYA 1JECA 2FWAA 3EPLA 3L6CA 4OB8A 1X14A 1N2ZA 4Y98A 2HF9A 2VDOB 3IXQA 3PIDA 4NX2A 5FWXA 1CIJA 1KJIA 3O1LA 5HCNA 1JILA 1U3DA 4ZQCB 1YZLA 2XGMA 4KYVA 2PX4A 3EVZA 1IWPB 1QH1B 221PA 2FR1A 5FQNA 2ZYAA 3KSDO 4J49A 3RUCA 4AO8A 1Q7GA 5F76A 1LZLA 4X61A 1O57A 1P2GA 3BXHA 2QM3A 1ZJJA 1UIMA 3C3WA 3GCWA 2ZQZA 4W1SA 2VJKA 3FH0A 5E6UB 4CFYA 3GLFB 2JGKA 3RIEA 3OZSA 4HNSA 4I6GA 2JKVA 4M1YA 5C5EA 2RGRA 3K15A 1R50A 2WUWE 2HDWA 1K1EA 1ZGGA 1WUHS 3G7UA 5KVAA 5KVSA 2NZVG 3OPYI 2R751 4DMGA 2A3NA 4R2IA 4OQ4A 3KTDA 4EO7A 2OAEA 3NFYA 3W1VA 5BW5A 2XGOA 2VZ8A 2QMZA 5DYNA 4X6XA 1ZJ5A 1QYCA 3NYRA 2NYRA 4KQEA 3UJCA 1A7UA 1AGXA 2E5WA 3N9IA 2RGNC 2X8JB 3R3WA 4R0NA 5DISB 2KBFA 3NRBA 4RUKA 2PLNA 2PY6A 2IP1A 1H23A 2IXAA 3OC6A 1LVUA 2DPXA 4FYWA 1BE0A 2OO7A 2OHFA 1TDJA 4TTPA 4LOAA 2IYWA 2EBHX 2SHKA 3P45A 2JW5A 1V95A 4AN0A 1A4XA 3GDFA 5TMBA 3W7VA 3QITA 3UVEA 2XTZA 5E1BA 4M46A 5B1YA 1C3OA 1RM5A 3AONB 3Q72A 1IWOA 4TXNA 4N76A 3UJHA 4QFBA 1YXMA 3EW9A 5ER6A 3MWGA 1OLSA 3M4JA 3QKWA 4KX3A 3DLAA 1QXSA 3CTMA 1N5LA 3GH3A 3GLSA 4R9SA 5J5AA 1IEWA 3TZ6A 3GVIA 2PUEA 3BIXA 5CTJA 1YB5A 4RVCA 5LQMA 1NNUA 5K0BA 2O7SA 2ZU0C 1VL0A 1F51E 2REOA 3HCDA 3P97A 3QA9A 4FUQA 4UHJA 5DGXA 4CUZA 1ODTC 4XWKA 1QIDA 1JLKA 4XKJA 4EMBA 2YMLA 1GPKA 1G3UA 3L6DA 2WPDA 1A96A 1LPAB 5HMLA 2HB6A 3FSGA 2PO5A 4PSCA 1G8HA 4CM4B 3KETA 3KQNA 2DPYA 1MEJA 2O1EA 3AI2A 3VU3A 5KTTA 5I7AA 5IZCA 1U2DA 2G4VA 3FMVA 1UDXA 4K05A 5SYNA 4G0UA 2H1SA 4I8IA 4OCZA 4KTTE 3HB0A 1C7IA 3TLEA 5EMKA 6REQA 5HQ3A 4YS6A 4YR7A 3D1LA 1SVLA 2BCJQ 4O1HA 2WT8A 1V16B 4JT2A 1AMNA 2RKBA 1RQ7A 1TVKB 3OCJA 1E3LA 1DJQA 1NONA 1EQAA 2ZIEA 1ARZA 4H1VA 1VE3A 2V6FA 4GC5A 2V8BA 5IH7A 4WX2B 5EJ2A 2EF0A 5DM70 4KR3A 3B3GA 3AYZB 3R09A 1ECBA 5BVHB 2PUTA 4LJ9A 1OXUA 5DSTA 2GYVA 2I5PO 2QU8A 1C5KA 3L0DA 4MUKA 4JMPA 4KQ2A 1YZFA 2FUG6 1UJ5A 3DBVO 3GQBA 4OQZA 5ARDA 5FBKA 5JFTA 2GD0A 4HDKB 4MS4A 3ZJUA 1JDZA 4CV1A 3LPMA 8OHMA 1GAXA 3ZWDA 1OZHA 3UV6A 4K28A 2XUGA 1J23A 3AL0C 2WWTA 1H6AA 2L42A 1Z0JA 2PUVA 5EIFA 4OY3A 1B2RA 4JUBA 3U9SA 1X9HA 4JELA 1G3IA 2AFVA 1WG8A 3IIKA 3FMIA 1QIGA 4HDNB 2X8LA 4QBGB 4D56A 3K6SA 4D26A 3ENWA 4YWJA 2NAFA 4OLHA 3UCFA 2I78A 2ZRFA 1X7ZB 3EWAA 1BMQA 3P9ZA 3AEYA 1UDCA 1GNRA 3PQ4A 3HBNA 1X7DA 3U0BA 2JIRA 2W58A 4JI7B 1LJ8A 3DBRB 3KFXA 2PPVA 3DE1X 3SLRA 3R76A 3MWDB 1E18A 2ODBA 4NK5A 2XYPA 2PQ2A 3RKUA 5IS2A 1EVIA 4MB0A 4JJIA 4MX8A 5E7JA 1EZ1A 2CDRA 1ZZEA 3CSSA 3TKAA 3ECSA 1JSZA 2EVWX 4CGZA 3I83A 4BY9E 4AYWA 3HJHA 4GG1A 2G9RA 1NW4A 2O57A 2YY7A 3B48A 1QG2A 1Q1GA 3BRWD 3IQXA 1CSEE 3JTMA 3THOA 4V0OA 4LEIA 2CVFA 3HO8A 2CMFA 2G1AA 1NVAA 4ZVRA 1TUGA 1GA6A 3FDZA 3QVTA 1FPMA 4G5SA 4WCFA 5FTJA 4F93B 1SHUX 2R96A 3DPUA 1YJ8A 3GEMA 3OLXA 3Q8XB 2C20A 2DFLA 3O3OB 2QQGA 2B7LA 4KW7A 4WD3A 5DNYB 3P9NA 4YMGA 4ZYVA 3QVWA 1CUEA 2H7VA 5JD6A 2C5FA 7REQB 5TIIA 1MRNA 3CW9A 1CUCA 2DZDA 2ZWOA 3EUFA 1CDDA 4FCVA 4B9EA 2WYUA 3IPCA 4BAZA 1Z0FA 3T35A 4EIWA 3NJRA 1EFPA 4DZZA 3CF4G 3RRJA 3OPXA 3WYDA 3HCRA 4YTEA 5J1TB 2QL7A 1ZGBA 3ETDA 3ESZA 1CU1A 2PNJA 5THQA 4B7AA 2IX3A 3NPAA 2WF9A 3N2NA 3O4IA 4QG7A 4TLMB 2Q5LA 4K9PA 3ZVLA 3GLHA 1WW2A 2A78A 2N46A 2RHRA 1TRHA 2GVNA 3LXMA 3Q6IA 5COAA 3LYUA 1F1BA 1U5AA 3UMBA 3BD9A 1Q6YA 2FQYA 3PPXA 3B82A 1T6YA 1N7JA 4JDPA 1WL8A 4KIWA 2IZZA 2KSQA 1JHQA 4K9DA 4FZ5A 3JSAA 1U0HC 3R3JA 5CDGA 1LFDB 1JU4A 2XVYA 4UEKA 5LZ7A 3ZR4B 1JEYA 1RJFA 2ECPA 2W9XA 1U7XA 3ITKA 1Q7RA 3HBAA 4IQ8A 3VNSA 3KV3O 5TT1A 4Z9BA 2C1EA 3LPLA 3QE0A 4LMRA 2X7XA 1AKRA 5ENZA 2H0AA 3ML1A 4QODA 1T29A 1YHYA 5FL3A 3QHAA 4JJ8A 2E55A 2CNWD 3S55A 4PLPA 1EXNA 3HJFA 4G81A 2NYAA 3RSFA 4G1FA 5I5EA 4O4LF 4LDAA 3UJ7A 3RVQA 4Q24A 4KXWA 2VJPA 3QU5A 2I87A 5ICGA 3DMTC 2CC2A 4KPUA 2FMXA 1GVNB 2G0TA 2MYTA 3MXOA 1RYBA 3GJXC 5CD1A 1UXJA 4Z49A 4DRXA 4JC4A 3EX7C 1IZ9A 4IDHA 3GUYA 3WL6A 1A76A 3EXIB 4EI9A 1WE2A 4ZCPA 4A82A 1YA8A 1EFTA 2I29A 1OAOA 4KNWA 5CGQB 1XPOA 3QBDA 1OFVA 3GEGA 4ZO4A 5LBUA 4QQKA 1YK1A 2OZKA 3N0VA 3IR7A 3P9CA 1QIHA 1TVEA 4OHZA 1SCUB 1Y89A 3EPRA 1RZRA 2WI8A 5CLHA 3W8EA 1QZUA 1M34B 4OHUA 4HQKA 3IKMB 2FHPA 4PHCA 4DWWA 4JBYA 1GIAA 2XUOA 5ESXA 2LCIA 4RA9B 2W6NA 1I4TD 1E3DA 3JALA 5EZ6B 2PR7A 1N2EA 4PW0A 3SE0A 1WSDA 2NAPA 3GUVA 1C8KA 2ZYWX 3RS3A 2DUMA 2HX1A 1E4YA 1H2FA 2QOEA 5HJEA 5JY6A 1CQPA 4LNUA 1H42A 1CUIA 4ZYTA 3VC2A 3W4JA 3WDMA 4LZAA 3KZNA 3HK2A 4NICA 4KJXA 1VDZA 4RU1A 3ZY2A 1BCRA 3U31A 3AHFA 3M0EA 1X0XA 1MT0A 3D6TB 3KWLA 721PA 4GL2A 3IQIX 5BWLA 3PFGA 2ZSHA 4LSZA 3OOEA 1R9MA 1A5ZA 2EWWA 2C2KA 2DWPA 2YXBA 1XA3A 1R8YA 3BIFA 5K9ZA 2BW0A 2VZ0A 1LBIA 4R7TA 4LKRA 3ERCA 1CUSA 1OIVA 2GD1O 1U7PA 1WMBA 1ECJA 4OAQA 4QDJA 5H9VA 4CWAA 3IELA 5DBEX 3FNRA 3MHPA 4REOA 2GVDC 1Z74A 2R8OA 1N8SA 1S0UA 4B2LA 3L49A 1KVSA 3TSZA 4WIAA 4H3VA 4LPSA 1SQGA 1ID1A 1RWVA 1KK2A 2P3QA 4QDUA 4YEDA 3QA3E 1DBPA 1Z15A 2VJNA 1C3VA 2GXQA 3DMNA 4DYDA 4HFNA 3C7AA 4FB5A 5BN3B 2YHUA 3L46A 1T0JB 1JP7A 2BH2A 2F9MA 2WJ6A 3ZDCA 1SNYA 2R7KA 2RKOA 4U6QA 4NJEA 1Y3DE 5EXTA 1L4YA 4EKDA 1UBTS 2B61A 2OHXA 3KUDA 5JAQA 1AQNA 5LWQA 1RWXA 3RYIA 4EQ6A 2WB2A 2AUTA 5JAIA 1WU8A 3D8BA 3S8YA 2HM7A 3LA8A 2HYDA 1J09A 1XCGB 4AURA 2HF7A 1P9RA 1ZM7A 3F4LA 1G17A 4O5OA 5J63A 1B2LA 4HX5A 4WAUA 4EHBA 5CDTA 3TFQA 5JJKA 1AUOA 4YRTA 3NM5A 2FWBA 2XMZA 1C3LA 1A9ZA 3N8DA 4DMMA 2V9ZA 2ABWA 2R8EA 2AWOA 3MW8A 3N2YA 3H6KA 3UHJA 2B5OA 3AEQA 4OXQA 4HFMA 3SQDA 1VM6A 5AHKA 1D8TA 3A4LA 4ZOCA 2JFXA 5BWMA 2ICAA 1MJHA 3RREA 1MDBA 5CH8A 3UJ6A 4H7IA 2J59A 5DTEA 2PMEA 4AJ9A 1C7RA 5INTA 3DEYX 4INAA 4I5FA 3S68A 1N0HA 3GT4A 4YDRA 1KQOA 5CH5A 1EUCB 1AF4A 3DFZA 3KSMA 3DMRA 3K09A 4G5QA 1HLDA 1KFEB 4PG7A 4PLTA 4CNQA 4DDWA 1KWKA 4QM7A 3UMRA 4PZCA 4TN5A 4F0JA 1FW6A 4TS4A 3FF4A 4CT5A 2KQUA 3A2LA 5B2FA 4GM0A 2SICE 3GDWA 2VH5R 1NJ1A 2DT5A 2WUDA 2BUBA 1COWD 4MKHA 2NUAB 3TLMA 1FNMA 2PZBA 2POCA 2UVPA 2CLFB 1EVLA 1YDGA 3D0QA 3M82A 3NFRA 4M89A 1GPH1 4ND5A 4TMFA 3L7NA 3AVYA 2WF5A 3AZOA 3QMPA 4KLNA 2ZJZA 3AVXA 5EJ4A 5KQGA 5AW0A 3QLTA 1V11A 1PLJA 3LLUA 1TM3E 2EHDA 3U61B 1J9EA 1JQKA 2O0JA 3KDSE 1JZSA 4HNAB 5AOCA 1UJ4A 1WHSB 1PEYA 3H16A 3OAAD 4PFKA 5EUBA 4DHWA 1EWVA 4HX9A 4CKEA 1UPXA 3W7BA 4MV9A 5D3MB 1U3TA 3CPHA 2CLOB 4QPNA 4UNSA 4UU8A 4BPRA 1PL7A 2R86A 5DN9A 4NOJA 4A92A 2C96A 1DO8A 1RABA 4ASUD 3QH4A 2XIJA 1H05A 1CEXA 5A4DA 1FSGA 2UUPA 4HQFA 2YKGA 2ZTVA 1OOEA 5CRIA 1JEQA 3TR5A 2ATEA 1YD7A 3RRZA 3W9SA 4RPCA 1CY1A 1I7PA 1R9GA 3OOJA 4JUFA 4KVGA 1A77A 4MGHA 4X1KA 1VKHA 1XPRA 3C5CA 1ONOA 4JN6B 4H3HB 4BYMA 1YR9A 2Y8EA 4YO7A 3TOVA 4LYFA 5TGZA 3KHKA 4UVGA 4CEIB 4JI0B 5JY1A 3OQMA 4EYQA 2WIAA 1A88A 1GR1A 4QOHA 3IXMA 3RC3A 3E03A 2I1WA 4GRIA 1MX1A 4G65A 3WIUA 3MMZA 5JI2E 4C1NA 5ESDA 2FSUA 2X4IA 3A70A 1P2UA 3AXSA 3I6ZA 4JLNA 3OQIB 4UOZA 3FUVA 2OBXA 1CETA 2NW6A 1C80A 3TL2A 1RXWA 5GIOE 3LP6A 3U5TA 4IFTA 4QSHA 1I4OA 2PX2A 1QIIA 1XLUA 4MIOA 3A9UA 5KVCA 3UV7A 1GZHB 1J2RA 4D6YA 3KVRA 4E51A 2CBXA 5CURA 3QOXA 3U3ZA 4IWNA 1Q17A 2SBTA 4GXNA 1LV8A 3VSDA 3OCUA 4CM5A 5DXAA 5JCPA 4NU0A 2IHBA 1ISJA 4RETA 3SKXA 4K87A 4FC7A 1TVMA 2JG3A 3ET4A 3CUYA 3H9UA 3OUTA 1GSHA 1RBQA 3G9ZA 1Q0QA 5KMGA 3EJ6A 4EKEA 3HRHA 2B4AA 4LHWA 1MH1A 3E1GA 3NHKA 3E9QA 4I4TA 4ILEA 5IBQA 4UTVA 2PYIA 2R65A 1JEOA 1NI5A 4TS1A 2JLUA 2FP4B 4B73A 1AUPA 2IYVA 3VTFA 3IQEA 3C6MA 4LHEA 2C7PA 1JKFA 1NM5A 1L4BA 1NPDA 2EX1A 3ZE6A 3QQPA 3NDPA 5ARCA 4NBSA 3TW8B 3ITEA 2MJLA 3VTAA 1P45A 3SEFA 3GEIA 4PNPA 1M33A 5J1SB 4RQBA 1NBME 1TCUA 2IQIA 4XRRA 4U63A 2OWEA 4FFVA 1TB4A 1SVUA 1P74A 3L43A 4OREX 4RESA 2QBYA 4H08A 1Q3KA 1V96A 1AQJA 3K1TA 1KO4A 3FWZA 3L1JA 4FBMA 3SR4A 4DL9A 2YDYA 4V24A 1Y82A 2ZYRA 4DXAA 3HDHA 4FOLA 3BH7A 3KUXA 4ASUA 3H1AA 3G5AA 1YCGA 5DGHA 1U5CA 2QD2A 1SXIA 3BWEA 3L8EA 1G8GA 3M2PA 5F2EA 5TEWA 4UAJA 4PG8A 1JA1A 4E5KA 4X7PA 3FPGA 3DE4X 4PHHA 2UXDB 1K8YB 1M7BA 1N7GA 2NZJA 3F73A 3K2EA 1QF7A 4E21A 4AJKA 1RC8A 2D13A 3IYLW 4C29A 4DOMA 1ZRNA 5BY2A 3AKZA 2EP7A 2YW9A 1N6PA 4H4CA 4ZK6A 4URZR 1UBCA 5HUJA 3IOEA 2J6HA 2FWNA 2F1IA 2XDQB 1EVQA 2ZSAA 4OMFG 3DWIA 1EEHA 4Y30A 4FW8A 1T13A 3GMSA 4PIVA 1BXKA 3LK6A 3OY2A 1MOSA 1NC3A 3EXIA 3D8HA 1H2HA 2YZ2A 3BEDA 1XCLA 2HQBA 1OH8A 1ZNZA 2ONZA 1CD5A 1M2EA 2FFHA 4DV7B 1PNRA 3EVAA 2ADMA 4DZTA 2OBLA 3U19A 3D5EA 3MWFA 4QOJA 1MJGA 2YJ4A 4D9EA 2P4QA 1E20A 1USWA 1XZHA 2VG8A 5KU7A 3MLAA 4F9TA 2GDZA 2DERA 2TMDA 3PI6A 4Q4LA 2YWDA 4QQRA 1P91A 1U7UA 2V6IA 1P18A 3G2NA 4I1VA 3BJMA 3PLNA 5EOVA 4ZAGA 4BWFB 4Q9AA 4A2QA 3M6IA 3NIBA 1GPMA 1HDRA 4BMCA 4ALLA 4CKYA 5LUAA 1AXEA 1PWEA 3T34A 4BLQA 3UH1A 2CY0A 4RMGA 1Y3CE 3HKCB 5ENDA 4EGSA 3GJ5A 1GSAA 3AVTA 4FYHA 2F3PA 4RH0A 2H5IA 4J0CA 3GI1A 4I1UA 4Q21A 5FBVB 4AY2A 1KDPA 4YONB 3PKZA 4F6LA 1A0OA 3G0HA 1U0BB 2IHJA 1HDXA 5FPYA 4OJNA 3L3BA 4RSMA 4FDLA 2CV0A 3I6MA 1UBEA 3ZWPA 1VL2A 4GEKA 3T8YA 1FFDA 2EFEB 3CRZA 4JB0A 4GPTA 2CDAA 4AUKA 1L8LA 3DDSA 2PH7A 4NS4A 1FTGA 1RXEA 3MSCA 3WB9A 3JQFA 3ZZTA 4CPDA 4NCBA 1K98A 2GF2A 2X9NA 3FPSA 4BO9A 3JQAA 4QPZA 4D0NA 1ZAYA 2ZIGA 4H6XA 4PHTA 1V5FA 1WPXA 2GGSA 3FLMA 4LOIA 5BOVA 3VQTA 4AVYA 5BNZA 3EVBA 2IDZA 2Q3DA 2XBLA 2NVOA 4X8LA 4D0LB 4AICA 1WXDA 3HKEB 2C5AA 3G1WA 3F9CA 3T38A 4RHUA 2XCLA 2IY9A 2O2GA 2WAMA 1A4IA 3WG9A 1QLWA 3OZIA 3SSAA 4B85A 4CL0A 3M9WA 2NT3A 1GLVA 5A6VA 4S1TA 1LWNA 1M6WA 1U0GA 4B43A 3W2GA 2IEDA 3KLPX 4MIEA 4OAOA 4E2YA 10MHA 2IVFA 4U02A 2RHMA 4BNWA 1X80A 1CG6A 3DMYA 2OM2A 1P4SA 4DCVA 2F4VB 5AKKA 4J0GA 3FPJA 3I04A 1C9JA 5DHSA 5TSDA 3QW4B 5B6JA 3QE9Y 1TU4A 1W29A 4UASA 3SGLA 2RONA 3NH9A 3B1ZA 3T9CA 1GSOA 1XRPA 2ECFA 2OFPA 2WTMA 3CRW1 3OM0A 5IFLA 4GOND 3IKTA 1JSCA 2WFZA 1XTKA 2E6UX 5A0VA 1EH5A 1SXHA 3HB1A 1HH4A 3OT1A 4BLPA 2DWQA 1Q16A 2R84A 1G8YA 1E2JA 3EPPA 4ZALA 4YWHA 3KXKA 2NGRA 4RA9A 4BKPA 3JAWB 1MNQA