1VL0A

Crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
HMKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNPQSAYGKTKLEGENFVKALNPKYYIVRTAWLYGDGNNFVKTMINLGKTHDELKVVHDQVGTPTSTVDLARVVLKVIDEKNYGTFHCTCKGICSWYDFAVEIFRLTGIDVKVTPCTTEEFPRPAKRPKYSVLRNYMLELTTGDITREWKESLKEYIDLLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DTDP-4-dehydrorhamnose reductase, rfbD ortholog
publication title Crystal structure of DTDP-4-dehydrorhamnose reductase, rfbD ortholog (CAC2315) from Clostridium acetobutylicum at 2.05 A resolution
rcsb
source organism Clostridium acetobutylicum
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vl0A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1vl0A02
3LT4A 3PEFA 3QWAA 4RVSA 4O63O 3RQSA 3E18A 2GO1A 3C3XA 3D1LA 3GZNA 3SC4A 4LVCA 1IZ9A 1T4BA 4BNVA 4UVDA 1EK6A 2C20A 5AXDA 3E9NA 2VT2A 7MDHA 3OHSX 4FSHA 1VC2A 5L51A 1LA2A 3JQDA 1H6CA 4YJGA 3TZHA 2EGHA 2PWZA 1XA0A 3DR3A 3QSGA 4Z9XA 4LSWA 1P0FA 3GRPA 4WEQA 2JCXA 4BO5A 1L1FA 2Y67A 2B35A 3D0OA 4DQUA 3L4SO 2AMFA 1H5QA 3WFJA 1LLDA 1TEHA 3PJEA 5IFLA 4FJ0A 4Y98A 3JCZA 1O9BA 2NUAA 4XKJA 1Q7BA 4A73A 1E7RA 4BGEA 3RROA 3AM3A 3GFBA 4LW8A 4MVJE 3WLFA 5ENDA 5ADHA 5F3RA 3NGXA 4ND3A 4OH1A 3W8FA 5T67A 4UUPA 1AN9A 2QG4A 3UICA 3Q9NA 4ALKA 5DF1A 2P5UA 2PV7A 4PIVA 4RVGA 4R4JA 1HDGO 1PR9A 4O6VA 3FWNA 1F8FA 2I99A 5L4SA 1EZ4A 5ILOA 4MVJH 3V1UA 1BW9A 3QW2A 1PGQA 1ZEMA 4J3FA 4ND1A 3E6AA 1LSSA 3OIDA 5HTOA 1UP6A 1P45A 4J9VA 2A92A 2DUWA 1ZSVA 3DBHA 2X0JA 2X5KO 3U4IA 3ZDFA 2A9FA 1LSOA 2DT5A 4Q39A 1KVRA 1CWUA 4D44A 3NYWA 3P2YA 3L9WA 5L4NA 3NTQA 1S6YA 4YJHA 4OYRA 4RVUA 2VUTA 4EITA 4CUKA 1P9LA 4WGGA 4XZ3A 3CXRA 3TZ6A 3STHA 5I8WA 4M1QA 1BGVA 3I9KA 1GYRA 4DQVA 3Q6IA 4QXMA 2G1UA 3GEGA 2CNBA 2X8LA 2TMDA 4CLRB 1GV0A 2C54A 1R4NA 2P9GA 1J6UA 3H2ZA 1H0KA 3ZU5A 5G2OA 4J4BA 1ZK4A 4CQLA 3DZJA 2YHUA 1YBAA 2DC1A 5ITVA 1EFLA 1JWBB 2O2YA 4AFNA 1C1XB 1KOLA 2X23A 1N92A 5A1TA 3ASVA 2B37A 2Q2WA 4I9UA 3HWRA 4PLYA 1MV8A 2OORA 2PZKA 1GCUA 1K5HA 4WNIA 3RAJA 4AJ2A 1CEQA 2DPGA 1ISJA 3NRCA 2ZQYA 5COQA 1YE3A 2H6EA 4FPXA 1J4AA 4YQZA 1VSVA 1YS4A 2ZYGA 4IZHA 1C0PA 4GI2A 1DIBA 4IQ0A 3FF4A 4HX5A 3AM4A 2NVWA 2WWRA 3H8VA 5B4VA 4TSKA 2O7QA 4HV4A 1VLLA 4HFMA 3H9JA 1LDEA 1ZVMA 1KYQA 4JBIA 1GQQA 2UAGA 1E3IA 2GPTA 3RASA 2G0TA 4KDFA 1J49A 2VTEA 4PZEA 2P2SA 3JQFA 4J2OA 1B3RA 1U8FO 3ZGYA 2QRLA 1JAYA 3ZHZA 5K9ZA 2NADA 2PKQP 4Z3DA 4EJMA 5A03A 4XYEA 1H9BA 5JFOA 3WOHA 3H5NA 3JD0A 1JU9A 2CFCA 2OUIA 5JW6A 3T4XA 2NSDA 3JQ7A 3A28A 4AJOA 4YAJA 2VHXA 4DPMA 3PQFA 4CODB 4PG7A 3Q11A 4AJKA 4OL9A 4GX1A 3JQ9C 3ZNPA 2HDHA 3O26A 2AE1A 1P44A 4E2WA 1U1IA 3PYMA 5KJ6A 1L7DA 2NVUB 1K6JA 5BQFA 1GDHA 3F46A 4XJTA 1RYEA 3JQ8B 2NM0A 4TRNA 1XDWA 1NASA 4LN1A 3LVFO 2GZ1A 1ZK1A 3UCEA 3HG7A 4IIVA 5IZCA 2HMTA 2ZYDA 1G0OA 2AA3A 2WM3A 4WPGA 3ZV4A 3JSAA 3ONFA 4I5DA 3R6DA 5JAZA 4RF4A 4ALLA 5MGBA 5AOVA 2P91A 2AXQA 1IPEA 2Q2QA 3QQPA 4LISA 3U4DA 3JQEA 5ENVA 3BZUA 1GYPA 2JFFA 3IJRA 5EN4A 3W6ZA 3H3FA 4GX0A 4A2CA 4W4TA 3ZWAA 4NPCA 2FSSA 4CMHA 4Y6RA 1F8GA 2WTBA 1UAYA 2GDZA 3IAHA 1V0JA 1ZJZA 1JVBA 2YV3A 2R6JA 1I24A 4OKIA 2OXIA 1LI4A 4YJFB 3JV7A 3NDJA 3TPCA 1H6BA 1SEVA 4ZA2A 3DMTA 3C8MA 5G4KA 1NM5A 2BRUA 2E6UX 3FR7A 4MO2A 3S2GA 2VRBA 5COBA 4BO2A 2D4AA 3DHEA 1BTOA 4E5YA 4OOFA 1YXMA 4PLCA 3RKRA 4F6CA 3RU9A 1SOVA 2AW5A 5HRUA 4W9NC 4DYDA 3FHLA 2EERA 4U7WA 1QYXA 4FCCA 2W2LA 4NMHA 4TRJA 3T7EA 4R01A 3LQFA 1L7EA 3ZWVA 3WLEA 4BGVA 4TMFA 1EMDA 5IDXA 5T64A 4RVDA 1E6UA 1EVYA 5CEEA 1O89A 4IZIA 1TLTA 5AVOA 3X2EA 5T6BA 3EUWA 3BHMA 3EAGA 4EJ6A 4ZN6A 3RKUA 1RM4A 2D59A 3RU7A 2O23A 3UGKA 1QLJA 4JJGA 1RWBA 4KTVE 4R54A 5THQA 3PXXA 4GX5A 5A5EA 4MDHA 1XGKA 3HJAA 3W8DA 1Y1PA 4JP2A 3VC7A 2RHRA 3WXBA 4QO7A 3ZNQA 4MVJF 3C85A 3MJTA 3D64A 4R1UA 3VZPA 5I7SA 5JCXA 4GLOA 4KWHA 1HSOA 2FR8A 3WGTA 3MTGA 1PJSA 2EW2A 1U7TA 4BV8A 3DEYX 4Y67A 1YL6A 4QECA 4JXKA 4RV9A 1PJLA 3GRKA 4R1NA 1UJMA 1BDBA 2V65A 3AY3A 2EV9A 3G0OA 3T7CA 3WGYA 5G4LA 3WTBA 5CDTA 3Q1LA 3D4PA 2HK7A 2BFOA 1AUPA 1HYEA 1RM3A 1QV6A 2OO5A 2JD2A 1IUKA 3UH1A 5C7OO 5JAMA 1A7KA 4YVFA 5BSHA 1C0KA 2OP1A 3A14A 1U4OA 2BI8A 4J1QA 5L7TA 2Z5LA 3BMOA 3E48A 2XXBA 4I1IA 5ILGA 1OBFO 3RC2A 2O7SA 4TVOA 2H9IA 2X0NA 3IUSA 1NAIA 2FHSA 5KVVA 1BHSA 4IS3A 1ONPA 4ZQEA 4PLPA 1H2BA 2I3AA 2Y0EA 4BO8A 3E5MA 3JYQA 2Z95A 1XKQA 2D5AA 1I10A 1PL7A 4BOYA 4CMIB 4CR7A 5DBGA 3WNVA 3ZZNA 2PZMA 1TB4A 4R16A 4E32A 1PJ4A 3BMCA 3OSUA 2PZLA 2NTNA 2ZJ0A 3WWZA 1ZK2A 5JDIC 3D3WB 1X14A 3GN2A 1I5RA 1T2EA 1V8BA 2VOJA 1DFGA 4GSLA 2DLDA 3WMWA 1I2BA 2IDZA 4CJXA 3BMNA 4BVAA 5DNAA 1PJCA 1R37A 1KEUA 3LT2A 5CPFA 4XGKA 2DTEA 4IMRA 3H7AA 2I3GA 4DPKA 1U3TA 1UDCA 1SB9A 1Q0HA 3B6ZA 1F06A 5EINA 1DO8A 3VH3A 4EEXA 3GGGA 1VE9A 4FR5A 3AUAA 3OQ6A 3IMFA 1MX3A 1R0KA 5B4TA 4J49A 3I9MA 4FFNA 3HN2A 2R00C 2D1YA 1PGOA 5B1YA 2IZ1A 3AW9A 3ENNA 3EVTA 2DBRA 4XGIA 3KYDB 1CDOA 1DIGA 1KVUA 1ULSA 2GLXA 2FZEA 2VHZA 5J23A 4BNLA 1P31A 3E5RA 3RC7A 4CQMA 1ZK0A 3U4CA 5HBRA 1ENOA 2PLAA 3NTOA 4B3HA 4WUVA 4B4OA 3BMQB 4CR6A 3WWYA 1QYDA 3TZCA 1T2DA 1U5CA 4MVJP 5KVCA 5KCZA 4ALIA 4CM4B 4C4OA 1T2FA 1NTOA 2YJZA 4ALJA 5ER6A 5JSFA 3SJ7A 1YQDA 1HDXA 2TMGA 3I3OA 3WJ7A 4Z9FA 1JQBA 2D3TA 4BNNA 3RIHA 3KEOA 3K9QO 1FXSA 3PIDA 2CVQA 3I6IA 2PD4A 1Y8QB 4JP3A 3RBXA 3HSKA 3LC7O 2GN8A 3WICA 4BNHA 3A06A 1YQGA 1CQIA 1HT0A 1BG6A 2ZCVA 4MIOA 4XEHA 4J7UA 1UXIA 4O0LA 1PIWA 2DVMA 1FDVA 3KUXA 3JQGA 1BXGA 4OAQA 4XQEA 2Y1DA 1WAMA 3OEWA 2VUSA 4E12A 4AJPA 2VZ0A 5BNTA 2E49A 3OFSA 2NTVA 2OBNA 3LZ6A 4YAIA 3TFOA 2V6GA 3O03A 1ARZA 4BMSA 2I66A 2PGLA 3TFQA 5GZ6A 1O5IA 4RLHA 3E1KA 5U1PA 3JQ9A 5I9LA 2W2LD 4WCFA 1FDTA 2ZIZA 3FPCA 3HDQA 4UUOA 4TWRA 3NKLA 1UZMA 1YB1A 4LMRA 3VH1A 3LU1A 4XDYA 4M49A 1QYWA 3MJCA 1UR5A 4OOEA 3S8MA 3AOEC 2FRDA 3KHUA 4E30A 1V3UA 3KB6A 2FR1A 5JNLA 2IEDA 2VHYA 3Q2KA 5IG2A 1DPGA 1PJTA 3EGOA 1SEPA 3UF0A 3KETA 1E6EA 3WQSB 4Q3BA 5CEJA 1IHXA 3QA9A 4DGSA 3GEDA 3D5TA 3BXXA 3KXDA 1SMKA 1WNTA 3P7MA 4R1SA 1C1DB 4YT2A 3BTOA 3RC1A 3Q3CA 5ES3A 3VOSA 1AE1A 4A0SA 4AJLA 4D42A 1PGPA 2HJSA 1HE2A 1UXKA 1X15A 3ZWWA 3IKTA 4OO3A 2NU8A 4RPJA 3DAFA 2CMDA 1EVZA 3DZIA 4L75A 3U49A 3OJFA 4D7AA 1ISHA 1A4UA 2X4GA 4BKRA 4DWVA 5HWSA 1Z75A 1UAGA 2GYYA 3MJVA 2UUOA 3RUDA 4YEDA 5GZ1A 4DVJA 3AWDA 2ZTUA 4J1NA 1Y8RA 3ZW9A 2UDPA 1DRVA 3DFUA 3MWDB 1EFKA 2FPIA 5G0VA 4ND2A 1FDWA 5KJ1A 1Y7TA 3RUFA 3C7CB 4D3SA 2BHLA 2ZYAA 4BO1A 1RJWA 3GK3A 3LK7A 3QV1A 5L4LA 4MOWA 2POQX 2A4KA 4W9NA 1PQWA 2VCYA 4ZQFA 2C2YA 5IXSA 4NJOA 3SC6A 2FY8A 1HDYA 4GPD1 3GA0A 4A7PA 3H9QA 2CVOA 3PIIA 4XRGA 3KSZO 4DC1A 1G6KA 3EHEA 4L4SA 3O4RA 3IUPA 4WLUA 4R41A 4IDGA 4QFDA 2PA3A 1NFFA 1VPDA 2HO5A 5L45A 5A06A 1KETA 2VUUA 1P1RA 1DAPA 1YL5A 1LX6A 3AFMA 1DJQA 1XEAA 1LNQA 3L0DA 4L74A 4CM8A 1GQ2A 4KZPA 1NWHA 1YDEA 2ZTLA 4NG5A 5JC8A 3RUEA 3GNTA 3PFFA 5CDYA 2QRKA 1YRLA 3HDJA 3D3EA 4BO6A 3U62A 3CEAA 5IXYA 3DFZA 1AHIA 2Q50A 3HNPA 1CJCA 4GKBA 2UUPA 1IE3A 4AJIA 3VPSA 2BI7A 3QJ5A 3OM9A 4MP6A 3NAQA 1HXHA 3RI3A 5JBIA 2Y1FA 1ISFA 3CINA 4OSPA 4BNIA 1WDMA 1GL3A 1EE2A 1ZSYA 3B70A 3ZU2A 2QYTA 4HFRA 4MPDA 3FI9A 3GF4A 1TT5A 5KJEA 1IOLA 3WQRA 3GZ4A 2NACA 2HK9A 1JDJA 1ZXLA 5A05A 1NQ5A 2FN7A 4UAGA 3JQ6A 2D0IA 3ZWBA 4CMAA 4GKVA 1WPQA 4E5KA 3OA2A 3MWEB 2BD0A 4KUHA 4EYEA 1DXYA 1GU7A 2HMSA 3D5QA 1ZMTA 1FK8A 5BNFA 1H93A 3JTMA 3I9OA 4DXHA 2FMUA 5BSFA 1PGJA 3JD1A 4CQMD 4CV2A 1NNUA 4R3WA 3V1YA 9LDTA 2OZPA 4YT5A 3Q2IA 5JC1A 3JQBC 3ZWPA 1PZHA 3D4OA 4B8ZA 4IGEA 5COAA 3V2GA 1PJ2A 3HADA 3O38A 1ISMA 1T25A 3GDOA 4J0EA 3GEMA 1WDLA 3I4CA 5IDYA 3IS3A 4KOAA 1X0XA 4B4VA 4P22A 1HE5A 3AM5A 4CMBA 4FQ8A 1I3LA 1EBUA 3ANNA 2VHWA 4E21A 3H4VA 1SZJG 1V3TA 1Z7EA 1P1KA 3LT0A 1K3TA 1P33A 4BL5A 5C37A 4UVIA 1NAHA 2CD9A 3RVDA 4XIJA 5BT9A 2Q49A 4H15A 1EVJA 2IEBA 4KDEA 3DHNA 1MC5A 4HXYA 5CDUA 4Y9DA 1NHGA 1Q7CA 2YQ4A 3GT0A 4D41A 2FPPA 2ZTVA 3C7AA 1DC4A 3DDNA 1HDRA 2QRJA 4J1TA 2B4RO 1Q2XA 4DMMA 2Y1EA 1PL8A 4CMGA 4RCVA 5C7LO 4CLOA 2NU7A 2P9CA 4I8XA 3OF2A 2VYVA 3OJEA 5B12A 3ANLA 2GSDA 1E3EA 2PD6A 1QLHA 2C82A 3GC6A 4BO7A 4CLRA 5I7VA 3ZH2A 1PZEA 1T24A 2R00A 1KY5A 4LVUA 4OIMA 1HYGA 1N2SA 1H2HA 1MG5A 3LSYA 4NR0A 3SLGA 4ITUA 3PWSA 1WZIA 2DBZA 4R5HA 1OAAA 3W1VA 1MXFA 1OMOA 2W90A 1XLTA 1C1XA 3GH3A 3IJPA 3W8EA 4YDRA 3I6QA 3H9UA 3FSRA 2FOIA 1K6XA 2WD7B 5ITWA 2JKVA 1OI7A 3IDSA 2OL4A 3PDUA 3VVBA 4DREA 2ZB7A 4NZ9A 5IN5A 1DEHA 3QVSA 3I23A 2GRAA 3RFXA 3VZSA 1E1LA 1XSEA 1LQTA 1R12A 3ULKA 2PNFA 4ZGWA 2X9VA 5JMPA 3WB9A 4J16A 4OSOA 4EGFA 2B4TO 2QW8A 3TL3A 2G82A 1BVUA 4IDEA 1E7SA 4QUKA 4IY1A 1ZSNA 4EZBA 3AU9A 1HKUA 5JO0A 4TZKA 3UVEA 3M6IA 1A27A 2FR0A 3PGXA 1GFSA 4F6LA 5TX7A 3GG2A 4J1SA 2VRCA 2B0JA 4CR8A 3GZNB 4CV0A 4YT4A 4MINA 1NYTA 4M8SA 3ZCXA 2JCVA 3ZHBA 1D8AA 2DKNA 5IZ4A 1LSJA 2HCTA 4PGFA 1PQUA 4Q9NA 1Y9EA 3PYXA 4JIGA 1MA0A 2PD3A 2RIRA 2WMDA 2ZQZA 2ZATA 1HTBA 4UVEA 1MGOA 3WQQA 3U4HA 3S2EA 4HNHA 1D7OA 2W4QA 3RJ5A 3GQVA 4WLFA 4JBHA 4XYBA 5JDCA 1PJQA 1PZFA 1QSGA 2NVUA 3DOCA 4TKMA 4IJWA 5TT0A 2VHVA 2QX7A 3AOEA 3QIVA 2O48X 3F3SA 3GUYA 5TNXA 2FSVA 3DZFA 4NK5A 3W4KA 4F45A 1LC0A 1X7DA 1XWFA 5L7YA 1T1SA 3CZMA 1BMDA 1SNYA 2YDYA 1I01A 4BHTA 4FIZA 3PJGA 3BYZA 3F9IA 4Z0PA 1KEPA 1LLQA 2HAEA 2PGJA 4FDAA 4AJHA 1J0XO 4OXNA 1KC3A 2J5RA 1G0NA 2YHIB 2D8AA 2YFQA 4E5NA 3VKUA 4WLVA 4BO3A 3KYCB 1O94A 1HL3A 1VRWA 4D79A 1KVSA 3JYNA 4WEOA 4XQ9A 2WYUA 1YBMA 4FB5A 3NT5A 5ICSA 3K92A 2DQ4A 1Z74A 5I8ZA 2D2IA 1R0LA 1DAOA 4PFJA 4RPKA 4YJFA 1IPFA 4BNZA 1B8UA 1GTMA 3PZRA 2Q3EA 2Q4BA 3GUCA 3ZU3A 1E3WA 4DMLA 4KP7A 1GZ3A 5CPBA 4OQZA 4J7CA 5KKAA 1NX6A 4YYZA 4RQUA 4GGPA 3ST7A 3V2HA 3UUWA 1XG5A 4IDCA 4BNTA 5AXAA 3CE6A 4JBGA 3HDHA 1ENZA 2AHRA 3PGJA 4JJFA 5A4DA 3TNLA 3DBRB 3VKVA 3OICA 4NIMA 3KBOA 2WSBA 3NTRA 4B3IA 3QLJA 1E3LA 3O8QB 3VPFA 4WKGA 4IDFA 1JKIA 4AJ1A 5KVSA 3QHAA 1QYVA 3WYEA 3KSUA 3L4BC 3V8BA 4WASA 1PZGA 2C29D 1X1EA 2BGKA 2J3JA 3BHIA 1LDGA 3GVHA 3DZGA 5BNIA 2EKPA 4E5PA 2RH4A 2PGDA 4FFPA 1KIFA 1ZEJA 2OHXA 4D46A 5EIOA 5FI3A 2GUGA 2E48A 1A72A 4BNWA 3GVIA 2BMAA 2YV2A 1EDOA 4H7PA 3MOIA 1SCUA 4XB2A 1NVTA 1U7HA 4IBOA 2IYOA 4YAEA 2EKLA 3SX2A 4BNGA 3U0BA 1ENYA 1T2CA 4Z6KA 3M2PA 5H83A 3AI1A 2O3TA 3RUIA 2GF2A 2VYVD 4N5LA 4PG5A 3PVZA 4DLAA 4U5QA 3NX4A 3VH2A 3AOGA 3LC2O 3PHIA 4TROA 5U4QA 4CLEA 3HQ4O 3BTUA 2HMVA 4I9NA 4ALMA 4HP8A 1XR3A 4F3YA 1XHLA 1VI2A 2HK8A 3LT1A 2QZZA 2BFAA 2Q4EA 4OXYA 2F00A 3VPXA 1DJNA 3L6EA 4BKUA 3ZNNA 4IM7A 3FNEA 2E4AA 2HQ1A 4F46A 4NDNE 4XWYA 3OJ0A 4O5OA 3G1TA 4IINA 4UVGA 5EQFA 3U09A 2V6BA 1QYCA 2PKRA 3JQBA 1U8XX 4ZQHA 4Z3KA 2YYYA 1HDZA 1B26A 1UXJA 1ZZEA 1ZH8A 3JQAB 3NEPX 4NH4A 4DL9A 1V6AA 1PR3A 4CMIA 1PEDA 3TOXA 4L4XA 2FWMX 5A9RA 4BQRA 3L9XA 1QR6A 1SO8A 1EUCA 2DTXA 2GGSA 2Y99A 5EMHA 4YAKA 1YH3A 3D3WA 2J5KA 1F0YA 1GEGA 3VHRA 1HLDA 3VZQA 1YB4A 1E7YA 4E2YA 4PLVA 2VQ3A 2DM6A 4L0QA 3KOUA 2C59A 2EEZA 1Y6JA 4P8RA 3FNHA 4NJMB 4D45A 1JW9B 1T26A 2HKIA 4LCEA 1GPDG 1PS9A 2I76A 4DIFA 4M86A 3ZV6A 6ADHA 2VRCD 3PJFA 2QHXA 3V5NA 1A7AA 1VL0A 3JYOA 1NP3A 5TJHA 2DU8A 1U3WA 1UXHA 4BIIA 4FFRA 1O8CA 1AGNA 1T2AA 5F5NA 3WG9A 3JYPA 2UYYA 1CERA 4ND5A 4PVDA 1CRWG 1SPXA 3PFWO 5L3ZA 1ADCA 1B7GO 1LDMA 1UZLA 4RF2A 5JXWA 2IZ0A 1I3MA 2CSUA 3K96A 4M87A 4FN4A 1R4MB 3F5QA 5AQ1A 3BAZA 3M1AA 4ZRMA 3DBLB 2P4QA 4D43A 1G1AA 1RYDA 2OBYA 4R68A 1O0SA 1DDOA 5CAEA 1HE4A 1OOEA 3S55A 3PWKA 3PYLA 1UDAA 4YB8A 2VOEA 4Z9YA 1JTVA 3PHLA 4ZJUA 2ZTMA 4IJVA 4J0FA 3WFIA 2O4UX 4FC7A 4BNKA 4RVFA 5GZ3A 1E92A 3WYCA 3QWHA 5A02A 4B4WA 1ZIDA 1YBVA 3WGOA 3EY4A 2DFVA 2VWHA 2VZ8A 4W99A 4EEZA 4UVHA 3K6JA 4RVHA 4K9DA 1CQJA 1ZCJA 3BMQA 4JROA 1GPJA 5TJ9A 4XCVA 5TLSA 1S7CA 1JA9A 2O2SA 4GQAA 4EUHA 4RZIA 3QVXA 1B15A 5KKCA 4IXTA 2NWQA 2Z1MA 2X22A 3ZV3A 4CM4A 1MB4A 3B1FA 1FMCA 2YY7A 3ONDA 4WOKA 4XQGA 1CYDA 1VJ0A 5EPOA 4CM6A 1GADO 4BB5A 4EUEA 3SJUA 3D4NA 1YGYA 1JLLA 4R5MA 4G65A 4RF5A 5CP8A 2UV8A 2NU6A 1NPDA 2DTDA 3KSDO 2PKQO 3P5SA 4GLLA 4UULA 5HS4A 1MFZA 3CMCO 3FPLA 3ITKA 2P4HX 1RM0A 2IYPA 3ZHXA 3GGOA 1N9GB 3DZBA 1A71A 4MJLA 2NVBA 2NU9A 4DIOA 3L6OO 3RD5A 2EJVA 1PJBA 4YWJA 1T4DA 2AEMA 2G5CA 4Q3DA 5G0UA 1ZFNA 3OQ1A 2VZ9A 3BMOB 3FR8A 5MDHA 4Y6SA 1GZ4A 1I3NA 4GMGA 1GQYA 4XYLA 1BXZA 2GCGA 4KMSA 4BNUA 2JD0A 1C0IA 1KEVA 3SLKA 2XF8A 2I6TA 2X5OA 4BS9A 4ND4A 4UUNA 4H16A 3FD8A 2CDCA 3SVTA 1R0SA 4UUMA 4JNKA 1QKIA 4YAGA 1X7GA 1DOHA 3V1TC 1M6WA 4GL4A 5FYDA 3I9NA 4Y8VA 2YV1A 1ZXBA 4QSMA 5JAQA 3JQCA 1DBVO 2W2KB 4W82A 4WE3A 2AG5A 4U0JA 4D3DA 1P1IA 1C1DA 3S1LA 1B8VA 4DA9A 5TF4A 2WD8A 5A5FA 3PQDA 2ZB8A 1ZBQA 1GEEA 1JVSA 3HFGA 3VTFA 3DAGA 1HWYA 4J2HA 4II3A 1UP4A 1JKJA 4P4LA 1P1HA 2EHDA 3INTA 5TT1A 5THKA 4CLDA 1PGNA 2DAPA 2BKAA 1VKNA 2DFDA 1PS0A 4IGFA 4Z0TA 3VH4A 1V35A 4ZD6A 4FGSA 3EC7A 3F47A 3H65A 2Y93A 2J8ZA 3IQDB 1P1JA 3CPSA 2J3IA 3GGPA 5FF9A 5JY6A 3N58A 2HMWA 2GASA 1GYQA 2VNAA 4GH5A 3I83A 3HB4X 3ZV5A 1DIRA 4TRRA 4OMUA 4GBJA 2GZ3A 9LDBA 2JAPA 2VWGA 2PY6A 4BNJA 4FD3A 5HA5A 5CG1A 1W4ZA 1A4IA 5TSDA 1EUZA 1HF3A 2Y1CA 1IHYA 2Y1OA 2EKQA 4BKOA 4Q3EA 2HU2A 5LC1A 1BXKA 2A35A 2OMEA 1GCOA 3ICCA 4ESOA 4MVJA 3PPIA 1LLUA 4B4UA 3L4BA 2IODA 2PK3A 3CMMA 4HY3A 4CMJA 4NFSA 1EQ2A 4ZQBA 4RPGA 2WDZA 3GMSA 1QMGA 1YVEI 4WOJA 4XYGA 1E7QA 4CL8A 3KLPX 3MZ0A 4AICA 3G79A 3PP8A 1E7MA 2WYWA 2X9NA 3CZRA 3QY9A 3DONA 4IDBA 2I5PO 3RBZA 3F1KA 1LDNA 1XYGA 4ILKA 3EZYA 3ZWOA 4I5FA 3HUDA 3KVOA 4J4TA 2CF5A 3ZWCA 3B1JA 1DC6A 1YJ8A 1KY4A 3U3XA 1M76A 1BRMA 3LLSA 3L07A 3M2TA 1BDMA 5DP2A 1B2LA 3GAZA 1EEHA 1PJ3A 4P38A 3DMYA 5LDHA 4FS3A 4WLNA 3TQHA 1MUUA 3ZHYA 2EF1A 4EW6A 3ENKA 4W7HA 4G2NA 4RQTA 1E0DA 1EK5A 4BNXA 1U9JA 3RJ9A 5L95A 1R66A 2RBEA 4MIYA 1LRJA 4R9SA 3VPHA 1JAXA 4IJKA 4PG6A 1PSDA 3DTYA 2FP4A 2IZZA 4R9RA 1U4SA 1YWGO 2GN6A 1Q1NA 4YCAA 3O9ZA 3K2BA 1K89A 4YT8A 2YUTA 4OHUA 1P77A 5TQVA 3VAZA 3S2FA 2V6MA 1WP4A 4LRSB 4FJ2A 1UH5A 4PLHA 4PZCA 4WCFB 3VDRA 4PN3A 2HRBA 2GR9A 5IJZA 2QZ9A 3UCFA 4CMEC 4AJNA 2HUNA 1P0CA 1YKFA 4N7RA 3X2FA 3NT2A 3S2IA 1ML3A 4NK4A 2YDXA 2O4CA 5CDSA 3VDQA 4TRMA 1Z82A 3ROQA 1ZJYA 2BFPA 3PTZA 4IDAA 5FFFA 7ADHA 1YO6A 4XX0A 4BGUA 3GNSA 1D1TA 4K6CA 1R15A 3TZKA 4R3NA 4O59O 1TA4A 1ZK3A 1VL6A 2X6TA 3AU8A 5TRTA 4NBUA 1LDYA 4DBZA 3AUUA 2FZWA 2NQTA 4MKRA 2EWMA 3G49A 4PLGA 4S3MA 4MVJI 2HSDA 3ETEA 4RL6A 3ZW8A 3OP4A 4DPLA 4DRYA 1ENPA 2UVDA 4FFOA 1C14A 4LSMA 1D4FA 4CM1A 5JLAA 4L4RA 4TQGA 2XAAA 2Y68A 2I65A 4CV3A 2YFHA 1H6AA 1R6DA 1Y8RB 5A3JA 3OECA 5K6AC 3DB2A 1DIAA 4NU6A 1Y9AA 1DSSG 1WW8A 4ID9A 1K6IA 2J3KA 2H63A 1IZ0A 4OXKA 4BO4A 1HZJA 1EBFA 2IXBA 1GR0A 1F14A 2BELA 3EW7A 1AHHA 3A4VA 2XPCA 4HFNA 4QEDA 5KWEA 3GOHA 3N7UA 3PK0A 2ZJ1A 3H5RA 4NFYA 3TWOA 1KVTA 1M67A 4DC0A 4IQGA 2OP0A 3MOGA 3R3SA 1E5QA 2HLPA 2WD7A 3EK2A 1DC3A 3I4FA 4QT0A 5DOZA 1NFQA 4WLOA 3ZWMA 5A9SB 5JDIA 5TC4A 1YB5A 3KRTA 5JO9A 3LDHA 1W6UA 3KLMX 3AI3A 1ISGA 2VWQA 4FFLA 1P3DA 1JN0A 4E31A 1CF2O 1LU9A 3GVPA 3OMLA 4PG8A 4YRDA 3FWZA 4N18A 1B0AA 1W73A 2X86A 4UEKA 5TS3A 3C1AA 2VNSA 4KWIA 1N1GA 1YOVB 3DL2A 4OJNA 5DN9A 1GY8A 3KZVA 3OIFA 4IQ8A 1K2WA 5HM8A 1PQPA 4ZQGA 4TZTA 1PL6A 3WGHA 1GUYA 2P68A 3IC5A 2BFMA 1EE9A 1P74A 4AJEA 3VPGA 1GZ6A 4GVLA 1ZKMA 2JD1A 2OFPA 4J43A 1TT5B 2O3QA 1E1KA 3R3JA 3BTVA 3INGA 4BO0A 1GUFA 1U5AA 3F4LA 1PS8A 4INAA 1XELA 3K31A 3NDRA 4EBFA 1NPYA 3ROKA 1LRLA 4QFCA 1E5LA 5F5LA 1YDWA 1E3JA 4AG3A 3WTCA 4IXWA 2ZKLA 4K26A 5EJ2A 5LCXA 1BSVA 2OGUA 5KNLA 1Y5MA 4MVJD 2C2XA 1MLDA 1D3AA 1XIVA 4NBVA 1QP8A 2E82A 3RC9A 1MP0A 1LC3A 1LTHR 2V7PA 3CSDA 4KTTE 1D1SA 1HE3A 1NVGA 3QE3A 3ICPA 3E9MA 2JFHA 3HB5X 4N5NA 5C7IO 2X58A 3RSHA 4IS2A 5T57A 3NUGA 5JMWA 5DOVA 4JGBA 4DBVO 4E2ZA 1Y81A 4WECA 1HEUA 2C5EA 2YHIA 3WIDA 5BSGA 4S1VA 4YJDA 4B7XA 3ZWNA 2O50A 2J3HA 2NV6A 3KYCA 3OBBA 3PJDA 4MP3A 4PVCA 4X54A 1KERA 1DC5A 5I7EA 1NXQA 1KVQA 1FJHA 4L73A 1DIHA 4RLSA 5JE8A 3DTTA 2EG9A 3WBFA 3GR6A 4B8WA 3KO8A 2PH3A 4Q3AA 4YJGB 4MP8A 3G3EA 5T5QA 3OA0A 4CLOB 5IN4A 4EUFA 1DFHA 4CM3A 1LEHA 4RF3A 4WCDA 4JQCA 1DHTA 3CIFA 4J9UE 1E77A 2ZB4A 4LRTB 5EESA 2C0CA 3WJAA 4XR9A 1C0LA 2O3UA 4RGBA 2NLOA 4BKPA 4EJ0A 2RAFA 1NWCA 2EW8A 3JQ8A 4BO9A 3OJLA 1QRRA 4OQYA 1SB8A 2WYVA 4G5HA 3DBRA 1LJ8A 3TL2A 3D7LA 4PG4A 2LDXA 4MVJG 3RUAA 5TIIA 2Y0DA 3AY6A 3K8ZA 3AI2A 3CH6A 5JCJA 2AQIA 3HDYA 5I7FA 1I32A 5F21A 3O8QA 3IP1A 1Z73A 2HJRA 1JKFA 4Z0HO 4B79A 3GPIA 2X1HA 3AJRA 1Z45A 3PHHA 2Y1GA 4NU5A 4FBGA 4GAEA 2YW9A 1BW9B 3OEYA 2C7VA 1WMAA 4ONEA 1KEWA 4U0KA 1LBEA 1IYZA 3H9GA 1H94A 2X9GA 3B1KA 3WBBA 2BLLA 3A9WA 1OFGA 3DBHB 3WGQA 2RHCA 3LF2A 2RH8A 1F12A 3WS7A 2O3JA 1RM5A 1MC4A 4EI2A 4YRBA 3MJEA 4E2XA 4NFHA 4YJHB 4IDDA 1Q0QA 5CFZA 3FRJA 3OJOA 5DBFA 2EXXA 1U2DA 4IJUA 4FW8A 1VSUA 3F1LA 3SXPA 4QX6A 1NFRA 5I9NA 1R4NB 4FFMA 4GMFA 3QVOA 1X1TA 3R1IA 4J91A 1LRKA 1WDKA 2JJYA 3K2EA 1HRDA 4DIBA 2BH9A 3BHJA 4M54A 4NBRA 4CQLB 1NR7A 3TRIA 4W7IA 3C24A 1MFPA 2Q1WA 1WXDA 3FTPA 3V2UA 3DWFA 2DBQA 5CEFA 3UFXA 3WMXA 2Q1SA 3W6UA 2EGGA 3OETA 1LSUA 3WGZA 4CMEA 4CM9A 2AEFA 2E37A 3JQAA 4WCFC 4RJTA 1NQAO 4N54A 2J6IA 1R16A 1DRWA 1TI7A 3ADOA 3GMDA 3CKYA 4J7XA 2VT3A 1UDBA 4O1MA 5IF3A 3GLQA 3UN1A 2GN9A 3DXFA 4RDIA 4DLLA 3HZZA 4RORA 4FOSA 4RPLA 4CUJA 1N8KA 1F17A 4LMPA 5JYDA 2G76A 4IMPA 3PHJA 2YZ7A 4AVYA 2P9EA 2H5LA 3A1NA 1OC2A 1UP7A 4GSKA 4YA6A 3MJSA 2V6FA 2IXAA 2VYNA 3TSCA 3P19A 3Q0EA 3IIEA 5IAAA 2Q46A 4QTZA 1LXCA 1X13A 3K73O 4NJMA 4LK3A 5DDIP 4FGWA 2B5VA 4I08A 1RKXA 4XYMA 5EQDA 4BB6A 4J4HA 4HKTA 4EDFA 1KC1A 3FN4A 3PQEA 5CG2A 3M1LA 3MJ4A 2X0IA 5ER9A 4BMNA 3NV9A 1VL8A 4PRLA 1U2GA 4YPOA 4FC6A 2PFGA 3I9JA 4K28A 3GNQA 1I36A 5K6AA 3JQ7B 2X0RA 4NBTA 1R4MA 4HWKA 3ZU4A 1M75A 1E3WB 4XGNA 1UUFA 1E7WA 1IULA 2CDAA 3DBLA 3CTMA 4NHEA 2CY0A 1ONOA 5DULA 3C1OA 4XJSA 3GN1A 2XOXA 5U9CA 3K30A 3NJ8A 5H82A 1WZEA 3UHAA 4HUJA 1HDOA 4L9RA 1ZMOA 4HNGA 4YXFA 4PZDA 3ORFA 4YBZA 2ET6A 3TOZA 2B36A 3VTZA 3ZWXA 4ZHSA 1QV7A 4GWKA 3TF5A 5DBIA 2JCYA 3UXYA 2Q99A 1PWZA 3E9QA 3I1JA 2B4QA 3T4EA 3GDGA 2P5YA 5KOIA 1I3KA 4B7CA 3C1TA 3JYLA 5FI5A 1VJTA 4JK3A 4LGVA 4PLTA 4DLBA 4II2A 4GGOA 2ZB3A 3DQPA 1VKOA 1HDCA 1J5PA 2WJPA 3COSA 4UEJA 1DB3A 4XR4A 2EIHA 3EZLA 5A04A 3CUKA 5CHEA 1AXEA 4Q3CA 1U3VA 4CV1A 2GD1O 4GWGA 3GDFA 5L9AA 2NNLD 1SAYA 2LDBA 5DZSA 3ROMA 2JL1A 4BV9A 2GERA 4TVBA 3RBVA 3HN7A 4I5GA 2Y0CA 1DLIA 5A9TA 4RPHA 4BNYA 5G4KB 5T8KC 3GFGA 1YONA 2HRZA 5ICMA 1CETA 4HADA 4KQXA 5AXBA 3E8XA 2VN8A 3H6KA 1N9GA 3QWBA 2Q45A 1SC6A 1QORA 2I9PA 1B14A 3KYDA 2Y05A 1ADFA 4GX2A 4CUZA 5BR7A 1ORRA 4A26A 3I52A 3WDSA 5K0ZA 1PX0A 3E82A 2X5JO 3ADPA 3PHGA 4BQPA 1X7HA 3L77A 2Y66A 1FDUA 1XQ1A 3AUTA 4G81A 2ZCUA 3B20A 3WNQA 2NQ8A 3OIGA 1E6WA 4UEOA 5JCJD 4QO8A 3ABIA 1EDZA 2DBVO 3ITDA 4XQCA 4YTEA 4L76A 4D3FA 2AG8A 5L7WA 3JD3A 4CLXA 3WSVA 4E33A 1SBYA 1VJ1A 2EP5A 3DHYA 3H9EO 3EYWA 4E4YA 4NBWA 3RCBA 4RZHA 2F1KA 1X0VA 1Q0LA 2JHFA 5A3VA 1KS9A 3DZHA 2PTGA 4Q3NA 1EVIA 4PRKA 1A9YA 4HBGA 3N74A 2W2KA 3TZQA 1U28A 2DUUA 1Y8QA 3H2SA 1ISIA 3GHHA 4JLWA 4MVJM 5EERA 1KBZA 2CZCA 1ZUD1 1EQUA 1HETA 2C5AA 3F6YA 1I2ZA 5IDWA 3W4IA 5JAIA 1Y5RA 1TXGA 1IY8A 3DAPA 1ULUA 1TT7A 1RPNA 3ASUA 2Q1TA 4QQRA 4R69A 4UREA 4BMVA 4DQXA 4U6SA 3WGGA 1YQXA 4XIYA 3ZWYA 1AXGA 1U3UA 2PZJA 4DUPA 4J90A 5JY1A 4AJJA 3K5PA 1HZZA 3L6DA 4M55A 3BIOA 2BF7A 3ETDA 1N1EA 4MKXA 2XXJA 3WX0A 3MCVA 5KIAA 2B5WA 3I5MA 3PDJA 4CLHA 5F1KA 2CVZA 4H3VA 2EJWA 4BNFA 3ONEA 4KUGA 4OKNA 5B37A 3JQAD 4CM9D 2OOSA 4U8GA 3ZI0A 3H5AA 3LLVA 1N7GA 1XCBA 4C7KA 1V9LA 4E5MA 3OQBA 3PLRA 1N5DA 2Q2VA 2I67A 3PZBA 5FWNA 4YR9A 1NHWA 3QVWA 5KJCA 2DPHA 3DC2A 5KTKA 3BMCB 2BGMA 1T1RA 4ZU3A 3PRJA 3AY7A 4JJIA 2GNAA 3HFSA 1A5ZA 3C7DB 2Q1UA 4PLFA 2VYND 4MKZA 1B8PA 1NPTO 3AFNA 3WYBA 1LUAA 5HS6A 4NNJA 4CM5A 3BMNB 4HFJA 4DYVA 3GVXA 4OGWA 3KM0A 3GPDG 4W6ZA 3AK4A 2NTJA 4XB1A 2BGLA 1ZNQO 3LF1A 2O3RA 3GHYA 2AE2A 2JFGA 5EL0A 1H6DA 1UXGA 3AUSA 4YRAA 2JAHA 1MG0A 2PR2A 3DO5A 1ONNA 8ADHA 1DFIA 3FBTA 6LDHA 5GY7A 2QIOA 3UAGA 5JS6A 3HE3A 1M2WA 2GZ2A 3NDIA 4JN6B 3ZN2A 4XD2A 2C07A 4WNCA 3FNGA 4A27A 5B4UA 1GD1O 1I2CA 1N7HA 4I5EA 4NQZA 1VM6A 4CPDA 3RFTA 2QYSA 3PI7A 5TGDA 1K0UA 5L53A 1B3BA 3MEQA 3G1UA 4U6QA 3BTSA 5BSEA 5G0SA 3Q9UA 1C3VA 4JCOA 2JHGA 3DOJA 1XU9A 1YL7A 4ROSA 4CQMB 1NQTA 3G17A 4N5MA 4LCJA 1CIVA 4CL3A 3H3JA 4A5OA 2CUKA 2YQ5A 4AJ4A 1NQOA 5DCWA 4XA8A 4XDZA 1SOWA 5JDCC 1HYHA 1JWAB 2CF6A 3VVCA 3RWBA 3IP3A 3F5SA 1LQUA 2B83A 1DHRA 1W0CA 3TDKA 1FF9A 3OH8A 4R51A 1WMBA 3QWFA 3TJRA 4FOOA 4IPTA 1M6HA 1ID1A 1FDSA 1XQ6A 3ROPA 1ZO8A 3F4BA 3R0IA 3NJ4A 1E1MA 1I30A 2G17A 4L8VA 3U5TA 3ETGA 3SBOA 3WR5A 4PLZA 5AXCA 2W98A 5IDQA 1HSZA 1E1NA 4ZVVA 1O6ZA 4K6FA 1A9ZA 2PH5A 4M89A 1EUDA 3UCXA 3HHPA 4FJ1A 3ANMA 5H81A 3SEFA 3FTNA 1LDBA 3JQFC 3JQGB 4C7JA 1O95A 1Z7BA 1BXGB 1Z6ZA 3VZRA 3PLNA 4P4GA 1I0ZA 5JYEA 2HMUA 1XU7A 3EMKA 1QXSA 4WJZA 3BA1A 3IL2A 1BVRA 3ON5A 1PU2A 4PCVA 4E13A 4Y6PA 2J5QA 3UW3A 1NBOA 3QWIA 4IIUA 3ZNOA 3DBVO 2WE8A 2VWPA 4URFA 1WWKA 5KJFA 3DZKA 5G0TA 2ILTA 8LDHA 1BWSA 5FEUA 2CDBA 3IKVA 2VTDA 2ZK7A 4CMKA 1ADBA 1P1FA 1ADGA 5C3MA 3NT4A 1H9AA 4BGIA 3EVNA 2Z1NA 1W8DA 2O3SA 4ZRNA 1OC4A 4MIEA 4E3ZA 1DLJA 3RFVA 4BKQA 5A9SA 3KEQA 5CDGA 1NR1A 4A10A 3WGIA 1IL0A 2AQ8A 3E03A 5IZCC 4PLWA 4A03A 5F1OA 4YQYA 2EP7A 4XRRA 3PWZA 4AL4A 4NI5A 3NGLA 2R2GA 5DT9A 2W8ZA 4ALNA 5F1PA 5KVQA 2FPGA 5GMOA 1WLYA 3JD4A 4R1TA 4BNMA 1HLPA 1ZW1A 1PTJA 4B7UA 4I9HA 1Q7GA 1YOVA 2WEKA 1I8TA 3KYBA 3MTJA 1E3SA 3QP9A 4E6PA 3JD2A 3FCOA 5DCUA 5T8KA 2SCUA 1UZNA 2AQHA 4IUYA 2RCYA 4D0SA 1LLCA 1B16A 3FNFA 5G0WA 1PWXA 3DMTC 5LDGA 2GN4A 2X7HA 1I33A 2AEJA 1GAEO 1QG6A 4KQWA 4RO0A 3P2OA 4WK6A 3RUHA 3QVTA 1MXHA 2H1SA 4K1LA 1GUZA 4B3JA 4RDHA 4TKLA 5I9MA 5AYVA 4CMCA 3U9LA 2AQKA 4E0BA 4P4NA 3I9LA 5JPIA 4D0RA 3TN7A 3LC1O 4JX8A 2QQ5A 1M66A 2IE0A 3IOYA 3KV3O 1YJQA 1GV1A 2A94A 2WE7A 3KTDA 2IRWA 4OM8A 3RUCA 5DP1A 3WSWA 4DTIA 5C5IA 4BUCA 2C7GA 3EDMA 5L40A 3DOOA 3FBGA 1V3VA 4J6FA 3QRWA 4ZICA 4YACA 2B69A 3LYLA 1OZAA 1WVGA 4GVXA 3GAFA 3UOGA 3W4JA 4CM8B 4WLEA 1DRUA 2D5CA 3GG9A 3UKOA 4CM7A 5DCYA 3WIEA 3GVCA 4KUEA 1NVMB 3GY0A 3INRA 1IB6A 1TVEA
chains in the Genus database with same CATH superfamily
1E69A 1U8UA 1W4RA 2PZFA 4AMVA 4EABA 1V3QE 3FGZA 4N0EA 1V71A 1OU4A 2JNWA 2GO1A 2NZVG 3H5WA 3M4JA 2Q41A 5DI3B 5BVGB 3F97A 4KK4A 3E9EA 3FDZB 5IBPA 3W9SA 5JMTA 1VFNA 3JAWB 4LVCA 2C5BA 1T4BA 4HD8A 3WGMA 2C20A 2HT6A 2C1EA 2RHGB 3H18A 4A6DA 1VMIA 5DHSA 1TYAE 1Z5VA 2PPLA 4YWHA 4F4DA 3JQDA 1QOZA 1H6CA 1K8ZB 1ZOPA 4L5AA 1FW6A 1D2HA 5TVGA 2YYAA 5LB4A 1OTHA 2PWZA 4PC2A 5HR5A 4UBIA 5E3HA 3UJNA 1O6GA 4LF5B 1G3MA 2YRWA 4XWAA 2IYFA 1L4BA 5EMNA 5J59A 1Z2DA 4NZPA 2XRMA 4WEQA 1HGXA 3SEZA 5AVUA 1L1FA 4F86A 3EOBI 5HFNA 3ORHA 1KZ4A 1Y33E 2Z2ZA 5B7NA 5KYVA 3IPCA 1GA1A 1PKXA 1JJ7A 1OQAA 4Y98A 5I8PA 1BKSB 1G3IA 3H1TA 3JCZA 4XKJA 2R1TB 4NKRA 1KAOA 1X38A 1QB8A 3BGIA 4P7BA 4RGQA 4YROA 5DW3A 3CRRA 3U48A 3C4QA 4EKDA 5ADHA 4WKOA 4ER0A 2HGZA 4ZIRA 1OJ7A 2CV0A 5AFSA 1L7RA 1P2SA 3ZVKA 5CT4A 1FFYA 3Q9NA 1Z5GA 3HP1A 4ALKA 2ALJA 3SU8A 1WUJS 2P5UA 2PV7A 4FI3F 3KQLA 4PIVA 2H06A 1RXEA 3GXOA 4LKOA 3FWNA 2RK4A 4JBXA 1MV5A 5ILOA 4IHKA 1BW9A 3DMPA 3AX6A 3H1AA 4YDHB 1I13A 4UHCA 2WILA 3ANXA 2PX8A 4C87A 3OIDA 1GAQA 1LSSA 1PK8A 2DHEA 3AP3A 3TYXA 1N33B 1P45A 3SVZA 2IWRA 1R8SA 1UC9A 3SCZA 1XN1A 3ESCA 1ZVVA 3RFCA 1T5LA 1KVRA 2GD6A 3B3GA 1XEXA 3DB1A 4JT4A 4JYBA 4DG9A 2ID8A 2MR5A 3EZNA 1ZICA 1ESMA 4Y2XA 5E8RA 4F2WA 5ERYA 5C53B 2BTOA 4EITA 1P9LA 3LHDA 1U1EA 2C04A 4I14A 2VPPA 5DGHA 3RIXA 2IYTA 3TOSA 3USCS 2UYHA 2XA1A 1WE2A 3PUJA 1J7KA 4GRAA 3D3KA 1PUXA 5IBRA 4AYTA 2QVBA 5FA8A 2TMDA 1MX1A 2VQSA 3KJEA 4CLRB 1W35A 4QDUA 3WGLA 3AINA 4QJIA 4ZYTA 1FW8A 3QNWA 4IJMA 3MT0A 3H2ZA 4A0FA 3DF9A 1H0KA 3FB4A 5ALNA 4ZT6A 3ZU5A 4ENUA 4JXXA 4FVTA 1ORVA 1TUGA 3AEZA 5EGSA 4MDEA 3DZJA 4OH7A 3Q7EA 4BP9A 4GIBA 5JS2A 2RDMA 5ALUA 3N0RA 1RMYA 5ITVA 1NUHA 3SQXA 4I36A 1A2BA 4ZV9A 2O2YA 5CLJA 1F6BA 1C1XB 2A5FA 2BI4A 2X23A 4L5CA 3WDMA 3KQUA 3WLMA 3ASVA 2B37A 1WZUA 1HDIA 4DNFA 2Q2WA 4I9UA 1TKCA 1GKYA 1SULA 1DQPA 3HWRA 1ECBA 4PLYA 4KG7A 1XZJA 2OORA 3U2QA 4EHAA 4RABA 1K5HA 4G84A 2SKEA 4Q4AB 3NIBA 4AJ2A 2QLTA 1CEQA 3KT0A 2DPGA 2X2PA 2ZQYA 4UC0A 4W63A 3BWXA 3FDIA 4FPXA 1J4AA 2YUIA 3IOEA 3KDPA 3EMBA 5CNKA 1SH7A 4OATA 1VSVA 1YS4A 2WHXA 3JATB 1VLJA 4DARA 1GTVA 4HDKB 2NUPB 1DIBA 1KZHA 4MUHA 4HWGA 2P62A 4BB0A 3W5BA 4HX5A 3AM4A 3TLAA 2NVWA 1NZDA 3D02A 3H5TA 4LA4A 3BH0A 3BULA 2BCGY 3X1ZA 1K6EA 1VLLA 5DGDA 3LY8A 3ZDEA 5IKOA 4PQYA 1WW2A 1LDEA 1JQKA 1ZVMA 3DZDA 4JBIA 4LQDA 4X91A 5JZMA 3A2KA 2IHKA 1S7GA 2GPTA 2DH5A 2R79A 3JWGA 5FO0A 1Q11A 2IY9A 3RASA 1DKOA 3UV7A 2BHRA 2VTEA 1JPNA 3SR3A 2DXIA 4J2OA 1B3RA 1U8FO 3ZGYA 3IURA 2ZR8A 1YFKA 1W5BA 5K9ZA 1GITA 3EAQA 2XTMA 3KJGA 4DCMA 3L6BA 6REQB 1ZI9A 4F93B 4EJMA 1T3HA 4XYEA 1BFUA 1DIOB 3OPYI 3H5NA 2HUPA 2O0HA 2CFCA 4QDJA 3WOHA 2GJ4A 1ANKA 4BMOB 3T4XA 3UGJA 3UBMA 4D4LA 4EUNA 2HIHA 3A6LA 2NSDA 3CCFA 3CB4A 2ZSDA 2NYAA 2ADFA 3A2NA 2VHXA 3T6KA 1A69A 3WK4A 3M89A 4QXAA 1XP8A 1K7FB 4QOFA 4TYQA 1SHTX 1EHYA 1LCIA 4PG7A 4QDXA 5HJ7A 2C7RA 5WRFA 4GX1A 1JSRA 2ATVA 4Z7QB 5HEKA 3AR3A 4RWZA 3BUSA 4GYYA 1G5QA 1PTKA 2F1JA 1FDIA 1KFJB 1L7DA 1DZ3A 1MIHA 2NVUB 7REQB 3F46A 2BP7B 3QYJA 5ILQA 4EYQA 1Y6FA 1XK7A 4EBFA 3ZY6A 1TMKA 5DLYA 5AIAA 2DGDA 3WK8A 2PGNA 1ZK1A 1Q6ZA 2FMHA 2PQMA 3R2JA 1S01A 4IIVA 4RNDB 3RS3A 4HPJB 3VSEA 2HMTA 5D87A 1RHRA 2ZYDA 2AA3A 1KYZA 2BEVA 3G2IA 5IZCA 3HHEA 5LZ2A 2JIDA 2ZBFA 3DLAA 5DRTA 3IAXA 1UQTA 4YXWA 3AILA 4ALLA 1UC4B 4ZEVA 5JS8A 2AOUA 3QG5A 3TLBA 3UK2A 3DFKA 3GMIA 3JQEA 3KD2A 4MWZA 1GGEA 3PG5A 3IV7A 4X1YB 1TD9A 3H3FA 3OEEA 5AOBA 2FQXA 1JVNA 3W34A 2X41A 3PFKA 3NYIA 1QTNA 1KDTA 5JBQA 3ILSA 3PQ5A 1V39A 4CMHA 4Y6RA 1F8GA 2HHJA 1O6CA 1V0JA 1ZJZA 2YV3A 4KRFA 1WCWA 4PX2A 1SVIA 3TCKA 3F67A 5JD3A 5AI4A 5ECYA 1LI4A 4HQKA 3NDJA 4YJFB 3TPCA 1W5EA 2DJ5A 1H6BA 1OWLA 2HPAA 4PO8A 1ORWA 1QCDA 1SEVA 1FS6A 1XQ9A 2XCOA 4ROTA 4ZA2A 1E9DA 4WD3A 4A8TA 3C8MA 3ZJYA 3NHSA 5AKGA 3N59A 3OTQA 3PNSA 6Q21A 2FLKA 5H5JA 2VRBA 3F96A 2B1GA 2FWNA 5J2UA 4X20B 3WA7A 2XWSA 3ZD6A 4HGNA 4E5YA 1T4GA 5EJMA 4F6CA 3CGGA 1VTKA 2AW5A 1JTFA 5HRUA 4W9NC 3IMEA 1OUMA 2RGEA 1PR5A 3K0SA 3UGTA 3U3KA 4G1MB 1PSWA 2AXPA 2PLWA 4R1PA 5ALMA 4NMHA 1B6TA 3T7EA 1V11A 2OBFA 2YV5A 3LNCA 2ZSBA 4P54A 4GNKA 3WLEA 4BGVA 3K71B 5I4CA 4TMFA 4LOAA 4NATA 1H65A 1L5RA 1JP7A 4MAMA 2HPZA 3O4JA 5T64A 4A6PA 2L18A 1EVYA 5CEEA 2OM2A 3AF0A 3LL7A 1OTXA 4OX9Y 3BHMA 3EAGA 1VIMA 3H9BA 3CV3A 1WABA 3W8RA 4HTAA 4V0RA 3BM5A 4M9XA 1P5JA 1JG4A 2D59A 2O23A 2XVMA 5BYJA 1QLJA 5JZVA 1IJBA 4KTVE 5JVDB 5THQA 2IUFA 3TLGA 3OQMA 1VGVA 3IDZA 4FZRA 5A5EA 3F6CA 3QXCA 1C30A 1VL1A 2IDJA 3HJAA 4FKZA 2CZQA 1B6RA 5FR1A 2Y1XA 3DUFB 3M0EA 1V47A 1BZYA 4MGKR 3G85A 1NLMA 3VC7A 3RRYA 1QGOA 1X92A 3P32A 4YI5A 5EYPA 2HCFA 3GJ5A 1XXLA 3IHTA 4K9KA 4LXIA 3WIUA 3B1VA 3SP1A 1WKVA 2CBGA 3GGJA 3P45A 5HNKA 3VKHA 3DEYX 3EC2A 2BAGA 4L8LA 3T9AA 3NZEA 4YNBA 4AX4A 1E1QA 2QLFA 2IOYA 2I4NA 3LW8A 4XVUA 3EFEA 3SIXA 1PJLA 1GTRA 5DTJA 3D4BA 1UJMA 2YJTD 2V7BA 2V65A 2Y1WA 3AY3A 3WHPA 3OX2A 2BGRA 2XWJI 3ABQB 2EV9A 1K7YA 3SHTA 5G4LA 2C5SA 5CDTA 5ITZB 5I7HA 2X3UA 1HYEA 1RM3A 5HDQA 1QV6A 2AK2A 2IU0A 5C7OO 1Z6AA 3K15A 1A7KA 1C4XA 1S8OA 5BPHA 3IV9A 5BRAA 4UDXX 1R5BA 3AHJA 5C3UA 4Y2HA 4TLLB 1GSHA 5FLKA 2IE8A 1IN6A 3TLJA 4JQSA 4C6SA 2QTAA 1V8DA 4D26A 4A6EA 1AK9A 1C9JA 4PNZA 3UTCA 1ONPA 3EMVA 4JSRA 2OECA 4PPNA 1DKRA 1H2BA 1OREA 8MHTA 1MN6A 2Y0EA 3C6ZA 4L5YA 3ZQ6A 2RG7A 1I10A 3GDWA 4EG8A 2QX4A 1EB9A 2EP8A 2WU3A 1QK4A 3Q9LA 3ZZNA 1VHWA 1KEEA 4X85A 1TB4A 1KJIA 5ALRA 3ZHTA 4E32A 4P5DA 4XAQA 3WVNA 4MDFA 1PJ4A 4M0DA 3OSUA 2AV6A 4C4ZA 2ZJ0A 3R23A 3WWZA 1WCXA 3THYB 2H4XA 4FFBB 1S02A 1FUEA 3RSLA 5HRAA 5AUOB 1F7VA 5JJIA 2FAXA 1T2EA 4KPUB 4ER5A 4OQMA 5H1YA 1DFGA 3GCWA 2GSWA 4KR3A 4ENWA 2QTVA 1QHEA 4MARA 3DGEC 3MBKA 5FOSA 5K8UA 2WHPA 4F3TA 4F5EA 2JBHA 3HCNA 3IVXA 4Y9SA 2ORVA 3R76A 1YZNA 5CPFA 2JI4A 2CJFA 4XUGB 4NYIQ 5H4HA 1O94D 3VISA 3H7AA 3GQBB 1U3TA 1QQ5A 1USGA 3LXRA 1BHQ1 3TNJA 4B6OA 5FTJA 3WP0A 4ZVMA 1SURA 2R6HA 4BLUA 2E5LB 2UUAB 3D7KA 3W5JA 4WX2B 4M3NA 1A88A 3GGGA 1KK2A 3SSMA 4XWGA 5K0GA 5JMOA 4FR5A 4AKTA 3OQ6A 4EG1A 2I7CA 3AONB 3L0PA 3IMFA 2VA9A 1KH3A 1MX3A 1R0KA 4EF4A 5K3EA 4BPBA 1XMIA 4HOYA 2BE9A 4WXEA 3EVGA 3DOEA 2PUBA 4G0OA 1V96A 2LIVA 3K09C 4QYIA 3SX4A 5KTRA 2WJVA 3NEAA 2HWXA 4OSEA 1TVKB 3NYRA 3MMXA 3B2NA 2GZHA 1IG3A 3LQRA 3VZDA 4MEJA 3QE4A 2D2EA 3THOA 1O6FA 3PX7A 2GLXA 3ZR4B 5CFLA 2FZEA 4W8OA 1QAQA 2NXEA 3NKVA 4RDXA 4K81B 2WNHA 4CIBA 4A36A 4BNLA 3IT2A 3B12A 1NLZA 3RC7A 4BFXA 2K4MA 2FEAA 3SYMA 4IIGA 3C15C 4MUIA 1CDZA 3EDRA 3V7YA 1GOTA 3T9FA 2PLAA 4B4OA 2Z2XA 4NCXA 3DT6A 1CQJB 2AX4A 1R6AA 4MWSA 1L1EA 2IHJA 3TZCA 4DADA 1NMSA 3G23A 3ITNA 5ALOA 2DSTA 2HXGA 1F5NA 1GNPA 2HWYA 3AFGA 4INOA 1YJ5A 3NBFA 3BFXA 4MVJP 4TKZA 4ZVKA 1LLFA 4ALIA 4CM4B 2AKEA 4ALJA 1GJRA 2VH5R 5JSFA 4PZ0A 2VBGA 3E5HA 4BFYA 3HBAA 3MGCA 4CIVA 2PV0A 1NC3A 4UM9B 4HDAA 4NARA 3ZJUA 3CX8A 4Z9FA 1G55A 1JQBA 2OV4A 4KIJA 3M8KA 4BNNA 3KEOA 4CDRA 1QCZA 4EY5A 1LI7A 3KOXA 3FNQA 4MV0A 3W9YA 3A06A 4C43A 1YQGA 1BG6A 2ZCVA 1NYRA 1Z26A 3KR1A 3LWNA 3UBTA 1MQSA 4QASA 3V4PB 4HG2A 2A78A 2YYSA 1JXAA 1GO2A 2Z4SA 3MWJA 3R0JA 3VPAA 2HF7A 1I6LA 2VHUA 3KVNA 1OLSB 4OAQA 4XQEA 2XGMA 2JEZA 4XEUA 2I4MA 2E49A 3OFSA 5FEMA 1JE0A 3ADCA 4YAIA 2YYZA 5B2ZA 1II8B 2Q5JA 3IOCA 4E5UA 1GPMA 2V6GA 2J9ZB 3ID6C 3GW8A 2I66A 1FZTA 2PA0A 2X1MA 3KWFA 5KNCH 3B7GA 3GJ6A 3KQKA 1L7VC 1V9CA 1PJAA 3K1JA 2YVAA 2XMGA 3DHWC 1PSZA 3IIMA 4TWRA 1YB1A 2I7TA 3RVPA 4F04A 4BB9A 2FPSA 2R7AA 4GP7A 4NWIA 3L5KA 1SU7A 4YDSA 3VH1A 4PHHA 2YVLA 1JMKC 2Q3CA 5A0FA 4ZEWA 1QYWA 2VR1A 4H27A 4UM7A 1T6XA 1W46A 4EHLA 1JXOA 4OOEA 4O4LF 5AESA 3EVZA 2ZUBA 4E30A 5CLGA 4XCXA 1ISRA 2XGSA 4K9QA 2IIPA 3LAWA 5JNLA 3A31A 4G8DA 2Q7DA 3KKOA 1DPGA 2JRCA 2E87A 1DV2A 3KOWA 4LNHA 3UF0A 4H6XA 4M7OA 1E6EA 3KETA 3OM1A 4BFWA 2XADA 4Q3BA 1IHXA 2R8PA 4HH0A 3QA9A 2QPTA 2WUEA 3KXDA 1WNTA 3P7MA 2W4MA 2IX9A 2KJQA 5AI6A 2J3QA 3RC1A 3Q3CA 4D42A 1E18A 1YZFA 5J5VA 5LWQA 4I4IA 2HJSA 2ONKA 5JZOA 1HE2A 2OQIA 1UXKA 1UDXA 3GBPA 2R8EA 4R2KA 1Z06A 3F6BX 4RPJA 5TB5A 3UIEA 2X13A 4JSTA 3DZIA 4B34A 1NY5A 4D7AA 5LA6A 1ISHA 2XUOA 4H08A 4DWVA 5AVWA 5EZ5A 1L7QA 1UAGA 1OWMA 5HWSA 2HJHA 4N49A 2FSIA 3L05A 3ND9A 1SQGA 1QGED 3U26A 3AWDA 3BSYA 2ZTUA 2XEDA 3BIXA 3O7MA 4GW3A 4J1NA 1YQUA 4KCGA 3ZW9A 1SXJB 3R7SA 3OCYA 4R2HA 1NJFA 3JVVA 4JC4A 3U39A 4ND2A 4N3CA 3D6NB 1B0PA 1MORA 3FTDA 3IRUA 5KJ1A 5GPBA 3F7OA 1JFTA 1F51E 3T1HB 4HH1A 3AIMA 4X65B 4Q18A 1EP2B 1USIA 2BHLA 3RRMA 1NVBA 3LK7A 4TVSA 1E2FA 2P1DA 4MOWA 1OROA 2A4KA 4W9NA 3VU3A 3BWBA 2QT1A 3FOAA 4OVKA 4WVFA 4ZQFA 2YJ3A 1DKLA 2ORYA 3K32A 1L4GA 4WZBA 2FHPA 4QG7A 4BATA 3BD9A 1SUCA 2ZPAA 4GPD1 4WHMA 2ZT8A 3RFFA 2CE7A 4GI1A 4RIHA 4QA9A 3SBDA 4QULA 5FV7A 4DMHA 1K8RA 4L4SA 4W5JA 3O4RA 1THGA 3ROTA 5BSRA 2H52A 4WDQA 2PA3A 4LHYA 1I3OA 4EGCB 1MQ9A 2A3NA 4BZPA 3KT6A 3QLUC 3M9LA 1GPAA 1OX5A 2A9QA 2HO5A 4UBOA 3W5VA 4G1BA 1DAPA 1Y4UA 1ZBDA 2WQ7A 1XEAA 2WNSA 1X9GA 4LS3A 3K9HA 4EG3A 1YZQA 1KZ9A 1Z4LA 4CM8A 4FKMA 1Q7RA 1GPBA 1YDEA 2ZTLA 4NG5A 1XE3A 3TD6A 3L7IA 5IJ0B 1KYYA 5EFOA 1NR5A 4PZUA 4Y2SA 2QBYA 3U62A 5CW2A 3I6MA 3G6WA 4AZVA 3ICWA 1T0IA 5JNVA 3UWKA 1CJCA 2XMSA 4AJIA 2SECE 1OA1A 2EG5A 2OGSA 2XKJE 1Z6PA 2LRHA 3OM9A 4E1VA 4LX0A 3RI3A 1DOZA 4L9AA 1MHTA 2ZWOA 1WDMA 2BFFA 5LVAA 1EE2A 1DS6A 3QXXA 2Q5QA 1SRQA 1BKYA 3KQWA 2QYTA 1S96A 4HAIA 4MPDA 2WC1A 1Z5NA 1QLWA 3GZ4A 3RSSA 2PWBA 4D9MA 4UMEA 5A05A 4UAGA 3JQ6A 3ZWBA 2ZRLA 2ZI5A 1VFPA 2XUPA 5GV8A 4N5IX 4C14A 1NW8A 2CCKA 1WPQA 5TMPA 2C8VA 4LWQA 1Z8FA 1Z3CA 2FP4B 3VZCA 4B6JA 1KMHB 1QUFA 3OLZA 2BD0A 2PBRA 4JA0A 3NBAA 4KUHA 4BWVA 1UDRA 3AEUB 5TMEA 1E2UA 2FZ5A 4D98A 3B38A 4GPIB 1ZMTA 1FK8A 2OOKA 2Q5LA 3I1FA 1C5KA 2QNRA 3ELUA 4FI3C 1CNMA 2AMYA 1NNUA 4PU0A 5LYYA 2ZXUA 1XRMA 2OZPA 4KAAA 5EWJB 4HDSB 3IHWA 3JQBC 2C9BA 1K5PA 2AMVA 4B0PA 5AHKA 4B8ZA 5EHQA 3V2GA 3NC4A 1G2OA 5JJKA 3ZDXB 1OIVA 3GLFE 1ABEA 1SCIA 4GQIA 2YKGA 1USUA 1WDLA 1LBQA 2H65A 4KOAA 1XVIA 4B4VA 4BX9A 3CXUA 3HN6A 1F2VA 3TBHA 5CFRA 2YH2A 2JLCA 3AM5A 3VDXA 3QPDA 2AUTA 1EBUA 3IHLA 5P21A 1SZJG 1Z36A 3DEAA 3PFCA 1K3TA 4JJKA 4TV8F 5A2QA 3QELB 1EJ2A 2F67A 2I33A 5E9WA 5BT9A 1X8KA 2XB8A 1AD2A 2P1ZA 3FOWA 2E6KA 3M9XA 2IEBA 4H15A 4XXHA 4URYR 2UXBB 4KDEA 2OCXA 3DHNA 4BMPB 4ZHQB 4HNTA 4KBYA 4KNYA 5F77A 3PNOA 3GT0A 1PW5A 5JARA 3BN3A 2P6RA 2ZTVA 1QONA 3FWPA 4CT4B 5IJWA 3O8LA 5CFQA 2B4RO 4TXMA 2ZJAA 3HJTA 2PL3A 1PL8A 1QH1A 2Y1EA 4MLCA 3AR4A 3T3PB 4RK4A 3EXFA 4L78A 4RIIA 3M6FA 3OF2A 3TVDA 3MWGA 2GSDA 1RCUA 2DPXA 1OX4B 2C82A 4MMZB 4BO7A 3ZH2A 2PSDA 1C9KA 1KY5A 5FBVB 1HYGA 1YZGA 3AEKB 3K09A 4LTDA 4B3BA 3PUHA 1K7CA 3KBBA 3NTLA 5CD1A 3K7EA 3NATA 1EFCA 1W59A 3EFBA 1CUSA 3ELYA 4WOCA 4WNAA 3SLGA 4EX6A 5AUNB 2W2QA 3PWSA 1YUNA 2XD4A 1WZIA 3A4TA 3A9TA 1DE0A 1LBIA 1OAAA 4R5HA 4Q16A 4RTRA 5CFMA 2K7FA 4R6XA 2FQYA 3W1VA 5ALWA 1M83A 4DUGA 5CCBA 3BXGA 3DH0A 2P4SA 2ZIWB 3W8EA 4CKWA 3IJPA 1LD3A 3QFHA 3UMYA 2DBYA 5A6SA 1ZMXA 3GL9A 4LTNA 2JI7A 4OHYA 1CFJA 1TJ4A 2WD7B 1NUTA 2HJGA 2JKVA 3V4VB 1OI7A 1GGFA 5TPWA 3V1KA 4DREA 2FKNA 3G8AA 1WB6A 5E4TA 3CUVA 3QVSA 4HB4A 4IDHA 4Y2PA 4UTPA 3O3NB 1K63A 2ECFA 3B5JA 1XDZA 5LUBA 2A5DA 3VZSA 9GPBA 5HIMA 3DNFA 3DL7A 1R12A 4JT9A 3T5GA 2CXQA 2COEA 4ZGWA 2X9VA 4BAUA 1KNQA 3KKPA 3Q6NA 2PT5A 4OSOA 1YR1A 2JFPA 3TL3A 3EF1A 1KP3A 4H7FA 4M1WA 3ZDYB 4OK3A 4IUCS 1VLVA 3D43A 3A11A 3E22A 4LE2A 4TV9A 2RB5A 3ZCPA 3AU9A 1DRJA 3Q6MA 3UJCA 3ZLBA 3OCWA 3SOZA 1WHSA 5D5QA 1DI0A 1GFSA 1T10A 3I42A 4Q47A 5CVCA 4F6LA 2HHAA 3ZJVA 5LZ8A 4R8KA 2VRCA 1IM5A 3Q3EA 1GUBA 2B0JA 1U0EA 2J9RA 5B3KA 2JVKA 5LQMA 2NO9A 2JATA 3KQQA 4EPRA 3AG5A 1TO2E 2N75A 2J0VA 4C4RA 2G5GX 2OGTA 5KSYA 1EJ0A 1XZFA 1W19A 4NCKA 1OBVA 2FKAA 4TLBA 4FTWA 5I7OA 3L7YA 1O77A 3SS7X 1C7ZA 2PD3A 2RIRA 2VAVA 3P0EA 5KYWA 2BFDB 2GCPA 1JJAA 4TYNA 1HTBA 3RGWS 1FX0A 3U4HA 5B7QA 4MQMA 1ZGCA 4HNHA 4QD3A 1RKQA 3S2EA 2W4QA 1WSDA 5JSKA 1FPQA 3F71A 3GQVA 4QBFA 3RVNA 4ARIA 4JBHA 1K8XB 4OHOA 1PJQA 5BXYA 1YTUA 4PS0A 3M83A 2I4OA 2JF0A 3DOCA 4IJWA 4AVYA 4ZT4A 1Q19A 4D2IA 5AJTA 3ZQJA 5J1TB 1N5MA 1YZYA 3F3SA 3OO1A 4YMTA 1UWVA 3LNTA 4P4TA 3W4KA 2BL4A 1LC0A 4F45A 3IUBA 1L5WA 1Z6YA 2CJXA 3K72B 4HNSA 4UJ5A 5L7YA 3BWDD 4R71A 1BMDA 1JE1A 1SNYA 5FJIA 4PX3A 2JDID 3WLSA 1NRIA 1OLUA 1Y3FE 2HMAA 5LZ4A 4A8HA 4WKBA 3PJGA 3F9IA 3BIFA 2B25A 1KK3A 1L4FA 1KEPA 1LLQA 3D6MA 1CEYA 3VC2A 1JG2A 1JHMA 1NNI1 1F2UA 1BVYF 3D8TA 1CJTC 3PE4A 4E5NA 2HM7A 3QZUA 4BO3A 3KYCB 3QKRA 2EARA 1O94A 3BRWA 1VRWA 1W85A 4X8MA 1E62A 3EQ6A 3M5WA 4JJ6A 1P19A 5SYAA 1DEOA 1GQSA 2IHZA 1YBMA 2DY1A 4JT2A 5ICSA 2WU0A 1YUMA 2CFTA 1OE0A 3X3HA 5I8ZA 5DTMA 5IH7A 4RPKA 4BNZA 3K6RA 3U3RA 4REQB 4W5OA 1YMUA 5ALXA 4MV7A 4ZOLB 1IQUA 5AM3A 2WSLA 2J1LA 3LX6A 1GTMA 1UJBA 3PZRA 5AI0A 2PUVA 3IBCA 3HP4A 5JRJA 1X7WB 4M9RA 2J45A 2I1VB 4MGIR 1E3WA 4IIJF 1NJ1A 5CXXA 1L5LA 3R3WA 4YRFA 3T0GA 3X0DA 3ZS9A 4DSOA 3C45A 1K97A 3FAKA 5KKAA 4E51A 4A2WA 2Y92A 3CT4A 5L6MB 4GGPA 2BH2A 3GRCA 2X1LA 3ST7A 4C29A 3NHZA 3P94A 4U3JA 4KXMA 4ZCPA 4EHHA 1XG5A 4G5OA 4IDCA 3FE2A 4BNTA 4GO1A 3IP7A 3FUTA 1QTQA 3BD7A 4YLEA 1RQ7A 1M0EA 4BUJA 4DA6A 2NO1A 4ZEOA 4EPVA 1WXGA 5LUAA 4MUEA 2AZMA 3H5OA 2C99A 3S29A 2H2GA 4B3IA 2ZRAA 2JGEA 1XZKA 3EZXA 3NH9A 3QLUA 2ENWA 3N6XA 5E1MA 5FH9A 1ZJWA 1FU4A 4LBVA 4UQPA 2FRVA 2FB9A 1YQWA 4IH9A 3C3KA 1XPRA 5DTRA 4KYTA 1V7ZA 2BYTA 3PRYA 1G8GA 2O8CB 3FKJA 3H99A 3D1VA 3VR2D 4GWLA 3DZGA 3C6YA 2YZNA 1FIUA 4E5PA 1L3IA 1CV2A 2X6QA 3GLTA 1C9NA 5JXHA 5IVHA 3CKKA 2XR1A 4M9SA 1FNNA 1L7XA 3GVIA 3H17A 2BMAA 2XUQA 1EDOA 2V0CA 1GQFA 5HXAA 2M6SA 4H7PA 1IH8A 4G5GA 2EKLA 3M7IA 4RHXA 5EHZA 3R7WB 4C4TA 3U0BA 3ZE7A 3QM1A 2NPFA 3TQQA 2QUAA 3KZMA 2F55A 4H7JA 4U7PB 4Z8YA 2HFKA 2PZ8A 2HA5A 1QANA 2XB6A 3PL1A 2I7XA 4PG5A 3GEIA 4DLAA 3CR3C 3EG5A 3NX4A 3MWKA 3T5BA 4CIWA 1QZTA 2DUJA 3ICOA 5ERXA 3LPLA 4S2UA 3D8RA 4KQ1A 1GGMA 3HQ4O 5E9QA 1YJAA 1DJMA 2ZIUB 4FCVA 4HP8A 4V0NA 3RHFA 3KU1A 3X2SA 3P9YA 4X5OA 4D4JA 3QKSA 4RJJA 1PLKA 3UWMA 3W77A 5AW1A 3P26A 3DDSA 1P7VA 3N9IA 1DJNA 4BKUA 4B40A 1KI9A 1QIEA 3FNEA 4BVGA 2E4AA 4F46A 2O1SA 2VUIB 2IEYA 4V0OA 3H97A 3GLUA 3U09A 2XDAA 4ARSA 4RA6B 5ES4B 3JQBA 5LPNA 3FIUA 1NOJA 4BXOA 5BOVA 4MUXA 2N9UA 3P4UA 1DWPA 3B1YA 5EJ4A 4YP9A 2CW5A 3O95A 1SIUA 1EP3B 4CMIA 1PEDA 1Y4DE 2I2XB 2PVPA 4L4XA 4N8DA 1RW4A 3INYA 4F5DA 4GEKA 3L9XA 5K3FB 1AQIA 4G01B 3C8ZA 1OI2A 1KAHA 5AKHA 3UJDA 2GGSA 2PM8A 2FA9A 2WUGA 2Y99A 2GN0A 3RHSA 3RTAA 1TECE 2PEYA 4YAKA 1J5XA 1YH3A 1U0LA 3D3WA 3TIGA 5JFTA 5FYQA 2Z2YA 1AIPA 1HLDA 2OG1A 5EXPA 4IFTA 3VHRA 2BEUB 1VCOA 1MU0A 3OLYA 3W2TA 1RWQA 4PLVA 1A1VA 1KI4A 1PFUA 1YACA 3HJNA 4XGQA 4U7JA 5ARCA 2C59A 3SZOA 1QK3A 2LZ0A 1YR9A 2ILVA 2R68A 4MRNA 2GPBA 4D45A 1YR2A 4NJMB 3WYNA 1H2XA 1UOOA 2Z3VA 1XDDA 2I76A 5DSXA 1CUIA 1IPHA 3MTAA 6ADHA 1M1NB 5L6LB 2ZWPA 2QUZA 4AULA 1RI5A 5A5VA 1VL0A 3HXOA 3G82C 4EHKA 5KQGA 3NHYA 4ZAWA 1O8CA 1AGNA 2H1WA 2QR5A 4K2HA 4ZO9A 1CB7A 4R05A 3HCAA 1XTPA 4PVDA 1BN7A 2AOWA 3DWGA 1RYFA 2WYHA 1SPXA 3DWIA 3GDHA 3PFWO 4MW4A 1B7GO 1LDMA 1UZLA 1WXEA 5E9JA 4ARUA 2HSGA 4DSZA 2GHIA 4FUTA 4FN4A 1TJPB 1G8KA 1V5EA 2QN1A 5JD4A 4NJEA 1Q1EA 3UJ8A 3DBLB 4D43A 1KY2A 3U16A 3PT5A 5KU1A 4DIKA 4F4FA 2VQFB 1ZCBA 2XT9A 1O0SA 2FPWA 4V24A 4UNRA 4ZDKA 3KKEA 1JI3A 1KGDA 1OOEA 1XI2A 1ZCZA 2EAUA 4U39A 3S55A 1OWNA 1AS0A 4UMDA 5JWHA 4DCOA 2ROQA 4HN2A 4YB8A 1GRNA 2HADA 5K3DA 4ZJUA 1J22A 1OYVA 4CDGA 2O4UX 4JLAA 3G2JA 4ZZ2A 2AZ4A 1G59A 5ARBA 4QBIA 2CVHA 4MIKA 3NWEA 2MYTA 2DFVA 2BMJA 3U1VA 1E3QA 3HDTA 4O4IB 3QKUA 4JROA 4RLFA 5B36A 4JBWA 2VDMB 1CJVC 3Q88A 1N57A 1E79D 1S7CA 1JA9A 2COUA 2XH8A 4GQAA 2JG3A 4IDUA 2IWHA 3VVMA 4DDUA 3KJIA 4LC0A 3QLVA 5ESDA 5EKTA 1ZHFA 1R6VA 4FBLA 3B1FA 1MJHA 5AO9A 1NUSA 2BTQB 4D9GA 1U0NA 1PZXA 2ZSHA 4CFYA 1HKHA 4ARZB 2W83A 4CM6A 1IBSA 3LWZA 1DL5A 2VYQA 3E7FA 3G9ZA 4HZUB 2ISQA 4FDUA 1T0PA 3WC4A 2XBMA 5EWMB 3K1ZA 1SKQA 2PLFA 4KEAA 3TPFA 3T5TA 4EFKA 1PR2A 4EHNA 2OHVA 4CG3A 4UULA 4EVRA 5JJBA 1MFZA 3EXHB 4MKFA 3FPLA 2BW0A 4OGKA 5LQDA 1UOEA 4AY5A 1RM0A 3GJSA 3Q98A 1EESA 1TK2A 4OJKA 1FSSA 1H0HA 3W90A 1M6YA 3HVRA 3SJAA 4BVHA 4I50B 4EIWA 1BC5A 3QMMA 1A7JA 4WXHA 2NZ8A 1A50B 2YIDA 5TDHA 2C2GA 2ZBUA 8OHMA 4JLDA 1YE5A 3DJYA 2Y71A 3DE6X 4DIOA 4OLHA 3NIWA 1SXPA 1T4DA 2AEMA 1X7YB 3WB2A 5IEBA 2FPLA 3DWEX 3L04A 1IMJA 1I3NA 3OFJA 3R6WA 5G41A 2WJGA 5FWXA 1VGQA 2GCGA 3E5NA 3IAAA 3QGMA 4TN1A 4KB5A 1XLUA 3RC8A 4KMSA 4BNUA 2ZETA 2HYIC 1T6NA 4N48A 1C3OA 4RA9B 5DM2A 1ZOLA 2O2JA 3NORA 4BRSA 2XF8A 1TZMA 2C5FA 4BS9A 4QDTA 4UUNA 2J6HA 4NAVA 4B47A 3ZLAA 2CHUA 2CDCA 1VSTA 1RRPA 5EEGA 4MVYA 4OHKA 2IP2A 5CLHA 4JKIA 4WOBA 3HI6A 2FSGA 2ZUCA 4LKRA 1D0IA 3D31A 4Y9TA 4RTLA 2EBWA 4U4AA 2J48A 2AT1A 4CTJA 2BR3A 4CFSA 2WOOA 2ADMA 1B76A 1ZXBA 4QSMA 3BF7A 3E1SA 3PF8A 5EXTA 4AL4A 4EBBA 5CYOA 3WB1A 3TXYA 2V54A 4RKRA 4WERA 1C1DA 2P5TB 2QQFA 5BQOA 2VJYA 5G3ZA 2WD8A 4KKXB 4G9EA 5BNWA 4N0PA 3A6GA 3X1JA 2GH1A 3OZSA 2B20A 1JVSA 1R0XA 2FMXA 4L3WA 3DAGA 4M0KA 4B85A 3I64A 4J2HA 4Q21A 3N1UA 4E88A 4OBEA 3KPUA 4DWJA 2NZXA 5TT1A 1YULA 3INTA 4LDQA 5D7BA 4JU8A 5THKA 3WLKX 1PGNA 1JG3A 4GXQA 4LOJA 4OREX 1PS0A 4IVQA 4ZV4A 5CM9C 4U2BA 4G24A 2PVSA 3A1TA 2ZT5A 3F47A 2XMRA 3L6UA 3OC6A 4UBNA 3PL5A 5FF9A 1D9ZA 3LVQE 4QM6A 3FETA 5ENZA 4ESVA 3N58A 5KNCD 1XTJA 2GASA 1F2TB 5K8VA 4QE3A 1CDDA 3KJXA 1DIRA 2VPIA 2W2NA 4L0CA 4GBJA 2GZ3A 3NETA 1X2EA 2Z4RA 3OPMA 3C5VA 4QPPA 3UC5A 5ICFA 4IKOA 1N3IA 4QLOA 2EDCA 3CPEA 3HRIA 3O7WA 1KYIA 1A4IA 4FD3A 3A9CA 2ERXA 2WJAA 4JUIA 2Y1CA 2FI1A 2CBZA 3D7RA 1P17A 3T7RA 3COYA 1QQBA 4BKOA 1UXOA 1OBCA 4EATA 5T7BA 2HU2A 1J23A 3G2OA 4HWSA 3R4VA 4WBNF 1E96A 4QDOA 2A35A 3K1YA 1GCOA 2JFOA 3NPMA 2R6DA 1PFWA 3KHKA 2PJRA 3DV0B 2IODA 1J1ZA 3CMMA 5LJLA 4CMJA 1N9KA 3OQNA 4ZQBA 4RPGA 2FZVA 1X7XA 5I9BA 4HUQB 4RMHA 2OT3B 1E2KA 3LX4A 1YVEI 2JZNA 2XE6A 1J42A 1E7QA 1RMQA 2W6ID 1T9ZA 1SM4A 4CL8A 4HS9A 4NENA 3QY9A 1L5VA 1LDNA 4D3XA 1Q16A 1ZVQA 3FTQA 1FA9A 3PXAA 4LJ6A 1YCHA 2PRZA 4I5FA 1NOIA 4WKPA 3NONA 4FYKA 3UHPA 3E0XA 3EGDA 3C8HA 3D2AA 2ZJFA 4DDHA 2X40A 1VL2A 1VYTA 3U3XA 1M76A 2Q5CA 1FC0A 2W8BB 1Q6YA 3M2TA 4ANFA 3QMPA 4KVGA 3O84A 3UY4A 5HJ5A 1IZ7A 2YRFA 3IQXA 3SYKA 4FS3A 2E7ZA 3A37A 1N4AA 2YJGA 5FD8A 4OQQA 1MUUA 2VJMA 1H1LB 2EF1A 3ZHYA 2R6AA 4EG6A 2ADOA 1U2DC 4OMDA 4NV3A 3PXBA 2B21A 4PONA 1AUXA 4IKEA 4MJ3A 4W7HA 4ZMBA 1SCAA 4RQTA 1PV1A 2XHEA 5TE9A 3A2MA 4OFWA 4MV8A 1R66A 3PXGA 4L28A 1AZSC 4R2JA 4DBLC 3HJCA 4KRXA 3T7JA 3OJCA 1PSDA 2H08A 2AFHE 4I3FA 1D1QA 4NCNA 4E03A 3KUUA 1YWGO 1WUHS 1CRZA 1IQRA 1GT6A 3ONWA 4I2NA 5C7YA 3O9ZA 821PA 1RPAA 3K2BA 2VP9A 4I4TB 3KZKA 3NWBA 1H05A 1SD2A 1XNHA 1G5IA 3G59A 3MT8A 1P77A 4HBZA 4NDZA 4PC3A 2O5RA 5HM6A 5BSVA 2VPZA 1WP4A 4WCFB 5AHWA 4DV1B 4EW1A 4PZCA 1R74A 1Y4AE 1CC1S 4DOMA 1Q3KA 2GM5A 2I2FA 2H59A 4JR1A 3UCFA 4CMEC 4OYHA 5EKXA 2HUNA 3TZLA 1P0CA 4M1OA 3UPDA 4B6QA 2QM0A 3KPWA 1THTA 1PFVA 4ZVUA 4IICA 3GLIE 1TRHA 2A1UB 1F60A 1D5WA 4M8IA 1Q44A 4OU4A 3VDQA 4HLNA 2ZTHA 4X93A 4IQ4A 4DLTA 5A6VA 1Z82A 1ZJYA 2BFPA 4BPRA 4IDAA 4QBGB 4PC1A 3TQRA 4BGUA 3MTBA 3ILYA 1R15A 3HVIA 1XZ8A 4EB6B 4UM9D 3SC2B 1ZK3A 1G3RA 1LPAB 1VL6A 5G40A 5TPZD 3WKCA 3N87A 5ALIA 5HKKD 1ZQ1A 1QG0A 1USKA 2JGMA 2P40A 3IEUA 1FSZA 4M22A 4RH1A 1C9DB 3C3BA 3UG6A 3KQNA 2XRFA 3JWIA 2FF7A 3FCAA 3RYCA 2H16A 2Y0BA 1Z0UA 2AXNA 1Y3HA 2XOKD 4DTCA 4V0LA 1HYQA 1MCZA 2C9DA 3NB0A 4QOHA 2UVDA 3V6MA 1C14A 3GRZA 4YRMA 5AI9A 4RCYA 4MS1B 3NRBA 3W3AA 5JLAA 4DDMA 4L4RA 4TQGA 3GWZA 4YP6A 1C7JA 1NBIA 3HCWA 4KDRA 1IOWA 4RVCA 2EFHB 3I2IA 1DIAA 2J08A 3PPXA 1XN4A 1WW8A 3GPLA 4MYTA 4DAEA 5D3MA 3FIJA 1K6IA 4H4DA 2J3KA 2R1TA 5JBNA 2V7EA 3L82B 2H63A 3ELWA 3ZCUA