1DFHA

X-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfhA00
4D46A 4DC1A 1JWBB 1NAIA 5EL0A 1GCOA 3VTFA 1PQWA 2B5VA 1QSGA 3INGA 1P9LA 1H94A 2NQTA 3CPSA 3F5SA 3O8QA 4A10A 1Z6ZA 3EVTA 1C1DA 1PGNA 4G65A 4XRGA 2D0IA 4R9SA 1N9GB 2I99A 1QYDA 1SBYA 2VWGA 3DZJA 3UW3A 4E3ZA 4YRBA 1R6DA 2D5CA 3ZHBA 3L4BA 4JP3A 4EI2A 1EDOA 1ENYA 5AVOA 4A73A 1QLJA 4ZA2A 2DU8A 4FOSA 3TNLA 5FYDA 5JCXA 2X9NA 4UUNA 3SXPA 5FFFA 4FQ8A 2EXXA 2Q2VA 2HRBA 3AUAA 1YKFA 3BMOB 1NTOA 2G17A 5TSDA 2GZ3A 4FSHA 3FR8A 2ZB7A 4EITA 2ZATA 1HDZA 1B8UA 1VC2A 3JTMA 1YL7A 4M8SA 1GFSA 2OMEA 3O9ZA 4QEDA 4RDIA 5LDGA 3NAQA 5JO0A 3DTTA 5EINA 3ENKA 3H6KA 2VTEA 3QW2A 4WASA 3OIFA 1NFRA 3GQVA 1EEHA 1X7GA 4B3JA 4BNHA 4UUPA 1WW8A 1ZUD1 4OXNA 5G4LA 5J23A 4E5YA 2WYWA 5HS6A 4NFHA 4R1NA 4J4BA 4FCCA 1NQ5A 1NWCA 1RJWA 2AG5A 4MIOA 1IPFA 4AJOA 4FPXA 4L8VA 3ST7A 3WX0A 4FDAA 3ZNOA 1Y1PA 4F6LA 4IIVA 4ZGWA 1O8CA 1ONOA 3FBGA 1SZJG 4BNJA 3AWDA 4YRDA 4K9DA 1DHRA 3PHLA 4XDYA 5JC1A 2QRLA 5CFZA 4DRYA 2BGMA 5KVCA 1SOVA 4W7IA 3DWFA 2P4HX 2JD0A 3ZWPA 2W8ZA 1AXEA 2NQ8A 3JQ9C 4JJIA 2XXBA 3JQCA 2Y67A 4LK3A 4AJLA 2VUSA 1ZK3A 2ZB8A 1KEVA 3T7CA 3ZWXA 1D8AA 1YJ8A 4ALNA 3WNQA 2WM3A 1G6KA 1PJBA 2GZ2A 4XJTA 3OA0A 3CZMA 1LRJA 1U3VA 1Y5RA 4EJ0A 2WD7B 3RCBA 3G0OA 3KZVA 3GK3A 4ND4A 3PDUA 2X0NA 1QLHA 3OICA 3COSA 5A02A 2DKNA 3RVDA 4BNMA 1KY4A 1LUAA 4P4GA 1WMBA 1EE2A 3AUUA 1T24A 2WMDA 3NX4A 1A71A 5C37A 2Q50A 2X23A 4NU6A 4WOJA 4D41A 1GQ2A 5AXDA 2GASA 4IMRA 3I9JA 1UDAA 2OZPA 3F4LA 4OL9A 4KTTE 4FFMA 2GN8A 3GEGA 2C5EA 3S55A 1ML3A 2HKIA 1U3WA 1KVTA 4BNYA 4QFCA 3AOEC 1UAGA 3L4SO 4B4WA 4L76A 2EP5A 2ET6A 3KYBA 3AOGA 3KB6A 4RVUA 4U7WA 4XQGA 5T67A 1EVIA 3KXDA 2PH5A 4R54A 1GCUA 4NJMB 3U4DA 3D3WB 3K8ZA 4OXKA 5G4KA 2PTGA 2BLLA 3SJ7A 3H5AA 5AYVA 4O6VA 5IXYA 2OBYA 4MP8A 4WK6A 5LDHA 3LDHA 4S1VA 2J3HA 1HRDA 1E5LA 1ADBA 3BMQB 4N54A 3RSHA 3GOHA 3DMTA 4E5NA 3ROKA 2HMWA 4J16A 5G0WA 4CR7A 2ZB4A 5ICMA 3WQQA 1BVRA 3DB2A 4HXYA 4ALIA 4FR5A 4R01A 3D1LA 1AHHA 3G17A 3JQDA 4MVJD 5I9MA 2FMUA 2GERA 2O3RA 4JP2A 1MB4A 5DBIA 4IBOA 2P5YA 3P7MA 3ZNNA 2AE1A 4KZPA 4LVCA 3EZLA 1Y8QB 1P1KA 1HXHA 1OFGA 3WGZA 2HRZA 4BO9A 3C1AA 1P0FA 1K3TA 1Q7GA 4GI2A 4J4HA 3VPGA 4BB5A 2VT2A 4FFLA 4PLZA 4WLNA 3VDQA 3VTZA 4P22A 1YE3A 1GUYA 1EUCA 4ZU3A 1E7YA 3PDJA 1ZSYA 4O59O 3T7EA 5BSFA 3FNGA 4A03A 2PKRA 4J9VA 1EDZA 4QXMA 1B0AA 2G76A 4J6FA 3V8BA 2PH3A 4PLFA 2IYOA 3A4VA 2OL4A 4YAJA 1T2DA 3GPDG 4Z9XA 4KWIA 3C85A 4NBRA 1WZEA 4XEHA 3E9QA 3RC2A 4RDHA 1U5AA 2RIRA 4CV1A 4E5PA 4CLXA 3HUDA 3HJAA 3ZV6A 3KRTA 4J7UA 4MVJA 5HWSA 1P0CA 5A3VA 2D2IA 2GPTA 1PR9A 4WEOA 1AHIA 1VL6A 4NK4A 1U2GA 2QZ9A 3NT4A 1MFPA 2AW5A 4WJZA 5ILGA 3JQFA 2X5JO 1NM5A 2EKQA 1A7AA 1N5DA 1V6AA 3DDNA 1X13A 4QTZA 3PFFA 4IZIA 3RC1A 3U09A 4CODB 1FJHA 4IDBA 1O5IA 4FGSA 4QX6A 4MO2A 4M54A 4PG8A 3P2OA 2QYSA 3DBRA 2DBZA 1EK6A 3AK4A 1XU7A 2C82A 2AMFA 3ZWNA 2BHLA 1A4IA 3WGGA 4MKZA 5T57A 5L95A 3PIDA 1DSSG 3ZHYA 3ZU3A 1V9LA 4NZ9A 3AY6A 4ZRMA 1GYRA 3Q9UA 5T64A 4OOFA 2VN8A 1G0OA 3D7LA 3L6OO 4IS2A 1QYCA 2CSUA 4MP6A 3OEWA 3R6DA 3GVXA 3JQGB 1GYPA 3VPSA 1BXZA 1MX3A 2YFQA 4OSPA 1IE3A 3I23A 3K30A 5AXCA 1EVJA 4BO7A 3SJUA 1DFIA 2DT5A 2Y68A 2HO5A 2IXBA 4GMGA 4L4XA 4M87A 5MDHA 1W0CA 4NBWA 4AICA 3QVTA 2XAAA 3ZHXA 4E2ZA 1LLCA 3H7AA 1JDJA 3OHSX 2VNAA 3HN2A 3NV9A 2JJYA 3JYPA 4OO3A 5F3RA 3EAGA 4YJFA 3WMWA 4HADA 1JW9B 4J1NA 1VJ1A 5LC1A 1B26A 5ITWA 3FNEA 1W4ZA 2Q1SA 3JQBA 3LVFO 2D1YA 4GSKA 1JVSA 3H3FA 3DAPA 3D0OA 3KV3O 3A1NA 1H9BA 5EPOA 2C2XA 3MJSA 1HDGO 1LTHR 2BFMA 2PGLA 1B8VA 4MINA 4RPHA 5FI5A 3HDJA 1P31A 2AE2A 4LISA 2DC1A 1KY5A 2ZJ1A 2R6JA 1YBVA 2VRBA 2UVDA 3BTVA 4MVJG 2V6MA 1L7DA 2WE8A 3RASA 1OI7A 1V0JA 2FSSA 3Q6IA 4TKMA 3GVCA 4PVDA 4YWJA 1GV1A 3P2YA 4CMIA 1ZK1A 1MXFA 2VCYA 4DLBA 2QX7A 1ISGA 3GUYA 1ADFA 3D64A 5TGDA 1HEUA 4C7KA 3V1TC 2I67A 2CDAA 4W9NA 3WB9A 5CDSA 3K6JA 2GYYA 4CM5A 1ONPA 2FPGA 1WLYA 1K2WA 4EDFA 3DOJA 2FPPA 4M49A 1Y8RA 2O3QA 1MXHA 1VKNA 3OFSA 4RGBA 4AFNA 1HYHA 2AQHA 1K5HA 1B15A 1K6XA 4WEQA 3T4XA 3TOZA 4YYZA 4FS3A 2D4AA 2YUTA 3WS7A 1AGNA 2O23A 4ND3A 4P38A 1GADO 3AI3A 4CLOB 3C24A 3WQSB 5CAEA 3TPCA 3DZBA 1R15A 4BO5A 1WP4A 2JL1A 4IDDA 3OQBA 2ZCUA 5GZ6A 3PQFA 5DBGA 2SCUA 4RF2A 5CDUA 3PJGA 4NNJA 2EG9A 5JSFA 3A9WA 5IG2A 3GRKA 4WUVA 1P1IA 2VHVA 3DHYA 4DC0A 4CM9D 3QVXA 3WLEA 4OYRA 2PD6A 4ALMA 5T8KA 4E30A 3PXXA 3VH2A 5CP8A 1CETA 4TRRA 5IF3A 3PP8A 4M89A 1UXJA 1DBVO 3CSDA 5MGBA 4RV9A 3U4HA 3AJRA 3FF4A 1X15A 2J3JA 4XRRA 4CM4A 1MG5A 4XYBA 4NBTA 1BMDA 1SB9A 2RCYA 3VH3A 1I3KA 2O3TA 3HN7A 4RORA 3IKTA 3QWBA 2J6IA 1LSSA 4J4TA 4Y6SA 4ZQBA 1QRRA 1YONA 1PS0A 2P9EA 3E82A 5TIIA 5A1TA 4DWVA 4BKPA 3BMNA 1LDEA 2Z95A 1JTVA 3G79A 4KUHA 2FOIA 2EKPA 3X2FA 1KOLA 2WYVA 4EZBA 1VJTA 1QKIA 2Z5LA 3DZKA 1DDOA 2C2YA 3O8QB 4NPCA 1M2WA 1C1DB 3WBBA 4BL5A 3LF2A 4CM9A 3WJ7A 1W6UA 1P44A 5I7EA 3VKUA 4AJEA 4I08A 4NG5A 3S2GA 1X7DA 2TMDA 4EEZA 5JS6A 2EERA 2YW9A 3CMMA 4BGEA 1DXYA 1FDTA 3ANNA 4BQPA 3SEFA 4BIIA 3W4KA 3KSDO 3JV7A 4XGNA 2FZWA 4OQZA 1CIVA 4CMCA 4UULA 1N92A 1KVRA 3V1UA 2HLPA 3PWZA 2VWPA 4IY1A 4CMGA 1EE9A 2OFPA 1E6EA 3I1JA 3INTA 3QSGA 3A06A 3LYLA 3RBVA 3S1LA 3E18A 4M1QA 4BGIA 1LI4A 2BMAA 4DMMA 4NK5A 5JDCA 1AN9A 1F14A 5KJEA 3U0BA 2NADA 4RPKA 4JXKA 1WNTA 3MOGA 3VH1A 1YJQA 4FFNA 2F00A 4MJLA 1ZEMA 1E7WA 3NT5A 1ZCJA 4GWGA 3GHYA 4S3MA 1S6YA 4XJSA 5DP2A 1SMKA 4J9UE 3B1JA 1EVYA 1GL3A 5DDIP 7MDHA 4TZTA 2X4GA 1Z7BA 2W90A 2DUWA 2HMSA 2HAEA 3FTPA 4JCOA 4O63O 1ID1A 3AI1A 1JWAB 2H5LA 2X0RA 1DFHA 5JXWA 3BHMA 3ZCXA 5F21A 3V2HA 1J49A 4O1MA 4BNNA 3I83A 2C07A 4K1LA 5JPIA 6LDHA 2VTDA 1AE1A 4HNHA 2P68A 3VZRA 3VC7A 1DB3A 1X0VA 3GH3A 2GNAA 1MC5A 4A2CA 1Z75A 4WLVA 2IE0A 5KKCA 2VHWA 3ZWMA 5JAIA 4FGWA 4J3FA 5AOVA 3HB5X 1UXGA 3HE3A 4W6ZA 1GPDG 1N1EA 2Q2WA 2Y0DA 2HK9A 4ND2A 4E5KA 1BGVA 4KTVE 3WYBA 3RU7A 1A7KA 2EGHA 4BO3A 2YYYA 1NQOA 3IP3A 4UEOA 2OXIA 1IOLA 3JQ7A 1D1TA 3I6QA 3H9EO 3V5NA 1V3TA 1Y81A 3RFTA 1ZO8A 3U5TA 1IHXA 1U28A 2VHXA 1XQ6A 4E31A 1YOVA 4CM6A 1TI7A 1ZNQO 3VKVA 5TLSA 1VPDA 4J90A 3BIOA 1ZVMA 1Z45A 3C3XA 4WNCA 5LCXA 1NWHA 3JD0A 4YR9A 5DF1A 3GN1A 4N5LA 4R5HA 4P4LA 4B3HA 1LA2A 3QVSA 1VLLA 4JIGA 4OXYA 4Z3DA 3OM9A 1MGOA 1F8FA 1IY8A 4ZD6A 5L3ZA 5DP1A 3DOCA 2UAGA 1T2CA 2DUUA 2ZJ0A 1A27A 1YS4A 4ALKA 1B14A 4DBZA 3I9OA 5G4KB 4EYEA 1EFKA 2FRDA 3EYWA 2FN7A 4YDRA 4Z0PA 1D4FA 1VE9A 3L77A 3LSYA 3ZWOA 4Z3KA 1UP4A 3FPLA 5TJHA 1I30A 1U1IA 1R4NA 3GLQA 4Z9YA 3UAGA 1P33A 3GFBA 4RVGA 2QQ5A 1B8PA 1ULUA 3M1AA 2PD4A 3QHAA 2XPCA 3PLNA 1E1KA 3CZRA 1PZHA 3WIEA 4PZEA 1KBZA 4GLOA 2PNFA 4DYVA 2YFHA 2B4RO 3BHIA 2VUTA 3JQAD 4Y9DA 3WJAA 4GX1A 2I9PA 3JSAA 3KOUA 3DC2A 3WYCA 3ASUA 1DRVA 1O95A 1KC3A 2Q49A 3AY3A 1JQBA 4B8WA 3ONFA 4PZDA 2PKQP 3I9NA 4I9HA 1FF9A 2VOJA 2NM0A 5CG2A 2J5QA 3TWOA 3NDJA 3F4BA 4QT0A 2Y1GA 3U4CA 2QZZA 5C7OO 1OMOA 3EUWA 3PFWO 3PGXA 3PPIA 5G2OA 3VPFA 1I8TA 5TT1A 2B37A 4PN3A 4CUKA 3GRPA 1NNUA 1ADGA 3CINA 1GEGA 5DBFA 1ZEJA 3OJFA 2E4AA 2J5RA 2EV9A 3IKVA 4DIFA 2OP0A 1LDGA 1ZH8A 4IJVA 4R5MA 1QYWA 1GPJA 3JQ8A 2AQ8A 3RBZA 3OP4A 4TVBA 3BTOA 3GAFA 2DPGA 4OH1A 3GR6A 4ND1A 4D43A 2IRWA 3JQAA 2UUPA 1CJCA 4E2XA 4RZHA 3JYNA 4KMSA 3ANLA 1T4DA 3UVEA 1ADCA 2DBQA 2IZ1A 3TL3A 1LEHA 5JCJD 1H5QA 3Q2KA 3JD1A 1HZJA 1GU7A 3QIVA 1CF2O 5EJ2A 3Q9NA 4BNTA 1LLQA 3AUSA 1FMCA 1BG6A 1NVTA 1PSDA 2F1KA 2PZJA 3DBRB 1DC4A 4PCVA 2VWHA 4WCFA 4C4OA 2X9VA 1O89A 1PGOA 4XDZA 4LSMA 3RC9A 2IXAA 1OC2A 4UVEA 5HTOA 1HDXA 3WOHA 4EJMA 2BI8A 3H2SA 4YJHA 3TOXA 3WMXA 1ZBQA 3TQHA 4H3VA 3GVPA 1RM5A 1KIFA 4MVJM 3DFUA 4OOEA 1PIWA 4U5QA 4N5MA 4UVDA 4FD3A 3ZNPA 1WWKA 1ZSVA 3LC2O 3VZPA 3D4NA 4BKOA 4EJ6A 1F06A 2B83A 2GRAA 4CM1A 2LDBA 3D4OA 5JCJA 4DQXA 4G5HA 1J0XO 2XF8A 1ZW1A 3WGQA 2AEJA 2OBNA 4AJ4A 2NNLD 1N1GA 1XYGA 5THQA 1Q7CA 1PGPA 1VL0A 3MWEB 4CMHA 4HFMA 3B1KA 1GYQA 3GZNA 5U1PA 3IAHA 1B3BA 4XD2A 4RVFA 5A5FA 3TJRA 1PWZA 4IDFA 4YJFB 3HWRA 5JBIA 2RH4A 2QRKA 3ETGA 4IZHA 3WNVA 4D45A 2X7HA 3DTYA 4I5EA 3WR5A 5I9LA 5HRUA 3WGIA 1XEAA 3L9XA 4IDAA 1EUDA 3P19A 5THKA 2Y1OA 4GKVA 2HJRA 2V6GA 3JQEA 1PQUA 1ZIDA 3VHRA 1M6HA 4CMIB 4XQ9A 4YBZA 4YQYA 2C7GA 2W98A 3KUXA 1JA9A 5CHEA 4F6CA 3GY0A 3PHGA 2QHXA 1UZLA 3KETA 5KIAA 3EGOA 3IQDB 2C5AA 4P8RA 1YDWA 4NFSA 3DHNA 2EJVA 2ZCVA 2JCXA 4HP8A 3C8MA 1QV7A 3D5QA 1Y8RB 3IS3A 4Y6RA 3TZCA 1T2EA 3AW9A 3SBOA 5BSEA 3X2EA 1WMAA 4U0KA 1DO8A 3FN4A 1VSUA 3TRIA 1GDHA 1HSZA 2Q4EA 4LCEA 3DQPA 1YVEI 4PLTA 3Q3CA 2C20A 1YQXA 1LU9A 2BI7A 1YRLA 3NTRA 1XHLA 1RWBA 4JBIA 5L7WA 1T4BA 4PRKA 1SO8A 4UVHA 3MJ4A 5JMWA 1K6IA 1SNYA 5BR7A 2OGUA 3AU8A 3M6IA 1RM3A 2VYND 5IZCC 3E9NA 1YL5A 3BTUA 1W8DA 2YHUA 1CDOA 3F46A 3TSCA 3WIDA 1R12A 1YDEA 4II3A 3CMCO 4LMRA 4MOWA 1HDCA 3WWYA 1CYDA 4HV4A 1XLTA 1J5PA 1P74A 4XGIA 2QIOA 4DQUA 2VRCD 4J49A 3UOGA 4CQLA 5B4TA 3OECA 1DJQA 1FDUA 1SC6A 2OORA 5JLAA 2X9GA 3CUKA 3BMNB 1TA4A 1R37A 3GN2A 4KDFA 1DC5A 3W8FA 4BO6A 4R1UA 5CG1A 1Q2XA 1A72A 1A5ZA 3F47A 3VOSA 1WVGA 5L9AA 2E48A 3UH1A 4KQXA 1CERA 2A94A 3STHA 1A9ZA 2O3UA 4Q3CA 1X14A 1DIBA 4AJ1A 2D59A 3L0DA 1PU2A 4GH5A 4WE3A 1HDYA 2B69A 3L07A 1UXIA 4GSLA 2DTDA 3QV1A 1I33A 1K6JA 4BNVA 1B7GO 1ZFNA 3JYLA 4Y98A 4DLLA 2I76A 2CDBA 1X7HA 3DHEA 3E9MA 2FWMX 3UKOA 1OBFO 1UJMA 8ADHA 1SEVA 1NBOA 3PWSA 4J1SA 3TZHA 4W4TA 1HLDA 2PV7A 3GHHA 2POQX 1HT0A 2VRCA 5CDTA 2R00C 2XOXA 3IUPA 4H16A 4BMNA 1LSUA 4YT8A 3LT4A 2HDHA 1YGYA 3GNSA 1DLJA 4L74A 5L40A 4JN6B 2CMDA 4BMVA 2H1SA 3QY9A 4DBVO 5CEJA 4K28A 1YH3A 1GUZA 1NP3A 1KEWA 3JQ6A 4GVLA 3NJ4A 3H4VA 3UGKA 3O03A 4A0SA 4CMEC 3PZBA 1E1LA 2DTXA 3KM0A 1TXGA 2AG8A 3KO8A 2H63A 3ABIA 2GN4A 2VQ3A 1N7HA 4K6FA 1VL8A 1Z73A 1P45A 3VH4A 1F17A 3ROMA 4R51A 1DIHA 3MZ0A 4XA8A 5F1KA 1U8FO 2YDXA 3DZGA 4Q3AA 4KP7A 2X5KO 2FY8A 4X54A 3IC5A 1H93A 3NRCA 3QE3A 4IJWA 4YAGA 4E33A 3KYCA 1NVMB 3I9LA 1ISMA 1EUZA 2JFHA 2NTNA 2RHCA 1DEHA 2HUNA 3ULKA 1FDVA 4G81A 1UUFA 4FOOA 4YJDA 4UEKA 3WGHA 1PGQA 1LC3A 3LLSA 2ZYDA 3RJ5A 2BFOA 3QWIA 1JKFA 5A4DA 4B4UA 4HNGA 4B3IA 1NYTA 2W2LD 4OM8A 2AEFA 2HMUA 2O3JA 4BO1A 3EY4A 4IIUA 4K6CA 4MPDA 5K6AC 3WSWA 2GN6A 3KSZO 5G0UA 5F5NA 1UP6A 4L0QA 4L75A 4MP3A 3HADA 4BUCA 4E4YA 3H9QA 1C1XA 2W2KA 3INRA 1X0XA 4CV3A 5JC8A 3ORFA 1M76A 1XWFA 1H2HA 2PA3A 2UV8A 4PLWA 4GX0A 4I9UA 1YB5A 3MTJA 3ZDFA 1OZAA 3ZNQA 3MJEA 5IN5A 4Y67A 1ONNA 5TF4A 4LVUA 4Z9FA 2O7SA 3L4BC 3RFVA 2CF5A 2O2SA 3H8VA 5I7VA 3H5RA 4CR6A 4J7XA 3OJOA 4CMAA 4DIOA 1ORRA 5U9CA 1ZK2A 2W2LA 5C7IO 3OIGA 4I5GA 4FN4A 2O2YA 3RAJA 5BNTA 3ZH2A 3B20A 1PL8A 2I6TA 3F9IA 1IL0A 3IJRA 4BGVA 4BO2A 3OJEA 3PIIA 4NR0A 2X1HA 2ZYGA 5JDIA 1KYQA 2C7VA 2UUOA 2J5KA 2DTEA 1F8GA 1RPNA 1U4SA 1XGKA 4BNGA 5KKAA 3UXYA 3W4JA 2I3GA 3N58A 3ONDA 3GFGA 3ZN2A 2NU7A 1XU9A 5B4UA 2GN9A 4JBGA 1PL6A 5ADHA 5ICSA 4UREA 3GGOA 3GUCA 3E1KA 1C14A 3QQPA 5CEEA 3S2FA 3FRJA 3U9LA 2WD8A 3SC4A 4YA6A 4Z0TA 3WTCA 3ENNA 4PLVA 3ZW8A 2C54A 1VI2A 4JQCA 5L53A 3NDRA 4Q3NA 4E32A 3UFXA 3K2BA 5KJ1A 2X6TA 4BGUA 1PJTA 1Q7BA 1TT5B 1BWSA 4I5DA 4EBFA 3ON5A 2ILTA 3PLRA 5JY1A 3G1UA 4MKXA 5C7LO 1XQ1A 4GLLA 5K9ZA 1IHYA 1AUPA 3PYLA 2J3KA 3GEMA 1B2LA 3HFGA 1UXHA 5KCZA 4HFNA 5IDQA 1D7OA 1PJCA 2ZB3A 3PJFA 1QR6A 1M66A 3JCZA 2YV1A 2B35A 1NAHA 3DBVO 5EN4A 1KVSA 5COAA 4D3FA 3GEDA 1ISJA 1C0PA 1UR5A 5HM8A 1DAOA 4RCVA 3CE6A 1E5QA 3M1LA 3RU9A 3FTNA 3JQ8B 4CUJA 3ZI0A 1DFGA 2JHGA 5COBA 3BYZA 4CLRA 5DZSA 4WLEA 5DCYA 5H82A 5BQFA 3JQAB 3IDSA 1NPYA 5BSHA 4YPOA 1E3IA 4L4SA 3OQ1A 3OJLA 4AG3A 5GZ1A 2B5WA 4GGPA 5AQ1A 4BHTA 3P5SA 2AEMA 1HE2A 7ADHA 2DVMA 2NU9A 3A14A 3EK2A 1XDWA 5ER9A 3RFXA 1BW9A 3RJ9A 1ARZA 3F1LA 4DQVA 4ITUA 1LDMA 4IXWA 1LQTA 5DULA 4EW6A 2QRJA 5AXAA 3GA0A 1O0SA 2BFAA 2EKLA 4BNLA 2H9IA 2Y1DA 4CV2A 4NFYA 4ZQEA 3W1VA 3ZV5A 4WCFB 2DM6A 1DAPA 3H2ZA 5ENVA 4RLHA 3KLPX 4HWKA 3W8EA 4KUEA 3TFQA 3ITKA 3Q11A 2G5CA 1P1JA 4WLOA 3BTSA 3V2GA 3S8MA 1CQJA 1K89A 4YJHB 4DMLA 4IDCA 1V35A 5G0TA 4ZJUA 1QMGA 3WGTA 1WPQA 1DRUA 2NWQA 4FC7A 1F12A 4Z6KA 3AI2A 1QP8A 3FPCA 1AXGA 3MEQA 4A7PA 4XWYA 3GDOA 1KC1A 2V65A 3DMTC 1C3VA 3R3JA 4AL4A 4NDNE 1Y6JA 4GX2A 3RUIA 4FJ2A 3JQ9A 3OSUA 1K0UA 5TNXA 3WDSA 1NFFA 2UYYA 1N8KA 3UN1A 1JLLA 4HY3A 1FXSA 3V2UA 4J1QA 4ZQFA 2J8ZA 3GZNB 3I3OA 3LC1O 5L4NA 5L45A 1Q1NA 1IUKA 3KVOA 1UDCA 1DC3A 3K96A 5KJCA 3ZWAA 4PG7A 3ZHZA 4WKGA 2PZMA 3HFSA 1QG6A 1I5RA 3PHHA 5A06A 1NQAO 1R16A 1M6WA 1U4OA 4GGOA 2DQ4A 4YT4A 3E03A 4DTIA 3PHJA 4OMUA 3MTGA 1DC6A 4XYMA 4E12A 1ENPA 2ZTMA 3TFOA 1QV6A 2P9GA 4LCJA 1HETA 2I5PO 3N74A 3N7UA 3GGPA 2A35A 1I2BA 2EGGA 5HBRA 1GUFA 5DOVA 4FBGA 2WSBA 2O3SA 5JW6A 4U8GA 1CWUA 3I4CA 3NYWA 1CEQA 4CMBA 2X86A 3FNHA 3WGYA 1UAYA 2AA3A 4BNXA 1PGJA 3W8DA 3AOEA 1XCBA 1EK5A 2YQ5A 1E3WA 1E7QA 2IYPA 4IDGA 4PG4A 4UEJA 2VYVD 3GMDA 3NT2A 3SX2A 4XYEA 4CV0A 1Y9EA 1PX0A 1ISFA 4XZ3A 2BGKA 2VHYA 5FWNA 2JHFA 2EW2A 4YJGA 1PZEA 2GSDA 4RZIA 4JROA 3VDRA 4YT5A 4NJOA 4AJKA 1LX6A 3JQFC 3ONEA 3G3EA 4YAEA 1HZZA 1LDNA 4CUZA 3RIHA 4E6PA 4R69A 3DOOA 2OOSA 4BMSA 4BB6A 4RPGA 4RJTA 4NQZA 3RUHA 4JBHA 1PTJA 2BD0A 5EESA 3LT2A 4RPJA 3QRWA 5BNIA 1YBAA 4L4RA 3ANMA 2WJPA 3ZWBA 2BF7A 2CY0A 1FK8A 4W7HA 1U3TA 4MVJE 4PLGA 2O4UX 3RUDA 4LW8A 3U3XA 3ZU5A 1HYEA 3E8XA 4K26A 4PZCA 4NH4A 2FR8A 3EZYA 3LZ6A 4RQUA 4UVIA 2IODA 3PWKA 2VYVA 3PRJA 2A9FA 3UHAA 3LC7O 5BSGA 4Q39A 2EJWA 3O4RA 4W99A 3RUCA 4KQWA 2IDZA 2NTJA 2VUUA 2RH8A 3D5TA 3OJ0A 1VRWA 4NI5A 2HMVA 3ZWWA 3L6EA 4FJ0A 3K9QO 3HB4X 4PRLA 4CQLB 1HKUA 4F46A 4TQGA 1U2DA 1NHGA 3ADOA 2P2SA 1KERA 1R0LA 3KEOA 3OH8A 4BNWA 1E1MA 3B6ZA 1H6BA 1V8BA 2EW8A 3W6UA 1DRWA 5I9NA 4QUKA 3ZV4A 4L9RA 5A5EA 4P4NA 2Q1WA 2YDYA 5IN4A 3JQBC 3GDGA 4I9NA 5FI3A 2W4QA 4R3NA 3PYMA 2P9CA 4J7CA 1RKXA 1R0KA 1V3UA 5JMPA 4EUHA 3WLFA 2C29D 2Z1NA 2WEKA 1SPXA 1PJ2A 4IINA 4AJNA 1UDBA 3AM4A 3VAZA 1ZJZA 3WYEA 2VZ0A 4UAGA 2JCVA 2GO1A 3NTOA 4JLWA 5IDXA 2H6EA 3PQEA 3WBFA 2I3AA 4BQRA 4J0FA 4DXHA 4W9NC 4ROSA 2GUGA 3VVCA 2DAPA 2IEBA 1EQUA 2B4QA 5A04A 4D7AA 1BHSA 5JFOA 1XA0A 1I32A 3PJDA 2HJSA 4C7JA 2AHRA 2R2GA 3RC7A 3NTQA 4A26A 3PZRA 5B12A 1T26A 3ZWYA 4YAIA 1GR0A 3FSRA 3ICPA 3K5PA 5IAAA 1JN0A 1MC4A 4YXFA 4PLHA 4YAKA 2YV3A 1NPDA 3GNTA 4OKNA 4FIZA 2ZQZA 5BNFA 4WCDA 2G0TA 1YB1A 3RQSA 1SCUA 3H65A 3HSKA 5TRTA 4NBVA 3PK0A 2V7PA 4ND5A 1LLUA 2OUIA 5IDYA 2EEZA 2C0CA 4B4VA 4AVYA 3KYCB 1PZGA 1DHTA 4UUOA 4D42A 4NHEA 4BO8A 4XB2A 4HBGA 4AJHA 4E2YA 4XYLA 4NMHA 1PWXA 4WLFA 1EVZA 1U7TA 4LGVA 4RL6A 2V6FA 5T8KC 3WQRA 3MWDB 2O48X 1VJ0A 3B70A 4U6QA 1PJSA 2BELA 4JX8A 3F5QA 4QQRA 5F1OA 4KWHA 1Y9AA 4DL9A 3C7AA 3PI7A 5B37A 2NVUA 5IDWA 1HF3A 1IULA 4GAEA 3FHLA 2ZTUA 3OEYA 4O0LA 2PZKA 2WWRA 4LSWA 5KNLA 3I9MA 3TL2A 5B1YA 1LC0A 4GPD1 1O9BA 2RHRA 1JVBA 4BKQA 3ZV3A 2VZ9A 4UUMA 4R1SA 4F3YA 4F45A 1C1XB 2W2KB 1O6ZA 3EDMA 4PG5A 3OETA 4HFRA 2NSDA 2OP1A 5JO9A 1PZFA 2HQ1A 1JAXA 4DIBA 1CRWG 2I65A 3WWZA 5IXSA 1E7SA 4PFJA 4IQ0A 1I10A 4KUGA 4FB5A 1MP0A 1SOWA 2WDZA 4JJFA 2ZTLA 1RM4A 3AM3A 3MJCA 3HNPA 5JE8A 3HDHA 3QVOA 4KOAA 5CPFA 1R4MA 3BHJA 4TVOA 5L7YA 4AJJA 2AQKA 2UDPA 3E5RA 4XQEA 1ZXLA 1PJ4A 2O7QA 4TRNA 1KEUA 1UZNA 1VM6A 3ZU2A 2FPIA 2WTBA 1KEPA 1T1RA 3QVWA 3D4PA 2Y93A 2YJZA 4LMPA 3AFMA 4CM8A 2YHIA 5FEUA 4RO0A 1RM0A 4GWKA 4CPDA 4BNKA 5JDCC 2B4TO 2DPHA 3KLMX 4JJGA 1OAAA 5CDYA 2ZYAA 4AJ2A 4DPKA 2O50A 4L73A 5HA5A 3U4IA 3JYOA 3OA2A 2X0IA 4IPTA 4GMFA 3AFNA 3KYDA 4CR8A 4MVJH 5A9SA 4R3WA 5F5LA 3DONA 3H9JA 1XKQA 1ENZA 1PS9A 1T25A 3DAGA 3GF4A 5CPBA 2Y66A 2NVWA 1LNQA 1Q0QA 3WSVA 5EERA 2B36A 2JCYA 4Q9NA 3L6DA 3RWBA 2PGDA 4IXTA 3VVBA 3BMCA 3FNFA 1UP7A 2GCGA 3D3EA 3BXXA 2GDZA 4PLCA 1DPGA 3GZ4A 4XQCA 1Z74A 4E13A 4D44A 3FWNA 4URFA 4WNIA 4RVSA 4YCAA 3TDKA 4PG6A 1WDLA 1LXCA 4B7CA 1GZ3A 3DBHA 4IQGA 3MCVA 4RF4A 1YWGO 3GAZA 3JD3A 1C0KA 4MVJP 1P1RA 3ZU4A 2PFGA 1PL7A 5JYEA 3AY7A 3IJPA 1X1TA 3PQDA 1GV0A 4BV8A 3UCXA 4J91A 1ZMTA 1H2BA 4R1TA 3GPIA 4IUYA 5FF9A 2WYUA 2GGSA 2X0JA 3FR7A 4ALLA 2XXJA 3EHEA 1BXGA 4R4JA 4CM4B 2Y1EA 2RAFA 3FI9A 2P5UA 1T2FA 1PS8A 1YXMA 1ZZEA 2X58A 3VZQA 4DPMA 5G0SA 3M2TA 1NPTO 3E5MA 5K0ZA 4CLRB 2E49A 4XYGA 4BNIA 1HWYA 4PGFA 3KEQA 3CXRA 4CQMD 1LLDA 3FD8A 1U7HA 2E82A 2GR9A 1HSOA 5I8WA 3ADPA 3S2IA 3QA9A 3U49A 5BT9A 3VPXA 1NR1A 2CDCA 1I2CA 3C1OA 5GMOA 3DBLA 2VYNA 1BW9B 1Z7EA 1XSEA 1FDWA 2IZ0A 3QJ5A 1PEDA 1D3AA 3HG7A 4MIYA 5EQDA 5U4QA 3RUFA 1E3SA 4N18A 5CDGA 2Q4BA 5IZ4A 1VSVA 2ZTVA 1HE4A 2C59A 2OHXA 1HLPA 1N2SA 1YO6A 1LQUA 1J4AA 3PEFA 1NHWA 1BXKA 1Y5MA 5GY7A 3PTZA 2BKAA 4CMJA 3NDIA 4EUFA 5A9RA 3LK7A 4HX5A 1GZ6A 1Q0HA 5A9TA 4CLHA 2Y0CA 3AU9A 4LN1A 3S2EA 3HZZA 1I36A 1E3JA 2EIHA 1GAEO 3UUWA 2FR0A 1ENOA 2Y1FA 4MVJF 1HL3A 4IQ8A 2FR1A 2JD2A 4NU5A 4OAQA 1E7RA 3H5NA 1TEHA 2CF6A 2DLDA 4CQMA 4D0SA 1BRMA 1KVUA 3DL2A 4J0EA 2X8LA 3FBTA 5ITVA 1I24A 1QXSA 2JFGA 3TF5A 4ZN6A 1HE5A 2O4CA 2NTVA 5C5IA 4AJIA 5ILOA 1LDYA 3GG2A 2NLOA 3R3SA 1U9JA 4R41A 1JAYA 2ZQYA 3ETDA 4XB1A 2E37A 4FFPA 4OHUA 4HUJA 3DEYX 5F1PA 2FP4A 2ZIZA 3TZKA 3WFJA 1E0DA 5AXBA 3G1TA 4WLUA 3QP9A 4J2OA 5IJZA 2IZZA 1E7MA 1JU9A 3GT0A 1C0LA 6ADHA 4ZQHA 4Q3BA 4GVXA 4R9RA 2D5AA 3GNQA 3F1KA 1N9GA 9LDBA 1TVEA 1QORA 4BOYA 4DPLA 2X5OA 1I3NA 1RYDA 4OSOA 1QYVA 3RROA 4E21A 3R1IA 5TJ9A 1YQGA 3L9WA 3A28A 3QWFA 3KTDA 1X1EA 1MLDA 3OIDA 4YB8A 1NXQA 4WGGA 3GVHA 5DOZA 1WXDA 3O38A 5JAZA 5JAMA 1O94A 5KVSA 3LF1A 1DIRA 2VT3A 1BDBA 1BTOA 3FCOA 2EF1A 1XELA 1E3EA 1E3WB 2Q99A 3BMOA 3Q0EA 1WZIA 4GQAA 3IUSA 2WE7A 1LDBA 3BZUA 3IOYA 3NGXA 4PVCA 3IP1A 1ZK0A 3OMLA 1G0NA 1MA0A 3AM5A 2GLXA 3JQ7B 4JGBA 5ENDA 4YJGB 1KVQA 3K92A 1E6WA 3RUAA 4MDHA 1OC4A 1UXKA 2D8AA 4ZQGA 2Q1TA 1YOVB 4I1IA 4I5FA 1WDMA 3F6YA 1BVUA 5KOIA 1HDOA 3C1TA 4H7PA 4OIMA 2PWZA 4ZRNA 2JKVA 1P1HA 3CTMA 1LSOA 4CMKA 4D3SA 1H6AA 3RBXA 4WCFC 4EGFA 5L7TA 2NACA 1P1FA 3GDFA 4YT2A 3WTBA 1J6UA 1ZXBA 1NQTA 2BFPA 3JD4A 4TRMA 1T1SA 5H83A 4TSKA 4YTEA 4G2NA 1EMDA 3GGGA 2PK3A 4YQZA 3W4IA 2J3IA 1P77A 4IJKA 5TX7A 3HDYA 5JNLA 5L4LA 4EEXA 4W82A 3ZWCA 1R4NB 2JAPA 3CH6A 4CL8A 9LDTA 4QO7A 3EVNA 5A3JA 4FJ1A 4CM7A 3I6IA 3ZW9A 5G0VA 4Q3EA 3C7DB 4E5MA 2Q2QA 2YY7A 2EWMA 3LT1A 2BRUA 2VOEA 3TZ6A 3HHPA 4D3DA 4CJXA 2WD7A 1U3UA 3DZFA 4MIEA 2PLAA 2HSDA 2CUKA 1F0YA 1GQYA 5KJ6A 1N7GA 4DYDA 1G1AA 1HTBA 3DMYA 3DXFA 5EMHA 4BKRA 3ITDA 1NASA 3UF0A 2VWQA 1QYXA 4D79A 4ZHSA 4UVGA 5TS3A 2PY6A 5KVQA 1DIAA 3ASVA 5KVVA 3EC7A 4OKIA 2ZK7A 3ZWVA 1IZ0A 2RBEA 2YZ7A 2VHZA 1PR3A 2Q3EA 1MV8A 3NKLA 4M86A 5KJFA 3BAZA 5DT9A 1M67A 3DO5A 3I4FA 2Q45A 5CEFA 1JKIA 1LJ8A 1I3LA 1SAYA 1ZKMA 1SB8A 5ER6A 3I9KA 5I7FA 3IIEA 3MJVA 5EIOA 1GQQA 4J43A 2DFVA 4NJMA 3D3WA 4IGEA 4GX5A 3GG9A 1PJLA 3DAFA 3JD2A 3O26A 4OQYA 3WG9A 1XG5A 2BH9A 3SC6A 3PGJA 4RQTA 3BMQA 4XIYA 2PZLA 3OQ6A 4XCVA 1NX6A 1UZMA 4E0BA 3CKYA 5TQVA 3DZIA 2CFCA 4A27A 1U8XX 2GF2A 5GZ3A 1LBEA 1YBMA 3WXBA 3HDQA 4II2A 3R0IA 4OGWA 1P3DA 2DBRA 2DFDA 2B0JA 4CLDA 5ES3A 3CIFA 1H0KA 4PLYA 4B7XA 4TRJA 2Z1MA 1A9YA 1HDRA 2EP7A 3I5MA 1NFQA 4IM7A 4BS9A 4CL3A 1Z82A 1XIVA 3QWHA 1ULSA 2P4QA 2QYTA 1Y8QA 1ZMOA 1YQDA 1UH5A 4B8ZA 4INAA 4XR4A 4TKLA 1E92A 1WDKA 2IEDA 4H15A 2NU6A 3K2EA 1ISIA 4M55A 4EUEA 3ZZNA 4BO0A 2Y05A 4B7UA 4BNFA 2NVUB 5HS4A 4FFRA 3RKUA 1RYEA 1E6UA 1EBFA 1S7CA 1ZSNA 2CVZA 2OO5A 3FWZA 4D0RA 3PVZA 1MFZA 5TT0A 1BDMA 3VPHA 1MG0A 3QWAA 1JKJA 1I01A 1SEPA 1Q0LA 1ZK4A 3GC6A 3DR3A 2HMTA 4BVAA 5DN9A 4IS3A 4DREA 3U62A 4YEDA 4CLEA 3WFIA 3DFZA 1E77A 5JAQA 4YRAA 3SVTA 4Y6PA 1CQIA 3LU1A 5I7SA 5A05A 4TZKA 2AXQA 1W73A 4O5OA 1I2ZA 8LDHA 4RPLA 2QG4A 1DLIA 1H6CA 2VNSA 5DNAA 5EQFA 1L1FA 3ZGYA 1NR7A 3KHUA 3WICA 1GY8A 3I52A 3K73O 4ONEA 5IFLA 5DCWA 2ZKLA 1E3LA 4MVJI 1E1NA 1Y7TA 2Q1UA 3H3JA 4LRSB 1R4MB 3RKRA 3SLGA 1TLTA 4DLAA 4FW8A 1R66A 4XX0A 4XKJA 2FHSA 2QW8A 1TB4A 5C3MA 2JAHA 5A03A 3NJ8A 1BSVA 2DBVO 4BNZA 4R16A 4TMFA 2PD3A 2Y0EA 1DOHA 1WAMA 4J1TA 4U0JA 1I3MA 3EMKA 1T2AA 4CM8B 4DVJA 4RLSA 2YHIB 3OF2A 3HQ4O 4A5OA 4N5NA 4WPGA 3T4EA 3M2PA 4PLPA 4RVHA 1L7EA 1EBUA 5H81A 3ROPA 2TMGA 4IJUA 3K31A 3RI3A 2CVQA 1DIGA 5IZCA 2JFFA 3W6ZA 4XIJA 1D1SA 1EQ2A 3DZHA 3E6AA 3JQGA 3CEAA 2I66A 4BKUA 1A4UA 3KYDB 2G82A 3G49A 4KDEA 5A9SB 4MKRA 3NEPX 1LSJA 2A92A 4Q3DA 4B79A 4GL4A 3IL2A 4AJPA 3H9UA 3LT0A 4HFJA 4OJNA 4WOKA 5KWEA 3Q2IA 3GMSA 3BMCB 2YV2A 5I8ZA 4YVFA 2PKQO 2Y99A 3PYXA 4JK3A 5B4VA 4YACA 2FSVA 3RD5A 4LRTB 5DCUA 1IB6A 1IZ9A 3NUGA 4BO4A 3DBHB 4ZICA 2CVOA 2E6UX 2P91A 1TT7A 5KTKA 1FDSA 2JD1A 1R0SA 3C7CB 2X22A 1LRLA 1GZ4A 1ZJYA 4QSMA 1OOEA 1EFLA 3KBOA 4U6SA 5TC4A 4QECA 1NVGA 3LQFA 4DUPA 4NIMA 3ETEA 5JY6A 1LRKA 1BXGB 4N7RA 4FFOA 1PQPA 2Q46A 3Q1LA 2HCTA 3UICA 4ESOA 2NU8A 4XR9A 4Y8VA 2HK7A 2CZCA 2NV6A 4BNUA 5L4SA 3UCEA 4WECA 3BA1A 4BV9A 1IPEA 3JYQA 1VKOA 4ILKA 2R00A 1PJQA 4QFDA 1YB4A 2V6BA 1H6DA 1M75A 1V3VA 4RF5A 3OBBA 2GZ1A 4IGFA 1EZ4A 2A4KA 2CD9A 2CNBA 5T6BA 2NUAA 3E48A 3WGOA 3MJTA 1B16A 4CMEA 5JYDA 4TWRA 2PR2A 2EHDA 4ALJA 3TZQA 1YL6A 3EW7A 2G1UA 1XR3A 3DBLB 1HYGA 1B3RA 4PIVA 3NGLA 2PGJA 3PJEA 4QO8A 4B4OA 5L51A 2FZEA 2HU2A 4IMPA 4RVDA 4HKTA 2AQIA 4Z0HO 4CLOA 1ISHA 3V1YA 1HE3A 3IMFA 4NBUA 2D3TA 3H9GA 3KSUA 3UCFA 4DGSA 2VZ8A 3PHIA 1KS9A 4ZVVA 4FC6A 5JDIC 5COQA 4RF3A 2HK8A 3F3SA 3VZSA 4CM3A 1TT5A 1GD1O 4J2HA 3SLKA 4GKBA 1H9AA 1GTMA 3QLJA 1C0IA 3TN7A 3MOIA 1I0ZA 1MUUA 1IYZA 3ROQA 4R68A 4ID9A 4CQMB 4DA9A 3GVIA 3RUEA 2BGLA 3AUTA 1GEEA 4TROA 5T5QA 4JNKA 2GD1O 4I8XA 3LLVA 1U5CA 3ICCA 1KETA 1PJ3A 2LDXA 3B1FA 4GBJA 5K6AA 2YQ4A 4IDEA 4XGKA 2NVBA 2Y1CA 1DJNA 4E2WA
chains in the Genus database with same CATH superfamily
5HE8A 5PGMA 4DIEA 1NAIA 1SBQA 4Q93A 1OB5A 1JHAA 4DC9A 1ZC4A 3K5IA 4L1KA 3VTFA 3MWLA 4ZT4A 1XPRA 3C15C 4C06A 1PQWA 3E7WA 3K2IA 2ZJYA 3LQKA 3V00A 1P9LA 3UYLA 1H94A 2NQTA 3O8QA 5J1SB 3TZBA 1NNLA 1M2OB 2DPYA 4S1NA 5GJCA 4UMFA 2XH8A 2HW8A 2D0IA 1G4AE 3BB4A 2Q8QA 4B3DA 1SBYA 4PHCA 4AF7A 4BFLA 4K0RA 4E3ZA 2PUEA 1M1ZA 5KMGA 4EI2A 4PZAA 4LX8A 1YUBA 3PDCA 4ZYVA 1EDOA 4B34A 4FGLA 5AVOA 4A73A 3QJGA 4Q12A 5K0LA 4FOSA 3RTDA 1QGZA 2G63A 3ELUA 4ZYZA 4G1VA 2KX7A 3SKYA 4U9HS 5KSZA 2C9ZA 2X9NA 3SXPA 2YJ6A 2R6DA 3KQOA 5FFFA 5JZ9A 2JFOA 3CURA 1Q91A 2RKWA 4KXLA 1B6RA 4OJTA 1AQLA 4RJKA 4WSOA 2HRBA 1OIVA 2IU3A 2G08A 1J70A 4PBTA 4PNHA 4IKEA 4UEWA 4FSHA 2Q5CA 3K0AA 3EXFA 3A1EA 3OJCA 1HPLA 2UKDA 1YL7A 3N0WA 4Z4FA 2L82A 4JWKA 2E89A 4ZVTA 3DMFA 2MMCA 2QLJA 1HORA 3M34A 4JOQA 1MC8A 1NXTA 4W5RA 1DKOA 5BV2P 1J99A 1KYTA 1E9SA 4UCWA 2WWGA 5C80A 2W71A 1LTKA 3NC1C 1QZTA 2XYPA 3MFQA 3FYDA 4I50A 4OXNA 4LOIA 3KELA 3M83A 2ERYA 1XL0A 1UM9A 4P1ZA 4F4CA 1UJNA 3B3QA 4UTVA 1QFJA 2H52A 3TE6A 3H2YA 4PZ9A 1JG2A 4R1NA 1QIJA 4DJ5X 3OHPA 4KBYA 1IEVA 1NWCA 1NIPA 1RJWA 2AG5A 4XTRA 3NNSA 5C8YA 3TR5A 4ZKDA 3X3HA 3S3TA 4PXAA 1ECLA 4AJOA 4CG0A 2ZRDA 3KZ1E 4TMWA 4UDNA 5HM6A 3V8NA 1YA6A 1T3ZA 3GZJA 3RHFA 4ZGWA 5JJLA 1JFRA 1O8CA 2PSHA 1FCJA 3KVYA 3FBGA 5KHLB 1MRZA 2CXUA 2ZTHA 4BNJA 1MO4A 1EFVB 4Z9BA 1DV1A 4IQFA 1DHRA 2Z1DA 4AQ7A 5JC1A 1CP2A 4MV7A 5LZ5A 1A8SA 1NV9A 2PO5A 2VZLA 3VTKA 2PKXA 2ZANA 3CWQA 4GXTA 3WMEA 4KR6A 4ARCA 1Y4SA 2J9FB 3JQ9C 4JJIA 5FNVF 3V8QA 1R27A 3DLPX 5JSQA 1KPHA 1RADA 1PF7E 1ZK3A 2PJDA 2VUSA 3NYQA 4PHGA 2JEZA 4ZP1A 3ZWXA 4DADA 1YJ8A 4OVKA 1G6OA 2UZ1B 3L18A 4XJTA 3OA0A 4HLNA 2PAAA 3AHEA 4YY3B 2PX3A 1HYQA 5TV2A 3D02A 5ALPA 4EJ0A 2QD4A 2XUAA 2RGYA 3RCBA 3EPPA 3G0OA 4ND4A 2X0NA 1QLHA 5E2AA 1YE5A 3OICA 1GPAA 4YRRA 2W11A 1U04A 4KQFA 3OT5A 3RVDA 1AO0A 1TA0A 3K15A 4BNMA 3B6JA 4TT8A 4Y3UA 1LS6A 4JI5B 4N76A 1SK9A 4KN5A 2PEYA 3UA3A 2WMDA 1ND5A 3E8SA 4KYTA 3TSAA 3AWIA 2X23A 1X80A 2WW8A 1JU4A 1P3Y1 2QPLA 4HUQA 1GLVA 1YS2X 4PC2A 4J03A 2OR3A 1KZYC 1YB2A 2H2GA 4OL9A 3YASA 1EX6A 4FFMA 4ZCLA 1G3UA 2GN8A 2NAPA 3GEGA 3HZHA 2NYUA 3CN7A 2VDLB 121PA 2EVWX 4GE3A 2F8LA 1ML3A 4WX2B 3RAEC 1JQKA 1GTVA 1G4UR 4BNYA 2REQB 1RPAA 3AOEC 4QFCA 2Z43A 4NJEB 4MRPA 4R1PA 3KB6A 3AGQA 3DTVD 4QBKA 5BN3B 1NX9A 2WAAA 1IXRC 1EVIA 3ELWA 4XQGA 4GOKA 5EUMA 1I7PA 4EG7A 1GCUA 3RWOA 1CUBA 2VNKA 3HCCA 4R8MA 2FLWA 4RLQA 3UHPA 3A3PA 5AYVA 1BOFA 1QH8B 2ZWVA 1M72A 3FYHA 3IEMA 1SKAA 1T3GA 1ZN9A 2OBYA 2KYRA 4WK6A 5LDHA 2J3HA 4NONA 3EFOA 4LXIA 4QG7A 1ADBA 3NBZC 4RTRA 3HN6A 3RSHA 1L5LA 1UBNA 3GOHA 3DMTA 3UWDA 3SGLA 2QI9C 1QJ4A 4CEIA 3ROKA 5C52B 1E2MA 2HMWA 4J16A 2YXLA 1MVOA 1PTJC 4CR7A 1WW3A 2EP8A 2PE5A 5SY4A 1GKLA 3G8BA 3QUTA 3UFBA 2X8WA 1CRZA 1RXCA 4HNRA 4LXYA 4E15A 5KDOA 5ARDA 4CF4A 4PWZA 4FR5A 1AHHA 2OYRA 1Y3HA 3AGPA 3SFVA 2FQQA 3FUUA 4RY0A 1NKVA 1QCZA 5E9QA 5DBIA 1MU0A 3EW9A 1T8UA 3F73A 2J3DA 1CR1A 1AQIA 3OCWA 2AE1A 4PIMA 4M22A 4M9QA 4O4JB 3T0FA 4DABA 2F3TA 2FCRA 1OFGA 2H11A 2Z09A 3HCDA 3DTVA 3KZOA 3S2SA 4RJIA 4ZT7A 2LXNA 3WE7A 2ECPA 2O0JA 2ZR7A 2ZS9A 1Q7GA 4WBSA 5CFQA 3F4KA 1PSZA 2NU6B 4EFNA 3VDQA 4BX8A 4CG3A 1G66A 2AXPA 3R6WA 4AF8A 1YE3A 3W5AA 1EUCA 2GZHA 2KQUA 1Z8HA 5EHXA 1FNMA 1W34A 1YAHA 4AKHA 2VK8A 3PPVA 4RQBA 3UK0A 1VJGA 1N2BA 5A6VA 3W2IA 5BSFA 3HV0A 4A03A 1EVLA 4TUYB 2PKRA 2RB4A 4S2EA 3EEIA 1EDZA 4LBWA 1TO6A 4P3YA 3LTNC 1IY1A 2COEA 2G76A 3D3JA 3OKPA 1SCNE 4FYWA 1M33A 4KQGA 5JJBA 3HSSA 3VNRA 1E9BA 3GPDG 1JG4A 4N49A 1LWNA 3IXMA 3E9QA 1Z0FA 2Q07A 3BVPA 3RC2A 1HA3A 4HYQA 5SYNA 1C9KA 2EG5A 2GWRA 2G25A 5DM60 4E5PA 3EEYA 5J2UF 3HUDA 1YBFA 3HJAA 2IUSA 3ZV6A 2VT6A 1TZKA 1XD2A 2HHAA 3EWNA 4J7UA 1MJNA 3NANA 2X14A 1K66A 3X1KA 5A6SB 1PNTA 1DAGA 3I04M 4MGKR 5DV9A 4WEOA 1AHIA 4GEGA 4EARA 1U2GA 2JGEA 2CB0A 3COZA 1MFPA 4WJZA 3U3OA 2FMIA 3K16A 6REQB 1S2NA 2C98A 1RHQA 1N5DA 5U4XA 1OI3A 1X13A 1VL5A 3ILHA 4K86A 3QF4B 2XDWA 2P4UA 3Q0TA 4G3XA 1U2RA 1XMVA 3F6EX 3RC1A 1ZH2A 2BGNA 3PVCA 4YP5A 4EFMA 1FJHA 3K9NA 4IDBA 5HR5A 2XBUA 1KXJA 2C1EA 3IILA 4QX6A 3O74A 1XVIA 4KQMA 4UAJA 2QYSA 3WFZA 2C2WA 2BYTA 2QUKA 4MYTA 1CFJA 3Q6MA 4N7BA 1GDDA 2AMFA 3HLYA 3NASA 4WNYA 3UATA 2GCPA 4ZPJA 3ZWNA 3PCRB 2VXOA 5EJFA 1UDWA 1ZMXA 1TQ6A 4HRVA 3ZD9A 4ZT3A 1DSSG 1VIMA 3EQ2A 5C1PA 3IUEA 5DLDA 1C7ZA 2RH9B 1KO7A 1V9LA 3ZU3A 4NZ9A 3VJKA 2QGNA 4DLKA 3I61A 3ZJUA 4DT1A 3SSMA 1GYRA 1K5PA 3JVEA 3AL0C 2P2NA 4OOFA 4B87A 4ZC1A 3IBSA 2AR9A 4IS2A 2QR5A 3L41A 1G7CA 1QYCA 1XRMA 2CSUA 3LUJA 3OESA 3L0OA 4MP6A 4CTKA 4P7BA 3OEWA 1RAAA 4QOGA 1H1TA 1GYPA 4BZZA 5CVTA 4IWNA 3W3AD 1Z4QA 5A3QA 2YFQA 3LY7A 3I23A 3K30A 4J0HA 4X5OA 4Y0VA 4C88A 1KMQA 4AS1A 2Q27A 2DT5A 2O5VA 2Y68A 1FNSA 1LBTA 3HACA 4TWIA 4KX3A 4RADA 3UT5A 1J2RA 4GMGA 4M87A 1CUDA 4OU4A 1DINA 1W1WA 3G1WA 3NB0A 4QU8A 4GC9A 4RZQA 2G0AA 2ATCA 4C2TA 2AKEA 1YE8A 2YVAA 1HQCA 2PPVA 1A76A 2DKOA 4HYEA 2DT8A 2JJYA 1CQWA 4KCGA 2PV0A 3Q8KA 5F3RA 3UJ7A 1T9DA 4GEKA 1XTSA 3EAGA 4RHUA 4M3NA 3PU6A 4D8XA 2WZBA 1B26A 1FP2A 4DLTA 2HRRA 1W4ZA 5C51B 1NLZA 3JQBA 1ORVA 1JYFA 2D1YA 4GSKA 3U1BA 2V3VA 4ON9A 4K9MA 3D0OA 4TYYA 1B0UA 3A9VA 3KV3O 3A1NA 3LCCA 4OHXA 5F4BA 3MJSA 1HDGO 1RLUA 2PGLA 2SKEA 2YWXA 4RPHA 3RKSA 5K8LA 4LEIA 2ZJ1A 1QHFA 4P83A 1VL1A 2FGJA 2R4QA 1TK2A 3K05A 2CKMA 4ZOEA 3Q6IA 4TKMA 3AF2A 3MA0A 2CMFA 1BEUB 5JJCA 1ZK1A 1RXVA 3OU2A 2F3UA 1HDEA 3LOQA 1AKMA 1PLJA 3W3AA 3G2OA 2NU8B 3RSSA 1IC6A 3DFMA 3N0VA 2VDPB 5A62A 1QFMA 5DHQA 2OHFA 4FDUA 3EG5A 2ZRJA 2H7XA 4W9NA 5FPQA 5BYJA 3W1EA 3KU4A 3TZEA 5CDSA 3STUA 1IXYA 2ZSHA 1W5EA 2MT9A 4QDOA 3W9UA 1ONPA 2FPGA 5A5DA 4C30A 4DG8A 2EFHB 3L6CA 3NAGA 3P94A 1COZA 2O3QA 1Z63A 4N7MA 3I28A 4FD2A 3QLEA 1S3IA 2AOWA 2HOQA 4RGBA 4U2DA 3QXCA 4AFNA 3DFIA 4B0PA 1OXUA 3IQZA 3EJ6A 5DO9A 1YZGA 4DCCA 1HKHA 3T4XA 3LOUA 4WEQA 4TKUA 2B92A 3LRPA 2D4AA 2D2VA 1EM8B 2R97A 5FUBA 4KITB 3PG5A 4TMZA 4B74A 4GPIB 3AI3A 3ZHTA 4C4XA 4ZZIA 2CK3D 3ZZTA 5DNVA 1TC2A 2OYSA 2XSZD 1E79A 1QIEA 3OQBA 3A6HA 1TIPA 2CL6X 2IFTA 2H7VA 2R8EA 3PFBA 4U1RA 4A9AA 4BPRA 4ZIRB 3WA7A 5JSFA 3JAMA 1K8XB 3DYBA 4TYMA 2BGWA 3DHYA 2PKCA 1CR2A 3IQGX 4FWBA 4CM9D 5KUTA 1NJ6A 3VVLA 4MULA 4KXYA 4OYRA 5DTQA 2QTLA 4E30A 1EJBA 3IPYA 3M3HA 3IE0A 1GAJA 3VH2A 5CP8A 4CQNA 2PSEA 3GJQA 1J2JA 3OE1A 1AUQA 5DHTA 1DBVO 2HJWA 4BKMA 1ISSA 4GOLD 1O8BA 2HZBA 4IVRA 1M6VA 3FF4A 4ARZA 3FVTA 2ONJA 1QQ7A 1YVRA 3UK1A 4CM4A 1JMKC 3VU9A 2ZSUA 3VH3A 4PYMA 4WVFA 3SKXA 1LSSA 5KWSA 5J2TA 1Q7TA 3DAYA 4GPTA 4EW1A 2X77A 1X77A 4E07A 4RQAA 1NF8A 3VBEA 5TIIA 1IOVA 1L5QA 1UL1X 4S35A 4Q9LA 1P7CA 4GT1A 3G89A 4K6OA 2A9JA 3CXUA 2CK3A 3L1JA 3TD9A 1WXFA 1KOLA 2WLTA 4L9AA 2XSZA 1II0A 2JK1A 4MTLA 5IVDA 1VJTA 3DUWA 3RNLA 1FSFA 3KAKA 3RS4A 5B1EA 1KJWA 2QTWB 2J5BA 1T5TA 1H4QA 4W1SA 5SICE 3RRJA 4ZV7A 2A7XA 4KLRA 3WBBA 4MRSA 2Q28A 4BL5A 5CLIA 3LF2A 3IQIX 4CM9A 1W6UA 4G0NA 1ZJ5A 3T5PA 1HGXA 2YZNA 4PU0A 2M6KA 4NG5A 3EQZA 4PRKA 5JS6A 1WF3A 2FVYA 2CN1A 3B5EA 1DXYA 5JS2A 4TZ0A 1GFIA 2F8TA 4IRUB 3PUJA 4WWHA 1T0HB 1GGJA 4RIGA 1J0CA 1HY3A 1FA9A 4X45A 3JV7A 2NYRA 2FZWA 4F3NA 1W48A 3IELA 2WJJA 4TKVA 4UULA 4YUXA 1EEXB 3P32A 2Y2UA 4G8JA 2WWVD 2MJLA 3U7QB 4EHBA 2Q5LA 4CKWA 1SURA 4IY1A 2FA9A 1THZA 1E6EA 3D6MA 4M0FA 2PX5A 3AF3A 3V7FA 2J46A 3QYAA 4BP8A 4M76B 3ZGXA 1WBBA 4BGIA 1CUFA 3AKCA 4JLBA 3O7WA 1LJLA 4R9VA 3HEBA 5KJEA 1F14A 4FWIB 1QWSA 2XGJA 3DTNA 3FCEA 1PAUA 4H7EA 2B2CA 3QUQA 4IIXA 1WSDA 2FMKA 1ORHA 2FFBA 1REQA 3IDZA 1GDTA 1FP4A 1YD7A 2QQ0A 5DX0A 1NXPA 3GLIE 1SVUA 4X8LA 1ZICA 3G9QA 5DP2A 3ML1A 5DHAA 1UZAA 1PFYA 2DOKA 3K6SA 4YP1A 2EKDA 3T34A 2P35A 3AXTA 4QOEA 1ZMRA 4HLCA 5JG7A 4F93B 5JZSA 5FKJA 2FPIB 4YR7A 3EQ8A 1DX9A 4NZYA 2DUWA 2HMSA 4NABA 3CTPA 4QOJA 5NLLA 3WP1B 2ZE8A 2HBZA 3L01A 4ZEWA 3AI1A 3I01A 4JJ7A 3H13A 1TZBA 1DFHA 4XCQA 4KO8A 5LM3A 3WAKA 2B7CA 2NZYA 4YH1A 5F21A 3A6JA 3E9DA 4O1MA 5MFPA 1XTVA 5JPIA 2WHRA 5BT8A 4BGDA 2Q0HA 2QL7A 5D00A 1TRHA 3S5JA 4HNHA 3WWOA 2P68A 5IASA 2G07A 4E6EA 1D2RA 2NTEA 5CURA 2BUAA 1UKEA 5M5BA 3O1HB 3LUCA 2GNAA 2FI1A 3BQ9A 5ELLA 2B1IA 1MC5A 4B4KA 1D4AA 5REQB 3USZA 3A11A 3VHXB 2G09A 4IOJA 4AYWA 1GPDG 5KU7A 1DAMA 4HB4A 4JVLA 1D7AA 5INTA 2Z5VA 3WYBA 3W5SA 2XITA 1ZLXA 7GPBA 4BO3A 2CLOB 4M88A 4KQCA 2YYYA 3ZTYA 2BCEA 4UEOA 2P78A 3KZKA 4ANFA 3M3PA 1DAKA 1FFXB 2QQGA 4FZVA 4UBLA 3JQ7A 4X6YA 3I6QA 1TYEB 3RVJA 1XUOA 5LZ8A 2O06A 1RMQA 1OIXA 1XVLA 3KJEA 1IHXA 5A7FA 3QUCA 3EZXA 5DWDA 4RABA 4U7HA 2VHQA 3L7CA 2QJTA 1XQ6A 5B2FA 4E31A 1XCMA 2V7XA 4LYDA 4BQEA 3G85A 2BEWA 4N3BA 3KALA 4BEWA 1YR9A 3U2QA 1LW7A 5DCLA 3C3XA 4WNCA 4X97A 1SUIA 1NSFA 4KRGA 4JI0B 2QY9A 3B89A 1JHXA 3DL4A 4ND8A 3SIXA 3MRVA 1P5FA 4N5LA 5B7QA 4P4LA 3AR2A 4RY9A 2FW7A 1GPYA 2A30A 4QWMA 1EUQA 1EK2A 3DAHA 3EBPA 4DR2B 3R0QA 3OF5A 3AJAA 3QYPA 5AWFC 1F8FA 4R40A 3GLHB 1WCIA 3O93A 4Z3DA 5L3ZA 4LF5B 1CK4A 2QQFA 4OHCA 1T2CA 3H8SA 1CUWA 1FDIA 1YS4A 2J3EA 2QRQA 1IIBA 1VZ3A 3E5HA 3I9OA 1Q16A 1Q7EA 1DO0A 1MB3A 4BLRA 2XYVA 4ISCA 1NXWA 2I1LA 3OPXA 1AMUA 2QL5A 1EFKA 3FKQA 5I9BA 5AVTA 3HY3A 1ZNXA 4YDRA 1Z7WA 2V4MA 5AI6A 2YH2A 1VE9A 3HLTA 3V1KA 2ZYHA 1IWPB 3OQIA 3T7IA 3ZWOA 1NZFA 1K88A 1U1IA 3DEAA 2PWBA 3GLQA 4KLZA 3ORQA 4RK6A 4KQ9A 2VBCA 3O82A 4RMNA 3OLXA 3IRVA 1XU4A 4JLDA 1B8PA 1M8PA 2Q3MA 2PD4A 2REOA 2JFWA 4Q19A 5F73A 1W87A 9ATCA 3TOVA 2XYQA 1T5SA 3GROA 3PLNA 3BL8A 2CFRA 1E1KA 4C0BA 1BE0A 5FI1B 1PZHA 3MT9A 5CNIA 1TD1A 3ECSA 2W2QA 2YVUA 3RIGA 2PNFA 2FPWA 5AOAA 2YFHA 5EHIA 3BHIA 4MI6A 2EKBA 3WJAA 3BB1A 1G5IA 1XOIA 4DILA 2R1TA 3E53A 1OVMA 3I64A 3A27A 3JSAA 4UNQA 1U2EA 3DC2A 3EXHB 5IFKA 5HNKA 3PHBE 1KC3A 1D0IA 3F5DA 2ZRNA 2Z6AA 2GD6A 3IAS1 1KPIA 3CG4A 1FF9A 4HVAA 1XA3A 2GTIA 3PC3A 4JDPA 3MCUA 2OVBA 1H66A 1PFUA 3NDJA 5K3BA 4R2IA 5C4GB 1KMNA 3SHWA 3VYRB 4RSGA 1YULA 5IJ9B 2HTFA 3P2MA 5FULA 4YUZA 3Q9LA 5C1BA 3A1SA 2IHBA 3O4JA 4EJ2A 2YS7A 3FCXA 3D7NA 4FMBB 2B37A 3I6ZA 3TUIC 3DEHA 4B6SA 2DGDA 1TKCA 2MSCB 4WKPA 3R75A 1NNUA 3Q3IA 5EZQA 2GEKA 4ZK2A 3LLCA 5AKJA 1JLSA 5HK8A 1AF4A 2HIMA 4AIRA 1GXSB 1NUTA 3A6LA 3KR0A 1DMRA 2R6FA 2J5RA 1PV4A 1DTWA 3O83A 2EDCA 3FYTA 5B1SA 3U5ZB 2W4IA 1W5FA 1ZH8A 2BRUC 3SQMA 1BFKA 2H31A 4X61A 2AJBA 3HB9A 3CX7A 4TVBA 2NUTB 3T54A 1W36B 1NT2A 1EZZA 4CKEB 3R4CA 5HJEA 2FZGA 1NW4A 4TWJA 2QX6A 5JH7F 3K2QA 2UUPA 2BCJQ 3SMVA 5LZ9A 1CJCA 3TBKA 1U0EA 4E2XA 2DLCX 1DADA 1TTQB 2OGTA 3HBLA 3STVA 3SYNA 3R8XA 1CUHA 5HTKA 4QULA 1ZISA 1AKQA 1LI7A 2WA2A 1VIYA 3H04A 1LEHA 4XLLA 3TRHA 5JCJD 1WZUA 1O3YA 3A25A 1UQUA 3NV7A 4Q3KA 5AIBA 1C3LA 4C21A 1ZQ1A 1ODKA 4D02A 2OQ2A 2JVJA 2A2ZA 4EUSA 2ZE7A 2ZI3A 4JB3A 2BM1A 4GQIA 4WIAA 1LLQA 4I4TB 4UJ3A 4K1XA 4DA8A 1FYXA 1NVTA 2F1KA 3AINA 4IXNA 5H5JA 3WIUA 2VWHA 3GT4A 4C4OA 2QMQA 2R11A 3UPDA 2RGBA 4F5EA 4FE7A 4PM4A 2X9VA 1PGOA 2J9XB 4XDZA 3KV1A 4LSMA 4ZRDA 1IATA 2IXAA 1KYVA 3G9XA 1FUEA 2BI8A 3JWEA 3MIIA 1EVEA 4XARA 3WMXA 4RTLA 4EG5A 4DZZA 2B8EA 4MLCA 3BREA 3M1YA 1CEEA 2AMJA 5IAEA 6PFKA 5IT0A 1RM5A 3RRZA 3GLGA 3ESZA 3ITEA 3ZXUB 5LMZA 1XEXB 2RFLA 3LO5A 3OG9A 3MT0A 3DFUA 1ICEA 3L79A 4U5QA 1E2BA 4UVDA 4C89A 5T4HA 1S2GA 1ZSVA 2NV2B 1ACLA 3G8AA 5AKGA 5FLEX 5MHTA 3MQ2A 2BEUA 4EJ6A 1F06A 3EULA 5BSKA 3ESDA 2GRAA 5DK4A 9ABPA 2Q9BA 5FWYA 5JCJA 3ZE1B 4DQXA 1J0XO 1ZW1A 3IHLA 1FC0A 3WGQA 3QJYA 4AJ4A 3IERA 1JHUA 4JLUA 5KOJA 1LZLA 5BSMA 3FGNA 2HFJA 2HC9A 4PX3A 5K0CA 1CEYA 2OECA 1HL7A 5U1PA 1KA9H 1PN3A 1TJ3A 3IAHA 1B3BA 4DG5A 2CVPA 4DM7A 3CEMA 1KEEB 2N75A 4IDFA 2VDQB 2YJTD 1QPGA 1RFGE 2QRKA 1YRYE 4IZHA 1NVXQ 3ZWKA 2PZGA 3MAGA 3BMXA 1UJ2A 1W581 3DTYA 1M7BA 3AIMA 3G0CA 3ZS8A 3LQ4A 5I9LA 5HRUA 4A23A 3GV0A 3WYAA 4IDAA 4C08A 5THKA 1XZDA 2VDJA 3TLJA 4K81B 3IUBA 3AJEA 5E0OA 1L5RA 1NW5A 4GKVA 4A36A 3F7MA 2V6GA 2OO5C 3NCTA 2PANA 2Q3BA 3D3KA 4HMOA 1XB2A 4QYIB 1N3LA 1ZIDA 4NP6A 1R0YA 3N8KA 3IAFA 4FQ5A 3GYGA 5DGXA 5HF8A 1O97C 2VP0A 3N8HA 4CMIB 1X7WA 1P2UA 5LYJA 3WK8A 4GFDA 3KUXA 1JA9A 5SYAA 4JR2A 4A8JC 4D4LA 4ZI2A 1DOZA 2GH1A 2WG1A 3Q8XB 4IIDA 4ZALA 4COOA 1KI9A 2QLLA 1XCOA 3A26A 5HFNA 1V5FA 2ADMA 5BVHA 2RGCA 3H1AA 4FLEA 1G5PA 1YDWA 4H4EA 3DHNA 2ZCVA 3S7TA 1BEEA 1L9KA 3CF4A 1TIKA 2BJWA 3G2QA 1V16B 1SXJA 3H8JA 3KDPA 4UUQA 5CJPA 1LKZA 3ZX5A 4AS3A 1F38A 1QV7A 2FPPB 3T3NA 1E2HA 4M0CA 3IS3A 5DLEA 3KQVA 1IN1A 4RIHA 1T2EA 5L3RA 4F6RB 1W4RA 4B44A 2P6UA 1ZWLA 3M9WA 4QATA 3X2EA 3WIBA 1NQUA 2UVQA 2PYDA 5KQLA 1GDHA 3F5MA 2Q4EA 4ZI7B 1OBOA 3DCNA 3JAWB 3EPKA 4MQMA 1AKRA 1K8RA 2VP6A 5K01A 2C20A 2HCFA 1MJFA 3RSGA 4Q4HA 1YUMA 1Y3BE 4PZUA 1AF7A 1LU9A 2CKDA 4U9IS 3NTRA 3SSAA 4IQ4A 3REGA 1XHLA 4ENWA 2RK6A 4JBIA 5JSHA 5L7WA 3WLMA 4G26A 3KKKA 5JR3A 4GGMX 3UAOA 5FLYA 1K7XB 2XI4A 4F4DA 2OGUA 3M6IA 1U8ZA 1JR3E 3C3KA 4FI3F 1MT0A 1OFIA 3RTEA 5IZCC 3M6AA 1NJ5A 2P6RA 5LQJA 1CG6A 1WD7A 2IPOA 1ZESA 2IHJA 4GMHA 3F46A 4PO8A 3TSCA 4H1UA 2GNPA 1T8SA 2Q4RA 3OUTA 4PPNA 3WIDA 4II3A 2XECA 3NUZA 4LVNA 1P6QA 4QVKA 1G3QA 1IBMB 3EFEA 3PNLA 2A5GA 3F3MA 4F96A 4TYNA 5SY9A 4P08A 4IV5A 2H85A 1J5PA 1IBSA 1ZIOA 1P9NA 2AOXA 1UKVY 2WYIA 3T5CA 1RKBA 1RXIA 2VRCD 3KUDA 3O4IA 4DQUA 5CB4F 3VSCA 3KJXA 3RYTC 3OECA 3PNQA 2WTAA 1W88A 2HQBA 3LV8A 2WUVA 1EI9A 2X9GA 3SF8A 4AN4A 1M6EX 3CUKA 3BSSA 4XYEA 2XB2A 3AVTA 4F4HA 4AKGA 2Z98A 5DKFA 1JQ5A 1A2QA 5LP6A 1RVDA 3T38A 1TQHA 2WTNA 5L9AA 4RTQA 1D6MA 3R3ZA 4NXNB 2E48A 3UH1A 3GJ3A 2E4YA 1GGNA 4L6AA 1MABA 3STHA 3SE7A 2GARA 4OQNA 2CLFB 4NZNA 5AW7A 3NVKI 1M2GA 1DIBA 2PNJA 3V4ZA 3L0DA 1K6MA 1KKMA 2HGSA 4BMXA 3OZWA 4F4IA 2G28A 4Z86A 1KEZA 4KK4A 3ADCA 2A1TS 1UXIA 4TKZA 4R8KA 3N5CA 5D5HA 3WLNA 1FLNA 5IJAA 1K6JA 1XZPA 2IUUA 4BNVA 2O8BB 1TRKA 1B7GO 1ZFNA 4S0XA 4XSVA 3SR3A 2CDBA 1X7HA 3UKOA 4LYAA 4QYXA 2HHHB 4J0DA 1VI6A 4J1SA 1NBOA 4ZVSA 4I81A 4W4TA 2H5IA 4BAGA 2VRCA 2DUJA 1B6GA 4CYMA 1W4AA 1WF6A 5DGDA 4KU4A 2UVPA 1LSUA 3E9ZA 3ETCA 1KTVA 5L40A 1D8TA 4JN6B 4BMVA 3FYUB 4R2WA 2Q5OA 4ZJPA 4OHRA 5DHSA 3LXRA 3GLTA 4QAJA 1W9MA 4CE6A 3NJ4A 2DQZA 3BCUA 3D6FA 3EZNA 4A0SA 1SN7A 3L5KA 3AR6A 4JQSA 3PS9A 3KM0A 4U63A 3UAWA 3V8MA 5JMOA 5CIYA 3MJHA 5BMVB 1WDWB 3DNFA 4WK0B 2CLDX 1A4XA 1GGKA 1FRQA 2P9HA 4R51A 5FH9A 4DDMA 4HAOA 3DDOA 1P18A 1B74A 2M2IA 4INOA 5DPMA 2GJSA 1H93A 4YJKA 1SA0B 2ZPUA 4EJSB 4RD4A 2C2KA 3KYCA 2CLCX 2B99A 2NIPA 4I6GA 4KSYA 3QKTA 1BZYA 5GWXA 1G64A 5KYNA 4WHMA 1SG6A 1DEHA 4GW3A 3ULKA 1MH9A 4KO2S 2ZRHA 2QLBA 3HRKA 4F84A 3O84A 4UE3S 1XRSB 1N3IA 1GITA 1UFOA 1NMYA 1UUFA 3WGHA 1PR4A 3RJ5A 1D0SA 3FWYA 3QWIA 2GOYA 3H2IA 1XAGA 2P11A 2O1XA 4E03A 4RFSB 1OXXK 4AU1A 1NLUA 2MIIA 2AEFA 4BY9E 4BRSA 2HMUA 4C3UA 13PKA 5M34A 1W5TA 4XJXA 4D98A 1NYLA 4MW6A 4DRXB 3EY4A 4IIUA 4K6CA 1Q1AA 3D7MA 4M1MA 4NPAA 4WFJA 3IBTA 4MPDA 1A95A 5DW0A 5K6AC 2WAOA 3W3ZB 3WSWA 4ZYLA 2C7QA 4D4KA 1I13A 3CX8A 3N86A 4LG1A 4E4YA 4BUCA 3ZGZA 2P0YA 1JAZA 2L0XA 3H9QA 2GFHA 1UBEA 4NH0A 3INRA 3WNDA 1FU8A 1UPAA 1QK4A 3NS7A 4TGLA 2WV7A 5HIJA 4FSDA 4P92A 2QNRA 1X39A 2PA3A 1FNCA 2IE8A 4PLWA 4TTQA 2O6LA 3AI7A 3BE5A 3I01M 1G63A 4GX0A 4I9UA 3ZNQA 3AR3A 3T7AA 4A6XA 4NDZA 1NC1A 2LUOA 2O2XA 2SKDA 3G7NA 4UBJA 3IT0A 3UGQA 2CCJA 4Z9FA 3AEUB 2H7YA 1O08A 2VPQA 2CF5A 2RONA 4K8OA 3SIPA 3QVUA 1J56A 4K2HA 4EDHA 3PD7A 3PJRA 2DHRA 4YDQA 4JBYA 5LQAA 3WLJA 3RAJA 3H2JA 4JT4A 5K2OA 4JUBA 1W29A 1U9YA 1YHNA 3VAAA 2GNOA 3PIIA 1DCKA 4DCGA 4IR7A 5JDIA 1NVUQ 2WT8A 3AP1A 2G7MC 1T91A 3PF8A 5EXPA 3PI6A 4RTSA 2J0QA 2CNLA 1GHTA 3GMTA 3HM9A 4OY3A 3BBLA 3CLHA 2AUNA 3B78A 1E61A 3EODA 4RJJA 2MINA 3HCRA 1CJSA 3GFVA 5F4ZA 1XGKA 5KKAA 3S7ZA 3UXYA 2IEYA 2JS7A 3Q6NA 1XKTA 3OLZA 3ONDA 4MUGA 3LPLA 1E63A 3RU2A 5CYFA 2N1MA 1PK8A 3SQDA 3ZN2A 4EGQA 3PDIA 3AQIA 4WOPA 3FMOB 4X1YA 2IV3A 4DJJA 2V54A 3K1ZA 3RW9A 2ZJ5A 4HNUA 1FFHA 2IXTA 2PSDA 4I1YA 1YCHA 2XUHA 4B2PA 2W37A 3GGOA 2M1XA 1WOYA 3DL7A 2AI2A 4Y2GA 3UENA 3LQ2A 3KJQA 3LWNA 5CEEA 3FI0A 2AFIA 3S2FA 3U9LA 1QV9A 3SC4A 1AX9A 1WKCA 3G8DA 4MB0A 4UM9D 4Z0TA 3IT3A 4GI3A 1KIMA 1SBHA 2QUZA 2Z9CA 2QLTA 1RWPA 2IF2A 2W0MA 1U8AA 2VP5A 3NBQA 4BQOA 2JG3A 1JX6A 4RJ2A 4AAYA 2YRXA 3EMVA 3D2LA 4OQXA 5ECYA 4CF3A 1V5WA 2ACEA 4B7ZA 4B75A 1LPAB 1TT5B 4EB6B 1GR1A 1AMOA 1YQQA 2F43A 4UTRA 1WZ2A 1EX9A 3K5WA 2AF3C 2F59A 3D6UA 2EX0A 3G1UA 3R8CA 1O6CA 4WZZA 2EJCA 2I33A 4BMDA 1YRBA 1IHYA 1QRDA 2QT9A 3GEMA 4PBRA 4G4SO 3JTEA 4QTXA 4XPIA 3HBJA 4HFNA 4FS8A 5FR2A 4JELA 3U9SA 5IDQA 3NEYA 4GYJA 1SG9A 5DNUA 4JU9A 1QR6A 3CR3C 4YHHB 3DBVO 4LF9B 2PU7A 3QM1A 4KAXA 1QC5B 3KPUA 3LW8A 5K4GA 1DEKA 4D3FA 1UR5A 1C0PA 4H6XA 4TUYF 1IAQA 1NF9A 2JKZA 2XIQA 3CE6A 1E4VA 4NMWA 4I1OA 5FBZA 4DLNA 5HM8A 2QM7A 3FTNA 3G9TA 4OSEA 2O19A 1DFGA 4N6OA 1ZOPA 2Q2NA 5AKIA 2FZCA 3BIFA 5DCYA 2ZJFA 2R25B 3OM1A 1WB6A 2AZ4A 2CL5A 3JQAB 4ZMBA 3EBLA 5HIMA 3GXOA 3DE7X 5BSHA 3N5KA 5BYBA 4MX8A 5GZ1A 1JILA 1BHO1 1DIOB 4GGPA 5AQ1A 1CZHA 1GZ5A 3TEMA 1E4EB 1I4TD 2WBLC 1HE2A 2O05A 4MV0A 5IYZA 3O2QB 3ZCSA 3CVXA 5TPWA 1BYIA 3QE9Y 1OFUX 3N70A 3VJRA 4REMA 5EJMA 1SKYB 4GP6A 4FW9A 4LDQA 4C1NA 5KWJA 4ITUA 2IEAA 4IXWA 3DOEA 1K7SN 3GYBA 3EGWA 1PR6A 1PLLA 1OBVA 1P7PA 2Q6KA 2BFAA 1Q84A 2GMWA 2JA2A 1J9EA 2P7IA 3B3GA 3NCHA 4MVWA 4ZQEA 3SFTA 3W1VA 5LL6P 4B80A 1RAFA 4KLCA 3A3YA 1OFUA 3KLPX 3L5OA 2MSDB 4N0QA 3ITKA 3TFQA 4FGZA 2PL9A 3Q11A 1CT9A 2LCQA 1GG8A 1PWYE 4DMLA 4YJHB 2ZI9A 4ARAA 1U7PA 2XCUA 4IDCA 4TVKA 2ZXFA 2Q3CA 3E2PA 1QMGA 4ZJUA 1GVNB 3EB9A 3LDAA 3B13B 5FL3A 4UTNA 1DRUA 2ONYA 5K0GA 3ABZA 1ZRSA 2B6HA 4HRXA 4FC7A 4Z6KA 2FZ4A 3AI2A 4M0PA 1AXGA 4N8SA 1QPBA 4UTOA 4FFSA 3R9XA 3QEMB 4Z49A 2I6FA 4GXNA 3A1FA 1U81A 2XY4A 1EFAA 3W6PA 1C3VA 4G5QA 1O96A 3F71A 4NDNE 1Y6JA 3E05A 2C2OA 3LUKA 4GX2A 4MLDA 5JXJA 4D9MA 5G02A 4KLNA 3F3KA 1GLNA 3OSUA 2OA0A 3GLHE 3UYKA 2GJ8A 4QASA 5TNXA 2HI0A 2IT1A 2WNHA 3AF6A 2WF5A 4U7GA 3WDSA 1NFFA 4CIDA 1UM9B 1PRYA 3BWVA 3UN1A 1NATA 1II8A 1FXSA 2R48A 3E1SA 3PNSA 4HY3A 1WTCA 3V48A 3W5DA 8MHTA 1KK0A 4ZQFA 4Q05A 3I3OA 2ZSDA 1XJQA 1Z2OX 3LC1O 1H1LA 3P9CA 1ST2A 4OPMA 2HGZA 1P2FA 4ZZ0A 1DC3A 5B1IA 1LBIA 1N6NA 2V1XA 1T6NA 5E6RB 2AYXA 3OC0A 4QUAA 3ZX4A 5JADA 3TB4A 1Z68A 5AJXA 1H2AS 3PHHA 1S5PA 1U4OA 4ZXPA 2XTAA 1EUDB 4YT4A 3HJCA 3O8DA 5HPYB 1ISPA 2ZTMA 3N0RA 4B3XA 2P9GA 1AKTA 3PTLA 2FJUA 2ZBPA 3CWZA 3HJUA 4LCJA 2ZGVA 5HIKA 2I62A 4CKBB 2ZJ8A 2VR1A 1I2BA 5HBRA 2XQGA 4TL6A 1F4PA 1GUFA 1N6LA 1Q3KA 2WSBA 4FBGA 3O21A 5KCMA 4GG1A 5NULA 3UUEA 3KPWA 1CWUA 5JW6A 3PWTA 3ZK8A 1CEQA 1DPFA 2FPXA 3DEZA 4R2XA 2JGKA 3OWOA 2GHRA 4M1ZA 1YB7A 1GN9A 1NNSA 2BWJA 2OGWA 3CUUA 1E3WA 1EK1A 4Y2SA 2J48A 2J6CA 1R5OA 3VR2D 4FUTA 4UEJA 4IDGA 1C9NA 5D85A 3SX2A 5EJ7A 1BJTA 1K63A 4CV0A 1Y9EA 5F3WB 3B6EA 1PX0A 1ISFA 1SUWA 3KFVA 4XZ3A 3E2IA 4U2FA 1VE5A 1MOPA 2OCIA 4C0JA 1QF6A 4FT2A 4I8DA 1K3FA 2FVXA 2JHFA 4NYJQ 4ZJZA 1XQXA 4JROA 4Q4CA 3M6LA 3K70D 1P9WA 3FCAA 5TE9A 4EHLA 1LX6A 4YAEA 4CUZA 4YRGA 1GU0A 1HZZA 4OHKA 3RIHA 5DVZA 4BMSA 2OOSA 1QRUA 1XAJA 5JWOA 3ZH9B 1CDZA 1ZM7A 1JH8A 4JBHA 4OI1A 1IRXA 1URPA 1W4CA 4OK5A 1XP8A 3LT2A 5KTTA 1WY5A 5BNIA 3EX7C 2Q8NA 3TXYA 3A4IA 5KEIA 1NG9A 2OUKA 4MR9A 1X1QA 4DEXA 4HEQA 2I03A 1V1MB 4UW9A 2CY0A 2X5NA 3AHJA 2PAFA 4OCZA 4W7HA 1QK3A 3UJAA 1ZC3A 3GRRA 3IJEB 3F67A 2HSEA 3QLVA 1TFRA 1UBFA 4O4IB 1Q74A 3C2QA 3U3XA 1D2EA 4JA0A 3RF6A 4MYUA 2XQIA 1N6PA 4TLLB 1DX6A 3HJTA 4PZCA 4C0AC 5DXJA 4KDCA 4WZAB 1RRMA 3EZYA 4RQUA 3GBVA 1YFLA 3L4KA 2QN6A 3P4UA 4MR8A 3UXHA 2QSJA 1X3SA 1WPGA 1DEAA 1S3FA 3HXLA 4YUYA 3IIIA 1EPUA 1ZBDA 3V1NA 2Q7XA 3ACDA 1KQNA 1B1CA 2WTUA 1LF0A 1YI1A 1NBMD 3RUCA 2WU3A 1U0HC 3WYNA 4G4IA 3OJ0A 4NI5A 4QU9A 4C2UA 3ZWWA 1P91A 4U3JA 3MS7A 4UKDA 1OA0A 2P65A 2R8XA 3K9QO 4WXYB 2PGXA 4QPZA 4TQGA 1U2DA 3SF0A 3BWBA 2W9XA 5LD2C 1KERA 1S7GA 4N3GA 4GL2A 3I8SA 3R0XA 1S2LA 3EVAA 1MC1A