1VL0A

Crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
b'HMKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNPQSAYGKTKLEGENFVKALNPKYYIVRTAWLYGDGNNFVKTMINLGKTHDELKVVHDQVGTPTSTVDLARVVLKVIDEKNYGTFHCTCKGICSWYDFAVEIFRLTGIDVKVTPCTTEEFPRPAKRPKYSVLRNYMLELTTGDITREWKESLKEYIDLLQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-dehydrorhamnose reductase, rfbD ortholog
publication title Crystal structure of DTDP-4-dehydrorhamnose reductase, rfbD ortholog (CAC2315) from Clostridium acetobutylicum at 2.05 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vl0A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1vl0A02
5COBA 1GAEO 4Q39A 5L7YA 4G65A 1E7YA 3KXDA 3RASA 4CM3A 1X7GA 2BGLA 4JJGA 4ZQGA 3LYLA 3ZV6A 5K0ZA 3GGOA 1GD1O 2FSVA 5JC8A 5F5NA 2BI7A 4M8SA 4MVJD 2C0CA 1DC6A 4IDGA 1EBUA 2R00A 4IXWA 4AJ4A 4BB5A 4RVSA 5B4UA 1PTJA 1W0CA 2AQHA 3HFGA 3X2EA 3PHHA 2RH4A 4U8GA 3WSWA 3MWEB 4PG8A 2AE1A 1C0LA 2BF7A 4HV4A 4BGEA 3GT0A 2Q50A 1QORA 2IDZA 1U5CA 2Y1FA 4I8XA 3G17A 1DFHA 4FPXA 2X9GA 2Y93A 1ADCA 5HS6A 4BMVA 1PJBA 4N18A 3NT2A 1A7KA 1UJMA 3DFZA 3AM3A 2YJZA 2PV7A 1NAIA 3I52A 4JJIA 1GY8A 3EVNA 2ZYAA 2DFVA 4CMAA 4CMEC 1RYDA 2DU8A 4DC1A 5BR7A 3OETA 4YJGA 4BNKA 3D3EA 3AM5A 3QP9A 4J1QA 4TRJA 4NHEA 1W4ZA 3VPGA 1IE3A 2B0JA 3MJVA 5G0WA 2IODA 3ZWPA 1QKIA 3OFSA 2YHIA 1BMDA 1N1GA 1T2DA 2O48X 1OC4A 1XLTA 1PJQA 2C82A 2UYYA 1DIBA 1P1FA 2HK8A 3LSYA 4IIVA 2DUWA 5F1KA 3VVCA 4XYLA 4FFNA 2YYYA 3OQ1A 1AN9A 1LSJA 4BNTA 3WFJA 3EYWA 1OMOA 4TVBA 3GR6A 4QUKA 1Y8RB 3A9WA 3P19A 3F46A 1DLIA 1FDVA 3WX0A 2CVZA 4TKMA 3GZNB 3IJRA 2JFHA 3GVPA 3PYXA 1J49A 5L4SA 1GEEA 1CERA 3D4OA 3TZCA 4RVHA 1WAMA 1E77A 2WTBA 1GV0A 2CFCA 3JQ7B 3CEAA 4QO8A 1NVMB 4XKJA 2Q2WA 3IL2A 3AK4A 3BMQA 2PD4A 1GPDG 1DC4A 1HTBA 1NPDA 4WKGA 2GPTA 3WGIA 4OOFA 1N9GA 5I7FA 1PL8A 4ZQBA 3MTGA 1YWGO 3KOUA 4CM9D 3GMDA 3GNQA 3AOEC 5JCJD 1MV8A 4PG4A 1XG5A 4ITUA 2W2LA 5I9NA 3NJ4A 4ONEA 4BNWA 3DDNA 4YAJA 4FJ0A 2FR1A 4ALKA 4ALIA 4J49A 2YV3A 1B2LA 4UULA 4R5HA 1EUDA 3BXXA 1L7EA 2JHGA 4QECA 4GVLA 5JPIA 5EESA 3FNGA 2E48A 4GL4A 5I8ZA 2H1SA 1U9JA 1P33A 1U5AA 5CHEA 5DBGA 3VOSA 2FY8A 4MVJE 2EHDA 3JD3A 3RC9A 4PCVA 1YQGA 2VHXA 2CDCA 1XR3A 2LDBA 1PU2A 2YHUA 2X0RA 4L73A 4R5MA 4IDAA 4R9SA 5G0TA 3WGZA 4OGWA 4R3WA 1CEQA 5EMHA 1E6EA 4GX2A 3IUSA 3DAFA 2Q1UA 5JCXA 4PVDA 4A03A 1YQDA 1PS9A 4BNVA 1HSZA 2DVMA 5THQA 3BYZA 3DQPA 3MWDB 1QXSA 2BLLA 3H3FA 1LI4A 4L74A 1FMCA 2AG5A 2ZTVA 1E5LA 1O8CA 4BO9A 1ZO8A 2GR9A 1YH3A 2EGHA 3P7MA 1ZIDA 4IDDA 3NTRA 3PIDA 3PQEA 1DRUA 3EK2A 4A26A 2GZ2A 4L4RA 2EP5A 5JO9A 4Q3EA 1Q2XA 4U5QA 1R66A 4NR0A 3TZHA 4BB6A 5L9AA 4ZJUA 4FFLA 1SCUA 3D64A 3TPCA 3ZU4A 2JAPA 4OXYA 2NVBA 3NGLA 1XHLA 2W90A 3B20A 4LSMA 4ZN6A 3E03A 4RQTA 3MJEA 3HN7A 2IEDA 1KEVA 3ONEA 3PWZA 5A4DA 4Y67A 2PNFA 3AWDA 2I66A 3IOYA 1I5RA 1BRMA 4P38A 3GQVA 2F00A 3QWHA 3DOCA 3WFIA 2O4UX 3ENNA 3G0OA 2Q49A 3GUYA 1ZK2A 2ZTLA 2EW8A 1JWAB 3AW9A 3IC5A 1BXGB 1F14A 4DMLA 2ZCUA 4GX5A 4DIBA 1QYDA 5HWSA 1N7HA 2XXBA 3WWYA 4XB2A 1MP0A 5L40A 3CUKA 2OL4A 1DDOA 1U4OA 2Y1CA 1WPQA 2CDAA 4GVXA 1OBFO 2W2KA 3OSUA 1NVGA 5HBRA 3GGPA 2JD0A 3JQDA 1I10A 3F6YA 3JQCA 4JLWA 4UEJA 4RZHA 1NASA 3RUHA 9LDTA 3KSDO 1XYGA 1X15A 4IGEA 1SMKA 1DBVO 2GF2A 1XEAA 2F1KA 1CWUA 4WLNA 1QMGA 4ZHSA 5KKAA 4INAA 3ENKA 5F3RA 1GEGA 4KUHA 1I3KA 4BHTA 3HNPA 1JKJA 1YL6A 2H6EA 3PYMA 4XJTA 2ZKLA 1I8TA 5T57A 1GZ4A 1H9BA 3DHNA 5GZ6A 3GH3A 2NTVA 1YVEI 2V6MA 4BO7A 1X7DA 4JCOA 3WQQA 5K9ZA 3JYQA 4DYDA 1PGQA 4NJMB 1ZEJA 3JD0A 3UGKA 4WLFA 1HETA 4PG6A 4DVJA 5CDSA 1QP8A 6ADHA 4BO2A 4DLBA 1HDYA 4N5MA 4WEOA 1QYWA 1LDMA 2CNBA 2HDHA 1J4AA 1K6IA 1DRVA 5KJCA 2ZCVA 4OHUA 3VZSA 2A94A 3RFTA 5I9MA 3VPSA 4BO6A 3VKVA 4CMEA 3B1FA 1VKNA 3NKLA 3L6OO 3PZRA 2EKPA 1DLJA 1CIVA 1GL3A 4CJXA 4RF4A 1I30A 1KOLA 4EW6A 5JAZA 4WJZA 1V0JA 1HEUA 2C54A 4S1VA 1VC2A 1DIRA 5G2OA 3SXPA 3IMFA 1SO8A 2AE2A 1T4BA 2EWMA 2PZLA 5AXDA 1PGPA 2C20A 3PP8A 4R41A 3UXYA 4N54A 1UDCA 2Q4EA 1WDKA 1ZUD1 2WD8A 4B8ZA 3UHAA 1HDGO 1X1TA 1SNYA 4E33A 4R16A 1A4IA 4PRLA 3LU1A 3GOHA 1H6DA 3KM0A 4E5YA 2JFFA 4QTZA 3E5MA 1PQWA 3QVOA 5JE8A 3ZCXA 4MPDA 3K9QO 1FDTA 4MVJH 2HMTA 4YT5A 1XQ1A 3KEOA 4CQMD 3RFXA 3DBLA 1JKFA 3JYLA 1B14A 1WZIA 3P2YA 5H83A 2DT5A 4IJKA 1Y7TA 3AUAA 1YB1A 2WM3A 5FF9A 3ZNPA 4ZGWA 1E7MA 4AJOA 1CETA 3AOEA 1GUZA 1EDOA 1GUYA 1WZEA 2X0IA 1HKUA 3AJRA 4H15A 4WCDA 1VL8A 2PGJA 4QX6A 1JDJA 2HCTA 3KYCA 1Y5MA 5A03A 3RI3A 4UAGA 2HQ1A 2PGLA 4OIMA 2G5CA 3OICA 3GHHA 3BTSA 3WIEA 1D3AA 2B5VA 1YOVB 4F46A 1A71A 2Q1WA 2AG8A 4R54A 1C3VA 1I01A 3ROKA 1K5HA 4HKTA 4OQYA 4Z0HO 4CMHA 4PLPA 4BO8A 1GYRA 3DZFA 2J3JA 1DFIA 4ZQFA 3ANNA 1Y1PA 2ZB4A 5JMWA 5LCXA 4M87A 4WASA 4XRGA 1I33A 1LLQA 5MGBA 2J6IA 3T7CA 3BHJA 4JXKA 4KOAA 5KIAA 1IZ9A 1NP3A 2OMEA 3DB2A 4NBVA 1LRJA 5DCYA 3V1TC 3W4JA 1CF2O 3COSA 3K5PA 3SC4A 2V7PA 3NTOA 1GYPA 2Y1GA 1G0NA 1U8XX 4FOOA 4UEKA 1M67A 4BNJA 4BNFA 4FFOA 4CMIA 1Y8QA 3JQ8A 4GSLA 3PWSA 1DRWA 3E82A 1PJ2A 1X14A 3Q2KA 4E5MA 1PR3A 1O5IA 3ANMA 1H0KA 2P91A 4WLOA 1MB4A 2GN9A 3JQGA 4QXMA 1YJ8A 3OIDA 4I5DA 1LJ8A 5DULA 3RBXA 4B8WA 3WJAA 1Z7BA 3GA0A 4CMBA 2IEBA 2OBYA 1D4FA 4B3IA 4E4YA 3K30A 1DC5A 3LLVA 2NVUB 4DLAA 3PRJA 5A9TA 3RJ9A 3LT0A 4TVOA 1E5QA 4RVUA 1XCBA 1WNTA 1C0KA 3PQDA 1ZMOA 4BKUA 2PD6A 2QX7A 4ALLA 1VM6A 2NTNA 1MGOA 3AY7A 4DQVA 3RSHA 2JCVA 3GC6A 4YJDA 3O38A 4BQPA 4BMNA 4NBWA 4CMKA 1RYEA 4AICA 1ZXBA 4QT0A 3CINA 1H2HA 3K2EA 3JQEA 4BGUA 3TDKA 1LRKA 3ZHXA 2OBNA 4CLDA 3ZWVA 3ULKA 2WMDA 4BGIA 3GPDG 3JQFC 2C29D 2JL1A 3A14A 5L51A 4IIUA 5JY1A 4BOYA 3CE6A 1I2CA 1SB8A 2P9GA 1R4NA 2GN6A 1EEHA 5TT0A 3NGXA 3W8FA 1GU7A 4K6FA 3LLSA 1SOVA 4II3A 1H93A 4TRRA 5AXBA 4FC7A 1ISGA 2OGUA 2Y99A 2FPIA 1HRDA 4KWHA 1P44A 3TWOA 3PIIA 4C7KA 5A04A 4XYGA 4DRYA 5CG2A 3Q0EA 1B3BA 2VRBA 4BIIA 4A27A 1FDWA 5AVOA 2DKNA 2PR2A 3O9ZA 3UFXA 4QFCA 3TQHA 5ENVA 2BI8A 4NFYA 3O26A 3RUIA 3FBTA 4YXFA 1ADGA 4YT4A 2X4GA 3C7AA 3M6IA 1C14A 4B3JA 5JY6A 3PTZA 1UZLA 1BW9B 2B83A 3HDHA 3L9WA 2X0JA 5TT1A 1LDBA 4YJHB 3ZI0A 1R4MB 1KIFA 3GG9A 3RFVA 3TRIA 2VWPA 3UH1A 3PGXA 1D7OA 2BRUA 3DMTC 4BVAA 4YCAA 1DC3A 3FD8A 3R3SA 1U1IA 4PIVA 2JD1A 1VJ0A 3KYDA 5IJZA 3Q1LA 1I3MA 5ILGA 2I67A 3L6DA 4H16A 3QWAA 4YT2A 3PI7A 5JS6A 3I1JA 2RHRA 5ER9A 2X6TA 4TKLA 3W8EA 2D8AA 1Q0LA 4WNIA 3C1OA 3BHMA 1Q7GA 2X86A 1A72A 3S2EA 1HE5A 3H5AA 3PZBA 2YQ5A 3ICCA 1XDWA 1DAPA 1LDYA 1UR5A 4JP2A 4XQEA 1R16A 3QWFA 3TL2A 4L4SA 4UVDA 4E3ZA 3DBHB 1X1EA 3HFSA 3UVEA 1I3NA 3JCZA 2PTGA 1ZJZA 1GQ2A 3L07A 1T2CA 1ZK3A 3QVWA 4OJNA 3RU9A 2DPHA 3PXXA 1PZGA 4BNNA 1LXCA 3BHIA 1NWCA 1ZW1A 3H9JA 1ADFA 1KVSA 2AA3A 2OORA 2C5AA 2XPCA 3DZKA 3JYPA 4Y8VA 4D0RA 1T25A 2Q3EA 3HSKA 3TZKA 5ICMA 3BA1A 3ZHBA 1G6KA 3Q9NA 2EF1A 4GGOA 3B1JA 3LVFO 4XRRA 2PFGA 1HZJA 2VRCA 5H82A 4AJLA 4I1IA 1GFSA 3K6JA 4DPMA 4P4NA 4HUJA 4IUYA 1LDGA 2YDXA 1ENZA 3AU8A 3CKYA 3HE3A 1B8VA 3OEYA 4E13A 1M2WA 3JQAB 5B1YA 4Z9YA 5G4KB 2PY6A 3IDSA 4A10A 1JW9B 1YB4A 1BWSA 1HL3A 2P9EA 3GEMA 4RF5A 4DREA 1JWBB 1P3DA 2NM0A 3W6UA 3S2GA 3LT4A 3B70A 1DHRA 3QSGA 4Y6SA 4WCFC 2BD0A 4ROSA 4EUEA 3GZ4A 1E7SA 3EAGA 4OKIA 3QW2A 1ULUA 2EG9A 4M89A 4OSPA 4E2WA 5JFOA 3BTUA 3TNLA 5JC1A 1X0VA 1A27A 4DLLA 4HY3A 1K0UA 3PWKA 5JDCC 3DBVO 4RLHA 4J7XA 4D3FA 2X7HA 1PJSA 5IXYA 4Q3CA 4CM4A 1ZKMA 4OYRA 5TNXA 2JCYA 4MIEA 4LRSB 4BO0A 1LDEA 1UXGA 1DB3A 2P2SA 2Y68A 5BSGA 3RKUA 1F8GA 1JA9A 1PJ3A 3D3WB 4E12A 5KTKA 5J23A 2QYTA 2O4CA 3OMLA 4ND5A 3N58A 1JTVA 2HMSA 4L76A 4NI5A 3WGYA 4XQGA 3ZWCA 4WOJA 1XELA 5KJ1A 1ZXLA 3PQFA 4FGWA 3EGOA 5JXWA 1GQQA 4E5PA 1Z75A 3ON5A 2VQ3A 2WE8A 3MEQA 4Z9XA 3UCXA 5DNAA 4GSKA 1E3IA 1IUKA 3PK0A 2D3TA 5I7EA 2B37A 5I7VA 4I5FA 1EMDA 2PGDA 4OKNA 3QY9A 1V3TA 1EQUA 5KVCA 2IRWA 2O3QA 3OH8A 3W4KA 3ONFA 1ULSA 4D3SA 2B36A 3O8QB 4ND2A 4BNYA 1OOEA 3GFGA 2NWQA 4P8RA 4RF3A 1D8AA 3OJOA 4B4OA 2NU9A 4BKOA 3TOZA 3LQFA 2HK9A 1XU7A 1V6AA 1ZK1A 4FCCA 1I2BA 2W2LD 2HUNA 4UVIA 1QYVA 3DO5A 2Q1TA 5KVQA 1IY8A 1UH5A 3VPXA 1OAAA 2ZQYA 4CMGA 4KWIA 4YAEA 5K6AC 4CMJA 1U7TA 4W99A 1LSSA 4U6QA 5HS4A 4DC0A 2G1UA 3JQFA 4D46A 5LDHA 5KCZA 1IHXA 1NBOA 1Y8RA 5COQA 1LBEA 1S7CA 4JROA 1YJQA 4DUPA 1WLYA 5C7LO 1FDUA 5THKA 4XGNA 2QQ5A 3EZLA 3MJSA 4CR7A 4M1QA 3ZWBA 1EBFA 4CLXA 4DBZA 3S55A 4JX8A 4M55A 4Q3NA 1KVTA 4RPLA 1RM4A 5TLSA 3IIEA 5JBIA 3EZYA 3NJ8A 3KUXA 1JVSA 1PWXA 2X5OA 4C4OA 4YAIA 3UOGA 3V1UA 2R2GA 5IN4A 2WEKA 1NAHA 1PQPA 1MG0A 2XXJA 4KZPA 1DO8A 1HE2A 1CQJA 4R9RA 3G3EA 1P1RA 3ROQA 4DXHA 3OF2A 4YACA 4W4TA 4AFNA 1B15A 1TVEA 4UUMA 3LK7A 1YE3A 4GWGA 1TEHA 1RWBA 3A1NA 3U0BA 1IPFA 1OFGA 2Q2VA 4OL9A 3JQBA 4YR9A 2I99A 5EL0A 4LVUA 1U2DA 1IB6A 3DMTA 4OAQA 1QLHA 4TRNA 4HWKA 4RPGA 4IQ0A 3E18A 1T2AA 5CDTA 1I2ZA 4HFJA 1UAGA 4YJGB 2A35A 1QLJA 4CUKA 1KVRA 3PDJA 1PJCA 1ML3A 4DIFA 3WJ7A 4DL9A 4E32A 3PFWO 4WEQA 3A4VA 3EC7A 2YHIB 4RDHA 1QV6A 3GDFA 5KVSA 4UREA 2AQIA 1K6JA 4MVJA 1WMAA 5C5IA 1JAYA 4XGIA 1ZMTA 1ZVMA 3KEQA 1E6UA 3E1KA 3ZNNA 1DHTA 3DFUA 1NQOA 1U3TA 4J1NA 2FPGA 2IXAA 4O0LA 3V1YA 5ITWA 2D2IA 3RBZA 2Y67A 1O6ZA 1T2EA 3VC7A 3TZ6A 3TFQA 3ADPA 1Q0QA 3ROMA 2NTJA 5C7IO 1ONPA 2PZKA 2YFHA 3AUSA 5BSHA 1YB5A 2GN8A 4HBGA 3BMQB 4WLEA 4AJ2A 1YQXA 4XB1A 2EKLA 1GDHA 1KVQA 1N9GB 3AUTA 3S8MA 2ZYDA 4WPGA 1YRLA 4IY1A 4FC6A 2IZ0A 4QFDA 1YONA 2DBRA 4P4LA 3VAZA 5JDIC 1PJ4A 1E1LA 2JFGA 2FWMX 3FWZA 1FF9A 1ONOA 4FD3A 3H9GA 3UKOA 4MKRA 3KO8A 4NG5A 2D59A 3OQ6A 4OQZA 3WLEA 4CUZA 3ZW8A 5DP1A 3OJEA 5T8KC 5KJ6A 3ZWYA 2RBEA 1SB9A 3AU9A 4KTTE 3SC6A 4BNIA 3H65A 1NX6A 3DTYA 1B16A 1A9ZA 3PGJA 1BXGA 1F12A 4MIOA 1YL5A 2DQ4A 4QQRA 4WCFA 1E3EA 1HXHA 4BMSA 4D0SA 1TXGA 4K1LA 2HRZA 4IJWA 3D5TA 2BFPA 3K92A 4NZ9A 3IQDB 5JDCA 2CY0A 3WGHA 3U3XA 4LVCA 4GX0A 2B35A 2G82A 1FK8A 2RH8A 2W4QA 3GG2A 3ZV3A 2QRKA 3LF1A 4ALMA 2ZTUA 4P4GA 4IZHA 1Y9AA 4G2NA 4OXNA 2QRLA 4HXYA 4J4HA 5L7TA 3WGTA 1WMBA 2GDZA 1LNQA 3MJCA 2EERA 5DCWA 1JLLA 4ZQEA 4FJ1A 4GKBA 4MVJI 1AHHA 1E1MA 4UUOA 2QHXA 2UDPA 2J5KA 5JCJA 1R12A 4W6ZA 4KQWA 4JN6B 4GGPA 1Z73A 2BFOA 3IUPA 4U0KA 3W6ZA 2YV2A 5B4TA 5B37A 4YA6A 3OEWA 4Q3DA 1ZK0A 1AHIA 4J16A 3H6KA 2WDZA 5CDGA 4KDEA 1U2GA 3WYBA 3WBBA 3C1AA 3M2PA 4XDYA 5C3MA 1AGNA 2VCYA 4D41A 4CR6A 4HNGA 1RM5A 3U4DA 3WICA 3QVTA 3GVHA 1PS0A 2QZ9A 3JYNA 4MP6A 1GQYA 2GGSA 2Y05A 1NPTO 3ZWXA 1E1NA 1IHYA 2ZATA 2X22A 5L95A 1DJQA 1ZZEA 4J9VA 4IZIA 5IDQA 3C85A 1GV1A 2HAEA 1V9LA 1L7DA 1TT5A 5BQFA 3QRWA 3ZH2A 2EGGA 1ZJYA 1PGJA 4JNKA 2GN4A 2I3GA 2QZZA 5KNLA 4ZD6A 5IZCC 3SLGA 3DEYX 3EHEA 5EN4A 3WTCA 4E6PA 4R3NA 1WP4A 3FTPA 3HZZA 4YYZA 1DFGA 4FSHA 4FIZA 5A9SA 3RD5A 1J0XO 1Q0HA 3RBVA 5K6AA 1BGVA 1EE2A 1LX6A 2C07A 3A06A 5GMOA 4KP7A 1N5DA 1ZBQA 3PHJA 3E48A 1VSUA 1XKQA 4NU5A 4Y9DA 1NYTA 1C1DA 4RF2A 2HK7A 5KJEA 1Z82A 1AUPA 2Y1EA 1RPNA 2CMDA 5CDYA 5JYDA 3C7DB 2FHSA 1C1XA 1PL7A 4Q3AA 1UDAA 3DTTA 1ISJA 3GNTA 3DZJA 3FF4A 2CSUA 1YL7A 1P31A 1I36A 3VTFA 4M54A 1JKIA 3UN1A 4CV0A 5HM8A 3NUGA 1CDOA 3HDQA 5A5FA 4CLOA 2VZ9A 1PZHA 4JQCA 4FBGA 2HSDA 1EE9A 4O5OA 4YAKA 5JYEA 1Q1NA 4BV8A 4O1MA 1UUFA 2YW9A 2Z1NA 2ZB8A 2BH9A 4Y6RA 2HLPA 3SVTA 1ZNQO 4NBUA 5TIIA 1GZ3A 2HMVA 1KVUA 5DBIA 3Q2IA 4ZRNA 5AOVA 5CG1A 2X0NA 5L53A 4YRDA 3ZNQA 4YQYA 3OECA 2WYVA 4NK4A 4LW8A 5IG2A 1VJTA 4W7HA 1EK6A 3I23A 1UP4A 3ICPA 2QG4A 2TMGA 2BGMA 4XA8A 4AJPA 4OSOA 4J91A 1X0XA 4RJTA 1KC1A 3C8MA 3QWBA 3F1KA 4DMMA 5CAEA 3GAZA 2QRJA 2VNAA 2P4HX 4GAEA 1MG5A 3OIFA 3KZVA 4ILKA 1IYZA 5T5QA 2NU8A 5A1TA 4RGBA 4PVCA 3TSCA 2NNLD 3C3XA 3OP4A 3Q3CA 3NAQA 1NM5A 5HRUA 4A5OA 4CM1A 5JLAA 5DCUA 2WWRA 5A3VA 1NWHA 4JP3A 1V3VA 2CZCA 3GF4A 1NFFA 5CPBA 4DYVA 5BT9A 1QYXA 3GN2A 4AVYA 1Y6JA 5L45A 2GCGA 1X13A 2O3TA 3CMCO 4RVFA 4DTIA 1NFQA 4CL3A 1ID1A 3DZBA 4YVFA 2JHFA 3DBLB 5ILOA 3AY3A 3H2ZA 5CEEA 5U1PA 2OZPA 1O89A 4MVJM 1XQ6A 1ADBA 2I9PA 2WD7A 4WLUA 4Z6KA 2C7GA 3AY6A 3INRA 5JDIA 5TRTA 3KYCB 1NR1A 4JIGA 2VN8A 2G76A 3ANLA 4NFHA 4BO3A 2AEFA 1E3JA 4ALJA 1ZEMA 1PEDA 3PHLA 4K28A 1K2WA 1H2BA 1ENPA 4H3VA 4AJ1A 2B4RO 4PLZA 2VYND 1VJ1A 3GVIA 5ADHA 5A02A 2RHCA 2CF5A 2PH3A 3H5NA 5CPFA 4MOWA 2OP0A 3BMCA 3W4IA 1NQ5A 3DOJA 3JSAA 4PRKA 2DUUA 4BNGA 5A9RA 1VE9A 4J1SA 3K96A 1WDLA 1B8UA 3UCEA 4Y6PA 3NT4A 5C7OO 3I4FA 3MOIA 5TX7A 3WNQA 4AJNA 5JAQA 3ZU2A 5G0UA 3ETEA 1B0AA 2BFMA 3ZWOA 3ZWWA 4KDFA 2GLXA 4CV2A 4CQMA 2AQKA 1ZSNA 4ZU3A 4Z9FA 1O95A 2PKQP 4CPDA 1EK5A 1ZCJA 5DBFA 4CMIB 3JQAD 1UDBA 1TI7A 4BO1A 2Q4BA 4RV9A 4XX0A 3K73O 4J1TA 4W9NC 4PLGA 2EKQA 3MZ0A 3GUCA 4H7PA 3RROA 5KWEA 1ORRA 3PPIA 4Z0PA 1D1TA 4G81A 3MJ4A 4FJ2A 1BSVA 2EV9A 1QYCA 1R0KA 1I24A 4BKPA 4F3YA 3RIHA 2Q45A 3RU7A 2YZ7A 5BNTA 3WTBA 1SOWA 2FR8A 5JO0A 2Q2QA 4YWJA 5A05A 1P45A 3VDQA 4JBHA 2OP1A 1R4MA 1K6XA 3D7LA 1EUCA 3I9KA 3JQ9C 4GH5A 4I9NA 3U5TA 2YUTA 1RJWA 3UUWA 5HTOA 1XIVA 4KUEA 3JTMA 4EGFA 4Q3BA 5EINA 2Z95A 3NEPX 1YKFA 2XOXA 4MVJP 2BELA 4RLSA 2BKAA 2FP4A 4NFSA 1UXKA 4LISA 4QO7A 2W98A 4TZTA 4FB5A 1DIGA 1EFKA 4J3FA 1MUUA 3WMWA 3W8DA 3R6DA 5F1OA 5DOZA 3N74A 1DIHA 3U62A 1P1JA 4CLRB 4CLEA 4Z3KA 5IZCA 2X23A 2GO1A 2ZIZA 4L8VA 5TJHA 2WE7A 1UP6A 3DAPA 3HDYA 4NQZA 1QSGA 2A92A 4EBFA 2VWQA 4J4TA 3WIDA 8ADHA 1LUAA 4CM8B 3TZQA 2I6TA 1CRWG 3BMNA 1ONNA 3UW3A 5CFZA 1R4NB 4M49A 1O0SA 1EVJA 2WSBA 4QEDA 4YBZA 1HYGA 4B4UA 4E2ZA 3INTA 1HLPA 4J2OA 5COAA 4R1UA 1I0ZA 1JVBA 1F0YA 2FSSA 2VOEA 5KOIA 4NPCA 4FS3A 4D79A 2YY7A 1T1SA 2HO5A 1VL6A 4J4BA 3VHRA 3ONDA 3BAZA 4ZQHA 4BO5A 3BMOA 3V2UA 1T1RA 4R1NA 4NMHA 4FFPA 3Q11A 1DPGA 2RIRA 5DN9A 2FOIA 1PZFA 1BDMA 5LC1A 4AJJA 4CM6A 5IDYA 3ORFA 5BNIA 1H6BA 1LSUA 2Z5LA 3QLJA 1CJCA 4R51A 4AL4A 4B7UA 2PZMA 4XR4A 4B7XA 1QV7A 4YPOA 5F5LA 2ZTMA 2HKIA 1DAOA 2IYOA 3MOGA 1Z7EA 3CMMA 4K9DA 3WLFA 5I9LA 3ROPA 5KJFA 3NRCA 3TN7A 4EEZA 1PGNA 3DHEA 3H9EO 4RDIA 4TRMA 5G0VA 3QE3A 1NXQA 2OOSA 2RAFA 3V8BA 2UVDA 2VOJA 2E4AA 2ZB7A 4BV9A 1ZK4A 3L0DA 4U6SA 5KKCA 6LDHA 2DTXA 3F4LA 1IZ0A 2NSDA 1TA4A 3GEDA 4GKVA 5B12A 2YV1A 4NDNE 3VH4A 5IDWA 1R15A 4XDZA 1A7AA 3VKUA 1QR6A 2LDXA 4EITA 4KUGA 1G1AA 1EUZA 4GMFA 4EUFA 5T64A 2PLAA 2Q99A 1VI2A 4YJFA 4A0SA 1WDMA 4F6LA 1BVUA 1PX0A 4PFJA 1R0SA 3U4CA 4BNLA 4PLHA 4B79A 4E2XA 1U3UA 1YDEA 1ENOA 2GASA 1HDZA 1PQUA 2J3HA 4YB8A 3HHPA 4RL6A 3RKRA 2CD9A 2DBQA 3DBRA 1U7HA 1EZ4A 3OA2A 3WXBA 4DIOA 3UICA 5ENDA 4CQLA 4YDRA 1P0CA 3D1LA 4E21A 1PL6A 1DXYA 3K8ZA 3DMYA 1HT0A 3F5QA 1D1SA 1U4SA 4DQXA 4IMPA 1E6WA 1UXJA 3HG7A 3KSZO 4AJIA 2GZ1A 2FMUA 3FPLA 4YRBA 4WK6A 2RCYA 4XEHA 4XWYA 3A28A 2VTEA 3TOXA 4A2CA 3F47A 4ALNA 4IGFA 5H81A 1F06A 3GGGA 3I4CA 2BMAA 1H9AA 3P5SA 1VSVA 2A9FA 1GCUA 5TSDA 1VKOA 1E3LA 3S1LA 1LU9A 2D0IA 3K31A 1VL0A 3AUUA 2GD1O 3SLKA 5L7WA 1PGOA 3CH6A 4XJSA 1FDSA 1KY4A 1SC6A 3T4XA 4ND1A 1U8FO 1XGKA 2VZ8A 2V6GA 4EZBA 1E92A 2TMDA 4J9UE 5DOVA 3AM4A 3O03A 4XIYA 3RUEA 1BVRA 3VPHA 2IZ1A 4HX5A 1ZH8A 1FXSA 1XU9A 4CM4B 3O4RA 1E3WB 1T2FA 1CYDA 4CV3A 3OBBA 3PJGA 4GX1A 1KS9A 1JN0A 5ES3A 3RJ5A 4KMSA 2PH5A 2HMWA 4AG3A 4PG7A 2JCXA 1C0PA 1UP7A 1M75A 1KEPA 3AFMA 5A5EA 5HA5A 2AMFA 3IP1A 2ZYGA 3CPSA 2UV8A 2B69A 1IPEA 2HJRA 3G1TA 3HWRA 5EJ2A 4OH1A 3FBGA 2IE0A 4MKXA 4WECA 4RPJA 2CVQA 1HDOA 2VTDA 5U4QA 2CVOA 4Z0TA 4W9NA 3DC2A 4BQRA 3U09A 3QA9A 3KLMX 2Y0DA 1GADO 1KYQA 3QVSA 4CL8A 2Y1DA 4FW8A 2XAAA 1PR9A 3RC2A 4AJEA 4J0EA 3I3OA 3BTOA 3NV9A 1KBZA 2NV6A 3OA0A 4RVGA 3GZNA 1NHGA 4ESOA 3DR3A 4J7UA 1DIAA 4PLVA 4PZCA 4RO0A 3GDGA 1DOHA 2VYVA 3JQ7A 3RWBA 4MDHA 2X5KO 1PS8A 1HE3A 3JQ9A 2O2YA 5FI5A 4RORA 3CTMA 3F5SA 2C5EA 3JQ6A 3PDUA 4JBGA 2GRAA 2CDBA 4TSKA 2J3KA 1R6DA 4FFRA 4ID9A 3GNSA 5F21A 3GY0A 4J43A 3GAFA 2QYSA 4GLLA 1E0DA 2NU6A 3OM9A 5G0SA 3VVBA 4P22A 3FTNA 4A73A 4L0QA 3C7CB 2UUOA 3E9MA 4IBOA 4IJVA 2DTDA 4WNCA 4O63O 2X1HA 3ZN2A 4NH4A 4E5KA 5TJ9A 3BTVA 3WQSB 3CSDA 3TJRA 3HN2A 1MFZA 4URFA 2GERA 3VDRA 2H63A 3D5QA 2I65A 4JBIA 4WOKA 3UCFA 3WGOA 1IULA 4CMCA 1JAXA 3I6IA 1KY5A 2PWZA 1P1IA 1W6UA 3VPFA 1B8PA 2I5PO 3WDSA 3F1LA 4MO2A 4RPKA 1MC4A 3H4VA 2VUTA 3EW7A 3IAHA 4D43A 4PLTA 3R3JA 2D1YA 5G4LA 1MXHA 4CLHA 2P68A 3OQBA 3ZHZA 5FYDA 2Y1OA 4L75A 1L1FA 4DQUA 1MA0A 3VZPA 2AEMA 5CEFA 1J5PA 8LDHA 2GUGA 2Y0CA 1VRWA 3LZ6A 4LMPA 5EIOA 3V2HA 4EUHA 3JD2A 3NDRA 1LC3A 3QHAA 4IQGA 3AOGA 2VWHA 1RM0A 3QVXA 3DXFA 5MDHA 3OJ0A 3FNFA 4D7AA 4D3DA 4YTEA 1LLUA 4DWVA 3D4PA 1Q7CA 1NQAO 2EIHA 1ZFNA 4JJFA 4MINA 2J5QA 1KETA 1ISMA 2HJSA 3ADOA 2GNAA 1Z6ZA 4CR8A 1K3TA 3AI2A 2EEZA 1GPJA 1YGYA 3I9MA 5T67A 4HNHA 3E8XA 1HDXA 3PJFA 4LCEA 3PFFA 1W8DA 3GVXA 3GEGA 5CDUA 1ZSVA 1SBYA 2E49A 1H6CA 3FI9A 3L6EA 1LEHA 4MVJF 4BS9A 1NHWA 3GVCA 1HZZA 4LCJA 3HADA 4PZEA 3VH2A 2J8ZA 4L9RA 4PLFA 1ISHA 3HB5X 5LDGA 4PLYA 7MDHA 1EFLA 2FZWA 4K6CA 2JD2A 4J7CA 4UUPA 1TT7A 1N8KA 4GLOA 4IS2A 4K26A 2ZQZA 3MTJA 2IXBA 3ITKA 1T24A 3SJ7A 3RUCA 3ZZNA 3LF2A 4IJUA 3U49A 3SX2A 2D5CA 2VHVA 4BKRA 4WGGA 1H5QA 1NNUA 4YAGA 5AYVA 2QIOA 4CM7A 4LGVA 4CM9A 3F3SA 2BHLA 2XF8A 4RQUA 5CEJA 1BXZA 1B7GO 1QRRA 3AFNA 1SEPA 2NADA 1G0OA 1NR7A 3HUDA 1PJTA 3PYLA 4IDEA 4OM8A 1VPDA 4E31A 1LLDA 1UXIA 1HYHA 4W82A 3FN4A 4GMGA 4PG5A 3PHGA 1BTOA 4WUVA 5CP8A 4XYBA 4I5EA 1TB4A 4NJMA 3F9IA 3QIVA 4ZA2A 3U4HA 4WCFB 1GUFA 2D4AA 2QW8A 3DWFA 3QWIA 4IMRA 2FPPA 4S3MA 4TROA 1NVTA 1GZ6A 2AHRA 1A5ZA 5TC4A 5IZ4A 3G79A 5FWNA 1E7QA 3S2FA 2AW5A 3CZMA 3WBFA 3PEFA 3GDOA 4D44A 4OOEA 3E9QA 2X8LA 4R68A 4BNZA 1W73A 4ZVVA 4XYMA 3UF0A 3VZRA 3L4BC 2I3AA 1HLDA 4E30A 3H8VA 5BSFA 1P77A 1YDWA 3P2OA 4EDFA 3WG9A 1BXKA 1UZMA 4XIJA 5DDIP 3WWZA 4R1SA 1M6HA 3OJFA 1LTHR 5JAIA 3NDIA 2PZJA 1MC5A 2IZZA 2OUIA 2W2KB 3U4IA 3KLPX 3ZWNA 4BUCA 2DPGA 4D42A 5DT9A 3ZV5A 3CIFA 5ITVA 1F17A 3E6AA 3KVOA 2O7QA 2E82A 1ISFA 3FHLA 3KB6A 4TQGA 3I83A 2VWGA 4MP8A 1BG6A 4G5HA 3QV1A 2BFAA 4ND3A 2AEJA 3ZV4A 4FQ8A 1UXHA 3WB9A 3C24A 4I08A 3FNHA 2C7VA 3EMKA 5F1PA 3UAGA 4PZDA 4R1TA 4I9UA 2P5YA 4NBTA 2ILTA 2C2YA 4IDFA 2JJYA 3GK3A 5U9CA 1O9BA 3R1IA 2Q1SA 2W8ZA 3NYWA 4CV1A 3L9XA 4MKZA 2BGKA 1GYQA 1TT5B 2O3UA 1JQBA 4LRTB 4Z3DA 1ARZA 3RQSA 4BNMA 1CQIA 5TGDA 3T7EA 1R0LA 4R01A 1I32A 4XQCA 1Y81A 4MVJG 1AE1A 3V5NA 1LC0A 2P5UA 5TQVA 1KC3A 3OJLA 1SPXA 1LLCA 4W7IA 3ZWAA 5L4NA 1HYEA 1N92A 5A9SB 3FCOA 3OIGA 2EW2A 3EY4A 3CXRA 5EQFA 2H5LA 3LT1A 2J5RA 3H5RA 3WYEA 4IS3A 2PKRA 4U7WA 4DGSA 3EVTA 5ICSA 1XSEA 1YOVA 4OXKA 4FOSA 1C1DB 5B4VA 2NU7A 1BHSA 1HE4A 2V65A 3CZRA 1RM3A 1LSOA 2YQ4A 4E5NA 2O23A 1N7GA 4AJKA 5BSEA 3QJ5A 3BIOA 3SJUA 4C7JA 4DPKA 4QSMA 4GBJA 5GZ1A 1Z45A 1A4UA 1C1XB 2DAPA 3VTZA 1KEWA 1H6AA 3RUDA 1PIWA 3IP3A 3PHIA 2Q46A 2A4KA 4NJOA 3PJDA 4KQXA 2EJWA 4CLOB 3INGA 5L3ZA 4HFNA 2YDYA 1Y9EA 2FN7A 4HADA 4I9HA 4GI2A 2AQ8A 1JU9A 4FGSA 4MIYA 1YS4A 4PLWA 2Z1MA 5C37A 3LC7O 4B4WA 3L4SO 2E6UX 2ZJ1A 2DFDA 2VUSA 1N1EA 4XD2A 1OI7A 3NDJA 2IYPA 2EP7A 3ZDFA 4EJ6A 1Q7BA 1ENYA 3X2FA 4BO4A 3M1LA 3PVZA 4FN4A 4GWKA 2Y66A 5BNFA 5AQ1A 4HP8A 2HU2A 3MJTA 4O59O 2NQ8A 1U3VA 3I9JA 1DEHA 2P4QA 2I76A 2D5AA 5L4LA 5JW6A 1U3WA 3KTDA 4JK3A 2NVUA 3GMSA 3ZNOA 3S2IA 2GZ3A 3PLNA 1V3UA 5EERA 2ZJ0A 2H9IA 1B26A 2G0TA 3I9OA 1SZJG 4LSWA 4ZICA 3IS3A 2ET6A 1MFPA 4WE3A 1P74A 9LDBA 4B4VA 5AXAA 3AI1A 4HFRA 3WYCA 5T8KA 2DBZA 4BNHA 1E1KA 4D45A 1YBVA 4EJMA 1BDBA 1VLLA 3JD1A 3IKTA 1C0IA 1R37A 1KERA 2C2XA 3W1VA 3TL3A 1DJNA 3KETA 1I3LA 3I9NA 4BL5A 3WSVA 1AXEA 3M1AA 3T4EA 3WGQA 1T4DA 2X5JO 4L4XA 3AI3A 2AXQA 3WQRA 4AJHA 2CUKA 3FR8A 1SEVA 5DP2A 4BKQA 3R0IA 2NVWA 4R69A 2SCUA 3GRPA 1YBAA 3H3JA 4X54A 1KEUA 1PJLA 4CM5A 5TF4A 3KYBA 4RCVA 3WGGA 2WD7B 3STHA 1ISIA 3Q9UA 3NX4A 4II2A 3ABIA 1Y8QB 1YXMA 3JQ8B 1WW8A 4N5NA 3B6ZA 1EVYA 2R00C 3GHYA 1E3SA 4TMFA 3ST7A 3KSUA 1F8FA 1P1KA 1DSSG 1T26A 3ETDA 1WVGA 3JQGB 2DLDA 1XA0A 3FNEA 1HDCA 3I5MA 3DZIA 1LQUA 2WYWA 4XQ9A 4RZIA 3M2TA 1NPYA 2UAGA 1N2SA 3KRTA 1HWYA 4RVDA 2X58A 2OHXA 3VH1A 3SEFA 3FRJA 2E37A 2NUAA 4KTVE 4MP3A 4N5LA 4OMUA 3ASUA 2HRBA 1BW9A 2GYYA 4IQ8A 1P9LA 4XGKA 5GY7A 4XZ3A 1Z74A 2X9NA 3BMCB 4J90A 4PLCA 5EPOA 4CLRA 4NK5A 1H94A 3ETGA 1HF3A 1LA2A 4YJHA 1EDZA 1RKXA 5EQDA 4NU6A 2J3IA 2HMUA 5TS3A 1E7WA 1NFRA 3VH3A 2O7SA 3DOOA 4DBVO 4BNUA 4CM8A 2VHYA 5JNLA 1HDRA 2VT2A 2NACA 2VRCD 3HJAA 5DF1A 4RPHA 3ITDA 3L4BA 3LDHA 4Y98A 4CQMB 5IDXA 5T6BA 2P9CA 3I9LA 2YFQA 4XR9A 4B7CA 4Q9NA 5A3JA 4ZRMA 1EQ2A 3F4BA 5IXSA 5IN5A 2C59A 4IINA 3G49A 3DONA 4EI2A 3K2BA 2OXIA 1O94A 3DZGA 4BNXA 1UZNA 4HFMA 3BZUA 1EVIA 3JD4A 1FJHA 2NLOA 2VHZA 4UVGA 4B3HA 4NIMA 3D0OA 3FSRA 4ND4A 3WNVA 5JMPA 1V35A 3DBHA 2O3SA 3QQPA 1IL0A 3HDJA 2JKVA 2VYNA 3H9QA 4M86A 2DTEA 4YQZA 3JQBC 4EJ0A 4EYEA 1QG6A 1GR0A 2VZ0A 7ADHA 4I5GA 4E0BA 2O2SA 3SBOA 3V2GA 5I8WA 4IDCA 3N7UA 3DAGA 5GZ3A 5ER6A 2VT3A 2WJPA 1MLDA 3ZU3A 3H7AA 4R4JA 4J0FA 4WLVA 3OHSX 4CUJA 1LDNA 1B3RA 4TWRA 4UEOA 4E2YA 3ZHYA 4CODB 2FR0A 2DBVO 4UUNA 4LK3A 1LRLA 4JGBA 4XCVA 3JQAA 2CF6A 5G4KA 4MJLA 4LMRA 1V8BA 3KHUA 3RAJA 5JAMA 4F45A 3DL2A 2FZEA 1M6WA 3RC7A 1ZSYA 2B4TO 2OFPA 4TZKA 3TF5A 3KYDB 3BMNB 4GPD1 3WOHA 3HB4X 1PWZA 4YT8A 1MX3A 3WS7A 2WYUA 3HQ4O 3H2SA 3JV7A 4FFMA 3IJPA 3ZW9A 5KVVA 3Q6IA 3RVDA 3WR5A 3WMXA 3KBOA 2PA3A 1K89A 3LT2A 1M76A 4DA9A 1UAYA 3TFOA 5DZSA 3RCBA 4UVHA 4J2HA 1NQTA 3DHYA 2PK3A 4PGFA 4YEDA 2DM6A 2B4QA 1M66A 2EJVA 3VZQA 2PD3A 3BMOB 2OO5A 1OC2A 4IPTA 3DZHA 3FWNA 3MCVA 2ZB3A 2G17A 1TLTA 4LN1A 2ZK7A 3B1KA 1XWFA 5JSFA 4UVEA 3D3WA 3GFBA 1HSOA 3RC1A 2O3RA 1WWKA 1PZEA 3ZWMA 1WXDA 1Y5RA 3FPCA 2B5WA 5FI3A 3EDMA 5FFFA 2FRDA 5FEUA 3U9LA 2V6BA 3EUWA 4NBRA 1IOLA 3D4NA 2O50A 5IFLA 3FR7A 2Y0EA 1S6YA 4DPLA 1PSDA 5AXCA 4F6CA 4YRAA 3E5RA 3ZGYA 1GTMA 1U28A 4IM7A 3GLQA 3GPIA 2GSDA 4BGVA 1GCOA 2PKQO 1NTOA 1X7HA 2NQTA 1E7RA 4FR5A 3PJEA 3KV3O 2UUPA 3I6QA 3RUAA 2VYVD 1SAYA 3ZU5A 3RUFA 5IF3A 2VNSA 3GN1A 1YO6A 2O3JA 1P1HA 4XYEA 3O8QA 5IAAA 1E3WA 4GQAA 4OO3A 4YJFB 3H9UA 4IXTA 4A7PA 2EXXA 4PN3A 3L77A 3JYOA 3PLRA 2VHWA 3LC1O 1EVZA 2R6JA 4O6VA 3GRKA 4NNJA 4IDBA 1P0FA 1YBMA 1MXFA 2POQX 3NT5A 2X9VA 4N7RA 2JAHA 1OZAA 5I7SA 3DBRB 1J6UA 3ASVA 4J6FA 4CQLB 1LQTA 1A9YA 2DC1A 4U0JA 4FDAA 3G1UA 2V6FA 2VUUA 5A06A 3E9NA 3IKVA 3NTQA 3LC2O 1AXGA 4EEXA 3C1TA
chains in the Genus database with same CATH superfamily
5COBA 1RRPA 3M4NA 2E9SA 4G65A 3R5HA 5L7YA 5TVGA 5CXXA 3WYDA 3PF8A 2YN4A 3RASA 2P75A 3OZIA 4JHLA 4CKWB 3CSSA 1PW5A 4JGGA 3ZV6A 1NJSA 2PFKA 3BIFA 4NBNA 4OL0A 4F4FA 4JIMA 2XUGA 2QLTA 2FSVA 3VGPA 4JT4A 2CV1A 1Q84A 1SA0A 1XDDA 1RIIA 3Q10A 4M8SA 5CFNA 3ZTWA 2OCBA 5KNBH 4OHFA 3DD5A 2NZXA 4IDGA 4W5WA 3UT6A 1A1VA 5ED0A 1EHCA 4IXWA 4AJ4A 4I8DA 1PTJA 2J33A 3EUFA 2A86A 2AQHA 3QVMA 4M0DA 3X2EA 4A15A 3PHHA 4U8GA 1JXQA 3JX9A 1K86A 4QICA 3EIQA 3MWEB 4KX5A 4OK3A 1FNNA 2BF7A 2BFFA 2NSLA 3IMEA 3FMFA 1XVIA 2IDZA 3IGFA 13PKA 4FGKA 2HR1A 4KIUA 4V3CA 1MQAA 1ZITA 1GT6A 2GM9A 1I2MA 1Y4AE 1MW9X 2FWJA 2N3ZA 4A82A 5AKKA 3VA7A 1XO1A 2F3QA 4I4TA 4QQKA 2IVZA 4LV5B 2IOQA 3WLIA 5D8DA 5HS6A 4DUGD 1PJBA 1AQ6A 3EXG1 3DFZA 2JFUA 3AM3A 1OSNA 1ZONA 2MDTA 1SKMA 3ESZA 2FX3A 2YJZA 3E0XA 2PV7A 4CHTA 1NAIA 1OILA 4FE7A 1CEEA 1KI9A 1GY8A 2GAFA 2QZJA 3EVNA 4DC1A 1OXTA 1ACMA 4Q05A 4MEBA 5LYJB 2XGSA 3EPLA 3OUUA 1MC1A 1ZKDA 4S24A 1F7UA 1KYVA 2Q6OA 3KR1A 4U39A 1LPPA 1I51A 3MQ2A 3VPGA 1A5BB 3V3TA 1IVNA 5G0WA 5KHLB 2YHIA 4G86A 2C82A 3IDQA 1XLTA 3AX6A 3L02A 1PJQA 3DMNA 1WOMA 2HK8A 3LSYA 5ES4B 3H2KA 2XUAA 2VK4A 3F98A 4GU5A 4NZYA 5IYZF 2FG7C 3T3MB 1LSJA 2O2XA 2O8VA 3R3WA 3T9BA 3WFJA 2CNWD 2LKCA 4D4KA 3GP3A 1V7QA 2IW1A 3P19A 1XMQB 3ML1A 3F46A 1FDVA 1O54A 3CPHA 1L4KA 2CVZA 3G2OA 3PICA 4RD4A 3RARA 3WX0A 2AS0A 4KPUB 2O5RA 3GVPA 1DO2A 1ZHFA 1EGQA 4HUQA 3FETA 4RA9A 1GEEA 1T1GA 1SUEA 5L4SA 2AKEA 4QQ8A 1SXJC 3VTAA 2WTBA 1XCLA 2I6SA 1VJCA 1A8HA 3IV7A 2QV7A 4FDVA 4E5VA 5BV1A 1NONA 3IL2A 1UJ6A 2EFHB 2NIPA 3OUZA 2C00A 2FVYA 1ZN9A 1HTBA 2ETXA 1QRTA 2JHAA 3QU5A 4PXSA 2VZEA 4RWZA 2F3PA 2GPTA 5EZ5A 4X94A 2EJUA 2PMCA 1BX3A 1RRVA 4ZQBA 1YWGO 2VP9A 4P3NA 4KWTA 1RMYA 3BA6A 3M9WA 1MV8A 1GLNA 3T5CA 4ITUA 4RS4A 2F1HA 5DI3B 3T9AA 4MYSA 2CXRA 1W0KD 1FLAA 1JFLA 2H06A 3U4GA 1SKYB 4RY8A 3EOAI 4ALIA 1ZZGA 3DLIA 2HWYA 2A0UA 3FJ1A 2XA2A 2YV3A 2R87A 4J49A 4XVRA 3TNDA 4KJZA 2V8BA 4QTUB 4R5HA 3O6VA 3R9KA 3NWOA 1QS0B 4MAFA 1CJKC 5JPIA 3WIOA 2E48A 4Z7QB 3EZGA 2AEEA 3ZOKA 1NM5C 1U9JA 2H3EA 4RS3A 3G7UA 4URXR 5JNUA 1CUSA 2FY8A 2VNHA 3LFUA 1WZUA 2UZAA 3LC0A 4MVJE 4NP6A 3KXLA 3HJCA 3GDHA 3JQRA 1KDPA 4QUIA 4DIFA 3HCFA 1EDEA 2VHXA 2P6PA 1EWKA 3C16C 3W6NA 2HJ9A 5A7HA 2IP2A 4HR7A 4OATA 3WGZA 2WAAA 3AIIA 3PIRA 2NV2B 5EMHA 4EA7A 1QH9A 3ZTTA 4R83A 5BN3A 3DAFA 2Q1UA 4OQ4A 2FW9A 2C9DA 2OAEA 1XRRA 2DKOA 3PU6A 721PA 3RU3A 1HSZA 2GBGA 3MWDB 3DQPA 2GCOA 4R1LA 3UXMA 1H2ZA 1WEKA 1U7DA 2WDPA 3HVUA 5BN5A 3IYLW 4RCZA 2AG5A 4AAYA 2B2NA 2OCKA 2NGRA 4PHGA 2QD3A 3AR9A 1YCGA 4HJXA 1L4EA 4WDRA 2IYZA 2JFVA 3U7QA 2EGHA 2YYZA 3IQGX 4IDDA 2H92A 3PIDA 5BURA 1QVAA 1UPTA 3PQEA 1AQNA 3COVA 4Y7DA 4N76A 1DRUA 3WKCA 5EJ5A 4D8TA 1PHPA 1MPTA 3ASZA 1TQ2A 4B45A 4DS3A 5JO9A 4ZFNA 2GDJA 1QIMA 1OKKA 1QO0D 5B6JA 3AETA 4AKTA 3OTIA 1A2KC 3D64A 3V4PB 2V6IA 1TRHA 3LZDA 2VL7A 4AZSA 1PT7A 5HGXA 1XTJA 1QPGA 3LV8A 4F04A 2C5GA 2DE0X 3CUUA 5LXTA 3LG2A 1ZXXA 3B20A 3T7AA 4ZN6A 1P72A 2XVXA 4RQTA 5H80A 1K8YB 3DF9A 1X42A 3FMOB 2B3DA 4EX6A 3IP6A 4Y67A 4M0UA 1GG5A 3EIEA 3PEUA 1JIJA 3AWDA 5FL7A 4BU0A 1I5RA 1OAOA 2NSJA 3TKAA 2ZUUA 3I9FA 4HDMA 3RGGA 2W11A 1ZMBA 3B6JA 3DOCA 5CT6A 1HRKA 2I7VA 4MYTA 2JLSA 3ENNA 3G0OA 5KNDA 5L6LB 3L5KA 1TUBA 4GI3A 2W37A 3J7AC 4HEA1 1YIDA 2DR3A 3T06B 4D4IA 3SFTA 5K3BA 3HL0A 3N5KA 2I1QA 1BXGB 3J81A 4DMLA 4CKEA 2C1ZA 1AGXA 4DR1B 1J07A 1EFVB 2FX2A 5HWSA 2B2XA 4EFLA 2O8CB 1W93A 1J8YF 1GPKA 4RJKA 2XB4A 1P7VA 1DDOA 1U4OA 3GJ5A 4B47A 2Y1CA 2PGIA 2ZAMA 1QP7A 3LA8A 4GVXA 2FZ4A 4P5EA 2W2KA 3PEWA 1B6SA 1NVGA 4OI4A 3F6YA 3JQCA 3MWFA 1X7ZA 2Q07A 3D7MA 3O7MA 4UW9A 5FPPA 9LDTA 1ODKA 1QTIA 1H2FA 3ZVRA 2C9OA 1OH6A 1DBVO 2C8JA 4D6YA 5IJ9A 1CS0A 3LPDA 4YCJA 5JNRA 2GF2A 3AEKA 2F1KA 3NBQA 1CWUA 1OZFA 3CR7A 4WLNA 1LLFA 4AUKA 4TQUS 4MXDA 1NI4A 1NF8A 5FUQA 5FWXA 2BKLA 4CRWB 1IEVA 2QROA 4JB3A 4KQ9A 2H6EA 2JZOA 3PYMA 2WILA 4CEJA 3M6LA 5ENZA 4XDGA 3A9SA 4ZYYA 1QAOA 2I3ZA 2WFZA 1GZ4A 4QRHA 3TNFA 221PA 3UB3A 3DHNA 3P9CA 3GH3A 2NTVA 1FRFS 1YVEI 4ANFA 1KGSA 4G07A 4JBWA 1W4AA 5CXSA 4MUBA 1E99A 1NV8A 2FMKA 4QHTA 4DYDA 5LZ9A 1TF2A 3H8SA 3BOSA 1ZEJA 1NSTA 4I55B 4DA0A 3UGKA 1VIDA 4DM4A 1J70A 1Y8AA 3HMQA 1PR0A 2TYSB 2FPPB 1QJ4A 1RHUA 2YMMA 4DCSA 2HOQA 2YYSA 2PUDA 2FDRA 4KI0A 2BRUC 2F3SA 4PSCA 1D6SA 2GVZC 5B3AA 4N5MA 3L4EA 4WEOA 1L8OA 1NSFA 1PJ8A 3TIVA 4AROA 5JRJA 3IV9A 5K6RA 2CNBA 4Q02A 3PNPA 2AWNA 3EIOA 4R8KA 1DRVA 3PUJA 1J7JA 1TTHA 4BE9A 3QEBZ 5FOXA 1C8VB 5EI5A 5A4IS 2ZCVA 3D6FA 4IRXA 4OHUA 3UB2A 3RFTA 4WH0A 4ZDIA 4O4HA 4CMEA 3RIYA 2FN9A 3HR4A 5L6MB 3KSRA 1P6UA 4XQ0A 5DNDA 2JHPA 2VJCA 2AT1A 3PV0A 3B1FA 2KPOA 1R8SA 3HXMA 2WKWA 3L6OO 4NCAA 3PZRA 1NVWQ 3EOBI 3QE0A 4K6MA 4X44A 1W1UA 2M2IA 5ALIA 3U7EB 1DQYA 2Z8ZA 4G41A 1S2GA 4ZVNA 1U8CB 1JR3A 1SQ0A 3RVSA 1DEKA 1KR5A 1QGOA 1HEUA 2C54A 4S1VA 1TYBE 4PNHA 2RHJA 3ZQJA 1TW2A 3FPJA 5H68A 1ZVQA 4DCMA 3IMFA 1ESEA 2ACVA 4G23A 5HJ2A 3MTAA 1OFVA 1KHHA 1T4BA 5HEKA 1U1FA 1JKXA 1JLRA 1PGPA 2C20A 3PP8A 1YRQA 4R41A 3REFA 4E5SA 1GPH1 5A4JA 2WD8A 2AF4C 1A5AB 5GJCA 3UHAA 5C9ZA 1ZL0A 2W22A 3H2IA 5I3CA 1EGHA 4PRLA 1DE0A 4BFWA 4ZJYA 3GOHA 4MLZA 4E5YA 2XMSA 1EH5A 4QTZA 1IG3A 4L85A 4ZOBA 2H54A 2F43B 4C08A 5HG0A 3QVOA 5JE8A 3P2MA 3I30X 3ZCXA 4MPDA 1KYXA 3LL7A 3OZWA 1FDTA 2AOXA 2AI3A 3OZTA 4MUIA 1LJUA 3RTDA 4BXOA 2VJNA 4LZNA 4CQMD 3WVNA 3DP9A 2YIDA 5H83A 1WSBA 2QDKA 1WW2A 5LJIA 1Y7TA 1SGWA 2A9JA 3GP8A 1Z0IA 1RHKA 1RWOA 2B7CA 4RESA 3UJAA 4ZGWA 5I8PA 3M34A 2QMYA 4AJOA 3L82B 3V2IA 3AOEA 1GUZA 5IULC 1EP1B 2IS4A 1BOOA 2X0IA 4K2AA 2NXWA 3AJRA 3E9CA 5D1NA 4ZU1X 2HWWA 3SGLA 4X85A 3HRIA 4O4LA 1ATIA 4PQEA 1JDJA 2HCTA 5CDFE 2DETA 1Y5MA 2JI7A 3RI3A 3HA2A 1Z6QA 1U9YA 3L7LA 2PGLA 2P6MA 2G5CA 3HY4A 4YONB 3OCWA 3MMPA 2CLMB 3OICA 4ZAXA 5JJ5A 4IUBS 1B0PA 4NCJA 3WRXA 1S2LA 4UBMA 3UK0A 1O57A 2PO5A 3G8YA 1A71A 2NU7B 3CH5A 2AG8A 1H85A 4PAWA 4QGFA 4GYWA 4BV3A 3ROKA 1J06A 1EWQA 2ZBDA 4HKTA 4OQYA 1H2AS 3OUTA 3ESAA 1JJBA 2A78A 1NDUA 3RE1A 1OYWA 2KYRA 4LHVA 3C5CA 1DFIA 1K2VN 2FEXA 3AONB 3L1KA 4IKPA 3W0LB 2ZB4A 1ZD5A 2Q6KA 4FK8A 5CB6A 4M7RA 2I3DA 2OG1A 1C81A 2LZ0A 3AFIA 3BWXA 3BM5A 1I33A 4WASA 1GGFA 1EPUA 2IV2X 1OYOA 2H57A 4J07A 1OTHA 1NP3A 1BOFA 3I1YA 8ABPA 5KIAA 2CHVA 5BVGA 1IEQA 2IQIA 3RVPA 5DCYA 5F76A 4GRDA 2VPYA 1ZC3A 3L6UA 5KOJA 3K5PA 5KTPA 3AJEA 2X1VA 1GYPA 4WVLA 1U8XX 3FYUB 3FZYA 2HXSA 4UEKA 1NXXA 5DSTA 2XX3A 4BNFA 3I2GA 5E4YA 5JMOA 3FWKA 3ELUA 1JU3A 3KJZA 5CM8B 5EHQA 1W76A 2H1IA 3QKWA 3Q2KA 4E5MA 3ANMA 3V42A 1H0KA 2GXQA 2P91A 4WLOA 5HKLA 5K0JA 3PUKA 5EEGA 5BSMA 1X38A 2GN2A 3DL4A 2I2WA 1SVMA 3HM2A 5CLQA 4YPFA 4IX9A 3FKSA 4LPKA 4AN1A 2ZWOA 2YXBA 2QTHA 1NU8A 4CMBA 2HD4A 2IEBA 1MT3A 1MVLA 1XZIA 2OBYA 3BQMB 4Q3LA 4C2BA 4B3IA 1CSEE 4D4GA 4E4YA 3LQKA 4Z99A 2CVFA 2DUJA 3TQQA 1JI3A 2YCBA 2QTGA 5BPFA 1OF1A 1D2MA 4DLAA 1VG9B 2G9UA 4M21A 3RJ9A 2WJIA 3LT0A 1KOGA 1E5QA 2CYAA 1JEQA 2DQZA 1XCBA 5JTTA 3TEFA 1QIJA 2IU0A 3S27A 4DRZA 4FHCA 4BKUA 2QX7A 2Y76A 3TTUA 5BW4A 3AVQA 3V7NA 1ISSA 2H4XA 1KYIA 1CZRA 2Z0MA 3AY7A 4LBWA 4DANA 4IQFA 4MQLA 1T6YA 3B2NA 2EKDA 1Q1BA 1I9GA 4YJDA 1ICIA 3FX2A 4AICA 4H18A 2QL5A 4KYTA 4GZ3A 3RSOA 5JYCA 3JQEA 1IAQA 3DV2A 3PDWA 4HRAA 4F38A 4DV1B 2WJYA 3PUIA 2IU6A 3FTQA 5C53B 3UWSA 2P90A 3CN9A 1Q77A 3PUWA 3ZE7A 1UKVY 4CWAA 3F8WA 2ZYUX 2V7XA 2VFAA 2WMDA 3AVPA 3T5AA 1IY2A 3GPDG 4RHFA 1MTZA 1EAYA 4WNAB 3OEED 4N40A 1P4HA 2JL1A 4HDNB 4MHTA 5JY1A 1XYVA 3VOTA 4BOYA 3D3QA 1N5RA 1L7BA 4AX8A 4O2AF 3GNLA 4FKBA 4MQ4A 3DLHA 3GDWA 2REQA 1GU7A 1YNOA 4PHHA 3IIIA 3ACDA 3I8SA 3PITA 4ZYZA 4II3A 3R0QA 4TVKA 4TRRA 3W04A 2AXNA 4FC7A 1G59A 1NLZA 1Y6RA 2R3SA 1Z28A 4UAVA 2QMUA 4KWHA 2EAUA 4ZAZA 3P9KA 3TWOA 1WZNA 4C7KA 4DCGA 4DMRA 5DJ5A 3WL5A 3Q0EA 1B3BA 2ZJOA 3ZK8A 3LBHA 4DILA 5AVOA 2P1DA 5LP6B 3KQUA 4X6YA 4EABA 1Z3CA 2HTFA 2MSNA 3O9ZA 3BKXA 4LRXA 4XOUA 3TQHA 3UFXA 2IH5A 2H00A 1GIAA 1V1MA 3MTQA 3O26A 4PX9A 1ADGA 4YT4A 3E3AA 4ENUA 1PAUA 4BFSA 3VSCA 1DGQA 3UWMA 1MOQA 1OLOA 1GPYA 1YZFA 3AV0B 3EIHA 1HG1A 1UPBA 3PTZA 5IAKA 5IC5A 2NUAB 3W8RA 2ZI6A 3R77A 1YK0A 1LI5A 3G13A 4IIEA 4QOSA 3HDHA 3BICA 4KVZA 1SQFA 3FIJA 4G36A 3Q3EA 4U2KA 4WXHA 4AS1A 2XRMA 3IVCA 4HN2A 5D01A 1W30A 4YDSA 3RVBA 3V4FA 3VYRB 3DMTC 1C8BA 1DC3A 3DR5A 4A2WA 2ZSIA 3D6VA 2FEMA 2ZREA 4LOKA 4PIVA 3WLOA 3OI7A 2XEXA 3A6HA 3KYDA 4GVPA 1B8OA 4DQLA 3QPAA 1IUNA 3KQQA 3QWAA 5LDDC 5JHHB 4H08A 3I1JA 1O9GA 4MQMA 2X6TA 4UJ5A 2PGAA 2X76A 4LV6A 4AF8A 4FEGA 4XLLA 3GB9A 3PQ6A 4IIYA 4BBAA 3BHMA 2R6GA 2QTAA 16PKA 1SHUX 1A72A 2NUPA 1XEWX 1J7KA 4GE3A 2FE1A 3LK6A 2QRVB 2G8LA 1ZGZA 1E1CA 1W85B 4XH9B 3J80A 3RS0A 1JG6A 3ICCA 4NV0A 4WFQA 1QQ5A 1DAPA 4BBZA 1UR5A 1NGSA 1XP8A 1I2AA 2Q3BA 3TL2A 3AUFA 3E9YA 4L4SA 2HSGA 1SBHA 4NCNA 2AN5A 3HFSA 2QRHA 1I3NA 3JCZA 3NYIA 3R5TA 3TO5A 4YRNA 1D6NA 1TMKA 1ZJZA 4L8FA 3GFVA 2SICE 2N75A 1REQB 4Q47A 4RADA 3B5JA 4E46A 3DLPX 3SQOA 3AR4A 3ZZ1A 3R7FA 1NWCA 4A0FA 2MJLA 1ZW1A 2PVSA 3HA3A 3V9PA 3RVMA 1AQIA 4YP7A 5DHPA 3TGLA 2PEZA 2CSXA 1N2CA 2C5AA 2IGBA 2YJGA 4D0RA 1HOXA 1R9NA 3EVZA 3ZHBA 2CB0A 1AQUA 4RLFA 1YC2A 2EF1A 2WM8A 3OF3A 4GGOA 3LVFO 1ZC4A 1L7RA 1ZIPA 2VA8A 3KTAB 3ENZA 4AJLA 5C7OO 4DEYA 3RRNA 3NCHA 4XOIA 5DW3A 1AURA 2X15A 3DPUA 1LDGA 3NIGB 1H0SA 4L50A 5CYPA 1M2EA 3E15A 1ZA2A 4BAZA 5HHTA 1FFDA 4LTDA 3V8EA 4D5GA 5G1PA 1JW9B 1MR3F 1HL3A 3QVVA 2EIXA 3DZCA 5EHIA 1P3DA 1UIRA 2NM0A 2QTNA 4OQMA 1CR4A 2VF7A 3LT4A 1C1HA 2NO6A 3B70A 1DAMA 3E9EA 5CJJA 2HA4A 1G64A 1M1NB 4CCAA 4HN9A 4EUEA 3TVDA 1ZR2A 1MZVA 1IBKB 1ULUA 4L2IB 4AQ7A 1FFXB 2EG9A 2JFBA 3D2BA 1AHNA 4M89A 1XTKA 4GPZA 2JFYA 4GWLA 1A27A 3R7NA 4DLLA 5HSGA 5JC1A 4UBLA 3FOWA 3WYFA 3HL4A 5FIUA 1TM2A 5C31A 5KYGA 1Z6AA 2HIGA 2DWCA 3BG5A 3GPBA 3DZDA 4XVQA 1FZTA 2F1OA 2NUTA 4OYRA 1M6VB 5TNXA 2RC5A 3ZD9A 421PA 3KQSA 1AIPA 2ZE8A 1FBTA 2GJAA 1UXGA 2IYLD 1MOZA 1PYGA 3WGJA 3EPJA 4W9RA 3BCUA 3D3WB 4EFNA 3GWGA 1BZYA 2VNIA 5REQA 2ZJAA 4MWSA 1QRDA 5A6SB 4NI5A 4TLMB 5ISMA 2Z6VA 2UYGA 1J99A 1M1YA 2ZE5A 2F17A 1RJDA 3EARA 2UUCB 1XELA 2G28A 1ZH4A 3E4DA 2ONCA 4B3MB 1E0SA 1R5BA 3FI0A 3RYFB 4LZZA 1KPIA 2GILA 3IVMA 2FXVA 4UQPA 1O97C 1VB5A 2WMOB 4S1NA 2WE8A 1SBTA 3QFHA 1POWA 3ZHRA 4Z9XA 2JLAA 4HVTA 3P52A 4QKQA 4ZKDA 1IUKA 3HYTA 2CCJA 3IXMA 3HR8A 1G2IA 3NWPA 2I2CA 3PK0A 4QL3A 5FXMA 1CV2A 2GEFA 4I5FA 5JASA 1ABBA 1EMDA 4CXMA 4OKNA 1NULA 3BXFA 1TDJA 3LXRA 2WW8A 3SQNA 3O4IA 3E58A 3BPSA 4MWEA 4U2CA 3C97A 3L5OA 3C6YA 5C0OE 4C1NA 4L8YA 5KVCA 4XWTA 4P54A 2Y0PA 1W88A 3ONFA 3W4KA 3WYNA 5NLLA 4D3SA 3ANTA 2B36A 3O8QB 2JA1A 1H5UA 3GFGA 5C46F 5I9BA 1B74A 1U3GA 4WBNB 3QV2A 1J0AA 1Q95A 1USUA 2NU9A 1WEHA 3DCYA 4AP6A 2X0KA 3L8DA 3TOZA 5GGYA 2HK9A 4FFBA 5SYAA 1XAGA 4B33A 3LCJA 4BHHB 3RFCA 3FOCA 3HU2A 3SEZA 1TM7E 2HUNA 4UVIA 3CZ4A 3SVZA 5IM4F 3B9QA 3DO5A 5I4IA 4DCPA 3ND5A 1NMYA 1UH5A 3VPXA 2J48A 2WQ6A 4CNBA 1L4YA 1UC5B 5K8UA 3BF8A 4KXYA 2FTKE 4QG7A 3OPYA 4PBTA 4YAEA 1N9ZA 1U7TA 2QB5A 2QF7A 3ETHA 2OFXA 3LM8A 1MNQA 4W99A 1LSSA 3EGWA 4DCCA 3S2UA 3KCNA 3FOZA 1E32A 1JTEA 1XMXA 4QUBA 1IHXA 4WGFA 4TMXA 2IE8A 1XNJA 5I51A 1ZY2A 3I01A 4G2TA 4LOIA 2CHEA 2CYBA 3OO1A 1WLYA 4NKRA 4YMVA 1OB2A 5AVSA 2QQ5A 2D2VA 3MJSA 1N75A 4DBZA 4DMGA 1OTXA 1KS2A 3VBEA 1G8JA 4YP5A 1SA0B 1FLVA 4OQPA 2QYHA 1ZD1A 4EMUA 3HB9A 3L0IB 4L5YA 1KAEA 3IIEA 3HO6A 4LVNA 3EZYA 4XI9A 1GXSA 2FF7A 4FHDA 4JOSA 1VYTA 3V1UA 4DMFA 1QZXA 1Z8DA 3MTIA 3QGMA 4KQEA 5PNTA 5IN4A 3TG2A 4KZPA 1LZKA 2BFFB 3QEJA 1DO8A 2ZBGA 3FPHA 2G88A 3ZZMA 1P1RA 4DXHA 3OF2A 1VJ5A 4YACA 4W4TA 4AFNA 2XXAA 4N3GA 4LEIA 4GWGA 2HRCA 2VBFA 3A1NA 3T3GA 3U0BA 4B43A 1OFGA 4YR9A 2R8RA 1Y98A 2VLBA 2DHRA 2VJKA 4I4TB 5AT1A 3ZCVA 1A9XB 4LYYA 4YMHA 4J0JA 1ZGGA 5TV2A 2QVZX 4DHWA 2GKGA 1Z37A 2HA2A 3UUFA 1KEZA 1LGYA 5BWBA 4TRNA 1E9RA 4G63A 2COEA 4RPGA 4X95A 1SKYE 3TLBA 4R0NA 1EA7A 2XDYA 3QA3E 4DE5A 3F71A 3HV2A 2PMDA 4HMPA 4IJQA 3IQEA 2M98A 2QM8A 4LJAA 1Y1SA 4JV5B 2I4NA 1R3DA 3L7BA 1C29B 2PX0A 3MRVA 2EYQA 3ODGA 4ZT7A 1E1RD 3PFWO 4JB0A 4P5PA 1M7BA 2FWAA 4YWHA 3WJ7A 1NW7A 2YHIB 4RDHA 1L4NA 5EWMA 3GDFA 1CVLA 4UREA 1CNMA 2AQIA 2P4SA 3OPNA 1WMAA 2FWIA 3O93A 4XGIA 2C7PA 3GLFE 1ZVMA 2AH5A 2UXBB 4HS4A 3L49A 4LHZA 5IJWA 2H59A 2J09A 3SKVA 1F5NA 1TMGE 1ZNYA 3PGVA 4TTVA 1PLJA 3OPYI 3V1YA 2I6GA 3BIJA 3KAQA 1XJ5A 5AK6A 3V8VA 3WB1A 5J4KA 4M0CA 2FF5A 4JI1B 4RA9B 4HUQB 4YXWD 1F6BA 1HNXB 2XH8A 1RYMA 3TZ6A 3IAM6 3LDFA 5JVDA 1JPVA 1X8JA 2Q8NA 1QAMA 1G2OA 2AYXA 3GCDA 4LYJA 1W29A 4JR0A 1ZVVA 3GRFA 1NVXQ 4R1MA 4AK9A 4QOEA 3KHTA 1M7GA 2CL5A 1L0BA 1WCIA 4OYYA 4N01A 4DR3B 1TD1A 4W5JA 4DUGA 2WZDA 4XB1A 4C20A 5B57C 4MI9A 5B64A 4ZOLA 1KVQA 3TLGA 4AP9A 2DQYA 3FCEA 4WPGA 3S8MA 4UTVA 2WIGA 5FEMA 1RI2A 3T9DA 1SC4A 5HIMA 4QFDA 2DBRA 3BE6A 4P4LA 1IXSB 4YQFA 5JDIC 1PJ4A 3T6KA 3VU8A 2VP5A 2O1EA 1IFXA 2JFGA 4PC7A 4A8PA 1KYTA 4L9WA 3KK0A 1K6MA 1ONOA 5DLYA 1PFVA 2AK3A 4MPRA 3AKZA 3M6FA 2W4IA 4L0MA 4NG5A 4BQSA 3OQ6A 1D04A 2PXXA 4JDPA 1XEXA 4HWOA 5I5EA 4BX2A 5AFSA 3PT9A 5EP2A 1O3YA 1MEJA 4I3FA 2QVGA 3BWVA 5HTKA 4EFMA 5K3EA 4DDVA 2HGSA 2KLBA 3H65A 4OJQA 3CF4G 1RKVA 3A0RB 3I6MA 4PZYA 5MHTA 1KZ7B 3KOXA 4KR7A 2CNWA 3P32A 1PFUA 1YL5A 2ZE7A 3A6LA 4MIOA 2OXEA 2P3OA 5FBKA 4TWBA 4XCXA 4YRIA 3L0OA 5CX1B 3WHIA 3R6LA 2YHSA 2WKSA 3RFUA 3DUWA 4D0SA 1KGDA 5BN4A 3H5TA 2CXPA 4IXMA 1N4DA 5FBRB 5AKJA 5LZ7A 1P7CA 3WA6A 3GFOA 3NQ41 2QDXA 1DV2A 3W5DA 2G82A 3QE2A 4GQIA 2QRKA 3O4HA 1KE2A 2W5UA 4ALMA 2ZTUA 1G60A 1VXOA 4P4GA 4IZHA 2FKNA 1T1IA 2GCOB 1FP7A 4HXYA 4J4HA 5L7TA 5LA6F 1YD7A 3WK4A 1YSCA 1LNQA 5BN5B 2EERA 3LOPA 4D56A 1GG9A 5ALYA 3BSSA 4UUOA 1PWHA 2QHXA 2O1XA 3U7QB 3UWDA 2WHQA 4JN6B 1Z73A 5B4TA 5DWDA 3A4MA 1DZ3A 1W0KA 4BYMA 4AKGA 3PDHA 5JQGF 1ZK0A 4YUXA 5JSQA 3K9HA 1C9DB 2WTXA 3A1TA 2W2QA 2W2OA 1LK5A 3JSXA 4WERA 3V1NA 5CDGA 4IHQA 3AETB 3B36A 3C1AA 4OK6A 2FSHA 5FOUA 5K3OA 3NMUF 2WJAA 1RHMA 3N59A 4LX8A 4G8BA 5C3MA 2M6KA 3CLRD 4B2PA 1Q91A 2WZCA 3HJRA 3SLRA 2GCEA 1Z5ZA 2QPOA 3GBPA 3U3ZA 5LXTB 2CWWA 1SELA 2GVDC 2QZ9A 2BKEA 3E4CA 4MP6A 1GQYA 2GGSA 4DCUA 1DKUA 1XVLA 3TCNA 5CVTA 1I5EA 4YCLA 3MPOA 1IHYA 2ZATA 4RMJA 3ELBA 1WSWA 4J9VA 2IYQA 4NV3A 4IZIA 4WD3A 1H1LB 4HDMB 1B23P 2GM5A 3JPWA 1M6EX 2OKCA 5IDQA 2EJTA 1J2TA 4RM3A 4MKHA 1Y1TA 3W9YA 5J4HA 1TT5A 5A3QA 1TUBB 3ZH2A 3RRXA 1JXOA 3HB0A 2VYCA 3GUZA 4CKEB 4KLZA 4KBYA 1KA9H 1WPXA 3DEYX 3SLGA 4B7AA 1GO2A 1HTTA 4GLFA 4R3NA 5L3RA 3FTPA 2NZJA 4GPAA 3VXKA 4DGQA 2CNDA 2H1FA 3BJIC 1DFGA 1Z7YA 1T5HX 2H0AA 3O4FA 3OZAA 3R3YA 4FIZA 3IR7A 3QUSA 2CC2A 3S8EA 4DR4B 5A9SA 3RBVA 3NBYC 2PRSA 3BCSA 3I12A 1PI3A 3S0JA 1BGVA 1P6XA 1X7ZB 3A06A 1NZJA 1TO6A 1A69A 2R9VA 2YC2C 1P2DA 4H1TA 1J8VA 1G63A 1KFBB 5AVUA 1FZQA 1QO0A 2VDRB 3A1WA 3QEOA 4EI7A 4TMWA 1R10A 5IJ9B 1CS0B 1NJ2A 5BMOA 4R2HA 4TS3A 1Z3IX 3AEKB 1AUOA 4QGAA 4M46A 1RPNA 4MYUA 5CDYA 4ZI7A 1N6KA 1VDMA 1NI4B 5D3ZA 4LJ7A 1M2OA 1HEYA 2F67A 4FI3F 5FWXB 1XT6A 5JYDA 2FHSA 1GG2A 1UDAA 4TYPA 3GNTA 4WXYB 1RPZA 4CEJB 1VG0B 5KYVA 3ZQKA 1EXNA 2IL1A 5B3LA 1JR6A 3AT1A 1YL7A 1T3SA 3VTFA 2IZOA 3OCUA 3NUGA 3CX4A 3HDQA 4LZPA 1PZHA 4GZ5A 4MDYA 1OR8A 1PFGA 1WLSA 3ROTA 1EJ2A 1Q1NA 1YA8A 1DXHA 3NDPA 1EQAA 3U44B 2Z1NA 4EUSA 1RRGA 1RYBA 2HLPA 3RSGA 4FU0A 4JP1A 1ZNQO 1IM2A 3L6CA 3LWNA 4D5EA 3ADKA 3I01M 5DBIA 4H1HA 4QNMA 4D99A 5IT0A 2BGWA 4DC9A 5CG1A 2JIQA 4YRDA 1D7AA 4GBMA 3R5KA 2V3WA 2WYVA 4NK4A 3OVMA 4Q9LA 3ZQUA 4KIGA 1MB9A 1V5FA 1ITZA 1ZN7A 1P5ZB 1LKZA 4W7HA 4XUDA 4OK5A 1ZD8A 2I4OA 4B0PA 1QQAA 4O4HB 3U4QA 2IEAA 5K09A 3VDNB 3CY6A 3KPUA 4XLTA 2J3QA 3V4RA 3VR6A 5K0CA 1W46A 1XE3A 2QQGA 4Q4AA 1GQOA 5E2BA 4Y1FA 3FMGA 5G1OA 3S2YA 2LBPA 3W3ZB 3F1KA 3EWIA 4NE9A 4RABA 2R7KA 3OY2A 5ULLA 1IYZA 1VA4A 4YDQA 4NZMA 2NU8A 3TSCA 1PK7A 1W5FA 3A6GA 3OP4A 3IQIX 1DXQA 3CZPA 1IONA 2W00A 3NAQA 5HRUA 2OTCA 1XMIA 5JLAA 1U2ZA 2WWRA 4EZIA 2HNBA 4JP3A 2R65A 1GA4A 1QHGA 3CXUA 1KF0A 4P35A 5CPBA 5KC9A 1K4YA 4BATA 1ECPA 1C30B 3WA7A 2HU7A 3OCVA 2QUBA 4OJMX 3VUEA 5L45A 2O3TA 2GAIA 1GVHA 4RVFA 4JFRA 4DTIA 1RPJA 1NFQA 1A7JA 1PVDA 3U3RA 5A5DA 5KZMB 3V1MA 5TPWA 1ID1A 3C3AA 4QVIA 2JHFA 5ILOA 3AY3A 5K4HA 4KQIA 3HZOA 4L95C 4UCWA 2P2ZA 3HA7A 1G5PA 1ULHA 3PUHA 4QWMA 1U8UA 2BZGA 4AY3A 4Z6KA 1GQSA 4CT5A 1AVTA 3C7TA 2VP0A 1XB2A 1XZGA 3TSZA 2FMTA 2E3JA 4O4LB 2FOLA 1F48A 4W8GA 2ERCA 3SBEA 1AQLA 2RI1A 1NZDA 3C7KA 1AKYA 1P5JA 1SVUA 2WU0A 3FUVA 4TMKA 2EQAA 1B6RA 5JNWA 3CE9A 2O19A 3TE7A 4K28A 3PHLA 4C4AA 4DIDA 4F2WA 2B4KA 4PLZA 2VYND 4WFIA 4WRRA 5LMNB 5A02A 2RHCA 2IEGA 2ORED 2WKPA 4EP1A 2JJ1D 4MOWA 5FPSA 2OP0A 3NVKI 1NX9A 3BMCA 3I34X 1NQ5A 4PRKA 3JSAA 5EE1A 1A8IA 3BFPA 4KGVA 2IOFA 2W6QA 4II7A 4BNGA 4IOJA 5M5BA 1VE9A 4J1SA 3TKYA 4WZBA 1RHQA 4Z86A 3KIPA 3COJA 3SS9X 4CF7A 3UCEA 4G25A 1GARA 1JU4A 1GNLA 4CT4B 4RC9A 3MOIA 3U31A 4RMHA 4Z1MD 3ZU2A 2ZI3A 5BVGB 3B6MA 4GXTA 2E87A 2PXAA 5KNDH 5KOJB 4CQMA 5JSUA 1NC1A 4JOBA 1J9GA 1O6GA 1KIMA 5DMXA 4CPDA 3ILXA 3BQ9A 2FSVC 1ZCJA 4B6PA 2H4HA 3E2MA 1MC8A 5IVDA 3JQAD 5HF8A 1UDBA 1TI7A 1UEXC 2ZRKA 2O8FA 1P73A 4FP9A 4MW6A 5FBWB 3PD7A 3K73O 4XX0A 2J9YB 2EKQA 4C6TA 1SXGA 2LKDA 2O2IA 2VKQA 3GUCA 4GOKA 2G9QA 1ORRA 3LYUA 3PPIA 5ALFA 4EHJA 1VPEA 1D1TA 4EI8A 1EFDN 2FRXA 4FJ2A 2EV9A 1QYCA 4BKPA 4ZRDA 1R0YA 1JQAA 1SVLA 2YZ7A 2C2HA 2YJ5A 4M7PA 1J8QA 1VSBA 2UVPA 1SOWA 3KWFA 1PNOA 4BEBA 2FR8A 4Z4CA 5KREA 1S89A 1W5EA 3IBGA 3GD7A 2Q2QA 1BAPA 1K4KA 2VXOA 5ANRB 3V1LA 4DL9A 3K70B 2ZSEA 4C2TA 4ITRC 3FUXA 3IERA 4KEAA 2OP1A 1R4MA 3D7LA 1JEQB 4FQ5A 1R0CA 4QOFA 4HDAA 4GH5A 1U3DA 5CVJA 3U5TA 3VJKA 3W3AD 3UUWA 5HTOA 4C88A 4N9WA 3KQVA 3OC0A 3QLUC 2Q7OE 4Q3BA 5EXPA 1T8UA 5EINA 1E59A 3HSSA 1DAIA 4C3OB 1PKXA 2D5LA 3AQIA 3N2GA 4MVJP 2BKAA 3E70C 1E0JA 3B51X 1TD9A 4N41A 2W98A 3OQJA 5HX7A 1ZI9A 5B36A 3IDZA 2Q29A 3F2VA 2H9YA 3PPVA 4DR2B 1DTSA 4YUYA 4KXWA 3W8DA 1HYBA 1RMTA 4Q9DA 1NQWA 2PUJA 1J20A 1YS1X 3N74A 1NRXA 1P1JA 1W4CA 2JLUA 3F7TA 3KXKA 1R3UA 2GO1A 4L8VA 2DPYA 4MV5A 1W87A 5HGJA 1XYYA 3EXHA 1G8PA 1L7AA 5B2EA 4BWGA 4EBFA 5B2FA 1ETUA 2GAJA 4N8SA 3VHQA 5IK2D 1DAHA 2I6UA 2C4WA 3N6XA 3SBXA 1YZTA 2X8WA 5AW2A 4JI2B 3UNXA 3L05A 5LD2C 3W2EA 1CRWG 1WUIS 4JAVC 2ADFA 3BMNA 1S2DA 3L8YA 2AMYA 3LPMA 4FYJA 4M49A 1NOIA 1HYGA 2XCIA 1UCFA 4KK3A 4E2ZA 4F7WA 3INTA 4PS0A 4K9MA 4KG7A 4JUCA 1LW6E 2BGJA 1YHYA 3E5NA 3DFIA 4YP9A 1I0ZA 1JVBA 1WY5A 2VOEA 1LW7A 2YJ4A 4GM0A 2PV0A 3RYHA 1PD1A 5J9FA 3W6PA 4G1EB 3ZIUA 4JC4A 2CGEA 1SVIA 2G5TA 3ER9A 4PZLA 2V96A 2HO5A 1VL6A 4FFSA 3WLLA 3D8SA 3DNFA 4TL6A 3UFXB 3BMOA 4IRMA 2CN1A 4M22A 3V2UA 4N8EA 1V1MB 4NMHA 1FFEA 4FFPA 3F96A 3OT4A 3T7DA 2RAUA 1DPGA 1D4ZA 3BL6A 2RIRA 3DTNA 4HEQA 3PI6A 1BDMA 3L8MA 4QJ5A 5TMBA 5BNIA 2Q28A 5CH5A 2ZQ5A 2CXTA 4H7KA 1CJCA 5JCZA 5TR9A 4AL4A 4B7XA 4QWWA 4B5KA 1QM5A 3QVLA 1PDVA 1YQQA 5F5LA 2G4LA 2NTEA 4ED9A 1DAOA 3FTFA 3WLFA 1I7SB 4EY4A 5A6VA 3EA0A 2OYSA 3F6BX 1KBQA 3DHEA 4JASB 2OK8A 1XTBA 1SVWA 1WL8A 3OEEA 3BXZA 3KU4A 1JHVA 3AF0A 1TGVA 4TT3D 4DADA 4A6XA 5K8TA 2R6HA 1QB7A 2ZSHA 3V8BA 5FA8A 1D0SA 1XDUA 1X39A 2ASVA 2ZYHA 1FNDA 4ZOCA 4BV9A 3TZLA 2F55A 1CR0A 2YRFA 2NSDA 1K75A 3RS7A 5K4AA 1TA4A 3WSTA 5IWCA 2NUPB 3JWEA 4NYJQ 4E5UA 4B9AA 1A7AA 1E1CB 2LDXA 3QKUA 1K1EA 3ESRA 1NC3A 2XMZA 4KUGA 4O4JA 3BGVA 4GMFA 1QIHA 3I37X 4MS3A 3VAYA 2PSHA 1VI2A 4YJFA 3HKBA 3N5CA 1X2EA 2B99A 1R0ZA 1YZ3A 1HZZC 1BVUA 2GBPA 4HTAA 5JCOA 4QDZA 2FW1A 4JA2A 4JX9A 1IUOA 1D4AA 1WTCA 4P31A 2YJ6A 3U4CA 3M4YA 3QU9A 1HLFA 4PLHA 1M6NA 3D8BA 1YDEA 2V5VA 1M34E 3P26A 1HDZA 1M3SA 2CD9A 4NMMA 3ZZ0A 1MRZA 2DBQA 4BRUA 1EZ4A 5A7GA 4L27A 3TD6A 4E21A 3K8ZA 3ZJYA 2C1XA 1N2CB 4UCFA 7GPBA 3UG6A 1ZA1A 5AJVB 3SZLA 3PTAA 1Q7TA 3O75A 1MENA 3R0ZA 4MMYB 1P7YA 1SRQA 4EKYA 1EX1A</