1DFHA

X-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfhA00
5JDIA 1U4SA 1Y5MA 4XYEA 3GN1A 4FCCA 4P4GA 5A3JA 1DIHA 1LXCA 3ZU5A 4MVJH 4CUJA 4OH1A 1G0OA 2W98A 2O48X 4GLOA 2X0RA 5C7OO 2JFFA 2PLAA 3BMCA 3GPIA 4TVBA 2DT5A 5A06A 3RQSA 1LC3A 1B0AA 3D5QA 4AJLA 4BNUA 1JKJA 2X86A 1PGNA 3GVCA 4ID9A 5EIOA 4BNNA 4WE3A 4WLEA 2PKQP 1LSSA 2WE8A 3IP1A 3O8QB 3ZWBA 1UAGA 4Q3BA 1CQIA 1EE9A 1V3TA 4RZIA 4XQ9A 1C0KA 2C5AA 4J16A 1Y8RB 1ZSYA 2VWGA 1XLTA 2AQIA 2CFCA 1FXSA 3QWIA 3BTUA 4IJWA 4FGSA 3CINA 4A26A 4J7CA 1DBVO 2UYYA 4K26A 3I9OA 4OMUA 4L4XA 2XXJA 3NDIA 4HUJA 3S2IA 3ROPA 3CIFA 5DCUA 4RPKA 4BGUA 3HJAA 1PX0A 1E3LA 4XRGA 2VN8A 1BVRA 1RPNA 4TQGA 3RD5A 3RCBA 4XQEA 3GN2A 4BNYA 1I01A 4ALIA 1LLCA 1AE1A 3AUUA 3TZKA 2CD9A 2NLOA 3NT5A 1BXKA 1MXHA 2PZMA 4KTTE 5T8KC 2GN4A 3ANLA 3NDRA 2D5AA 4J2HA 4LRTB 4OQYA 3I6IA 2EEZA 1M66A 2JD1A 2NU9A 5CPFA 1LBEA 4AG3A 3VDRA 2CUKA 4FBGA 1EUZA 3W4IA 3CKYA 1HYHA 3OEYA 4R41A 5KVVA 4RLHA 1AUPA 3TZHA 3JQBA 2O3RA 2F00A 1PJTA 3GY0A 5KVCA 1X1TA 2YV3A 1EEHA 1ZCJA 4J91A 3L4BA 3TWOA 2VWHA 4LMPA 4TRJA 2VYVA 4LRSB 5K6AA 4PLPA 1WW8A 3PHIA 3V1YA 3DAFA 1X1EA 3IP3A 4IS3A 4JNKA 1PS9A 3ZV3A 2I76A 2RH8A 1M6WA 4FOOA 4DQXA 4E5YA 1WLYA 2TMDA 2HAEA 1A27A 3RKUA 4ZQEA 3BMOB 3PHGA 1R4MB 1RM5A 3GNQA 4WECA 1PJQA 3E1KA 1EQUA 1T2AA 1ZK2A 3KLMX 4CQLA 5CDGA 2EG9A 3LC1O 3PHHA 3ZZNA 4B7CA 4Y67A 2Y99A 3D7LA 4CMEC 2E6UX 1QG6A 1QORA 3OQBA 4BMNA 2RHCA 4EDFA 4ZGWA 4XQCA 1NASA 3ROMA 2GPTA 2ZJ0A 3HB5X 1A7AA 5IDWA 3VAZA 2VHZA 2DPGA 3ROQA 1UDBA 4YAIA 3G0OA 3GGOA 2X0NA 3PTZA 1R0SA 3WYCA 4GSLA 1UDAA 1XR3A 4BQPA 1WMAA 3H4VA 3HG7A 2QRLA 4XRRA 3E18A 3ONEA 1KEWA 4E5NA 4FOSA 5HM8A 5AXAA 3RBVA 3PQEA 2FR8A 4MVJG 4BO8A 2DUWA 3I4FA 3DO5A 1DJNA 3PQDA 3RSHA 2EW8A 1P1HA 2O3QA 3QVSA 4GSKA 3VH1A 1P0FA 2R2GA 3WBFA 3ZWMA 2ZCUA 5HS6A 4YT2A 3E9QA 1XEAA 4NBUA 5EINA 2VYND 1GU7A 3PWKA 1WDKA 3IQDB 1E92A 4I5EA 4NFHA 4MVJE 3RASA 2PGJA 1R4NA 3WQQA 4CMIA 4UUMA 1OAAA 1TVEA 5TC4A 2O3UA 2D8AA 4FFLA 2NVUB 2Q99A 3PIIA 4GVLA 1XKQA 2WMDA 4BQRA 4PVDA 1LRLA 5KWEA 1HKUA 1OZAA 1T1SA 2C5EA 3PVZA 2QRJA 5KVQA 3GH3A 3U0BA 4O59O 2BFAA 1BHSA 4Z3KA 1UXHA 1NHGA 4IBOA 4HFJA 3QJ5A 3JD2A 1WPQA 3MEQA 4NBVA 1OC2A 1Y7TA 1GPDG 4BGIA 4JIGA 3HZZA 3KVOA 1IUKA 1X13A 2HKIA 1LQTA 3ITKA 5T64A 1T4BA 4P8RA 3TZQA 3JYLA 2WJPA 1VL6A 3NV9A 4ALKA 4BO7A 2OO5A 3PK0A 1DC3A 5EL0A 2EWMA 3WG9A 2C29D 5AYVA 4B79A 4BNXA 1GZ4A 3NAQA 2IODA 1R4MA 4U6SA 1XYGA 2YFHA 3T7CA 2RAFA 4E13A 4WOKA 4XX0A 2B4RO 3OJ0A 1JA9A 2HJRA 3I9LA 4PLTA 2HMVA 3NX4A 4Q3EA 3O8QA 1SAYA 2DBRA 4D45A 1UXJA 2FHSA 1MFPA 3PXXA 4AFNA 1GQYA 2BGKA 1Z6ZA 2X58A 4JP3A 1CRWG 3STHA 1LA2A 4YJDA 3W4JA 5IDYA 4J2OA 3WQSB 3QWHA 3B1KA 5KJEA 4IMRA 1A71A 3GDGA 4IGFA 1DIBA 1O89A 3VHRA 2EV9A 2NACA 2I6TA 1Y9EA 1A72A 3WJAA 2AG5A 1H5QA 3E5MA 1ISGA 3JYQA 4PZCA 1C0IA 1HWYA 3H5NA 1U1IA 5A1TA 3OA0A 5GZ6A 2VNSA 3K73O 3HNPA 4QO8A 3ZCXA 1ONPA 2W2LD 3CH6A 2NVBA 2P91A 5I7FA 5DOVA 3AFNA 3RC9A 3BHMA 1EDZA 1PJBA 5ILOA 4B8WA 4R51A 5JY6A 2VYVD 4R1UA 4YJHB 3L4BC 2VHXA 4WLUA 5JAQA 3IJPA 3QVWA 2Y67A 5IFLA 4IZHA 4CL8A 3NTRA 1F14A 4AVYA 2JJYA 1XGKA 3ZWNA 1NXQA 1ML3A 4LK3A 1CERA 2Y1EA 1OFGA 4CMJA 4WCDA 1K6IA 4J1SA 2X22A 3Q1LA 2O2YA 3DMTA 3GQVA 2X9VA 4FJ2A 4NH4A 1MUUA 2BI7A 3SC6A 1DLIA 1F12A 5DT9A 1PL6A 4BNVA 3QWBA 5A9TA 2YY7A 2PD3A 3I3OA 1PEDA 3AY7A 4INAA 2RHRA 1Q7CA 1JVSA 5F3RA 4NK4A 4D41A 3INTA 1PJCA 2JAPA 1LQUA 1HDCA 3GRPA 3I9MA 4WPGA 4ALJA 4XR9A 2O3TA 4C4OA 5CDTA 1WDLA 2X0IA 4R4JA 2V7PA 2OUIA 4NBWA 2CVQA 3H6KA 1F8GA 2P5UA 3KSZO 5COAA 5BNTA 3VZSA 1I10A 3ZV5A 1TA4A 3PWSA 1C3VA 5BQFA 1Z7EA 1EBUA 4FB5A 5T5QA 4K6FA 4XGIA 1ZK4A 3WSWA 5DOZA 4CLHA 1YO6A 1B15A 3QW2A 3AI3A 3ENKA 3UN1A 9LDTA 3WICA 1ZXBA 1K5HA 2EF1A 3GT0A 3HFSA 3L6DA 2CDCA 2PR2A 3CUKA 3MJVA 4TZTA 3AOEA 3WGYA 4YVFA 1GYQA 1LSJA 3LT1A 4QO7A 1VJ0A 3U3XA 2CDBA 3L77A 4NFYA 3V8BA 1PR9A 4MKRA 3BYZA 4BS9A 3FNHA 4E3ZA 2NU7A 4M54A 3VPFA 4B4WA 1NX6A 2E4AA 4BB6A 4CJXA 4BMVA 1U2GA 3DBRA 4WK6A 1ZUD1 4L73A 2CMDA 1YXMA 3DBLA 4DLLA 1NPTO 2BMAA 2WYVA 3TZCA 4EJMA 2B36A 3NT2A 4OJNA 5I7EA 2VUUA 4D3SA 1KERA 1NWHA 4RV9A 4BO5A 1E3IA 2VUSA 4NQZA 3WWZA 5TGDA 2X1HA 3L4SO 4D3FA 1CWUA 3JYNA 1KY5A 1A7KA 4ONEA 1V35A 2A35A 3UUWA 3K2EA 4LCJA 5AOVA 3VH3A 2CF5A 4XDYA 4GKVA 3I5MA 1DHRA 3EYWA 4ZQGA 4Y98A 4J0FA 3WNVA 1E3EA 2Y0CA 3GNSA 4PG6A 2VT3A 4D44A 1BXZA 1GV0A 3ZH2A 4RVSA 1T1RA 1PWXA 2Q50A 1NWCA 3KYCB 3PQFA 4J1QA 3I4CA 3L9XA 2GN9A 2HMWA 3I6QA 4DWVA 2Y1DA 1QYDA 3HUDA 3CE6A 1JQBA 2YHIB 1PZGA 4CV1A 4RQUA 3RUHA 3UAGA 2A4KA 4HFMA 2FWMX 1CIVA 5G0TA 3U49A 5JNLA 1P77A 1B3BA 4IXWA 1DAPA 5F5LA 1JTVA 3ETDA 4PCVA 3LLSA 1ENOA 4RVHA 5LDGA 1C1DA 1HYEA 3KSDO 4LGVA 4EYEA 1FF9A 1IZ9A 4K28A 1YVEI 3JQ6A 1U8FO 1HXHA 3JYPA 1V9LA 3FNFA 1YBAA 1R4NB 2Q4BA 3FBTA 4YJHA 3ZNQA 5CEEA 5HA5A 1Z7BA 4J6FA 2X7HA 3K30A 3FWZA 2J3HA 2EP5A 1VKOA 2JHGA 3JQCA 1BW9B 3RKRA 4XDZA 3WSVA 1ISJA 5CEFA 4KOAA 1ARZA 4B8ZA 3R1IA 3C7CB 4BB5A 2GNAA 3VZPA 1A4IA 4OOEA 1PQWA 2CZCA 2YW9A 1W6UA 4F6CA 4TKMA 4M8SA 2OP1A 2BD0A 2HUNA 4BV9A 3RU9A 4E30A 2BHLA 1P1KA 4GX0A 5IXSA 1UZLA 2AA3A 1GQ2A 3QVOA 1ZJZA 3KYCA 4IS2A 1NPDA 3H9EO 1LDYA 2JCYA 5EJ2A 3CXRA 4BNZA 4J4TA 1DO8A 1VI2A 3VH2A 1DLJA 4J0EA 5IXYA 5L4LA 1UJMA 4GPD1 1UXGA 1NAIA 3LT4A 3BMCB 3JYOA 2JHFA 4A03A 2IRWA 4ND1A 4ND3A 4BNHA 2VRCD 3LU1A 3UXYA 5CG1A 3KETA 4OIMA 1IPEA 1UP7A 5FFFA 1P9LA 5I8WA 2VTDA 5JFOA 3JSAA 3Q6IA 3VKVA 4AJHA 4Y6PA 3RROA 3ANNA 5HRUA 1IL0A 5J23A 2SCUA 2GGSA 3TDKA 4Q39A 1ADGA 1K6JA 3TL3A 1NR7A 3M1LA 4NG5A 2NM0A 4HXYA 3JQFA 1PWZA 3NGXA 1ZO8A 4MDHA 4CM4B 3RUAA 1D8AA 2CF6A 1Q1NA 1YONA 2IZZA 2J3IA 5IG2A 2H63A 3OP4A 2PTGA 2V6GA 5TJ9A 4YJFB 5CFZA 4I9NA 1NAHA 3LT2A 4EI2A 1ISHA 5F1PA 5JSFA 3VTZA 4YJGA 3TNLA 4ZQBA 4FD3A 3RUEA 1LDNA 1BG6A 3ZWPA 1IPFA 4FJ1A 3DFZA 1N7HA 1CF2O 1B8VA 5COBA 3SJ7A 4HWKA 4R1TA 5CHEA 3BMOA 5L7YA 3GZ4A 3B1JA 3OJEA 4Q3NA 1PS8A 4WLFA 3D3WB 7ADHA 5HTOA 5A9RA 5BSGA 4BO0A 4DTIA 5JBIA 5CDUA 2JKVA 1MB4A 1HE5A 4MOWA 2IEBA 4W6ZA 5C37A 1E6EA 1GADO 3E9MA 1UP4A 1KC1A 5L95A 1JU9A 3NKLA 1HT0A 1R37A 5H83A 3WB9A 1Z82A 5T8KA 2ZYGA 4A73A 2HRBA 4YQZA 4CV3A 1DSSG 3GHYA 4II3A 5JE8A 4HADA 2I3GA 5A9SA 3ZHXA 1NBOA 2HU2A 3WFIA 1U9JA 2YHIA 4NPCA 1EVJA 5DN9A 4HNHA 2JL1A 1Y6JA 4RL6A 1R16A 2Y0EA 4BNJA 3PHJA 1WP4A 4R1NA 2VQ3A 5THKA 3U4DA 1DHTA 4DBVO 1KS9A 1FDSA 3IIEA 4ZA2A 4XJSA 1W8DA 1NR1A 2B69A 2HJSA 3ZHBA 1SMKA 4UEOA 1XG5A 1H6AA 4A7PA 3ZV6A 3MJCA 5I9NA 4K9DA 4ZU3A 3PIDA 4LN1A 2B37A 4KDEA 3RAJA 5JCJA 1FJHA 3QE3A 3WDSA 3CZMA 2P9EA 1ONNA 4I5GA 3WS7A 1C1XA 4NJMB 1Q7GA 2PH5A 3WGTA 3BZUA 3P19A 3E8XA 3NRCA 1LI4A 3WYBA 1UXIA 3AU9A 3P5SA 4XQGA 1QR6A 3BTSA 4JQCA 2W8ZA 2GR9A 5K6AC 2YQ4A 5LC1A 1IULA 4WNIA 4BGEA 2IE0A 4QT0A 5EERA 3M6IA 5DBIA 3PYXA 3UHAA 2AQKA 4RDIA 3G1UA 3KTDA 3F46A 1VSVA 1WVGA 5JS6A 4MVJM 1I24A 2E48A 5DCWA 4B3HA 4DYDA 3GUYA 2PKQO 1VJTA 3ZU3A 2FSVA 5A05A 1CJCA 4U8GA 1ZK0A 2VYNA 2X8LA 1ZNQO 4IZIA 2G1UA 4Z0TA 2CY0A 2NWQA 4FIZA 4R54A 3DXFA 4E2WA 2EKQA 1E3JA 2DUUA 1NTOA 1HTBA 3S2EA 3QQPA 4DC1A 5HWSA 4NMHA 4J1TA 4GWKA 4QFDA 4G65A 3RI3A 4IQ8A 4CV0A 5TQVA 2QHXA 4M89A 4XGNA 4OQZA 2EJWA 1PL7A 5L7TA 3RUDA 4LSMA 4DIOA 6LDHA 3I9NA 4EJ0A 1SO8A 1M75A 1PGQA 1E5LA 1WZIA 4NDNE 3ETEA 3LK7A 3M2PA 1E3WB 1QV6A 2EW2A 1H94A 1C0PA 1UUFA 3OMLA 3JQAA 2HK8A 1HEUA 2FR1A 2PKRA 4MP6A 2VHYA 4A2CA 1I36A 1MC5A 2EGGA 3DZGA 4XGKA 4CM3A 3OIDA 1YDWA 4CUKA 3WIEA 3V2HA 2F1KA 2D59A 1GUYA 2FY8A 4HKTA 1H9BA 4EUEA 4MKZA 4IJVA 1BVUA 1NFFA 4CMKA 4E21A 3DDNA 2B4TO 5F1KA 3DL2A 4NR0A 4N7RA 2HMTA 3FR7A 2B4QA 3IKTA 2EERA 2GUGA 3OEWA 2OXIA 4IDGA 3R6DA 2J8ZA 3KO8A 4TZKA 3DBHB 3NUGA 2QZ9A 4EBFA 1E1NA 1UXKA 1R0LA 2HCTA 1ID1A 1PL8A 5JAMA 2QG4A 3DZKA 3EK2A 4YEDA 4YCAA 1ZVMA 1T4DA 3WGZA 3WX0A 2G82A 1RM0A 3K8ZA 1JLLA 2WM3A 3DR3A 4D3DA 4HV4A 3C1AA 1P0CA 4XYMA 1QMGA 3TN7A 2BFOA 5AVOA 1I33A 3GGPA 5T57A 5THQA 4O5OA 2D4AA 4ZRMA 5JMPA 3ASUA 1KVRA 4OO3A 3L0DA 4MVJD 2FOIA 4N5LA 3D4OA 4FFNA 4I9UA 1E3SA 3TSCA 2XOXA 4XA8A 1K3TA 1N2SA 1LSUA 3QVTA 3CTMA 3UCEA 2P68A 3FSRA 4UVGA 4IDBA 1ZKMA 5AXBA 1P3DA 1A4UA 3PRJA 4R69A 5COQA 5TS3A 1SCUA 4OXKA 4RPGA 3JQFC 3KLPX 5DP2A 1XHLA 5JLAA 2W2LA 4GX2A 4CM4A 3AOGA 4YPOA 1D3AA 4J3FA 4AJPA 1T26A 3C7DB 1C0LA 2X0JA 3L9WA 2EIHA 2QYTA 3JD3A 4IY1A 1YL7A 1AN9A 1UAYA 4J90A 4CR7A 5K9ZA 3FPLA 4BO2A 4CLRB 2AQHA 2HRZA 2XXBA 1NVTA 5HS4A 5K0ZA 3R3JA 1KY4A 2DBQA 3DTYA 5DBFA 2CSUA 1F0YA 1QV7A 2Z1NA 3E6AA 2NVUA 2E82A 4P4LA 2XAAA 4DREA 1MA0A 3SJUA 3UW3A 1QRRA 3GAZA 1DC6A 2LDXA 2DVMA 1ULSA 3ZU2A 2O4CA 1PZHA 2YQ5A 3C85A 2DLDA 1SBYA 1QP8A 1K2WA 1EDOA 3DBLB 4M1QA 3WXBA 4TVOA 5BT9A 3KZVA 4MVJA 2P4QA 5IF3A 4CMAA 4HNGA 1QKIA 3VOSA 4YB8A 2I65A 3ZI0A 4H15A 4UVEA 4NNJA 2X9GA 1B14A 1MP0A 1QXSA 3AY3A 4B4VA 3VPXA 3DFUA 1K6XA 2QW8A 4HY3A 4R68A 4WKGA 2EHDA 3K92A 1GCUA 5L51A 2WD7A 3E9NA 3P2OA 3HHPA 3Q2KA 4MP8A 4A27A 4CL3A 3G79A 1ZSNA 4YT4A 1D4FA 3IKVA 3SXPA 3ZV4A 5IZCC 4BL5A 3LVFO 3W8FA 3HN7A 5BSFA 3GZNB 3QHAA 4HBGA 5H82A 1ZH8A 3H8VA 4FR5A 2P5YA 3ZWWA 1BMDA 3DZIA 1NQTA 4PZDA 1M76A 1DEHA 1VC2A 2HDHA 5DCYA 1PS0A 1YH3A 1JW9B 3DOCA 1BXGA 1LDGA 2JFHA 4PGFA 3VC7A 2ZB3A 4JXKA 5JAIA 1JAYA 3D4NA 1WNTA 5G0WA 3KXDA 3JQ8A 3NJ4A 4IDEA 3IAHA 5CEJA 1KEPA 5B4TA 1I32A 4S1VA 1GL3A 3U09A 4HX5A 1Q2XA 1H6CA 2DM6A 4BHTA 3FN4A 5KCZA 2GZ2A 3GEMA 4WJZA 1S7CA 1ENPA 4FDAA 1MXFA 3KM0A 3MJEA 3EGOA 3KV3O 1IYZA 3IL2A 2HLPA 3IS3A 4JBGA 2D0IA 5MDHA 2UV8A 3TPCA 2YUTA 1GCOA 5B4UA 3WFJA 1DPGA 3VTFA 2ZYAA 3AM4A 2E49A 1U4OA 5I7VA 4WLVA 4BGVA 5IDXA 1M2WA 1EZ4A 3FF4A 1I8TA 3GG9A 4BV8A 5C7LO 3ZHZA 2IXAA 2CNBA 4WCFA 4TRMA 1YQXA 3EW7A 2AEFA 2G5CA 1EUCA 3IUPA 1GD1O 2O50A 2VUTA 4OHUA 1O8CA 1VL0A 1E77A 1W4ZA 2ZIZA 2Z1MA 4BOYA 1DFIA 1IY8A 1EVZA 3F1LA 2B83A 2QRKA 3MZ0A 3WGIA 4YRAA 4CPDA 4ZN6A 4QSMA 2QQ5A 1WWKA 5BNFA 2IEDA 4IPTA 3UOGA 3FTPA 1ZZEA 4QXMA 2OORA 1LRJA 5EESA 1ZMTA 2NTVA 4N5NA 1UH5A 2PH3A 2YV1A 1XQ1A 3NDJA 1LLUA 4RO0A 5G0VA 5TLSA 4GL4A 1YOVB 4CMHA 4F3YA 1P1FA 1X15A 3DB2A 4RJTA 3FI9A 4NJMA 4R9RA 3RJ9A 2BGMA 1HDGO 5JO0A 4PLHA 3IC5A 1SB9A 3RIHA 3E03A 1QLHA 3PLRA 5KIAA 3ZNOA 3JQ8B 3PDUA 4GBJA 4OL9A 5GMOA 1K0UA 3GDFA 1GPJA 1ENZA 2BELA 3OF2A 4OSPA 1Y5RA 2VRBA 2IDZA 6ADHA 3B70A 3V1UA 3VPGA 4DA9A 3Q11A 5JPIA 2FPPA 4PLCA 4KMSA 1SOVA 4W9NC 4PLFA 5JDIC 3KEQA 1HLPA 3W6ZA 3N7UA 2NNLD 3GPDG 1DB3A 3GF4A 4AJ2A 4DIFA 1WMBA 3O38A 2GN6A 2O2SA 2ZYDA 3R0IA 2P2SA 5G2OA 4XWYA 3WGHA 1GR0A 1XSEA 1TB4A 2QYSA 2J5QA 4FJ0A 2PZJA 4FQ8A 3L6EA 2LDBA 1ZEMA 2OBYA 5C7IO 2GO1A 1G0NA 4LSWA 4ND2A 4H7PA 1KBZA 4NIMA 1KETA 1XU7A 3AM5A 1R66A 1JDJA 2YDXA 1H93A 4ZRNA 1T2EA 4BO1A 1VE9A 1YWGO 4BMSA 3WLFA 2A94A 1NP3A 2VNAA 1GUZA 1NFRA 3PI7A 2EXXA 1NVGA 4J4HA 1LNQA 3T4EA 4A10A 2H5LA 1OMOA 5EPOA 2WTBA 1E7WA 4E2YA 4TMFA 5BSHA 1IB6A 3TF5A 2WE7A 5LDHA 2DTDA 4L76A 4GMGA 4RCVA 4B4UA 3ADPA 4CM9A 3VZQA 4UVHA 1FDUA 1TT7A 5AXDA 2VOJA 3D64A 2V6FA 5L4SA 3OQ6A 5ITWA 3TFOA 2QX7A 3G3EA 4WCFC 3RWBA 3MJSA 1GV1A 3OIGA 4BNWA 3AJRA 4MINA 3LF2A 2FR0A 3AW9A 1YDEA 1ONOA 3AUAA 3DMYA 3ZNPA 4E4YA 4M86A 4YYZA 2YJZA 1TT5A 4W7IA 3JQAD 1ZK3A 4B7XA 1R0KA 4Y9DA 1E1KA 2D1YA 1GY8A 5CP8A 4D0SA 1SEPA 3BMQA 3ZW9A 2Y93A 1UR5A 5G0UA 2O3JA 3KOUA 3SLGA 3RC2A 4ZD6A 3TRIA 3CMCO 2ZJ1A 3V2UA 3W1VA 4OKIA 3TOZA 3JV7A 3C1TA 4R5HA 3WJ7A 5A5EA 4LCEA 3S55A 4CQLB 5JDCA 3HDHA 3DTTA 3KB6A 1CQJA 4JX8A 5G4LA 3D0OA 3GLQA 3CZRA 2Y0DA 3DMTC 4YT5A 4BNKA 3KEOA 2YZ7A 3H9QA 4MIYA 2ZK7A 8ADHA 1NNUA 4OXNA 3EZYA 4D0RA 1SB8A 4WUVA 1N9GB 1LU9A 4J4BA 2DBZA 2UDPA 4Z9YA 4ZJUA 1I3KA 1NVMB 4I5FA 5JCXA 2NQ8A 2ZTUA 4CQMA 1I2CA 2ZQZA 1E7QA 1X0XA 3JD0A 3MJTA 3PGJA 4KQWA 4RVUA 3UGKA 1YOVA 1B8PA 1XIVA 2NTJA 4FN4A 4GWGA 3K2BA 5CDSA 5DBGA 3E5RA 3GVHA 4F6LA 5U4QA 5B37A 4JK3A 1F8FA 4BKUA 2C2YA 2VZ9A 3C24A 1HE4A 1H2BA 1YBVA 3COSA 4IGEA 4BNMA 3I23A 3A06A 3VPHA 2B5WA 3WTCA 5L9AA 3DHNA 4N18A 1NHWA 4KWIA 4EUHA 4CLRA 3WNQA 1O6ZA 4JROA 2GZ1A 4GGPA 3JQEA 1Z75A 4BKPA 4DQUA 3PYMA 4ALLA 1HDRA 4XKJA 4J9UE 5ICMA 4A0SA 3V2GA 4RDHA 3P2YA 4G81A 3RFXA 1FDTA 3WIDA 1ZJYA 2GD1O 4N54A 1U3VA 3D1LA 2R00A 1ZFNA 3LC2O 4ND5A 4K6CA 4UEKA 1Z45A 1RWBA 2Q3EA 1NQ5A 1GYPA 4AJ4A 3JQ9C 3DBHA 4HFNA 4G5HA 4YRDA 4Q3AA 3KYDA 1GQQA 4OYRA 1DOHA 4YXFA 3D3EA 4RPLA 1BRMA 1RKXA 1I0ZA 3JQGB 4UVDA 1H0KA 3JQGA 3OIFA 2YFQA 1HE2A 3HDJA 4O6VA 1JWAB 3F6YA 4PZEA 4MKXA 1BGVA 1FDVA 3FCOA 1KEVA 2Q1UA 1DJQA 3QWAA 1EUDA 1P45A 2Y66A 1XU9A 3OBBA 1ADFA 5FI3A 4PLYA 5TSDA 1TI7A 4JN6B 5H81A 4KUGA 1GYRA 2DTEA 3DWFA 3C8MA 3SVTA 2NQTA 5F21A 5A5FA 1G6KA 4BO4A 4KZPA 1CEQA 3D5TA 3WGOA 4DGSA 2O3SA 3UCXA 3SLKA 4JJGA 2ZTLA 4CUZA 3QVXA 3GG2A 2I9PA 2PZKA 3R3SA 4PLGA 2FN7A 5I8ZA 2Q1TA 1X7HA 1BWSA 5JO9A 1KVTA 2Z95A 3ZWAA 3S8MA 3UH1A 2QIOA 4MJLA 4F46A 4QECA 4BKQA 5IZ4A 4YAKA 5TF4A 4NK5A 1V3VA 5DULA 2GASA 1A5ZA 1BSVA 4GQAA 2C54A 1SC6A 4IM7A 5ER6A 5IJZA 3DZHA 1VRWA 5LCXA 2X23A 3GAFA 1U5AA 1D7OA 4GGOA 4JGBA 2V65A 2Q2WA 4PRLA 5KJCA 4E2XA 1T2FA 4WLOA 1GTMA 3IMFA 3JQ7A 1PSDA 3JQ7B 4FC6A 3OSUA 1DIAA 1P1JA 1A9ZA 1KVUA 4RZHA 2PGLA 4WASA 4DLBA 3ZDFA 4YRBA 4PG8A 1I3LA 3C7AA 5TX7A 5TT0A 3MWDB 1ENYA 3HE3A 4J9VA 2Q46A 1O94A 4KUEA 1YQGA 4RORA 4DC0A 1V3UA 2NTNA 3O9ZA 4J49A 3F4BA 5JYEA 1J49A 4DBZA 5JW6A 1T25A 4I1IA 4P22A 4YWJA 4FPXA 2B0JA 4ILKA 4PIVA 3B1FA 4Z3DA 1LJ8A 2A92A 1RJWA 2RIRA 3B6ZA 4YTEA 1HDOA 1U5CA 3PWZA 3BHJA 3OJLA 4RVFA 2BFPA 1PGOA 3PFFA 1UDCA 4OM8A 1TXGA 4EEZA 1ISIA 4YACA 1T24A 3K9QO 4JJIA 4BUCA 1DIGA 1M67A 2GZ3A 4UREA 4PLZA 1UZMA 4F45A 5ICSA 5JXWA 1EE2A 4Q9NA 1VL8A 1E6UA 4MVJI 1U2DA 5U9CA 3DOOA 5DZSA 5IDQA 3L07A 4GX5A 2A9FA 4RPHA 1JKFA 2PNFA 3F5SA 2NUAA 1ZIDA 4BO6A 5JYDA 4P38A 2I3AA 2FZEA 4YAGA 4D46A 1BTOA 2DPHA 2O23A 5KTKA 2GN8A 3JQDA 3UCFA 1E7RA 1U28A 1D1SA 4CMBA 1VM6A 2YHUA 4CV2A 1GZ6A 3WMXA 2FPIA 3UICA 2PA3A 3UKOA 1PJ2A 2NV6A 3IOYA 3LC7O 3KYBA 4RVDA 4JBHA 4L75A 1PTJA 1GDHA 1O9BA 1PZEA 2WYUA 4FW8A 4BVAA 2X6TA 3GMDA 1EK5A 2ZB7A 1YQDA 3RC1A 4K1LA 1B3RA 1PJ4A 3ZU4A 1Z74A 1ZK1A 4IIUA 4MVJP 4D79A 2OMEA 5A04A 4YBZA 4IQ0A 3TJRA 1MG5A 1SNYA 3JD1A 3K6JA 5I7SA 5KOIA 1QYWA 8LDHA 1SEVA 1ADCA 4GMFA 4R01A 1U3TA 3ZGYA 5JY1A 1LDEA 4LW8A 3X2EA 2W2KB 2PK3A 1AHHA 2GDZA 3I52A 4UUNA 1WAMA 1Q0LA 4IINA 3QY9A 3U9LA 4CMGA 4UAGA 5ITVA 4JJFA 4XJTA 4D42A 4CMCA 3H9UA 2AE1A 3ORFA 1DRUA 4QX6A 4AJOA 1I2ZA 3AI2A 1MLDA 3PLNA 4RQTA 2G76A 1XA0A 1LLQA 2ILTA 5L45A 4IDDA 4CM8B 4EITA 4WEOA 4CQMB 4CM5A 1ZEJA 1N5DA 1DDOA 1IE3A 4OGWA 4XEHA 4LVCA 3H5RA 2DFVA 1HZZA 1Q7BA 2DBVO 3MOGA 1PJLA 2PD4A 2DAPA 2H1SA 3ICCA 3FHLA 3GVPA 3ONDA 4L9RA 3A4VA 4BNGA 1NFQA 3SC4A 3UFXA 3WGGA 3Q3CA 1DRVA 4TRNA 2PGDA 1U7TA 2QZZA 4E2ZA 2HMUA 4NI5A 1F17A 1T2DA 2BKAA 2C7VA 1YB5A 2GLXA 3FTNA 2PY6A 2TMGA 4NFSA 3VZRA 2BFMA 4D7AA 2EP7A 1IHYA 4XIJA 4Q3CA 4EW6A 2Y1FA 1NQAO 2JCVA 1S6YA 3DZBA 2PZLA 2JFGA 3FBGA 4GX1A 1ORRA 3NT4A 4ESOA 2Q1SA 4B3JA 2JAHA 1PJSA 3FWNA 1QYXA 4UVIA 1V0JA 2PD6A 5A3VA 1DFHA 4IUYA 1MFZA 2B35A 3WBBA 4BO3A 3A1NA 4Q3DA 1MV8A 2FRDA 1EVIA 2X5OA 2YYYA 3EZLA 5DF1A 3NEPX 3PFWO 3ANMA 4JCOA 1UZNA 3K5PA 4FSHA 4U0JA 2RH4A 4KP7A 1GUFA 2X5KO 4DVJA 2Q45A 1FMCA 4H3VA 1E6WA 3HDQA 3N58A 4I9HA 4YJFA 1RM3A 2NU6A 4E31A 3DZJA 2OFPA 2O7QA 1Y1PA 3EMKA 3GRKA 3I9KA 4CR8A 3GNTA 3QP9A 1WXDA 3U4CA 4U5QA 4Y6SA 5JC1A 3SEFA 2C07A 4PVCA 4DMMA 2BH9A 2DC1A 1EMDA 2AEMA 3CSDA 1AXGA 3GZNA 1NQOA 4UUPA 3ROKA 4CM8A 3V1TC 5CDYA 1OI7A 3RUFA 4GVXA 3M2TA 2VZ0A 4J1NA 2NADA 3GEGA 4PLWA 4GLLA 3W4KA 2IYOA 4YR9A 3EDMA 4Y8VA 4BKRA 4GKBA 2WYWA 5G4KB 4ALMA 5TT1A 1BXGB 2O4UX 1YE3A 1Y81A 2C59A 2GF2A 3BAZA 5A03A 3PJEA 4TKLA 1TT5B 1Z73A 3SBOA 4XB2A 3QRWA 4L4RA 5IZCA 4ITUA 3U5TA 2WDZA 4JP2A 2VWQA 3ZN2A 3FNGA 2BRUA 4QQRA 4Z9XA 1Y9AA 3T7EA 4B4OA 1ZBQA 5KNLA 3BTVA 4MIEA 5JMWA 1E3WA 1UP6A 1N92A 3BA1A 4U0KA 4PN3A 3LT0A 1Q0QA 2HQ1A 4R5MA 2CDAA 3DZFA 2AMFA 1YRLA 3QA9A 3BXXA 2HMSA 4DPKA 1FK8A 2Y68A 4DQVA 5G0SA 4HP8A 3H9GA 1PGPA 3O03A 3A9WA 4XYGA 3SX2A 4W82A 1AGNA 1FDWA 1P74A 1R6DA 3FR8A 4O1MA 3S2GA 2ZB8A 3GC6A 3I83A 4J7XA 1E0DA 2AW5A 3H65A 3NTOA 1RYDA 2NSDA 3NYWA 4DIBA 1DIRA 3BMNB 2OP0A 4D43A 4RF5A 1N7GA 4Y6RA 4RLSA 4B3IA 5FYDA 3ZWXA 3TZ6A 1X7GA 1B2LA 4CLEA 3AI1A 4CM1A 2XPCA 4ND4A 2I66A 4BO9A 4PG7A 3OJFA 4YQYA 3L6OO 3HADA 2C0CA 1GEEA 2WD8A 4IJUA 1YB4A 5L4NA 4CODB 3LF1A 5BSEA 4WNCA 3A28A 5A02A 1BW9A 1LTHR 4IMPA 5TIIA 3DQPA 4E5KA 2Q4EA 5ENVA 1H9AA 1P33A 4DXHA 3E82A 5JDCC 1NPYA 1HE3A 3GGGA 4JLWA 2FPGA 2R00C 5ENDA 4PG4A 3W8EA 2AG8A 3VDQA 4YT8A 2EJVA 5DP1A 3ULKA 3I1JA 3X2FA 2IXBA 4Z0PA 3DAPA 1HSZA 4PLVA 1DXYA 3LSYA 2ZATA 3ZWCA 1NYTA 2OOSA 3PP8A 4J43A 4RF3A 5EQDA 1XQ6A 4MO2A 3AOEC 3T4XA 1X0VA 1HDXA 3QSGA 5HBRA 4AICA 4BNTA 3FRJA 3GHHA 1W73A 4XB1A 4IDCA 3W6UA 1JKIA 3F3SA 1ZXLA 1HLDA 2W2KA 2CVOA 3KUXA 1N8KA 3GMSA 4O63O 2C2XA 3PZRA 3NGLA 1OBFO 3VH4A 3F47A 3HQ4O 3TOXA 7MDHA 4E0BA 3AUSA 1PIWA 3PJDA 1O0SA 1PR3A 4CMIB 1BDMA 4EZBA 1YB1A 1TEHA 1E5QA 2FP4A 4U6QA 3Q9UA 4E12A 3O4RA 4I5DA 3ZNNA 2DQ4A 1R15A 3RFVA 4L74A 1EBFA 2X5JO 3HWRA 4ZQFA 1JN0A 2OZPA 3INRA 4FC7A 1V6AA 3HDYA 3PYLA 1OC4A 4YJGB 1NM5A 1O95A 3F9IA 5L40A 2Y1GA 1EVYA 1BDBA 2NVWA 2VWPA 4TWRA 4L4SA 3JCZA 3RBXA 3U4IA 2AE2A 1U3UA 1VJ1A 3TQHA 2J5RA 3GR6A 5TJHA 2Y1OA 5FEUA 1LLDA 5CG2A 1B7GO 5DDIP 1PQUA 3H5AA 3D3WA 3OA2A 4EJ6A 1HF3A 3P7MA 1JAXA 2GRAA 1J0XO 3D4PA 1AXEA 1KVSA 1P31A 5G4KA 2VHWA 4FFOA 3W8DA 2VOEA 2EGHA 4II2A 2PWZA 3H7AA 4KUHA 3HN2A 3ITDA 4RGBA 3B20A 5EMHA 4YAEA 5TNXA 1H6DA 1XWFA 1Y8RA 3UVEA 4CM7A 4DRYA 3DAGA 4ZICA 3VVCA 2P9CA 4CLXA 1RYEA 2C20A 4NBRA 3WLEA 3BMQB 3GDOA 1HZJA 3OHSX 5JC8A 3ASVA 3KBOA 4BIIA 2POQX 1IZ0A 2FZWA 1HSOA 4L8VA 4EEXA 1JWBB 3PJGA 3Q2IA 3E48A 4PG5A 4R3WA 3F4LA 5B1YA 1IOLA 1PQPA 1MGOA 3BMNA 3DOJA 5EN4A 1HDYA 2OBNA 1K89A 1KOLA 3GFGA 4KDFA 3QWFA 2X9NA 1H2HA 2UAGA 1F06A 3JQAB 3EY4A 4ALNA 1MC4A 5DNAA 2ZTMA 1DAOA 2Z5LA 3UF0A 2C7GA 4E5PA 1WDMA 3ICPA 5KJFA 3H9JA 1ZMOA 5GZ1A 3ONFA 3ADOA 1X7DA 4N5MA 3K31A 4P4NA 2AXQA 1KEUA 2VRCA 4GI2A 4NU5A 1LX6A 3N74A 2VT2A 1XDWA 2VZ8A 1L7DA 4FFPA 4EGFA 1YJQA 2BGLA 2I99A 4BNLA 5ILGA 1I5RA 4WOJA 3G49A 5ER9A 3TL2A 3GOHA 4YAJA 2HK7A 2OHXA 3EAGA 5EQFA 1EFKA 3PHLA 5JAZA 3DBVO 5L53A 1KYQA 5FWNA 3LDHA 2FSSA 5KKAA 5IN4A 3MTGA 3EVTA 5T6BA 1E1MA 4AL4A 2DKNA 2OL4A 5C5IA 2IYPA 4AJNA 3F1KA 3EHEA 3QLJA 3OICA 4FGWA 3OH8A 4IDAA 2AQ8A 4UUOA 1DC4A 4MVJF 3RUIA 4MP3A 4NJOA 1E1LA 1H6BA 3JQ9A 4IQGA 5U1PA 3IUSA 2IZ0A 3GVIA 3WYEA 4ZVVA 4FS3A 3GVXA 3MTJA 1V8BA 4RF4A 3TFQA 4EUFA 3GUCA 2RBEA 1TLTA 4DMLA 3GA0A 4W4TA 5AXCA 3MOIA 4XCVA 3U4HA 3VPSA 5L7WA 3H3FA 1QSGA 1JVBA 1YS4A 5A9SB 2FMUA 4RPJA 4NHEA 1CETA 1I3MA 1PGJA 1QYVA 1U8XX 4R16A 2VCYA 4TSKA 4XR4A 2CVZA 4H16A 4FFRA 4XIYA 4DPMA 1J6UA 2P9GA 1AHIA 4GH5A 1KVQA 1HETA 1ISFA 2P4HX 1VLLA 5CPBA 3G1TA 1LDBA 4ZQHA 1L1FA 1D1TA 3VKUA 1Y8QB 3GEDA 2Q49A 4OOFA 2D5CA 3WOHA 5JCJD 1LC0A 3AM3A 1ULUA 4XD2A 4Z6KA 3CEAA 3MWEB 1E7MA 3DHYA 3OQ1A 4PFJA 2RCYA 3ETGA 3RC7A 3LLVA 3WTBA 1MX3A 1DFGA 1I2BA 3OM9A 3PGXA 4M49A 5MGBA 1DC5A 1ADBA 3GK3A 4GAEA 3ZHYA 3OJOA 3HSKA 4NBTA 3GFBA 1P1IA 1SZJG 2AHRA 4C7JA 3NTQA 3A14A 3ZWYA 2R6JA 2G17A 3LYLA 1B26A 4O0LA 4A5OA 4E6PA 2BLLA 4FFMA 2I67A 4DUPA 1SOWA 4URFA 4B7UA 3AFMA 1HDZA 4RVGA 1N1GA 2UUPA 3Q9NA 1HL3A 5CAEA 1L7EA 4QEDA 4U7WA 1ISMA 4TRRA 1LEHA 3MJ4A 4WGGA 3RU7A 4CLOB 3DONA 3ENNA 1PJ3A 1E7YA 1E7SA 1W0CA 4DLAA 3PEFA 2DFDA 1A9YA 3OFSA 2WD7B 3WWYA 3AU8A 4AJEA 1YBMA 4OSOA 4W7HA 1HYGA 5TRTA 2GYYA 2JCXA 5IN5A 3EC7A 3AK4A 3INGA 4WLNA 2J3JA 4AJIA 1U3WA 3FNEA 4DYVA 3AUTA 3I9JA 4UULA 1VKNA 3PDJA 4G2NA 2O7SA 4KTVE 4E5MA 1T2CA 2H9IA 4J7UA 5GZ3A 3JTMA 3KHUA 4LVUA 4TROA 3WQRA 3QV1A 1OOEA 2E37A 4RF2A 1SPXA 3EVNA 2WSBA 3EUWA 1XCBA 5FI5A 2W90A 1Y8QA 5BR7A 5B12A 4M87A 1YGYA 3C1OA 4NZ9A 5GY7A 2GSDA 3RUCA 2DU8A 1QLJA 4X54A 1RM4A 3DC2A 4CR6A 2W4QA 2PV7A 1HRDA 4R1SA 5FF9A 4ZHSA 2B5VA 1YL5A 5F1OA 1LDMA 1B16A 4E33A 4LISA 5KJ1A 1YL6A 2Y1CA 4YDRA 2V6BA 4Z9FA 4AJJA 2OGUA 1YJ8A 4CLDA 4DL9A 3DHEA 3CPSA 3BHIA 1ZSVA 3DEYX 2HO5A 4R3NA 3S2FA 1YKFA 4DPLA 1XELA 3AY6A 1R12A 3O26A 1VPDA 3ZWOA 5AQ1A 4OKNA 1X14A 2DTXA 4QFCA 2BI8A 2GCGA 1GZ3A 5B4VA 3RBZA 2V6MA 3PZBA 2YDYA 3M1AA 2D3TA 3Q0EA 2I5PO 2EKLA 4E32A 2D2IA 2IZ1A 3H2SA 1O5IA 1CYDA 1C14A 1J4AA 2AEJA 2ZKLA 3KYDB 2WWRA 4R9SA 5IAAA 3U62A 1U7HA 1LSOA 4Z0HO 3BIOA 4CM6A 3S1LA 3IJRA 2VTEA 2Q1WA 4CLOA 1MG0A 3FD8A 5F5NA 3WGQA 1GFSA 1PU2A 1WZEA 4KQXA 1IHXA 1QYCA 4NU6A 2JD0A 4L0QA 1C1DB 1G1AA 4OAQA 4XYBA 4I08A 1VSUA 4BNIA 3JQBC 2VHVA 5I9LA 4CQMD 3H2ZA 1N9GA 3K96A 3H3JA 4OXYA 3NJ8A 4ROSA 2NU8A 1KC3A 2Q2QA 4QUKA 4WEQA 1GEGA 3WMWA 4AJKA 5BNIA 3IDSA 1CDOA 4MIOA 1ZW1A 2YV2A 1J5PA 3FPCA 3JD4A 3KRTA 2J3KA 2UUOA 2X4GA 4HFRA 1P44A 1C1XB 1PZFA 2H6EA 4PRKA 1EK6A 5L3ZA 2Y05A 2ZTVA 3ABIA 3DBRB 3OECA 1DRWA 3RVDA 1GAEO 1P1RA 3ZW8A 1I3NA 3LQFA 1LUAA 3BTOA 4IXTA 3C3XA 4JBIA 5ADHA 3RFTA 3ST7A 3PJFA 4UEJA 4BKOA 4IIVA 4BNFA 2C82A 4MPDA 2WEKA 2XF8A 4XZ3A 3PPIA 4XYLA 1B8UA 4W99A 1N1EA 4YA6A 2J5KA 5KJ6A 3OETA 3MCVA 2ZQYA 2J6IA 9LDBA 3V5NA 3QIVA 4S3MA 2PFGA 5KVSA 1Q0HA 1EFLA 2Q2VA 4I8XA 3ZWVA 1LRKA 5I9MA 4QTZA 4CM9D 3HFGA 3AWDA 2G0TA 3WR5A 5T67A 3VVBA 5A4DA 2JD2A 2EKPA 1KIFA 5C3MA 4KWHA 2BF7A 1M6HA 3RJ5A 2ZCVA 4M55A 3KSUA 1EQ2A 4C7KA 2GERA 3CMMA 3ON5A 4LMRA 4IDFA 4WCFB 2UVDA 5ES3A 1I30A 4CMEA 3F5QA 2ET6A 5KKCA 3HB4X 2ZB4A 3G17A 2HSDA 4W9NA 4IJKA 2HK9A 3LZ6A 4AJ1A
chains in the Genus database with same CATH superfamily
1I9GA 1Y5MA 5JYBA 1VE7A 1RPJA 4P4GA 3QEBZ 3CFYA 1ZGCA 1JHYA 4HB0A 4YHHB 3NHRA 3UOAB 4DG5A 5CB6A 1V1MA 2X0RA 4J0IA 4MPTA 3RVKA 5C7OO 3GRFA 3BMCA 3GPIA 5BY2A 5FWXA 3RQSA 2G07A 1BC5A 4RD4A 2DSNA 2YW2A 4NV1A 4MV9A 3OMXA 4AJLA 2X86A 3B3JA 3N75A 4Z7OB 1PGNA 3F0TA 4OB6A 4WE3A 4V0SA 4WLEA 4AWAA 1P9RA 2FPGB 1YR9A 2ZT8A 3O8QB 1UF9A 3VHXA 5IF9A 3K0FB 4Q3BA 4XUGB 5JSQA 3FTEA 1EE9A 4Q7QA 1V3TA 4RZIA 3ZX5A 4G0MA 4Q3KA 4XQ9A 1C0KA 1KKUA 3M49A 4QRDA 3ZGOA 1Y8RB 1PR4A 1ZSYA 3IQHX 1JR6A 3RJTA 1Q1ZA 2WKQA 3TIXB 4GSYA 1JQDA 5LL6P 1D1QA 4BV2A 3M6LA 1FXSA 1SUDA 4IJWA 1QYRA 3N05A 1RI4A 1J21A 5DWVA 1DBVO 2ZFUA 3CX4A 5LLSA 3M3HA 4GOOD 2CJYA 4OMUA 3S2IA 1DKQA 2H8KA 2WSYB 3ROPA 3UXEA 4FCTA 2QUJA 1AQYA 2IYEA 5DCUA 1XDBA 2F64A 3L4KA 3QXGA 1FUUA 2WUWE 1FIUA 2C42A 3AZPA 5K03A 3F6PA 1Y7HA 3JWIA 4TQGA 1OW3B 3AEQA 3RD5A 5D85A 2PX5A 3FB1A 1AOXA 4GZ5A 1LLCA 4ZFNA 4KNWA 3NT5A 5SZHB 4U63A 2PZMA 2ZR9A 3IQXA 3PNSA 4IH1A 1Q0SA 2JGNA 4J2HA 4LRTB 1RRFA 2D5AA 2E55A 4BBJA 5EJ4A 3I6IA 4PQFA 4P3NA 4AG3A 3NMUF 3ETJA 4MLCA 4RANA 4KHPB 1OX5A 1AKQA 4QDTA 5A71A 2C92A 3RRXA 3AF0A 4IX1A 3ROFA 3UMVA 1AUPA 3FSEA 5KVVA 5GOZA 2O3RA 3RFFA 3GY0A 1OZGA 1VLMA 3KQUA 2F43B 2DFTA 1ZCJA 2XKBA 3DO6A 2BEUA 3FMPB 3LUJA 4L8GA 4QREA 3TWOA 1BCRA 4LMPA 2PKXA 2WLSA 1U2QA 1TLFA 3G89A 2FMHA 1JP7A 2Z5FA 2PBRA 3PHIA 4QULA 4QXAA 3R3ZA 4HAUA 1WNFA 1U5BB 4JMPA 2QA5A 1XFAA 2PUVA 4IJ6A 4JNKA 4UW9A 1M6WA 3HJTA 4GWLA 5FBWB 2JGAA 2P5TB 4MUEA 1WLYA 5EKXA 2F3TA 1IVSA 3PQ4A 2HBYA 4X60A 1M2JA 4JB3A 4WFJA 4ZQEA 3VR5H 2YXLA 1JQAA 3BMOB 1CB0A 2XI4A 3EIXA 4QAQA 3Q85A 1M0SA 1H0RA 2HMYB 2W6CX 1OAOC 1C81A 3MUNA 1ZK2A 3ER6A 4XSVA 4CQLA 4LF8B 2JIZD 2JS7A 4R2JA 4P34A 2F1JA 4CF6A 4QYMA 4DSOA 3GP3A 3PNPA 3ZLJA 1AS0A 2QE7A 2YIJA 1W5TA 1RBYA 2CXQA 2Q5IA 4EDFA 2XHZA 2WHEA 3E2MA 2C9ZA 3EJWA 2GPTA 2D0OB 2MT9A 3HB5X 5ALWA 3A4LA 1TKAA 2QXUA 3NB0A 3ROQA 2QWXA 2QN9A 4OFXA 1W94A 5CB0A 3IYLW 1XC7A 1CK4A 2FKNA 5LQDA 2V0GA 1N8SA 4TTIA 4BQPA 4HNAB 1GOTA 3EVFA 3H4VA 2H1OA 3HCFA 3BMXA 1CC1S 4P2GA 5HM8A 4BE4A 5KKAA 2Q7XA 2BYTA 3BD7A 4F12A 5AXAA 1EWQA 1Y3CE 2LD4A 3V46A 4MVJG 5CIQA 2DUWA 3S7TA 3SQOA 5KSWB 4A2PA 3I4FA 1T1GA 3C3KA 1FLAA 3PQDA 3IV9A 3RSHA 3LQ1A 3ZWMA 2CWWA 3QVSA 3VH1A 1V3QE 3RYCB 3H2BA 2WSLA 4GLBA 4NENA 3L3BA 4INOA 3UJBA 2YTZA 4UE2A 1J9ZA 1HG0A 1S2IA 3FUVA 2PBFA 1GU7A 2PEYA 1WDKA 3UMCA 4C03A 5FO1A 4CMIA 3CLTD 4QBFA 4ATNA 1OAAA 5ULLA 1C3LA 4P1ZA 1NRJB 3OT1B 1R5NA 2Q99A 5D6OA 2XUJA 1VLJA 2HPAA 2WMDA 4KPGA 3VC1A 3IPRA 4PVDA 1E9FA 2HSGA 4YYEA 4LZZA 1BN6A 4OP1A 1Q15A 1A5TA 1UMBB 2C5EA 2P30A 2P3QA 3P45A 2D7DA 2QRJA 4NATA 3T7RA 3U0BA 5LQMA 4UHKA 2BFAA 2MSNA 2DWUA 3RIXA 2BKUA 1AIPA 1LI5A 2GXQA 3JPYA 4YH1A 1U6IA 1WPQA 2F9LA 3OOYA 4NBVA 3VNRA 4BGIA 5KTRA 5TS2A 1ZWLA 5DNEA 4UTZA 2RE8A 1S3IA 5K8IA 1IUKA 1MAAA 3ET4A 1LQTA 2VP9A 3N7TA 4RTOA 1MQ9A 2CNNA 5IMSA 3JPWA 2Q9CA 3LW8A 2VYQA 1W5AA 2FEPA 3L1JA 4TMZA 3PDIB 3NV9A 5ERYA 5CFLA 2H52A 4RAQA 1T6XA 2PBZA 4BTLA 2EWMA 2C29D 2D13A 1YZGA 3OG9A 1F2TA 4K3UA 1KY3A 1AD2A 4UUAA 1URPA 3H11B 3KG2A 3PV0A 5E38A 2H4YA 3IIMA 4JASB 5BYJA 1ADJA 2VT6A 3MRVA 3S1AB 3QE0A 3OJ0A 1DTWA 2GI4A 2ECPA 2IC5A 2V7VA 3IOBA 3MCAA 4Q3EA 2JATA 3BH7A 4XX1A 4HGRA 1SAYA 2ODWA 2IHBA 3DO8A 5LZ5A 2FHSA 2B7BA 1MFPA 3EXAA 3PXXA 3CNBA 3G2LA 3FSGA 2X58A 4FHFA 2JLWA 3TLGB 3STHA 3HPRA 1E1YA 3R3WA 4FCVA 3A6PC 3BGOS 1QOPB 4NTZA 3W4JA 4BAZA 5JWOA 2RGYA 3IVAA 2XA9A 1POWA 1Z4OA 1YQWA 3EUAA 4HNAA 1B8OA 2UYQA 3B1KA 3GCXA 5KJEA 1A71A 4IGFA 3MVEA 2SHKA 2UZ1B 3SXUA 1S1CA 3FYSA 1DIBA 4PYNA 5I7UA 3CT6A 3VHRA 2NACA 3WJAA 5KYYB 3CYFA 1AKTA 1KIMA 4HEA6 4DNOA 3JYQA 1DQPA 1HWYA 3H5NA 3I8XA 4ND8B 4UKDA 3RH0A 2ARKA 4OX9Y 1C7IA 2BM0A 4MQBA 3MAJA 5AM2A 3K73O 3HSSA 1GG5A 1IQ0A 2QMYA 4G1BA 1GLGA 5DOVA 3MGKA 3DEHA 1FJ2A 1PJBA 5ILOA 3BBLA 5D1HA 1NMXA 4B8WA 4F2PA 4KN9S 4AQYB 2B9EA 3NETA 4YJHB 2GAIA 4N03A 2CT8A 5DYNA 2JLBA 4UE3S 4WLUA 5BPHA 4ERXA 2V97A 4Y7DA 1YAHA 3NHAA 4YP6A 3LX6A 1ZQ9A 4NJEA 4D9CA 2AGVA 2CHEA 3KPJA 3OX3A 5LU8A 3ZWNA 3CN7A 4UU1A 1ZIXA 1G59A 1CUIA 4LK3A 2PT6A 4MI1A 2XB6A 4KAJA 1XRPA 4IXNA 3Q1LA 1RZUA 3DMTA 5J9FA 4OHYA 4UU8A 4J0HA 1EH5A 3T34A 2EATA 3F90A 3V55A 5LN1A 4ZIRB 1ZVQA 4NH4A 1CQIB 2YN0A 4HWSA 3UT6A 2HPHA 2JHAA 5G41A 5L6MB 2IS4A 3DAYA 3KYIB 4KXMA 1PL6A 3O4VA 1L7OA 3QWBA 4HVAA 4FZ3A 2V7QD 2NYUA 3H87A 2B34A 5TGTA 2PD3A 2Z2XA 3AY7A 4INAA 1ABBA 2VTBB 2RHRA 3FH0A 1R3UA 3HXKA 3GLGA 1RIFA 3SC2A 4NK4A 1QDEA 5JJBA 2IBTA 4TMKA 3INTA 2IU6A 2VNJA 3L40A 1PJCA 3K1JA 2P62A 1RBMA 5INTA 3GRPA 3BDIA 3HV0A 3KPWA 2ZUWA 4M88A 5JVDF 3PNLA 1X8LA 4Y30A 4K9KA 1QP0A 1CVRA 1WDLA 5HUHA 4R4JA 5CGQB 3UAYA 2B30A 2PT9A 4JBLA 5HCNA 3AEQB 2CVQA 1IZZA 3PFNA 3RRFA 3T06B 3LOQA 1NF3A 4MW1A 4PR0A 4NBKA 1I2AA 3K53A 5KYUB 2A7QA 1C3VA 4L72A 4QJIA 2IHNA 2XWQA 1DT5A 3PGLA 2ASVA 1SBZA 1YO6A 4H17A 3UN1A 4PANA 2EF1A 4YQFA 4X8LA 3K71B 2CLMB 3WGYA 4B35A 3P9YA 1IVYA 1F5NA 4QO7A 5DYYA 2X0DA 4RY8A 2CDBA 2JBHA 2D7CA 3L77A 4NFYA 3LCJA 3RG8A 3SDZA 2CLIB 4BLUA 2NNWB 2EX4A 4MKRA 4V0RA 3FNHA 1SXJA 2NU7A 3N8DA 3R0XA 1CTQA 4I1OA 4I55A 1XVVA 3VPFA 1ESNA 1ZMRA 3OPYB 3WLLA 2MSLA 4BFZA 3ONVA 3BGDA 5D87A 4BMVA 4CJXA 3FDJA 4L73A 2CMDA 3KD3A 1JQ5A 5BSMA 2F4NA 2CCGA 1SURA 1XO1A 1HR0B 1R6UA 1NYRA 1QZ3A 2CYBA 2P6UA 3KVNA 2I7TA 3ESQA 5IBCA 5AIBA 4F5EA 1RXIA 4N40A 1BMFD 1P4GA 4BO5A 4DJEC 2O8EA 1S2OA 4NQZA 2R9VA 5TGDA 2X1HA 4KQ9A 2RGCA 1U31A 3CCBA 2WSSD 3PKJA 4FEAA 4S1WA 1EAYA 1KY5A 3JYNA 2PVCA 4Q1EA 1X7XA 2YR0A 1P4SA 1SH7A 5AOVA 5LZ2A 3HO1A 3VH3A 1M1UA 2CF5A 3A3NA 1F2UB 4C08A 1OLSA 2IPXA 1SXQA 2QLBA 2CD7A 1EJ0A 2Y0CA 3GNSA 2V7GA 2CV2A 2Y8EA 4NX2A 2A3NA 4ZZIA 4FDTA 3RS3A 4AK9A 2GXAA 4M7RA 4MWGA 1RAHA 4RVSA 1CT9A 3OCVA 4LYHA 1QK3A 4E5VA 1NWCA 3KYCB 3PQFA 4J1QA 2WJWA 4MI3A 1Z2CA 3WGKA 1GAXA 5JH7A 1AUOA 1KQPA 1RRVA 1UXOA 3FMGA 3GD7A 4MA4A 5AW1A 2XV1A 1G2PA 3U7JA 1IOWA 1VZ2A 3HNOA 1C0EA 2CJWA 2XNKA 1ODKA 2J7KA 3E9CA 3KP1A 3FOZA 1FSGA 1K8ZB 2MU1A 2YHIB 4UMFA 2WU4A 5BW8A 1FS4A 3UAGA 2YS7A 2XY4A 4FZRA 5DB4A 2A4KA 4HFMA 4QHTA 1CIVA 5DLEA 5JNLA 3C4VA 1XMIA 4C3UA 1EDBA 2QTMA 2PSFA 4CNQA 2ZAMA 1JTVA 3NCTA 4XXHA 5LDGA 1HYEA 4GLFA 3KSDO 2W70A 3MCTA 3ZHQA 1MOQA 4F7DA 3CC8A 1IZ9A 4K28A 1KU6A 2IW3A 5EE3A 3I64A 3EX7C 2DR3A 1HXHA 1SD2A 1UK7A 3T15A 4UNPA 2OFOA 4OY3A 5HA5A 3FXAA 3CB4A 4J6FA 4M83A 3WKDA 1GKKA 3SVLA 3EOAI 3JQCA 2FSUA 1C9EA 1SCIA 1VKOA 3I9V1 3WSVA 1NUUA 5AKZA 1NI4B 821PA 1A9PA 1QVVA 4B8ZA 5DLPA 3VZPA 2ZM6B 4MUXA 1FJXA 1A4IA 1Y5NA 5ESWA 5A0VA 1WHTA 2F43A 3AFIA 5FOWA 3C3MA 4R1MA 1U8CB 1M1ZA 4M8SA 1M7BA 4L16A 1UOQA 3RU9A 1SC1A 5J4HA 3IX7A 4M1MA 1P1KA 4XFDA 2X7XA 2BE9A 4Z5XA 1GQ2A 3MHPA 4J29A 4ZRDA 2JI9A 2PSDA 4EB3A 3IQFA 1NPDA 1ULHA 5LM3A 2ZCJA 1TTTA 3CXRA 5FA6A 4J4TA 3M6VA 1VI2A 2HFKA 1DLJA 4I3HA 1Y6ZA 4J0EA 2HK6A 1R0ZA 1B6RA 4GPD1 3BEOA 3GJ6A 4ZOCA 2E9SA 1PT8A 4NSNA 3AIMA 4AROA 2K2WA 2YWXA 3AKEA 2JHFA 3QKWA 2KPOA 3R5KA 4W6QA 1EK1A 5C4GB 3FG9A 1L7XA 3TQCA 4A03A 5KYNA 4X41A 4YCDA 3ZQUA 4N1AA 4NYIQ 4BNHA 2CUNA 1N8NA 2VRCD 2OBLA 3NM4A 4G37A 4PBSA 5CG1A 4ISCA 3UC5A 1XZAA 1P9LA 5JFOA 1QO7A 2CJXA 3BM5A 3LS2A 4M8NE 1NVXQ 2FQQA 4Q7LA 3ANNA 5HRUA 4F5YA 4H7IA 4ZAZA 3RIMA 2GGSA 1L3CA 3RW9A 3TDKA 4YAUA 4OM7A 4R9VA 4BBZA 4RTMA 1NR7A 3SC2B 4NG5A 2NM0A 1R9NA 4ZQCB 3JQFA 4J94A 3NGXA 1CRQA 2RH9B 4ZI7B 1RPZA 1MJHA 4YP0A 2IZZA 3TCKA 1YONA 2BBOA 3H6GA 5JPCA 4EGQA 4F60A 5HOQA 2DQYA 1AV7A 5J2TA 1NAHA 2CXHA 3LDFA 4E6EA 4XDGA 5JSFA 1D2RA 3VTZA 2VK1A 3K0CC 4YJGA 3TNLA 5JAPA 2JHCA 1Z6XA 4PV7A 2X4LA 4GM0A 1PYGA 3OI7A 3CM0A 4KEAA 3DFZA 5EFZA 3QLUA 4HWKA 3GZ4A 1E96A 2JFXA 3B85A 4DMHA 3VX4A 1QQ5A 4O29A 4P4SB 3HKBB 3D3WB 4GI5A 4WLFA 1NM5C 1V7QA 4EHLA 1DUVG 5C8YB 4ILEA 4K46A 4RS3A 1N2CE 3L1UA 2YXNA 2ZB2A 3ZWKA 4TXMA 1UQUA 2BVNA 5CDUA 1BFKA 3DLPX 4X5OA 1ORIA 2JLQA 1KI3A 1RYNA 2IEBA 3K6RA 4KV9A 5GJVC 1E5TA 2MSWA 4K3VA 4K9OA 1KC1A 2WTNA 2JIRA 1GDDA 1JU9A 2X2EA 4ZGGA 4QVIA 3KQKA 1SRRA 1YRAA 3VSCA 1QF6A 4L8YA 1Z82A 1T2UA 5T8KA 3HFRA 3JZDA 3REQB 2HRBA 1VI6A 4YUZA 8GPBA 3QNUA 4NBSA 1QR2A 2HYDA 2W0SA 5JE8A 5HUJA 3OFND 4E5UA 4EF6A 1RWMA 4NPHA 1SU7A 2HU2A 2J6BA 1U9JA 3EODA 2E87A 1EVJA 3KK0A 3NIBA 4C6HA 1KTIA 4OB8A 1YK0A 3KJXA 1Y6JA 3K05A 1DE0A 1THZA 1Q92A 1U4NA 5FTMA 1SIUA 1USIA 4BZZA 4JEIA 4CG2A 1VE1A 1ZD4A 1HE8B 4K9LA 4QEZA 4RNCA 4G1EB 2QLNA 3BFVA 4HEQA 1BEEA 2R86A 5EUQB 4I46A 2OESA 5HFAA 4ZTBA 4ZT3A 1Q1AA 5LA6B 3JS5A 4XJSA 3E84A 4BX2A 1Z39A 3COPA 1TU3A 5FH9A 4B3GA 3IVGA 1L5KA 5LYJF 3RC3A 1D6MA 3ZHBA 2Z9CA 5CH3A 2PLFA 3PGKA 4XVUA 1H2FA 2RGRA 2ODAA 1U80A 1VOTA 3MJCA 3NHKA 4ZU3A 2XQFA 3AV3A 4LN1A 4RZQA 5DIZA 1N34B 2K6GA 3RAJA 1YZKA 3A1VA 4KDEA 4UBJA 4RWEA 4KR9A 1T4GA 2GWRA 3CZMA 5CLLA 4I5GA 3QYPA 1ZD9A 2OTCA 1KJNA 3TSWA 1NKVA 1Q7GA 2H4ZA 2IW1A 4O4JA 1Z29A 3BZUA 4OBEA 2G4LA 4RK4A 4MB2A 5EJEA 1UXIA 3AU9A 2HN9A 3E70C 4XQGA 3K0FA 1OYOA 4L57A 4CRWB 3U44B 2V1XA 2W8ZA 3DZDA 4D4IA 1G41A 3HWSA 1V1JA 4TL6A 1CUGA 2OGWA 1IXRC 1YNSA 1YKGA 1IN7A 3TCXB 1IULA 1Y33E 1SVUA 2IE0A 2JFPA 1N0IA 5DBIA 2BTEA 1E1QA 1QAQA 4EQ6A 5E8JA 2CHGA 3SFTA 1ZOLA 3CS3A 4B3SB 1OR8A 1VSVA 1MVOA 2GYVA 2OFWA 5JS6A 1OFIA 4O02B 3AEUB 2UZAA 1DKMA 4XSGA 4IHJA 2BJHA 2JJQA 1EGVB 3D6UA 2FSVA 3DOHA 3GD5A 4QGFA 1L5HA 1CJCA 1IRXA 2FWJA 1GG8A 4IAOA 4C06A 3JVUA 2VDQB 1ZK0A 2SKEA 5BR8B 4NY1A 4IZIA 2G1UA 3N3BC 3L7CA 3DXFA 5J3JA 4M76B 4I0WB 2C94A 3FLAA 3L7BA 1TEZA 2Q3JA 1GPAA 1N6HA 3GJ7A 2RGBA 1BYUA 4NMHA 5HIMA 1CUDA 4J1TA 1ZONA 4R9NA 1YQ9A 3RI3A 4M89A 4ENWA 2PX3A 1BS1A 2QRNA 2QYOA 2VPTA 1DTEA 1GVNB 3C8DA 3DG9A 3O1JC 3U7EB 5LBIA 1ULBA 2R8XA 4DIOA 3BS4A 3MUFA 3I9NA 4XI9A 1E0AA 1CQJB 1SO8A 1T6YA 4CFSA 1PGQA 1YDMA 2GHTA 1H9CA 1SVMA 1E5LA 1WZIA 2GJ9A 3HR7A 1CRZA 3AIKA 4TMXA 4EYKA 1WZUA 3BSWA 4CVNA 3ZIAD 3B3FA 3T9FA 1C0PA 1CZLA 2G88A 3EFBA 3KKLA 3ZIUA 3GEIA 2VF4X 5T4EA 5EHGA 2HK8A 2FR1A 5KTSA 4GZ6A 4M46A 2B20A 2PVSA 3ZDQA 1HFEL 3HR4A 3TEFA 3DZGA 1XMQB 4LE2A 4ZAGA 4CM3A 3OIDA 1YDWA 4J75A 4CUKA 2JIDA 1VPVA 3LVBA 1U9YA 2Z2JA 4BN5A 5IHXA 3I0NA 4G41A 4OVKA 3QLTA 1GU0A 5CGZA 4YDSA 1J06A 3SCZA 4EUEA 4DLPA 2ZI6A 4JXXA 1DAKA 4GUAA 4IJVA 3RO7A 4Y2PA 1NFFA 5DX0A 1AGYA 2XSZA 3ZDXB 1UMBA 4E21A 3BJRA 2P69A 4H3HB 5IVDA 1E1RA 4RY2A 4HAOA 3ROTA 1RBZA 1T3HA 3SKYA 3TLEA 3DL2A 2XMCA 1G3RA 1M2GA 2ZR0A 3PRYA 2R87A 2PRSA 5HIKA 5DM4A 3TLKA 3IKTA 1HO3A 2OXIA 5JTUA 1O8BA 4RHUA 4NP6A 4Q9KA 3VSEA 5I3CA 1VJCA 2DHDA 4M3NA 3ZK7A 3E7DA 2XNDD 2B6HA 3KO8A 2DQZA 3DBHB 4IWYA 2QZ9A 4J76A 4LQCA 4EBFA 1E1NA 1RRCA 1R0LA 2AR7A 4U3JA 1IN6A 1Q1QA 1OE0A 2QG4A 5BUCA 4EJ2A 1DBWA 2ZT5A 1T4DA 3C97A 4Q7KA 2ZSEA 4OREX 3EXFA 4FYJA 3PUXA 4KLCA 5AUPB 4D3DA 2VDWB 1E3MA 1RYBA 2R25B 4DA8A 1QMGA 5JZSA 5CM9C 2XMBA 4V2IA 5T57A 5THQA 5TMEA 5TPZA 1E59A 2CL0X 4O5OA 2A9OA 3U3ZA 3DHWC 4II7A 1TA0A 1XXHE 1GCIA 3TQRA 1XMPA 3B52X 4Y0NA 2EFYA 1WA5A 5BW4A 4YLYA 2FOIA 3N9IA 3D4OA 5DM70 3PITA 4G5QA 4NCIA 3EULA 2A0YA 3NXSA 1GXSB 4CIVA 2YWBA 3T12A 1YCHA 1MJGA 3Q3JB 3R2JA 3GRVA 1N2SA 3O9VA 3VUFA 2EF0A 3VU9A 2X41A 2YRFA 2VTVA 3CTMA 3UCEA 4D0GA 2JH8A 4FGKA 4DRZA 3GLIA 3O2SB 5ARBA 5FFNA 2J7PA 1P3DA 4BY9E 1E2BA 1HRKA 1A4UA 3TD6A 1TLLA 4FHZA 4ZV4A 3DNPA 1QVZA 1FU4A 4OXKA 3MBOA 1WIWA 3NHYA 5JLAA 3N6RA 1WVMA 2A9RA 3C3EA 3RRMA 4LI0A 5IVIA 1D3AA 3OBIA 4BTVA 2AX4A 4AJPA 3L9WA 3USES 1F1JA 3I53A 1MDFA 4YRNA 1SQ0A 5EKUA 3ZYZA 2F6RA 4OQQA 3P97A 4IY1A 5TXGA 3ONNA 2Y3IA 1UAYA 3FTDA 5C8DA 2BTQB 4ARZA 1V4BA 3K6KA 1NW4A 4CLRB 1Z33A 1H69A 2DGDA 2EBWA 4IIJA 4GOJA 2V7QA 3R5TA 4LRXA 4CDGA 3OU6A 4DDTA 5K0ZA 1X1RA 4Z9BA 2DBQA 5DBFA 4Q1DA 3ZDZB 1X86B 3CUYA 1OVGA 1L3BA 1L6IA 3NOVA 4TT3D 1QV7A 1W0KA 3QUQA 2NVUA 2WWXA 5HSGA 4P4LA 1H5UA 2PMEA 4F56A 2Z5VA 1MA0A 1HYQA 2BM8A 4MB6A 3DYVA 4X20B 1FC0A 2FR8C 3FYTA 4MW0A 3GAZA 4I1VA 5AWFC 3BWCA 2BP7A 1NE2A 2DVMA 1DAGA 4TQ9A 4UM9D 4JYZA 3FOBA 3ZU2A 2YQ5A 1AUXA 3TRKA 1WZNA 1KI6B 3WGUA 1SELA 3VR5D 5KX5A 1X1BA 1SBYA 1K2WA 1GXSA 5LZ4A 3RSFA 4UAUA 5E6SB 3DBLB 2FN8A 3GWGA 2XDQA 1KK1A 2FMFA 3EVAA 4BN4A 4WBNB 2V7XA 4WKPA 2PXAA 5IF3A 2OB1A 3TXXA 4DT1A 1QKIA 1OHHA 3VOSA 2WZCA 1RYFA 2QX4A 2M6RA 2I65A 4G9GA 1Z5ZA 3VJLA 3OZEA 5LP6A 1XTRA 5EC8A 2W2TA 4UVEA 4IOLA 4HCJA 4BBAA 2XWPA 1B14A 1G9XA 2ZULA 3UK2A 3W04A 5ABPA 3C7TA 5J4LA 2DUJA 1QC5B 2A86A 1RZ3A 2FPWA 3KWFA 4TLBA 2QIPA 5BW6B 1GCUA 2GN1A 5BXQC 1P5HA 5A2GA 4JHLA 2CGEA 2GAFA 2FAXA 5ALJA 3TLJA 5L51A 3DE4X 4WH0A 4URVR 3E9NA 3P2OA 4PX3A 4R2MA 4WZBE 3VDNB 3VZCA 3M0EA 3O8RA 3OEEA 1N6PA 4EMUA 2NAFA 1W7AA 3VZBA 1P7ZA 2WF6A 3IKVA 2REQA 3HBJA 4M1SA 4HQLA 4E2FA 4Z3OA 1JQJC 4QPCA 2IY8A 3ZV4A 1YBHA 4IQFA 3LVFO 1QMPA 4YMIA 3VNVA 3GZNB 4JA0A 2XMRA 1DELA 1I4DD 1CSEE 1JZTA 2FVYA 3H8VA 1NY5A 1RC0A 1OBCA 2J9RA 2LV8A 3SJZA 1RLTA 3FYUA 2EG5A 5JJCA 1R88A 2O07A 1UZUA 3R44A 2BSQA 1DEHA 4IF6A 2HDHA 3E61A 1OV6A 3G9UA 3NBAA 5DCYA 1FZQA 5IH3A 5JQGA 5JRZA 3VM6A 1HQKA 5EMKA 4JUDX 4NZYA 2IYXA 4PGFA 2TMKA 1TO6A 2O5VA 3PWTA 1RPAA 4BJ1A 1WEKA 4EYQA 3D4NA 3T1NA 1VPTA 2C58A 2XE7A 3KXDA 3NJ4A 4KE8A 2F7SA 3ZE7A 1YS7A 1KEPA 5BO5A 4X62B 5CCXA 3PTLA 2JZCA 4C7OB 1GL3A 1OXMA 1XZCA 3FNIA 2YJGA 3BB3A 3M1YA 1H6CA 2DM6A 2I22A 1H3FA 1ISRA 2GZ2A 5KCZA 4IRMA 4WJZA 4UOQA 1TYCA 5HF5A 5A6SA 1AU9A 1OH5A 5KNDH 1LLFA 2HB6A 1MXFA 2QTVB 3CUTA 3KV3O 4CT0A 2HNAA 3O84A 1IYZA 3E7WA 3MCWA 5KYVA 4IILA 4NV3A 1FTWA 1A9RA 2XNCA 4KH0A 2RCNA 1JEEA 3IS3A 5CLJA 1XOIA 1MB2A 4N7JA 5FPPA 3ZVRA 3MMSA 1U0FA 4JLBA 4D5GA 1TM1E 2OA0A 5HE8A 4FYHA 3KKEA 1A2OA 5HEKA 1UPCA 1UBGA 3K1AB 3SDSA 1VKRA 3R7BA 1LPAB 4EO7A 1BWQA 2VDVE 2XE6A 4P3YA 1JE1A 4PTZA 4BDSA 3LDGA 5FDFA 3D0QA 5IDXA 4P5EA 2NSYA 4OQDA 1EZ4A 5CTAA 1I8TA 3EXFB 3AO0B 3U1TA 5LFAA 3HGTA 2WY2D 2KB0A 1MABA 3ZHZA 1CCWA 2CNBA 4DLTA 1RAAA 4Y9SA 3ZCUA 1TZCA 2EDCA 3H5IA 2VUTA 5HCIA 2X8JB 5WRFA 4URHA 1VL0A 1E77A 3G2IA 4JOSA 2AFHB 1IY8A 3RHTA 4IJMA 4HXGA 3ZE9A 5CHYA 2BHSA 3CZQA 5FHRA 4ZN6A 2GXUA 3UBMA 4DM7A 1NBMA 2P41A 4C78A 4YREA 1WWKA 3OC0A 5BNFA 1JQKA 1JALA 5DO9A 5I5GA 4IPTA 3DBOB 4V03A 1PV4A 1FNCA 1OVMA 2CUTA 2KSQA 1ZZEA 2NQ2C 3FTPA 4LOKA 4QU9A 3ZI4A 3AHFA 4F3TA 3A6FA 5ICFA 1ZCBA 1UPTA 3HDGA 4F1JA 3DE1X 5G0VA 2VPQA 4CMHA 5LUBA 2AJTA 3K15A 2VNKA 1E2JA 3G5UA 1DWUA 4BQNA 2QUIA 3KPUA 5C8YA 5J5CA 1BEZA 4F3YA 3BBPA 4S04A 3OE1A 2ZVQX 4WZBA 3RJ9A 5BMVB 2AWOA 1RWXA 2BGMA 4JT4A 4BLPA 4RDXA 2CNWA 2F67A 2QAJA 3RARA 3FVVA 3PLRA 1P0QA 1LFDB 3AR6A 1RXEA 4H0CA 5JFGA 2FZCA 2TMYA 4JV5B 1K0UA 1M6EX 1ENZA 4MCAA 1Y5RA 3AR4A 4OGGA 1Z56C 3R5HA 1HTTA 1STOA 4OHBA 2GVZC 3Q11A 5DTRA 3USCS 1JHMA 4AO8A 3CKKA 4KMRA 1H3EA 3AR9A 2PMFA 6Q21A 1ZMBA 2PS9A 5HVNA 4PLFA 4YCLA 5BQ3A 4P33A 1HLPA 2Y1WA 2JFNA 3OFNA 3TTVA 2AF4C 3GLFE 3GF4A 1QZTA 3FZEA 4ZAFA 3R9XB 3O38A 2GN6A 2XUKA 5B64A 1SBTA 5A3QA 5HKAA 2P6NA 1NL3A 4WACA 2HOQA 5E4FA 3MRSA 4TKUB 3WGHA 4QT4A 4MQUA 2A33A 2AI1A 1GR0A 2R8ZA 2WOJA 4HDKA 5K8VA 1XZGA 1DKPA 4MEJA 4M36A 2J5QA 4C1NA 2ZE5A 2WJVA 3QENA 3UWOA 5JH7B 4TYWA 2FN9A 5GONB 1X1CA 4FQ8A 2JZNA 3LRXA 3Q8LA 1D4ZA 1Y9JA 2W2QA 3OM8A 2H0AA 1MQSA 2JFWA 2MR6A 4F1WA 4NIMA 1E79A 1XU7A 2AD1A 1GKUB 3EGDB 3NHPA 3DW3X 1ML4A 1R66A 4CN9A 3TSZA 3IPXA 4D0NA 3D8TA 1NSFA 1MZPA 4WVFA 4BO1A 2RGNC 2NSHA 1ZOIA 3WLFA 3T1VA 2GZAA 2VNAA 5LZ9A 3EE6A 1EINA 3L7OA 2EXXA 2VKQA 3THSA 1NVGA 2B92A 3ELYA 5J58A 4KPEC 2OCAA 3EGWA 1VHLA 3NANA 4DM3A 1CUVA 1AMOA 2IL1A 2AJCA 4LJ9A 5AK4A 2X8BA 4E51A 1IB6A 4LZOA 4TMWA 1U8EA 1GILA 1Q50A 5AM4A 1FMTA 5TQ2B 3AF3A 3MSCA 4G8BA 3DW1X 3NKVA 4IEFB 1ZPDA 3QF4B 1PF7E 4QDZA 5IJWA 3RF6A 1TT7A 2XMQA 4EHBA 1JEYB 2D1QA 5L4SA 1U8AA 1I9CA 2Q2OA 1C7ZA 2CNOA 1RVV1 4ZZ1A 3G3EA 5ITWA 5F4BA 5JXJA 3K1TA 5LZ8A 1XZLA 2GZRA 1JE0A 1JDBC 3MJSA 1OU0A 3AJEA 2BZSA 4HRVA 4JJEA 4MINA 1GTZA 4FKMA 4BNWA 3IEMA 3A2MA 3LK6A 1YB7A 4M60A 4EKGA 1ONOA 3ZNPA 4E4YA 2N1MA 1SBNE 4W7IA 4CKXA 4D9HA 2D1YA 5HQ3B 3NAGA 4RHXA 1SCAA 4I50A 2P8SA 1P80A 1SEPA 3BMQA 4BQIA 4D0SA 5JECA 5TEVA 3CWZA 3NZEA 3SLGA 3AEXA 4A15A 5GOTA 4ZD6A 2VL7A 2ZJ1A 2O2HA 5CVCA 4EP1A 5AW7A 3HCNA 3G02A 2NOAA 3RRBA 3WJ7A 5KYYA 1IY0A 4HDNA 1HMPA 4QFMA 4CQLB 1H8EA 1GT91 2PVPA 3HDHA 2EGUA 1XT6A 1CQJA 3KB6A 5IARA 4BJHB 3TD2A 4YT5A 3IQEA 2VK2A 2ZRNA 3HGMA 3LLUA 2YZ7A 3H9QA 4MIYA 3U4GA 1X74A 4OXNA 3V1NA 4M0FA 2X7JA 4WUVA 2AR9A 4O4IF 2PT5A 5IHPA 4U1RA 4LRWA 5B1DA 2BISA 2FI1A 5I7WA 2DBZA 4HDQB 4Z9YA 2QTTA 2H4JA 3EGXB 3IVCA 1JEJA 2XUOA 5K20A 1NVMB 2IITA 4I50F 1AMUA 1XNRB 2V98A 3QPDA 5KNCA 1DNPA 1TF5A 4OQFA 3GMTA 2PBLA 4P4SA 4PTLA 1CR6A 3I3SR 1C9DB 2ZQZA 3CEMA 1ODCA 4KQWA 5ALDA 4RVUA 4EGCB 5D6NA 4DKJA 4N5DA 4N4AA 1YOVA 1MB9A 2XNSA 4BXOB 2IV7A 4EFLA 2XGOA 3JVVA 1E2IA 4FDUA 1DC7A 1P5JA 2DCMA 2EFJA 2NTJA 3K2BA 3BILA 4GWGA 4XE5A 3E5RA 3N0TA 3GVHA 3OPQA 5U4QA 1V16A 2VZ9A 3ZZMA 3STWA 2EBFX 2AXPA 2WJYA 3AUXA 3CNEA 4V0KA 1H2BA 1BZYA 3U3MA 1AXRA 5FT9A 4AG5A 4DMRA 2HHHB 3A06A 4LNUA 2M6LA 1Z5PA 1EXWA 2XKAA 2W43A 4XCXA 2YKGA 4CLRA 4HDRB 3AUYA 2NTYC 4WHMA 1LY1A 4JROA 5BN5B 4DLKA 3MLEA 3U39A 4CE6A 5E2AA 2JCGA 4V38A 3KBBA 4GT1A 1FE8A 1KMHA 4XKJA 1WQ4A 4RVCA 2MCFA 2M6KA 5ICMA 2ERCA 4KO2S 2MYUA 2XMDA 3DE5X 3TDMA 1NUPA 1HX7A 1XD2A 4EVRA 1SXJC 2WSMA 4BEBA 3BRSA 4PQYA 2WFLA 2FPMA 3NVMB 4N54A 3B78A 3LUFA 1VP9A 3D1LA 4FI3F 1CY0A 4UEWA 4KR6A 4QA9A 3PQ5A 4MJXA 4Q16A 1J8YF 1ZU5A 4K6CA 3ZGNA 4B4KA 4BEJA 2ODPA 4HDOB 4YUYA 3HMKA 2I91A 2IP1A 2PH7A 1ZCZA 2QXYA 2MR5A 3K1AA 1NQ5A 1UFQA 3O1IC 2C2ZA 3JQ9C 5FR1A 4G26A 4GXTA 2WHXA 4TKVA 1XU4A 4YRDA 1IUPA 4X1YA 2UZ3A 4L22A 4UVDA 1H0KA 1OSNA 3JQGA 3W5VA 3HDJA 2IHZA 4WCVA 2I4RA 4PZEA 4CG0A 3BCHA 5LPNA 1L5SA 3SX4A 5B1EA 5IX8A 3WP0A 1KEVA 4YP7A 1C7QA 3SOZA 2Q1UA 1DJQA 4CIYA 1P61B 1Y3HA 2Y66A 2ZPAA 3BE8A 4LTMA 5CH5A 1ADFA 4JP1A 3U44A 1PO7A 2WWTA 1JX6A 4DQ0A 1VYTA 2ZAIA 5EPUA 3L7IA 3FPBA 4KUGA 4NOMA 2D62A 2FCAA 2Z58A 4IFEA 3COVA 4NCXA 4NNOA 1FYDA 1IUOA 3R3YA 5F21A 2HNKA 3AONB 2OK8A 1MNAA 3V4SA 4ZDJA 2ZAOA 5C1PA 3QFHA 4FDVA 4M2LA 1TM5E 4DGSA 1QF9A 3DP9A 1G20E 2O3SA 4DLXA 3EFEA 3ZVMA 4HYEA 4LYJA 4CUZA 2IIVA 1DBQA 1INLA 3R3SA 2WJHA 3LWBA 4UOEA 4QQFA 2VNIA 2W11A 1H05A 2FZVA 4UEQA 4BBPA 2FQYA 4ZVSA 4B71A 2I29A 1N5IA 4R6WA 5A3RA 1LS6A 3R7DA 3WK9A 4FB4A 4Z8XA 3RC8A 3VYTB 4RWZA 3HZHA 3ZHOA 3FMFA 4EJFA 3CV3A 4PONA 4MKGA 1CUEA 4NK5A 5A3SA 3W3AD 5DULA 3H0CA 2GASA 3IUMA 1A5ZA 1BSVA 4GQAA 3AXSA 4MRRA 4IM7A 3D7SA 1DGQA 3FRHA 1JLHA 3GLSA 2OCDA 2B4YA 2EP8A 1M2KA 2YV4A 4OKSA 4PRLA 4BQOA 3OFKA 1EUYA 1XCMA 2GBLC 4DHWA 2PSEA 2JLXA 4WLOA 5DSXA 2X1VA 3IMFA 4FFBB 4RK7A 3TSOA 1PSDA 4F5WA 3Q5EA 1KRXA 4PRZA 1QQBA 3PX3A 3VV3A 3ZHUA 4DNXA 3L8MA 2CNLA 3IAFA 5FL3A 3G8DA 5JISA 4JVOA 1ZC4A 3U31A 3MCUA 1P1JA 4ZXFA 2FLKA 4WASA 3ZDFA 4YRBA 5F64A 4PG8A 3R7FA 1YT5A 4MV0A 2W2PA 1ENYA 2HEGA 5AJUA 2Q46A 1O94A 5E7QA 3TR0A 1V3UA 1WF3A 3C15C 3O9ZA 4GLJA 4J49A 3TSYA 3QNMA 3NM5A 5JYEA 4LGMA 1J49A 1MH1A 4DBZA 3O94A 4IVPA 1MCZA 4P22A 3N53A 1AG9A 4PWYA 4RIFA 2PM8A 3X0DA 4FPXA 4ILKA 3AGPA 3ICOA 4YTEA 2I4LA 1RJWA 1KYTA 3K4PA 2C84A 1HDOA 1U5CA 1WSBA 1JBQA 3PWZA 4OHRA 4GECA 4R84A 3BHJA 3STYA 5BNWA 2BFPA 4HZUB 1T5LA 1KAQA 1K8YB 3PDWA 1JJIA 1TECE 1BU5A 4G8DA 1PHRA 3AP3A 4ZO9A 5BSKA 2XDAA 5KDOA 4BUCA 2GZ3A 3ENWA 4V24A 5JXWA 1UZMA 5ICSA 2VP0A 4HB4A 1EE2A 2QTNA 4P7KA 1U90A 1V8PA 1WX1A 4Q9NA 5L3SA 4AMBA 4QXQA 5IDQA 1NTRA 3D2AA 3IALA 1YV9A 1ODIA 2A9FA 1L1RA 2DLCX 1T5IA 4RFLA 5IK2A 4M37A 1MNQA 4BO6A 2XGGA 2GO7A 1PT5A 3RHZA 2PJRA 1L4UA 3KALA 3H2HA 1OA0A 4XIFA 4UTRA 1E7RA 3D7KA 5CM2Z 3UAVA 2PANA 3V1KA 1M0EA 1V9CA 2HNBA 4JY7A 2IHYA 3FETA 5JD5A 3UICA 2FMIA 2R65A 3MA0A 1JWLA 3LC7O 3DE0X 3NP7A 3QF7A 1QKJA 2ZM5A 3OFVA 4V0LA 3NW9A 3MW8A 2NPOA 1B23P 1PZEA 2X3UA 5DYIA 3O5AA 4PAGA 2TRSB 3FWYA 4UJ3A 1FFXA