1VL0A

Crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
HMKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNPQSAYGKTKLEGENFVKALNPKYYIVRTAWLYGDGNNFVKTMINLGKTHDELKVVHDQVGTPTSTVDLARVVLKVIDEKNYGTFHCTCKGICSWYDFAVEIFRLTGIDVKVTPCTTEEFPRPAKRPKYSVLRNYMLELTTGDITREWKESLKEYIDLLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DTDP-4-dehydrorhamnose reductase, rfbD ortholog (CAC2315) from Clostridium acetobutylicum at 2.05 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords DTDP-4-dehydrorhamnose reductase, rfbD ortholog
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vl0A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1vl0A02
1CEQA 4CR7A 3K96A 1PL7A 3JD0A 1DFHA 4CMEC 3UAGA 2JD0A 3DTTA 1DC5A 3L6EA 5JLAA 3RUAA 5FI5A 1WPQA 4BO9A 4Y6RA 3MOGA 3HQ4O 3KYDB 1O89A 5H82A 4BKQA 4DWVA 1HLDA 3ZV6A 1B3RA 1BW9A 2V6FA 2AW5A 5CEJA 2EG9A 5IDXA 2EGHA 2D5AA 2OXIA 2ZTUA 5I7FA 5CG1A 4O1MA 3GQVA 2I65A 2X23A 1F17A 1JW9B 4CV1A 4CLXA 5C7LO 2DTXA 5HM8A 4WUVA 5U1PA 4C7KA 1ZXBA 3A14A 1B15A 2IYPA 3AFNA 3UHAA 3RUFA 2VTEA 1FF9A 4OOEA 3V1UA 1LA2A 2VZ0A 1Q7CA 1AUPA 1NR7A 1VJ0A 1UP7A 5A06A 2CF5A 4AJIA 3LK7A 4EJMA 1GFSA 1UZNA 5EESA 5DCWA 1FMCA 4ZA2A 2O4CA 5ITVA 1X13A 2OOSA 4IDEA 3AUSA 1NQOA 3FTNA 1GUFA 2PZMA 1BMDA 1NVMB 3JQ6A 1V8BA 4FOOA 3D7LA 2BI8A 3QVOA 5JCJA 2PY6A 3LC1O 3EAGA 3QWHA 4PZCA 5JO0A 4FJ0A 4MVJD 3NTRA 1K5HA 3N58A 1YBMA 3T4XA 3RBXA 4EW6A 3U49A 1WP4A 5T5QA 1SBYA 4WCFA 1KBZA 3PWKA 4G5HA 5EERA 4BNMA 3INRA 5IAAA 5C7OO 1NQAO 4PLWA 4ROSA 1QXSA 3M1LA 3IP3A 3W6UA 1E3WA 1PS9A 3KLPX 4K6FA 1VSUA 1HYEA 3H5RA 3S55A 3GGPA 4E5NA 5C3MA 2LDBA 3I4CA 3Q2KA 1E1NA 3FR7A 1ENOA 4HFRA 3WQRA 3C1OA 1T2FA 2R6JA 3UCXA 4AJJA 5TRTA 4R1SA 1YJ8A 4TVBA 3F5QA 2RBEA 4N18A 1A4IA 1PL8A 1KVUA 3MJVA 3L9WA 2Z5LA 2PD6A 2P9GA 3IAHA 4PLCA 1SNYA 5HWSA 1R37A 1JN0A 5ES3A 1DPGA 5JYDA 2Y1EA 1PJQA 1YB4A 4KZPA 1Q0LA 3V1TC 3WICA 4DIFA 4Q9NA 4I5DA 5BSFA 4R16A 4XDZA 4U0KA 1YRLA 4DPKA 2RAFA 1NQTA 4E21A 1GV0A 2DTEA 5BNIA 5FWNA 5JAQA 1HLPA 3KSDO 1Y8RA 5JCJD 1XELA 1IB6A 3JQ9C 5F1KA 1EK6A 5THQA 3UFXA 1NWCA 3U4IA 4PZEA 2VT2A 3RFVA 1SOWA 3EVNA 1C0KA 3WJ7A 4RJTA 1VKNA 2AQKA 3HE3A 2Q1WA 3BXXA 1U1IA 2IEBA 2E48A 2ZB7A 5KVQA 3QWAA 2VHWA 4DLLA 3TJRA 1JAYA 4R1NA 3IL2A 2QHXA 3V1YA 2Y1OA 5HBRA 3R6DA 2JFFA 4J2HA 3STHA 2PR2A 1Y8QA 4LRSB 4J7CA 4QO8A 4ZD6A 2GZ1A 1AHHA 3ZHXA 1K6JA 2DPGA 4D7AA 3MJTA 1A72A 1QV7A 5JC8A 5FYDA 3BHIA 4YJHA 2EGGA 2F00A 2PGJA 4HFJA 3QLJA 4TROA 1UXIA 3GZ4A 4GSKA 4BS9A 1B0AA 1YB5A 5JDIC 3NUGA 2PV7A 1E5QA 3ZNOA 4FQ8A 3E03A 1D1TA 1UAYA 2Z1MA 1XCBA 1P31A 1N9GA 4PG7A 4OKIA 3WBBA 4J0EA 2GCGA 3C8MA 2B4TO 2GASA 3R3SA 5A5EA 1A9ZA 3AU8A 1JWAB 3FNFA 4YRAA 2OFPA 2ZTVA 5EINA 3N74A 3WJAA 3ZWBA 1L7EA 4PZDA 1SOVA 3L0DA 1EQ2A 4W9NA 5B4UA 1HE5A 1MXFA 3QW2A 4IDGA 5ENVA 3VPHA 3H6KA 2C20A 3I9LA 3KBOA 3B6ZA 4DPLA 2VHZA 4R68A 3EYWA 1IPFA 4JJIA 3JQBA 5IZCC 1WVGA 5TT1A 3DTYA 5KWEA 4NFYA 2CVZA 2Q45A 3GOHA 4R69A 5CDYA 1GD1O 4JIGA 5IXYA 1DOHA 4NZ9A 3WGYA 3AUTA 5KOIA 5I8WA 4IXWA 1QYCA 5IDQA 1EVZA 4ESOA 1C3VA 3CXRA 4Y6SA 1GCUA 5IF3A 3D3WB 2FPIA 4ZN6A 2GO1A 4NFSA 2Q49A 4ND2A 2NWQA 4NI5A 5ADHA 5JFOA 4WLEA 4A7PA 1PTJA 4KQXA 3DFZA 2ZTMA 3RBVA 1CETA 1VL6A 2AEMA 2I3AA 1BRMA 3MJCA 3ZV5A 1X14A 3ETGA 3HN2A 3Q9UA 4YAJA 3OHSX 3RC9A 5JYEA 2C82A 3CINA 3OJEA 3DFUA 5L40A 4M1QA 4XGKA 4UVHA 4Z9XA 3WMXA 3JQ7B 1SAYA 3QQPA 5EMHA 1JKFA 1VC2A 2ZYDA 4HNGA 5I8ZA 2DUUA 1XR3A 1NVGA 4WJZA 1RKXA 4NR0A 3DHEA 4U8GA 1BGVA 2GZ3A 4CM8A 3KVOA 1DC6A 3DBLB 3WR5A 2EKLA 3JSAA 1OZAA 5MDHA 4XQEA 3U0BA 3V2HA 2VHXA 4UUPA 2VYNA 3LT2A 3RJ9A 4PN3A 4PIVA 5GZ1A 2GF2A 4MJLA 2DBZA 3BHMA 1DXYA 4J1NA 3I52A 4E2YA 4X54A 1DB3A 3DZGA 2WD8A 4UULA 1HF3A 3F9IA 2VNSA 4HV4A 1XEAA 3F4LA 4E4YA 4WLNA 1V6AA 4NK5A 1XQ1A 2P91A 4MVJP 4D46A 5K0ZA 1UXKA 3LC2O 2E6UX 2I9PA 2YY7A 3G3EA 4HP8A 5KJEA 2GLXA 1PU2A 1QYXA 2Q1SA 2Y1DA 3PWZA 1B2LA 3SJ7A 6ADHA 3IDSA 2HSDA 1HRDA 4L4RA 4TRNA 4MDHA 5BSGA 4FC6A 3M2PA 1T2DA 5B4VA 4MO2A 1Y8QB 2I5PO 3IP1A 4RZHA 1LDGA 2ZCVA 3SBOA 2PA3A 3G17A 4FFLA 2VQ3A 4L73A 4BO8A 1XHLA 3NT4A 3AU9A 3PQDA 4RF4A 2W2KA 2ZB4A 3K5PA 4NBVA 3JQ8B 4Z0TA 3AUAA 4GX1A 1LI4A 2HKIA 4L4XA 4DC1A 5JBIA 1XYGA 4CMEA 3WGQA 4F45A 3CMMA 5F5LA 2IEDA 2DQ4A 3B1JA 4GKVA 2NV6A 4XA8A 4IQ0A 4WEOA 5L7TA 2AA3A 4KTTE 1T25A 4PLTA 1IHYA 1BG6A 4JJGA 4MPDA 4E12A 2Y05A 3I9JA 3GR6A 4JROA 1NAIA 3H2SA 3PXXA 4XRRA 2G82A 3VZSA 1E6EA 4KDEA 5TJHA 5KCZA 4IXTA 4NHEA 4HXYA 1RYDA 2HMUA 3GVPA 1J6UA 2BFPA 3DR3A 4GMFA 4E2ZA 5CG2A 1G1AA 3BMCB 2W2LD 1NX6A 1Z7BA 4CLRB 3DBRA 1OI7A 1A9YA 3JQAA 3VH4A 5KVCA 2J8ZA 4J9VA 3ZH2A 1ZH8A 2PGDA 3OJFA 2RIRA 1VRWA 3KXDA 3NYWA 4FD3A 4IDBA 3DAFA 1IL0A 1F14A 3O26A 2P68A 4AJ4A 3DDNA 1VJTA 5JMWA 1XGKA 4Q39A 2QRKA 1O95A 2C2XA 3VAZA 1D7OA 3TF5A 3ZNQA 4CQLB 4CUJA 1UDCA 2BKAA 5F1OA 3RROA 1YQDA 1X7GA 1ENYA 1AGNA 3OJLA 1Z6ZA 1UAGA 4YQZA 1HDCA 1N1GA 2NADA 2Y1GA 1HKUA 4Z3KA 4R3WA 5EQDA 2PD4A 5HTOA 1D1SA 1LJ8A 4WPGA 4K28A 4N5LA 2UVDA 3E5MA 2OZPA 4CV0A 4Q3CA 2GRAA 3OP4A 3B1FA 3K2BA 1C1DA 5K9ZA 3CUKA 1F06A 3ICCA 1SC6A 4E5KA 5AXAA 4NQZA 1FJHA 5L4NA 2J3IA 1Q7BA 4B7UA 1VPDA 3ROPA 3GPDG 3G1UA 1PGQA 2OBYA 3E18A 4OL9A 2C07A 5JPIA 2H9IA 2O7SA 4ALIA 5DN9A 3WDSA 4L76A 1YS4A 1WDLA 1I5RA 1ZFNA 2A92A 4NBTA 3H9QA 4OM8A 4BNVA 1XWFA 2DFVA 3SXPA 4B3JA 4Y9DA 2WJPA 2O2YA 4IDDA 1DHRA 1U4OA 1ID1A 4J4HA 2JCXA 1I3KA 3GDGA 1W8DA 3VKUA 3E5RA 3KZVA 3EMKA 5COAA 4DLAA 5L4LA 2YHUA 1QYWA 1VE9A 2BGLA 3WG9A 3UVEA 4L75A 4R1UA 1X0XA 5DBGA 4EUEA 2C5AA 2X5KO 5JW6A 3DAGA 3A1NA 3HSKA 3P5SA 4BL5A 2VYND 1R15A 2PK3A 2TMDA 1LLUA 4PG8A 4HNHA 5F5NA 3OQ1A 4CQMD 5KJFA 1FXSA 1GV1A 1XG5A 1NHWA 2H1SA 3RQSA 2CF6A 4XGIA 5G0VA 2GYYA 2POQX 4TZTA 4GVXA 3JD3A 4K26A 3HADA 4WLFA 3ZCXA 3AM3A 4J1SA 1KVQA 1AHIA 1NFRA 1P1RA 4FN4A 3RUCA 2Y68A 1ISFA 3DB2A 4FW8A 4EITA 3PHJA 3PEFA 1TT5A 4W82A 2R00A 2EP5A 4JBHA 2Q99A 4YQYA 4DMMA 2Q1TA 2EERA 1R0KA 4W6ZA 1DJNA 3C24A 2GR9A 1ZXLA 2X6TA 2EIHA 1PSDA 3UW3A 1MB4A 4DLBA 1ZJZA 4ZVVA 1DAOA 1I2BA 2CD9A 3UH1A 5TGDA 1Y9AA 3VZRA 2WYWA 3I9NA 2CDCA 1DC4A 3GVCA 4NU6A 3JD4A 1H0KA 1LU9A 4RLHA 2ZB8A 4M55A 2IXAA 2NTJA 4PG4A 1CWUA 4JP2A 1D4FA 3L9XA 3GG2A 4CM7A 4PLFA 3CZMA 4UEKA 3WGHA 4CM5A 3GH3A 3BTOA 1SB9A 4W99A 1D3AA 3GAZA 4YXFA 1K2WA 4RF2A 4A26A 4AVYA 3ORFA 1GZ4A 3AOEA 4R4JA 1K0UA 1C0LA 1L7DA 5B12A 3WBFA 2WYVA 5DT9A 5AOVA 4NG5A 3FCOA 3F1LA 2BF7A 4OQZA 1SMKA 1N9GB 1I24A 2UV8A 4RQUA 1PGJA 4RVGA 1H9AA 1MGOA 3GDOA 4CM9D 2OGUA 4R1TA 1UP4A 1FDSA 1M6HA 5T6BA 5KNLA 5DDIP 5CDUA 4NDNE 3RUHA 4IS2A 5L45A 3T7CA 3KB6A 1HT0A 1YB1A 3MJ4A 4UAGA 5A02A 5IDWA 3I83A 3TL3A 3TZKA 5CAEA 1DRUA 3TFOA 2C7GA 3O4RA 1UP6A 1GYQA 2E82A 4OSPA 1YQXA 2FSSA 4WCFC 1MP0A 3HJAA 1WLYA 1CF2O 5KKAA 4CM4A 1PS8A 4CMAA 4CMCA 1TT5B 3P19A 1ADCA 4QUKA 4L9RA 2WM3A 4FBGA 3GPIA 4Q3EA 4FOSA 4EEXA 1XSEA 2PZJA 4D44A 3KTDA 4GVLA 4TWRA 1QORA 4DQVA 4U5QA 4Y8VA 4Z9FA 4DMLA 3WGIA 1HL3A 3GY0A 5BNFA 3I3OA 4BB6A 1U9JA 2DUWA 4RPHA 1V3VA 3DBVO 3DZHA 3TDKA 3A06A 4LMPA 4ND5A 3JQGA 2E4AA 5DOVA 3U5TA 2D3TA 1H9BA 1RJWA 3MOIA 1R4NB 2WSBA 3TOZA 3DWFA 1QLJA 3K2EA 5DP1A 1H6CA 3GFBA 1P1IA 4KWIA 5JE8A 3WYEA 4CLHA 2D4AA 1C1XB 1H6AA 1GEEA 2YFHA 4FCCA 2P4HX 1B8PA 1BVUA 2C7VA 2EWMA 2R2GA 3LT1A 3SEFA 2A9FA 2AQ8A 1N7HA 1R0SA 3PP8A 3LDHA 1UJMA 3UICA 1PJ4A 2B4RO 4IQ8A 1LSUA 4UVDA 4OGWA 3TL2A 2PKRA 1EE9A 4J43A 4BKPA 1Y9EA 4RDIA 4EYEA 1HYGA 4AJHA 4BNUA 4BOYA 4TKMA 1NM5A 3H3FA 2IE0A 4UEOA 4XJTA 2AQIA 4AJEA 1FDTA 4IY1A 4TMFA 1LQUA 4YA6A 3QWFA 3EC7A 4IIVA 3WGZA 2D8AA 1P9LA 1I33A 1NPYA 5L4SA 1N8KA 1IUKA 1K89A 2Z1NA 1PX0A 3RSHA 2ZB3A 3JQAD 4DBVO 1U3UA 4DUPA 1A27A 1CQJA 2G76A 1Q7GA 1T24A 3GEDA 4M54A 3GHHA 4EJ6A 4NU5A 2DLDA 1ZVMA 3KYCA 3AJRA 5BNTA 1EBFA 3GLQA 1VSVA 4PLVA 4K6CA 3IKTA 4NBWA 4GBJA 1WDKA 5IZ4A 5TX7A 4BGIA 1B26A 4CLOB 3AW9A 3PHIA 1RYEA 1LDYA 2FPPA 4PRLA 2AXQA 3H5NA 2ZTLA 3QWBA 3ZWWA 1KERA 3CKYA 4AJOA 1ZK2A 3CIFA 1U2DA 2VCYA 2JAHA 1FDWA 3ABIA 4DQUA 2B4QA 4D3DA 1DHTA 4U0JA 3AI2A 2XXBA 2VWHA 1Y81A 4YR9A 4BNTA 1NBOA 4II3A 1GQ2A 4WKGA 2O3RA 1GAEO 2A35A 2GN4A 2V6GA 1B7GO 4CQMB 5ICSA 3IIEA 1OC2A 1PWXA 1GTMA 3JQEA 3ZU5A 4RZIA 3JYPA 3L6DA 3BMQA 1V0JA 5HS4A 1NPTO 3GUYA 1R16A 4YBZA 4DTIA 3JQBC 3W8FA 4LVUA 5IZCA 5U4QA 1E3EA 1LTHR 1LRLA 2DVMA 4Z0HO 5IN5A 1MV8A 1PJTA 1SPXA 4DC0A 2EHDA 3M6IA 1U8FO 1LBEA 5L3ZA 3OIGA 2PTGA 3PVZA 3KLMX 4IM7A 1HWYA 3NGXA 4J90A 3ZW9A 5I7EA 4WNIA 1KVSA 1A5ZA 3ZW8A 1E1KA 2VT3A 4FGWA 2O3TA 1Y5MA 3AWDA 5DBIA 1UXGA 1GU7A 3GNQA 5CFZA 3JYQA 3INGA 1E7MA 2RCYA 4GX0A 1F8FA 3NDJA 1DLIA 3LT4A 3LLVA 1GDHA 2O23A 1Q2XA 4F46A 3QIVA 3PQFA 2WD7A 1TT7A 4B8WA 2DAPA 2AG5A 5IFLA 3ONDA 4YPOA 4UUNA 3NT2A 1IOLA 3D4OA 1B14A 2QIOA 5ILGA 4P4NA 3RC1A 2C54A 1NWHA 4GLLA 3D1LA 1N92A 1YWGO 1W0CA 4ZJUA 1HYHA 1UXHA 2PFGA 3GAFA 2DBQA 4HBGA 4CV3A 3Q2IA 2EKQA 4Z6KA 3UUWA 4GWKA 1S6YA 5L7YA 4G2NA 3RCBA 3OFSA 3ZZNA 4O5OA 5EJ2A 3RC2A 2PLAA 4P4GA 3JV7A 1HE3A 4CM8B 2CUKA 2UDPA 4CQLA 5HRUA 4E32A 5CDTA 5EQFA 3MTGA 3RKUA 4BMSA 3BYZA 5GZ6A 1XU9A 2GPTA 3OF2A 2OO5A 3JQ7A 5TF4A 2I6TA 2FSVA 3V2UA 3ROQA 1ENPA 4LCEA 3GN1A 4M86A 3W4KA 3W6ZA 3KHUA 2HMSA 4TVOA 1UXJA 2D0IA 3K31A 1E5LA 3KUXA 3ZI0A 5DCYA 2AE2A 4J3FA 3ST7A 2JFGA 4JGBA 1B16A 3WYCA 1N7GA 2I99A 3FWNA 4NJMB 2C0CA 1RPNA 2YFQA 3TOXA 1E77A 3P2YA 3WNQA 5A3JA 1EMDA 1QG6A 3PYLA 5G0UA 1E3SA 2JD2A 4E2WA 4CMKA 3HG7A 3F5SA 2GUGA 4URFA 3NDRA 1PQWA 3NTOA 2BD0A 3U4HA 1LRJA 3FD8A 3JYNA 5A9SB 1D8AA 3H7AA 2X0JA 4TZKA 2EKPA 2PKQO 4YJDA 4NMHA 3GEGA 1EQUA 4RDHA 3PJEA 1VL0A 2VOJA 2ZJ0A 1AE1A 4MIOA 5AXCA 2QYTA 4CV2A 3VVCA 2D1YA 4ALNA 3VDRA 2ZQYA 1OFGA 2X9NA 3RU7A 3OICA 1PR9A 5KKCA 1NR1A 1ZEMA 5EIOA 1V35A 3D5TA 1I36A 1F12A 1PGNA 2OBNA 3X2FA 3NV9A 1NYTA 5H81A 2WE7A 2Y0CA 1AXEA 2Q2QA 3BTVA 2B37A 5DCUA 4OAQA 4O63O 1N2SA 4Q3BA 3WQSB 3ADPA 3NRCA 5TSDA 4QECA 1TXGA 1VKOA 3HB4X 3RAJA 5FEUA 3ONFA 3HDYA 1LNQA 3PRJA 4NH4A 2FN7A 4FFPA 4E0BA 3QA9A 3BZUA 3JYLA 3ON5A 2B5WA 3DMYA 4WEQA 2O3SA 4A03A 1DSSG 1PJ3A 4PG6A 4OXYA 3H8VA 5K6AA 1ZUD1 2JJYA 5ITWA 2Y66A 3BIOA 2OL4A 3RBZA 5DF1A 3KEOA 1PWZA 1GUZA 2BELA 3H9GA 3L4SO 1LC0A 1ML3A 1YH3A 3BMOB 5TNXA 4PRKA 4BO0A 3D4NA 3A28A 1Q0QA 4J1TA 1U4SA 4ALLA 3CZRA 1HSOA 1O6ZA 5T64A 3W4IA 1QMGA 1NNUA 1EVYA 3D4PA 2X4GA 5LDGA 1IE3A 1X7HA 4C7JA 3DZBA 4IJWA 4B7XA 1KETA 3TZQA 1P3DA 2ZYAA 4BNLA 3LQFA 1B8VA 2EW2A 2VTDA 3G49A 4QQRA 5AVOA 4CM6A 2CZCA 4BIIA 3U62A 1E0DA 3WFJA 3HDJA 1MXHA 3RUEA 4F3YA 3P7MA 2YV3A 1YO6A 3ZWVA 4IJKA 4Z0PA 2O50A 5DNAA 3F46A 2C29D 2VUTA 1JU9A 3ZWPA 5BR7A 2B5VA 1DFIA 3PGXA 4NBRA 1SO8A 3SX2A 3WSVA 1CDOA 2JHFA 5A4DA 1H6DA 3VTFA 5G0WA 1I10A 4S3MA 2WYUA 3DQPA 4I5GA 2PZLA 4J9UE 4AJ2A 3NEPX 4XR9A 5A1TA 3D5QA 3ZU2A 3O9ZA 1H6BA 4TRJA 2HAEA 3NT5A 2NNLD 4NIMA 4E2XA 4FFOA 5DP2A 3JQFA 2OP1A 2YJZA 4UVIA 4ITUA 1E6UA 1ZSVA 1QYDA 3W8EA 1BXGA 3FSRA 1EEHA 1LSSA 2F1KA 4HFMA 3GVIA 3K6JA 3F4BA 3FRJA 2W98A 1G0OA 3TFQA 4D43A 4RO0A 4TQGA 3H9EO 4IDFA 1NAHA 1G0NA 3PK0A 3ITDA 3ZN2A 1U3WA 4F6CA 3AOEC 1WDMA 2G5CA 2P9CA 3AK4A 3GK3A 1VJ1A 3DL2A 3S1LA 2PH3A 1C0PA 4BKRA 3H2ZA 4GPD1 1TLTA 1WMBA 5AYVA 5IN4A 1EFLA 5KJ6A 2UYYA 4LCJA 1HDXA 3MCVA 4GL4A 1A7KA 1QV6A 1R4MB 2J3KA 1MUUA 4O6VA 3U4CA 1CIVA 3PJDA 3KOUA 5A9TA 2FRDA 4BNXA 4QTZA 3LF2A 1EUZA 1NFFA 3ZWMA 2NTNA 1XLTA 3ADOA 3QWIA 1JTVA 4DPMA 1EDOA 4RVSA 2OP0A 3WB9A 1ZMOA 1U5CA 1E3WB 1KVTA 4ALJA 3AOGA 1NTOA 5JDCA 3ZU4A 4I1IA 2HQ1A 1EE2A 2JHGA 3QHAA 1GPJA 4CLRA 1KOLA 2PZKA 2JL1A 3OETA 3O38A 4BNNA 1U5AA 4BNWA 2R00C 1MFPA 2FP4A 3GFGA 3WIEA 2GSDA 3K9QO 1M75A 1P44A 3ULKA 4ZQEA 2FR8A 1T4BA 3HNPA 5COBA 4WE3A 4AL4A 5A3VA 2W2KB 1YL6A 5JNLA 1Y1PA 1H93A 3L77A 1YDEA 5A03A 4QXMA 3UCFA 4BKOA 4PFJA 3MJSA 2RH4A 1IYZA 3PDUA 1LSOA 3PYMA 4UVGA 1I30A 3ETEA 4XYBA 1ARZA 4BNFA 3H5AA 4Q3DA 4Q3NA 4RCVA 4NJMA 3WYBA 1P77A 1ADGA 1PQPA 3BA1A 3E9MA 4JLWA 1IHXA 4Y67A 1O8CA 4LK3A 4GLOA 4EJ0A 4GH5A 2NSDA 4A73A 2X8LA 3BMCA 3WXBA 2CVOA 3OQ6A 2A94A 5JDCC 3TPCA 2FY8A 1PEDA 2HRZA 4QX6A 1CYDA 3EW7A 4PLZA 4PVDA 3ZNPA 1DAPA 1EK5A 2ZJ1A 3PLNA 3RWBA 3VH2A 2RHCA 3ENNA 2HK7A 4IZHA 4UUOA 2E37A 4GI2A 3INTA 1P1KA 2O7QA 3EUWA 3OJOA 2QRLA 5ER6A 1NASA 3X2EA 3PIDA 1LDEA 1E7YA 4WOKA 3C85A 4XQ9A 4BQPA 5L51A 3FF4A 2IXBA 3IOYA 4G81A 3DAPA 1Z82A 4RVFA 4L74A 4CR6A 2NUAA 3AFMA 4B3HA 4D41A 1B3BA 3AI1A 4AICA 4XYEA 4FB5A 5DOZA 5L9AA 3OECA 4N5NA 2TMGA 2EP7A 1KEUA 4L0QA 3EHEA 1R66A 1UH5A 4BQRA 1PIWA 1UR5A 5BSHA 3ZV4A 4N7RA 3NAQA 4IBOA 1LLDA 1GQQA 3B70A 3OIFA 3PI7A 1R12A 2H63A 5T8KC 3C7AA 5ER9A 3ZWCA 2B83A 2YZ7A 1Z74A 3FHLA 3ITKA 1GYPA 3HHPA 3BHJA 3QJ5A 4YTEA 2X5OA 3GGGA 4A5OA 1R6DA 2QG4A 3BMNA 4IGEA 3VPFA 4WCDA 3CMCO 3O03A 2PH5A 3ZU3A 4AJLA 1E7QA 5ICMA 2AG8A 3E9NA 4YDRA 3D3WA 4INAA 4D45A 9LDTA 1H2BA 4P4LA 1UZMA 5BQFA 5GY7A 1M67A 3HDHA 1EFKA 4E5PA 2IRWA 3ASVA 4I5EA 4XZ3A 4KOAA 3FBTA 1P1FA 5C5IA 1WW8A 1T2CA 3CTMA 4DYVA 2B0JA 2HMVA 1U2GA 4DQXA 1DJQA 3RD5A 1E3IA 5G4KA 2CNBA 1CRWG 3ANNA 2GERA 4BV8A 1O9BA 4RPJA 1OOEA 1U7TA 3RUDA 1SEVA 4IJUA 1PZEA 4BNYA 2HK8A 2Q2WA 3PHLA 2EJWA 3DZKA 3M1AA 3SVTA 2P4QA 5KVVA 3NDIA 3OIDA 3NJ4A 3VDQA 3NTQA 1QP8A 1I32A 3RFXA 3L4BC 3TN7A 1TEHA 3VC7A 4E31A 5ILOA 1GEGA 2HJRA 5A5FA 4YB8A 4CMIB 4WOJA 1UUFA 2HJSA 4YJGB 1AN9A 3DZJA 4BNIA 1WNTA 5AXBA 1KEWA 4QEDA 1QRRA 3MWDB 4NNJA 4YEDA 3GNTA 3ZWNA 2NACA 4DIBA 1XQ6A 2NVUB 1C1XA 1JA9A 1NXQA 2BFMA 2Y67A 2HMWA 4CLOA 3PZBA 3I9OA 1DIGA 3I6IA 1T26A 5CDGA 4OJNA 1NVTA 1KC1A 3ZDFA 1ENZA 2Y0DA 3B1KA 1ZSYA 1DIAA 4FDAA 2YQ4A 3MZ0A 3LVFO 4PLHA 5A9RA 4J1QA 4M87A 1XKQA 3G79A 1JAXA 2CY0A 3JYOA 4FFNA 4IMRA 3TQHA 3HDQA 2I67A 1ZK3A 4HWKA 1J5PA 3QE3A 2B36A 1F8GA 1DIRA 5TIIA 1Y8RB 1UDBA 5G0TA 2O4UX 5KJCA 4D3SA 1IPEA 2CMDA 3ANLA 3PPIA 3VH1A 2H6EA 4BNZA 4RLSA 2BH9A 3ETDA 4AFNA 3ZNNA 5BT9A 1KEPA 4DXHA 1GADO 2YW9A 5KVSA 1GL3A 4GX2A 4CL3A 2CVQA 4L4SA 3DO5A 2RHRA 2YUTA 5EPOA 1E7SA 1YVEI 1ZCJA 3FI9A 2WE8A 4D3FA 1KY4A 3JQ8A 2Y1CA 4XWYA 5FF9A 3WGGA 4E33A 1H5QA 4RPGA 4K9DA 3HWRA 4UUMA 5G0SA 1WWKA 1ZW1A 3D64A 4CMGA 1BWSA 2C59A 2GN8A 3GT0A 3LZ6A 1HDYA 5JAIA 8ADHA 4BGUA 4BO4A 3DMTA 1DEHA 1GYRA 1A7AA 1JKIA 2QQ5A 4WGGA 2NU8A 4CODB 5G2OA 1PJBA 1QYVA 5G4LA 4E13A 1PZGA 3DOCA 4H7PA 4MP3A 3QY9A 4JNKA 3TWOA 4CPDA 4JXKA 2CDBA 5T8KA 1DFGA 4LRTB 4YVFA 2NVWA 3VPSA 2Q50A 1PL6A 4RV9A 2GN6A 3E48A 3E9QA 1B8UA 4JBIA 2PKQP 2FHSA 3PDJA 4ZGWA 1SZJG 1WMAA 2AEJA 3DOOA 1ZK1A 2QX7A 1A71A 4I9NA 3I1JA 5B1YA 4XX0A 3QP9A 2HUNA 4XIJA 4FJ2A 3PWSA 3E8XA 4KDFA 1W6UA 5TQVA 3S2FA 2A4KA 3OBBA 4YRBA 3VOSA 1EBUA 2X7HA 3A9WA 4Y98A 3O8QB 3HZZA 2NU9A 3GVHA 4XKJA 2DBVO 3JCZA 2VYVA 7MDHA 4EDFA 3P2OA 4J91A 1T4DA 2IZ0A 4CQMA 4YT4A 3AY7A 2W8ZA 3CE6A 3TZ6A 4RVDA 4BNKA 3EZYA 3KETA 2VUUA 5CEEA 2BFAA 2DM6A 2P5UA 1TI7A 3CH6A 4II2A 4XIYA 4RPKA 2XOXA 4IGFA 4ZU3A 2NTVA 3EVTA 4XD2A 1I3MA 3GVXA 3WLFA 1E3JA 1P74A 2VWQA 1E1LA 1H94A 3GZNB 1F0YA 4JCOA 5F21A 1QR6A 1JDJA 2YV1A 2Q46A 2GNAA 2AHRA 4MIYA 4PVCA 3HFSA 3PGJA 1ISIA 2B35A 4KUGA 2J5RA 1K3TA 1XDWA 1FDVA 2EEZA 2VRBA 3CSDA 3S2IA 4KP7A 2V65A 3U3XA 4HUJA 3W1VA 4WK6A 1W4ZA 5IXSA 1Z45A 5CEFA 9LDBA 1I2ZA 1ZO8A 3O8QA 3UKOA 2AMFA 2AEFA 3HB5X 1Y5RA 5CP8A 1Q0HA 4DGSA 3VHRA 4D0SA 1HETA 2X1HA 5EL0A 4OQYA 3AY6A 3FNGA 2P5YA 1RM0A 4MP8A 4J4TA 1BXKA 4AJNA 1E3LA 3PLRA 1MG0A 3H65A 4KWHA 4RGBA 4XYLA 4Z3DA 5GMOA 3R0IA 4EEZA 1YBVA 1G6KA 3TZHA 3RVDA 1YXMA 3HUDA 4GMGA 4HY3A 4QFCA 4D42A 2YDYA 5TS3A 3JQFC 1OAAA 3DOJA 3ICPA 2QZZA 2YHIB 1U7HA 3OA2A 4ZQBA 2VOEA 4I5FA 2HMTA 4XQCA 2V6MA 2G17A 2QZ9A 1XA0A 1JKJA 1SEPA 1YDWA 1ZZEA 2O2SA 1ZEJA 2NQTA 1YKFA 3K92A 3LYLA 4E30A 1ADBA 4I08A 4P38A 4XB2A 5BSEA 4ALKA 3VZQA 5C7IO 1E6WA 1R4NA 2FPGA 2VYVD 3GGOA 4H16A 4A0SA 3IMFA 3PQEA 4BMVA 2J3HA 4OKNA 4EI2A 3COSA 1JQBA 3DZFA 4ILKA 4CUZA 2FZWA 3DBLA 5JAZA 1GCOA 5CPFA 5A05A 4MIEA 3PTZA 3UGKA 1YONA 2BHLA 4OO3A 1GUYA 4NBUA 1E1MA 3EK2A 4B7CA 2BFOA 2G1UA 4MVJA 4OHUA 4CM1A 4A10A 1Z75A 4IDCA 3C1AA 5JAMA 2ZKLA 4OXNA 3UCEA 1XIVA 4E5YA 1BXGB 4OYRA 1E7WA 4FIZA 1MA0A 4R9SA 3Q9NA 3W8DA 2WD7B 3MJEA 4A2CA 4PCVA 4DYDA 1LLCA 2IDZA 5K6AC 1NP3A 3IS3A 3I6QA 1PJ2A 4ZRNA 1KYQA 4RQTA 4O59O 1DC3A 2E49A 1X0VA 3PFFA 4FFRA 4R41A 5U9CA 3H3JA 2P9EA 1YOVA 4OXKA 1HZZA 1PQUA 4LGVA 4CR8A 5LDHA 2HK9A 2NU6A 2EF1A 4FSHA 4DRYA 3WFIA 2GD1O 4CMIA 4NPCA 3PFWO 3T7EA 2YYYA 3K8ZA 4PLYA 4R54A 2Y1FA 4IJVA 4OIMA 1X1TA 4FFMA 3DHNA 4MKXA 3OEWA 2X0RA 1U28A 4RORA 3FR8A 4I9HA 5A9SA 8LDHA 3NJ8A 4PLPA 1JVSA 3WS7A 3K30A 1J49A 1YOVB 4EZBA 3PJGA 4BGEA 4KQWA 4YJFA 1EDZA 1R0LA 2GN9A 2GZ2A 3U9LA 4QT0A 4YT8A 1ZIDA 4BNJA 4P22A 1M76A 1LX6A 4BO5A 3PJFA 3IQDB 1DIHA 5KJ1A 4WASA 3ZHZA 3Q1LA 1MLDA 1FK8A 2CFCA 1HE4A 2VNAA 3V5NA 2NLOA 6LDHA 3AM4A 2EXXA 4BNGA 3U09A 3GMSA 4XJSA 1KEVA 3HN7A 4GGPA 2LDXA 4TKLA 3AM5A 4E6PA 4MVJH 4MVJF 1U3TA 4XB1A 5CHEA 1MC4A 1O0SA 2C5EA 4XYMA 1T2EA 4BKUA 4DIOA 3RC7A 3ZWOA 4FJ1A 4BNHA 3ZHYA 3BMNB 4U7WA 5IG2A 4P8RA 4R01A 1BDBA 3VZPA 5TT0A 4L8VA 4MVJI 1GY8A 3MEQA 2HLPA 2FOIA 3BTSA 1OMOA 4YCAA 1ZNQO 5JY6A 1WZIA 1P0CA 1SB8A 5I9NA 4ALMA 4Z9YA 2NQ8A 1AXGA 4YAIA 1T1RA 1C14A 2VHYA 4ONEA 2BLLA 4IINA 4K1LA 3AUUA 1JVBA 1VL8A 3WSWA 1ZSNA 3H9UA 2GGSA 3ROMA 3EDMA 1J4AA 1Q1NA 1ULUA 4F6LA 4J16A 1FDUA 3R1IA 2I76A 4XCVA 3BMOA 4BB5A 4WLOA 1PGOA 3UF0A 5G4KB 3RU9A 3G1TA 1QKIA 2NM0A 5MGBA 4R51A 2JD1A 2FMUA 2FWMX 1Y6JA 1HEUA 4B4OA 3FPCA 1GZ3A 4M8SA 1PZFA 3C1TA 3GRPA 3FTPA 3VH3A 1LLQA 3SLKA 1HDRA 2CSUA 2UAGA 1O5IA 3OQBA 4EUHA 2YDXA 3ZWAA 4E5MA 3WLEA 3QVTA 3S8MA 4EUFA 2JCYA 4RF3A 4DVJA 1NHGA 5CPBA 1Z73A 2PWZA 2WEKA 3TNLA 3WNVA 7ADHA 1DRVA 3FPLA 4XYGA 3DHYA 3I4FA 4GX5A 1ZK0A 2XF8A 3OJ0A 2OORA 1XU7A 3DBHB 2SCUA 3MTJA 3E82A 4WLVA 3WGTA 3T4EA 2Z95A 3GF4A 3BMQB 5L7WA 3DONA 4W9NC 3AI3A 3IUSA 2XXJA 3F47A 2DTDA 2BGMA 1NFQA 2O3UA 3W4JA 5H83A 5C37A 3ANMA 1KS9A 2HDHA 1PJLA 2VRCD 1LDNA 2NU7A 2XAAA 1RM4A 4I9UA 4IZIA 1ONOA 1TA4A 1EVJA 4S1VA 2X58A 3LF1A 3BTUA 2VZ9A 5TJ9A 1ONPA 1ISHA 3QVWA 3RASA 4AG3A 1WXDA 4KUHA 1QSGA 3RFTA 3OMLA 1P45A 3GA0A 4GSLA 4XDYA 3CPSA 1CERA 1DDOA 3N7UA 4IUYA 2JCVA 3WTCA 5JDIA 4CM4B 5JSFA 1YBAA 2EW8A 3Q11A 3K73O 1LDMA 4ZRMA 2X9VA 4J49A 1Y7TA 1VM6A 1BXZA 4LSWA 4IMPA 2D2IA 2Q3EA 2VRCA 4CMBA 1T2AA 4W4TA 1V9LA 1WZEA 2Q4BA 4OSOA 1DLJA 4OMUA 5JO9A 3DBRB 3JQAB 1BSVA 1HDZA 3TSCA 4B4UA 2Q4EA 2IODA 3QVXA 1HZJA 1X7DA 2ZK7A 4J0FA 4XGNA 3IJPA 5TC4A 5T57A 2Y93A 4CL8A 4BO2A 3DXFA 3RJ5A 3I9MA 4LW8A 1S7CA 3JQGB 2I66A 3KSZO 3DZIA 2VWPA 4YRDA 4NFHA 1H2HA 1M2WA 4IS3A 3OSUA 4LVCA 1DO8A 5ENDA 1U3VA 1ISJA 1QLHA 1SCUA 3FBGA 2X0NA 4MKZA 4TSKA 3WWZA 1GZ6A 2DKNA 3EZLA 4R5HA 5I7SA 1UZLA 2OMEA 1J0XO 1I2CA 2W4QA 4PLGA 3OA0A 4CMHA 1KIFA 4U6QA 1LSJA 3I5MA 2D5CA 3NKLA 2XPCA 2PGLA 3ZHBA 3EY4A 5B4TA 5EN4A 2CDAA 4YAKA 1NPDA 1P1HA 5DZSA 4UEJA 1GPDG 2X22A 3SLGA 1EZ4A 2HRBA 2BRUA 4RPLA 2OUIA 2J6IA 3B20A 5B37A 4ZQGA 2P2SA 2WMDA 4FR5A 1N1EA 2ZCUA 4ND4A 3MWEB 3VPXA 3QVSA 4AJ1A 4B4VA 4ID9A 4BO7A 1KC3A 5FFFA 3C7CB 4MVJG 5T67A 2UUOA 1C0IA 3WX0A 1JLLA 4IQGA 1RWBA 2ZQZA 4ZICA 3CEAA 4J6FA 4ZHSA 1LUAA 1EVIA 1P1JA 3LC7O 1YL5A 2NVUA 3PYXA 4AJKA 3RIHA 1IY8A 1ULSA 1MX3A 2DC1A 3F3SA 4KMSA 1YL7A 2J5QA 5LC1A 2V6BA 5F1PA 1HXHA 4MP6A 3KYDA 1TVEA 3TZCA 3SC4A 4JX8A 4B4WA 3H9JA 4Q3AA 4R5MA 4J7UA 2O3QA 5THKA 2PD3A 3JQCA 4WNCA 1CQIA 3L4BA 5KTKA 4BV9A 3ASUA 1P33A 1E7RA 1ZK4A 1WAMA 3DBHA 5IDYA 3WWYA 1HSZA 2EV9A 1BTOA 3GHYA 2D59A 3D0OA 4DL9A 4YT5A 2X86A 2EJVA 2AQHA 2FR1A 2FZEA 4OOFA 3VVBA 2WWRA 1ISMA 3D3EA 4GGOA 1GR0A 2J3JA 3GNSA 2QRJA 3LSYA 2VWGA 4I8XA 5AXDA 3R3JA 4KTVE 4TRMA 2I3GA 3QV1A 3WQQA 1DIBA 4PGFA 3ZWXA 1LXCA 3VKVA 4JBGA 1IULA 1K6IA 3LLSA 3PHGA 4JQCA 4B8ZA 2ZATA 1EUDA 4YJGA 1O94A 1X15A 2V7PA 4W7HA 2O48X 3ZGYA 2YV2A 2GDZA 4HADA 4KUEA 1BVRA 1ZBQA 2HCTA 3AY3A 4FS3A 5CDSA 5L95A 2UUPA 1DRWA 5COQA 1MFZA 2DBRA 2IZ1A 2VUSA 1LC3A 3ENKA 3KEQA 4H3VA 4E3ZA 3WIDA 4PG5A 4BGVA 4DA9A 4QSMA 1T1SA 3FWZA 5I9MA 3WOHA 4JP3A 4R3NA 4NJOA 3UXYA 4JN6B 3M2TA 2DFDA 1I3LA 2C2YA 4RVUA 1I8TA 1YJQA 3VPGA 1RM3A 1TB4A 3KM0A 1N5DA 4N5MA 1EUCA 3V8BA 4BMNA 5JC1A 3I23A 1ZJYA 5JMPA 3PZRA 4J7XA 4CLEA 2YQ5A 4BO6A 2ILTA 4M89A 2QYSA 2AE1A 2Y99A 5IJZA 3KSUA 3GN2A 1KY5A 1ISGA 4B79A 4CLDA 4LSMA 3RI3A 2FR0A 3PIIA 4R9RA 4UREA 1M6WA 4XEHA 4WLUA 3WTBA 3JTMA 2O3JA 5HS6A 1VLLA 4MOWA 4ZQFA 4BVAA 3PHHA 4FGSA 4QFDA 2DT5A 1UDAA 4W7IA 1LRKA 2Y0EA 3KYCB 3ROKA 4JJFA 4YJHB 2WDZA 1YE3A 3RKRA 3KRTA 2BMAA 2IZZA 4DBZA 4YJFB 3IUPA 4CJXA 3E1KA 4J4BA 1C1DB 1Z7EA 3SC6A 4YT2A 2W2LA 4C4OA 2Q2VA 4RVHA 1ONNA 1ZKMA 5HA5A 1ADFA 3UOGA 1PR3A 3HFGA 3UN1A 1OBFO 4WECA 4FPXA 3Q6IA 4BHTA 3GG9A 2NVBA 2VN8A 4ND3A 4GKBA 2JFHA 4BO1A 4XR4A 4DREA 5A04A 2BGKA 3JD1A 1GQYA 4MVJE 2IYOA 1PZHA 1IZ9A 2RH8A 1JWBB 3FNEA 2PNFA 4CM3A 2HO5A 4JK3A 3ZV3A 4OH1A 1I0ZA 5AQ1A 2H5LA 3IJRA 2JKVA 2B69A 1KVRA 3QRWA 3VTZA 4EBFA 4M49A 4HX5A 4H15A 3SJUA 3DC2A 3RUIA 1K6XA 3V2GA 3GZNA 1CJCA 3GC6A 5GZ3A 4TRRA 5L53A 1HE2A 2QW8A 4BUCA 2G0TA 4ZQHA 3KYBA 5I9LA 2ZIZA 3S2GA 3KV3O 1U8XX 1M66A 3LT0A 4GWGA 2X0IA 2OHXA 4YAEA 4Y6PA 3Q0EA 4GQAA 1HDOA 1YGYA 4HKTA 1PGPA 3BAZA 3I9KA 1ZMTA 3JQDA 5JXWA 3QSGA 5JY1A 2ET6A 3OEYA 2YHIA 1ORRA 1PJSA 4AJPA 1V3UA 2ZYGA 4YAGA 4J2OA 4CM9A 1MC5A 4MINA 4A27A 4CUKA 3OM9A 3FNHA 4D79A 1LQTA 1NQ5A 4QO7A 1BDMA 3FN4A 1LEHA 1PS0A 3JQ9A 3A4VA 3EGOA 5KIAA 2HU2A 3ZWYA 4EGFA 3OH8A 5DULA 4YACA 1VI2A 1HDGO 3GUCA 4IDAA 2X5JO 3TRIA 4NK4A 2W90A 3C7DB 4LN1A 3L07A 4LMRA 4B3IA 4XRGA 1DBVO 4YWJA 3F6YA 3S2EA 4GAEA 3U4DA 3DEYX 1P0FA 4G65A 1HTBA 3KO8A 1W73A 3NX4A 2J5KA 3Q3CA 5DBFA 5TLSA 1X1EA 3GMDA 1R4MA 4LISA 5LCXA 4CMJA 3IC5A 3ONEA 4UVEA 5F3RA 1YQGA 3DMTC 4YYZA 3WMWA 1RM5A 1OC4A 2VZ8A 2JAPA 1BW9B 5JCXA 4MVJM 1V3TA 2BI7A 4HFNA 3IKVA 1IZ0A 2DU8A 4WCFB 3GRKA 4O0LA 3C3XA 4XQGA 3GDFA 4ND1A 3G0OA 5FI3A 3F1KA 1A4UA 1LDBA 1I3NA 4BO3A 2DPHA 1MG5A 3NGLA 1BHSA 3GEMA 1E92A 3H4VA 4N54A 3WGOA 1I01A 4IPTA 5JS6A 4RF5A 1L1FA 3E6AA 4MKRA 5J23A 3LU1A 2Q1UA 4RL6A 1PJCA 3L6OO 2VHVA 5I7VA 2WTBA 4D0RA 3JD2A 4U6SA 4FC7A 4IIUA 2X9GA
chains in the Genus database with same CATH superfamily
5JJIA 2G9VA 3DEFA 4CR7A 3FKQA 4M0PA 2QRZA 1XRMA 3QF4B 4WNYA 4ZI5A 5HZHA 2BDEA 4ZEXA 4ZOLA 2C4UA 1RT9A 4Q7EA 4BO9A 1ODTC 2QMHA 4QFBA 3MFYA 2VP5A 4X7RA 4NBSA 4MWDA 1M34E 3IPCA 5H82A 4BQIA 1JEYB 3BGSA 3CWZA 1A9TA 1HLDA 1D9ZA 3LJKA 1LPPA 3ZV6A 4BVGA 4XTRA 3W8RA 1VBFA 2AW5A 5CEJA 3N2KB 2YWFA 1L1RA 3BB3A 2AI1A 2EGHA 2ZTUA 5I7FA 3BD7A 3K1AA 3QU2A 4UMEA 5J59A 4L5JA 4UM8B 1FFXB 1MTZA 3RSSA 1G18A 3RYCA 2AMJA 3IEIA 2IU6A 3O8OA 5C7LO 4OJKA 2C2OA 4WUVA 5U1PA 4ER3A 1Z2DA 1ZXBA 5DEIA 3WGVA 2FUNB 3KQLA 5CB4A 1B15A 2ONKA 4G25A 3RUFA 5FUQA 2NAFA 2FPLA 4X95A 2YMQA 2VZ0A 4K9OA 1NR7A 2WAAA 4LHVA 5LD2C 5LU8A 3GUZA 3CVYA 2JGKA 1HG0A 5H70A 4YMVA 1UZNA 2CDRA 5EESA 2BSQA 1NUAA 1FMCA 3BB1A 4V3CA 3ZX4A 4BLRA 4LQLA 2O4CA 5KWJA 2C7OA 5AVQA 4PF1A 3KKLA 2TECE 5FKJA 3V00A 3FTNA 4CKCA 5LQMA 3JQ6A 4JYMA 4NPHA 2Z6QA 3WL8A 2BI8A 2C4VA 3WJ1A 1H1DA 1SCIA 3NONA 3QVOA 4HAVA 5HBGA 2PY6A 1EXVA 2PE5A 4PZCA 3V6LA 2FJ0A 1RLIA 2VSFA 3MA0A 3T4XA 3M3DA 2RJ3A 3ZE0B 4U2DA 2OD2A 2CXTA 4RULA 2C42A 5LNK6 3MTBA 2CJWB 2QZJA 4Q82A 3AL2A 2QJRA 3NWBA 4WCFA 1U1GA 1KBZA 1VCOA 4PGGA 4CG1A 1J0DA 1UOEA 1T5DX 4X7MA 5E6RB 2DRIA 4G5HA 2C0QA 1KO8A 1TTPB 1RRKA 1JEEA 1X1RA 5EERA 5C8YF 4KR3A 1YR1A 2XGJA 3CW2A 2BPOA 2GOYA 1R27A 4EY7A 2CXRA 3C74A 1JHMA 2NUBA 1PS9A 3RGGA 3B48A 3HRKA 5EXSA 3WDKA 5C3MA 4LF7B 4FEAA 5FPPA 2Y2VA 2AFHA 3P0JA 1LPNA 3OOSA 1T3LA 4HFRA 4MMXB 3W5HA 1AQJA 3A0UA 3C1OA 5FADA 4EPRA 2R6JA 1OX4A 2HSZA 4RMJA 4AJJA 3NDBB 1ECGA 1KP3A 4HCJA 4TVBA 3JRXA 4N18A 3IR6A 4WESA 1A4IA 5K3FB 1U6IA 5K4HA 3A1VA 2PD6A 3IAHA 1SNYA 1XD2B 5HWSA 1IEWA 1R37A 1TM1E 3C7KA 5ES3A 2J07A 3IKJA 1Q0LA 4PYJA 1BKYA 1PZNA 2VJBA 1DCMA 2ZJ5A 5CX1A 3UK2A 3VR6D 3ZZTA 1T4GA 4ETIA 5AWFC 4BRWA 3D1VA 4WXMA 2LUOA 1IXRC 4DPKA 2JIRA 5F2KA 5JAQA 3QYPA 4K6GA 3N1UA 2WJ4A 5K3DA 3WC4A 3D3JA 4LFBB 5HGJA 5JCJD 1XELA 1UBHS 3DPIA 5THQA 3R75A 2WWXA 4TUYA 3BK2A 3UFXA 1CF4A 1NWCA 3U4IA 1AHPA 4D9JA 4QU0A 1DQNA 1C0KA 2ADMA 1Y4UA 2IHYA 3FETA 4HGRA 3RU2A 3VX3A 2R11A 1NIJA 4QKQA 3TBKA 3QUBA 4AMBA 2OZKA 1LPAB 4DC9A 4YUZA 2RKOA 5GOTA 3THYA 1PX2A 2YFYA 1AS0A 1XP8A 1U2TA 1Y8QA 4QO8A 4J7CA 2SCUB 3JTEA 3VO8A 2XUAA 3PFNA 5LQNA 1K6JA 2XQVA 2YJ5A 4D56A 1LY1A 1R8SA 2Q0XA 5FYDA 3BHIA 3PCRB 1PCXA 1D1QA 3MT7A 5BW8A 5FL7A 2CCKA 2W5UA 4MW9A 1AX9A 4HFJA 3OOEA 1DQYA 3QYAA 4KLCA 4NICA 4C5AA 4XIFA 3K4HA 4DSOA 6REQA 3DLBA 1DI0A 2V7BA 1DCFA 1WW3A 5I5GA 2D0OB 2IC5A 3NBYC 3E03A 3AR9A 4GIBA 1UAYA 3T3OA 3NBMA 1P31A 2F64A 2GCGA 1XVUA 1Z0ZA 2B4TO 2BM1A 5A5EA 3R3SA 5GP1A 1GNLA 3S81A 1YCFA 4QHSA 1F4PA 2ASEA 4YRAA 5HKKD 4P08A 1TD1A 1O6BA 2ZTVA 1HYBA 5G02A 3N74A 3WJAA 4ZI2A 4PZDA 1SOVA 2ZRPA 4KN5A 2OD9A 3ZXIA 1YC5A 3L7OA 1HE5A 2XADA 2N1MA 3N7AA 3TK1A 2YWJA 2VEOA 3H6KA 3RRYA 3B6ZA 4EFDA 5KDOA 3TBHA 4E14A 2REQA 2R5WA 4TTIA 1IPFA 4PO9A 3W7BA 1PT6A 1OVGA 1WVGA 1Z33A 2GETA 1UBTS 1R0YA 1TVKA 3GOHA 3OX2A 5CDYA 3DW1X 3NUZA 2VJQA 3P27A 4K86A 3VRHA 1JFRA 1XAJA 5MN6A 1DOHA 3WGYA 5I4IA 2VT6A 3QKSB 5CYPA 2JI9A 4FM9A 1BROA 1QYCA 1TFUA 2CWDA 2HV8A 4YQFA 1OQAA 2C95A 1CTQA 1E6KA 1JDVA 2C4MA 2ZANA 5JFTA 1Y1QA 4TMZA 4ZN6A 3WWPA 1JBKA 1E9DA 5HSGA 3JVVA 1T34A 3AYZB 3P32A 1D4ZA 4KXNA 4GXQA 4YC7A 3DFZA 2ZTMA 3MSXA 3RBVA 3UPUA 2PRSA 2AEMA 1OFIA 1BRMA 4QOEA 1K0FA 2P90A 2PGXA 3ETGA 3HN2A 1EWYA 1X94A 3OHSX 3Q9UA 4YAJA 3SQDA 5JYEA 2C82A 2OXEA 4W5TA 3DFUA 3ORHA 1YR7A 3MTIA 1XZQA 2AFIA 4Z9XA 2GB4A 2YJNA 3C97A 4O5AA 2GS9A 3AVWA 1C5KA 1XR3A 3IEXA 3C7TA 1SULA 2CXUA 3AHCA 4DSUA 2WJYA 3GQBB 3DHEA 5AHRA 4JI0B 2NPOA 1RABA 1WCV1 4IF4A 3QLUC 4NOLA 1ODCA 1NQWA 2H54A 4UZFA 1TQDA 3WR5A 3JSAA 1XVAA 4RIEA 5MDHA 1ZITA 5ADUS 3V2HA 5M2QA 4RPIA 3MINB 2TS1A 2WSLA 3RJ9A 2CNWD 5KTSA 2O54A 2GF2A 1JFTA 2DBZA 3LX4A 4M1OA 5B2ZA 2JJ1D 1U81A 1BQ3A 1JP7A 3AERB 3CLUC 4EHAA 5K8TA 5CFMA 4IDUA 3AWIA 4HV4A 5TPZA 1CUCA 1FSZA 3GFVA 1ILWA 4JLJA 1CDEA 3HXMA 1M1NB 2A6PA 2E4WA 1VJ5A 3BS4A 1XQ1A 3AQ4A 3AJEA 4JBNA 1JZSA 1KAOA 4XUDA 3Q8MA 2GLXA 1QYXA 2YY5A 3IHWA 4JEIA 5AI5A 2Y1DA 3W3AD 5HIKA 3ZDBA 3V55A 3PWZA 1B2LA 1CRZA 1Z7YA 2EYQA 3EWNA 5DMXA 4EKDA 2W4IA 4M98A 3LP5A 3EBPA 3LBFA 1U2ZA 4HJXA 1EFRD 5BSGA 4E7OA 4G0OA 5SYNA 4FC6A 4ZJZA 4A8JB 2R79A 1T2DA 3A2LA 3U9TA 1I1OA 1Y8QB 5EJ9A 3NVDA 3JWIA 3IP1A 1LDGA 4QASA 3HBLA 4C14A 2N47A 4B7ZA 3PA8A 1Q84A 3HYCA 2NSYA 4BO8A 2HA5A 3HJNA 4MTLA 3U7GA 3LUFA 3UTCA 2E5WA 3PQDA 5EHIA 1E2BA 2W2KA 3OPVA 3K5PA 2OCBA 3H2YA 3AEZA 3JQ8B 4EF6A 3AUAA 4FGZA 4KKXB 4GX1A 2HKIA 4JP1A 3GJ5A 3QYJA 4OB7A 5F2EA 3UJ9A 1OWNA 1Z26A 4MPJA 5JBIA 3UGJA 4CMEA 4UOQA 3EPPA 1UZAA 2WICA 3DT8A 3FGZA 3LYHA 3RS9A 2E87A 2IEDA 4HYQA 4DUGD 4F45A 4G5GA 4WEOA 2FMFA 2AA3A 4HATA 3SZGA 3GB9A 3V1LA 4MB0A 4PLTA 2Q6TA 2XMPA 1IHYA 4JJGA 4S0ZA 2ZBPA 3KCQA 4UTRA 1CDZA 2BZGA 3VR6A 3RKSA 2Y05A 3SC3A 5CBPA 4R0NA 3CISA 3FFXA 2IYQA 5REQB 2EQAA 1WUYA 4XUCA 2FMHA 3VZSA 5TJHA 4DJTA 5KCZA 1KQFA 5LOVA 4RY8A 4EQ6B 1BCSB 4FHZA 1G21A 2YC2C 4NHEA 4HXYA 4MCIA 4BP1A 2FFJA 2HMUA 13PKA 3DR3A 5H7XA 3U7RA 1G1AA 2PBZA 3BMCB 2W2LD 1JYEA 1VZ2A 4M0LA 1L5RA 5FUWA 4E46A 5IM5A 3WE7A 2XB9A 2I87A 4C2BA 5JMOA 3JQAA 2RGEA 3GEHA 2FGJA 3EXIB 3IEKA 5EOVA 3OPQA 3VH4A 4DCTA 5KVCA 1EFCA 1IWPB 4TL9A 5FBKA 2TMKA 3DAFA 3O26A 5JMWA 2Y0PA 3D8HA 3MWDA 2VA8A 1EINA 5K3BA 3SHWA 4DG5A 4A36A 3TF5A 2QF7A 4CUJA 3JYHA 3UMBA 1QAQA 1UDCA 3OG9A 1WBDA 3NHMA 1NIPA 2H2GA 4MARA 5LKAA 1UAGA 2AF4C 4C05A 4QUHA 3VSEA 1RPAA 721PA 1HDCA 4DJEC 2NADA 5JSZA 1OXMA 3SIPA 2Y1GA 2K2WA 4ND6A 1HKUA 2HPVA 4BVJA 3U1TA 3SICE 2R3SA 4LDQA 3UANA 1EHYA 2FEPA 4LDRA 2QV0A 4WA8A 2PD4A 3IDAA 3AVTA 1D1SA 4FILA 4FZ5A 5K7SA 4JU9A 5AJYA 2BSXA 3STTA 1QZTA 5KQRA 1MVNA 1ULAA 3HBFA 3BXZA 5J5VA 1OIWA 1WXWA 4Y9SA 3RHSA 4BWVA 1YI1A 2CB9A 3ZVNA 1VE3A 3ITEA 2J3IA 4OI2A 1VPDA 3ROPA 2JASA 3GPDG 4L15A 4MQ5A 4M0UA 3GX1A 2PRIA 1ZUNA 3H5OA 3JWJA 3JZDA 4HB0A 1CUVA 4NMMA 1GIAA 2O7SA 2XE7A 3BKXA 4KFRA 2ZWOA 4GZMA 1Z13A 4O8CA 4WZ6A 1YS4A 4AY4A 2VXOA 2ZXUA 1WEHA 2O8DB 1ZFNA 4Q4HA 1UEJA 4YCJA 4NBTA 4TL7A 2G5PA 4IDDA 1T4CA 4MCJA 1TDJA 1DHRA 1U4OA 4IIFA 4YP7A 1GOTA 3SP1A 4BCCA 4QZVA 1ZGHA 2I2CA 3LPLA 4Y9RA 2N3ZA 2IT1A 1VE9A 2YHUA 3L1HA 2W0SA 2H4HA 1D5CA 2CLIB 1OI3A 5DXFA 1RIFA 4Z8XA 2ZCJA 4KIJA 4L28A 4TKUB 3GD5A 3OC6A 4FBMA 3GCWA 4H4DA 3WRWA 2JARA 3TPFA 1YA8A 4BJ1A 3CNBA 1JHPA 1Q22A 3P5SA 4BL5A 3ESDA 5T4BA 3NKFA 3KDSE 2EBFX 3ZE9A 5BPFA 2IDJA 2WWWA 3I72A 2HRQA 3KE9A 4M8LA 4D9KA 1LJLA 3HXOA 4F7WA 4B5KA 4RD0A 1EIWA 1GV1A 3L1IA 2JFPA 1JHXA 3T5MA 1XQ9A 4NU0A 1GITA 4D4LA 2EWWA 2QAGB 5G0VA 2VFAA 2NXCA 1M6YA 1QH1B 3COVA 5CA0F 1K08A 4GEGA 4C07A 2J0VA 2CJPA 2IZOA 5CD9A 2HSJA 2H1IA 4ISCA 4R2XA 2BSAA 4YMGA 5L3SB 1IB0A 2AK3A 3ZCXA 2VTBA 3AT1A 1NFRA 3EWIA 1P1RA 3G5TA 3DOUA 1XP5A 4FN4A 4J0CA 3V33A 1A76A 2C4HA 4WK4B 4EK9A 1Q1ZA 1Z56C 2RCNA 2Z6VA 4U7TB 3H1TA 4EITA 3IAAA 2X0DA 4W82A 4P4SA 2R00A 2EP5A 4GMDA 3V8EA 4YQYA 2KLHA 2Q1TA 1NY6A 4MW7A 4HZUA 3EGEA 2WUWE 4R2HA 5CNMA 1FFYA 2HWYA 3C24A 2YINC 1M2GA 2H2DA 1MB4A 2ZSBA 1E8MA 4PNZA 4ZVVA 1GZVA 1NATA 1RXYA 5TGDA 1II0A 3G9XA 4L4ZA 3VZRA 2J30A 4U1RA 3VDMA 2ZWPA 3PGKA 4EYGA 5DBHX 4M99A 4M8NE 4PX9A 2WB2A 1DC4A 3IB3A 4NU6A 4LF9B 4IW3B 3U4QA 1LU9A 2ZRAA 3X1MA 2LD4A 3I12A 4PG4A 5IAJA 4OY3A 1LBSA 2H4FA 1WCXA 4QGBA 3HS3A 3AO0B 1XDZA 5FTJA 3BMXA 4ROTA 4CM7A 3LQ2A 2HWXA 3GL9A 4E94A 2WWIA 3O8CA 3L3BA 2WUGA 3K5IA 4LCBA 3TSOA 4CM5A 1IQPA 3CTPA 3WYNA 1IY2A 2X8BA 2RH9B 3UFXB 2AC4A 2VP4A 1IAVA 3E7FA 2BFCB 3S2ZA 1W88A 2JW5A 2WF6A 4XLTA 3FYUC 4P93A 2R7AA 2RAVA 2J4FA 4WOCA 5DT9A 1BVYF 1N0VC 1UWKA 2IGTA 3HM9A 1HNWB 1DBSA 3ONWA 2ZPTX 3TB6A 3HU1A 3H1BA 1KE2A 1SMKA 3G5UA 3RS2A 3WYGA 1DAGA 1Q17A 1UQRA 4HEA6 1PGJA 4RQUA 1MGOA 2OGUA 2ZYWX 2VH2A 3V7YA 4MDEA 3AL0C 3KB1A 4R1TA 4BFTA 1FDSA 2WLTA 5KNLA 5LYJB 1R8QA 2EFEB 2GZRA 1MX9A 4IS2A 1ZAKA 1YB1A 3AKCA 3L6BA 1M6EX 1P2SA 3L8CA 3MJ4A 1Z7WA 5A02A 1DO2A 3I83A 4O2BB 2DERA 4G5RA 4HDRB 4BUJA 2UYCA 1WP9A 1UADA 2VP0A 5K0TA 3U4AA 2BT4A 4ZZIA 4TQAA 4JLPA 3X1KA 4QUBA 1RXIA 3DW3X 1NJ8A 4DJAA 4KIUA 5BXYA 1WLYA 1CF2O 4FFSA 1FFHA 3LDGA 1YFLA 3WWEA 4KQ2A 5K45A 5LBUA 1GZSA 4L9RA 2B5OA 2WM3A 1KMHA 3TCNA 2HMYB 4I46A 1CJMA 3K0HA 2RKWA 3K8OE 4RNDB 4URUR 1JGTA 1XSEA 5FPSA 4EEXA 3OY7A 3IILA 4MQFA 4D44A 2RHGB 3GLIB 2FW6A 2V3CC 2IV2X 3MHTA 5CW2A 5EJEA 4HMQA 3I62A 5ICEA 3SFVA 3WGIA 3B6JA 1JIJA 4FHCA 1HYQA 1HL3A 1M2NA 1U0TA 3GY0A 4JITA 5AKHA 1VDMA 2FHPA 3TQSA 3WKEA 2XVZA 3TAXA 5KSWB 2Q28A 1YBHA 2PUFA 3A06A 3ZZ1A 5DXJA 2F3PA 5HKBA 1C7QA 2R86A 4HDNA 1XEXA 1E2PA 2E4AA 3EZNA 3K35A 4XOUA 4ZT4A 3U31A 3KR1A 5DOVA 1V16A 5TXGA 3RTBA 3W9BA 3WJ7A 1MQAA 2R48A 2FPGB 4L07A 4OQ4A 2OK8A 2XA9A 5DLDA 3CN7A 4DCSA 4IH1A 2B92A 1YFJA 4EKEA 3D4BA 3BH0A 2XUJA 1Y4SA 3D1JA 3HPQA 3Q4GA 2Z30A 3JATA 5MGNA 1CZRA 1B8PA 2P4HX 2Q7DA 2R2GA 3RH0A 2AQ8A 4OA5A 1E0AA 1LD3A 2KSQA 3OT4A 3SX4A 1GRRA 2H18A 2ECOA 1NBWB 3UJCA 3I3SR 3UICA 4YRNA 1K7FB 4MDFA 1Y0BA 2R5FA 4HDNB 4PZUA 1Y9EA 3PE3A 3IRUA 1K6MA 2QS9A 5CVJA 2PZEA 2RG7A 1HYGA 3I2KA 3BIXA 3EQ6A 3O8BA 4PFSA 5DLEA 1Z5UA 4QL3A 4TKMA 2G71A 3H3FA 2IXFA 1TYDE 2MOKA 2QAIA 4MQ6A 1PL0A 2B1GA 2NUTB 2IUFA 3QEOA 1EJ0A 3N2IA 2JZNA 4J03A 3RIXA 5JWHA 3FKSA 4BFVA 1FYDA 5AM1A 2RHBA 4RTJA 2PT5A 3RQIA 3P71T 2V4ZA 4DMCA 2PRZA 4QYIB 3PNMA 2QTNA 1K89A 2QTRA 3WA6A 1DX6A 4R2WA 2ZB3A 3H0KA 3JQAD 2TSYB 1A27A 1OPXA 3QU9A 3FOWA 1NY5A 3P20A 4X1YB 3VUFA 4TYWA 4NU5A 4G36A 4AF7A 3LPAA 1PYDA 4RNCA 3UA3A 2DLDA 5K3OA 2AR0A 2WP8J 1YNOA 2HV9A 2ZETA 2EG5A 3QPWA 3LLCA 1EA7A 1QLWA 1RSZA 2HF2A 3ZC3A 3OAAA 5BNTA 1BFUA 5KNDH 1RKUA 4NBWA 1GUAA 3UPDA 3CNLA 5AOBA 2H29A 4G07A 4GBJA 1FMLA 3RRMA 3F90A 5LXTA 5TX7A 3M34A 3DPSA 1H85A 1ZM7A 5KSZA 3ERCA 3G89A 3PHIA 3Q72A 4GZ3A 1LDYA 1SVUA 2XA2A 4TLMB 2AXQA 4QYTA 4AQYB 3H5NA 3ZDDA 4WJKB 1IEQA 2ZTLA 5HIIA 3QWBA 4DCVA 3MMXA 4AJOA 4E1BA 1L5HA 1XO1A 3O2QB 1Q1EA 1LH0A 1LWOA 1GRQA 2JAHA 1QGED 2QA5A 1FDWA 3KTAA 4X65B 4GC9A 4YLEA 1DJMA 2WM9B 3ABIA 4AXXA 1VE1A 3BXPA 4IV0A 1UKVY 2YWHA 3IQZA 3IAM1 1D2AA 4IZOA 5CJJA 2QTTA 1ZA2A 4ES6A 3Q10A 1AUVA 3USCS 1DAFA 4U0JA 3KD2A 1N1DA 1O8BA 1Q5PA 3L0PA 1JS1X 2VWHA 1Y81A 4HH4A 5AR1A 3W05A 2AB0A 2FPRA 4TLEA 1IZ8A 4YR9A 3GP3A 4YP1A 2BFFA 5CB8A 2J6BA 5LQUA 3JZAA 1KSGA 3R24A 3BRWD 4XWAA 1GQ2A 3V1NA 3G8AA 1FZQA 2GN4A 3M49A 2XIJA 4BV3A 4ENTA 1KBOA 4IRXA 1B8OA 2OFWA 1L5QA 2VF8A 3ZE7A 3K70B 1GTMA 3TW8B 2Y1LA 4Z1OA 2UXDB 4BP8A 3RABA 2VPZA 2ZE5A 4NC9A 3WADA 2IE8A 5HS4A 5K3SA 1U65A 1QQTA 3NBZC 4DTIA 2FJPA 1DBPA 3K1YA 4LVUA 3BKWA 3IDZA 2DVMA 4MUYA 1S2NA 2Z6AA 4XASA 3R41A 1XA3A 4LZOA 2QORA 3WAJA 2ID9A 1U8FO 3QMVA 3KK0A 4OJTA 1I94B 2RK4A 2X4LA 5L3ZA 2XUOA 1CHDA 2PTGA 3B53X 3TINA 2WG2A 3PFKA 4UD6A 3NGXA 4KYUA 3U2QA 5B55A 2VQSA 2W0MA 5FOVA 2YVQA 1U99A 1G8HA 1Y3HA 4G85A 2B2XA 3FDXA 5D3MB 4FIDA 3ZW8A 3PEEA 4FGWA 2O3TA 1Z0JA 2Y1WA 4N0EA 3E4CA 2ECPA 2CMGA 1W5BA 3GNQA 2JI4A 4LZZA 3INGA 1XNJA 2RCYA 2P3QA 3I2GA 5I9BA 1AF4A 3NDJA 2B8WA 4TTJA 1DLIA 1VOTA 4LWPA 1S1MA 3LLVA 1Q2XA 1XZGA 1VPWA 4MWTA 1DXHA 2AUNA 2DSNA 5DPMA 5IVKA 2AG5A 2E1RA 1QBGA 2APJA 2Q21A 4LRUA 4BATA 2BGNA 2CXHA 1IOLA 2IYNA 3BA6A 3I8SA 5CJPA 5BV0A 2SECE 2CL7X 5CLJA 1FS5A 3HKCA 3ED1A 3WYAA 1W8IA 2UKDA 3NEAA 5ILGA 3SU8A 1R0WA 4ZFNA 1RAFA 3A2KA 2OD7A 4B9AA 3RC1A 4O2RA 2OBMA 2C54A 1E9AA 3S2UA 1NWHA 2QN1A 3KLOA 5LIRA 1LTKA 1N92A 4P3PA 5JOQA 2GCOB 1XZFA 3KWLA 1PFVA 3GAFA 1T15A 3DZDA 4JH0A 4OBWA 5DLQC 5LQSA 1TQHA 2AXEA 4TV8F 2K87A 1FFEA 2YIMA 5C5CA 2EKQA 5FUYA 3IVXA 3SIWA 1L4UA 4D8TA 2E21A 1DKRA 4G2NA 3MJRA 4P2BA 4KSCA 4YECA 1JH8A 2PLAA 5AK3A 3RC2A 1E1YA 4CM8B 2CUKA 2UDPA 2PMWB 1D6SA 1S01A 1Z4OA 2JRLA 1K7SN 3K9WA 3QW4B 5IJ0B 5EQFA 3RKUA 1MAUA 2I3BA 2Z5FA 3W2FA 1AK2A 4FGLA 4MRAA 1EHIA 3JQ7A 3ZZMA 1IBMB 2QRVA 3JVUA 2ATIA 1UC5B 2FSVA 1WZNA 2I6TA 3ROQA 1ENPA 4LCEA 1ZLYA 5KYYB 1XT6A 4IR7A 3AB3A 3P9QA 4M86A 4OYHA 5F3DA 2ONJA 3W4KA 4BJ3A 5A3QA 3ETCA 1EWTA 3K31A 1E5LA 2VNJA 3ICVA 3LP8A 3M3HA 3ZI0A 3WQHA 4J3FA 5A4MS 4Y1RA 2JFGA 1NG9A 2AZXA 1TF2A 3B52X 2QUIA 2EIXA 4JGBA 5JNUA 3OU2A 5EJGA 3WYCA 1N7GA 2I99A 5AJVB 4NJMB 4DS3A 2UUCB 3N2KA 2QRQA 2QTZA 4KW7A 5G0UA 4CMKA 2B20A 5FFMA 3COWA 3F5SA 2TMYA 3NOOA 3IQXA 5ECDA 3CVOA 1PQWA 4D02A 2HSGA 1RQGA 3HL0A 3U4HA 2JIPA 2CVHA 5D1NA 5B57C 3G7SA 5HZMA 3JYNA 3BIFA 3P9CA 2OLKA 1J09A 2FCRA 1K8ZB 2YVUA 3S99A 5E3HA 3TIIA 1LI7A 1X7YB 2NAPA 1AZSC 3L02A 4FINA 3RR2A 3HC7A 1WOYA 4HGYA 3H1AA 3IV6A 4CKWB 1SD2A 1EQUA 5ICGA 4DYHA 3VA7A 4D3ZA 1UPFA 1X74A 2GAOA 3ODGA 5AW0A 4I4TB 4ZVLA 1DBQA 2D00A 4MMYB 3UK0A 4BZZA 4LZLA 1RBQA 2ZQYA 4WIAA 1OFGA 2FMTA 2IS2A 2F3RA 1Q14A 1W88B 5EIOA 1M8GA 1V35A 2B7CA 4QYIA 3EIXA 4NMLA 5I4BA 3CJQA 4L6CA 4EMBA 2FEMA 3GFSA 1G60A 3FMVA 4AS1A 3GLSA 2A9JA 1UBCA 3KPJA 1T5SA 3ZE1B 4GDMA 5LQJA 1M3SA 5KOJA 2BTQA 2Y0CA 3DV2A 3I2JA 4MZDA 5D5HA 4OVKA 4X8HA 2AXNA 3U6BA 1VE7A 3UMGA 1KJNA 3BTVA 3QTBA 2QLLA 2B37A 4OAQA 4WN9B 2R84A 4B9EA 1AV6A 1N0UA 4QULA 3IIMA 3WQSB 3NRCA 5TSDA 4Q3OA 1U2RA 2IIVA 2XGOA 5AK0A 1TZBA 3LWNA 5F76A 2VYQA 3LP6A 2Z56A 3ONFA 5AI4A 5D86A 2EFJA 3LPNA 4NH4A 1GTJ1 4FFPA 4ZGGA 3BZUA 2N1BA 2PSFA 3AEKB 3ON5A 2BKVA 3L7MA 2B5WA 4N5IX 1FS6A 4I1VA 4A6DA 1HDEA 4EVRA 3MRTA 2B7BA 1J5EB 1UPUA 2OYSA 1WABA 3AQIA 4YAUA 4B35A 1QKJA 1Y1RA 2D2VA 4Y9UA 5ITWA 4B3MB 5IUNC 5KNCH 1OLUA 2CE7A 3AONB 5FTWA 1XQYA 4JOBA 4BLSA 4PO3X 3HYLA 2CNNA 3H9GA 3L4SO 5EI5A 1ZH4A 1XEXB 3CUTA 1JDUA 1YH3A 4CKBA 1SKAA 3SCZA 1MOPA 4PRKA 1ECJA 1OYWA 3TAUA 4QATA 3MLBA 1Q0QA 5KSOA 3HY4A 1EKXA 2IS4A 1U4SA 5CXQA 1YMVA 3C8UA 3CZRA 1O6ZA 2DPXA 3W4IA 5HKAA 1ZHOA 1N5RA 2CLMB 1W0KD 4GXNA 4E08A 4ZV4A 2A7QA 2QQFA 1SFRA 4IJWA 2A4MA 2I4LA 3MCZA 4CF3A 1IPHA 4HH1A 3PXUA 4BN4A 4BNLA 4UTPA 3LQFA 5GVSA 2EW2A 3G49A 4KI0A 5K01A 2ZIUB 1K88A 4B81A 4RLQA 1ADJA 1KMHB 1SUFA 1P4GA 1SR8A 2FSHA 3IIKA 1X7YA 2P69A 3U62A 4F3YA 3P7MA 4Q6WA 1P72A 5DNAA 2VUTA 2VA9A 3ZWPA 3O8NA 1CX9B 3LX8A 2OHOA 5TPZD 4N76A 1L3IA 2RFLA 3BRCA 3AXSA 3GPBA 3OUUA 4QSHA 2HWKA 4E5VA 2GXAA 1QJ4A 1SO8A 3SX2A 1CDOA 2JHFA 5A4DA 1INLA 1NE2A 3VTFA 1GDTA 2IEZA 4S3MA 3LSTA 3RTGA 5BMVF 1OB2A 3KELA 3UXMA 1NF8A 1J8VA 4TX1A 4NZYA 1T8YA 3GELA 3LCJA 4MQBA 1V5WA 3L46A 3G02A 4IIYA 2VTVA 4J1GA 1JSLA 1VHDA 2GN0A 1H8ED 2NNLD 4MITA 4NIMA 4E2XA 4MULA 3SQOA 2EW1A 3BXFA 3U37A 2NU9B 5BN4A 4UARA 4UASA 1ZSVA 3QLEA 3FX2A 5H3LA 4P33A 4CXMA 4L4YA 1M74A 2QTGA 3GRFA 3U1VA 4WSOA 2I29A 1LSSA 2F1KA 2XJ4A 1YIDA 2WIDA 4QYWA 1VYTA 3ESRA 2P2YA 3VVMA 3F4BA 4BLWA 1W0JA 1C3OB 1JLRA 1G0OA 1W34A 1WJGA 4OJYA 4TQGA 2PQ0A 2HDWA 4IDFA 4KEAA 1YU9A 3ZN2A 1U3WA 2DEUA 3AOEC 1RLTA 1YIOA 2P9CA 2R8ZA 3LMKA 3AIOA 4M6WA 5CVCA 3GK3A 1VJ1A 5SYAA 3TW4A 4AWAA 3NHLA 1M8KA 4TTAA 5B1SA 1PLKA 3B8EA 3S40A 2HYIC 2P2DA 2NSLA 4P98A 5A0VA 2ONYA 4Q6BA 1AGPA 1WMBA 3F5MA 4RFLA 2XTMA 2Q5IA 3WP1B 5KJ6A 3CKMA 1EM6A 3QX8A 3MCVA 5L3QA 1QGDA 1R4MB 2P4SA 3ANYB 4Q19A 1QH0A 3PC6A 4O6VA 4EW3A 1CIVA 5KEIA 5FBWB 1FP4B 1NJ2A 4QDKA 5ECWA 4EFNA 2O2CA 3KFLA 3F8WA 3PHBE 3D7NA 1EUZA 4YI5A 2ZWVA 3C3WA 1HC7A 2C3YA 2FPKA 2FX5A 2QR5A 4K6OA 4KPUA 4PTZA 4EPVA 1NGSA 1ZS9A 1QYRA 1Y1KE 1JG6A 3EIUA 3OLXA 1U5CA 4L8FA 3S7TA 5FR2A 2GJAA 2V03A 2XZPA 3AOGA 3OCCA 4M0KA 5CIYA 2JBWA 2FN3A 4S2EA 4A2WA 4WXYB 7MHTA 3RS3A 3GWGA 4G41A 4EUKA 2OUKA 2B0CA 1PLLA 5C31A 1GPJA 2ZBRA 1EK1A 2WHXA 4MK4A 2JL1A 5TARA 3ZHVA 5E3IA 2OV6A 2QB5A 1L5YA 1KIAA 1MFPA 4PSAA 5D85A 1OH8A 3H1EA 3NKVA 4P4SB 1MJGA 4KLRA 1P44A 4ZP1A 3I4LA 3NRBA 1YS6A 2JLWA 2YASA 2FR8A 3ZTTA 4R8SA 5COBA 2QVCA 3UJ8A 2H9AA 1RYHA 2HSEA 3JU3A 4AL4A 2ZI7A 4KJZA 1EM8B 4AMVA 3VR3A 2HPHA 3NP7A 4QQKA 1D0IA 2W2KB 3CLHA 3FYTA 2GF9A 2VDOB 2N46A 3B89A 1H93A 3O0TA 5ALSA 1AUXA 3UCFA 2COKA 2VXBA 1KXZA 3PDUA 1LLFA 5AW2A 4UVGA 1I30A 3PNSA 3HR7A 3FE2A 3WL6A 4EJ6A 1X87A 3I45A 4RJJA 1TM3E 4Q3DA 4RCVA 2V9PA 3TECE 4GYWA 3OHPA 4PC6A 4XD7D 3VYWA 4MUMA 5BR4A 4Z7OB 4JLBA 4LK3A 1B76A 5AHKA 1WMDA 4AKSA 4DQKA 4A73A 3K9CA 4R2MA 1BX3A 3FRHA 1M1XB 1L7QA 1OTHA 1QRDA 1TLFA 2CVOA 4MKIA 1Z0FA 4RH0A 4PGAA 1BQ4A 4HSGA 5JJKA 1S2LA 3GJ3A 2WWFA 4HEA1 1ZNXA 5JDCC 2IK8A 2PUDA 1A9QA 5UKDA 1JJIA 2HRZA 1K92A 4Y7DA 3VGPA 4GOND 3GFTA 2X42A 3PT9A 2WUVA 3RWBA 1ETUA 2RHCA 2WMOB 1G5QA 2LKDA 4DR5B 3ENNA 2HK7A 3F67A 2E37A 3SZLA 3VSAA 1U80A 2UZ3A 3TMKA 1T8WA 2PCLA 1MC1A 1NASA 1Z2PX 3PIDA 4PFKA 4WOKA 4UNNA 4B73A 1H2EA 1BN7A 2B4AA 3FF4A 4G81A 4D5GA 3F8SA 3QF4A 1V43A 2PU7A 2PYDA 4CW7A 3AFMA 3RLFA 1B3BA 1OWLA 1ZA1A 1UDXA 4KHZA 4N3GA 3SJZA 5CX4A 2XAUA 4DM4A 4N5NA 3CVJA 4BASA 2D6FA 2O8EA 2FW9A 2XH8A 2EP7A 2OXRA 2QL7A 4X64B 4C0JA 3EHEA 2QZSA 3P9RA 2XI4A 1SXPA 2X7XA 1YKGA 1UR5A 1JIVA 2XB6A 2ZRNA 2CL5A 1AS2A 2ANBA 3TTUA 2V9ZA 3WGMA 2PZGA 3JAMA 3RVNA 2H5IA 3U3JA 4C3OB 4TM7A 2VDWB 1ZMBA 3B70A 2XNCA 3WO1A 2VJLA 3CRVA 1XJQA 2QPTA 1RXCA 2B83A 3C7AA 4QFMA 5FBHA 2V5UA 2OXTA 4Z1MD 4HNRA 4YTEA 5IP5A 2I7XA 3GGGA 5E4YA 4A5OA 1O2DA 1XZEA 4J3JA 4YRKA 3CE9A 1PT7A 4LZAA 5ALWA 3A36A 5I47A 3O03A 1O95C 3ZBPA 1L4FA 2ZBUA 4AJLA 5ICMA 3FWYA 4U5XA 3HXKA 4D45A 4BQEA 1VLVA 1H2BA 3RK0A 5SZJA 1M67A 2JFVA 3HDHA 3WGLA 4E5PA 1QHIA 3VBCA 1UJ2A 4AU1A 1H1TA 2FTKE 1KOFA 1OA1A 3L43A 5C5IA 5CA1B 2FUG6 4KI7A 4H7IA 1VLZA 2JFYA 3JALA 4X1IB 1DJQA 2FG5A 4X66B 3TVDA 4MW6A 1EU1A 1ZLXA 1CRWG 3ZJTA 1RJGA 4MW2A 4BV8A 1KJIA 3K0CA 5BYBA 3AL3A 2VCEA 1OLXA 4PCAA 4LDJA 1DOAA 2W6IA 3RYFB 2WU0A 1YJ5A 3EMBA 3GJ4A 4ON9A 5FI0B 1GA4A 1PZEA 3H4MA 1YUMA 3R8XA 3SSNA 2QYHA 4G5FA 1XTTA 4D0LB 2P4QA 4F9EA 2OGSA 2ZTSA 3NTXA 4L9AA 4R81A 1SVKA 4QDTA 3NEJA 2O07A 4G5SA 2OHFA 3L1UA 4I55F 1QP8A 3DD1A 1ZC3A 1XZLA 1TUBA 3VSBA 4YLGA 2Y0BA 3VC7A 4E31A 2OBFA 3RF7A 1F0PA 1N75A 5A5FA 3KXIA 4LEIA 5C34B 4FU0A 4CMIB 1ML4A 4BMOB 4Z5XA 3L4JA 1GKIA 1YJXA 4OHWA 4QU9A 4H1HA 4YJGB 4J0QA 1AN9A 4AZSA 4A15A 1EXMA 5IM4A 4LK2A 2FZGA 4N7MA 3RK1A 4NNJA 3GNTA 2VYCA 2XTZA 4AAYA 2IUSA 3MBIA 4H4CA 4RESA 1NXQA 2JDID 2OZEA 5FTKA 2OA0A 2HMWA 4CLOA 4A0RA 4D25A 1DV1A 2BHSA 1T26A 2IFTA 2OGWA 2XUDA 4KIGA 5CDGA 3GJ8A 1I1HA 1KC1A 1ENZA 4ERXA 1ZSYA 1KWKA 1Z5WA 6Q21A 2FQ1A 4FDAA 4IDNA 5DW3A 3W6OA 3ITNA 3U3OA 2CUNA 1CJBA 2WFAA 4X63A 1JAXA 2CY0A 4BBAA 5BV1A 1IQ0A 3KXPA 1Y34E 2R5NA 4QEZA 1C7EA 1JZTA 1ZK3A 5DO9A 5BWOA 4REOA 5KBYA 2C7RA 2M6RA 4K81B 4CIAA 5IT0A 3SG0A 3KPYA 4WZBE 5D3QA 1UDBA 1WZUA 5G0TA 2O4UX 1KI7A 2C5BA 4Z9AA 3BE6A 2NO5A 3PPIA 4LWZA 4F96A 3VH1A 3MAGA 1RQRA 1TMKA 3ETDA 3ZWQA 4WKNA 3ZNNA 1K68A 1QJCA 5BVHA 2VKTA 4U7FA 4QHYA 1OWMA 4DXHA 3E2MA 5B7QA 4UCQA 3VISA 2CCGA 4MWZA 2IPOA 5DGCA 5EPOA 4PWZA 1YVEI 2VBCA 3FI9A 4D3FA 1KY4A 3KLNA 4I3HA 4XWYA 5EUMA 1JEJA 1TIKA 1F3LA 4INOA 3QNUA 1RMYA 4JR1A 4K9DA 4UUMA 2D7CA 3FNQA 4UHJA 2V7QA 2GN8A 5FPHA 2WU1A 2H1CA 1ZIPA 2Q5OA 2P1DA 1XQWA 3LZ6A 4H3SA 1HDYA 4X7BA 1XZJA 2WWHA 3M7IA 5CW1A 3THSA 3IQWA 4PTLA 8ADHA 5JAIA 4WACA 3T5BA 3IBGA 5EKXA 1MT3A 5EWMA 1TEZA 5KDDA 3T41A 3BULA 3QBEA 3TIVA 1JKIA 1PWYE 1RRCA 4CODB 1XZCA 2VPIA 1VGVA 2HK6A 1PJBA 3HLKA 1QYVA 4L8WB 4E13A 3DOCA 4JEUA 1ZD1A 2ODBA 3RS5A 3FPSA 4JNKA 2XWQA 3G9UA 4JXKA 2CDBA 4QQ8A 4AK9A 1H9CA 1DFGA 3N53A 4LRTB 4P3YA 4YJ3A 3NPMA 2YWDA 3SHVA 3VPSA 2Q50A 1PL6A 2VJKA 1E1CB 5CLIA 4JWTA 4XGQA 1PLJA 2QUHA 3DQZA 5TS2A 5FIUA 1MRSA 2R751 4BNDB 1IY9A 4YMTA 5TQ2B 5E0KB 4LTMA 4L2IB 3DOOA 1NDHA 3DEIA 1TF5A 3SD7A 1RTTA 1Y6ZA 1RXSA 3ESCA 4I9NA 4MUBA 4DLTA 1R74A 4B8YA 1DQZA 3G5LA 3JZMA 4XX0A 1S9HA 3M6AA 3U39A 2G3YA 2ZSFA 4AB1A 1Y8CA 1GL9B 4GWLA 5T7BA 1WXIA 3OBBA 4OQFA 1U9YA 1OZGA 5K0JA 3O4FA 1L7XA 3GCZA 1SUSA 5EUQB 1IMOA 4OQPA 2DT8A 1G291 3W1EA 4L08A 4QC2A 3K2QA 2B1QA 2H00A 1F6WA 1OD6A 2VDNB 1USUA 2PM8A 3A3NA 1QZUA 3A9VA 5DX0A 3KSMA 4Y30A 4AZ0B 4NYIQ 4RTKA 5SY6A 1JV2B 1V6SA 4N0QA 4ZREA 1T4DA 1USWA 1NMYA 2OCGA 3AY7A 2VJMA 5EUBA