1A82A

Dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biotin biosynthesis
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1a82A00
2MMGA 2D7DA 3CM0A 5JEDA 1NSTA 1SULA 1QHSA 1QHHB 3C5CA 3C8UA 1Z0KA 4XJXA 1N2CE 3A4NA 3TJZA 1JPNA 2BMEA 3B9QA 1KZ7B 1KSGA 1T6NA 2CHQA 4FXPA 3P4XA 4DLWA 2V9PA 1J2JA 3L8YA 3C15C 2D4HA 1JAIA 1ESNA 2WWFA 2ZANA 4YDHB 2GAOA 2K5UA 2F43A 1OXVA 3L82B 4B76A 2O8EB 1XX6A 2QN6A 3IILA 4HZUB 4LJ8A 4PPNA 3VHLB 4DCUA 4PO9A 1E3MA 3JZAA 4XSHA 1QZXA 2VHJA 1RRFA 3U4QB 3RRMA 1W5TA 4BE7B 3ZVRA 3I4LA 2ZRCA 4U00A 1SVSA 1OJLA 2Z0MA 3MGCA 3QUSA 5FPSA 4D4JA 2CVHA 1GKYA 2ZUDA 1ZP6A 2ZIAA 1OT3A 1E1RD 1N6LA 3W6PA 2PCJA 4CT5A 1VMAA 3BK7A 5FPYA 3OIWA 3CONA 3RRZA 3KJGA 1KNXA 3AVWA 5FI0B 5LB2A 1NMZA 4UXJA 4ABYA 2X19A 3KQHA 3NIBA 5B64A 1MKYA 3GEIA 3HYTA 1EFHA 4M1SA 3SBDA 3SYLA 4C0KA 4C4PA 3FMFA 3I73A 3Q5EA 3WP1B 1GVNB 2C2HA 3AVTA 4LPSA 3TAHA 3VR2A 1D5CA 2G88A 3NC0C 4YMTA 4JL8A 1ZRHA 3THOA 4EUNA 3RC3A 1NY6A 4DDVA 4E22A 3KKPA 3MWYW 3QEOA 5A4JA 2IXEA 2EWVA 3X2SA 2QU8A 4HYYA 2AK3A 4E5UA 1KI9A 1JXMA 4TL7A 4JT4A 3QOFA 4PSKA 2E1RA 1DS6A 3QENA 1E9CA 3GLGA 2CJWA 4W5WA 1IOZA 1KJWA 4QM6A 4FWIB 1UPTA 4FN5A 4MQBA 4XWAA 5E7MA 4MUAA 1NJFA 4TYNA 5KYKA 2WJJA 4JLDA 3CIOA 4JLKA 3OIVA 4ZDIA 2JLUA 2IWRA 2JLSA 4B35A 2ASEA 3B9PA 1FQJA 1O3YA 3LQRA 5DLQC 4B47A 2ZS8A 4OQXA 3LBHA 1R6BX 2IYZA 2R62A 2OT3B 2ERXA 4KAXA 5IF9A 4G3XA 3WMGA 5JRZA 1BYIA 2C9YA 3MRSA 2NTYC 2HLDD 4HAWA 4ZDJA 3KTAB 1P6XA 1N5IA 3EC1A 3T35A 4URYR 4LYHA 1UAAA 2XZPA 3I3SR 1E2MA 3NBZC 3TW4A 4W5HA 5FOWA 2G3YA 4M1MA 3Q5DA 3OE7A 3ZS9A 1E9DA 3M6AA 4EQ6A 1AK2A 3D8BA 1KDTA 4MYCA 1KYIA 3OESA 3SHWA 3QF4B 2RGNC 2KBEA 4B6EA 1BMFA 1KJZA 2VF7A 1M74A 4IRUB 1OF1A 2P2LA 5JWOA 5FTJA 3LVRE 3H86A 3HWSA 3I1FA 5C18A 1Q0UA 1W5SA 4RCZA 2QNRA 4RD2A 3VNVA 2J46A 1FQKA 3CRVA 4FIDA 1VG8A 1YU9A 2X1VA 1G7CA 3ADKA 4NYJQ 1H8HD 1G8HA 3ECCA 1DARA 1YZQA 2IYSA 3WBKA 1E6CA 1W44A 5DN6A 1E2QA 3BC1A 4NCIA 4ARZB 1GRQA 3AVUA 1MABB 3I8SA 1TMKA 5H1YA 5D3MB 1YZUA 4FMDF 5EJEA 1AQUA 2ZRIA 3WYGA 2VHUA 3TAUA 4L8GA 4B3CA 2OUKA 1OE0A 1HA3A 1UBCA 2RKOA 4NONA 5AJXA 4BZQA 2PLFA 3PUZA 1Z6YA 3AKCA 1FPMA 2OXCA 2RGAA 1EFTA 1NIJA 4HUQA 5L3SB 1E0SA 3GCGA 3QSYA 2VRWA 2FNAA 2NZ8A 5G40A 1JEEA 1G16A 2FFHA 2JJ2D 3ASYA 1OPXA 3H4MA 4OI0A 2B7CA 2FGKA 4M9QA 2H17A 2Q3HA 2IUTA 4JLJA 3L0PA 5AJZA 1R0YA 5FTNA 4HUTA 1EX7A 1VPLA 5KHOC 3CPJB 5HR5A 1EESA 1U0HC 1GNPA 1WCV1 3FE2A 4J0QA 4FMDB 5LBIA 2C03A 2XJ9A 3WNDA 3SJZA 2IS1A 1US8B 1ZM7A 2ZSDA 2WTUA 3ZVLA 3AB3A 1LS6A 2XZOA 3QPUA 1G7TA 5AUQA 1T0HB 1L4UA 4A8JB 2CJWB 2PBRA 4N0DA 4GP7A 5E4FA 3RLFA 4P31A 4L5BA 4V0KA 1JBKA 4N3NA 5HZHA 1E2DA 1OH8A 3UG7A 2OLKA 4OHXA 1DG3A 4FI3C 5AK0A 3QBVA 3OEHA 1CKEA 2QAGC 2V54A 2KE5A 2OZEA 3UMRA 1FOEB 1UADA 3CX7A 1TQ2A 2Q0HA 3B6EA 1AJEA 4NH0A 3WY9A 4Q4LA 1QBKC 1YKSA 2BBSA 1KI7A 1E2KA 3K0EA 4B32A 4RCYA 3F5FA 3D3QA 3W8RA 5JZVA 1ZYUA 1XBTA 3QXXA 4BASA 4KYIB 4LGMA 4AYXA 4UJ3A 2GXQA 3BB1A 1QHIA 2FGJA 4I81A 3W6OA 4A8JC 3LY5A 4QGAA 1G64A 5KTYA 1Z63A 4EIWA 3EA0A 2O0HA 1ODFA 5CM9C 1W36B 3VQTA 4IKEA 2YWFA 1NN3A 3K0AA 3B2EA 1KK2A 1DBSA 5G41A 3ICEA 2Q9AA 5GVSA 2I4IA 3IO5A 3EWAA 3O8DA 1C1YA 4R98A 1NLYA 1R2QA 2QSZA 4PQYA 2R8RA 3L2OB 4Q9LA 1SVWA 5D3QA 1XTJA 2DFKB 3PCRB 1Y3AA 2HF8A 1X86B 1EX6A 3IUYA 4ZCIA 4DSOA 5AR1A 4BFVA 2O8FB 4TWZA 2OCPA 5JSZB 5TMPA 1WBBA 2YOHA 3VU9B 4Q5IA 5EZ6B 1NN1A 3U3RA 1YVDA 4UXHA 5HE9A 3ZZUA 3R9WA 2BEKA 4IEIA 4EJSB 2OFXA 1JAHA 2OESA 5TDHA 4TYYA 2ZREA 4LDJA 1NI3A 2DHRA 2F3TA 1U8AA 3SN6A 4QFMA 1IY2A 3EPLA 2BM0A 4PAQA 2NIPA 5TXGA 2RAPA 2GZDA 2WOOA 2G9NA 3N2EA 2ZI6A 3OEEA 5G3ZA 3TMKA 2AD1A 2GJAA 3A36A 4PHGA 4PO8A 5J5CA 4OQMA 4DJTA 1N6OA 3DPUA 1AGPA 1MO6A 1ZCBA 2ZJYA 3RS3A 1WRBA 3T1OA 1RRCA 3K70B 1VYUA 4US1R 3S1AA 1CF4A 1G4AE 2RGEA 2QROA 3T1QA 1SZPA 4FINA 1Z5ZA 3ZIAD 3NWJA 1LVGA 1X8KA 4CEIB 2ZSFA 4R9UC 3VKWA 3BXZA 1E99A 2RCNA 2RGXA 3P27A 2QMUA 4DLZA 2B7BA 3ZYCA 3E70C 4KVAA 5C1BA 5KUTA 3QG5A 4BQSA 2GILA 4NHOA 2P0EA 4LC1A 2HCBA 2V3CC 3DKPA 1VYVA 2IEYA 3UATA 2VF8A 4D0GA 421PA 4LHVA 4C9BA 1KK1A 1QG2A 2AXPA 1J8MF 5EXXA 4M53A 1X8LA 4PZLA 1COWA 1FX0B 1OIXA 2GJKA 4GBMA 1NF3A 2ZJ8A 2J0UB 3BH7A 3J81k 4IFBA 4LCBA 2ZXUA 3GLFB 2OSBA 3K70C 2PZEA 1G8PA 2N42A 2P6UA 2NPFA 2Q3MA 3OEED 3ZLJA 2QMOA 4IXNA 4JVSB 1KO4A 3T12A 1QRAA 4CVNA 5L3QA 3AP1A 1JR3A 2XAUA 3LVQE 3T1VA 4X8MA 3SHFA 3FFAA 4G5RA 1E2JA 3SJAA 4TYPA 3FWYA 2HJVA 5L3VA 1PZNA 1ONBA 3K1JA 4IDHA 2QP9X 3D7MA 4UNRA 3SQWA 2VEDA 3TR5A 2O8CA 1VCMA 3UK6A 1S2MA 1EXMA 2Z5FA 1W1WA 3CNLA 1ZNYA 4Q1CA 2W0SA 4A0GA 3KB1A 5TB5A 1CS4C 1NG1A 1VIAA 1P2TA 2W2XA 3A6PC 3HU1A 4G1UC 5K8LA 2G77B 3AKYA 4WAUA 3RSLA 5EUMA 4Q9IA 5CM8B 1OXUA 3I62A 4MRPA 4PR0A 2D3WA 2ZROA 1XTIA 1UDXA 2VQSA 4ZI3A 1KGDA 1CJTC 1XCGB 4JSYA 2WOJA 3TRFA 2VLIA 3ADCA 1JPJA 2REXB 2C04A 3K9NA 3QPVA 4PAMA 4Q1AA 1W2GA 4UJ5A 3VTKA 4BLSA 5AUNB 2BVNA 1OFTA 1UKZA 2QPOA 3GLHB 4Q4HA 1SVOA 2TMKA 1G3IA 4Q47A 4B73A 3TKLA 2W58A 2ZSEA 2CMKA 1AQYA 1COWD 2IXFA 5DYGA 3DVLA 4OL0A 4QBGB 4QHYA 1GIAA 1G6OA 2BBTA 4HAYA 2ZRMA 4F91B 1ZM9A 1GM5A 5HCNA 2VP4A 2DYKA 4II7A 2J7PA 5FI1B 2YOGA 3RYTC 1JXOA 1FNNA 2GBLA 1JR3D 2ZM5A 3PIRA 3CX8A 4EDHA 4DCVA 2XXAA 5FOVA 1W49A 3GJ5A 3PUWA 1S8FA 1L8QA 4BFSA 4W5JA 5KPJA 2PLRA 3CW2A 5JS8A 4D4MA 5HKKD 3FMPB 3MSXA 1Z3IX 2ZYUX 4WW0A 4DRZA 3IQWA 2OM2A 4Q4JB 1M7BA 2WVJA 1G41A 1G5TA 4ASUA 5BN3A 2ORIA 4OK3A 1IY0A 5BXQC 2JATA 2OAQ1 1HYQA 1KY2A 4TT3A 4NCHA 1GKIA 2VP0A 2WJHA 5HE8A 2ZI7A 4MUBA 3V4FA 5DGXA 3AV0B 2XEXA 4P0TA 4KLZA 2AWOA 4RD1A 1GDDA 2PT7A 1F2TA 2A3RA 4Q1DA 3TK1A 4KXFB 3EZ7A 1E2HA 4NP6A 1NVUQ 1AIPA 4ZIRA 2J7PD 2F1HA 1XZPA 4Q21A 3V00A 5LPNA 4TLAA 4HSEA 1CJKC 3PEVA 2CE2X 3PJRA 1ZW6A 1RE0A 5CB8A 1ANKA 4LRWA 3R7WB 4HB4A 1FL9A 3FFBA 2IS2A 4UNNA 3GLFE 2R9VA 2V6JA 5JCZA 1S3SA 1IONA 1E32A 4DBLC 2REBA 2YZ2A 3LFUA 3SFZA 1ESMA 1XRJA 3FKSA 4DLUA 1LF5A 4V0NA 1HURA 4GL2A 1U9IC 4C7OB 621PA 4A4DA 5FPKA 3K0FA 1E9SA 3PEYA 5BYJA 1J70A 1UKEA 3K0SA 3QXJA 2WMNB 3CPEA 3O8BA 1KO5A 2F3RA 2WWIA 3N5CA 4ASUD 1KSFX 3R9IA 3U7FB 3F8TA 1E9BA 3QJYA 5JI2E 5HTKA 1K8RA 4OJQA 4JLBA 3TSZA 3MWLA 2ZRJA 3NHBA 3BB3A 3SS8A 3BS4A 2AXNA 1MT0A 2J7KA 5EP2A 1GOTA 2VP6A 4UKDA 4B71A 4GRAA 2PT5A 3GLHE 3VHXA 3X1ZA 2XNSA 4V0OA 4B3DA 3WNBA 2HXSA 1PUJA 2WWHA 1KI6A 4PZYA 3AGPA 2WM9B 2PEZA 1UFQA 2GNOA 2RGDA 3THYB 2IA5A 4O2RA 4JLNA 3U60B 1V43A 1HH4A 2FPMA 1D6JA 4CRWB 4C0HA 3FKSD 3AVXA 1KMQA 1E2EA 1NVVR 1XWIA 1VG0B 2YC4C 3BH6A 2JLQA 2KB0A 3AGQA 1KI1A 1NRJB 3RS2A 5G3YA 2QP4A 4XD7D 4V0ME 1G7RA 3TBKA 4AKHA 2ZTSA 3KXLA 3ZQJA 1Q1EA 5GVRA 2ZAOA 1F2UA 3GJ6A 1XPRA 4BLTA 4QBHA 1LY1A 2ZE5A 3VR3A 2O8BA 4I1SA 4NYIQ 1DELA 1YR7A 1XMJA 2OG2A 3KKNA 2FE4A 2XOKA 1EG7A 3DDCA 1RFLA 5EE9A 4OI1A 3BH0A 2Z4RA 4H9GA 2J0SA 4BLOA 3NDPA 1W2HA 4DSNA 3SNHA 3IEVA 5FUVA 3AF0A 3TE6A 4IOKA 2FPLA 1II8A 3HPQA 2A5DA 4WOPA 2ZRKA 1UBFA 4V0LA 1G21E 4DHEA 1ZCAA 4QNMA 4TL6A 1DE0A 1UBEA 1M2OB 1G8FA 1E94E 3PFIA 4I1OA 5KDDA 1KMHA 4HLDA 5EP1A 4HAVA 2YWEA 2BMFA 1QG4A 4UNSA 3V9PA 1VHLA 2XITA 2B92A 3EIQA 2QSYA 3CWZA 3MWKA 1E98A 3I92A 4OHYA 1TEVA 1XEXA 2CXXA 1CJUC 1GKUB 2ZEJA 1Q3TA 1XD8A 2NOAA 2FZLA 4QOSA 3I8XA 1XB2A 4ZO4A 4BFYA 2BOVA 2ZETA 4JYCA 2ZUBA 2C9OA 3FYHA 1FW6A 3RS5A 4GNKA 4Q4AB 4P32A 4DC9A 1XF9A 2CCJA 4P3YA 2GXAA 2RGNA 4ESHA 2HF9A 4HEJA 4GZLA 1W48A 4Q9HA 2XOKD 4CEHA 4A6PA 4D81A 4TTQA 4A15A 2GRJA 1WA5A 1NN5A 1XU4A 1N25A 4MGZR 2EFGA 3U44B 5H8WA 4DCSA 4YDSA 4GOXA 4D6PA 2J0QA 3FHOA 2V6IA 3AVOA 2GXSA 3GFOA 4HLCA 3GFPA 4IJMA 3SE0A 1D2NA 3CRW1 4ZKEA 4MITA 1GITA 3WRXC 3KQNA 5H70A 3OF5A 4LPKA 3UMFA 1Q21A 4IEEA 2C95A 1GP2A 2HT6A 5CJPA 5C4MA 1K5GA 4LJ6A 1AKYA 4U7DA 4IHQA 1KI6B 2QEQA 4C0BA 5LB4A 2GEUA 1YRAA 2QMHA 1VKJA 3CB4A 3EARA 2ZRGA 4JBYA 2RGBA 1VHTA 1CU1A 3THWA 4URUR 1KNQA 4HB3A 4D25A 1OKKA 2V55B 2RHMA 3QPWA 4FCTA 2FZ4A 4F4JA 3QEJA 3LX8A 5CIWA 1IXRC 5DI3A 5LDDC 3RS7A 1LTQA 4OHVA 2GKSA 4X8OA 1WF3A 3BB4A 2GWHA 3SZRA 1AS2A 3H84A 2SHKA 1R8SA 4KITB 1OXSC 1TUEA 3GEEA 3K9HA 2CLCX 4URVR 1HV8A 4MH0R 3U5ZB 5TV2A 3R9XA 4CF7A 1IQPA 4OHZA 2WSSD 2HLDA 3AP3A 5EP3A 3TH5A 1AKEA 2ZS7A 3VR5A 2R2AA 2EFDB 2XTMA 3QKSB 5F2EA 3TR0A 2WSMA 1SXJA 5AJWA 4ZDWA 5K8UA 4Q00A 3E2IA 2IX3A 1NBME 3C14C 4V02A 4OK6A 3SDZA 4E07A 4RD0A 3P26A 1N6RA 1FUKA 1YE8A 2R6GA 5DHFA 3IBYA 5DI9A 3KXIA 3Q9LA 1TNDA 4R71A 3PUYA 1HUQA 2DY1A 3LO5A 4Z51A 1T8UA 4G5QA 2CHGA 4NDZA 3B1ZA 4OQFA 1KY3A 3AQ4A 1E9EA 1Z28A 2H57A 2ZRNA 1CJMA 5FBQB 2ZRDA 3BJIC 2BJWA 2QAGA 1H8HA 5FOXA 3LLUA 4JLMA 3TSWA 1IY1A 3QKRB 4MRVA 4BLQA 2JLZA 4IXMA 2D7CA 1HT2E 1OKKD 1XXHA 4M2LA 1Y63A 5AUOB 2C99A 2QZ4A 1UM8A 2FEOA 4XH9B 3OIUA 3CKLA 1EGAA 4WZAE 3KDSE 3ZVNA 5A0FA 4XSGA 5AJYA 4ACBA 4DLXA 4NCJA 3AF2A 2OO7A 3NBFA 1Z6GA 1XMSA 2PJRA 5CDFA 1P7CA 3OAAD 4KI0A 2GCOA 2OBNA 2W83A 1SXJD 3TVDA 5KOYA 4DSTA 4JL6A 4A82A 1N0UA 1GTVA 1YHNA 3HR8A 4LHYA 4C0AC 5KSYA 4CEHB 3LWNA 2VP9A 2PX3A 1WB9A 2JJ2A 3BAFA 4JVNA 5JJLA 4AURA 4IOLA 4EPWA 1CRPA 1FFHA 1OLOA 3NC1C 4LYFA 1D9ZA 4WA7A 2BV3A 3CWQA 1RZ3A 2F55A 1KK3A 5DO9A 1XCMA 2IYTA 3QVUA 4LYAA 5CK4A 2A2ZA 3FKQA 2ZAMA 4AD8A 1ZU4A 1Z29A 2BDTA 4TLBA 3W34A 2ZQ5A 3B1YA 3B7GA 3BOSA 3GJ0A 4P4TA 2JIZA 4PQRA 4DVGA 2JLWA 5F9FA 2A5JA 1X6VA 2VSOA 3AUYA 1DAGA 5CK5A 2F43B 3CRRA 1W7AA 1R0WA 2EFCB 3B5JA 1G8GA 4QHSA 2R6AA 1UJ2A 2FEMA 2VSXA 4MYTA 1D8TA 1L2TA 3IIJA 3QG1A 1VCNA 2DFTA 3DM9B 1P5ZB 5JLJA 1BH2A 1Z6XA 4NPHA 1ZJ6A 4Q19A 4PANA 2HDNB 4O2LA 5JEEA 2JGNA 4DEYA 2RB4A 4ZV4A 1G19A 5KNCA 4GZMA 4JLVA 4FWTA 1ZD1A 1ZMXA 1YZTA 1A1VA 3EPHA 1ZNZA 2ZI5A 2JAQA 4XWKA 3CO5A 1BIFA 1RJ9A 3U61B 4S2EA 3Q3JB 2J5XA 5HZKA 3GPLA 2IHBA 1JJ7A 1Q44A 2JA1A 4Q1FA 3TVTA 1PLLA 2WJIA 4WZBE 4LJAA 3FGNA 3K9LA 1Q1ZA 3K09A 4FCWA 1T9HA 521PA 3AF4A 1OW3B 3W8NA 1S9HA 4NYMR 4QL3A 1UEJA 1ZC4A 2QGNA 4TTRA 2JIZD 3ZJYA 4DSUA 1Z47A 3AH8A 2P5SA 1U81A 4M9XA 5FPHA 5EE3A 4TYQA 1A4RA 1P72A 1P2UA 4PFSA 4BGDA 5CLQA 3LBNA 1N5KA 2IHYA 4KODA 4DUGA 3GLGB 4TYWA 3HPRA 5DE3A 2VO1A 2VP2A 4OK5A 1FMJA 3GP8A 2G1KA 1M8PA 2C78A 2CDNA 5JJIA 2Z83A 2WIBA 4AI6A 2GZAA 2P67A 3KX2A 4GSYA 2P65A 2ZJAA 4JS0A 1VG9B 2J59A 4M21A 3ZH9B 1G5PA 5FTMA 4C0JA 1M1YE 2GDJA 2QUZA 4M9SA 3KFVA 3MAAC 2VHTA 1D9XA 3OFNA 4PSAA 5FH9A 1JJVA 2ZJ5A 4YMWA 1ZD9A 2P5TB 1JB1A 3U3JA 1T5IA 3Q72A 3HYRA 3PENA 3QBTA 1E1QD 2YWHA 3IBGA 1KO8A 2BMDA 4EQ6B 3B85A 4Q1BA 1YRBA 1KKLA 2V7QA 4Z8YA 4BFWA 1E0AA 3A8TA 2WMOB 2QL6A 5IT5A 3U7HB 2BMJA 1F5NA 4DT1A 2KWIA 1KAOA 4F93B 1KI8A 2P6NA 3VR4A 1NMXA 1CR4A 2DFLA 3MJHA 1JQLB 1NN0A 3SQXA 821PA 4DCTA 4GOJA 3U6BA 5JWRA 5FBLB 4DUGD 1DTSA 4XVRA 2JLVA 2GAAA 1GUAA 4ESVA 1KKMA 1OB2A 1GWNA 1VECA 2FFAA 1X1RA 4H1UA 1K6MA 4PPQA 1OYYA 4PAOA 3ZIAA 4M22A 4JLOA 3UANA 5P21A 3EZ6A 4RFSA 1FUUA 2ODBA 4TMTA 1TU3A 3SYKA 1R5BA 3I72A 3ZD6A 3KKOA 3RSOA 2QORA 2IEZA 3ADBA 4MYHA 1ELOA 3K70D 2J9RA 1Z08A 5EXTA 5F98A 4QNRA 5F9HA 2AFHE 3T34A 3KFXA 1KOFA 2OCAA 3OFND 2HUPA 1YR8A 1Q20A 4HUQB 3RAPR 1IN6A 3CF2A 3HDTA 2FU5C 1OH6A 3K0CC 3WYFA 1RJ9B 4HAUA 1W36C 3G0HA 4AYWA 5FTLA 1TEXA 2V7QD 2NO0A 3C5HA 1P61B 1ZUNB 2W0MA 3EA5A 1MOZA 3IEUA 3IQXA 2QBYA 4PHFA 4HDOB 5KSOA 2IYXA 2GF9A 3GLIA 4Q7LA 2FN4A 3EIEA 3SBEA 3CF6R 2CBZA 4PHTA 4BFUA 2YV5A 4FMBB 2HV8A 4HAXA 1QHYA 4IDOA 4ZPXA 1IJEA 4DZZA 2UZ3A 1GRNA 4JL5A 4RD6A 3R20A 4PC3A 1YR6A 1PJRA 2VHQA 4QC2A 2IUSA 1VCOA 4IOJA 1W4CA 1XZQA 3KJHA 2QY9A 2QRNA 1WP9A 1T91A 2IYRA 1NSFA 3LW7A 3NBXX 4URWR 5B30A 3KQUA 3QKUA 1Z0FA 1HQYE 3F0TA 2H16A 2QQ0A 4A9AA 1GAJA 1W47A 1I2MA 1OFHA 3BFVA 4ILEA 3A1SA 3GJ3A 3O8RA 1OSNA 1CEEA 4EJSC 2XTZA 4BECA 4LY6A 3GLGE 3GJXC 4TLDA 5BN5A 2XB2A 4QRHA 4RD3A 1R0XA 721PA 3LBIA 4QJ4A 3B60A 2R6DA 3Q8XB 1KK0A 2OFOA 2W2TA 3LD9A 4A0HA 2ZSAA 1N5JA 1IN7A 2GCNA 1XEWX 2IYVA 3QIAA 4PPFA 3W5JA 3WMEA 5EUQB 4JZKA 3AF1A 4GDFA 1N6HA 4A2WA 2IYWA 5JECA 1U94A 3H0KA 4JBWA 2VHCA 5GJWC 2EYUA 4Q7JB 3VKGA 2Z6VA 1SHZA 4CW7A 2AK2A 2BJVA 2IYLD 4MGIR 3FB4A 1JEDA 3WXMA 2J3EA 4D4LA 1M7GA 2IT1A 3IDQA 3LDAA 3NBYC 4NYJR 1ZC3A 1XJCA 3ZVMA 3FPAA 1W0JA 4JKIA 1NVWQ 4JJZA 4PC7A 2CK3D 5SZHB 2O8DA 3IKJA 3K0AB 1LS1A 1AZTA 3RDPA 2ANCA 3FHTA 4R7ZA 2HYIC 3RVBA 3M0EA 1T3LA 3KKMA 5HKKA 2NMVA 2H18A 3I32A 1OIVA 2R6FA 3LQQA 1K5DA 3SC3A 1UDWA 3NH6A 1XP8A 2G0TA 4PPGA 1IAQA 3EX7C 2ZITA 2G0NA 2IXGA 2OBLA 2OAP1 2QQEA 2GTPA 2ZVPX 3THXA 5J4YA 1KO7A 3C16C 4OI2A 1Q3HA 2BCGY 3ONWA 1FTSA 5J47A 3QVVA 4HATA 3TNFA 1G7SA 1QHXA 2PZGA 2WWGA 1DOAA 1Z07A 3CR7A 4IOMA 4RKEA 3NKVA 1GFIA 1SHKA 1DAEA 4WBSA 1QVRA 1IHUA 1NP6A 4P4UA 3V4RA 2VIIA 5J40A 3SOPA 4O0MA 5TVKA 4X8HA 4AK9A 2CNWA 2Z4SA 2RGCA 4PX9A 1TF7A 1E2PA 2REOA 1ZAKA 4ERNA 1X3SA 1ZNWA 1SVLA 3HR7A 4EFLA 2WWYA 4FMCF 2A9KA 3PUVA 2IC5A 2QG6A 4C0QC 1W0JD 4MYUA 3VR6A 3BD9A 2FH5B 5TARA 1P9WA 2IK8A 1B0UA 3ASZA 4XOIA 3IPYA 3X1YA 4Q48A 4NCNA 2R44A 1FTNA 3IO3A 2EYQA 2BBWA 4LJ9A 3S1AB 2JJ1A 2JDID 1Z2AA 1OXTA 4WIAA 2EWWA 1DAMA 1NVXQ 3QF7A 2KSQA 2QGZA 1ZM3A 5FTKA 2UKDA 4FCVA 1R8QA 4M8NE 1LFDB 2GETA 4TMVA 4F38A 2ORVA 2ZYTX 4R2HA 2PH1A 1RIFA 2FSFA 2HJGA 3FTQA 1LF0A 4TTPA 2VTKA 2BCJQ 1S4QA 5JJKA 1ZM4A 4HDCA 4NU0A 4P4SA 1T3HA 1C4OA 1F60A 2FWRA 1XDBA 2G83A 2NG1A 5DHAA 1XMVA 2L0XA 2CNWD 4KHZA 1E4VA 1I2DA 1NL3A 5FOTA 3W6NA 5J4VA 4EPYA 4TZ6A 2ZE7A 3NTUA 4LHWA 1W4BA 1NIPA 2A5FA 4E03A 2F1JA 2EW1A 4RD4A 2FOLA 2V1XA 4HLUC 2F9MA 4D80A 3ICQB 5L3QB 2HEIA 3TGPA 2X8AA 1KDRA 4JLAA 1G18A 1U8ZA 3D6TB 4BFZA 2QM7A 5M04A 3SJCA 2JJ1D 3VNUA 3UXMA 1KI4A 1GILA 2O8CB 4MDEA 4BZPA 3NEYA 4LBVA 3QXCA 2ZS9A 3Q85A 5E95A 3TQCA 4TZ0A 1G1MA 1ZUHA 4O3MA 2QM8A 2LWIA 4LWZA 1TF5A 4PC2A 4XD7A 4CEJA 1JNYA 1NY5A 1OFUX 2AWNA 1E79A 2QE7D 3B82A 5FFMA 3WMFA 4B75A 4QXAA 3PG5A 2OE2A 1BO6A 1OYWA 4RKFA 4DCNA 3DL0A 4Q66C 2WWWA 3P32A 2FPKA 3KJEA 3VX3A 4Q4HB 4PZZA 2WJYA 4A2PA 5HCIA 3AUXA 3U7EB 4WXRA 5FUWA 1E2IA 2GHIA 4Q01A 3LW8A 1GL6A 1A5TA 1M34E 3DOEA 5ELXA 1DAHA 3GMTA 4OQNA 1U0LA 1RKBA 2GCPA 4I1VA 1IXZA 1Z0DA 1TADA 1XD2A 4YMSA 4AG5A 5AJVB 1CXZA 2YHSA 4QGHA 4R2IA 4WZ6A 1NJGA 4IW3B 1G4UR 1QHHA 2XXAB 2R6CA 3W3AA 1PUIA 3BRWD 4Q9JA 3ZZTA 1GL7A 5FUXA 1E9FA 2VP5A 2WKQA 3NDBB 2GK6A 5FPTA 1E2NA 1U2RA 2GEDA 5CLLA 2ATVA 1FMLA 4QKQA 4G5OA 3CZPA 1ZBDA 2IYQA 2O8EA 1AN0A 4IVPA 1XMIA 2D06A 1E79D 4HZUA 2GEVA 4DLTA 2RGGA 2NO6A 5ANRB 2D62A 1IJFA 4TSFA 1P9NA 1TF2A 3U4QA 1HE8B 2WIAA 4C30A 4EPTA 2BWJA 4RVCA 2HYDA 3AKEA 3A37A 4WXPA 4G01B 4TLCA 3LNCA 4Q1EA 5BQ5A 1L4YA 3EWSA 5SZIA 4B34A 5JS7A 4LJ4A 1MRSA 3TUJC 5KNBA 2GBLC 4GP6A 2YC2C 3BWDD 5HPYB 3RWOA 3Q7QA 4HB0A 4Y0AA 4P33A 4B3GA 2GF0A 1F2TB 4DDWA 4IFEA 3DM5A 3MG9A 1E2LA 5JCPA 2W00A 2B8TA 4ZIRB 1M6NA 3U2QA 4KO8A 5AUPB 2H1LA 1RYHA 4JYBA 2PMDA 4AKGA 5B2ZA 4B44A 5KNDA 3GD7A 1S96A 4RZ3A 4LHXA 4DDTA 1BS1A 4O25A 5G53C 3EZ9A 4A36A 2EFEB 4C3ZA 1RRGA 4M4SA 3LAWA 3EAQA 1KSJA 1NNEA 1JR3E 2ZE6A 3HU2A 4DKXA 2YWGA 3K0FB 3A4MA 4BEJA 3T1TA 1TQDA 121PA 3C7KA 1RC8A 4PC6A 4TSFD 4M1YA 1CBUA 2C5LA 4M1WA 4EAQA 1ZNXA 4HB2A 5IDVA 1I4DD 5LD2B 2OFWA 1FZQA 3LXRA 2WSSA 1XTKA 2WV9A 1HY3A 4JKYA 4M0LA 4CZ2A 2ZRAA 5CB6A 3CH4B 3MMPA 1XPUA 4KU4A 2GJ9A 1A7JA 2I1QA 4B6FA 1XTRA 1P2VA 2BIFA 5KSZA 1E2FA 2JCSA 3LRPA 5KO2A 2V8OA 1MO5A 2CL0X 2QT1A 2HCJB 1CTQA 3CZQA 1AS0A 3ADDA 5JWHA 1OIWA 3PXGA 3KTAA 4BEBA 3W5IA 1TPZA 221PA 5EE1A 4DWJA 2J45A 1Q1BA 2ZJBA 1PLJA 4QBIA 1QDEA 4MGYR 2BC9A 2V4ZA 3PVSA 3RS4A 3AVPA 5AWFC 1ZIOA 2Q6TA 4FD2A 2QMEA 1U99A 3DZDA 4NKRA 4QBFA 4MKIA 4Z8XA 4BLRA 2CCKA 2O0KA 3QF4A 1QVAA 1EFUA 1FP7A 3RWMB 5LD2C 4Q18A 4DIEA 4DLVA 1G8YA 2P3SA 1L7VC 3FHCB 3A58B 2DWOA 1TQ6A 3O8CA 4TMZA 2RH5A 4TL8A 2AFIE 3B78A 3SEAA 5EXPA 3PEUA 4RSGA 5C2JB 5B57C 2I3BA 1Z0AA 3T06B 3UWOA 4ZI2A 1KI2A 2ZRHA 2VBCA 1ZD8A 1ZVQA 1F2UB 2C9CA 1JQJC 4DDUA 1CR1A 3OAAA 3K9GA 1LNZA 2FFQA 4XTCS 1CR0A 2O8BB 1PLKA 4ARZA 1MABA 1GL9B 3EIHA 1Q22A 5D3MA 1EWQA 2OXRA 3PV0A 1XTSA 1H65A 2FFBA 4TN1A 1RVDA 2A7QA 4H1VA 3UG6A 4W7SA 4CDGA 2CE7A 2AD5A 2BKEA 4CT4B 1KIMA 2FSHA 2KBFA 2OILA 2CEAA 5BN4A 1UKYA 4KCGA 4Q7MB 3TIFA 4ZCLA 2ATXA 2GA8A 4B43A 1II8B 5C46F 1Z0IA 3Q7PA 2ZU0C 1CP2A 3CBQA 1GSIA 2MSDB 3B1XA 4NCKA 4CGZA 1H8EA 1TAGA 1WDTA 2WJGA 4GPTA 5L3SA 1KMHB 3R8FA 3EW9A 1W46A 1Z06A 4QG7A 3CR8A 4M1TA 3RC8A 3EZFA 2BM1A 1II9A 1XEXB 2ANBA 3RANA 3AP2A 1I4LD 3B1VA 1OXXK 2CL7X 2FF7A 1D2EA 2DFNA 3KUCA 1OH5A 3DEFA 2HXYA 1VTKA 2O0JA 3G82C 3T5DA 4LK2A 3A1TA 3X1DA 3ND8A 4OI4A 2PMKA 1JI0A 4Z54A 3BERA 1RYFA 4MRNA 4CYMA 1KDOA 1U98A 1US8A 4Y0VA 3U7GA 4K8OA 4EPXA 4C2UA 4NZYA 1ZM2A 1DVRA 3UIEA 1E96A 3LX5A 4A8JA 3E1SA 3SU8A 2CL6X 4RFVA 4KVGA 3KUDA 3A1UA 2A5GA 5JHGB 3U3MA 3TW8B 3UPUA 1T4GA 2JLRA 3PITA 3AEZA 3NH9A 4KFUA 1AZSC 4IDPA 2BHRA 4YC7A 1ZUIA 4LX0A 4URXR 1GNRA 2OV2A 2VSFA 5EXSA 4QJ3A 3ZS8A 3GEHA 1H8ED 1SVMA 1E4YA 1G291 4JSTA 4KJZA 4EPVA 4M9ZA 1R5NA 5CITA 4A6XA 2CVFA 1A2KC 1OH7A 4KFRA 4BRUA 4JLPA 4S35A 4EFNA 3LXXA 4F4CA 2FSIA 4PQFA 5FR1A 1JALA 5FBRB 1WMSA 4D0LB 2ZJOA 2QPTA 2E87A 3FVQA 2WPDA 3THWB 2Y8EA 1TL7C 4TMXA 5DI3B 2NPIA 2VL7A 1CR2A 4B33A 3TQFA 3N70A 3BGWA 3K0CA 4I4LA 4AY2A 5H68A 1LW7A 4RZ2A 1W4AA 1J99A 2ONKA 4KBFA 3X1XA 1T3SA 2ONJA 2OLJA 2RMKA 2OBMA 3MWJA 1Z22A 4JJKA 3KZ1E 4NTZA 3ZGXA 2H92A 5BYKA 5K8TA 4F4IA 4NYIR 1OB5A 1SKYB 4LBZA 2BBOA 4LJ5A 4N0EA 2ZI9A 1SXJB 5FL3A 3CPHA 4B3FX 4D26A 1GZSA 3EC2A 4KLNA 4DIDA 1KO1A 2YKGA 2OCYC 2GXUA 1E1QA 5BWMA 2I1VB 2MSEB 5GADl 5CYPA 3TSOA 2ZI4A 4A92A 4C0LA 5CYOA 2O8FA 1G3RA 4K81B 5JSZA 3KKQA 3VU9A 2HT1A 1DADA 4XWOA 2FV8A 2W6IA 4U02A 1N0WA 3QXHA 3DOFA 4C2TA 3EZ2A 2A30A 4EJSA 2B8WA 2N46A 2YYZA 1HE1C 1BYUA 3CLVA 4I1UA 3OE7D 2ZRLA 2QAGB 4KSBA 1G3QA 2D2FA 2NO9A 3CRMA 2WPDD 1Z0JA 5F3WB 1R5OA 1BMFD 3U6KA 1XXHB 2O5VA 2ODNA 4NE2A 5FBVB 3DHWC 2YNMA 1J7KA 3WBJA 4BRWA 4DB4A 3AVYA 1RW4A 1SXJC 1WQ1R 2IS6A 3VKHA 1NKSA 5IK2A 5KPDA 1M7HA 1Z6AA 3RS0A 2JEOA 3CNNA 1W36D 1X8JA 3RHFA 3ETLA 2V1UA 4JMPA 1KI3A 4B48A 5EP4A 2ZRFA 2FG5A 1U8YA 2ZU6A 1AS3A 4HLQB 4UNQA 5CJ2A 1W4RA 3K53A 4A1FA 1N6IA 5DN6D 1RPZA 4TQAA 2GCOB 3AKDA 2WHXA 4A2QA 3BFXA 1G6HA 1HT1E 1TX4B 2ODWA 4XTRA 4CEIA 4ON9A 2IBMA 4LOAA 4I99A 2DPXA 2D2EA 4AYTA 2QTVB 2NO1A 1QHNA 1XEFA 4F92B 3CX6A 2J41A 1HQCA 3NHAA 1UF9A 2DBYA 1CRQA 1Z2CA 2W6ID 3ZZ0A 2IW3A 4JBXA 1R10A 5J4LA 4GMDA 4LJ7A 4OBEA 1J90A 3HU3A 4DXAA 2XX3A 2ZSBA 3BIFA 4ITRC 4JVLA 1IBRA 1XTQA 1UEIA 1FX0A 3QY0A 1YZLA 1DO0A 3REFA 2J0UA 2IF2A 3B8HA 4KFSA 2X77A 1B23P 1N0VC 3GLFA 2GJSA 2WWXA 4M1OA 4KFTA 4MGKR 1GG2A 2KJQA 5IK2D 1NMYA 2EVWX 1VG1A 2QA5A 1P3JA 2QT0A 4OKSA 3A1WA 5TY0A 1DAKA 1G20E 3LH5A 1IN5A 2NGRA 1SVKA 2IUUA 1SQ5A 5UKDA 1P60A 4LC0A 1CIPA 3FMOB 1SGWA 4LV6A 3CH5A 4LV5B 4QGGA 4JT2A 2ZI3A 1R0ZA 2FX3A 1DO2A 1F48A 4QM7A 2N1BA 3WP0A 2ZR0A 5DNYB 1HTWA 1V5WA 3OEHD 2F9LA 5SZKB 1SKYE 5JHHB 4XVUA 1EFRA 2ZE8A 2PL3A 2WKPA 3QI2A 4EKDA 4LJYA 1C9KA 5FOSA 1SXJE 1PV4A 3GQBA 1P4SA 3QE0A 3QXSA 4LBYA 4LBWA 2OCBA 2FMXA 1N3BA 4MA4A 3GLHA 1OHHA 3FOZA 3PR1A 1BOFA 3H2YA 1XCPA 4TQ9A 3SJBA 2GESA 4WVFA 4YMUA 1U0JA 2CCGA 2XB4A 1O87A 1VYTA 4HAZA 8OHMA 2ZUCA 3RRYA 4PTLA 2CK3A 1KDPA 4LZZA 4EFMA 4Q9KA 1FNMA 1CLUA 2AN9A 5GJCA 4L9WA 2QP3A 1MO4A 3IHWA 1MO3A 3ZQ6A 5JI3E 4US0R 2LCFA 3W90A 4UQOA 3U3OA 4E09A 1E0JA 5DSZA 3KB2A 2XZLA 2QI9C 3PUXA 2EQBA 4TMWA 4X8LA 4PXAA 1G9XA 4B2LA 5IRCD 4V0MA 3NG1A 1XXHE 2KI5A 2XSZA 1NG9A 5GJBA 1YZNA 2GK7A 3ZDQA 3VX4A 3K09C 1DPFA 3AM1A 1N6NA 1NVVQ 3MJRA 4NMMA 1CULC 1R4AA 1E0KA 4LYJA 3M1IA 3R8CA 4HLUA 2CHVA 2VYFA 1S0UA 3HP1A 4AWXA 4LI0A 4Q4JA 5FOUA 3W3ZB 4Z1MA 5CDFE 2VPPA 3X1WA 3IPXA 5E3HA 1EFRD 1XD9A 3VAAA 1YZGA 4YQFA 1S3GA 1X1SA 2BEJA 3BORA 5FR2A 1U9IA 2C98A 4ZCMA 1OHHD 1OFIA 2H7VA 1A2BA 3BFKA 3JVVA 4GI7A 5FL7A 4DT1B 2JJ8A 2OEPA 1N5LA 3EG5A 3U3KA 1G3UA 3JZMA 3MLEA 2ZVQX 2PCLA 3VMFA 4L15A 2AL7A 4XIGS 4RJLA 1E9RA 3NVAA 1EK0A 4TQUS 2F7SA 5EE0A 2JASA 2XGJA 4MKHA 4B74A 4KV9A 5DIFA 3KJIA 3AF3A 2CLSA 5J4HA 5JMTA 5C4GB 2JDIA 1KSHA 4TL9A 4AKEA 2AHOA 3G5UA 3R7WA 4RFSB 2AR7A 1IN8A 1G3MA 2ERYA 5BW8A 5B58C 3MD0A 1E2GA 3GJ7A 4HZIA 5KSPA 4YLGA 4V03A 2XSZD 1G17A 2UZIR 5DYIA 3NEJA 4OJKA 2FJUA 3P4YA 3W9YA 2Q21A 3ND9A 1XFAA 4ACAA 1MRNA 5EE5B 3L43A 1SVIA 4C7OA 4N1AA 3QNUA 1W0KA 4IDNA 3HJNA 5DISB 4D82A 2RHDA 5J4KA 4CIDA 3FMIA 4Z1MD 1D2MA 1Q57A 3QKTA 4UXIA 1TU4A 4PO1A 3IIMA 2X2FA 5JFGA 2DWQA 2A78A 1F3OA 3UWKA 2ZYVX 2QBYB 4QHTA 5GJVC 3T5GA 3GLIB 3WHLA 2PX0A 1AM4D 4K46A 5FL7D 2C8VA 5K8IA 2YOFA 4KSCA 1DG1G 4B3XA 3ZD7A 1Q12A 1MR3F 4GMXA 1VDZA 2FSGA 2NQ2C 3GFTA 2FA9A 2ZJZA 1G5RA 2WICA 3MCAA 2DWPA 1XNJA 2X2EA 4BZXA 1IM2A 2QAJA 3T15A 2VH5R 1R7RA 2QENA 2ECKA 4G5SA 2GVDC 3DZ8A 2WZQA 4GT1A 4IVRA 2IYYA 3THYA 2QPAA 2QE7A 3CNOA 3BBPA 5JBQA 4AG6A 3LLMA 3EPJA 2P6RA 3WNCA 3LA6A 3OIYA 4PSVA 5DH9A 1W0KD 3UMSA 1DEKA 3QQ5A 2B21A 3I61A 5FUYA 4Q02A 4OYHA 4FMCB 2FDCA 3FDIA 1NBMA 4BPBA 2IWHA 3RNLA 2A5YB 3MUFA 2WJVA 3SI7A 1XEWY 2EU8A 1CJVC 1MV5A 2QTFA 1WXQA 2IF0A 3UKDA 1U90A 2C77A 4BFXA 2ZYWX 1E9AA 4B2PA 3A1VA 3KXKA 2IS4A 3IIKA 1I4TD 2BKUA 1II0A 5SZJA 4L16A 1JR6A 2B6HA 2UVQA 1QF9A 2C96A 2CLDX 1FP6A 1LB1B 2Z43A 4EPRA 3AVVA 4AKIA 2ZR7A 4POAA 2MMCA 2ZPTX 3IGFA 2O8DB 2J87A 4HDQB 2LKCA 4TMKA 1WBDA 3CUEF 1MH1A 4M1KA 2QRZA 4LV8B 1KTVA 2H5EA 4RZXA 3A4LA 2EFHB 1KJYA 1N6KA 3WYAA 1AGRA 3SYNA 3L0IB 3M4YA 4DLYA 2F6RA 3B13B 1YZKA 4L4UA 3I5XA 1IXSB 4JIMA 4C0SA 4LUCA 1YJ5A 3WRYC 2AKAB 2GVZC 4AIIA 3CRQA 4YONB 3THXB 1ZINA 1IN4A 3EASA 4DB2A 1S1CA 4NBSA 4Q03A 2GJ8A 1P75A 2NZJA 1TUIA 2OHFA 1Z8FA 5CIQA 4D4KA 6Q21A 1J8YF 3GJ8A 4URZR 4LHZA 4DEXA 4Q4AA 1NBMD 2E9SA 5JRJA 3PEWA 2NO7A 2XTNA 4OHWA 3DMDA 4W9MC 3H1TA 3SR0A 4F7WA 1TTTA 1A82A 1P2SA 1S9DA 4LSGA 1P62B 1TQ4A 5EQTA 4TT3D 1KAGA 2ZR9A 1LV7A 3P20A 4G5GA 4KBGA 3P1JA 3VFDA 3U44A 3KL4A 1P73A 4KYUA 5L3RA 4L9SA 1Z6TA 1DAFA 3K8YA 2W2VA 5KDOA 2DR3A 5E7JA 2D74A 1QHGA 1NLFA 1VCIA 3GLIE 2WAYA 2YJTD 2G1JA 2JLYA 1N6PA 4US2R 4MRSA 1PVOA 2QTHA 2Q3FA 1AA9A 1UKVY 5E7IA 1YR9A 1OV4A 1T0JB 3TUIC 2IYUA 4QJ5A 3I5YA 3O47A 1KHTA 1XJ0A 4MRRA 5FBWB 2XNDA 4RZUA 1ETUA 2F1RA 4AC9A 3PQCA 2J0VA 4B3BA 2LKDA 5KDLA 1RRPA 2Q9BA 2Q9CA 5L8VA 1EWRA 4TLEA 3MFYA 3EXAA 2PEYA 3NXSA 3DO6A 1F6BA 2F1IA 1YQTA 4ZKDA 3OHMA 2GZHA 2O52A 4FW9A 4P4SB 3TLXA 4YXWA 2W6JA 1DAIA 1Z83A 4YMVA 1NLZA 1S1MA 4A0FA 4GOKA 3SFVA 4MKFA 1T8TA 4ZDKA 2DB3A 3LV8A 3QKSA 3RRNA 1GNQA 2H8KA 2WBLC 4DLRA 3DKVA 2YINC 4IDQA 3GJ4A 1XPOA 3AVQA 3OZXA 4D2IA 1P9RA 4B2IA 3L0SA 2YVUA 5IHPA 3L8ZA 2G6BA 3JVUA 2PZFA 3VR1A 4BFTA 4MDFA 4GFDA 2PJZA 4JVMA 1WE2A 4U5XA 4BWYA 2JLXA 4NYMQ 2VA8A 3CF0A 1VIYA 2ORWA 4RY2A 4NL4H 3EPKA 1KZGB 3B1WA 1SKQA 3IHLA 4UNPA 1GRRA 2ODEA 3WHKA 3N2IA 4DLSA 1Q1QA 3KQLA 2XNDD 4G0NA 4CEJB 1ZIPA 4HI0E 4QGFA 1ZU5A 1E69A 1UBGA 3QKRA 4OQLA 2AX4A 3E5HA 3BE4A 2R65A 2J1LA 3DMNA 1BKDR 3F3YA 4IVQA 4Q7KA 3RABA 4XVQA 3D31A 1JECA 3REGA 3C4JA 1E1RA 4BUJA 4YXWD 2W6JD 2ZJ2A 1NKTA 1XJQA 2XJ4A 3T61A 5EZ5A 3L0OA 1HEIA 2ZRBA 4MKGA 5A5GA 4A0RA 1T5LA 2MSCB 2ZRPA 3C41J 2DCUA 4PC1A 2IL1A 2AKYA 2WAXA 3KQKA 5KU1A 2WKRA 1XD2B 4PHHA 4BLPA 1EFCA 3TUZC 4D0NA
chains in the Genus database with same CATH superfamily
4D9FA 2EC5A 2HJHA 2D7DA 3DYIA 3HVUA 1LC3A 1EA7A 1PL8A 1X1BA 1L5YA 2BFDA 3C5CA 3C8UA 3Q87B 3ZV5A 3N8HA 3NIWA 3WWDA 4BP9A 3STYA 4AZ0A 2BMEA 1CS0B 3BZBA 3PC8A 2BZSA 4CIYA 1CNEA 1ILWA 1UKAA 1UR5A 3GLSA 1GQRA 1JQEA 1JQKA 4OQYA 3HCAA 2PZAA 1W8IA 2YHIA 1ESNA 2WWFA 1R4NA 2ZANA 3DBHB 1OOEA 3OHSX 3PJGA 4FFBB 3WOHA 2I66A 3SAJA 4UTNA 1SCBA 1W9MA 2EBWA 2VYVD 4G23A 4EB3A 3IBSA 2O8EB 1XX6A 2PXAA 4PPNA 3VHLB 4O1IA 4V1CA 4PO9A 3H5IA 2H5LA 2VHJA 1L3IA 1RRFA 4AJHA 4YMHA 4ZGBA 3UCXA 3U4QB 2JGDB 4BE7B 1T9BA 1Z6ZA 4MW5A 1FSZA 4CM8B 3H87A 1GYQA 1SOAA 3LKDA 3N2KA 5JNRA 2AFHA 2ZUDA 3VZQA 1E4EB 2OB1A 4MQ4A 3OCVA 3OPQA 4KX3A 1RWOA 3W6PA 2PCJA 3HYLA 1EDOA 4J29A 4B6RA 4X24A 1DOZA 1MW8X 3CONA 1GCAA 3E7DA 3ML1A 2RAVA 2VAMA 3RRZA 1V7PC 2BP7A 3KQMA 1AF7A 3GJTA 5LB2A 4UXJA 3ZJ4A 2J9FB 1PJ2A 1ZZGA 4IQGA 2OXEA 4RPGA 4U7FA 1FFXB 4ZV9A 3WLEA 4B7AA 4LYDA 4R9NA 2EJWA 4GI3A 1NVAA 1VIMA 1F1BA 1ZICA 3Q5EA 3TLCA 1GVNB 4O4HF 4LY9A 1F17A 1ORWA 4YMTA 2I8CA 3THOA 4LMAA 2MOKA 4EUNA 1U5BA 3IMEA 4O6VA 1U0TA 4DUZB 1NY6A 4FYIA 1ORIA 3UM9A 1B3BA 5IAGA 4RVNA 1GARA 3SLGA 4E22A 3KKPA 1PBNA 2IXEA 2FAXA 3ZTWA 3X2SA 4EG7A 5T67A 2EDCA 4PG6A 2Y1WA 1ISSA 4YLYA 3AIOA 3C7AA 3OZCA 1KI9A 1JXMA 5AKEA 4DTIA 2XVAA 1DQPA 2PS3A 3FYUB 4KP7A 5J3JA 2E1RA 5DN9A 4QICA 1E9CA 3PIIA 2ORED 1C0KA 2H2AA 1EWKA 3KYIB 2W6QA 2O8DA 2WF9A 1GGVA 1DUSA 1NV8A 1N2SA 2RI6A 2G8NA 5E7MA 3PDJA 1BQ3A 1NJFA 5AHRA 2ONZA 5HM8A 5KYKA 2G0AA 3R3VA 2IU0A 3CIOA 4JLKA 5LQUA 4Y0NA 1ZD5A 3SIPA 5CD9A 2IWRA 3QTTA 3PNBA 1ZGAA 1FQJA 5AI6A 4B47A 4IMJB 3ROPA 1QXSA 2FMUA 1ULUA 3LBHA 3RC2A 1R6BX 2IYZA 1FNDA 2JI4A 3OZWA 2GA9A 2QL9A 3AR9A 1C0LA 1QP7A 3CV3A 4HAWA 2HLDD 2B2XA 1F38A 3EXFB 2VSQA 3TB6A 2RHGB 3EC1A 1Q5PA 2M6LA 2NUPA 1B8UA 4XVHA 5H4GA 2P2GA 2P9ZA 3RJMA 4OFXA 4ROTA 3NBZC 3WTBA 3EXIA 5EQDA 2CHFA 4IV5A 1K66A 1YO6A 4A91A 5M2QA 1B6TA 1W93A 2FZEA 2JGFA 3M6AA 3U0BA 1KYIA 3OESA 4WKOA 1GPKA 2RGNC 2KBEA 2DH6A 4QEDA 5EPOA 1M1NA 3OTHA 3WQQA 2QVZX 4BKMA 4IP0A 2GO1A 1L5FA 2CD7A 1J7JA 1USUA 2TS1A 5D3KA 4D99A 4FI3F 3AUTA 2RAUA 2F00A 1FQKA 2BELA 2PMEA 1VG8A 3WGVA 1KOGA 2XF2A 4EEXA 5JCOA 4V0QA 3HCWA 1DARA 1YZQA 4BWFB 3LCRA 1OAKA 2QMQA 3EVDA 4ZJUA 5CLFA 3EQ2A 3GHYA 3BULA 1CQIB 2OKGA 1GRQA 3NUGA 3AVUA 2ZUEA 4RIEA 1TMKA 2Q3JA 5D3MB 1YZUA 3STTA 3WWZA 5EJEA 5LMNB 2C92A 1GTRA 3HB5X 4N48A 3DCYA 2V7BA 3TAUA 1NF9A 1YS2X 1SM4A 3AIKA 5F76A 3OLVA 1MZVA 2YJ5A 4M88A 3JR3A 2YS7A 4YAOA 5IFKA 1OE0A 1HA3A 2J4CA 1UBCA 1Y89A 3H97A 2FCRA 4J6EA 4BZQA 1MVLA 2O20A 3AKCA 1YQEA 2QVLA 4BBAA 1V0JA 2C1EA 4PINA 1EFTA 3FNGA 4G0YA 5DTIA 3TQRA 3FN4A 3BMCA 3K1YA 5AIAA 1E0SA 3QIVA 3GCGA 4QPZA 5L3SB 1E7QA 1P4AA 4ZAWA 2D2IA 2FFHA 2H8GA 1YVRA 2L18A 3H4MA 2GYVA 1S8AA 4P34A 5GM2A 1Q16A 2IUTA 1VMKA 5AJZA 5EWLB 4ESEA 1R0YA 3PUIA 3OM1A 3RYFB 2JCXA 4ZVKA 2GEJA 4ZCSA 1H2XA 1U0HC 2VZ8A 2VDMB 2X0KA 3EEQA 3RAPR 5JDCA 5CLGA 1EUZA 1FDVA 2TMYA 1NC1A 4MQEB 1TB4A 3GO4A 2DQSA 4IYJA 4IGFA 2C03A 2XJ9A 1SQSA 2MR6A 2Z3VA 1RYNA 5C1DA 1HG0A 1OT5A 3P2IA 1TECE 2ZSDA 1OLXA 4KPEC 3QMVA 3ZVLA 2P35A 1J8FA 1LS6A 3AB3A 3C3DA 3HA7A 2ZJ4A 3QPUA 1IMJA 1TK9A 4KAJA 3UH1A 4O08A 3ZUPA 1MOPA 1Y0BA 4JUCA 3U4DA 1CVRA 1CDEA 1GZHB 4ARBA 2F3QA 3DBOB 3QWHA 4V0KA 1J9EA 1JBKA 1U3WA 1YS1X 3K8ZA 4N3NA 1AKUA 1RXCA 3NATA 3HDHA 4EOGA 2JKVA 2HCRA 1EIZA 3FUCA 5FNVA 2Y0DA 4YFYA 3B8EA 3QBVA 5TNXA 4B0PA 5JVDF 1HDGO 1TO2E 1WHSB 2YRFA 4LZJA 1FOEB 1T8SA 4ZYWA 1N33B 1TQ2A 3EA4A 2JH8A 4L76A 3AX6A 4QOEA 4P4NA 4AJIA 3EVFA 4ATNA 3OURA 1AJEA 4NH0A 2E21A 2FHSA 2W6ZA 3DZGA 3L1JA 1YKSA 3DV9A 3PS9A 4K7JA 1DHRA 1E2KA 3K0EA 5DW3A 3UJ8A 4B32A 2X8LA 4D3FA 4X20A 3C6BA 4WSOA 1ZJWA 2AN4A 3DFFA 1WW3A 1XVUA 1DC5A 2VDJA 3QXXA 5KYNA 2ZCUA 4KYIB 1JDZA 4AYXA 2ID4A 2FGJA 5K9ZA 2I0FA 2OCDA 1JFSA 3IODA 1Z63A 1H4TA 4DKJA 4W63A 5E6RA 4QT0A 5JXJA 5EKDA 3EA0A 1Z25A 1ZGJA 1F1JA 3DHVA 5CM9C 3MQ4A 5IM5A 4LN1A 4MVCA 3F3SA 4JDUA 5SY4A 3N6VA 2G04A 3G2NA 3K0AA 2C5GA 1DIHA 4OO3A 5WRFA 1NXQA 1O8CA 2WSIA 3R5HA 2BHSA 1I6KA 3IO5A 4Y7CA 5LL6P 4KQKA 2DBVO 3SE7A 3EWAA 3SGLA 4BNWA 3O8DA 2EQ5A 1C1YA 1I80A 2VHVA 3EVNA 1YE3A 4O2AB 4RIGA 3Q4GA 1XFDA 1N1DA 2LZ0A 4JP3A 1X1EA 3ESQA 3HZZA 4PQYA 4Q9LA 2ON6A 3L2OB 3ELWA 1POWA 1XTJA 4DWVA 3S3TA 1Y3AA 3QQPA 3OCCA 4BXOA 5ELLA 5HDBB 5K1ZA 1VLLA 3JARB 3IUYA 3N9IA 3QUQA 4E13A 1W25A 1YQXA 2SCUB 1FU8A 5JSZB 2O8FB 3PX7A 2YOHA 3BRCA 5J2TF 2HIMA 4UXHA 4XQ9A 2H3EA 2BEKA 2EHDA 2X5JO 2ZR8A 3EY9A 3PQFA 3RPEA 1G2IA 1VBNA 2EKBA 4MS1B 4EATA 4DPLA 1LTKA 3RTCA 2KM1A 1PFQA 2DHRA 5ALMA 1TJ3A 3SN6A 4C4SA 1YJAA 5CNIA 2BM0A 4F60A 5THXA 1U2PA 3VM6A 1H3EA 1HE3A 3DG9A 4X61A 1E58A 3OFSA 3SHOA 2BY4A 2QHXA 2J6HA 3D4LA 2WOOA 2AUMA 3DWGA 3T3IA 2PVSA 1SCIA 3K35A 1UIRA 1LKZA 2COKA 1UBTS 3ZBPA 4BX3A 2XV1A 2ZI6A 1WB6A 2VNIA 1U2GA 4FOTA 5G3ZA 3VR4D 3STHA 4KBYA 4LDRA 3OFVA 4PHGA 3A36A 1HNXB 3SSMA 4OQMA 4BMSA 1YVPA 2OK7A 1B6RA 1MO6A 3EDCA 1NTRA 2F62A 2NM0A 1ZCBA 3FZNA 5E9QA 1WRBA 3T1OA 1RRCA 3PC2A 1M6VA 3BMOB 5E1DA 2NTVA 1G4AE 2RGEA 3T1QA 3RS9A 3KE9A 2Z3WA 5AW2A 4B6FA 1Z5ZA 2CLIB 4NABA 3KB6A 3C3KA 1UIMA 1Y9EA 4R8KA 4CEIB 4LZOA 1T5TA 2ZSFA 3TZKA 1E99A 2RCNA 3P27A 2OL4A 3E70C 5D1NA 2CFCA 1M0TA 1PEYA 5DBOA 2XMSA 3QG5A 3FRHA 4CIXA 1R18A 3U1VA 1QX4A 3AFIA 2XIQA 1F20A 2ZIWB 3MILA 3RRJA 4BQSA 1DRWA 2P0EA 1OASA 3KAJA 4TV8A 4D0SA 1TT5B 2WIGA 4X65B 1M0EA 4HRVA 1IK4A 3DEYX 1N9GA 2CVQA 4MZXA 1VYVA 5J9FA 2WF8A 3K32A 2QN8A 1XVVA 2XECA 3IVXA 1GGNA 1QG2A 3VZSA 2ZUSA 4H0FA 4ZALA 5EXXA 1T2VA 4ZT3A 3VVBA 3UBTA 4G8BA 4PZLA 1XZNA 1H2AS 3R5TA 4FSXA 1HE4A 4GBMA 4KPGA 1T8PA 4MW2A 3UCEA 1AU9A 4DJDC 2AJBA 2OGWA 1SOWA 1FXWA 3AIIA 3JYLA 5EI5A 2ZXUA 2OSBA 3KS9A 3GLFB 4GECA 4PR3A 1BXRB 4ZREA 4TXMA 2HK9A 2P6UA 2V59A 3Q40A 4G24A 4RA6A 4B7UA 3ZLJA 2QMOA 4JVSB 4KPFC 3T12A 4YQZA 2BFFB 4EENA 1LBEA 4L75A 3WB0A 3AP1A 2XAUA 2CFTA 4UW9A 1NLMA 3VSCA 2PDAA 3OOHA 3FFAA 3OSUA 4TYPA 5DBGA 3OTWA 1Q0PA 1ONBA 2OORA 3H6KA 2VTBA 4NCAA 4JI4B 5EZQA 3TR5A 4AP5A 4I4CA 1VCMA 2YDYA 4WUVA 5BSMA 3UK6A 3ZXSA 4CQMB 1WU8A 1YFJA 1H6DA 2B8JA 4OQDA 1P3Y1 1AQ6A 3EVGA 4CM6A 3ZHUA 2XBUA 1RXYA 3KB1A 2W2XA 1VIAA 1KORA 2R8EA 3PYXA 5A2QA 3MERA 5K8LA 2G77B 3H2KA 2PAFA 3PWSA 3VAYA 1HDYA 4ZANA 4PR0A 4YHHB 4EO4A 4G1CA 1XCGB 4UFPA 1L5SA 4NQZA 3QHAA 3TPCA 1UPAA 2C04A 3K9NA 5DNAA 3VTKA 1DT5A 2QRVB 5AUNB 4CLOA 1VI2A 1UBHS 1VKHA 5AK5A 5F23A 1QJ4A 2E6KA 3E0QA 2JRCA 3UC9A 1F7VA 3ZHVA 3MB8A 5A03A 2IBTA 2ZSEA 3EC7A 2O8VA 3ABQB 1COWD 1E7MA 1KFBB 1SBZA 3DVLA 4EW1A 4HAYA 3E6AA 4J07A 2I8AA 2ZRMA 1F14A 1ZOOA 3NUZA 5IYZB 5ESRA 1TK3A 3DTVB 2DYKA 1XYYA 1U2DC 3P2MA 1MC1A 2NUBA 3PB3A 4W82A 5FI1B 1DXYA 2SNIE 4BO4A 4CHTA 3K1AB 4DE5A 4BKPA 3AR4A 1NRIA 1TUBB 3MAJA 1JR3D 2ZM5A 3PIRA 2GLTA 1G55A 1NVTA 1DFHA 2AFIA 4DCVA 2XXAA 1A97A 1LVUA 4UASA 5F7XA 1W49A 3KZOA 4GEGA 3YASA 1S8FA 3GF4A 4U2DA 2V6BA 2XMDA 1ECCA 3L9XA 4ZXPA 5A9TA 3RT1A 5ERYA 4W5JA 1KU6A 5KPJA 5JSHA 3CW2A 5FI3A 4I4IA 1YNOA 2IH4A 3ASUA 2GN0A 3MSXA 2I9PA 2C2OA 4HK4A 1TEZA 3WGMA 4NAVA 1Y8RB 1YJXA 2DTXA 4IDCA 2WD9A 2Z4TA 3NKLA 1NPYA 1WUTA 2CLHB 4WECA 3OMLA 4G26A 3PFCA 4LA4A 4Q4JB 5F77A 3ZWMA 1OZAA 1CW2B 4B46A 3E7WA 4OK3A 4LWOA 2ODAA 3Q9UA 5BXQC 1V2HE 2JATA 2D5IA 2OAQ1 1KY2A 4JBNA 3AY0A 5CT9A 4E70A 1T0UA 4XIFA 3VPBA 4RF2A 4RVFA 4ZQBA 3TRHA 4P98A 1STOA 5AVSA 1UOQA 4P0TA 1MB4A 3OZVA 4KLZA 4KQ9A 4YRQA 1EUDB 1JIKA 4MQLA 4ECEA 5JNVA 3TK1A 4DIUA 1JDBB 4U4AA 1J42A 1E2HA 2HUNA 3GA5A 4IFIA 2KMLA 1C1HA 4G1FA 4HYQA 4NP6A 5MHTA 5CAEB 1JN0A 3C45A 1Q15A 3IP7A 4HSEA 4B3TB 4EYQA 3K7EA 3MW8A 2E5LB 2GN6A 4YT2A 2P40A 2Q7DA 5C8VA 4LRWA 1T6XA 1SUEA 4FCCA 4HB4A 3R7WB 2AF3C 1FL9A 3GLFE 2IEIA 1MC5A 3ZDCA 1E32A 1BAPA 1EJ0A 3FNEA 1SURA 4FNOA 1PYOA 2REBA 1P45A 2VQDA 2ZWMA 5AICA 3IPCA 4QDJA 3WFIA 2NO4A 3FKSA 3PA8A 2NAFA 4FGKA 1X7WA 3DMGA 4M1QA 1U9IC 3IAS6 1IVNA 1GUBA 1NYLA 2I6QA 2QE6A 3HUUA 3QUAA 1NXVA 4KQWA 4ZT6A 4HFJA 4DLKA 3MA0A 5M04A 1L4LA 5ALUA 1ZMOA 2HMWA 2LUOA 4IQ0A 5HOQA 2H4HA 1FRZA 1KO5A 1XVTA 4P9NA 2RGRA 1MNQA 2H06A 4MA5A 4W99A 3LYLA 3N07A 16PKA 4G84A 4ASUD 3E03A 3UHPA 1MW9X 4WCFB 5JI2E 4K8RB 4JX9A 2Y1CA 2YZGA 1FRFS 2WF5A 4JLBA 2P62A 4MI1A 3TSZA 1D7OA 3BB3A 5DSTA 3WGJA 4Z0HO 1MT0A 5EZSA 2UZ1A 3G1UA 3FCXA 3CRZA 3D6HA 5I8WA 3DVSX 3JWIA 2W71A 1TCVA 2H3HA 2YXPX 4J16A 3C85A 4UKDA 4HXYA 4EKIA 4GVXA 1NYQA 3MTAA 2JFZA 1OWOA 4G9GA 1L7QA 4ND3A 4RHXA 1ZN2A 4DA4A 4JYAB 3BL5A 4CF6A 3KT3A 3WO1A 1YDWA 3K9BA 1GYPA 1SBNE 2QRMA 1L9XA 3M5CA 3OJXA 1XA4A 2HXSA 4MW9A 4V0OA 4B3DA 3FZYA 3NFRA 3JSXA 2RJ3A 1CNMA 1KI6A 3K4PA 5BO5A 3AGPA 4XR9A 2PEZA 2W2NA 1UFQA 1O5IA 2YXLA 5DHPA 4A16A 2R7AA 1A8UA 2MYTA 2QVCA 2RFLA 4LNUB 5DXFA 4QPDA 3L6BA 4YJKA 2XH8A 3WRWA 1OZ0A 3HXMA 2J9ZB 3B2QA 3FAKA 1E2EA 1WCIB 4U2GA 1V7ZA 1NVVR 3Q10A 1XWIA 2YC4C 4G0WA 1KI1A 2YW2A 2QP4A 1Q7GA 3D81A 3JTMA 1OBOA 4XD7D 4V0ME 1G7RA 2BFPA 3LOQA 5ALHA 4Z49A 3KXLA 3ZQJA 3PBKA 1ODTC 1JP7A 5GVRA 4DADA 1IUPA 3QPDA 2HIHA 5KIAA 3QJGA 4QAJA 2ZE5A 3OZBA 3B38A 1NF2A 1YR7A 4X1IB 4GZ6A 4DMUB 3DDCA 1RFLA 1XAGA 4PFQA 1RPAA 5EQFA 2Z4RA 2WHRA 2A86A 2VPYA 1XDDA 2PL5A 3OT1B 1BMQA 4JGIA 3ZJ5A 4EK9A 5BP7A 4HGZA 1MA0A 2Z8ZA 4ND7A 3UBMA 2FE1A 3VR6H 1J0DA 3K70B 3AF0A 5EKSA 3IJ5A 1D1SA 2FPLA 4ZQEA 1II8A 2A5DA 3CLRC 1YMQA 3MGAA 3PPWA 1V5GA 5IBPA 2AOXA 1ZCAA 3V7FA 4KDRA 4PGFA 1A9ZA 3Q6IA 3U49A 1E94E 1QHFA 3H9EO 4O33A 5CTJA 3UVEA 5KDDA 4ZOCA 4C08A 3V9PA 3U56A 5LOVA 1X7GA 1VHLA 4XA8A 4LF5B 4U2FA 2QSYA 5AMXA 3ER6A 2JAPA 1E98A 1ZD4A 3I6YA 3I92A 4KMSA 1V96A 1YBHA 1L6RA 5H83A 3Q0IA 1CJUC 4HUJA 5HGJA 4J2TA 3EAGA 3RS8A 1ULSA 2DOKA 5CDSA 4X7BA 1OXMA 3CLUC 4Q9AA 5D5HA 5IYZA 2I9KA 1SBYA 2EFYA 1KJ8A 3DS8A 4RK0A 4WT7A 3A9UA 3GMSA 3R5XA 4PNHA 5AT1A 3TTVA 3IAM1 4AW9A 2BFMA 1Y48E 1FBNA 2IP1A 3EQZA 1LLDA 2C9OA 4GNKA 1BX1A 4U39A 1FJHA 1I0LA 3WL6A 3BM5A 2PZ8A 4UD2A 4NEGA 2H1RA 1CUJA 5C8XA 1XF9A 4P3YA 1KS9A 3I4FA 4WZZA 4NZZA 4KSYA 3PLRA 1KH3A 2HF9A 4IIXA 4EKEA 4GZLA 2ECFA 1LSSA 4HWGA 2JCVA 5TT0A 2Q29A 3EGIA 3PC6A 5FWNA 5JXIA 3RVMA 1WD7A 3OOJA 3A9TA 3EGWA 3THRA 2WC1A 3RJZA 3TW8A 1XU4A 3DFKA 5D7BA 1DCMA 5H8WA 5BR7A 3P0RA 4NZNA 4PRZA 3VH4A 1PW5A 2UVPA 5K0LA 3KZMA 4DCSA 4JB3A 4YCBA 2J0QA 4PGHA 1HE5A 3GFPA 4IJMA 1D2NA 3GCDA 2WU3A 3NUQA 2IE0A 3H1BA 3MOIA 1GITA 3CJTA 5L3ZA 3GWZA 3UXEA 4LPKA 4B85A 1RM5A 2OCXA 4IEEA 1G59A 3KL2A 1K5GA 3SCZA 4ILKA 2R8OA 3G8AA 4FYWA 1AKYA 4H2DA 3W8EA 4U7DA 1SUPA 3CX4A 3OF3A 3SMQA 1W4LA 1TYDE 5EJ8A 2XGOA 4L8VA 4F84A 1HEUA 1VKJA 4LF8B 2JHCA 1C4XA 1K75A 1U7ZA 1Z0ZA 2G4VA 2PYIA 2ZIUB 2ZRGA 4FVTA 2C8KA 1SKAA 4R0NA 2ZB8A 2BUCA 1MENA 4LZAA 2V55B 3HHPA 2RHMA 3TOVA 4X91A 3JYHA 4M8LA 5CIWA 4ERXA 2IXAA 1SMKA 1G2QA 2HRDA 1LTQA 4JQZA 3RUPA 5I7VA 4OHVA 1KZ4A 2GKSA 3IE1A 1WF3A 1ZD2P 2PS9A 2GWHA 3RREA 1TQ8A 2LP4Y 1S89A 1NUQA 5HQJA 5LSAA 5F12A 2HRZA 3JX9A 3FUVA 1FK8A 2G9UA 1IQPA 1UZMA 4HDSA 2ASVA 1VJ0A 2HLDA 3BRSA 4L07A 3B48A 3HJFA 4G4SO 4NOMA 2VOEA 2XTMA 3TR0A 1BQ4A 1LC0A 3UJ6A 3NW9A 4LY3A 1U0BB 4BQEA 2I54A 4LQCA 4Y2JA 5DRYA 2E82A 1E5VA 1NBME 1OI2A 3C14C 4L1KA 3AY7A 4DZRA 2IX3A 3SDZA 2HMSA 2OMEA 5BSVA 1IOVA 5KYWA 4FFPA 4KE7A 2B1QA 4HWKA 4IIUA 3P52A 5J1SB 3H6GA 1VSTA 1YE8A 2P7HA 5EIBD 5LQSA 1Y80A 3PSAA 2QYOA 3IBYA 4RA9A 3NYWA 5NLLA 3HTXA 1Y1LA 1HUQA 2H4JA 3K9WA 3LO5A 4YHBA 4YS6A 4Z51A 1E5XA 5I8ZA 2OYSA 4G5QA 2EKDA 4LTNA 1JVSA 1PBTA 3SDSA 4LVUA 3AQ4A 3OQIA 1BXGB 1IY8A 4FMPA 2XAAA 3GRKA 3SVLA 1IRXA 2ZRNA 5BWLA 1JZSA 2X8JB 1U0NA 2YMQA 4DYHA 1Y8QA 3NTQA 5DRTA 4L2IA 1A0OA 4KRYA 4O4IA 3PL1A 2WIDA 3QKRB 1BMDA 2FUKA 3ETJA 4MRVA 1MQ8B 1OKKD 1TIKA 2D7CA 2R84A 4CV0A 1RBYA 2EJVA 3KEOA 3R44A 4XYEA 2ZUVA 2GB4A 2HWWA 2WJPA 4WOCA 4BTVA 1M1YB 1O2DA 4AY4A 5KNBH 2PKRA 4S1OA 3H8SA 1NRWA 4LJKA 3ZVNA 3AETA 1OY1A 4DLXA 3F6PA 1PJTA 3OM0A 3Q9SA 1R9MA 1RLIA 1LPAB 1Z6GA 2WE7A 4K6KA 4X97A 4XEUA 2M6RA 2C2WA 5IXJA 3R74A 1EBBA 1LLQA 2GBGA 3A4VA 4KI0A 3PE6A 4M1ZA 1JDNA 2GCOA 1SXJD 3TVDA 3E61A 4BWYA 2AG8A 1AHIA 2GPWA 1LLFA 1C1DA 2P3OA 1R1DA 1VLQA 4WGGA 1GTVA 4HWPA 1B0AA 1TYEB 2E4WA 3OE1A 5AKZA 3RV3A 3SZOA 2G80A 1K9SA 1IU9A 1VDMA 2FR8A 2P79A 4KGXA 3WK4A 1WB9A 2GM4A 3K6KA 3M83A 2IZ5A 3W5VA 4BMPB 4BKQA 3EQ6A 1IMOA 1FFHA 5BW6B 2H7CA 4BJHB 3SQMA 3CWQA 3JPYA 4XWTA 1XCMA 2JC3A 3KNZA 4HX2A 4B80A 4F71A 2A2ZA 2ZAMA 3OLZA 4NBWA 1Z29A 2I1WA 5LDGA 2R96A 4DXHA 3GJ0A 4F4HA 2DXIA 1D5WA 2JIZA 1J2TA 4PQRA 2H7YA 4BKRA 2JLWA 3TOCA 2VSOA 1DAGA 1NQUA 3CRRA 3IT0A 2RHOA 5H02A 1R0WA 2CF5A 1P0PA 3K5WA 2EFCB 3B5JA 1G8GA 2ZT5A 5EJ2A 2VSXA 1QYCA 3URMA 3I3OA 1X1DA 2CVZA 2YZMA 1VE7A 5J63A 5IWAB 1FVXA 1L5ZA 2D5BA 3A1EA 4DDHA 5JUWA 4K9DA 4HNAB 2OQRA 2Y1XA 3TKAA 4NPHA 2XUJA 1KERA 4JENA 1ZJ6A 2PX6A 3KPJA 4KXWA 1QWOA 2WAOA 2YASA 5IC4A 2XGGA 4ZV4A 1AMOA 1G19A 3EIUA 4FYKA 4O4IF 5KNCA 3JVIA 2C5EA 1I2ZA 3M82A 1KZHA 1ZN9A 3PC8C 3I28A 3MF4A 3BGVA 4MV6A 1LPSA 4BN5A 5EHQA 1V4VA 3RLIA 1JDSA 1YSCA 1J5PA 1JDJA 5K3CA 3BXHA 3P9YA 4HQNA 4ZFNA 4HNSA 4RPJA 1J9ZA 3U61B 2B30A 2J5XA 4NFHA 3GROA 1NAIA 2IFTA 3H65A 3BWCA 1Q44A 4QQFA 4V2IA 1UXKA 1Z5NA 1LV8A 1MFPA 3M6VA 1W0CA 2GZSA 1YZYA 4MW7A 2DULA 4BNZA 4JC8A 2VRCD 2Q6VA 2IZ0A 3QVSA 1CUIA 3PNPA 1UT8A 3AF4A 1T9KA 3ZPXA 5ERGB 2XE4A 1N5MA 3ZJYA 2AIRA 2CDAA 5KWEA 1ID8A 3AH8A 3ETCA 4IDBA 4R05A 4CM4B 5IXYA 5KKNB 4M9XA 1DL5A 5AXCA 1NXSA 1V4BA 1SK9A 4PFSA 2BGLA 1C9NA 1GZ6A 1V45E 3JU3A 3RVPA 4BGDA 1VL8A 1R74A 4DREA 2PD6A 1V39A 3KLNA 3PL5A 4DUGA 1JVBA 1W8DA 4MMZB 1JG6A 5C37A 5DE3A 3MT7A 3C8MA 2VO1A 3DDWA 4GD3Q 5CDTA 4N03A 4EA6A 4OK5A 4Y2GA 2A3NA 4MZDA 4AWBA 1K3TA 1FVOA 1EP1B 5B36A 1WMDA 1Y37A 3GARA 1EPUA 1QRTA 5LP6A 1Z4JA 2GZAA 4GSYA 1M83A 1E1YA 1ODCA 2B34A 4PGAA 1L3BA 4C22A 4LX8A 5GY7A 3ZH9B 4C0JA 5LM3A 3C6ZA 4G0XA 4JROA 1M1YE 3IJPA 2GK4A 4M9SA 4N5LA 1DEHA 1O9GA 1GY8A 1UAYA 5DW0A 2XE7A 3KFVA 3OFNA 4PSAA 3BF7A 3L7IA 2ZJ5A 3JQBA 2P5TB 1ODKA 2DR0A 2E55A 2POQX 1UWVA 4OUDB 4P3PA 2OGZA 2WJWA 3HYRA 2Y27A 3QBTA 4NS1A 4R1MA 3GUVA 3WISA 1IZZA 3H3FA 2CMFA 2H1CA 1KVTA 2WFZA 1E20A 1TMOA 3PXBA 4ZQIA 1YWGO 3ZTYA 3GBVA 1KKLA 4CL0A 4UOEA 1SC9A 1YOBA 2QUHA 2V7GA 3A8TA 3DB2A 5DYTA 3SJ7A 2EZ8A 3CTMA 3C6YA 3IHTA 3LHFA 1F5NA 1FDTA 3SEQA 1S7GA 1GA4A 1KAOA 2KWIA 1EM8B 3DT9A 3VR4A 4UUNA 1QCDA 1FEZA 3ESYA 3IE2A 1YMUA 5D87A 3U3ZA 3SQXA 1PIWA 3MJ4A 1QYWA 4PZ0A 4DCTA 5K3FB 1MZPA 1DTSA 2VPQA 3CJRA 3S5JA 4KR9A 2ISSD 2GAAA 3DEKA 3LC0A 1JNXX 1GWNA 4LXHA 2G36A 1TTPB 1I7DA 3DDHA 1PQ4A 1Y4ZA 1K6MA 3P9SA 1LBIA 4KXYA 3FAZA 4PPQA 4D9CA 2P0YA 2CV1A 1TE2A 3FUUA 1KPIA 5FQNA 1PL0A 4C6HA 1P5JA 1FUUA 2ODBA 4M46A 4WEOA 2NV6A 3SYKA 5CDUA 3E4DA 5DBIA 4ND8A 3UJ7A 5KKCA 4GWLA 2Y0CA 1VHWA 2QORA 1HEYA 3Q3GE 3ADBA 2GMWA 3BEOA 1ELOA 4MYHA 1DKQA 5F98A 2P9EA 5TSDA 1UDBA 3QX3A 2OCAA 3L6DA 4M49A 2GS9A 2VDWA 3RTDA 1D2RA 4CETA 4HUQB 1ECFA 1NFQA 1IN6A 3U7RA 5JXHA 1T2DA 2QXUA 3EBPA 4UREA 5FWYB 5HBRA 3TGLA 4OEHA 5DP2A 1KKUA 1M8JA 3ROZA 1W36C 2XYHA 3E2PA 4EA9A 5ICEA 2V7QD 5HNKA 3LT1A 4UUAA 2NO0A 4MX8A 1C29B 2V9ZA 1HFEL 2W0MA 2XQJA 3IEUA 3IQXA 4IYRA 5E38A 5E9AA 3GLIA 1JH9A 3RVOA 2GF9A 3OU2A 1A5ZA 2AMYA 2C5AA 3M33A 4HQRA 1E3JA 3EIEA 3SBEA 5EERA 3DAOA 4XPIA 4DF3A 1EFKA 1FFCA 2GN4A 3SZUA 4Z5XA 2GM9A 4ZPXA 4MUYA 1BJRE 1EGVB 4KPUB 1U6KA 3M6XA 1XHLA 3TL2A 1N7GA 2ZYSA 1UPXA 4BIMA 1GRNA 4JL5A 4MHOA 4PC3A 3GZ4A 3LT4A 5HMLA 5HYVA 1QGOA 1VCOA 2IUSA 1UM9B 1W4CA 3P71T 3V4LA 2HM7A 3T7KA 4O63O 4URWR 1NSFA 3LW7A 4OSOA 2Y0EA 3WA6A 1Z0FA 1R66A 3B9RA 8AT1A 5E4JA 1VPDA 4OTZA 3DDNA 3I1YA 2EJCA 3V1MA 2G09A 3BSSA 1FDOA 1I2MA 1OFHA 1N1EA 3SS7X 1EA5A 1CEEA 1X7DA 3QLTA 5GZ3A 2E5FA 1A2QA 2OBYA 3L6CA 4LE1A 4LY6A 2D0DA 4NIMA 3UMBA 1L7AA 4TLDA 2XB2A 4MRMB 4QRHA 5BMOA 4R41A 4RD3A 1FX1A 4EGJA 1TZ2A 4QJ4A 3NIFB 2I6UA 1KK0A 3Q9NA 4TTVA 5GOZA 2H63A 4YH1A 3IURA 5CA0A 2Y9MB 4LDPA 2YNMC 5JASA 2IYVA 2ZWVA 2L42A 3EFHA 4JZKA 3N76A 5EUQB 2FLWA 1OV6A 2X13A 3NASA 3VZCA 2QLLA 2CMDA 1AQNA 1UBSB 1ITZA 1RYBA 3KPVA 4C6SA 1GXSB 4IIFA 4QEZA 1FYXA 3DOHA 4JC0A 2WTNA 1C3OA 4CN8A 3A32A 5IZ4A 1SHZA 2GNPA 2XUFA 4W8GA 4ED9A 3ZWCA 5IABA 4MGIR 1EI9A 1F6WA 2ZXEA 2V9CA 1JEDA 1RCUA 1PG0A 1QYIA 1VLMA 2CKDA 3WNVA 1AUPA 5HTOA 4D4LA 1M7GA 4LZWA 3AEYA 1ST2A 3FWNA 4BE4A 4HVLA 3NI2A 4MXDA 3FPAA 3DF9A 1JHXA 4AJLA 1UBKS 4R40A 2NXNA 5ARCA 3UAOA 1YI1A 4JJZA 1J9GA 4IZ6A 3IKJA 3BCRA 3GLRA 3CR3C 4JJIA 2ANCA 4AJ4A 5B3JA 1GT6A 4GHWA 3SM3A 2J3MA 1AN9A 1UBNA 4HDRA 2XMRA 1XEAA 3GG2A 5CBPB 2R6FA 3WZ2A 2QIOA 2AJCA 2QRHA 1RIIA 2IZOA 1Q11A 1Z88A 5C3UA 1V3VA 3MTEA 2J3QA 2ZITA 4FYMA 1M6EX 4S1WA 4JOQA 4Q3BA 4UM8B 2GZ2A 2OAP1 5TMBA 5CXUA 5KX5F 4D98A 2AJLI 2A14A 4M9UA 1YF3A 3R7BA 4ZQCB 4D8VA 3ONWA 4A6EA 5FOQA 1D1QA 2GTHA 4OGGA 3TNFA 4C3OB 4D92A 4DCPA 1XTTA 2Q4DA 3NLLA 2RHTA 4FNAA 4AS1A 4IOMA 4HAIA 1CVIA 3OCWA 1SQ6A 4RDXA 5INTA 1IHUA 1NP6A 4CMGA 4YPVA 5KYYA 1CJSA 1C3XA 1FU7A 3AEUB 3TTXA 2YVAA 4D9HA 2C94A 3BZUA 4E5MA 2WYWA 5HF5A 4ZO7A 5ADVA 1QONA 1C7EA 3LUFA 5CA0F 3ISTA 1E2PA 1X15A 2REOA 3X1JA 1ZA1A 2I6FA 3JQGA 1U28A 4ZU1X 4ERNA 2FW1A 1P5HA 1X3SA 2FZGA 4FHDA 1ZNWA 3PHGA 3CU5A 3UJDA 3UMVA 4MJ7A 3SC4A 5IUJC 3FTPA 3HCCA 1U2QA 1W88A 4MYUA 3UT5B 4ZJZA 1P9WA 1ECPA 5JPCA 3ZZNA 2PRJA 3PLNA 2R44A 3LKVA 3GB9A 1JEOA 2R1UA 3S1AB 4AX4A 1L7NA 3SYRA 1BVHA 4R1NA 1SRQA 1WVIA 4FFMA 1Z68A 2EWWA 4HPJB 1DAMA 4ALIA 4YUYA 4BGEA 2KSQA 1RWMA 3K8OE 3MRVA 1NYRA 1JPVA 3LPNA 2YDXA 1AKMA 4FBGA 3ZU5A 4BGUA 4FCVA 4EZBA 5C8ZA 2QRUA 3OZIA 3ZBQA 2GETA 5DNWA 4TMVA 3RQIA 4C5AA 1Q2XA 2PAAA 2LCIA 2CXHA 2P2NA 4R5MA 3E2MA 3G9QA 1XLWA 4MVJA 1JMYA 2FPOA 3G8CA 2FSFA 1EVKA 2HJGA 4Q3KA 1LF0A 4G65A 2JPDA 4KHPB 1N2HA 1T6YA 1PQYA 2BCJQ 2OD7A 1M72A 4NMWA 2OFFA 1ECGA 4HDCA 4JIGA 4NU0A 1T3HA 1O6BA 2FWRA 2X0RA 1C4KA 3PNSA 3MHPA 2X4DA 5DHAA 2CNWD 4FONA 1XL1A 10MHA 1E4VA 2H9AA 3OC6A 4A0QA 2UYGA 4WLFA 4EPYA 4TZ6A 3NTUA 2RD2A 5AVXA 4LRUA 1BE8A 1PT9A 1SOVA 1DQNA 4ZAFA 1LA2A 2F1JA 2P2SA 1MJFA 1PFVA 3V9AA 1K27A 1RQRA 4CKBA 4DQDA 2OD2A 3UJBA 5G1PA 4JLAA 3W05A 3WXBA 5L53A 1I3CA 3VSEA 4B81A 4ZVUA 2VZLA 1ZVVA 3OO0A 1G18A 2H0QA 3A3PA 4A27A 4EI7A 1Q0QA 1TZBA 4CIAA 2J8ZA 5E9WA 3U16A 2RHHA 3FYSA 2R6JA 4LBVA 5E95A 1JL3A 2ZS9A 3LYHA 1Y8ZA 4TZ0A 1G1MA 2YFKA 1BROA 4LY0A 5B37A 4LWZA 1U7TA 4YPFA 2BUBA 3OJ0A 1UP7A 1K0FA