1DFHA

X-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfhA00
2BH9A 2BGLA 4M87A 4TRNA 3GPIA 3AFMA 1JLLA 3R3SA 3ZWMA 2CVQA 4FR5A 4II2A 2DBZA 2YFQA 3GOHA 1EK6A 3PWKA 3S1LA 4BV9A 2H1SA 1C1DA 3PDJA 4FD3A 4BNHA 4B7XA 2X0NA 3GEDA 2I9PA 2NWQA 1VSUA 2AXQA 3RC7A 3MTJA 3OA0A 4XEHA 4OHUA 5DOZA 4M89A 3JV7A 3L4BA 2I67A 3FR7A 3BTSA 2FMUA 2OORA 3QVTA 3TF5A 3NTRA 3LZ6A 2BKAA 1O6ZA 3A28A 5L53A 3C3XA 1C0IA 4CM9A 1B2LA 4LW8A 5FI5A 4PLWA 2YDXA 3GNSA 1HLPA 2VT2A 3AK4A 3UKOA 4BKRA 1NQAO 1F8GA 2AQHA 4OXNA 3W6ZA 1GQ2A 2QHXA 3N7UA 3EK2A 1WP4A 1P31A 2XAAA 5L40A 2V6FA 3JQ9A 3RFTA 3C1AA 2P5YA 1Q7BA 4ALKA 4MIYA 1NFRA 3RUAA 1WW8A 4E4YA 4L0QA 4MKZA 3P2OA 2Q4EA 5L9AA 1IZ0A 1JVBA 3AM4A 4PG4A 2PGJA 4CUJA 2OP1A 1ZSVA 2D5AA 1HL3A 5F21A 3CZRA 3K2EA 2J5QA 3H2ZA 1LC3A 3OQ6A 2HSDA 4WCFA 1H94A 2X22A 3LF2A 4C4OA 2HO5A 3ENNA 2C5AA 1KEWA 4YAJA 2O2YA 5KVQA 3TZCA 3VZSA 4A0SA 4LCJA 1C0LA 4J6FA 5C37A 4ZGWA 3FF4A 1JQBA 1JKJA 2AEJA 4OOEA 3VC7A 4LRTB 2V7PA 5FEUA 3IKVA 3ZWBA 5T67A 1RM5A 1VM6A 5IN4A 5ENVA 1DC4A 4D42A 4BNZA 4B3JA 1JA9A 3RU7A 3RI3A 1QYXA 2Y0DA 3ROQA 3UXYA 1R4NB 1GZ4A 2JL1A 3NJ8A 1ENPA 4HV4A 1NPYA 4OMUA 4LSMA 1G1AA 3RBXA 3GUYA 1S6YA 3K5PA 1XU9A 4PRKA 2RIRA 2I76A 3FWZA 3HN2A 1A7KA 4OOFA 1HT0A 3EW7A 2J3HA 3ZHXA 5IG2A 3AI1A 4FB5A 3PJFA 4EJMA 3FHLA 4PRLA 2IYPA 3CINA 3KLMX 4HUJA 4LISA 4RCVA 3CE6A 5A5FA 2CFCA 1FF9A 1T24A 2ZB4A 2AQIA 4YQZA 3HDQA 4J4TA 4CM1A 4OIMA 3DAGA 2AQKA 3ZW9A 4MOWA 1DHTA 4QFCA 1AHHA 5C7IO 4OXKA 3OEYA 4BNVA 2C5EA 2VNSA 4ZHSA 4ND5A 1ZBQA 2CNBA 1PR9A 4YT2A 5JCJD 1LTHR 3WR5A 1ZKMA 1U8XX 3T4XA 4BVAA 3GNTA 4P4GA 4IJKA 5MGBA 3VZRA 2NNLD 4TRMA 3KLPX 1R15A 4CLXA 1CYDA 3FNEA 4HX5A 1I2BA 1VL6A 3GAZA 3WWYA 3GFBA 4EUFA 2FY8A 5GZ3A 3GN2A 1LI4A 1W4ZA 4LMPA 1LBEA 3GY0A 1B8PA 3GVHA 1XLTA 3SC4A 4AVYA 1YVEI 3HWRA 4DBVO 4WLVA 1BXGA 2W98A 3RQSA 3VAZA 3G49A 4KOAA 3KHUA 3V1UA 3TDKA 1C0KA 4ND1A 1V8BA 3JQFC 4XYBA 1I36A 3QWIA 4BO8A 5ITVA 4CMGA 1PS8A 1DFGA 3W6UA 1LDBA 1NASA 4BNJA 4ZQGA 1Y8QA 3UH1A 4FW8A 3X2EA 1MA0A 1FXSA 3L77A 2GDZA 1NPDA 3H65A 2B4TO 5A05A 4NJMA 3U4CA 1H6DA 2RHRA 4HFNA 7MDHA 2BI8A 2VHXA 5I7SA 4D44A 4KQXA 4XGNA 2VUSA 5B37A 5IZCA 4KP7A 3EVNA 1WZIA 5L4NA 1YBAA 1ZFNA 4D45A 5B4TA 2Z95A 3L0DA 3KYDA 2VUUA 1B0AA 5BSFA 3CTMA 4NJOA 1WMAA 1YDEA 5I7EA 1Z73A 1NQTA 4BGIA 1MC4A 1KVSA 3U49A 2DBQA 1B16A 1WDMA 3ZU4A 3TZ6A 4R16A 4BO4A 1FDSA 1CQIA 3OP4A 2G0TA 4U0JA 2VCYA 3NT4A 3PZRA 3WNVA 4CLRB 2ZB7A 4BQPA 1E7MA 2NM0A 4BV8A 2P2SA 2GZ1A 4W7HA 3FR8A 3HJAA 4TQGA 4XR4A 4R68A 4PLVA 1UH5A 2PTGA 3LSYA 4LN1A 5DF1A 1A71A 2VYND 2G17A 2QYSA 4FN4A 5HBRA 4AJNA 5DOVA 4HADA 3FNFA 2V6GA 1RYDA 4XGKA 1WVGA 5ER9A 4LSWA 3WS7A 2P9GA 1ZCJA 4YJHB 1ADGA 2X1HA 2Q50A 1NWHA 3ZN2A 1E1LA 1DJNA 4MP6A 4E3ZA 4R3NA 1DDOA 2Q46A 3EZLA 3QHAA 3H4VA 4L4XA 2NVWA 5KVSA 4I9NA 1JTVA 2F00A 3IC5A 1ZUD1 1LXCA 3QWHA 4O1MA 4R1SA 2HDHA 4Z0HO 5TSDA 2ZTUA 3M2TA 2E82A 1LC0A 2VOJA 3QA9A 2O7QA 4Z9XA 1KEUA 5BSGA 4CLDA 3DZFA 3L6OO 3LT4A 1H5QA 2DUWA 3OETA 1DB3A 3AM5A 4UAGA 1T1SA 1ZK2A 3AU8A 5C7LO 4CQMB 2E49A 2VZ9A 3RFXA 2YQ4A 3WYCA 3WXBA 5EPOA 3MOIA 1XQ6A 5JAMA 1LSUA 1SPXA 4CV2A 4UREA 3EYWA 3ROMA 4IGEA 5JLAA 1VI2A 4E6PA 1O89A 1EVYA 1Q7CA 4XQCA 4ALLA 2ZYDA 1ADFA 3GG2A 4E2WA 3W1VA 2AEFA 3ZGYA 2XXBA 3WGOA 5CDGA 1HE3A 3OH8A 3ZWPA 3B1JA 3V2GA 1LSJA 1A9ZA 3VH2A 2D0IA 1E7SA 4G2NA 3RKUA 1YBMA 4NR0A 4OKIA 1VSVA 2B5VA 4RPGA 1PJSA 2JFHA 4Q3BA 4XIYA 3VHRA 5IDWA 3PEFA 3WG9A 2VNAA 1GV1A 1R16A 1J5PA 2NUAA 1KVRA 3JQBC 4R51A 4UVHA 1RPNA 4IINA 5U4QA 4BL5A 1GUZA 1QP8A 2GSDA 3O8QB 4HWKA 1X0VA 2VQ3A 4FJ2A 3A06A 4PZDA 2O4CA 2FZEA 2O50A 2A9FA 3DO5A 4FIZA 4DTIA 3I9JA 3KUXA 3Q2KA 2D5CA 1EZ4A 3VTZA 1LNQA 2X4GA 4YXFA 1EE9A 4G81A 5H82A 4KMSA 3ZV6A 1ONPA 3FTNA 2QG4A 4OSPA 3WJ7A 3NYWA 4R9RA 3MWDB 2DC1A 4DREA 4GLOA 5TF4A 3GUCA 2ZCVA 4BO7A 4E2YA 1M75A 3GA0A 4DIBA 1RKXA 4IUYA 3ETDA 1MLDA 4CLOA 1X13A 2FP4A 3DWFA 1WDKA 3ONFA 2BRUA 4CMIB 4JGBA 5BQFA 4WLUA 1SAYA 2DVMA 1IYZA 3RD5A 4ESOA 1CQJA 2X0IA 3DBVO 1IUKA 1I10A 1LLDA 3OM9A 4J7UA 5DBGA 2PLAA 4JLWA 4YT4A 3GZ4A 4MVJM 3BMOB 3ITDA 1XSEA 3WOHA 2Y05A 4WECA 4DYVA 4E2ZA 1YS4A 2BGMA 3DXFA 4IDGA 1FK8A 1P1HA 3ADPA 3D3WA 2D4AA 4R5HA 5CEEA 5KVCA 3RKRA 4A5OA 3RUIA 5T8KA 3F4LA 3H3FA 3FN4A 3U3XA 3GR6A 5FWNA 3AJRA 4CUZA 4CMCA 2GPTA 2ZQYA 1V6AA 1WXDA 4RPHA 3PZBA 4PCVA 1TT7A 4CM4B 3I6QA 3I9KA 3NTQA 1V3VA 2CY0A 3HSKA 3JD0A 4JK3A 4DXHA 1BW9B 3PYLA 3HB5X 5TGDA 4YRBA 4IIUA 3GLQA 3PHIA 3ZU2A 4F6CA 1DC3A 2E37A 5ENDA 4ZRMA 3S2GA 3TPCA 4IBOA 4RVUA 3D4NA 2LDBA 4RGBA 3PRJA 1WNTA 3ZWNA 3M1LA 4CMEC 4DPMA 4RVGA 4X54A 3HNPA 3CEAA 1E3SA 3KV3O 1B14A 3ZWWA 4E12A 5CDYA 2ZK7A 4RLHA 2D2IA 2DTXA 5F5NA 3ITKA 5EMHA 2GN6A 4CMKA 4K1LA 4JP2A 5L95A 3DBLB 4R69A 1WZEA 1GPDG 2JHFA 4MVJA 1YKFA 2Y0EA 3L6EA 2YV3A 1LQUA 2Y0CA 3E48A 4NK5A 4BO6A 1V0JA 3DMTC 4MVJH 3NKLA 4BQRA 2EIHA 2VHVA 4RQUA 2IODA 5LC1A 2CDCA 2NTJA 3QVWA 1I5RA 1PJTA 3V1YA 2P4QA 3A1NA 3JQAA 3K6JA 3ZNOA 2Z1MA 4DC1A 4DQXA 2Q2WA 1NHWA 3F6YA 3H9GA 1EFLA 1M2WA 3DTYA 4FPXA 4ND2A 4EW6A 4A03A 2NADA 4HFJA 2IE0A 3MEQA 3Q6IA 5HWSA 4OQZA 2P9EA 3U09A 4CLHA 4MDHA 1N1EA 5JO9A 3WBBA 5A4DA 4M8SA 4XDYA 3VKUA 1HDCA 2O2SA 2GRAA 2XXJA 3AUUA 2ZTLA 3KEQA 3WGYA 1PZEA 1VJTA 1GV0A 3NTOA 3W8EA 1YL7A 5JXWA 3KVOA 3OQ1A 4ZQHA 1DFIA 1HE5A 3E9MA 1LJ8A 3PP8A 4B8WA 5G0UA 5EINA 1J6UA 4IQGA 4IQ8A 3PQEA 5G4KA 1UXIA 4EGFA 4EUHA 2HK9A 3GF4A 1PU2A 1TT5A 1P1JA 2PZJA 1T2FA 1E3EA 1XQ1A 4LGVA 3GDOA 1YOVA 3WIDA 4HNHA 1KY4A 1IE3A 5ILGA 4M55A 1DO8A 4XQGA 3LC2O 4F6LA 3UAGA 3WIEA 3A4VA 3JQ7B 4Q3DA 2YHIA 2OP0A 1P1RA 1PL8A 1TEHA 5CDTA 4ZU3A 5DP2A 5EIOA 4NU6A 1PJBA 1UXHA 2B5WA 3ZV4A 1S7CA 1I2ZA 4BMNA 2ZJ0A 3EHEA 3KYBA 3D5QA 4DLAA 1AGNA 4KTVE 2WD7A 1PL7A 1EVZA 3DHYA 3VOSA 3T7EA 4UVDA 3KBOA 3V2UA 4BKUA 1R4MA 3OSUA 3ZNQA 3KYCA 3BMNA 1G0OA 2AG8A 1N9GB 2HMSA 3CKYA 1RM0A 4AJIA 3UICA 5DBIA 1VL8A 4M1QA 3IJRA 1QV6A 4PLYA 3LT1A 5K9ZA 4B4UA 1HYGA 2RHCA 5ADHA 1N8KA 5A03A 3BXXA 1NPTO 1KVQA 3E9QA 3HQ4O 1SCUA 4HY3A 3BTVA 1GZ6A 2JCXA 3V5NA 4TMFA 2GO1A 4CM8A 1ZZEA 4CL8A 5C5IA 2D59A 3ZDFA 1U2GA 2OO5A 4IZHA 3RFVA 4WGGA 1HF3A 3VZQA 1F14A 2IYOA 4DC0A 4RF5A 4IDDA 3NDIA 4KUGA 1PWXA 3DAFA 4M49A 5DCYA 4CM6A 5T57A 3TOXA 1D1TA 4E13A 5LCXA 3LC7O 2FSVA 1O94A 4DPLA 4W9NC 3B6ZA 1JAXA 3GPDG 3N74A 3H9UA 1HETA 1LLUA 1VJ1A 1KIFA 5F1OA 1ZIDA 1BDMA 3F5SA 3H5AA 3N58A 4RF3A 1HLDA 1FDTA 1GTMA 1NXQA 1Y8RB 4FC7A 4BNNA 3IS3A 3NDRA 4ALIA 4I8XA 3LC1O 4CQLB 3TZHA 2RH8A 4B4WA 3BAZA 4IXWA 3JQ8A 4DIOA 1VRWA 4LK3A 4BO2A 3U5TA 3LLVA 5IZ4A 4CM9D 3DZGA 1TVEA 1Y5RA 2XOXA 2ZYGA 2H6EA 2YW9A 4J4HA 4EBFA 5T5QA 4DLLA 1BG6A 2NVBA 1DPGA 3W4JA 1K3TA 1V9LA 2P5UA 1RWBA 1VKOA 1I0ZA 4YJHA 1XU7A 1L1FA 4BGEA 1P74A 3QJ5A 4NNJA 2AMFA 1SO8A 2PK3A 4BNWA 1PR3A 4INAA 3DZHA 4AJ2A 1HE2A 4J16A 2YY7A 3BHJA 3D64A 1A9YA 5CEJA 2VYVA 4YT5A 4MVJG 2C7VA 3DAPA 2JD1A 3IL2A 2VWHA 2I65A 3INRA 3T7CA 1D8AA 2EJWA 4CQMA 1X7DA 4N54A 5I9NA 4N18A 2BFOA 2GCGA 3RUDA 1ONOA 4ALMA 1PGJA 2JAPA 1E77A 3TL3A 1U5CA 1U8FO 4P38A 3VPGA 1XCBA 2OFPA 1YB4A 1C14A 4F46A 4JJFA 2BFAA 3I1JA 4Y8VA 1SB8A 1EK5A 2BLLA 4GX5A 4BNYA 4RPLA 1XR3A 4UVEA 1N5DA 1UZLA 3RIHA 1ISIA 1P45A 4N5LA 2JFGA 2EWMA 3WFJA 5DBFA 3GFGA 5TJHA 3GVPA 5IDYA 1ISGA 5LDHA 3R1IA 1ZMOA 1H0KA 4NH4A 1T2EA 4KDFA 1PWZA 1Y5MA 1CERA 3DBHA 3PWSA 5B1YA 4PGFA 5ES3A 2CSUA 4W99A 4DYDA 3ST7A 1XHLA 3WSWA 2PZMA 4PZCA 1DIRA 1VPDA 3PDUA 4WKGA 3VTFA 5IAAA 2B37A 3NRCA 4NFSA 1T2AA 2G5CA 4GKVA 4YR9A 4ND3A 1JDJA 3JQFA 3M1AA 4MVJP 3RUFA 2X9NA 3HUDA 4YB8A 4IM7A 2O48X 4A7PA 3UCFA 4ZA2A 5JAZA 1HDXA 4DPKA 1Q7GA 1D4FA 2HCTA 2V65A 2V6BA 3Q0EA 1B8VA 1I30A 1Z45A 3E5RA 5DP1A 3RC2A 3M6IA 4J9VA 3PJEA 3PGJA 2NLOA 3FRJA 3G79A 4FOOA 4AJHA 1EEHA 2EW2A 1PJQA 1YQDA 2E6UX 5AVOA 4CV1A 1NYTA 2YFHA 4PG6A 4A27A 4P4LA 3OQBA 1QLJA 4TROA 3BZUA 5I9LA 1R12A 4GGPA 1QYWA 1U3TA 1GYQA 2B36A 1LRJA 2YZ7A 3JYOA 4Q3NA 4YJFB 4NBUA 3U0BA 3RC1A 4KWIA 4TSKA 1QYVA 3WB9A 3LYLA 4BKQA 4CMIA 4YAEA 3HG7A 3G1TA 5JCXA 1DIBA 1BMDA 1FMCA 1KERA 2UVDA 4J49A 3F47A 4G65A 4IXTA 2Q4BA 1PEDA 3QIVA 4J1SA 1OBFO 1Z7BA 5U9CA 3NUGA 4RPJA 5EQDA 3CH6A 1XA0A 3CXRA 1ISJA 5K6AA 2DT5A 3EAGA 4HKTA 4FGWA 2X58A 3VVCA 2O3JA 2RCYA 1MUUA 5DCUA 1E6EA 5TQVA 1PJ4A 3HFGA 3BMQA 2HJRA 3H5NA 1YQGA 3COSA 3FTPA 4WE3A 1QORA 3P2YA 2TMDA 2GZ3A 4IS2A 4JROA 3JQGA 2OHXA 3AM3A 3KM0A 2EKLA 5JYDA 3IKTA 1BXKA 1NFFA 5A9TA 1GADO 2X9VA 3I9LA 1WDLA 2P4HX 3B1KA 3PJDA 1PSDA 3CPSA 1JWBB 2NU9A 2W2LA 2QYTA 1WPQA 5T6BA 2Q1SA 4AICA 5L7TA 4WLEA 2X5JO 1BVUA 3WTBA 2X7HA 4O63O 4CR7A 3A9WA 3GRKA 1R37A 3V8BA 5DT9A 3AUSA 1BVRA 5KIAA 1PGPA 3QWBA 2C20A 4DLBA 1YWGO 3C1OA 3TOZA 4Q3EA 2VHZA 3TFOA 3QV1A 5U1PA 3KTDA 1JAYA 2J8ZA 3V2HA 4AJ4A 4YVFA 1E1KA 2QX7A 3GAFA 1U5AA 1M67A 4GH5A 5T64A 4KTTE 3GVXA 3B1FA 3RBVA 3I52A 5JDCC 2Z5LA 1H9AA 1QRRA 3WGQA 3GEGA 3EZYA 5CDUA 1W8DA 1VLLA 2GLXA 3GRPA 1ZW1A 2UUOA 2XF8A 5AXBA 2GN9A 4GQAA 3QWAA 4YJGA 3K73O 4UEJA 2X23A 3WYBA 3F5QA 3CUKA 2W2KA 3NGLA 2PWZA 4PG5A 4FJ1A 3IP1A 3F4BA 3QRWA 2NTNA 1PQPA 3B70A 2GD1O 3BMCB 3E03A 2J3JA 1E3WB 3JYQA 1HYHA 4JX8A 1X7HA 1DRUA 1RYEA 1UDCA 5EERA 1E7QA 3NEPX 1B26A 3NV9A 3S8MA 2CF6A 2YHUA 5AXAA 3WLFA 1IY8A 4RLSA 2D3TA 3PHGA 3AY6A 4FS3A 2BMAA 2HK7A 4YA6A 3WFIA 2OMEA 3L07A 1BGVA 1K6JA 3QE3A 1UDBA 4U6QA 4HBGA 1NVGA 4XKJA 1QKIA 1EUZA 3DBRB 2VWQA 3F1KA 4D41A 1E5QA 1O95A 1E3JA 2FWMX 2XPCA 5BSEA 4GL4A 3I4FA 5G2OA 3NAQA 4DQVA 3GNQA 4LVCA 5AXCA 4BMSA 4KUEA 2PKQO 1IOLA 1P77A 2AQ8A 4OKNA 4F3YA 3K92A 1PJLA 2GZ2A 1GQQA 5TRTA 2EGGA 4MINA 5KVVA 4EUEA 1H6CA 4MKRA 4L74A 2AG5A 5A3VA 1CWUA 5AXDA 2Y99A 1NR1A 3ABIA 4YQYA 2DFDA 3UGKA 3DQPA 5CPFA 2NVUA 1GU7A 1M6WA 2W90A 4WUVA 2BELA 2GGSA 3ZHBA 3VH4A 4BNKA 2UAGA 5ILOA 4OQYA 1DC5A 2FPGA 4GMGA 3I4CA 3NX4A 1DEHA 4ND4A 3OF2A 1I2CA 2DPHA 2YV1A 4E0BA 3INTA 5A3JA 2E4AA 4DUPA 5JPIA 1SEVA 3RUEA 2Q1WA 3BIOA 2J3KA 3Q11A 4I9HA 4CMAA 5A9SA 1YL6A 4PLFA 3L9XA 4AJPA 5TT1A 4TRRA 4YDRA 4BO9A 3G0OA 5JE8A 1N9GA 1P1IA 1X1EA 4EEZA 3RJ5A 4J43A 6ADHA 2FR0A 1E1NA 5DDIP 3SC6A 6LDHA 3GEMA 1U1IA 4L4SA 2O23A 3GHHA 4XYLA 4HFRA 1AHIA 3DEYX 4WOKA 1AXGA 1J49A 2AA3A 4Q3CA 3HDHA 3OFSA 2VRCD 2ZTVA 3JYLA 4RVSA 3OJ0A 3OJFA 4NZ9A 2Z1NA 3BTOA 4PLGA 5DULA 4OO3A 5JO0A 2O7SA 2QW8A 1EDZA 2X0RA 4JN6B 4DMMA 3WYEA 4TKLA 3ZHYA 3AOEC 5I7FA 4GX1A 1U3WA 4ZJUA 1DIAA 2PD6A 1SMKA 4Y98A 4CMEA 4J91A 4XYEA 2WEKA 5CG1A 1C1DB 4WLFA 2VHYA 3BHMA 4IGFA 1CDOA 3ZWYA 1YBVA 3O26A 3DR3A 4R54A 5GY7A 1A5ZA 4BB5A 5KNLA 1JWAB 3I23A 2BFPA 5BNIA 2Y1CA 1D7OA 4GX0A 3SXPA 1ZK4A 3FPCA 1MG0A 5B4UA 3HB4X 1R6DA 1M6HA 2B4RO 3GZNA 2GN8A 2JHGA 3PFFA 5JAIA 1E3IA 5AQ1A 1ZXBA 4IY1A 1Z75A 3DMTA 4CM3A 1Q0QA 3IJPA 1EQ2A 4CR8A 4PG8A 5KJ6A 5THQA 4G5HA 4PLHA 3M2PA 4PZEA 4JCOA 1KOLA 3AI3A 3SLGA 1ONNA 2DQ4A 4JJIA 3SJ7A 1SC6A 2Q99A 5G4LA 5DZSA 5L4SA 5TX7A 2EKQA 3DZKA 4O5OA 4AJLA 1UP4A 1GCOA 3U9LA 2WE8A 1ENOA 4FBGA 3VPSA 3MJ4A 3KOUA 4K6FA 3GMSA 4RL6A 3GGPA 4E5MA 1DFHA 1N1GA 2W8ZA 1ADCA 1WWKA 3ASVA 1N2SA 3BA1A 4WJZA 3RSHA 3MJVA 1SBYA 4UUPA 4YAKA 2GF2A 2NSDA 1K6IA 1EUDA 5HA5A 1QXSA 3FWNA 4BGUA 4URFA 1QSGA 1OFGA 2EW8A 3DMYA 3WQRA 1UXJA 4MVJD 4BNIA 5GMOA 5FI3A 4DRYA 1CJCA 3DC2A 1Y7TA 3H3JA 4BGVA 1B7GO 3SVTA 2AW5A 1DAPA 2CDAA 2DTDA 1ZK0A 1MC5A 3GN1A 3QW2A 3S55A 3OIFA 3TJRA 3TFQA 4TZTA 4D46A 4J90A 1P33A 4W6ZA 4EJ0A 1BTOA 1GYPA 2OUIA 1OI7A 4QEDA 1E6WA 1Y9AA 1GYRA 3ROPA 3PIDA 3I6IA 4WEQA 2HMVA 5COQA 4TZKA 3T4EA 3WWZA 2Q2QA 2VWPA 3KETA 2WJPA 4JQCA 2AE2A 4CJXA 2JJYA 4D3FA 1RJWA 1YGYA 1YQXA 1H6AA 1KBZA 3H8VA 4PLTA 4II3A 5COAA 1ZEJA 2C7GA 4J7CA 1E7WA 4UEKA 2EP7A 1JW9B 4NK4A 2DAPA 4WPGA 3WJAA 3MWEB 3VPFA 4YT8A 2IDZA 4EZBA 1KY5A 4OGWA 1QLHA 3P19A 4HXYA 4YBZA 4QXMA 4EITA 1PJCA 1T4BA 3OIGA 4JIGA 2VZ0A 5F1PA 5IF3A 3WMWA 1I3NA 2VZ8A 4IS3A 2BFMA 4XDZA 1NM5A 3PTZA 1SEPA 2RH4A 3CMCO 4GKBA 3F3SA 3QVSA 5L7WA 2I66A 2OBNA 1KS9A 3IAHA 2AHRA 3OEWA 4OYRA 2C2XA 4LCEA 4EEXA 4TRJA 1P3DA 1DIHA 4B79A 5JDIC 2X9GA 3LLSA 4J0FA 2ET6A 2PZLA 1GAEO 2ZB8A 3C7DB 4CM5A 5B12A 5IFLA 1F12A 5BR7A 4XYMA 3TQHA 3C7CB 3VKVA 1YB1A 3DHEA 1BXGB 5CDSA 5L3ZA 1ZK3A 4W9NA 1HSZA 3KZVA 3LQFA 4JBGA 4DMLA 5A1TA 2D8AA 1OC2A 4MJLA 3GQVA 1R4NA 1IULA 5I7VA 2O3UA 1Y8QB 4IDCA 2OZPA 4XQEA 2A92A 1EFKA 1YJQA 2PZKA 4RDHA 1XYGA 1YRLA 2EKPA 4WASA 1HDRA 4TKMA 3PIIA 5TLSA 4CV0A 4NJMB 4YCAA 2A35A 1TXGA 4OJNA 1GZ3A 3NT2A 2V6MA 3DB2A 4XB1A 5TJ9A 4R41A 3ONEA 1P9LA 2FPIA 1BWSA 4GAEA 4RF4A 2PV7A 3WNQA 4XA8A 4OSOA 1G6KA 3P7MA 3VH3A 1A27A 1MP0A 1MGOA 3FCOA 3MJCA 4BNLA 4R5MA 2VTDA 3G3EA 3GC6A 1H93A 1U28A 1P0FA 3HHPA 3VH1A 2OXIA 1LDNA 2J5KA 4I5EA 2DTEA 1K89A 1IPEA 2EXXA 3MTGA 3PLNA 3ON5A 1PZFA 3D3EA 4R4JA 4FFOA 1X1TA 4CR6A 3R0IA 1ML3A 3OJEA 1C1XB 3SJUA 4C7KA 3UN1A 1ULUA 1HDZA 3E1KA 3OMLA 2PA3A 1O5IA 5KOIA 2PR2A 5HS4A 2IZZA 1C0PA 2ZKLA 4AJKA 5A04A 4MVJF 5KJCA 4Q39A 2FZWA 3QLJA 4XYGA 3OJOA 3JD3A 3GDFA 4NHEA 4B7UA 1DIGA 2YYYA 3PVZA 3VPXA 3ZWCA 1GUFA 2IRWA 1ZSNA 2DBVO 5EJ2A 3ZNPA 1H2HA 4L8VA 3U4HA 4NG5A 2NU6A 5HM8A 1NBOA 2Y1GA 2FOIA 4W7IA 1IZ9A 1JU9A 1P1KA 1R66A 2YV2A 2FSSA 4PLPA 4BO5A 3IUSA 2TMGA 5F1KA 2HMWA 3E5MA 1KVUA 2PD3A 4FC6A 4PVCA 1PS0A 3ZWXA 2JKVA 4KDEA 4AFNA 2HMUA 3JD2A 3OIDA 2HRZA 1Q0HA 4JNKA 1H9BA 1QYDA 1GDHA 3PQDA 2R6JA 3B20A 1JKIA 3MJEA 4RDIA 4B3IA 4BKOA 4S1VA 1E6UA 1GEGA 1LRLA 3VDQA 1RM4A 3DL2A 3R3JA 4WLOA 1JKFA 2OL4A 1UAYA 4QO8A 2VYVD 1PZGA 3JYPA 1DOHA 1N7GA 2Y66A 3RUHA 4I9UA 3UOGA 2BI7A 2A4KA 1LDEA 1LRKA 1OMOA 2B4QA 1NFQA 3GDGA 2DUUA 2QQ5A 1IHYA 4W4TA 3E82A 3LF1A 3C7AA 3SBOA 1K6XA 2O4UX 1XELA 1CIVA 3DFZA 3HE3A 3I83A 3PXXA 4MIOA 1DJQA 1T4DA 4NPCA 4Q3AA 4RPKA 1NNUA 4XD2A 1HKUA 4CLRA 4IJWA 4QECA 1I01A 2DU8A 1HWYA 4KUHA 1UZNA 4XJTA 1Q0LA 2X5OA 1N92A 3BYZA 4BO0A 3LDHA 3ZHZA 3I9MA 5TIIA 1VC2A 1PZHA 1NHGA 1OAAA 1GCUA 4CL3A 4YRAA 3HADA 1LEHA 1MX3A 1LX6A 3ONDA 3EVTA 2R00C 4L4RA 1Q2XA 3C24A 1U4SA 3MJTA 3RUCA 3GGGA 4W82A 4YYZA 1NAHA 4L73A 4C7JA 4H16A 4J7XA 3HDJA 4N5NA 1QR6A 3ZV3A 1EUCA 1P0CA 4CLEA 2B0JA 1PL6A 3ZNNA 1ZJZA 3GVCA 1UAGA 2HKIA 1EMDA 1ULSA 3FPLA 4N5MA 4IDEA 1FDUA 4K28A 2C29D 1ISMA 1UXGA 4GSKA 3WQQA 4J0EA 3JQCA 1T25A 4RO0A 3TNLA 3EC7A 3DTTA 3BTUA 1I32A 3HFSA 2I3AA 2O3QA 3RAJA 3ULKA 3GHYA 1FDVA 3S2EA 4MVJI 4YTEA 3ZW8A 4NDNE 4WCDA 4BOYA 1K2WA 4NBRA 5DN9A 3K9QO 4BKPA 3DOOA 1PGQA 5G0SA 1J0XO 1G0NA 4Y9DA 2BD0A 3WX0A 5TT0A 3P5SA 1PIWA 1MV8A 3JD4A 3WQSB 2H9IA 3E8XA 3UHAA 3D3WB 2FRDA 2IXBA 4PFJA 1LDYA 1U2DA 1C3VA 2GUGA 3WSVA 1OOEA 3JQDA 5G0WA 3JQ6A 1L7DA 2W4QA 4BB6A 4J2OA 9LDTA 3ANLA 1U3UA 3JYNA 2WYWA 1Y81A 4B8ZA 3IQDB 4K9DA 1ZO8A 5CP8A 3L4SO 1HRDA 2WTBA 1AXEA 3EGOA 4WLNA 5JDCA 4GPD1 5IXYA 4WK6A 2HQ1A 4GGOA 3O8QA 4DA9A 1CRWG 5JMWA 2OGUA 2ZYAA 1TA4A 3U62A 1B3RA 1DHRA 1XG5A 4XGIA 1NQOA 4BNMA 1Z6ZA 4NMHA 4J1TA 2X6TA 3BHIA 3O03A 4J3FA 4UULA 4P22A 2W2LD 2X8LA 4FQ8A 3ZH2A 3PGXA 1MFPA 1KC3A 4J1QA 1YXMA 1A72A 1YO6A 2BHLA 1GR0A 4R1NA 4NBVA 4S3MA 4FSHA 2B69A 1VJ0A 1BHSA 2PNFA 4YACA 4UUOA 2O3RA 3ETEA 4D0RA 3PQFA 4H3VA 3PYXA 4E32A 2GR9A 2Q49A 1PTJA 1EVIA 3PJGA 1E1MA 3H9EO 4IJVA 2H63A 1X7GA 2DM6A 1J4AA 4J1NA 4PVDA 2Y1DA 1U7HA 4KZPA 1ZK1A 4ZRNA 2NTVA 1I3KA 3TZQA 1YE3A 5H81A 3BMOA 4B4VA 4IZIA 4D79A 4OAQA 1MFZA 4RVFA 5A02A 1GUYA 2F1KA 5IDQA 3KSUA 4FFPA 4XRRA 2VHWA 3JQAB 4A10A 4BS9A 2A94A 5DNAA 1R0SA 2NQ8A 2CMDA 3DZBA 5JNLA 3UCXA 3WGTA 3A14A 3DONA 5GZ6A 3OA2A 3CIFA 1WAMA 2WMDA 1YDWA 3HDYA 3NT5A 3I3OA 1AUPA 5KWEA 1TI7A 1DRVA 1TB4A 4GX2A 2I6TA 5JBIA 4FOSA 4L75A 4DL9A 2WE7A 2VT3A 4A26A 2JD0A 4RJTA 1DAOA 2DPGA 2EF1A 3OHSX 4CM4A 1NWCA 3OBBA 2Q3EA 4ITUA 4Y6RA 4AJEA 4AJJA 4MPDA 3E18A 3AY7A 4NI5A 3K31A 1BW9A 2PD4A 4E33A 4J9UE 1BDBA 2DFVA 4MO2A 4D3DA 3WTCA 1B3BA 1VKNA 3PHLA 4PIVA 2J3IA 2Y93A 1JN0A 2CD9A 5TNXA 4ILKA 3X2FA 4A2CA 4IDAA 1E92A 4CODB 2GNAA 1F06A 4U8GA 1KETA 1ZEMA 1XKQA 2HAEA 2QRLA 3ETGA 2GYYA 3PLRA 4JBIA 5G4KB 5KJEA 2EERA 3HN7A 1TT5B 3EY4A 1GL3A 3K8ZA 5F3RA 3RWBA 1UP7A 5JC8A 3ORFA 1PGNA 4CPDA 3ZU3A 1YOVB 3OICA 4QQRA 4CMBA 3F9IA 1HDGO 3L4BC 1UR5A 2DLDA 4E2XA 3QQPA 3DFUA 4BNUA 2YHIB 4UEOA 3C8MA 1BSVA 1UZMA 3DBLA 4ID9A 2ZTMA 4QFDA 3AWDA 3U4IA 1T2DA 1NP3A 4BNGA 1ISFA 2X0JA 2ZIZA 4B4OA 3CMMA 1WLYA 4BO1A 2JAHA 2WD7B 3AOEA 4AJ1A 4BIIA 4BNXA 2BGKA 5ICMA 3FD8A 3JQ9C 5BSHA 2RBEA 1R4MB 1E5LA 3E9NA 4FCCA 3KYCB 4OM8A 3BMNB 1Z74A 4K26A 4ALJA 2BF7A 3OJLA 2IZ0A 5FF9A 4DVJA 5K0ZA 4I5DA 1YL5A 2QRJA 2VUTA 3JQBA 4FJ0A 5JAQA 5DCWA 2FHSA 3NGXA 1GY8A 3DZIA 3Q9NA 1VE9A 3SLKA 2PFGA 1PQWA 2Q1TA 3Q1LA 2NU8A 1SB9A 4QSMA 2VWGA 2R2GA 4MVJE 1OC4A 3Q3CA 3JCZA 4WCFC 3RJ9A 4CM8B 3DDNA 1UXKA 4R1UA 2JCVA 3O9ZA 4BNTA 4MKXA 3IOYA 3RASA 1M76A 3H9QA 5IDXA 1Y1PA 2CVOA 3D0OA 4Z0PA 1LLCA 4ALNA 1DRWA 2Y68A 4Z9FA 2X5KO 1DXYA 3FNHA 2VRBA 4O0LA 3TZKA 4D7AA 1NTOA 3GGOA 2RAFA 4OXYA 1LU9A 1H6BA 1W6UA 8ADHA 2YDYA 1LSSA 2CZCA 3JD1A 4XQ9A 3GT0A 5JCJA 3TWOA 4B3HA 5KJ1A 5A9RA 4Y6SA 4MP3A 3VPHA 1V35A 2EP5A 5EN4A 1F17A 2NQTA 2OBYA 2HU2A 5ITWA 3I9OA 3U4DA 2C54A 1T1RA 5KKCA 4M54A 3JQ7A 1NQ5A 4D43A 1N7HA 1NVMB 4QT0A 4EDFA 1M66A 4HFMA 4YAGA 2ZJ1A 1LLQA 3AI2A 4Y6PA 1C1XA 5LDGA 8LDHA 4XX0A 5K6AC 5BNTA 4K6CA 1CEQA 3JQ8B 3QVXA 1GEEA 1MXHA 1GPJA 4PLZA 1Z82A 5FFFA 3MJSA 2ZATA 5CG2A 4IMRA 3MCVA 1E3LA 4IJUA 5A06A 4ZQFA 3ZU5A 2P9CA 2EHDA 4KQWA 3IIEA 2CDBA 2DKNA 4P4NA 1HXHA 4F45A 3QSGA 4CV3A 1QYCA 4WOJA 4CUKA 1Q1NA 1H2BA 1KC1A 2I99A 4PG7A 1YONA 1DSSG 2JCYA 2WDZA 4Y67A 4ZN6A 1PX0A 3L9WA 3ICCA 5EL0A 1ZSYA 2NV6A 4WEOA 4GI2A 4LVUA 1W73A 3JTMA 4OL9A 3WBFA 3ASUA 4N7RA 4RQTA 4FFMA 3FBTA 4DQUA 3QP9A 4FDAA 3UW3A 4RVHA 3AOGA 3TSCA 3KRTA 3ADOA 4UUNA 3GG9A 4J4BA 3PWZA 2WSBA 4FGSA 4O59O 5HTOA 3CSDA 2HK8A 2Q45A 3UFXA 2Y67A 2FR1A 3D7LA 2PKRA 1NVTA 1E7YA 5ER6A 4ZVVA 5JY1A 3E6AA 5BT9A 4JP3A 5COBA 4FFNA 2EJVA 2HMTA 2I5PO 4E31A 2WYUA 1FJHA 1GQYA 1Y8RA 3DOCA 1AE1A 3D5TA 2UDPA 4FFRA 4GWGA 2HJSA 2VYNA 4CQLA 3PHJA 4ZQBA 3H7AA 1ADBA 5HS6A 4TVBA 2P68A 3WGIA 2GERA 1ZVMA 5JDIA 3DBHB 3ZZNA 5IZCC 3G17A 4BNFA 3PPIA 2OOSA 3EUWA 1DLJA 1VL0A 2FR8A 3JQEA 3ZWVA 3KXDA 1V3UA 2PY6A 3GK3A 2O3SA 4YEDA 1OZAA 4MIEA 3HZZA 1ARZA 1XWFA 3OECA 1EQUA 5JFOA 1EVJA 3D1LA 3K96A 1T26A 4AG3A 4J2HA 2QZ9A 2VN8A 4IDFA 3MOGA 4TVOA 4WCFB 1LQTA 2DBRA 1XIVA 2JD2A 2Y1FA 4L9RA 1I33A 4E5YA 4RV9A 3AUAA 4H7PA 2ZB3A 2SCUA 3WICA 4NIMA 4PN3A 5KJFA 5I9MA 2Y1OA 3WMXA 3KSDO 3K30A 1HDYA 4OH1A 4R1TA 4Z6KA 2VRCA 3H6KA 3ROKA 2C59A 1Z7EA 4GVLA 4LRSB 3RCBA 2UUPA 4RF2A 3PFWO 2YUTA 4I5GA 4ZQEA 1I24A 2WM3A 1ID1A 3D4OA 4EJ6A 4UUMA 3LU1A 1U7TA 3S2IA 3KB6A 3DHNA 3JQAD 3STHA 2E48A 1E7RA 1K5HA 3LT2A 2Q2VA 4E5KA 2J5RA 3QVOA 4YJDA 4DIFA 2NU7A 1E0DA 4XCVA 4R3WA 1PGOA 5L51A 1NR7A 3LK7A 1GFSA 1NAIA 3BMQB 3LT0A 4RZIA 4NFHA 4DGSA 1P44A 4A73A 4QO7A 4CM7A 1BRMA 2D1YA 5TS3A 1X15A 3KEOA 5JY6A 1HSOA 4TWRA 1PS9A 1W0CA 3JQGB 1RM3A 1A4IA 9LDBA 1EE2A 2P91A 1X0XA 3LVFO 3WGGA 3D4PA 3QWFA 4U7WA 2WWRA 3V1TC 7ADHA 1QMGA 3PYMA 3C85A 4M86A 4XWYA 3DZJA 4UVGA 1HE4A 5FYDA 4ZD6A 1A7AA 2GASA 1SOVA 4R9SA 2CVZA 3SEFA 3CZMA 4NBWA 5L45A 3AFNA 3MZ0A 4D0SA 4H15A 1Y9EA 1JVSA 4I08A 4GVXA 5CEFA 1B15A 3C1TA 2ILTA 3AW9A 1F8FA 2FPPA 1CETA 1V3TA 1HTBA 1BXZA 1PQUA 4EI2A 4XZ3A 2Y1EA 2C07A 4JXKA 2C0CA 3RBZA 4NBTA 1HZZA 4YJFA 1P1FA 1MG5A 1ZJYA 4XB2A 4XIJA 3PK0A 4BMVA 1LDMA 3PHHA 1X14A 2X86A 3NDJA 4E21A 5A5EA 1HZJA 3JSAA 4QUKA 1LDGA 5G0TA 5CAEA 3EMKA 4Z3KA 3INGA 2JFFA 1ZNQO 1LUAA 2POQX 2VOEA 5JMPA 4YJGB 2IEBA 5IXSA 3ANNA 4CMJA 1MB4A 2W2KB 4FFLA 4IQ0A 2WD8A 1O0SA 3F1LA 4U0KA 4AJOA 5C3MA 2NACA 3L6DA 4MP8A 2J6IA 1UDAA 4BO3A 1DBVO 5ICSA 1XEAA 3RC9A 1R0LA 5F5LA 1IHXA 3RVDA 5J23A 3O4RA 2CUKA 3W8FA 2R00A 1CF2O 3GVIA 5C7OO 1PJ2A 2QIOA 4U5QA 3VZPA 1EBFA 1I3MA 3KYDB 5CHEA 1QV7A 3H2SA 4UVIA 4E30A 4YAIA 4I5FA 1D3AA 3NJ4A 5EQFA 1ZMTA 4P8RA 5HRUA 4L76A 5JC1A 4YPOA 4JJGA 4GWKA 1A4UA 1Y6JA 5B4VA 5L4LA 2PGLA 4EYEA 1YJ8A 1T2CA 2IZ1A 4HP8A 1O9BA 1SOWA 1MXFA 1NX6A 1HDOA 3AUTA 1L7EA 3KO8A 3QY9A 4I1IA 3AU9A 4YWJA 4CMHA 4RORA 2EEZA 2NVUB 2AE1A 2GN4A 5T8KC 3FNGA 4KWHA 2G82A 5EESA 4NU5A 1YH3A 3VVBA 2C82A 3FBGA 1ENYA 2O3TA 3FI9A 4ROSA 4D3SA 3I5MA 2EV9A 3VDRA 3ZWAA 1IL0A 4GBJA 4Z9YA 4Z3DA 2EG9A 2PH3A 2IXAA 5L7YA 1ENZA 4IMPA 3ENKA 3WLEA 5I8WA 4BUCA 4NQZA 4IIVA 4ONEA 5A9SB 2HUNA 3RROA 2LDXA 3Q9UA 4GSLA 3WGHA 4IDBA 2Q1UA 4Q9NA 1ZH8A 3ANMA 3IMFA 4O6VA 4QTZA 3UVEA 2ZQZA 1PJ3A 2G1UA 3BMCA 3GH3A 1GD1O 3ZWOA 1E3WA 1K0UA 2AEMA 2B35A 3K2BA 4XRGA 3G1UA 5H83A 2FN7A 2QZZA 3PI7A 3DOJA 1I8TA 3TRIA 1SZJG 5JYEA 3RU9A 3S2FA 4CQMD 5IN5A 1HEUA 3IUPA 3O38A 5KKAA 5KTKA 1LA2A 3DBRA 2EGHA 1SNYA 1U9JA 4GMFA 1D1SA 2B83A 1IB6A 2ZCUA 3Q2IA 5CFZA 3TL2A 1WMBA 2VTEA 2UYYA 4RVDA 4QX6A 4WNCA 1FDWA 4E5PA 2PKQP 4PLCA 1UP6A 4GLLA 2WYVA 2H5LA 2UV8A 1F0YA 1U3VA 3W4IA 5GZ1A 2QRKA 5KCZA 4NFYA 2IEDA 4XJSA 2HLPA 4R01A 1U4OA 1AN9A 1DLIA 1XGKA 1R0KA 4BHTA 3I9NA 3EDMA 1ORRA 1TLTA 2YQ5A 3IP3A 3KSZO 3H5RA 3ZI0A 1UUFA 5G0VA 3WGZA 1EDOA 3IDSA 3FSRA 3GMDA 2G76A 3GZNB 3R6DA 1I3LA 2CF5A 4WNIA 5AYVA 1KEVA 4DWVA 4IPTA 5BNFA 5I8ZA 2YJZA 3ZCXA 3SX2A 1LSOA 1XDWA 4U6SA 3UUWA 4E5NA 1EBUA 4HNGA 5IJZA 5THKA 1HYEA 5JW6A 3UF0A 5TC4A 3WDSA 1ZXLA 5JSFA 4YRDA 3ICPA 4LMRA 1QG6A 3UCEA 1KEPA 5MDHA 1DC6A 3H9JA 4ZICA 5CPBA 1UJMA 4B7CA 4DBZA 1IPFA 3TN7A 3ZV5A 2HRBA 4XR9A 4CLOB 1KYQA 1O8CA 3F46A 2C2YA 1B8UA 5AOVA 4Z0TA 3W8DA 2PGDA 4JBHA 2PH5A 1ISHA 3AY3A 4AL4A 2I3GA 4RZHA 1YB5A 3W4KA 1KVTA 5JS6A
chains in the Genus database with same CATH superfamily
3NEYA 2R751 1BWQA 4M0MA 3VGJA 5FWYB 4TRNA 4ZOLA 2PX5A 3ZKAA 3GPIA 1WO8A 4R7ZA 3HR8A 3W1EA 4ZCIA 2CVQA 1PBTA 5IT4A 1A2KC 3TUIC 3C3BA 2P6NA 3DNFA 5AW6A 4M83A 5JH7A 2OZLA 2O59A 1JG6A 5CB4F 1DUSA 1T9AA 1I4TD 3TBHA 1TTQB 2J3EA 4FD3A 4AURA 3GEDA 4ABYA 1MW9X 4Y9RA 2NWQA 4EHJA 4DMGA 1ESNA 4MH0R 2XDQB 1WPGA 1NBWB 2AJLI 2I67A 3OEEA 3VOAA 3BTSA 2FMUA 3ET4A 2OORA 4HDOB 4RCYA 2C97A 3LVBA 3TLYA 3OM1A 3B13B 5JS2A 2W43A 3C3XA 4JDPA 3FWKA 3P0IA 4JIMA 1I13A 3QITA 1Z0AA 3ZK7A 1GGHA 2JLYA 1WXEA 4EMSA 4DB2A 4GMKA 3OO1A 2YDXA 2PKWA 3GNSA 3UHPA 1DBQA 4U00A 2VT2A 4LJAA 3X1KA 2AFVA 1NQAO 2JLQA 3CO0S 1GQ2A 3AKCA 2I2AA 1XU4A 2W6JA 3EK2A 4MDFA 3H9CA 4A03A 2XAAA 3RFTA 3A4TA 4Q7MB 3WZ2A 1AMUA 1II0A 5BUCA 5GIOE 4F3TA 2HR1A 1UOPA 1ZM9A 3RUAA 1WW8A 3AT1A 2ZWVA 3ND6A 3DLCA 1GO2A 4L0QA 1U2SA 4DLWA 3P2OA 2FSVC 2Q4EA 5EYPA 4MHOA 5A9TA 1XA4A 1AUXA 3AI7A 4PHHA 2PGJA 4Q4JB 2D74A 2OP1A 3AQ4A 5T3YA 3KJEA 4RZSA 1HL3A 2B3TA 3W5JA 4UNPA 4RTQA 2H2DA 2HEIA 1ULTA 3BE4A 3GEBA 1FLVA 4PSDA 5EJ5A 2JHCA 4U2GA 1QCDA 3IAFA 1ZR4A 5B57C 2QORA 4C29A 1QGZA 1R0RE 3D4LA 1Z08A 1MEJA 3IOEA 1Z2CA 3O9MA 5KUTA 1BWPA 4UHEA 5HKKA 2ZJ4A 1XZQA 3ENNA 5CM2Z 2FWIA 1ICIA 4PZPA 4QBIA 3V7WA 4IL5A 2VPYA 4I3FA 4YAJA 3UAXA 5BN4A 3ZY3A 3C8ZA 4WNAB 3TRJA 2QENA 3MG9A 4P4TA 5A6VA 3FF4A 5EQJB 4N0MA 4ZXPA 1N57A 1WVIA 4UTXA 2ZM5A 1CDZA 1NQWA 4LJKA 5HUQA 5EC8A 3PFHA 3VC7A 3Q7QA 4LRTB 4MTLA 4LYJA 2FOXA 5BWCA 1P4GA 2R8OA 2DKOA 1OASA 3TLGB 4KRGA 4DLYA 5IN4A 5KOHB 5ENVA 4LWQA 5A0FA 1FZQA 3RU7A 1QGDA 2O0MA 3EVFA 3RI3A 4P86A 2W6NA 1R4NB 5DM4A 4E6EA 4GFDA 1IEVA 2JL1A 3LY8A 3NJ8A 2ZVPX 3CA8A 4HV4A 1E1CB 4YV7A 1SC9A 2UXDB 3ICEA 1J09A 1XL0A 5BSMA 4B9EA 2DQYA 2Q0HA 3HEAA 2RIRA 3FWZA 3QELA 4JGGA 4CRWB 4OOFA 5D01A 1QBGA 3EW7A 2J3HA 3ZKWA 4FB5A 1KI1A 1S9HA 2BUAA 2X1MA 3PJFA 1RTKA 3C6YA 1X1CA 3CINA 4NCKA 1BZYA 4QTXA 4U3JB 1L4BA 4HUJA 2CZQA 3CE6A 1U7WA 3KVVA 4OHCA 1XTKA 2X1LA 4PBSA 2GJ8A 4RMJA 5JD3A 3PDHA 3EJ6A 1TM4E 3CLKA 3OIVA 4YRLA 1N5OX 1SXJE 2FDXA 2ZB4A 1JWLA 1SD1A 2A5JA 1MPTA 3RK4A 5AUOB 5CCBA 5E9JA 4OIMA 2AQKA 1N6KA 3NBMA 1G8MA 3GGCA 4FI3F 1TKAA 2D5IA 3GMIA 3ZW9A 1I9CA 5CX1B 2YW2A 3Q3JB 5C7IO 2UUAB 1FSZA 4P2BA 3GDHA 4BMZA 2C5EA 1M2KA 2C3MA 4MV6A 4C21A 3DDUA 1D2AA 1ZBQA 2CHFA 5JATA 5LQUA 1KKMA 2OOKA 4PSKA 3WR5A 1ZKMA 5DNUA 1Z3CA 4HDNA 3TGWA 4BVAA 3NTXA 1BHO1 4KGZA 4GPIB 1Z6YA 4IJKA 4G5OA 3IXMA 4R7TA 4Z7NB 2EAUA 3EUEA 3RU2A 1QPBA 2JA1A 1CYDA 5DNWA 2IV7A 1GL9B 4J3JA 4HX5A 2YNMA 3R75A 3WQBA 4TMXA 1IEWA 3GAZA 4EUFA 3GFBA 2IIQA 3QM1A 4LDJA 5IEBA 4UBKA 1KYWA 2HF9A 1CV2A 4PS1A 1M8KA 1I7LA 1KFCB 3GL9A 3GY0A 4JCCA 4EUSA 1DXOA 1C9DB 1H1LA 2PH1A 4WACA 2X0EA 1ECBA 1K5GA 4MB0A 4EARA 3I0MA 2DZDA 2EBHX 1XMJA 2IXEA 2Z1DA 3FVVA 4DBVO 2JCSA 2W2TA 2W98A 3RQSA 3LCVB 2OSBA 3FNBA 4IZOA 2Q29A 4XYBA 3ZHOA 1EIWA 3HI6A 3QWIA 1RHJA 2GMWA 5TS2A 5AVKA 1DFGA 1XDZA 1S2LA 1F60A 3GD5A 7AT1A 4CIWA 2GD6A 3A9CA 3CC8A 3BRQA 4PYJA 3A6JA 1U0SY 1UBNA 4I4TB 4G97A 3UEOA 1MA0A 4HGNA 4R6XA 3HMQA 4TLLB 3CQ9A 4B75A 4HFNA 2R6HA 3H87A 4N39A 2V8BA 3M3DA 4BFVA 4O2AF 3AH8A 4HQKA 2V4UA 1UDXA 2VUSA 3ZW7A 3WAKA 3HA7A 4D9GA 3EVNA 4E1BA 5LPNA 1YBAA 2WTNA 3O5AA 4KWCA 3HCEA 1HMYA 4QAQA 1JT9A 2Z95A 4B47A 3PV0A 4YBRA 1ESMA 5LZ7A 2QSYA 3CTMA 1DTEA 1EJ2A 2C58A 2OG2A 3PFBA 1YDEA 3C8DA 2ZAOA 4YO8A 4B3TB 1Z73A 2EFYA 5E2BA 1DJLA 1KI2A 3GLFE 3ORRA 4BGIA 1MC4A 5FBQB 1KVSA 3SICE 3AKZA 2DBQA 1B16A 3K72B 3PEUA 4Z9BA 2FCRA 2XRZA 3TLJA 1FDSA 1SIUA 4N41A 1NF2A 4E46A 4OLBA 3OEHA 2VCYA 4LZLA 3ROEA 1QH1A 3ZBUA 4J76A 3T7SA 4HRXA 4OP3A 1A8SA 3VI4B 2G07A 3BGIA 3UMGA 3EPKA 2Q5CA 1SUPA 2D7CA 1ML4A 4JT8A 3TXXA 4XR4A 2B4YA 5ERYA 1UH5A 3LSYA 4H6PA 4ZJYA 1TKRA 3TVDA 1S2OA 1NOKA 3DG9A 4MPTA 1L7QA 4RM3A 1WHSA 3S70A 4FHFA 3MAAC 4Z3OA 5FOVA 1FUIA 1Y34E 3VDMA 4AJNA 4AECA 3LHIA 2F8SA 1QF6A 3PCXA 4A3SA 2V6GA 1YZVA 4HLDA 1QGAA 5B64A 4XGKA 2ZWMA 3G2OA 1WVGA 3PNSA 3NNNA 4MVYA 3T1OA 5IANA 1NJ8A 3WS7A 2O8CB 4YJHB 3ZHUA 1T29A 1TX4B 2VP6A 3D1JA 3EGEA 4O4LA 2W7TA 3DEAA 5FH9A 3H17A 4MP6A 1QK5A 2ANBA 2HREA 1X1QA 1X1AA 3H8SA 4N65A 5KVSA 1FNDA 2NVWA 3FUXA 1J07A 3WRVA 1JTVA 4RTOA 1R8SA 3BE8A 2HDHA 4C07A 2E82A 3W2FA 3KTAA 1VCHA 3DZFA 2ADFA 4AS1A 2B1QA 2HMAA 3L6OO 4HYTA 5CYFA 4C04A 1GN9A 5JMOA 2VXBA 4I0WB 1ZK2A 3DOUA 4REOA 3E9ZA 5FJIA 3FAZA 3NHPA 1WKVA 1A8UA 4ZEVA 5EPOA 5FPQA 3ND7A 2BP7B 1IFXA 1G21E 4B5KA 3EXAA 1JHMA 4YFYA 3S29A 3EYWA 5JLAA 1BGXT 1VI2A 3SM9A 5BR4A 1TUGA 1R6UA 5LQRA 1OVGA 3ZE7A 4MWZA 4P08A 3EDRA 3EZNA 3ZD7A 1EVYA 1Q7CA 1QZUA 1E18A 2JI6A 2P9TA 2P2ZA 1P17A 3Q8MA 2BFWA 2ILVA 1LTKA 3BF7A 4P93A 3VJKA 4CIVA 5CDGA 4LQLA 1HH4A 3PA6A 1XKLA 1ZVJA 3E7PA 3B1JA 1BEUB 4F93B 1E7SA 2M98A 2YMPA 4M38A 1NKSA 3LQRA 5EY5B 4HZUB 5HEKA 1IOZA 4OKIA 2X42A 4KRYA 4QQFA 2O6HA 3NTVA 2XMRA 1Z18A 4XIYA 4LXQA 4IAOA 1D6JA 3L7OA 4JI6B 5IDWA 5FO1A 1H8HD 2VNAA 3WG9A 4UHKA 1PZXA 1YQ9A 2G72A 4AZ0A 5K4HA 3IIIA 2QTCA 4R51A 4X3PA 2R7AA 2VSQA 2BCEA 2IYFA 4MYHA 1M6NA 3R5KA 2JBAB 1FDRA 1CW2B 5TQ2B 3A06A 3N2GA 2WY2D 1DWPA 2A9FA 4RHYA 4ZZ3A 3BWEA 4HAUA 2DR0A 2ZITA 2H5EA 2YWEA 5B7NA 1EZ4A 5SY4A 3VTZA 5KSWB 1G8HA 4KO2S 3LLMA 5GAJA 2BAGA 3H7IA 5DGXA 4G81A 3IUQA 4L27A 3UAYA 4YMUA 5JI3E 3ZV6A 1ONPA 3FTNA 4P3PA 2WU3A 2JIPA 4F3RA 3WJ7A 2OK8A 2GT1A 2WG2A 2YJTD 2MT9A 2DC1A 1C9KA 3CRRA 3H2GA 5DSXA 3RIGA 2EEPA 4TV8A 4E2YA 3KLNA 3LSTA 4DIBA 4Y2JA 1U2RA 2H1WA 2X1VA 2GLTA 4GRDA 1MLDA 2ZSBA 2FKNA 5K3FB 4EPXA 2ZM6B 3MJRA 1WDKA 5H3LA 5HJ7A 5C8VA 5FOQA 3QF4B 5BQFA 2WZDA 4WLUA 4DXAA 1IYZA 4KXQA 5DO9A 2O5EA 1UFRA 3DBVO 3V9AA 1IUKA 1I10A 3OM9A 5JXHA 3WIUA 1ZI9A 3PC8C 1Z0UA 4JLWA 1YMVA 1Q57A 4MS3A 4WDRA 1U0LA 3W8RA 2WICA 1UBHS 3HXMA 2ZRHA 1C8KA 1XQXA 4E2ZA 2OT3B 4J6EA 1UZUA 2AMLA 2BGMA 1Q77A 3IDOA 4M0DA 5AI4A 3DD1A 3ZVRA 1G4AE 1NVEA 1YDHA 2ECKA 2VZLA 3D3WA 3ENZA 1SXJA 2GZDA 3NLLA 3UJ3X 4HUTA 2D4AA 2R4QA 4R5HA 3D7RA 3VU8A 2XVYA 1ZGBA 2OM2A 2H4ZA 2C9YA 5CFPA 5K7SA 3HCNA 1PFUA 4C6HA 3Q1KA 2GK6A 5FBVB 3ABOB 3NBAA 5A1JA 1W47A 3FPHA 4WQMA 3USCS 3FN4A 3NUZA 4NZPA 5KYUB 3S4YA 1DT3A 1G6Q1 1GTG1 2ZQYA 1RE0A 3Q8WA 3R0QA 4GMXA 4LRYA 1UT6A 2O07A 2OESA 1GPNA 4CM4B 1TT7A 5K0JA 3L93A 2I4OA 2ZE8A 3GUHA 2VT6A 5C0OE 4F84A 4UXHA 4ZDKA 4KRXA 2ZGVA 3T7JA 3JD0A 2FDRA 4JK3A 4L5AA 1W0KD 1BW9B 4JHXA 3VMFA 4YRBA 5A4IS 5FLKA 2QB5A 1XZ8A 4J7AA 3QE4A 3R9XB 3UBTA 4R6WA 2I78A 4ZYZA 2PH7A 4BVFA 3F5MA 5DXFA 1JB1A 4HN4B 4RVUA 3AW8A 1YZTA 3D4NA 1U90A 4XTRA 4BECA 3BK7A 3U44A 3NANA 2NZ8A 4RTLA 1MPXA 5ALXA 3SEZA 2PS3A 4X45A 4G9BA 1XRSB 1XCGB 2IT1A 2WINI 5HDBB 1YDMA 3NATA 4MDEA 1S3IA 2P35A 1EFHA 4WK4B 5K0FA 3KV3O 2WUFA 3ZWWA 4E12A 1GFWA 4YHHB 1USVA 2VP2A 4RLHA 3FOBA 1VQ1A 4A36A 2D2IA 4EA6A 2IEAA 1QIDA 1WZ2A 2A3RA 3U3KA 5FKJA 4CMKA 3DSRA 1UJNA 1LCIA 2XSZD 1L7XA 5L95A 2EBWA 4R69A 3R3ZA 3CX6A 4K9QA 4MVJA 3IUJA 4UHDA 4IHKA 3NAMA 3ZI7A 5FNZA 1LQUA 4NRDA 1B43A 4BO6A 1FSFA 1V0JA 4MRSA 2YWDA 4FLFA 2EIHA 4OLFA 2VHVA 1T9CA 2F8MA 4Q4AB 1VECA 5A0VA 3QPDA 4K6GA 3R7WB 3VR4H 3PDCA 4DDKA 1XMXA 1J56A 1Y42X 1I5RA 2AFHB 4MEJA 1PJTA 4EW1A 2IHVA 2J7PD 1ZNWA 1EWVA 2JI9A 4KFUA 4IIFA 5KMGB 3A1NA 4MPRA 4YHBA 3ZNOA 2SECE 2Z1MA 4FPXA 1NHWA 2OBLA 3H9GA 4ND2A 3UG7A 4Z2YA 1PJ8A 1X7WB 1PAUA 2GEFA 1RXCA 2TSYB 3C15C 3MEQA 5AHOA 1XRRA 2HLHA 2ZQ5A 5JNUA 2PQ2A 1LK7A 2HIHA 4RGQA 3SI7A 3GLFA 2RK6A 3T52A 3RODA 2JKYA 2P9EA 2P3LA 1N1EA 5JO9A 2GJSA 2KLBA 2WA2A 3A6DA 1M1NB 2CUZA 2HM7A 3KOMA 4HAVA 4R2MA 5A4DA 4UEWA 3VKUA 3AZQA 2GRAA 2HQOA 3L7LA 3PQ5A 1CZOA 2DUMA 1PZEA 1COZA 4X63A 1NSFA 4PCUA 1YL7A 2HA7A 2UVQA 5JXWA 1SCJA 3KVOA 2QBYA 4M8IA 1Y5NA 4EQ6A 3TE6A 3TIIA 3ZD9A 2HU8A 2RJ3A 1HE5A 3S44A 4B8WA 1MC8A 1PR1A 2CJYA 3HP7A 1BYUA 3I01A 4QYTA 1MQ8B 1B6SA 5EINA 4H7JA 2O2IA 1F48A 4IQGA 2FE1A 4RSRA 5G4KA 4RADA 4LE0A 1JSCA 4LOAA 2WAMA 2V1XA 1PU2A 2Z2ZA 4DLNA 1MU0A 1T2FA 1GPH1 2R1TB 5CJPA 3EAFA 1WDWB 1Y0BA 2QS9A 3GDOA 3WIDA 1YR3A 4A15A 3ZIAD 4MPJA 2HJGA 1FB5A 4EB8A 3C5WP 3L0SA 3A4VA 1KDPA 3LWZA 2YHIA 3HA2A 3OE7A 4Q3DA 4ER5A 4CFSA 4JQOA 3GJ5A 4L6AA 2FOLA 2BF4A 5DP2A 3NWPA 3UK6A 1D2HA 5HR5A 4TS4A 2MSDB 4R1OA 4DNOA 4ER7A 5LOVF 4OXQA 5EIBC 2AUTA 5AVRA 3ZI4A 3OZ7A 1NLMA 3R8FA 4A8TA 4QUHA 3D5QA 4LKOA 2WD7A 1PL7A 4DRXA 2G36A 3DHYA 1MAWA 3OTOB 4MUJA 2QRHA 3I1YA 3JX9A 1LS1A 1UC9A 4M9QA 3KKLA 1G21A 2I6FA 2OLEA 3KYCA 2X0DA 4AS3A 5LXTB 1B73A 1A9RA 1OTXA 1XPUA 3I8SA 1JL3A 5DBIA 3AUJB 5FHRA 3WWPA 1JSRA 1OREA 4I36A 5E38A 4XPIB 1UMDB 2BKVA 2PWPA 3LT1A 4KMRA 4OQQA 5HJ2A 1J39A 1HYGA 2RHCA 3GW8A 3PR2B 2R86A 5KC9A 5A03A 1XPOA 3BXXA 3E9QA 4X24A 3I34X 2BJWA 2WD9A 1LWOA 3BTVA 2GPWA 4M6WB 4TMFA 4YLEA 4CM8A 3HRIA 3VO8A 3EBLA 1NKTA 8GPBA 5AOBA 1N1MA 1M7GA 3EVCA 3ZDQA 1I6LA 1T2NA 3NIDB 4CF6A 1F14A 2IYOA 3HVUA 4GUDA 4RF5A 3S1AB 2IYRA 4JYZA 3TNFA 5FTNA 4FMBB 1U8CB 4J0KA 4BRWA 1SCKA 2W0SA 1RXYA 2PXHA 2ST1A 2ZBVA 4M49A 4CM6A 5JXIA 5T57A 3U1VA 1RQRA 1D1TA 1FQKA 2B8NA 2X2OA 3LC7O 1STOA 4PU0A 1O94A 3JPWA 1GFZA 3V8PA 4W9NC 2ZREA 3JY6A 1SBZA 4UDNA 2FPWA 5EWMA 4ES6A 4Y0NA 1O87A 1C8BA 1HETA 1VJ1A 3DL0A 1RI2A 4IIDA 4KG7A 5FL7A 3VR5D 4D80A 2I7CA 3T7KA 2B98A 1VI5A 1KR2A 1BDMA 2W42A 3H5AA 4BU1A 1UK8A 1AF7A 1Y8RB 1GTMA 4BNNA 2HA3A 1V47A 3VSBA 2NO5A 1PF7E 2QLFA 5EXTA 4I8XA 1O08A 3U9TA 1W1UA 1RYZA 1GTVA 1A88A 4JVNA 5D1HA 1VRWA 2ZRIA 4LK3A 2G67A 2BFNA 1AZWA 4BO2A 3LLVA 4DLUA 4PO1A 4CM9D 5IPFA 3HCDA 1VB3A 3DZGA 5JAQA 1D1PA 4GD3Q 3LQYA 4XWWA 3E7FA 2IS4A 3CNHA 4Q9HA 1Z33A 5AM4A 2FW6A 2NVBA 2RJNA 2P0EA 4PW0A 4QGGA 4BE9A 4COKA 1H1TA 1W30A 4V3BA 1XROA 2KJQA 3W4JA 1K3TA 1OV6A 1GA4A 2YASA 1XCMA 2GWHA 2ZYSA 1MQSA 1V9LA 3ILSA 1I2AA 3NBXX 4BEVA 3L8HA 1AIPA 3MCWA 3TEJA 4BGEA 1KU6A 5L6LB 2FSPA 4WXPA 1U28C 1GNQA 3PUZA 4EGSA 2AMFA 2YWXA 3EGCA 1SO8A 2AG0A 4KLRA 3MJDA 1Z16A 2GPNA 1SKMA 3DZHA 1A77A 1YCHA 2YIDA 3FDXA 4AJ2A 4MQMA 2GWRA 4AMGA 4J16A 2YY7A 2IU0A 4XX1A 5KNDD 5CEJA 2VYVA 4MVJG 3OZXA 3DAPA 2JATA 5FB3A 2IDKA 5GWXA 4BEWA 3T7CA 4CQMA 4MLPA 3K6SA 5I9BA 1ZVQA 2GCGA 1QWOA 3ILYA 4HS4A 5T4HA 1Y6FA 1V71A 4NU8X 4F2WA 1VIAA 2QE7D 3TL3A 3B9QA 3FROA 3SC2B 4ADSG 2V74B 1EESA 1HY3A 3VPGA 2OFPA 2PRSA 4TTRA 3PKIA 1MOZA 4ND7A 3VBEA 2IY7A 2R85A 2Q62A 3LXMA 4FVTA 3WV5A 1N5KA 2BZSA 4Y8VA 1NURA 3LECA 1SB8A 3I5UA 4MW2A 4OLJA 4GLFA 4YRCA 3ZYCA 1TIPA 1XR3A 3L8GA 1EFVA 2WJ6A 1ISIA 4IIXA 4N5LA 2JFGA 3R3WA 4QQKA 3TGPA 1RMTA 2LP4Y 3H8JA 5EZYB 3WL3A 1HURA 1FUEA 1ISGA 5IDYA 3STYA 3UA4A 3ZLJA 1ZBDA 3WYGA 1RQ2A 4IJQA 1DAHA 4HVTA 3VNRA 1XZKA 5BVGB 2D5BA 1X7XB 2E6KA 2IF0A 3ABZA 1T2EA 3B1YA 1S3SA 3GLKA 2QUIA 4LYHA 5DW3A 4EHDA 2PUJA 3ZBQA 1PNRA 2L69A 2VP0A 4UUQA 3HR4A 2ECPA 1XHLA 2V6IA 1SRQA 4MQFA 3RVOA 4PZCA 4KQIA 3ZCQA 1YZKA 4P3YA 3LK6A 4A5SA 2X19A 3QEKA 5IAAA 4H0NA 1OIXA 3C6BA 4RMHA 2JIZA 4YR9A 4ND3A 1M6VA 4RU1A 1CF9A 1NA5A 3HUDA 5BYJA 5CGZA 4A7PA 1J1IA 3SK0A 3UCFA 4CDNA 2MSLA 5LBUA 3N28A 3Q0EA 5D87A 1IRXA 1HMPA 1OTYA 2B78A 3CE9A 4UTOA 4J9VA 3KALA 5IAGA 2J30A 4G2TA 4CCYB 3KQTA 4Q4DA 1CY2A 4AJHA 2E7ZA 4JWTA 4WDQA 2H31A 5AVZA 5CT4A 3W3AD 5FCDA 4EOGA 2YFHA 1TZ2A 1OTHA 3PKJA 1GP2A 4GPAA 4Y2SA 5TGTA 3PD0A 2HWXA 4EKGA 2FG6C 3QMMA 4JEUA 3NIFB 4L5IA 1IJEA 4F72A 1JU3A 4GGPA 5IX8A 1QYWA 1JUDA 1U3TA 3PE3A 1YBHA 3JYOA 1JBQA 1L6IA 4NBUA 5AESA 4TSKA 3WB9A 3LYLA 3P9ZA 4CMIA 1A3CA 3RVNA 1XTTA 2XYPA 1S2NA 4PPYA 1PQ4A 1B00A 5HIKA 4J49A 3F47A 3KUDA 4G65A 4KIJA 2Q4BA 5FA5A 3DE6X 1OBFO 4JLUA 3GLTA 5U9CA 3OIUA 3TQTA 5CJJA 3BRWD 4LXYA 2O7RA 1QYIA 2OGWA 4MKHA 4PE5B 3CH6A 1XA0A 1N6IA 4XD7D 4Y2PA 1F7UA 1ISJA 3MELA 2ZUBA 3EAGA 3TCKA 1G3QA 3FW1A 2PGXA 3FYSA 3T0FA 3A2NA 4FGWA 3DVAB 4HRVA 3FG9A 1PW5A 4ISCA 1NW5A 5TQVA 2CE2X 5NLLA 2GCPA 3BMQA 1TJ3A 1JR3D 1KI6B 3KJXA 3OJWA 3IPAA 5LD2C 2GXAA 1YRAA 1QORA 2BFFA 1MRZA 1ZN2A 3PGLA 2OHXA 3W9UA 3D7MA 1K6EA 4JEMA 5JYDA 1NFFA 2ECFA 1D2CA 4IH1A 3B1KA 1ONSA 3PWTA 3T1VA 1UKCA 3IT2A 2I2WA 3PJDA 3O8OA 2FN9A 3SZ3A 4JUIA 1PSDA 2XV1A 2VK1A 5DM60 2ZUSA 2XBLA 2QYTA 1WPQA 4DGQA 2R68A 4UQPA 4F1WA 1VG1A 4HB4A 4MGIR 3FOEC 4UQLA 1YZLA 4AKGA 2IEYA 4EF5A 4B3GA 1CJVC 2WM2A 2YS7A 3GLRA 3IIMA 4QGFA 4XB6B 2BTEA 2Z8XA 1R37A 3GRKA 5DSTA 3T5PA 2BSQA 3RJ9A 3TNDA 1FTYA 4PTZA 4DSUA 1QH8B 4W1RA 5EJ7A 1FSSA 1QB7A 2H1LA 2JFUA 3BL6A 1N6OA 2O2HA 1CC1S 3C1OA 3DLAA 4X1IA 4G0ZA 1T6BY 4FONA 3MTBA 4FFWA 5U1PA 3RF7A 2RGYA 1QVRA 3ESDA 4HPWA 1F5NA 4IUCS 4KPUA 5C1OA 4Z4QA 3MGAA 1NLFA 3A8TA 4N48A 4TMZA 1MABB 2UZ1B 4CKZA 1W0JA 3SU8A 3IBCA 2MIIA 1ULHA 1UPBA 4B73A 1RRMA 3LLUA 1U5AA 3ETNA 2EKZA 3H2YA 1U5BA 2WJHA 1CSEE 2LNDA 5EJ6A 3DL4A 2JGFA 3GVXA 1CLEA 3ELDA 3I52A 3LRXA 2WUVA 4OJMX 5JDCC 3UWMA 1IN8A 3GEGA 3EZYA 2GBGA 1RPJA 4RSGA 2HA0A 2GLXA 4QLOA 2CT8A 3WGJA 1XF9A 1KAQA 2VQSA 3MS4A 3OF3A 1PTKA 3HB1A 5SICE 1TFRA 1BH2A 4PRYA 4EY3A 1IK4A 2MR5A 2AOVA 2WQZA 4HTFA 2D13A 1U98A 1XE3A 5CYOA 4IR7A 4K0KB 3F5QA 3VU1A 1BQ4A 7REQA 2MCFA 1ECPA 2PWZA 4ZO7A 4AY3A 4FJ1A 2YWHA 3ABSB 2QTNA 3DMFA 5TB5A 3GFOA 4NMMA 2QEQA 1PQPA 1V8ZA 3AILA 3F7MA 4JJKA 5EZ6B 3WDMA 3ZOKA 5AJXA 3BMCB 3FMFA 1Z38A 4X1OA 5JBQA 1MZVA 3IJ5A 3JYQA 4FLMA 1ZLYA 4RGVA 1DRUA 4ARSA 1YZGA 2W37A 4LBVA 1G60A 4C4PA 1VDMA 1QHYA 4OQPA 2ZJ3A 5AXAA 1IY8A 4RLSA 3AY6A 3X3HA 2BE9A 2BMAA 3M4ZA 4B9AA 5CXQA 4WA7A 1SUWA 2GTHA 3AR3A 4U6QA 5EAIA 1U7OA 5LB2A 1E0AA 4AZWA 1NVGA 1U3CA 4L0CA 2R9VA 1ESCA 1KFBB 5E7QA 3F1KA 3MQ4A 1VYVA 1V26A 5E1OA 4NDAA 5K4AA 3SKYA 1E3JA 2FWMX 1NNEA 1WUIS 3I4FA 1KMIY 4DBLC 2ENWA 2ACVA 1W25A 3OE5A 4Y2VA 4LVCA 5DM2A 4BMSA 2PKQO 4KFSA 4F3YA 4QXRA 1PJLA 1UPFA 3GRUA 2AL7A 2JG3A 1N3LA 4MINA 1NOJA 3I1IA 1N2CB 221PA 1TDJA 1QF7A 3O8NA 4EUEA 4LOLA 4MKRA 1MA3A 4L74A 1TC1A 1CWUA 1DZIA 4KGDA 5AXDA 1JI0A 3ABIA 2Z5VA 1M0TA 3CUUA 3DQPA 5FUQA 5CPFA 1GU7A 1XT6A 3PFNA 2FU5C 2DHDA 1M6WA 2B6NA 3BVPA 3E58A 4IIYA 5DW0A 2GGSA 5E6RA 3RO7A 4HSEA 4BNKA 1EXWA 5ILOA 2C1EA 3CCBA 4OQYA 1R4ZA 2RB5A 4NMWA 4AZVA 2X13A 3LDGA 2UZAA 2FW8A 3M3HA 3HFJA 4C5AA 3K70B 5C46F 3IEUA 2DPHA 2YV1A 4E0BA 4YQFA 3U4QA 2VQDA 1LNZA 2E4AA 1Q83A 3IUEA 4Q4LA 3RUEA 2AMJA 4HC4A 2OQVA 1Y37A 3OCVA 4IXMA 4GZLA 4X95A 3LT5A 4WFQA 4CMAA 3ESRA 1TQ6A 1P7YA 2LD4A 1GNLA 2VDVE 5HUJA 4A2PA 5H70A 2FK7A 4ZOBA 1TQ4A 1NVDA 1XZDA 4BO9A 5FT9A 2J4DA 3SLRA 4WK0B 3MIZA 1X1EA 1U7UA 2ID7A 4ZQCB 5EWJA 4EEZA 3QTLA 3E9DA 1CJSA 1E1NA 1G9XA 5CT5A 1NT4A 3M5CA 3GJ7A 3IVMA 3MA0A 3TTYA 3JSXA 4CG0A 4KAJA 4MKIA 1MN6A 1NMEA 2IBTA 4HFRA 2C8LA 3V2IA 5FADA 2C84A 1FXWA 3JARB 1KF0A 2ZTVA 2R97A 3QKSA 1WTAA 1RLIA 2Z1NA 1YJBA 3HJUA 5AW2A 3CKKA 3FMIA 4FILA 4GYWA 2P2NA 3R7NA 2IH2A 2A5LA 2PZEA 2VL7A 3WYEA 2AOUB 4ZJUA 2HB6A 3AEZA 3AVQA 1CUGA 3PPWA 4KDRA 2GZSA 4TT3A 4XYEA 4CMEA 3OZUA 5CG1A 4UFPA 3D6FA 2I7VA 1OGJA 4AN1A 3BHMA 4IGFA 3JW8A 3ZWYA 2O14A 3AR5A 1YBVA 3MD9A 3O26A 3RAGA 1Z39A 3DR3A 3NVDA 1A5ZA 3CISA 4JP1A 3HP4A 5LBIA 5JNRA 1JWAB 3I23A 1V1MB 5BNIA 2Y1CA 1D7OA 1TM7E 1IDOA 2RGDA 5FHQA 4KVFA 1MG0A 2Q4RA 3GFVA 1P6UA 4RZ3A 5HZHA 1M6HA 4LJSA 1Z06A 4MWBA 5AVJA 1XNHA 4YV1A 3PFFA 4PZYA 3OX3A 2C2GA 1KZ6A 1E3IA 2QM8A 3JTEA 1ST3A 3AUXA 3H86A 3OCJA 1NN3A 3N70A 2DQKA 2IPLA 4IVNA 5EGSA 3UV7A 1E4VA 5K3AA 1EB9A 1MIOA 4CM3A 4NYMR 4F04A 2ZBFA 1HX7A 2OZEA 2JB9A 3KB1A 4NJEA 4PLHA 4PG8A 4GRAA 1XDGA 4EB6B 4YCNA 5FNVF 5LLTA 3ADCA 1GLNA 1WU7A 2J9GA 2KS6A 3SE7A 4BXOB 2PXXA 2IY9A 1KOLA 2A9KA 1ZU4A 1U7XA 2WPNA 3SJ7A 1VSBA 2O8BB 5AOAA 2PL5A 2YZGA 5DZSA 3VR0A 1CZHA 3W5IA 1U9IC 5CFMA 3N0WA 3OCZA 2GX6A 4GXNA 1RRPA 1UP4A 1Z6QA 1OU0A 4PZUA 4Q7LA 4MTCA 3OZSA 3KDAA 3TR0A 5A3SA 2O5CA 2DSTA 1GG5A 3HJGA 3LOUA 3MGCA 3KOUA 4BLQA 1RJEA 3A3PA 1B0UA 1EDBA 2QDXA 2M1XA 5AD1A 3CRW1 3IMCA 1N1GA 5AHWA 4ENRA 2Q3BA 3EXG1 4URYR 3T1HB 4EPVA 2CL5A 1AZLA 3EFOB 1N2SA 4WJZA 3RSHA 3WFZA 4A1OA 4E5UA 5IBCA 3OZDA 1N2BA 2MYTA 1LBIA 4MRMA 4YAKA 3I05A 3RT7A 2CKDA 3FTEA 1RWVA 1XALA 3AEUB 1J99A 2NSDA 3HKDB 2PSFA 4DLXA 4UD2A 1WL8A 4MWGA 3U48A 2JBHA 4BRSA 4YLGA 3LVQE 2ZFUA 4WN3A 5J43A 1QDUA 1RXUA 3TMYA 1H2YA 1U9CA 2EW8A 3NBKA 4GM4A 3IPYA 4I50A 3CX4A 1UXJA 4RY8A 3D7KA 2MWMA 2HMYB 3ESYA 1RWNA 2XOKD 2XUFA 1D09A 5CVUA 2QLLA 5FI3A 1U6IA 5B53A 3BICA 3FI0A 3HVKA 4DRYA 5C81A 1IIRA 2BFEA 5LU8A 3ZD6A 3DC2A 1I2DA 1TKBA 3LUCA 3CEMA 3ZHTA 1DAPA 3H0CA 4I7EA 2HBQA 2HSGA 2NV0A 3CG4A 1M2OA 5CA0F 4FCTA 2TS1A 3QW2A 2WVJA 3R23A 2WUGA 4RMIA 1Z5VA 2YYZA 4OLAA 1XVAA 4L5YA 1UBUS 2WFZA 4REQA 4JI4B 3SSOA 2W71A 1JHDA 4W6ZA 1XVLA 4F06A 2A1TS 4K9MA 4C7BA 2FHPA 4NONA 3VJMA 4C3ZA 1JPUA 2OUIA 1OI7A 3B3QA 4NV3A 4OHPA 1ETUA 3MUFA 3PIDA 4ZPJA 2B7CA 1RHMA 4KU4A 4QOHA 4ZU1X 3ZK9A 1M0SA 1PZMA 1R0BA 5H7XA 2WILA 4BO4A 4QU9A 3SBDA 3MGBA 3GP8A 2HQSA 2Q5EA 3WZLA 3ESQA 1IHPA 1HLFA 1XMVA 1RJWA 1YQXA 4OB7A 2O1XA 2G4CA 2ZXFA 4AKSA 1I6MA 1KBZA 2PVCA 4B87A 4EVQA 4UHJA 3CY6A 2G5GX 5DM70 3S7ZA 1CIPA 2Y76A 2FV8A 3BH6A 3RTCA 1QIGA 2WP8J 1VP9A 3FZNA 2L2QA 4J7CA 4D8TA 1JW9B 1ZISA 2ZIUB 4MYRA 2OKCA 3MWEB 3VNVA 1D1QA 2IDZA 5JISA 2A0YA 1E79A 1QLHA 2PUVA 3P19A 4MR8B 4TMKA 1XFAA 2VAPA 3KELA 1T4BA 4I6GA 4JIGA 1NVFA 2XUPA 3ZE6A 5K8LA 2A9JA 3PBKA 3EDCA 5CH5A 4WL0A 4H3KB 4MV3A 5C9ZA 3QFSA 5CTAA 4AMBA 1BNCA 5KTYA 4MR9B 3A3KA 1ECJA 3F3SA 2QMEA 3E4CA 3PDIA 4JQSA 1EDDA 1T5SA 4B48A 4R2LA 2OV3A 1KJ8A 2REXB 1E2QA 4PXYA 3ET5A 1DIHA 3K35A 3QIAA 4MJ3A 4TV9B 2P6RA 4KKVA 5KYKA 5AICA 1WQ1R 1JMVA 2ET6A 3KWFA 4O5AA 4H9GA 4XYMA 3RQIA 2W2NA 1FVXA 3VKVA 2XWSA 3E0QA 5CDSA 1BEZA 3LGSA 3CPJB 1L5MA 1IQ0A 1HSZA 1WRBA 1QV9A 2V1UA 5CB6A 2ZYHA 1PLLA 1Y3IA 1OC2A 1Z8NA 2HT6A 1KPHA 3FKSD 3GQVA 3Q40A 5E1DA 4KQ9A 3LBNA 3EG9A 5JUWA 4FX5A 1L1EA 3NO4A 4LAFA 2O3UA 3OLCX 4KV7A 3HKCB 2UKDA 5CCDA 3M6AA 1YJQA 3VTKA 1XYGA 1X2EA 3CT6A 2EKPA 3COYA 3LOPA 4MS4A 5TLSA 3DYVA 2G4VA 3D3QA 2XD9A 4YCAA 4DYHA 4ZAVA 1TXGA 4S05A 3QYFA 4HEQA 4LFBB 3G02A 2LTAA 2X0KA 1Z5PA 1MOQA 4BTVA 4HEHA 3MHPA 4XB1A 3BD8A 2IS6A 1UKBA 2FPIA 2XT6A 1BWSA 1GTL1 3HBAA 4RF4A 1W0KA 1QZ3A 4JSYA 4Y2HA 1UM9B 4EYQA 5KNCD 1HQDA 4XA8A 2JLSA 2WK1A 2A86A 4KNVA 4MV5A 3LUKA 4NMXB 4UATA 4MWTA 3D0QA 1KR5A 1JHXA 2IU6A 1XZJA 2Q6KA 3MJCA 1M2VB 1ZRSA 1YIOA 5LMCA 2PWBA 5A71A 4BKMA 3G7NA 1D0SA 1BXRA 2XQIA 1N77A 2Z98A 4HF7A 5TQJA 1P0FA 1A5BB 1SBQA 2XNCA 3PQ7A 1P5RA 4NZOA 3HHPA 5IT9A 2ZJAA 4K9NA 4I5EA 5DNVA 3LWNA 1P29A 3UT5B 2EXXA 1K89A 4TUYA 3AETB 2F43B 5BXQC 5B3AA 3ON5A 4XH9B 3RTGA 4H7KA 4ZEOA 2BI4A 3R0IA 5K8VA 4DDTA 1C1XB 3RC8A 4MCAA 2PA3A 1O5IA 5KOIA 2PR2A 2PO7A 1MEEA 4XSHA 3BD9A 2BHSA 2X41A 4WOCA 3GQBA 1AN0A 2AF4C 3SZOA 2R84A 2XIJA 5DLDA 4Q39A 2O0LA 4OMCA 3OJOA 4NHEA 2ZE5A 4I6EA 3PVZA 3VPXA 4BFLA 1A7UA 4Q4HB 1GUFA 3SMQA 1Z13A 2QD4A 3V1MA 2GF9A 3TLEA 2YMQA 4LUCA 2AK2A 2DBVO 2WVGA 3ZNPA 4R1PA 3AEQA 4ZRDA 1NBOA 1ZN9A 3ZC3A 1WETA 1TE2A 1EVKA 4GRIA 5HOEA 4GXTA 4W7IA 4R2KA 1IZ9A 1R66A 2J7PA 4MI1A 4LJ5A 3AVPA 1P4SA 3A6ZA 5IUKC 2Q27A 2R47A 2FSSA 3TL6A 4G23A 4BO5A 1NW9B 3OLVA 2O05A 1OLSB 4V0LA 1JFRA 3CT4A 5CT8A 1AKEA 5C7YA 4KDEA 4LJ6A 1G17A 1GG2A 4Q24A 5DYNA 2RHGB 1H9BA 4JSRA 4LZNA 2R6JA 4ZV4A 1CJBA 5HIMA 3MJEA 3M6VA 4RDIA 2A5GA 1Q21A 1JLMA 3QOYA 4QULA 5E6SB 1W4LA 3R3JA 2R1UA 3AZPA 4MUBA 4OY3A 2DETA 4BRUA 3IGFA 4FP9A 1N6NA 1QFMA 4WOBA 3ML1A 5CFNA 1ULBA 2FEMA 2I2CA 4EB0A 5LP6A 1ZD8A 3JYPA 1HZZC 3KBBA 3NHUA 2YQZA 1N7GA 4O2RA 2CXOA 2Q4DA 2BI7A 1LDEA 4N40A 5AW7A 1YZNA 2WG0A 1DCTA 2Q3MA 1E99A 2AYYA 2I87A 5CR9A 3GDGA 4KE8A 1HT3A 1O5OA 2CHVA 2DUUA 2A5DA 3MXOA 3PUHA 2QGZA 3ZWKA 4Q4CA 5CBPB 1XTRA 4OA8A 1I7QB 3UJNA 4AKHA 1JR3E 2BV3A 3A1SA 4MIOA 4G07A 3SBOA 1DJQA 1GXSA 4CYMA 1GUBA 2NSYA 4IJWA 2IF2A 1I01A 1QGUB 1JEQB 1S2GA 3LO5A 4Q3OA 4XJTA 4H77A 1T0JB 2X5OA 3ZIAA 4OEHA 4BO0A 4JITA 4MV9A 5HOQA 2BGGA 2PIAA 5CGQB 4IDNA 2XUKA 4K03A 5HUHA 1PZHA 1SC1A 1OAAA 4YRAA 4X7MA 5HKAA 3K4PA 4BDTA 4KWTA 1MX3A 3ONDA 5DEIA 3SDBA 2DWQA