1DFHA

X-ray structure of escherichia coli enoyl reductase with bound nad and thieno-diazaborine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title A mechanism of drug action revealed by structural studies of enoyl reductase.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dfhA00
1BDBA 3MJSA 4FJ2A 3GG9A 1BVRA 3SBOA 1ORRA 4Y9DA 2BMAA 3ZWMA 1ONPA 1GPDG 4DQUA 1EVYA 3VHRA 1PQPA 4YJFA 1YS4A 1T1RA 5U9CA 4BIIA 3ITKA 3SJUA 4XB2A 4E5KA 4YT4A 5EJ2A 2X5OA 3WS7A 3U4IA 1IY8A 2X6TA 1EK6A 1I3LA 4DA9A 1M6WA 2H6EA 1DRUA 2IODA 3PFFA 3UH1A 3K92A 3KLMX 5H82A 2WD7B 5DCUA 5EQFA 1KERA 1BXGA 1X14A 1LDEA 2PZJA 3U62A 3WBFA 2LDXA 2QQ5A 2EJVA 4Q39A 4OH1A 4E5NA 3HZZA 1NVTA 3NDIA 3T7EA 1ENYA 5JMPA 3DZBA 1NPYA 1G6KA 3PWKA 1C0IA 1E3IA 4R3WA 5IZ4A 4HFNA 4NHEA 3WOHA 4FR5A 1SCUA 5L95A 2JCVA 3RCBA 1L7DA 1U8XX 3JYLA 1A7AA 3KOUA 1ZVMA 3L07A 3ANLA 2YV1A 3S55A 4MIEA 3UN1A 3PLRA 1SOVA 1Z7BA 4R1SA 1SAYA 3ZWVA 2AW5A 4Z9FA 1D8AA 1GZ6A 4IGFA 3V1YA 1EMDA 4EW6A 4PZCA 3D5QA 4UAGA 1Y8QB 1WVGA 2X9NA 1E3WA 4GGOA 4L4XA 4L4RA 2DUUA 4P4NA 3LC2O 4XYEA 3RUDA 4EEXA 1M75A 1LC3A 4KWIA 1NASA 1YJQA 3UHAA 3ZU3A 1HZJA 3JYPA 3GRKA 3WNQA 4CM9D 2W2KB 4JROA 3FSRA 4RVUA 1DFHA 1B8VA 4BNXA 4P8RA 3ETDA 4XGNA 5B4VA 2NU9A 1KVSA 3DOOA 3M6IA 5HRUA 4XIYA 3QA9A 5F21A 4GX2A 4YT5A 4WCDA 1ENZA 3NTOA 4PG5A 4KP7A 2VHXA 4LCEA 3IKVA 5G0UA 3K5PA 4WEOA 1K6JA 4XQ9A 3GMSA 3WR5A 1N8KA 5CEJA 2FY8A 3UAGA 3H65A 3FNHA 2RHCA 3PVZA 5TQVA 1JLLA 4QFDA 2O2YA 4ALKA 5ICSA 1R4MA 1RM0A 2O3SA 2XOXA 4NFSA 1XSEA 1VPDA 2PA3A 3GVHA 4J1SA 5DBFA 3GDGA 5T57A 4D42A 2V7PA 3ADPA 4AJEA 4RVFA 4BNHA 5B4UA 1EE2A 1S7CA 1BW9A 1LX6A 1UP7A 1UP4A 1LLQA 5F1KA 4HUJA 4QSMA 3R3SA 4MDHA 5LCXA 3I9OA 3GN2A 3OA0A 4CQMD 5THQA 3HG7A 1TVEA 3NRCA 4XA8A 5LDHA 1HDYA 2GN9A 1GYQA 1E5QA 4J0EA 4AG3A 1T25A 1VLLA 4YAGA 2WDZA 1VJTA 3ZI0A 3ULKA 4IMRA 4E21A 3WXBA 1HE2A 3C7AA 1EZ4A 1HYEA 1YOVB 4R1TA 3MJCA 4UUOA 3RD5A 3V1UA 4D7AA 1R0SA 5C7LO 3WBBA 4HXYA 1MB4A 5DOZA 4OHUA 1LNQA 2HMTA 4BB5A 2Q45A 2Y0EA 3WMWA 3KLPX 3L9XA 4MKRA 1LDNA 1Y8RB 1PR9A 2DLDA 3NKLA 4II2A 3INRA 5GZ3A 4DQVA 4TRRA 1WZEA 2X8LA 4OQYA 5KOIA 4W99A 3R0IA 4MINA 4ZQBA 5EIOA 4E2ZA 2OP0A 4YAKA 3HB5X 3M2PA 3O8QA 1KVRA 1VI2A 1B15A 4F6LA 1GD1O 5JDCC 1J49A 1PX0A 4WJZA 2FPPA 3ROPA 1NP3A 4Z0HO 1QYCA 1TXGA 1GCUA 2NNLD 3CIFA 1PQWA 1I33A 1XGKA 4IGEA 4CMAA 5L4NA 1F14A 4D3FA 3C24A 4OXNA 4CR6A 5IZCA 1SEVA 2D1YA 4TZKA 2G1UA 5HS4A 3ZV3A 1HL3A 4YJHB 3S2IA 1TEHA 3GVXA 3GDFA 1U4OA 2V65A 2W4QA 4J16A 1ZKMA 3X2EA 3U09A 1V3UA 2J3HA 4WK6A 4HY3A 2Q1UA 1GZ3A 4DTIA 3KM0A 1A27A 1EDZA 1GUFA 4FOSA 1WAMA 1MFPA 1YRLA 2FR1A 5L51A 3I3OA 1Y9AA 3CINA 1BWSA 2ZK7A 3H6KA 3ASVA 3L4BC 4A7PA 2X0RA 3OICA 2FSVA 2HAEA 4OOFA 5T67A 3X2FA 3VPSA 1ULUA 1PL8A 2DPGA 4YCAA 3ZNNA 1N9GB 1ZNQO 2B35A 3AM3A 4J7XA 1GU7A 1R37A 1ZXLA 4BKOA 3ZWNA 4E2XA 1P1FA 1PZHA 4EJ0A 3ZNPA 1IL0A 2Q49A 3DBRB 1FF9A 3T4XA 2O3RA 3V5NA 1D7OA 3WICA 4CL8A 3JD1A 2UYYA 1XWFA 1O0SA 1H94A 2GCGA 4X54A 1Z73A 1P1HA 2WD7A 4I5FA 5CDTA 1VSVA 4RVGA 4YRBA 1W73A 1MX3A 3WB9A 4O5OA 1KC3A 2GGSA 3JQ7B 4I9UA 4FFRA 5DDIP 4DBZA 1BXKA 1VL6A 2NACA 3AU8A 4FS3A 4PG4A 4UUMA 3GG2A 1CRWG 2R00C 5FI3A 3E03A 1X7DA 3TWOA 5A3JA 4XR4A 3LF2A 5JO0A 3EY4A 1E77A 1Q2XA 1AXGA 1DO8A 3I6IA 4IQGA 2G76A 5IN5A 3KUXA 5DBIA 1PEDA 4HNGA 3TZKA 2H9IA 3H2ZA 3O38A 3FWNA 5THKA 1HEUA 5TRTA 3DZJA 4BGIA 1T2CA 3OMLA 1WMBA 1UDBA 3PXXA 3D4PA 2P4HX 3EHEA 3GH3A 4CM9A 1LLUA 3AUTA 4YJDA 3LZ6A 2H1SA 4BO3A 3AI1A 1IYZA 4FC6A 1LTHR 4DLAA 3H9UA 3PZBA 2J5KA 2BGLA 1JWAB 4K28A 1CQJA 3QWBA 1TT5B 4UEOA 5KJ1A 1ML3A 4CV3A 3Q1LA 1YGYA 4FCCA 3HDQA 4KQXA 2SCUA 3ANNA 1Y8QA 3ROKA 3C1AA 3PEFA 4ALJA 2PD3A 1NQAO 1E3SA 4AJHA 3WQQA 1MA0A 1HDZA 3ZN2A 1O95A 1Z75A 3R1IA 4TMFA 1U2DA 3DMTC 2X0IA 1IPEA 4KDEA 8LDHA 1HETA 3RAJA 2PY6A 1HKUA 4J1QA 4BO1A 4IUYA 4IXTA 5T64A 3ZZNA 1DFGA 1B8PA 2Y0CA 4PGFA 1V6AA 2P9EA 4CQLB 3EW7A 4DC1A 1LQUA 4Q3BA 1UXKA 1UXIA 3D4OA 3UCEA 3PFWO 5TJHA 1OC4A 3DZGA 3BTOA 4GVLA 3W6ZA 5CPBA 2CDCA 1X0XA 2YJZA 3F1KA 2OZPA 1QSGA 3GMDA 1YBVA 1U3VA 1BG6A 4A10A 2CMDA 1FDVA 5L45A 5CDSA 4M55A 1WPQA 2IE0A 2EJWA 1ULSA 3B1JA 3ZW9A 2YHIB 4BO5A 3RU7A 3KXDA 4L4SA 4UREA 3E18A 3K96A 4MJLA 4I5EA 9LDBA 3UFXA 2D0IA 3F3SA 2VHVA 1WDMA 3D5TA 3OIGA 3MTJA 3DZFA 4TRNA 2VT3A 2X4GA 5AXAA 4LRSB 2JAHA 2WEKA 2D2IA 1Z82A 1EBUA 4BO4A 1HE4A 2BFAA 3OBBA 1IHXA 2VWPA 3GRPA 4U5QA 5F1OA 3GHHA 3NV9A 1KOLA 4XZ3A 1HXHA 1PGNA 3BTUA 5BQFA 4CMGA 4MVJP 1Y5MA 1P33A 4ZRNA 1HZZA 1YOVA 1E7RA 1UXHA 4YVFA 1VL8A 3MJ4A 1F8FA 3OFSA 4GPD1 3HFSA 4RPKA 2F00A 1DDOA 2PKQP 1UH5A 4TWRA 2GN8A 4OJNA 5G2OA 5JCXA 5CDGA 4FGSA 7MDHA 4AJOA 2NTJA 5CPFA 3WSWA 3ZU5A 5ILOA 4WLUA 3FNEA 3JTMA 1Y8RA 2PLAA 3OJLA 1E7YA 3ZHYA 4MVJF 1B2LA 4LRTB 2VYVA 4XRRA 2VZ0A 4K9DA 4MOWA 1D1TA 4W6ZA 3ZWXA 1J0XO 2GR9A 2GSDA 2G5CA 2YV2A 4E5YA 4R51A 2JD1A 2QYSA 4GBJA 1QXSA 1EE9A 4R69A 2GLXA 3NYWA 3GQVA 1E1MA 5DNAA 3QY9A 4OKNA 4A26A 4R54A 3FI9A 4IXWA 2C54A 1OOEA 5DT9A 4O59O 4CODB 1I24A 2YZ7A 3D3EA 1NQOA 1NFFA 1ADCA 1K6XA 3F46A 3LYLA 1CERA 1DXYA 4XYGA 4BGVA 4YJHA 4G65A 1H2BA 1F12A 3GF4A 3B1FA 1VJ0A 3E6AA 2X23A 4ND2A 3FPLA 1X15A 4NDNE 1E92A 1F8GA 1MC4A 3NDJA 5MDHA 3IP1A 1DJNA 4MO2A 5ENVA 2D4AA 4KUEA 3RJ9A 3DAGA 5C7OO 4Y6PA 4JX8A 4G5HA 4IPTA 4RPLA 4O1MA 1LBEA 1XDWA 1R12A 3GA0A 3RC9A 1YONA 1F0YA 5TT0A 1OI7A 4OXYA 1PS8A 5TS3A 3WNVA 2Y99A 1DOHA 4BKPA 4F45A 1E1NA 3VDRA 3VH2A 4N5NA 5I9NA 3AM5A 1ZEMA 3QW2A 2HU2A 5KVQA 1DIAA 4RDIA 1SB8A 2HJSA 1DFIA 3DBRA 2TMGA 3SXPA 5T5QA 2VHYA 1GAEO 1LJ8A 1NR1A 1I2BA 4LCJA 4URFA 1HT0A 4Z3KA 2O7QA 4BO9A 3W4JA 3OECA 5A4DA 1P31A 3AOGA 2DBRA 2Z5LA 2DU8A 1T4DA 4NFHA 3ZNOA 5DF1A 3JQ7A 5EMHA 3VKUA 3AOEA 4KDFA 3C3XA 1YE3A 4BNVA 3M1AA 4IZIA 1R4NB 1H93A 1N1GA 2PD4A 2Z1MA 3BHJA 5G0VA 3TQHA 4U6SA 5JW6A 3UXYA 1YQGA 2AEMA 3ZWOA 2X5KO 1U1IA 1YL6A 1U3TA 2BGMA 3GY0A 4CR7A 1C1DB 4EITA 1TLTA 5BT9A 3LK7A 4BNYA 2XXBA 3PDUA 4CMEC 1ZH8A 2EF1A 5EQDA 4OO3A 2YY7A 4GX5A 3L0DA 4RLHA 2X5JO 4JGBA 3KYCB 4Q3CA 2AQ8A 1U7TA 2AHRA 2D3TA 3JQCA 1TT5A 5L4SA 3S1LA 3GFGA 3ETEA 2FPGA 1CETA 4I8XA 4RCVA 1O8CA 4L74A 4W7IA 1MC5A 1RM3A 3W1VA 1A5ZA 4AL4A 4BNLA 1A4UA 1DRVA 4UUNA 5ILGA 2EW2A 3K2BA 1N92A 3HN7A 4E12A 2FZWA 4RF3A 2FOIA 3RUHA 5BR7A 4YAIA 3K31A 2A92A 3UCFA 2VTEA 4RF4A 2ZB4A 2AE2A 4E31A 4I9HA 2NTVA 1BW9B 4HP8A 1PIWA 4L75A 4CV0A 1ISIA 4CQLA 2JFHA 4ZU3A 2OHXA 3RI3A 1RWBA 3PI7A 4ID9A 1IZ9A 3AI3A 3TZHA 4J91A 1KVQA 4UVDA 4D41A 5AOVA 2DT5A 2B4QA 4E32A 5TSDA 1X0VA 3C85A 5TLSA 3MWDB 4U0JA 1U28A 4KUGA 1QYDA 3PDJA 3TFQA 2B5VA 6ADHA 2IEBA 3G1UA 1F06A 3FR7A 2EGHA 3KB6A 4QUKA 3E1KA 2GDZA 2PZLA 2YHIA 1R66A 1I01A 1KEUA 4WNIA 3WYBA 1R0LA 2HMVA 1E7MA 1ZIDA 4J49A 3RFXA 5TT1A 1UUFA 4J1NA 3CSDA 5KJ6A 2JD0A 3HDHA 3P2OA 4K6CA 1DAPA 3S8MA 3ZV6A 3TZ6A 4BNZA 4YACA 4R5MA 1JTVA 2JJYA 3AY7A 3KBOA 1EVZA 2CNBA 1Z7EA 2HDHA 3EK2A 4KUHA 1R16A 3AU9A 1E3JA 2X1HA 3HSKA 1FMCA 3E5MA 4IS3A 2DKNA 4B4OA 4A0SA 3RUAA 1E1KA 3KSUA 3PHJA 3QVTA 3VDQA 4IMPA 3RC7A 3TN7A 1YDEA 1G1AA 5I8WA 3LLSA 4YXFA 2CSUA 1QYWA 1LEHA 4P22A 2HCTA 1I0ZA 1DIRA 3GVCA 4UVHA 1PL7A 4BHTA 1O6ZA 4P38A 5JLAA 3KHUA 1HDOA 4DGSA 6LDHA 1ID1A 3C7CB 1ZEJA 4FJ1A 5KWEA 3ZNQA 4CMCA 3PWSA 2ZTVA 2JCXA 4LW8A 2O3JA 3JQ9A 4ZN6A 4XR9A 1M67A 4BGEA 3WGZA 4NNJA 1BSVA 1T1SA 3SVTA 1X7GA 3OQ1A 4E13A 5HBRA 4IINA 1VE9A 4WGGA 5IDQA 2UVDA 2DAPA 3I23A 4LSMA 1IULA 1HWYA 3LT1A 3ZU4A 4J6FA 5KKCA 4Y6RA 4DREA 1PJQA 1ZK3A 3TZQA 3TFOA 1BGVA 1K0UA 2PGJA 2WWRA 4IBOA 4YTEA 4XWYA 3A4VA 2NADA 1UZLA 3JQ6A 2B4RO 3HE3A 3QP9A 3ZHBA 3IDSA 1IOLA 4D3SA 1I5RA 1C0PA 2YFHA 1T2EA 5U1PA 2HQ1A 4QXMA 4IDBA 5IAAA 1PJLA 4WUVA 3BZUA 5JS6A 3BXXA 4CM8B 4ZJUA 2X9VA 1Y5RA 4DPLA 1O9BA 1P1JA 1ZCJA 2OMEA 1VSUA 4PZEA 4Q3EA 3SEFA 4E30A 5DULA 5KCZA 5JDIA 4B7CA 3NGXA 2QW8A 3PQDA 1JA9A 1LRKA 3HUDA 2X22A 3EZLA 2JKVA 1P77A 2GUGA 4AJNA 2HRZA 2EWMA 2GN6A 3NTQA 5DP1A 1ADFA 2PV7A 1T2FA 3RUCA 5BNTA 3WFJA 4IDAA 1YWGO 3WGGA 2OP1A 1U3UA 3OIDA 4ALLA 5IJZA 1KYQA 3BTVA 4BO0A 4GLLA 1WP4A 5KIAA 2C5EA 3K6JA 4XYLA 4Z9XA 1R15A 2DFVA 3F47A 1PS0A 3ZWWA 3GT0A 4RF2A 3C7DB 3WSVA 1QKIA 1R4NA 1YL7A 4WCFC 2VWGA 1E6WA 3LDHA 3RKUA 3U9LA 4U8GA 3JCZA 3V2GA 3RASA 2ZCUA 5ES3A 3SJ7A 1ZW1A 4DPMA 1A4IA 1C1DA 1GYRA 3ENNA 3LT2A 3ZWBA 2RHRA 3EVTA 1T4BA 4L9RA 2NM0A 1EK5A 4YDRA 4IDEA 3MJVA 4MVJI 1WMAA 3VZRA 3INGA 5CP8A 1P0FA 3OEYA 1IHYA 1UP6A 4ND4A 3KYCA 1EUCA 1GEGA 3E5RA 3EYWA 3KEOA 4KWHA 4XYBA 1Q7BA 2BRUA 3E82A 4ND3A 3H9JA 4BNKA 3L6OO 4XB1A 1M2WA 4CQMB 3GLQA 3S2GA 4H16A 3BYZA 1IZ0A 2EKLA 1FDUA 3ABIA 4XCVA 4MP3A 4PLVA 2IXBA 2F1KA 2VNSA 4J4BA 3EUWA 4NI5A 1XELA 2E48A 4R4JA 5GZ1A 2FRDA 1U7HA 2X0JA 5HWSA 3EGOA 4YT2A 4DUPA 4MVJG 1O5IA 4PLTA 5COAA 2YHUA 4XDZA 8ADHA 3JQAB 3I5MA 2D5AA 1CF2O 3PPIA 3A06A 3GUCA 2NSDA 4MVJA 1OAAA 3HDYA 1JKIA 4JBIA 1Y81A 5I9LA 1NXQA 2OBNA 2C20A 2I9PA 3VH4A 1XHLA 2P2SA 1NWHA 4N7RA 4JJGA 1ARZA 2ZJ1A 5IN4A 1LLDA 2JAPA 3ORFA 1GCOA 4ALMA 3MOGA 1ISJA 5I7FA 1U8FO 4R41A 2CVZA 3JD3A 1C0KA 3JSAA 3DXFA 3CPSA 5A5FA 1DHRA 1IB6A 3DBHB 2AXQA 4WLOA 2Y67A 1RM5A 4JIGA 4ZHSA 5A06A 3JQAD 3ZWPA 3ZH2A 4DQXA 2Q99A 2IDZA 3QJ5A 5JXWA 2WM3A 3KETA 1XU9A 1LDBA 3DMYA 2CVQA 4AJ4A 4RDHA 5KVCA 1H9AA 3RC2A 1HYHA 4UVEA 2VTDA 3PP8A 2AG8A 2P4QA 3AK4A 5FI5A 1LSOA 4B3JA 5B12A 3QIVA 3CE6A 4NBWA 2O2SA 4WLFA 1QMGA 5B4TA 1PGQA 1NAIA 3IAHA 4BNTA 1H9BA 3ADOA 2OXIA 3DAFA 5CDYA 1V35A 5MGBA 1F17A 1YBAA 3TOZA 2AG5A 3D3WB 4GVXA 2VQ3A 4GX1A 4AJLA 2RIRA 3DR3A 4IQ0A 1ENOA 3IMFA 3EVNA 2NU7A 1PJBA 2FR0A 4IIUA 4OM8A 3H5NA 1AHHA 3AJRA 2ZKLA 3WMXA 1DC4A 2DQ4A 3A28A 3P2YA 3PQEA 3F5QA 3N58A 1FK8A 5CEEA 1SNYA 1EVJA 4B8WA 4E2YA 3PYXA 1D1SA 4HBGA 1ISHA 4LGVA 4NJOA 3UCXA 5U4QA 5DCWA 3CUKA 2ZTUA 4HADA 4LSWA 5IFLA 3OF2A 4DXHA 2QRLA 3H3JA 3ZW8A 1Q0HA 1P44A 1YXMA 2X9GA 1TT7A 3GNQA 2C29D 5IXSA 3O9ZA 4YRAA 3V2HA 4ESOA 3AWDA 3GVPA 2J5QA 4D46A 2B5WA 1GL3A 1QV6A 2EW8A 3PHHA 4J9UE 3S2FA 4EBFA 2Y1GA 4IDFA 1NVGA 1N2SA 1R6DA 3DB2A 4PCVA 4Z0PA 3W4KA 5IXYA 3S2EA 3FD8A 3JYQA 4TRJA 2Q2QA 3MEQA 2O23A 4RO0A 1CQIA 2BH9A 3WG9A 5FYDA 1P3DA 1T26A 1B7GO 2DPHA 3KSDO 5CFZA 5GZ6A 4J2HA 1RYEA 5L40A 4Z6KA 3IOYA 2PZKA 3OSUA 3QVOA 4RGBA 4CLEA 1IPFA 2CFCA 4ITUA 4CM4B 1HLDA 3GNTA 3TOXA 3WGQA 4H15A 3ROQA 2VUSA 4CM8A 5T6BA 4DLBA 3IC5A 3FBGA 3QLJA 4YWJA 1CDOA 1RYDA 2Q50A 1X1EA 5JCJD 2OBYA 5H81A 2TMDA 3Q11A 1CIVA 5L7TA 1T2DA 4A03A 2Y93A 4MKXA 1ZJYA 2VN8A 3JD4A 4Q9NA 2DTXA 3O4RA 2CUKA 4D3DA 5JMWA 3UOGA 1QG6A 1VM6A 5FF9A 5BNFA 3G3EA 4YJGB 4XYMA 1GADO 3ZDFA 2GO1A 3G0OA 1K89A 4XDYA 3LVFO 4J1TA 3U4CA 3NJ8A 1AXEA 1M6HA 4OSPA 3NTRA 4YQYA 4AJIA 1J4AA 2NLOA 4MPDA 4WLNA 5A3VA 1WWKA 2CVOA 3DBVO 3N74A 2Z95A 3IUSA 2LDBA 1DC5A 4B7UA 4TSKA 3WJAA 3WQSB 2W2LD 3PIIA 3QHAA 5C7IO 1XYGA 2PH3A 3L6EA 4PLPA 1J6UA 4S3MA 3KZVA 2V6FA 3KVOA 3IJPA 5LC1A 1ISFA 1EFLA 4Y6SA 3DZHA 3LF1A 4WEQA 5G4KB 3ON5A 4HWKA 4XEHA 5FWNA 3NGLA 1QLJA 4BO7A 4R3NA 4CLOB 4BGUA 5L7WA 2ZQZA 2JFFA 3DAPA 5DZSA 3C1TA 3JQ9C 2YYYA 3ICCA 4OYRA 1KEPA 3VKVA 4GSKA 2I99A 2VHZA 4CQMA 2VUTA 1EEHA 3I9JA 4L73A 1OZAA 4JCOA 3U0BA 1YJ8A 4QO8A 4FB5A 4A2CA 4OAQA 3AUAA 1ONOA 2EKPA 2J6IA 4NPCA 4TRMA 2VOEA 4FOOA 2BHLA 4BNMA 3IL2A 4NU5A 3TF5A 3JQAA 2GNAA 1HDRA 1N5DA 2W90A 5AQ1A 3ST7A 4K1LA 3OJFA 4DLLA 3FNGA 1N7HA 3RJ5A 4BO2A 4JP2A 4M86A 3ZHXA 3NUGA 2EXXA 4NBRA 3ZWCA 1PJ3A 1DAOA 5JDIC 5JC1A 5JAZA 1DBVO 2C0CA 2YUTA 2DBZA 2C7VA 3QV1A 4L0QA 3VPHA 2E49A 2JHFA 2G17A 2ZCVA 5C3MA 4I5GA 1I3MA 3DBHA 4PLFA 3WGTA 2PNFA 4UUPA 2BI8A 3H5AA 2GRAA 3SLGA 1DIGA 1LRJA 1SO8A 1WXDA 4NIMA 5DCYA 5H83A 1K6IA 5DOVA 2UDPA 2A4KA 2E82A 5DP2A 4I1IA 3ZU2A 1GEEA 5JAIA 3DZKA 1NVMB 1A72A 4C7JA 1Z74A 1PGPA 3BA1A 2HMWA 2B83A 2GD1O 1FXSA 3F4LA 4YEDA 1JKJA 5TGDA 2C07A 3QWAA 5K9ZA 3AUSA 1U5AA 1XEAA 1GR0A 3DOCA 1XG5A 1ZMTA 2IZZA 1VKOA 2FWMX 4HX5A 3CZMA 2IRWA 3D3WA 1DC3A 2DFDA 4ALNA 4R01A 1A7KA 4UULA 5GY7A 1JAXA 1LUAA 4WLEA 3TNLA 1Q0QA 4EGFA 2ZATA 2NQ8A 4E4YA 2O48X 3LQFA 4M49A 2BFPA 1I36A 3JV7A 1OBFO 1PTJA 4CM1A 3JD0A 1HE5A 3KEQA 4DMLA 4B79A 1HDCA 2BLLA 3CMCO 1N1EA 3F1LA 3EDMA 4LMPA 5KNLA 1MP0A 4FJ0A 2FSSA 1E7WA 1X1TA 1UXGA 3WJ7A 1PU2A 5JYDA 2J3KA 3CH6A 2J5RA 4D0RA 5GMOA 1ZBQA 1Q0LA 4YBZA 1EFKA 1LDMA 1T2AA 4L76A 1X13A 2JCYA 4YA6A 1QYXA 2X7HA 1I8TA 3QSGA 1QRRA 3Q9UA 1SC6A 4Z9YA 5TC4A 3SC4A 4DMMA 3FWZA 4JLWA 2CY0A 5JCJA 2V6MA 1TB4A 1ZSVA 3GAFA 7ADHA 1C14A 2IZ1A 4CMIB 3MWEB 1U9JA 3H9QA 4IS2A 3UKOA 1PWZA 3ENKA 5JY6A 1D3AA 1AGNA 3P7MA 2Y1EA 4IDGA 3BHIA 4KTTE 3H8VA 5DBGA 5COQA 4HFMA 3FBTA 4WLVA 3DHYA 4NR0A 1ZXBA 2XXJA 5CDUA 4W7HA 4INAA 4CM4A 2YW9A 4XQEA 3U3XA 4RQUA 5B37A 3B70A 4CMJA 2H5LA 3IP3A 3PIDA 2FHSA 1NPTO 3UW3A 4DC0A 3K2EA 4R16A 2W2LA 1WDKA 4AJKA 4N5MA 4BKRA 2QX7A 3G49A 3ONDA 5A9TA 2POQX 2Q4EA 4YJGA 3EAGA 4BV9A 3DWFA 3L6DA 3I9MA 1BDMA 1EUDA 2VRCD 2O4UX 5IDYA 3VVBA 2C2YA 4CLHA 3LC7O 4CMBA 2Y66A 1Y1PA 1D4FA 2Q46A 5AYVA 5KJCA 3EMKA 2HKIA 3DC2A 4PVDA 4ZQFA 2VYND 1QV7A 1NFRA 4ND1A 4PG6A 5KVSA 4FFPA 4BS9A 5IZCC 3CXRA 2YQ4A 4NBUA 2FZEA 1HDXA 2DUWA 4FBGA 3K73O 2XF8A 5JFOA 2EP5A 1SMKA 3JQ8B 4CM6A 3JQFA 2CZCA 1RJWA 2WTBA 4N5LA 3HDJA 5G4KA 3VZSA 1U3WA 4TKLA 3ETGA 4XGKA 1H6AA 4CLOA 2NU6A 3I9KA 2HK8A 3COSA 1XIVA 2Y1DA 3WDSA 4Y67A 5JO9A 4DIBA 1A9ZA 3OM9A 2WSBA 3N7UA 3MZ0A 3PTZA 5CG1A 5HA5A 1ADBA 3DO5A 1HSOA 4HKTA 2P5UA 3F5SA 4FPXA 2JL1A 2DVMA 2PKRA 3NT2A 5BNIA 2FN7A 3IUPA 3PJFA 2WMDA 3AFMA 3NX4A 1UJMA 5F5NA 4E5MA 2I65A 5AXCA 4BVAA 1S6YA 3O03A 5I8ZA 4DVJA 4U6QA 2YFQA 3RU9A 4XD2A 1PZEA 1I10A 1FJHA 4Y98A 2ZB7A 3PWZA 4QQRA 4LN1A 4R9SA 2O4CA 1HSZA 1WW8A 1B14A 2YQ5A 4S1VA 3UUWA 1ZK4A 2RAFA 3GEMA 3WGOA 4H3VA 3OH8A 3BMOB 1J5PA 2CF5A 4NJMA 5LDGA 5L53A 3QVXA 1UAYA 4E33A 1N7GA 3D64A 3I83A 4GKBA 2FMUA 3WTBA 3Q6IA 5A5EA 2NVWA 3QRWA 4YR9A 1GQYA 1VKNA 1UR5A 1I30A 3DDNA 1YKFA 4TKMA 4CJXA 2WE7A 4FFNA 1JDJA 3A14A 1ENPA 3DEYX 4FN4A 1WDLA 4QO7A 1NTOA 2P91A 3HHPA 5JNLA 2VZ8A 2QRJA 3B20A 3PLNA 3G17A 3ICPA 4N54A 2HO5A 4PZDA 4HNHA 2Y68A 2GF2A 2PFGA 1YL5A 3HWRA 3RUFA 2G82A 4XGIA 3W8EA 3AM4A 4PLZA 1WLYA 4CM7A 1BTOA 3UGKA 4GL4A 3H4VA 2B0JA 1Z45A 1UZMA 4ZD6A 2GASA 3A1NA 3H2SA 4UEJA 1GUZA 1MFZA 3VPFA 4MVJM 4PLGA 4AJPA 3WLFA 1E7SA 3WLEA 1GQQA 2EEZA 3GGPA 1P0CA 1P45A 4TVBA 3GPDG 4M89A 4U7WA 4NH4A 1Y7TA 3FF4A 2QIOA 1OMOA 1M76A 4MVJE 2VUUA 4CLDA 3PGXA 1NQTA 2I76A 4AJ1A 1QLHA 4FD3A 2O3TA 3FTNA 1E0DA 1GDHA 1H6BA 1JAYA 4FFMA 2OFPA 2X0NA 3BIOA 3Q9NA 2FP4A 4J7CA 1JW9B 3DMTA 4WOJA 1HRDA 3RBVA 1ZZEA 2JFGA 5TF4A 3AUUA 3VPGA 2IXAA 5I7VA 3EC7A 4R1UA 1KY5A 3SC6A 4CUJA 4BOYA 4O0LA 1YB4A 1EBFA 3C1OA 2GPTA 4QTZA 4BNGA 1Y6JA 2G0TA 1GY8A 1FDTA 4BKQA 1NYTA 3B1KA 4GLOA 4RJTA 1E1LA 5T8KA 2EGGA 2NU8A 3GK3A 1YVEI 1PGOA 3PZRA 1SB9A 4DRYA 4F46A 4BV8A 1C0LA 4RZHA 4CMIA 2IZ0A 3I52A 4I08A 4B7XA 3WWYA 1TI7A 5L3ZA 4DYDA 1RPNA 4D79A 1FDWA 2AEFA 2DTDA 2FPIA 2R2GA 2BFOA 3QVSA 2OORA 4TZTA 3QVWA 1E3LA 3RKRA 1DLJA 1JWBB 2VRCA 4O63O 1MXHA 4ONEA 5I9MA 2RBEA 4M8SA 4K26A 4LMRA 4KMSA 4G81A 4QX6A 1XKQA 3NDRA 3PGJA 4MIOA 1V8BA 3GZNB 4KQWA 2E4AA 2VYNA 4MP6A 4W9NA 4JN6B 3W8DA 3WGHA 4OMUA 4ILKA 4B4WA 2Q3EA 4RL6A 1GYPA 3D4NA 4GMFA 4NK4A 4B3IA 4JJFA 4RPHA 3AY3A 3GOHA 2P68A 4GH5A 5K6AA 2O3QA 2XPCA 4K6FA 4GAEA 3V2UA 4XIJA 1ZK0A 2P5YA 3PYLA 4D45A 2BELA 4CV2A 3H7AA 3JQBA 1ZSNA 3QE3A 1EQUA 4W4TA 4YT8A 4I5DA 3Q2IA 2HJRA 2I3GA 4RORA 1LC0A 3W4IA 3ZHZA 2D5CA 5L4LA 4RVDA 3ZWYA 4RV9A 2Y1CA 5A9RA 3I6QA 3WQRA 4CMHA 4BMNA 1LI4A 1XLTA 3JQ8A 3PK0A 3BMCB 2QZ9A 1W8DA 1ISMA 4Q3NA 5TNXA 3OETA 4YAEA 4A5OA 1LU9A 4BQRA 5C5IA 1A9YA 3T7CA 1LLCA 4WKGA 1YBMA 3BMNB 2RH8A 4KZPA 4IJKA 4BNJA 4ZQGA 2Q2VA 4FDAA 4YYZA 1NHWA 2QG4A 3GGGA 2X58A 2Q4BA 3ASUA 2NV6A 3GVIA 3LSYA 3WIEA 3ITDA 3V8BA 4AICA 4E6PA 3ONEA 1GTMA 2NWQA 4EEZA 2ZYAA 1PZFA 4CV1A 3HQ4O 2Q1SA 4A27A 2X86A 2QHXA 4WOKA 4GQAA 3GZ4A 4BNFA 4JNKA 4NBVA 1B8UA 1LSJA 1UZNA 1DPGA 2CF6A 3NAQA 4XQCA 4J4HA 4OQZA 4Z0TA 3BMOA 4LVCA 4PN3A 3ANMA 4PRLA 5HTOA 3VH3A 3OIFA 3LU1A 3OJEA 2WJPA 3D1LA 1GFSA 1SEPA 2RCYA 1UDAA 5ADHA 3AOEC 1FDSA 1QYVA 2HUNA 5EERA 1B3BA 3FN4A 4D43A 2ET6A 3OA2A 4WE3A 1LDGA 3KO8A 2VZ9A 4IY1A 1V3VA 1GZ4A 1KIFA 1E5LA 3DFZA 2J8ZA 2C59A 1R0KA 5IDWA 1E6EA 1KVTA 2YDXA 4HFRA 3OQBA 1BMDA 3RUIA 5ICMA 3P19A 4N18A 1VRWA 1DEHA 1YDWA 3DHEA 3DBLB 4WCFB 5KTKA 1MUUA 4E3ZA 3PRJA 3PHIA 4PG8A 2B4TO 4ND5A 3JYNA 4OKIA 4J9VA 4BO6A 3NJ4A 4EDFA 2PWZA 1PJTA 4CPDA 1BXZA 3STHA 3VZPA 4ZQEA 4BMSA 4CMEA 5JAMA 4ZA2A 4PG7A 1BRMA 4IJVA 1T24A 4GMGA 2AQKA 5EPOA 2AQHA 2PK3A 3JQFC 2ZJ0A 3KTDA 2GZ1A 1BHSA 2HMSA 4P4GA 1PSDA 3Q3CA 5F5LA 3DQPA 4WNCA 3AFNA 3IJRA 1B16A 3K30A 5JAQA 3E9QA 4CM3A 3D7LA 2QZZA 4H7PA 2VT2A 5DN9A 3DOJA 4FFLA 1AUPA 1C1XB 2BI7A 2GZ3A 4XJSA 3FCOA 2Y05A 1NR7A 2VYVD 3UICA 3INTA 4RLSA 1ZJZA 3L77A 5EL0A 1XQ6A 4AFNA 4FIZA 3WWZA 3OP4A 1P1KA 2ZB8A 4OSOA 3OEWA 4J3FA 1JN0A 4NFYA 3I4FA 4IZHA 1U4SA 5JSFA 1VL0A 3OJOA 2W98A 4CLRB 5JE8A 4UVGA 1I2ZA 5ER9A 1DLIA 5B1YA 2HK9A 1NQ5A 2UUOA 2EIHA 2OUIA 3PHGA 3P5SA 4JQCA 1YQDA 4BNIA 5ER6A 3F6YA 3JQGB 3U4HA 5KVVA 4KTVE 2CDAA 4RVSA 3QWHA 3E9MA 4CUZA 1Q1NA 1C3VA 3CZRA 4PIVA 5IG2A 2Z1NA 4DL9A 4GWGA 3G1TA 2CD9A 4NG5A 2XAAA 1DIHA 4J2OA 1XCBA 2VWQA 4XX0A 5A9SB 5CG2A 4R9RA 4P4LA 5JY1A 1W0CA 4R68A 4R5HA 2NVUB 3R6DA 3TL2A 4BNUA 3RROA 5G0TA 3T4EA 3UVEA 5JYEA 3GNSA 1ZSYA 3TJRA 2O7SA 4E2WA 4Z3DA 4BB6A 3DONA 5K0ZA 1PZGA 3GAZA 4XQGA 3U4DA 3GZNA 3RC1A 1PJSA 5F1PA 5JPIA 2IYPA 4E5PA 3GN1A 3HB4X 5ENDA 2ILTA 2DBQA 1LXCA 2ZB3A 4IDCA 3D0OA 3ZGYA 1XU7A 2AMFA 3F4BA 2EKQA 1DJQA 3CMMA 1KBZA 5AXDA 1XQ1A 5A03A 1H6CA 3RFTA 1QR6A 3BAZA 3RFVA 2HK7A 4CR8A 1E3EA 3K9QO 4JBHA 4GSLA 3H9EO 1NHGA 1A71A 5AXBA 2NQTA 3F9IA 1NAHA 4IDDA 5TIIA 2OL4A 3I1JA 2I6TA 3PQFA 4QT0A 4EJMA 4TVOA 1U2GA 3MCVA 3ZCXA 1HDGO 3HN2A 1YB5A 3GFBA 2UV8A 3W6UA 1YB1A 3JD2A 1K3TA 4GWKA 5KKAA 1I3NA 4L8VA 1DC6A 3CTMA 4DPKA 1KC1A 3CEAA 3BMCA 1LSUA 5TX7A 2WYUA 3IS3A 1Q7CA 2W2KA 4J43A 4KOAA 4TROA 4PLYA 4I9NA 4W82A 4NQZA 2WYWA 5F3RA 4EUFA 2O50A 1NBOA 1JVBA 4ZVVA 3BMNA 3LLVA 4BL5A 1MG0A 1YH3A 2P9CA 4NJMB 1SPXA 4JBGA 4CLXA 2QYTA 1KVUA 3KV3O 5HS6A 2WE8A 4LISA 2GYYA 3G79A 2DM6A 5T8KC 2ZTLA 2ZYDA 3GEDA 4ZQHA 1W6UA 1JQBA 2DTEA 2J3IA 5C37A 1H0KA 3DL2A 4RPJA 3GPIA 3HADA 4RZIA 1GV0A 4LVUA 3VC7A 3BMQB 3H3FA 2EV9A 5JBIA 3CKYA 2PD6A 2PKQO 3A9WA 3RSHA 5J23A 1HLPA 3WGYA 4OL9A 1IUKA 3I9NA 1JKFA 1MXFA 3FTPA 1G0OA 1LQTA 3ONFA 5IF3A 1MG5A 2A9FA 3RBXA 3QQPA 1WZIA 2AEJA 1B3RA 1QORA 4O6VA 3WYEA 1I2CA 3M1LA 2NTNA 1L1FA 1NNUA 2QRKA 3KYDB 3E8XA 4EZBA 4WASA 4XKJA 1WNTA 2Q1TA 4EJ6A 4W9NC 1CJCA 4QEDA 1QP8A 3TPCA 1AHIA 1P1IA 4CUKA 3DHNA 4IJUA 2GERA 1PL6A 4UEKA 3ZV5A 5CEFA 1HYGA 1KETA 1VJ1A 3LC1O 5K6AC 3AW9A 5A04A 2BGKA 4YPOA 5KJFA 3JQBC 1DB3A 4D0SA 4YRDA 5G0WA 2UUPA 5BSHA 1CYDA 1Y9EA 1KS9A 1I3KA 3WIDA 5I7SA 3VZQA 3B6ZA 3GUYA 2I67A 4HV4A 4J7UA 3DBLA 4WCFA 3HFGA 2UAGA 4C7KA 2Y1FA 3MJEA 4M1QA 5EINA 3ZWAA 3FRJA 2EHDA 2FR8A 2AQIA 2E37A 1UDCA 2VOJA 5L7YA 3U49A 1PJCA 2A94A 4TQGA 1ZUD1 2B36A 2Y1OA 2HSDA 1VC2A 1YQXA 5G4LA 4C4OA 3NEPX 5BSEA 2C5AA 4MP8A 1LDYA 3GHYA 4PLWA 4NMHA 3WFIA 2HRBA 4Y8VA 1G0NA 5BSFA 4OXKA 4Q3AA 1SOWA 2A35A 1O89A 5I7EA 3GDOA 1K2WA 3PHLA 4DIOA 2C82A 4PLHA 4AVYA 5ITVA 3SLKA 3QWFA 2DC1A 4J4TA 4MKZA 4RVHA 1C1XA 4II3A 1E6UA 4LK3A 4M54A 4YJFB 3HNPA 2OOSA 2PR2A 2ZQYA 4ALIA 2PGDA 4IM7A 3I4CA 2RH4A 1TA4A 4EUEA 5A05A 1KEVA 3WX0A 1JU9A 1HE3A 4FQ8A 2R6JA 1KEWA 3DFUA 1SBYA 4D44A 4CLRA 1GPJA 3QWIA 1AE1A 1DHTA 2WD8A 5ITWA 3VAZA 4FW8A 1BXGB 5BSGA 1H5QA 1I32A 1EDOA 3L4SO 1P9LA 2DBVO 2E6UX 2YDYA 4NBTA 3JQGA 4ZICA 2I66A 2PTGA 3C8MA 3K8ZA 4PFJA 4F6CA 4IQ8A 1N9GA 3VVCA 3PJGA 1BVUA 4DIFA 4R1NA 4BMVA 2JHGA 5KJEA 3ZV4A 2AA3A 4B3HA 3O26A 2BKAA 2Q2WA 2W8ZA 3JYOA 4YB8A 1ZMOA 3JQDA 9LDTA 1L7EA 3BTSA 2IEDA 3DZIA 2YV3A 3VTFA 1B0AA 5A9SA 4NZ9A 3WTCA 2NVUA 4GKVA 5TJ9A 3MOIA 3IQDB 1V9LA 4PVCA 4QECA 4BKUA 4CM5A 1V0JA 1SZJG 3RVDA 1DRWA 1DSSG 4BNNA 2H63A 3TDKA 4HFJA 2BF7A 3UF0A 4B8ZA 4UVIA 1E3WB 1UAGA 2NVBA 3KYBA 4YQZA 2NUAA 3VPXA 5L9AA 1OC2A 1ISGA 1NM5A 2P9GA 4GGPA 2EG9A 1NFQA 2EP7A 5JDCA 4NK5A 2WYVA 1Z6ZA 3OJ0A 3W8FA 4RPGA 4EUHA 1UXJA 4NU6A 4ZGWA 1Q7GA 5AVOA 2IYOA 5JC8A 1GQ2A 4EYEA 3JQEA 2C2XA 3AY6A 2VCYA 5EN4A 4E0BA 1MV8A 4BNWA 3RIHA 1PR3A 3NT4A 3DTTA 2BD0A 4FFOA 1E7QA 1PGJA 1H6DA 2B69A 3EZYA 4A73A 2VNAA 1KY4A 1R4MB 1NPDA 3WYCA 1LRLA 1RKXA 2ZIZA 4J0FA 4U0KA 2Y0DA 3TL3A 2EERA 1AN9A 4JJIA 1PQUA 1ADGA 4FC7A 3OQ6A 3PJEA 3PJDA 2V6GA 3L4BA 1W4ZA 4CL3A 4M87A 1PWXA 4RF5A 3OHSX 3GR6A 3LT0A 5HM8A 4OOEA 3KSZO 4B4UA 1XA0A 4XRGA 3RUEA 3I9LA 1ZK1A 3FR8A 3IKTA 4MVJH 5CHEA 1DIBA 4AJJA 4PRKA 3M2TA 1ZO8A 3KRTA 4J90A 3VTZA 1EUZA 3ROMA 5A1TA 4ROSA 3BMQA 2B37A 1LA2A 3NT5A 1M66A 4FSHA 3GC6A 4WECA 2PZMA 3L9WA 3E48A 4IJWA 5G0SA 2I3AA 4ZRMA 1XR3A 4MVJD 2AE1A 5A02A 3HJAA 1X7HA 1RM4A 2ZYGA 4GI2A 4YAJA 3Q0EA 3MTGA 3V1TC 2CDBA 1PS9A 1NX6A 2C7GA 4CMKA 4EI2A 1H2HA 2R00A 4MIYA 1NWCA 2O3UA 2PH5A 3VH1A 3E9NA 4AJ2A 1MGOA 1HTBA 3RBZA 3KYDA 4BUCA 1HF3A 5FEUA 3R3JA 2I5PO 4JXKA 2ZTMA 5EESA 3RQSA 2J3JA 3RWBA 3TRIA 4FGWA 1GUYA 3IIEA 3U5TA 4JK3A 2GZ2A 2JD2A 2D59A 1B26A 3O8QB 2VHWA 3FHLA 3AI2A 2GN4A 5COBA 4XJTA 3VOSA 1JVSA 2Q1WA 3TZCA 4RQTA 1PJ4A 4BO8A 1K5HA 4DYVA 1P74A 1V3TA 1PJ2A 3H9GA 3SX2A 3TSCA 3GGOA 2V6BA 2HMUA 4F3YA 4BQPA 3FPCA 3H5RA 2HLPA 4GX0A 3PYMA 1IE3A 3MJTA 2VWHA 1U5CA 3FNFA 5CAEA 4OGWA 3LT4A 4WPGA 3BHMA 1ONNA 1LSSA 1O94A 2BFMA 3DTYA 3WGIA 5FFFA 1GV1A 4QFCA 4G2NA 5IDXA 2PGLA 4IIVA 4OIMA 2VRBA 4PLCA 2D8AA 2OGUA 4DWVA 3Q2KA 1MLDA 1EQ2A 1OFGA 1P1RA 3GEGA 4JP3A 1CWUA 1ZK2A 4Q3DA 4DBVO 1CEQA 2OO5A 4B4VA 1EVIA 1YO6A 1ZFNA
chains in the Genus database with same CATH superfamily
4JU9A 1QOPB 1L4FA 4KNWA 4A23A 1WZCA 4BX0A 4ZZIA 5DVZA 4CZ2A 1ORRA 2PU7A 3NG1A 3ZWMA 2HBYA 1EVYA 4AKEA 3OVMA 1EH5A 4XVHA 1ILWA 3O95A 3H05A 3NNSA 3F8WA 1QF6A 3CNHA 2MSNA 3ITKA 1E2IA 4TTIA 3SJUA 2FN9A 2WT8A 3BCRA 2CNKA 3CLHA 4MA5A 3LW7A 2O2HA 2GT1A 5CA0B 1KI6B 3DQQA 1VDZA 4XUGB 1KHTA 1JG7A 4FTWA 5EJ2A 2X5OA 3ZR4B 5C5EA 4OHFA 5CB4B 1VCIA 3U4IA 5KX5B 2YJ4A 2RHBA 4F04A 3HB9A 1KI3A 1T9KA 2ACEA 4DA9A 2QTHA 1DRUA 4EO4A 1D2GA 1JZQA 2J9GA 2XLBA 4IHJF 3K1TA 1UM9A 4PPNA 3K92A 1QWSA 4HH3C 3IEPA 3AJDA 1TJNA 1ZUNB 4GP7A 1MAVA 4Q6BA 4QWMA 5DCUA 3TZBA 1KERA 3K72B 2QTBA 3R0JA 4GC9A 5EIEA 4RJIA 1GP2A 2LDXA 2QQ5A 5TMEA 3SC2A 2EJVA 4PC1A 4RA9A 3NM4A 1MH9A 4E5NA 3V7WA 1NVTA 1SN7A 5K0EA 3OG9A 1XZNA 2DFLA 2FEPA 3DBIA 3DT8A 1QH0A 1PP4A 4R3WA 3OWHA 1TVMA 1NJSA 2HJGA 3M5DA 1SIOA 4FEEA 1UZUA 3BORA 4MJ3A 2ZIXB 4IDHA 4MW9A 3RCBA 5KTNA 3HHEA 2JEOA 2IV2X 3JYLA 2NYAA 1ORVA 1UPXA 3CH7A 1BE1A 1NJGA 3B5JA 3KOUA 4FXPA 5AMXA 2WAXA 4C0KA 3FWKA 1A8HA 3FHJA 3MCTA 1VCOA 5HIJA 3ZHQA 1UK9A 1NI3A 2YV1A 4YV2A 3IPRA 3HNRA 1KNXA 4MIEA 1Z68A 3E84A 2XWQA 4H3HB 3RYFA 1IUOA 1ZN8A 2CUTA 2BPOA 1XRLA 3LFUA 1U1GA 2H1RA 4AQYB 1GZ6A 1OAOC 2FGJA 4I4IA 3D5QA 1KSGA 1L5FA 1Y8QB 3IDOA 2ORED 1NUPA 4G4GA 3ADBA 3IXLA 5K8TA 3RAFC 3MSCA 3IERA 1ZJ5A 1XU4A 3CF6R 4L4XA 2WUEA 2XB8A 3IV9A 2QL9A 3A9RA 3TRKA 2HGSA 3GBVA 4RD0A 5GINE 1Y5LA 2QGFA 2XUPA 1M75A 2OECA 1Y8CA 3IXMA 4KWIA 4BP1A 1ODLA 2VZLA 3ZTTA 3JYPA 2EG5A 3GRKA 1JHPA 3EODA 1QFXA 3ZU3A 3NFRA 4ZCMA 2WIFA 1O6FA 1AUVA 1E8MA 1SVWA 4D9HA 3ETDA 3ABQB 4K9QA 4DARA 3C5EA 3UOWA 4XIYA 1GNRA 4LBYA 4B45A 1KAEA 3R0QA 5F21A 2HBRA 5FJJA 3C4QA 4YT5A 4B87A 4ES6A 1E9AA 1FJ2A 2FW1A 2JJMA 1PDWA 5G0UA 4RKQA 2VHXA 3WHPA 4AVYA 3S44A 3K5PA 4WEOA 3GMSA 1EP2B 4ZT4A 1RYHA 2PL5A 3IJEB 1EXNA 3DYIA 3UAGA 3L7YA 2BHRA 1LQ2A 3EQ6A 3AO0B 4QFDA 1NU6A 3M5WA 1KMMA 4GGMX 4HO1X 3GVHA 2J1LA 2OZEA 3ADPA 4AJEA 1I4EB 2SBTA 4HS9A 2W2OA 3TLKA 2OXCA 1PWEA 4EBBA 2VP4A 4EI7A 1EVQA 1L7QA 2UXDB 2YVAA 4D4JA 1M5RA 2J6BA 2FLVA 3N2IA 2ZRLA 3AP3A 3O0DA 3NZEA 4H1HA 4JUAA 5TQ2B 3VNBA 2DULA 5C0OE 4HUJA 4ETNA 1OXSC 5LM3A 3UFXB 3CVYA 2F1OA 2GXAA 3GN2A 3QKSA 3D6FA 5CVUA 2PUEA 1I2MA 4WFQA 2ZRAA 2XHEA 5IC4A 5LD2C 1G7RA 4Q9KA 4EB6A 1XJ5A 1NP7A 2WI8A 3V34A 5HMLA 3PGA1 5FULA 2NSLA 4TTJA 3OOSA 2B7BA 3WYNA 4EHIA 1VJTA 3ZI0A 1Y6QA 3R9WA 1S2DA 2ECQA 4IMRA 2MR5A 4WIAA 1DCMA 3UJBA 1XK7A 1VIDA 3N39C 2HNBA 3WXBA 4V38A 2ISSD 3V1UA 3I3SR 1R0SA 4N5DA 1FTGA 1Q20A 4RIGA 4URUR 2LTAA 3R77A 4OHUA 2Q3LA 2Q45A 5KTOA 3WMWA 2C94A 4TXMA 4YFVA 1OZGA 3E5NA 3V33A 3KLPX 3QKTA 2IH2A 2YWBA 1QAQA 2QTLA 4F4FA 1Y8RB 3KJXA 3INRA 4NYMQ 3V7NA 1BWQA 1B1AA 3GLFB 3C3AA 3EFBA 4NE2A 5LQKA 1U0OC 4R2KA 3ZGVA 4IHJB 1NUTA 4DQVA 5LZ5A 2J0VA 5KOIA 2X8LA 4M9CA 2YWEA 4W99A 4PNEA 4QRIA 2YIVX 3AJEA 3ANSA 1AT1A 3CLRD 1D07A 2QROA 3HB5X 2R6GA 3EOZA 4MV3A 5JCZA 3QH4A 4FN5A 4HLUC 3ZY3A 1YUNA 2W6OA 3EPJA 1J49A 1WXEA 1IU9A 1GRVA 1O8BA 1NBEA 1OZHA 1PLJA 1VCMA 1JFRA 2CNWA 2H4ZA 3LVRE 4NBLA 4WJZA 2AG1A 3ROPA 1NP3A 4F11A 3ABSB 5CITA 1TXGA 3CIFA 2OSBA 2VAXA 5JAHA 4BFSA 3C24A 4XM1A 1XTUA 2BCJQ 1E4EB 3CUUA 5D5HA 5HS4A 1Z83A 1H4VB 4DLVA 1N75A 5EZSA 1TEHA 1Y1LA 2C3MA 3OQNA 3CJTA 4WFJA 4J16A 2LV8A 5KWIA 4FYXA 2UU9B 1CRLA 1ZKMA 2DERA 5H68A 1FXWA 2QLJA 5E9AA 2I7XA 1GGJA 3T5TA 2NV0A 2ZI9A 3I32A 3LSTA 4C2AA 4G09A 1A95A 1GZ3A 2NO5A 3DLBA 4L1KA 4MZDA 1WEHA 3A27A 3KM0A 4AP9A 5AW8A 4FOSA 3TXYA 3L18A 2CFIA 4OLBA 1BWSA 2Z8XA 1E94E 2JB9A 4A7PA 2X0RA 3CUWA 4L6IA 2FSVA 1FX0A 1G8GA 1FNDA 5F2OA 4ERXA 4EMUA 5J4KA 1QZZA 3A25A 3MTBA 3X2FA 1P1CA 1SQFA 2WWIA 4QREA 1V8PA 5BQPA 3C1UA 1N9GB 3ZNNA 1ZNQO 4YV7A 4NV0A 1Y7IA 1ZH0A 3DOFA 1NE7A 1XEWX 2X1VA 4IG4A 1Z28A 1ZH2A 1M2FA 5KTSA 2Q49A 2YOGA 3LX8A 1IN8A 3KFXA 1FF9A 4G85A 3V5NA 3GRRA 1S9DA 2VPZA 1QFSA 1GG9A 2G67A 2WHYA 1Q6YA 3TVTA 4RMJA 1O0SA 1T0JB 5AP9A 1KIAA 1YUBA 2GCGA 3OQPA 1Z16A 4MRPA 5CDTA 4FGJA 2JF0A 1IJBA 4RVGA 4N47A 3RRXA 2GGSA 5DDIP 4KHZA 5KDOA 1ZMRA 3ZQJA 3U31A 3WXMA 3OX3A 3CLUD 4FS3A 4EGSA 5C7YA 1AG9A 3AEZA 3B5EA 5EPEA 2IU0A 1C9EA 3MAJA 1E77A 2N3ZA 3HJUA 1XTRA 4WUTA 3UT5A 3ZDXB 1JYEA 5KB3A 3DOHA 4DA8A 3S3TA 3PEYA 4HQNA 1QOZA 1XZHA 1IXRC 4OHOA 4HNGA 3TZKA 2Q27A 4B6RA 1MZPA 4WN9A 2XUHA 3MFQA 4FNMA 1A4RA 1A50B 4KXLA 1T2CA 5NULA 3UXHA 4J75A 4BGIA 4MLPA 3KQLA 4HGOA 4N8DA 5DGTA 3UJ6A 3BSYA 2WC1A 2IPXA 2NZYA 2FWPA 3GO4A 4KPEC 1XL0A 3LZ6A 5AK0A 4BO3A 2KWIA 4UTRA 2PS0A 1IYZA 1GQOA 1LTHR 5J4YA 2AR9A 2G3YA 2J4CA 1G4UR 1K4YA 1SHUX 3PZBA 5AHRA 1Z0KA 1IN6A 3RE1A 4DLPA 1QG4A 1XDGA 2VK4A 2WJHA 3IP6A 3L7NA 4KCGA 4UEOA 2ID4A 3PFGA 5BQOA 3WKDA 2PL3A 1NSTA 2IKQA 3SCZA 4KQXA 4NE9A 1YZ3A 5FB3A 4K0KB 3IMEA 2JCSA 2EJBA 1GAJA 1E6LA 4PSUA 2XGJA 1ZISA 3AR2A 3S81A 5I7UA 1E3TA 1OYOA 4MWTA 1E3SA 3KB8A 4OSEA 4AJHA 1AO0A 2CLKB 5F77A 1CP2A 5GM2A 3BXGA 1XRNA 1Z4LA 4F3KA 1V1MB 1V1RA 5EFOA 2QPTA 1O6GA 3V8EA 3R1IA 3E7WA 3DMTC 1E8NA 2E87A 5IYZF 3TKYA 5JJBA 4P31A 2AZTA 4P7JA 8LDHA 2R5FA 3FDFA 1MC1A 1VE1A 2PY6A 2BV3A 2A0KA 3CZCA 4GI1A 1DZ3A 1F9AA 3MUEA 2A84A 4L78A 3WI7A 3AM1A 5K0BA 1OF1A 4GQIA 4FMBB 1H1TA 1U65A 2Y0CA 2H2GA 5DNCA 4DNOA 1NSYA 1M6NA 1IZYA 2WG1A 1WDWB 3AZPA 4J0HA 1N34B 3SEQA 3VNAA 2J0EA 3UB2A 4ISBA 4G0QA 1YQQA 3BTOA 4LJSA 3UJAA 4RD4A 4FYJA 1T4CA 2CXPA 2YJZA 3F1KA 4FDUA 2GA8A 5ELMA 2QI9F 5AESA 1QTQA 1U3VA 2C84A 1NBMA 3L6UA 4EQZA 3H13A 2G83A 5CNMA 4BFZA 4DDUA 3EEOA 1FDVA 2WILA 1V8FA 4F4HA 1KYYA 5AHOA 3B1JA 4ZVQA 5F4BA 3KL2A 2P40A 2FQWA 3MWLA 3KXDA 1V25A 5IJWA 4RKWA 1IZZA 1JKMA 2WB4A 4JI0B 2APJA 2FK7A 5H3CA 5L3RA 1GDTA 1FPMA 4MJLA 4H0FA 3UUGA 9LDBA 1WDMA 1RAGA 4ZXPA 4N6GA 3AVWA 4JP1A 1X8JA 2F7SA 4OQFA 3SF8B 4PANA 5AXAA 1FUUA 1NI4B 2I54A 3UAWA 4KIWA 4X7PA 3HM9A 1FTYA 2BFAA 1IHXA 3R5FA 2Q3DA 1PO7A 2PLWA 4GXQA 1Z4NA 1XRSB 4JJZA 4P9NA 4XZ3A 1ZJ6A 2QJRA 3BTUA 3D8SA 4LF9B 3F96A 1OLUB 1W5SA 1SUSA 3G5UA 5EGNA 3WHLA 1P33A 2VP0A 3QELA 4L3OA 4CMGA 4EG3A 5LP6A 1HZZA 4YVFA 3WL6A 2GCNA 3HLKA 1F8FA 3HFSA 1VMIA 2VAVA 3QKRB 4ZTBA 2XSZA 3HVRA 4X1KA 4NMWA 1A9QA 1SVMA 4CL0A 5T41A 5CDGA 4BMDA 4AJOA 1P3JA 2ZVQX 2GD0A 3ZI7A 4Q7QA 5BRAA 1MB9A 4FE7A 4O2BB 4V0ME 3ZU5A 2G8LA 4DA7A 4DDWA 5ILOA 4UTNA 1DU4A 1LPMA 1CRQA 3ORYA 1KDYA 2X1LA 1L5YA 1SC3A 4KR0A 3OJLA 5ALJA 1E7YA 3ZHYA 4JJ7A 4FDMA 3MF4A 1K6MA 4OJTA 2QA5A 4LRTB 3T3MB 1NN5A 2VZ0A 2CFOA 2NZVG 4K9DA 3AF4A 2ASEA 2XKAA 3ZWXA 2GR9A 3IAEA 3VR2A 5FUMA 5HGXA 2AOUA 4I1PA 4GBJA 4IVNA 3G6KA 1USGA 3HMQA 1QQAA 2Y1XA 2J9RA 3R6TA 3L8MA 2GLXA 4NZPA 3NYWA 4KQHA 1E1MA 5KC9A 1RPAA 3LAWA 3FNRA 3Q8WA 4KIUA 3U3KA 5LIRA 2E4VA 1L5GB 4URZR 1T8PA 2AZMA 1T1IA 1WCV1 2R25B 3IYLW 4QOJA 2C54A 4R54A 4Z9AA 4AIRA 2ZYHA 1AHPA 5E6UA 4X7RA 2QQFA 3DMPA 4PINA 3NHRA 3W04A 4ZDKA 1RHRA 3NTLA 5HOEA 3P0JA 3FWPA 3LYLA 1RDFA 4IJ6A 3UMRA 2DFTA 2NSJA 5A4IS 2AI1A 2B2NA 1F1JA 3PNMA 2FLKA 3GELA 2IE8A 3ASZA 4DILA 4ND2A 1H0RA 2MHCA 1MQ9A 3I01A 4HZUA 1E92A 4DG8A 2DH6A 1BMTA 5MDHA 3AFIA 1XTKA 4AS1A 1HT1E 4UBKA 1NUHA 3AKEA 4U2BA 2HZBA 4BECA 4MO2A 1KU0A 4CEHA 1XEWY 4C3ZA 3HYCA 3RJ9A 1YC2A 5C7OO 4Y6PA 4XDHA 4JX8A 5PGMA 4G5HA 2QMOA 4RPLA 5HRCA 3FHTA 3L0OA 5KNDA 1X87A 1V5EA 5ELLA 1CUCA 1R12A 1PR6A 2J9ZB 3QE4A 1G19A 4IIXA 3O2SB 4QG7A 1YS2X 1USWA 4I55F 5TT0A 1RC1A 4JSTA 3AUYA 4OXYA 5ELXA 2FUEA 4RA9B 3TRDA 1AJEA 1X1BA 4O4IA 1DNPA 5TS3A 5IYZB 5BUQA 3DT9A 1RJ9B 2E5FA 2ZBGA 3EQ9A 3CUVA 3GJRA 4V1CI 3SBXA 4ZT5A 5I9NA 3KXPA 1ZEMA 1JIVA 2V58A 4MK4A 1UFOA 2HIGA 5KVQA 4AKGA 2R1TB 2HJSA 1G3QA 2XE4A 2GAIA 4US1R 3DBRA 3IUEA 5AVZA 2BIFA 4HRAA 4RGQA 4NJEB 3IPLA 1FJGB 4B33A 3OIUA 5HFAA 4EHAA 1BWRA 3BSFA 2UZAA 3T15A 2ZE6A 4MVWA 1SCAA 2P9QA 4C6TA 4Z3KA 4LF4B 3W4JA 3OECA 5A4DA 1P31A 2Z5LA 2VJOA 2ZJ8A 3CN7A 4U7FA 4RTOA 1FXWF 4NFHA 4W5QA 3GEBA 3QSYA 2X5NA 2FMXA 3ZNOA 1J9EA 1KFKB 4D26A 1L8OA 4K9RA 5TE9A 2CMHA 1J7JA 3PBKA 3A1WA 4EY8A 2GAAA 2I4MA 3C3XA 3GUUA 4NMXB 5JRDS 2GBLA 4BNVA 3OQOA 2VSNA 4M0EA 2R60A 1H93A 2XMSA 3TM4A 3BHJA 3ZXUB 1V48A 4UE3S 3TQHA 5JW6A 2DBYA 1DCTA 1YQGA 1Z15A 4R1OA 4QXQA 1ECLA 3FFTA 4FMDB 1MX5A 3ZUPA 4DLNA 2P35A 4ZANA 1FLVA 1R6AA 4WESA 4NX2A 1C1DB 4CR7A 3GEEA 2YIJA 4TTPA 3W3AH 5HUHA 3LK7A 2IHBA 2WNHA 4D9CA 4CMEC 4DQDA 3DKRA 5DN6A 2OV8A 3M6WA 5EQDA 4ZDWA 4MS4B 3CA8A 4TXNA 5AHXA 2Q5IA 1KQ3A 1DINA 1FVHA 2L0XA 3ICEA 4M7PA 5A71A 4ZYWA 1X7XB 3QNUA 2FB9A 1FFXB 3KPJA 3ETEA 2FPGA 1CETA 2IDKA 2J0UA 4OHZA 4YPFA 1TUEA 3EZ7A 2JVIA 4X97A 1GVHA 5EY5B 5C8DA 4IVPA 4J0CA 1T0PA 3OKAA 1CY4A 1RM3A 3W1VA 2R8BA 4OHPA 1DXHA 2QUZA 1A4UA 2X2EA 4Y2JA 1Q84A 1PW5A 4EECA 1RZRD 3AVXA 3D3KA 3OQIA 5JZ9A 1WOYA 4E12A 1IJKA 4RF3A 1VCNA 1V5GA 3RC8A 2A92A 1T9AA 2VTEA 1JXQA 2QG6A 4B2IA 2J3MA 3PPWA 2AXPA 4E31A 5I51A 1N2ZA 1CQWA 1JEJA 3NAMA 2NTVA 4C4AA 3BH0A 2ZS7A 3CW8X 3ESRA 3BEOA 4HP8A 1A9PA 4MQ6A 1CV2A 4OGLA 4KREA 2XZDA 4CV0A 3QKSB 1YVDA 2JFHA 4LDPA 5DHAA 1RWBA 3U1BA 4QU8A 2HM7A 3KOYA 1KVQA 4O2LA 4EB6B 2VG8A 3N8IA 1AIPA 4E32A 3ZHSA 3T3NA 3AEUA 2RAVA 2GM3A 1SVUA 4TLBA 3PDJA 3UXEA 3L7OA 1T5HX 5JS7A 1UBRS 5FBQB 3RSZA 1EPUA 2A88A 2HZ7A 2ZW9A 3KOWA 1JFTA 5IT5A 4Z4HA 4OFBA 1E2BA 1KEUA 1YOBA 3OTOB 1IN7A 4WNIA 3KZXA 4R8MA 4DKXA 4MW2A 2OHOA 1VHDA 2HL6A 5ADWA 2HMYB 1KKUA 3UUFA 4BFWA 4J49A 5TT1A 1UUFA 2ZSIA 3VR6H 4HDQB 1MBZA 3AJAA 1ZI6A 4R9VA 3K70C 2YJGA 4F96A 4XWAA 1V11A 4GS5A 4RHUA 3W8RA 1X7YA 1F9EA 1V39A 3TZ6A 3GFSA 4OA5A 4YACA 3UK6A 4FB4A 5HUQA 3WRXC 4LXYA 3DAYA 2GD6A 3ZS8A 3FYHA 5I7AA 3JX9A 1Z7EA 2TS1A 3X43A 1PV1A 1JFSA 2P6MA 1OASA 4ZCRA 1R16A 2TSYB 2ATVA 4I55B 1E3JA 4EAQA 2QUAA 4BQEA 3P9RA 4MGYR 3TSWA 2JJ1A 3L1VA 2NU7B 3RLIA 4IMPA 2FW6A 3PXDA 1JHAA 5EWLA 2QZJA 3OEEA 3WMGA 1YDEA 4KIFA 1Z63A 4D80A 1DJOA 3LBHA 3TCKA 2IHNA 5KUTA 3TDMA 2XNDD 5JH7F 4HZIA 4QOEA 2RH5A 1MNAA 1DIRA 1HLFA 1ZIPA 2CMKA 3R0VA 4HEA6 4N03A 3W1EA 4BHTA 1O6ZA 1UBHS 3BE5A 2JGAA 2EATA 1XDBA 3AXTA 4B80A 1AKQA 1HDOA 3PCTA 4ZCPA 2XTZA 2POCA 1E3DA 1M73E 2J6HA 4QOIA 3HGMA 2QM8A 4HLNA 5LIPA 2HW8A 5FP0A 3NXKA 5KWEA 1THZA 2P2GA 1UAAA 3DLAA 1N2JA 1QGZA 1QHHB 3VI3B 3GJQA 2COKA 4LJKA 2OR3A 4ARAA 3NNNA 4OK6A 2O8CB 5JVDA 2O3JA 3JQ9A 1G7CA 3M4ZA 1KK0A 4C03A 1N2CB 4L8FA 5D6OA 1BSVA 5LMCA 3G1WA 1X7GA 4AUMA 1M8JA 2J08A 5LNK1 3V4OA 2G04A 2WPNA 1QFJA 4LSMA 4TGLA 3BF7A 4RTSA 1P2SA 1R8QA 1Y0BA 2EVWX 3E8MA 4S24A 2XLCA 1PJQA 1ZK3A 1RRFA 2YIMA 3T9DA 1K3FA 5JCPA 3ZLVA 3WYGA 4KPGA 1G8HA 2PYZA 1NVAA 1ST3A 2PRIA 3F7MA 3LT5A 2OVFA 3PXEA 1O0BA 1G5HA 5EEHA 1UZLA 1XI2A 3FFXA 4LZOA 5E95A 5I6DA 3KX2A 5HILA 3HE3A 3J7TA 3RF7A 2Q9CA 2JLBA 1UK7A 3H2HA 3QP9A 1Q77A 4P93A 1DKQA 3IDSA 1IOLA 4QHTA 1MW9X 1EI9A 5IDQA 3PHBE 5EKSA 1BJTA 2GN0A 4JBWA 5J63A 1Y1QA 2B61A 2BFBA 1B00A 4PYRA 2D0PB 1AZTA 1HQYE 2XTJA 3PL5A 4QXMA 5IAAA 1PJLA 1VXOA 2C03A 2WTXA 4WUVA 4XD7D 3IPAA 5DI3A 3W2EA 3KT0A 1CLUA 4K0RA 2W6ID 4G1FA 1OA1A 7GPBA 4LJRA 3PC2A 3FNIA 3LZDA 1O9BA 2W37A 2Z57A 1VSUA 1RWKA 3BXHA 1ODCA 3PGKA 3HCWA 2XDQB 5DULA 1MO4A 4L6AA 1GCIA 4U39A 2V3WA 3BWMA 1F2TA 1Q15A 1YGPA 1EP1B 4WNYA 5CVDA 1KHHA 2HU5A 3MTAA 2QORA 4D9JA 1JA9A 3MWEA 4PZYA 4L27A 1QG2A 1GN8A 3TB6A 3TW0A 2G8NA 2ANCA 4E5UA 2IOQA 4Z7JA 1C3OA 2WLTA 2QVZX 4U2KA 4LJ7A 3IE2A 3G8DA 2JIOA 3WL4A 4QJIA 4EO7A 3CF4G 2JKVA 2WUWE 5IANA 2F2TA 3CH4B 4ZREA 3UH0A 3LBYA 1OH5A 1AKMA 4NYIQ 2HRZA 1GFZA 1C29B 1GITA 1X77A 2GN6A 3CF4A 3NTQA 4K1XA 2DOKA 2PV7A 1UDXA 3G0CA 4FCTA 4L72A 1CXZA 4O2AB 2BM9A 2VO1A 2WP8J 4IDAA 4MGKR 3GLTA 3TG2A 1U3UA 4LV8B 4BTEA 2A9RA 2ZOSA 4N8EA 2V7WA 2C5EA 5K4GA 4QGGA 4CTJA 4XYLA 4Z9XA 1R15A 4IKOA 2HA6A 1MX1A 3GT0A 5DXFA 4ZTZB 2RGUA 1LTQA 1IBLB 1VB3A 3C7DB 1YL7A 1R4NA 2C92A 4FE3A 2HA2A 4UC0A 3AWIA 1FDOA 4QA9A 3JCZA 4WOPA 3V2GA 2ZCUA 2WM9B 4TVKA 5ES3A 2BHTA 1X94A 2XMQA 4Q7EA 5K8IA 3H8WA 2ATCA 2G28A 3W78A 2X2OA 2PS1A 4O4IF 5LQMA 3SYKA 3EVTA 2XMBA 2G71A 2R86A 5AVVA 2Z8YM 2O8VA 1AS2A 3OEYA 1IHYA 4IOKA 4TVSA 1EUCA 1ZI9A 3E5RA 3EYWA 3KEOA 2QD4A 3FSEA 3ND9A 3OUUA 3QVGA 4IW3B 1Q7BA 5KSWB 3E82A 4TMZA 4DBLC 5LU8A 4RDXA 3UWKA 3ESDA 1I1QB 3H9JA 1PFUA 3L6OO 4ND3A 1L5KA 5BW4A 1M2WA 4CQMB 3GLHE 2GM9A 1GCAA 2ZKIA 1TC1A 3IOMA 1K7XB 3G02A 4H16A 1R8JA 5JG7A 3IPYA 3SQOA 1GGHA 1FDUA 1YASA 2GBFA 3K9LA 1E1RD 4XCVA 2IVFA 4UW9A 3WL7A 1H2RS 4JX9A 3R5JA 1TVCA 3C6QA 2YMMA 4DM7A 2GQ0A 4F85A 1Y1RA 3LO8A 5HWSA 1JDUA 3GXBA 2KBFA 3TQFA 5JH7B 3IDFA 1GTSA 2NP7A 1QHIA 2VJNA 3D7SA 1FW6A 3PUZA 4QBTA 4IKPA 3I5MA 1DJMA 1CF2O 1R2QA 2NSDA 3E22B 3HDYA 1UBSB 1GLNA 4JBIA 2BFCB 3OTHA 2JJQA 2Z3ZA 4H31A 4M0DA 3SKYA 1Q5PA 2JIDA 3PFKA 5JJCA 1NXQA 5KYXB 4JUDX 1YZLA 1OU0A 4KN5A 1FYXA 1S1MA 2DJIA 3WK4A 1XAGA 2ZJ1A 3MRTA 3CLUC 3ORFA 2JAPA 3ACCA 1E1DA 2AOTA 3CWZA 2G1PA 1ISJA 5K0SA 1U8FO 3C6MA 3HC7A 2WJWA 4MYSA 4PCAA 4BC1A 2EEPA 3A05A 2C5BA 2GK4A 1WS6A 2GBCA 8AT1A 3AG5A 3DBHB 1IB6A 4GL2A 3EWAA 2ZR8A 3SJZA 2HXYA 3EUAA 4JIGA 3QUAA 4DZRA 4ZHSA 1VPWA 1DBIA 3N07A 4DEYA 2RGBA 3EAQA 4DQXA 3T5BA 3KKEA 2IDZA 3QJ5A 3K5IA 2WM3A 2QLLA 1XQVA 4BLTA 5AR1A 4QPNA 1H9AA 3T3GA 4EWLA 1M8KA 3PP8A 5F51A 2QL6A 3ETCA 3F6EX 3AK4A 1LSOA 2W2VA 4G63A 2VEDA 2CL5A 4EG8A 4NE7A 4X44A 2BGWA 3EG5A 3AHDA 1JKJB 1M2OA 2JHCA 3OU2A 5FA6A 1NBWB 1TLFA 3TQOA 3IAHA 5IJ9A 3JALB 3Q0TA 5H70A 2OXIA 1WUYA 5KQMA 4IMIB 5CDYA 3AMVA 2CXQA 1JF8A 4HMQA 3D3WB 4GX1A 4WBSA 3EULA 2WTMA 1BN6A 1JIXA 3TLYA 2XZOA 4P81A 1O2DA 2Y77A 4IQ0A 2YS6A 2OHFA 1G5RA 3EVNA 3S8EA 2PZAA 2HA7A 1KPHA 2IYSA 4M0CA 1GU0A 2O8EB 1AHHA 1ZGHA 1DJLA 2D5IA 2XITA 2JLCA 2ZKLA 2ZDQA 3A28A 3AJRA 1PJZA 3P2YA 3PQEA 3WMXA 5KDDA 3N58A 4Q9LA 5CEEA 4Y1FA 2QAIA 1EVJA 3ICQB 1GPAA 1YB2A 4B8WA 5FXMA 4BRSA 2ZSHA 1FYDA 4NCXA 1D1SA 1NA5A 2X41A 1ML4A 1E3MA 1ISHA 2OQIA 3IIMA 1OH6A 1EM8B 4OP3A 5DCWA 5CJ2A 4AP5A 3V8MA 3TLJA 4HADA 4DV2B 3BGIA 5IFLA 4DXHA 2XECA 4ZRDA 1ZOLA 2NZ8A 3H3JA 4MWOA 1Q0HA 3D7KA 1P0MA 3EUFA 4Q47A 4EHNA 2GYWA 2HHCA 4HGYA 5EXDA 4DSTA 4JU8A 4ZT2A 4P7KA 4L9AA 4ESOA 1AQNA 5KHAA 2X8AA 3AWDA 2J5QA 4A8JA 4EBFA 1GL3A 1QV6A 4J9UE 5ADVA 3ABOB 3OCZA 4C4PA 3DLCA 1R6DA 1L4KA 2DZDA 4Z0PA 5LKRA 3NP9A 1XAJA 4M9XA 5JZBA 3OJXA 4TRJA 3SSMA 4ILEA 3MEQA 3ND8A 1BXRB 4RO0A 4G56A 4O4IB 1UPFA 3N1UA 4TYQA 1QTNA 2EKDA 3OI7A 2WR8A 4INJA 1UT6A 4P0TA 3C48A 1YRAA 4OMCA 1P2DA 3VKHA 1H2FA 1WEKA 4J2HA 1L4LA 4MLDA 3OC6A 1GO2A 5L40A 5I45A 1PJRA 2O1XA 3N2YA 3D8NA 4FZVA 1CY1A 4F2DA 2P0YA 3Q5DA 3L46A 2QP3A 5EZYA 4EF6A 2PKEA 1YBFA 1E9DA 4IYRA 4EB3A 1TPZA 3GD7A 4RGBA 1WB9A 4JKOA 4CLEA 3EMBA 3NP7A 3CWQA 3Q40A 2VJKA 1GSOA 1NDQA 1RYYA 2PSFA 4H15A 2ZANA 4Y9UA 1LBTA 4ARIA 1OYYA 1J23A 3AVQA 3I2JA 1VJCA 1F6DA 1TJ4A 2FX2A 3BIXA 4FKZA 1C9JA 4YWJA 3ESXA 4MTLA 5JVDF 1MGPA 1RYDA 1X1EA 1TVKA 5H02A 5GVSA 5H81A 121PA 2IWRA 1LNSA 3HKCA 1J90A 3LDGA 4K2AA 4CU2A 4A03A 1FLDA 1Z6YA 1QF9A 5T4BA 3UHPA 2H1CA 5JMWA 4JYCA 2DTXA 4D3DA 5M7EA 4WW0A 2H5EA 1FP4A 3LP5A 4HVCA 1AKEA 4YJGB 4TYWA 1GADO 4X66B 3DB1A 5D5QA 1U0SY 3ICOA 4DC9A 5CW1A 4EH1A 1R27A 5DLDA 5FPKA 1J4AA 2NLOA 2JLYA 1U8CB 1TYAE 2VJQA 2CVOA 4B17A 3MCAA 2Z9DA 3NW9A 3BFPA 2Z95A 4Q82A 3ZWKA 1GQFA 2K6GA 3TTXA 2B1QA 5JADA 3WJAA 4G8CA 1L5ZA 4N7BA 2C4TA 2H5IA 1CY2A 3PNKA 2HHHB 1PKEA 4P4SB 1RRGA 5IULC 4Q1CA 3LMKA 3B1WA 3KZVA 3IR7A 3FCYA 3NNDA 3QX3A 3F49S 3K0FB 1ISFA 1Q3TA 1EFLA 4PHTA 4Y6GB 3LF1A 3NH6A 3ZIDA 3Q8KA 1OXBB 5FWNA 2GXUA 1QLJA 3ZCRA 1E1QA 4R3NA 2I87A 3A4MA 3BL8A 2C7BA 5L7WA 2OFXA 1H2WA 1O9HA 1TRKA 1V43A 2YVUA 4QPCA 3OZCA 2ZE8A 3W2GA 4BDSA 4X6YA 2YYYA 3HACA 5DK6A 4ZOQI 1XAIA 2VQSA 2A5LA 3NM5A 4TLCA 5IT9A 5ALOA 3SQMA 3I58A 4TV9B 4GSKA 1N5LA 2IYXA 3IIJA 2QM3A 2PT6A 4DV6B 1WF3A 3P0FA 2IBTA 3HUFA 2QRQA 3I9JA 3EE6A 3AB7A 4WOCA 4CFZA 5GIPE 1TIBA 4HCJA 3WBJA 4BVFA 1SY7A 1U9IA 2X19A 3WL3A 4A6DA 2LIVA 4A2CA 4PN7A 2Q0HA 4MWCA 3D43A 2ZXUA 2VSOA 2VSFA 1P2UA 2XD4A 4DR7B 3W34A 3LUCA 2XQVA 1LKZA 3NI2A 2G06A 4NPCA 4TRMA 3ZY6A 1UBTS 3H2YA 1M0SA 2QTGA 1NW7A 4K6HA 4R98A 2Q3CA 2E1PA 4ENSA 1MIHA 4QNMA 5JEDA 1W4BA 3EC1A 2VDWA 4PFSA 1U94A 3B9RA 4K1LA 2V55B 4XUEA 4B6FA 3OJFA 1Q21A 3F2VA 1T36B 4KE7A 5CVCA 3RJ5A 2HYIC 1DBPA 4JP2A 3ZHXA 4RKRA 2BHNA 4A8PA 3P71T 3B8HA 1Q1BA 5JDIC 3K1AA 4L5CA 5SY4A 1T3TA 1L4MA 3VUFA 3P5BA 1THGA 2DBZA 2V7QA 2C7VA 4L02A 1XXHA 1RMTA 3LNTA 4P6VF 4U2DA 5FLYA 3R7BA 3KSRA 1J21A 3WLIA 4D9KA 2IOHA 3Q2OA 3D81A 3C39A 3WGTA 4ZFNA 1JEYB 4QGHA 3I30X 1L5VA 1YHNA 4LOLA 1OREA 2W2QA 4TM8A 3VGJA 1UMBB 1UKVY 3Q7QA 5FBZA 1V7ZA 3CQ9A 5DCYA 3G7NA 5DM2A 1AURA 1K6IA 4UCWA 2E82A 2Q9AA 4KZKA 4G0ZA 4R84A 1U63A 1SHZA 4Q4AA 4DT1B 2Y1WA 2QI9C 3DZKA 1JSRA 3KQQA 2GD1O 1W30A 4YEDA 4DUYB 5ERYA 5TGDA 1A9RA 1C8KA 4K3UA 4FZRA 1TUBB 10MHA 2V96A 4PV7A 2R0QC 3PD1A 5AOAA 5BW5A 3C98A 2VXBA 2OO3A 4HX5A 2CXUA 1TKRA 3LTEA 4KC0A 4EHJA 2R8RA 1CULC 1JXAA 1M2EA 5KOJB 5J47A 1ZHOA 5EWMB 5JVDB 5EIFA 1QH1B 4M8KA 3V8QA 2VP9A 3ZY4A 1UBLS 2DFDA 4E1AA 3J81A 2FMTA 1C7IA 1EWRA 2H8GA 4UULA 1DAGA 4CKCB 2C7RA 3TNLA 5C18A 2TYSB 1RP1A 4ACBA 1T10A 2ZRJA 3ZD6A 5FOTA 1T29A 1DIOB 3SJBA 4WK0B 4HAZA 2O48X 4XCQA 4CKBA 5MN4A 2H4FA 2XQJA 1E79A 1I36A 2DYKA 4I3GA 3H42B 1OBFO 5TY0A 1X8XA 1Y9JA 2YC4C 3IEUA 4KGXA 2JIMA 4W5JA 1E2MA 2WWVD 4G5YA 4NCHA 2JLRA 3OQVA 4P5EA 4FCVA 4JSRA 1QYIA 2HXSA 3F1LA 4IIYA 1CRZA 3VFDA 3X1YA 1D7AA 1Q0UA 1U7DA 3II6X 2RG1A 4TL7A 4GDMA 1E7WA 4D9EA 5ED4A 4LSZA 5CHYA 4BWYA 5REQA 3E3NA 3L06A 4S0ZA 1PU2A 3LPNA 2J3KA 1PVDA 3Q3GE 4MQLA 5JYDA 4DAEA 4D0RA 2BEJA 1OI4A 1S89A 1Q0LA 3QITA 2AG6A 3JPWA 4Q93A 4CKXA 1XF9A 2JCYA 2KE5A 1X42A 1US8A 3JAKA 1QYXA 4KPYA 1GLVA 1I8TA 2O1EA 3QSGA 4JS0A 3RS8A 3SC4A 3AW8A 4IICA 4DMMA 4JLWA 1L5LA 1SOUA 1F2TB 1O94D 7ADHA 2IZ1A 3CONA 4CMIB 3MWEB 2AN4A 2O06A 3IGFA 2OC4A 5LLDA 3ENKA 4HDNB 5ICEA 1D3AA 1R50A 1QC5A 2QDXA 4I46A 4MR7A 2Y1EA 5I5GA 1JP7A 3T3DA 2X8JB 4FKMA 4KTTE 3D2LA 5EMJA 1LPBB 1YR9A 3PCRB 4FYHA 4JMLA 5COQA 2H4HA 4MCJA 3K5HA 3L84A 3RANA 2C2KA 2IYRA 2R79A 1U2ZA 2CLMB 3ED5A 4TL8A 3C3EA 2X0EA 3ZHRA 1OLXA 3U3XA 4B74A 3H2KA 1I6WA 5ERXA 3B70A 4MWEA 2B7LA 2L18A 5T4FA 4RXTA 4DIKA 1W5TA 1W581 2AX4A 2I34A 4TL9A 3UW3A 3K2EA 4HVTA 3W5SA 3A37A 1E89A 1M2JA 2P6UA 3DDSA 5IF9A 3D7MA 3VU9B 4CF4A 2IHVA 3FOCA 1CFZA 1CFJA 3IBGA 1JYSA 1TIPA 4I6JA 1JJFA 4BKRA 5DI9A 5A6SA 2JLQA 1ZM4A 4B3GA 3ONDA 5BQ3A 2Q4EA 2QVGA 4NVRA 4CNQA 1T8RA 2YVLA 4JBYA 4BV9A 3BPSA 4QLBA 4EKYA 5EJ4A 1T15A 5I8PA 2IYLD 3I9MA 5K09A 2P2YA 5DMXA 4R6XA 5JUWA 5IDYA 6NULA 5CCBA 2C2YA 4OI4A 3CNOA 1YDGA 1Y1PA 1EUCB 4Y2PA 3G0GA 3T7AA 5E2BA 3GQBA 3W6PA 3RLFA 1J8MF 3TLGB 1MOZA 1YRWA 1NFRA 3W3AD 3VAAA 5EZYF 3ZDYB 3NQ41 5CBPA 2WNSA 3EPLA 4A2QA 2GB4A 2FZEA 4NV1A 1S4QA 2G36A 2ID7A 4IIHA 1LBIA 4WXPA 3EMVA 2IFTA 1OAKA 4BFUA 3WO0A 1RZ3A 2OD2A 5AW3A 1L7AA 1TF2A 3X1XA 3ZZ0A 4EZIA 5IAKA 4CM6A 4QOGA 1RJWA 1R9MA 2WTBA 1QM5A 2GEUA 5G4KA 1P6XA 1OY1A 3IOEA 1L1QA 4GECA 4AIIA 4RANA 4CLOA 4LOKA 3Q3HA 3WMRA 4IGAA 2QPOA 3AT1A 3FPBA 4KAFA 3P9PA 5CGQB 3BFJA 4Y67A 1YC5A 1QP7A 3D7RA 3NBUA 3SX0A 3ECCA 5JCOA 4R0NA 2FMHA 4C0BA 3MZ0A 3PTZA 4EHDA 5A5DA 5CG1A 4D3YA 1H3EA 2X3YA 1NW3A 1SHLA 2FF7A 1HSOA 1YAHA 1M1ZA 1TLLA 1W4AA 4HKTA 1RAHA 2QMUA 3BD9A 2IYQA 3CT4A 3F5SA 3G0HA 2HLHA 3CEPB 3DCJA 3OFND 4RM3A 2WKSA 5G53C 5AKKA 4S0XA 1X38A 1PUJA 2EWWA 1OLOA 4RW0A 3AFMA 1UJMA 2B2XA 2I65A 1HC7A 4ZVNA 5K4HA 3VV2A 3O03A 4DVJA 5HW0A 3VNSA 2Z1DA 1FRQA 3I12A 4IH4A 4M38A 4XD2A 3IRVA 1PZEA 2AFRA 3O9VA 2J87A 1CUIA 1PV2A 1ZH4A 3P2EA 4JLNA 3H8JA 1UBFA 3HR7A 4M21A 1HSZA 4S1VA 2WJZB 2YQ5A 4LRUA 5KDLA 1QO7A 5CH5A 2P7HA 3BMOB 2CF5A 4NJMA 1AU9A 5LDGA 2PMWB 2CHGA 5EJ5A 4QFMA 4UUAA 4RD2A 1PR0A 3MQ4A 3ENVA 3ZHVA 1V5IA 4R31A 2GX6A 3GROA 4J07A 3Q6IA 2QUKA 3T5MA 2P62A 1YQ9A 2ZR9A 1GQYA 5ABPA 4LG1A 3LBAA 4QT4A 3PC7A 4AWXA 3LRTA 1E9EA 1RRKA 4CJXA 4FFNA 1JDJA 3A14A 4ENUA 3DEYX 4DRXA 1WDLA 2VAMA 2WM2A 1WKCA 2P91A <