1VL0A

Crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
HMKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNPQSAYGKTKLEGENFVKALNPKYYIVRTAWLYGDGNNFVKTMINLGKTHDELKVVHDQVGTPTSTVDLARVVLKVIDEKNYGTFHCTCKGICSWYDFAVEIFRLTGIDVKVTPCTTEEFPRPAKRPKYSVLRNYMLELTTGDITREWKESLKEYIDLLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DTDP-4-dehydrorhamnose reductase, rfbD ortholog (CAC2315) from Clostridium acetobutylicum at 2.05 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords DTDP-4-dehydrorhamnose reductase, rfbD ortholog
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vl0A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1vl0A02
2VCYA 1G0NA 4BNFA 2QG4A 1E7YA 4NDNE 4WCFA 4PVCA 5F5NA 3NAQA 2FSVA 2J3IA 4BO0A 3DHYA 2DBQA 2VRCD 3RJ9A 3V2HA 1HYHA 2BRUA 3U4CA 3QA9A 2AQIA 4BNIA 4DBVO 1AGNA 5IDQA 2DTDA 2BI8A 3AOEC 3MTGA 3E1KA 4Z9FA 3MJEA 1IULA 1ZW1A 5AXCA 4GX1A 1A27A 1KEPA 1ZKMA 2BFAA 1N5DA 3L6OO 4WNCA 3QJ5A 4F6LA 3IKTA 4CV3A 4HFMA 3DBHB 4M87A 1X7GA 4EZBA 1B7GO 2UUOA 4J9UE 4TZTA 1BW9B 2XPCA 4J9VA 4JGBA 1E3EA 3TZ6A 2HU2A 3FNHA 1F8GA 2Y99A 3I9LA 3QRWA 3OEWA 3CPSA 4XYLA 3JSAA 4Q9NA 4B8ZA 6ADHA 2GZ3A 1NHGA 1U3WA 3BHIA 4CQLB 2EGGA 4PG8A 4TSKA 5J23A 4XGNA 2EJVA 4JK3A 1UH5A 2BFPA 1SPXA 3W4JA 5CDGA 4YAKA 5COBA 4L4RA 3RFXA 1ENOA 3HNPA 3DL2A 3KB6A 3BMOA 4UVDA 2OFPA 1C14A 4D7AA 4IDAA 2X9NA 3IOYA 3PJEA 1WPQA 1E7WA 3A14A 4LISA 1R4MA 2O48X 3DQPA 5DNAA 1FF9A 1PWXA 3VPHA 1YGYA 3G17A 2HJSA 1KVSA 2HRBA 2IRWA 4DLBA 3LT4A 1GADO 1B15A 2D4AA 5H81A 4BGVA 1EUCA 3NRCA 1R15A 4RZHA 4WECA 5T57A 4YJGA 2RH4A 4ZQHA 4J16A 3ADOA 3AOEA 1B8PA 1KERA 2H5LA 5DDIP 3CZRA 3NX4A 1FDUA 4BNKA 3ZW9A 3RAJA 3QVXA 4PLWA 1O94A 4YJFA 3FNFA 3G79A 4PG7A 1ZO8A 3HB5X 5GMOA 1YOVA 3NV9A 1B8UA 1DIHA 4CM7A 3BZUA 4KUEA 1Y8RA 2JKVA 4XRGA 2I67A 1LRLA 3JQCA 2JCXA 2A92A 3PTZA 1EK6A 2TMGA 1BVUA 3E6AA 4R01A 3HQ4O 5H83A 4AICA 3HDHA 4FC6A 4O0LA 4JLWA 4LGVA 5A9TA 3M2PA 3SC6A 1ENZA 1VKOA 4BKUA 3IC5A 5CP8A 4ZVVA 3OJLA 4YYZA 1KEUA 4YCAA 1DFIA 4P4GA 1HZJA 5JCJA 5BNTA 3OJ0A 4OOFA 3PYLA 3ON5A 3P5SA 2V6MA 1E6EA 1HE4A 5CEFA 4CJXA 3PGJA 1CQIA 5F3RA 4E13A 4RV9A 1MG5A 4J4BA 2YQ5A 3Q2KA 3TSCA 4JCOA 4BB5A 1VM6A 2B69A 2A35A 4U6QA 4IJKA 3D7LA 4CMAA 2B0JA 3GPDG 3CMMA 1VL6A 3I9OA 5C3MA 3OA0A 3KUXA 3I6QA 1KVRA 4L76A 2RHCA 2O4UX 1P0FA 2IZ1A 4XIYA 5DBIA 4A0SA 1FDTA 3I9NA 3EYWA 4NK5A 2HLPA 5G0WA 1T2FA 3MZ0A 2ZTLA 4QUKA 4RCVA 3NT4A 4D45A 3H9UA 4Z0PA 4ND2A 3E8XA 4GPD1 2O3RA 3IUSA 3O4RA 1TB4A 4ONEA 2O3JA 4KQWA 4YT8A 4DQVA 4GL4A 2CDCA 3BTOA 1PJBA 4FC7A 3B1KA 4XIJA 3OIGA 4I9HA 1QG6A 1MC5A 3D64A 3C1OA 1PZFA 1P45A 1U9JA 3VDRA 3QQPA 4LSMA 1RPNA 4DWVA 3MJVA 1RWBA 1T2AA 2I99A 1EUDA 2X5JO 2DFDA 1FXSA 3IMFA 2W2LA 1GZ4A 4U8GA 5I9MA 4IDEA 4D0SA 2X5KO 4NZ9A 4L73A 3BMQB 3JQGA 1IOLA 3QSGA 4E30A 2PD6A 1M6WA 4L4XA 4FD3A 5C7LO 2AG8A 4HFNA 3OQ6A 4BO6A 5KJFA 4ZQBA 1YJ8A 1E3LA 4J0FA 2V6BA 3Q6IA 3BHMA 2HMWA 4KDEA 2VRBA 2WSBA 2Z1MA 3G3EA 4NG5A 4ZA2A 3K2BA 2GGSA 3VDQA 3DBRB 5A05A 3SBOA 1KY4A 5KVQA 3ZWXA 4E3ZA 1J4AA 2EJWA 4WLVA 4AJOA 3P2OA 4FFNA 1EUZA 1FDWA 3WGZA 2VWQA 1K6JA 3WMXA 2BF7A 5ENVA 4BMSA 4R5MA 5KTKA 2CVQA 1A9YA 3KYDB 1YS4A 3B6ZA 4TKMA 3JQDA 2JCVA 2QHXA 3PHGA 3ZWMA 4BMNA 3WSWA 3UGKA 3I1JA 4UVEA 4ZJUA 1ISGA 2YDXA 1SEPA 4TRNA 3L77A 4I5FA 1AE1A 1TEHA 1Y5MA 3ZCXA 3MCVA 3F1KA 4IM7A 4MVJF 4O63O 2ZTUA 5BSEA 1S6YA 3GGOA 3LC7O 3GRKA 5JC8A 1CJCA 3I4CA 2AXQA 2Z5LA 3FN4A 4LK3A 1XELA 3UCXA 3P7MA 2FHSA 1K0UA 1K3TA 4IMRA 4HXYA 1ZVMA 4NQZA 4AJKA 1ONNA 4X54A 2Q1TA 5B37A 1DB3A 2E48A 4MKXA 1C0IA 3OM9A 1LRKA 2Z95A 5EQDA 1EDZA 3ITKA 1GV0A 2VHZA 2Q1SA 3OETA 4AVYA 5TJ9A 4RDHA 3K6JA 1V6AA 2Y05A 2A94A 3ORFA 1I32A 3RUHA 1DAPA 2ZK7A 4OXNA 3K2EA 4GX5A 4IDDA 1PQWA 2G0TA 5FYDA 1EDOA 5JY6A 3PLRA 4BNZA 4CMEA 1HXHA 4FJ0A 3BMNA 2Q2QA 3UXYA 3N58A 4IIVA 1OMOA 3A28A 4BKQA 1X0VA 4Q3DA 5CG2A 4MDHA 4BKPA 2X5OA 5JCJD 1E3WA 1YXMA 4MKRA 4YT5A 4YA6A 1D8AA 1EQUA 4GWKA 4PZDA 2JFHA 3OICA 2UUPA 4QX6A 4WGGA 3WFIA 4EJMA 5CDUA 3QVWA 4B3IA 3FTPA 3VHRA 5T5QA 2ZYDA 2D8AA 2D59A 3AI2A 3IKVA 1SO8A 3V5NA 4PGFA 3DZBA 4AJ1A 3AUUA 3JD1A 1BDMA 1UR5A 2WYVA 3STHA 3D0OA 2C5EA 3DTTA 5G4KA 3LVFO 1TA4A 3AUAA 2XF8A 3ETEA 3ZU3A 1JTVA 5BSFA 1OFGA 3ZWPA 4E12A 1X0XA 4RPGA 1R4MB 3DONA 4MVJM 3LF1A 3ONDA 3QWBA 4ZU3A 1PSDA 3L4BA 5FEUA 1P1IA 1NPDA 4JP3A 1LSJA 4RVHA 3TRIA 1SMKA 4E6PA 2AEFA 5H82A 4DPLA 5L53A 1ONOA 3EDMA 3AU8A 3OA2A 4II2A 4R51A 4CMIA 4D46A 2B5VA 3KYCB 4BS9A 1GQQA 2AMFA 4BNJA 2WE7A 4DIFA 2WTBA 1I10A 3IP1A 2G82A 4ITUA 4OKIA 5DCYA 1Y9EA 2HDHA 4INAA 4NHEA 1UXJA 3CE6A 4PRLA 1DBVO 1TXGA 3R6DA 4M8SA 4M55A 1T1RA 2Y1CA 4XZ3A 1B8VA 1F06A 5A9SA 1I3NA 4AJHA 1P77A 3WJ7A 1LU9A 4UEOA 4WLEA 4OXYA 1Y9AA 2OOSA 1C1DA 4RVUA 1GD1O 2P68A 3AM3A 1AN9A 5LDHA 3ZNNA 1H2BA 1S7CA 3BMCA 1Y7TA 4BNHA 1KS9A 3I5MA 5IZCC 3OSUA 3QVOA 1LLQA 1GCUA 2PZJA 4HWKA 5L45A 5JMWA 3EHEA 2HK7A 4IJUA 1NQ5A 1ZCJA 4JIGA 1D1SA 4W9NC 4N7RA 2Q46A 3BAZA 4J90A 3AOGA 2PTGA 3GZ4A 1J6UA 3OBBA 2OUIA 2RHRA 3OIFA 5DP2A 5A3VA 2QYSA 4E21A 1PGJA 2IYPA 4BIIA 3VH1A 3KEOA 1U7TA 3PHLA 8LDHA 4ZQEA 1XG5A 2D5CA 2ZCVA 4XEHA 1GL3A 4BHTA 1K89A 4ALKA 4Y67A 5KOIA 1PX0A 1QV6A 1YQXA 4MVJP 5L7WA 4IJVA 2Q49A 5G0TA 2Q4BA 4ZICA 4E5KA 3WS7A 1GCOA 3PRJA 3RI3A 3PLNA 5DCUA 4YRAA 1Y6JA 2XXBA 4EGFA 1V8BA 1ZK2A 3IP3A 3NGXA 5IG2A 1WDMA 4FS3A 4P38A 4QSMA 1LI4A 3WGHA 5BQFA 1V3UA 3WBFA 1JN0A 4RO0A 2WYUA 3VH4A 3QWFA 3I3OA 4A10A 3JQ7B 2NWQA 1SAYA 4ALIA 2IZ0A 1JKJA 1Q7GA 3VAZA 4K6FA 4OH1A 3JQGB 2I9PA 2WD8A 4J43A 4XJSA 5A9RA 4QO7A 3WYCA 3JQ9C 2I66A 3ZI0A 5L51A 3RC1A 3UW3A 4RZIA 2NM0A 3HDJA 4DGSA 2R00A 5LCXA 3GDFA 2WWRA 1C3VA 4MIYA 3MJCA 1XSEA 2X1HA 3GOHA 2BKAA 3WGOA 4JBGA 5KVVA 5EERA 2DTXA 1NPTO 1E6WA 1QLHA 4CMGA 2WEKA 4RVGA 4KWHA 1XHLA 2W2LD 4GMFA 4RQTA 2AG5A 1NAIA 5CG1A 5IJZA 1LDBA 5T64A 3GNQA 4YVFA 1HDCA 4MKZA 1UP6A 2BELA 2HCTA 3KEQA 3PWSA 1JA9A 4XB2A 3RC2A 1E77A 3TFQA 2VOJA 4MVJI 1YQDA 1F0YA 4GI2A 2X4GA 2P9EA 2I6TA 3OMLA 5C7IO 4BGUA 3CINA 3T7EA 3NKLA 3WTBA 1H93A 3JQAB 4FFPA 3JQEA 2WJPA 4DYDA 3C7CB 1Q2XA 1QR6A 1I36A 3VPGA 5A5FA 5JW6A 4J1NA 4A03A 1PGNA 2SCUA 2V6FA 4PLFA 3ZW8A 2ZB3A 3RVDA 2B37A 4XQGA 2AEJA 4NPCA 5IXSA 3GPIA 2CNBA 1HLPA 1PTJA 3C7AA 6LDHA 1K6IA 4OAQA 5MDHA 2FR1A 1LLUA 4E2WA 1IL0A 2G5CA 1LJ8A 4BV8A 3CZMA 2DFVA 3UFXA 2NU9A 1A7KA 2W90A 4ZQFA 1BHSA 4IMPA 3HG7A 4E5NA 3OEYA 3VC7A 1UZNA 3CTMA 4YRDA 1XIVA 5I7FA 4R1TA 1GUYA 4LRSB 3KVOA 1XKQA 2ZJ1A 1P1RA 5HA5A 1V35A 1JVSA 4IS3A 5L40A 3VPXA 1Z73A 3H6KA 3GHHA 3H5AA 4PIVA 1ADCA 4MOWA 4R3NA 1N7HA 3NJ8A 2HO5A 1M6HA 4JJGA 3KSZO 5JYDA 3BMNB 1EE9A 3H5NA 4YB8A 3X2EA 3ZU2A 3AM5A 5U1PA 3KO8A 3L0DA 1KVQA 4BNXA 3DMTC 1LRJA 4CM4A 3HFSA 1DC6A 3FR8A 4U0KA 3AY7A 4EW6A 1RYDA 3ZN2A 3WDSA 2DPHA 2GF2A 2NVWA 1G1AA 3F3SA 4E2YA 2WE8A 5JDCC 4BL5A 1LDYA 2VUSA 2XAAA 1C0PA 3KBOA 2GERA 3HZZA 1DC4A 1PZEA 4D0RA 1VJ1A 2Y1FA 3VZQA 5HTOA 5L7YA 3EZLA 5EJ2A 5JDCA 4B7UA 2A9FA 2ILTA 1KVTA 4JJFA 5GZ3A 3H2SA 1DIGA 1Y81A 2PK3A 3B20A 4I08A 3DXFA 4KTTE 5JYEA 2F1KA 2R2GA 4XKJA 4PLTA 1DFHA 4Z9YA 4D3FA 1ML3A 4E31A 3DFUA 4R4JA 4LCEA 1T26A 1SOWA 4BB6A 4EJ0A 5CDTA 1A72A 1GZ3A 4ZD6A 1PL6A 1ZXLA 3BMCB 4OOEA 2GN6A 1YWGO 3OIDA 1NFQA 2FZEA 4GSLA 3JQBA 5LC1A 2DM6A 1BMDA 3DZIA 4EUHA 3OJEA 3PIDA 5ER6A 4XD2A 1H6DA 4XGKA 1X7DA 1WXDA 3TOXA 1E5QA 3JYQA 5L4SA 3AU9A 1HWYA 5A04A 3T4XA 2VNSA 3ZWBA 4HFJA 1U5AA 3QE3A 3TDKA 3CXRA 5KCZA 4CL3A 4B4OA 4TMFA 1UXIA 3AJRA 1A5ZA 1I33A 4ND3A 4K26A 3AW9A 3ZNPA 3FCOA 4OJNA 2PD3A 4IDGA 3MJ4A 4MP3A 4Y98A 4XYBA 4D3DA 3E5RA 3KTDA 2RBEA 1GR0A 2B83A 2NVUA 1LLCA 2O7QA 1K5HA 1W73A 4C4OA 2OORA 1Q7CA 2O3SA 4I9UA 4B3JA 2Q99A 5A4DA 3GN2A 1HDXA 2OL4A 3JYNA 3FF4A 1NFFA 1VI2A 3RUIA 4XA8A 4P22A 1ZUD1 4L8VA 3JQAD 3NYWA 2BH9A 4D43A 1ZJZA 4KZPA 1B26A 5AOVA 3JV7A 2J3JA 3BTUA 4CUZA 3HWRA 1HDYA 4ROSA 3RJ5A 4O5OA 1A9ZA 4URFA 1HF3A 3DAGA 2PLAA 4HP8A 1VPDA 2HK8A 2BMAA 4OQYA 5JFOA 1GEGA 2Y1DA 2FR0A 7MDHA 1NPYA 5JE8A 3WIDA 4E5YA 3TL2A 3SLKA 1ZNQO 3DHNA 2GRAA 1KC3A 4YQZA 4NFHA 2GNAA 3DMTA 2OP0A 2NQTA 3D3WB 4R3WA 1YH3A 1RM4A 4QECA 4E5MA 1DJNA 4BGEA 2EW8A 1O6ZA 2FPIA 3KRTA 3OJOA 1H6AA 1WVGA 3ZNOA 2NACA 5B4VA 3WB9A 1YDEA 2DBZA 5EINA 5TF4A 1GTMA 3DZFA 4RL6A 2QZ9A 1IHXA 5KKAA 3LC1O 4CLRB 3OECA 4H16A 4WLOA 5EIOA 2HAEA 1D4FA 2P2SA 3TZCA 2JFFA 5DCWA 5CDSA 4CR8A 3LT0A 5KJ6A 1BRMA 3JQFC 1DIAA 5G0UA 4BQPA 1YOVB 1PJLA 4CQMA 1DXYA 3GDOA 4NBUA 3K5PA 3H65A 3U9LA 2DAPA 3ASVA 4TQGA 3BXXA 4JP2A 4J4HA 3L9WA 1F17A 3ZWWA 1PJTA 4DA9A 1Q1NA 3QVSA 1EFKA 3H9JA 2B36A 3ZHZA 4C7KA 3ADPA 3RUCA 5THKA 3C3XA 1O5IA 3D1LA 1M66A 4BUCA 5JXWA 1N9GA 1NFRA 2A4KA 4EEXA 4IPTA 5ITWA 5L9AA 3E03A 1BSVA 4S1VA 1QP8A 1Y8QB 3U3XA 5F5LA 4BO7A 1DRVA 5I9LA 1BXGB 4MVJD 2EEZA 3MEQA 1T25A 4WLNA 4LW8A 4DPMA 3H4VA 5I7VA 4QQRA 5IN4A 4XGIA 5T8KA 5L4LA 3TF5A 4UUPA 1PZHA 2YZ7A 4B4VA 4ZGWA 3QLJA 3GGGA 3LK7A 3O8QA 1Z7EA 4XQCA 1UUFA 3BMOB 2R6JA 3AM4A 5IXYA 4UAGA 4N5MA 2X6TA 3JD0A 1Z74A 4K28A 3WNQA 1YB5A 4DRYA 2UVDA 3QV1A 4HV4A 1PGPA 2J5QA 1DIBA 1GAEO 4CM8A 3C1TA 3LSYA 2JD2A 4YJGB 2YQ4A 4MIOA 3LQFA 4NIMA 4ALNA 4AJ4A 5IDWA 1ADBA 4ALJA 1YVEI 5ICMA 1YBVA 3FNEA 2H9IA 1X1EA 2PZLA 3GVCA 3NTRA 1IZ0A 5B4TA 4J49A 3WGIA 4CQLA 2B35A 4CPDA 3DTYA 4J91A 4XJTA 1U5CA 2WD7B 2EKLA 3ITDA 3W6ZA 1ZMOA 3GF4A 2GO1A 1WNTA 3I52A 1H5QA 1LBEA 3IUPA 1YL6A 2YYYA 3PJDA 4PZCA 3SVTA 1IYZA 3ZHBA 1O95A 2O2YA 4CMBA 2OO5A 4OGWA 4J1TA 1W0CA 2OGUA 2IEDA 1JQBA 1V0JA 3R0IA 1N2SA 3DOJA 1SEVA 5L3ZA 3WOHA 1U3VA 4RJTA 4CM6A 3KETA 1WAMA 7ADHA 3I4FA 1R0LA 2Y0CA 3GEMA 1HSOA 4XX0A 1ZSNA 3MJSA 1K2WA 4CMJA 2VYNA 1N8KA 4PFJA 1ULSA 1H6BA 2HK9A 1ZSYA 5GZ1A 1DSSG 2VOEA 4BQRA 1VL8A 4O6VA 1U3TA 1HSZA 4IINA 3WYEA 5IAAA 1B16A 3V2GA 3U4DA 4D3SA 4UVHA 3DC2A 4IUYA 4CLRA 3KYDA 4BVAA 5ITVA 3FRJA 4CLOB 1YB1A 2B4RO 2VUTA 3ZWOA 1XYGA 3AY6A 2AA3A 4FPXA 1E1MA 2W4QA 4FJ2A 1O8CA 2NUAA 1DRWA 2JL1A 5EPOA 1HE3A 3FNGA 5ADHA 1Z7BA 5TS3A 1CETA 1T2EA 3R1IA 3DMYA 4H3VA 2PH5A 4F6CA 1NP3A 2B4QA 4M86A 2NU7A 1P31A 1B0AA 4PLZA 1PR3A 4B8WA 4CUJA 1GY8A 3P2YA 1WZEA 3K30A 3O9ZA 3KXDA 1LQUA 2X0IA 2NTNA 4QT0A 2O4CA 3KYBA 1PZGA 3KLMX 2AQ8A 2E49A 4FBGA 3TQHA 1CERA 3NUGA 4O59O 1HE5A 4XQ9A 3TZHA 4B4WA 1DC3A 4WLUA 5AXBA 3NTOA 1XCBA 3BA1A 3DAFA 3HHPA 2UAGA 4KOAA 2CZCA 2HSDA 2BLLA 5HWSA 3H7AA 3TZQA 5CDYA 5JY1A 5BNIA 1E0DA 4WKGA 1EVYA 1WMBA 2ET6A 3GMDA 3WYBA 4Q3CA 4H15A 1YBAA 4DQXA 2EERA 2CMDA 1EVJA 3H9GA 4RF5A 4H7PA 1HDGO 1SC6A 3CH6A 4NFSA 3WFJA 1U3UA 2V65A 4G5HA 2XOXA 4PVDA 2PA3A 2GCGA 4ILKA 2IXBA 4U7WA 1ZK0A 1LLDA 2PY6A 1MUUA 4W7IA 3ANMA 3GDGA 3HFGA 1P3DA 3CUKA 1CWUA 3DZGA 1P44A 2BI7A 3HN2A 5DF1A 4A2CA 1PGOA 3GAFA 1O0SA 4NR0A 5ES3A 3JTMA 2X58A 1WDKA 5TQVA 4I8XA 4DBZA 2IEBA 4GWGA 4IIUA 3BMQA 2YHIB 1VJTA 4R5HA 3KOUA 1I8TA 2RCYA 1NVGA 4RF2A 1R6DA 3KSUA 4YEDA 1UAYA 1GZ6A 4Q3EA 4YAJA 4YT4A 1OAAA 1VE9A 2QYTA 1YBMA 3Q2IA 3RFVA 5JNLA 3PZRA 4A7PA 4KUGA 5K9ZA 1V3VA 5JAZA 1I2CA 4FGWA 4Y6PA 2X86A 3F1LA 3MWEB 5HS6A 2D1YA 3VZPA 3KLPX 4WASA 1XLTA 4PN3A 3FPLA 5IZ4A 2I3AA 3F46A 2QRKA 3RROA 5G4KB 1HKUA 1YQGA 1X14A 3AUTA 1PS0A 1SB8A 3DBLA 3I23A 3PQEA 4ZRNA 2GUGA 1IUKA 1MGOA 1SNYA 2IYOA 1EBUA 2ZCUA 4OQZA 1UDCA 3DZHA 3JD4A 3RIHA 1B3BA 3O03A 4E33A 5G2OA 5C7OO 4GAEA 4IQ0A 3GEGA 3N74A 1ZMTA 4YAIA 3GC6A 2E37A 4ALMA 3WLEA 4CUKA 1SBYA 3SLGA 1VL0A 3LT1A 3UOGA 5EESA 1X1TA 3JQ9A 4CV0A 3JYPA 4CQMB 3WJAA 4JBHA 4BNWA 3H5RA 3WG9A 1T1SA 5BNFA 3K8ZA 3TL3A 1H2HA 2CDAA 4UUMA 3LZ6A 5T8KC 4F46A 1PS8A 1UDBA 3S2GA 3RUFA 2EP5A 5F1OA 1XU9A 1JW9B 2DPGA 4RPHA 2ZB4A 2X23A 1BXKA 3GT0A 2CVOA 4M54A 4UVGA 1P74A 3RU7A 3ENNA 4L75A 5JAMA 3OQ1A 4LRTB 4ND4A 2P91A 3P19A 1A4UA 4B7XA 3QWHA 2BGLA 2Q3EA 1F12A 1TVEA 3U09A 1I3KA 1R16A 2I5PO 5EQFA 1PJQA 1GYPA 1N1GA 1NWHA 1QYDA 3F5SA 4HADA 4FJ1A 1DO8A 4LN1A 1EZ4A 3JD2A 1KETA 1QYWA 1V9LA 3E9NA 3EY4A 2V7PA 3FWNA 4YJHA 3GGPA 1NHWA 4GQAA 3NJ4A 4FIZA 3S2EA 4KDFA 4NBTA 3AUSA 4RF4A 1ENYA 3GLQA 1V3TA 3I9KA 4E4YA 1T4BA 4EITA 3EK2A 5DZSA 3GA0A 2G76A 4RVSA 3RUAA 1LSUA 1U4OA 1H94A 2VHXA 3MOIA 2NTVA 4N18A 4NU6A 2DKNA 4CLDA 5DBGA 4CM9A 1DJQA 4OHUA 4R9SA 1XR3A 1U1IA 4I9NA 1T2DA 4DIBA 3ZWNA 2ZYGA 5LDGA 5FFFA 3V1UA 8ADHA 3FI9A 4J7UA 2FR8A 4BV9A 4W6ZA 3ZV5A 4WLFA 1VSUA 2DTEA 4TVOA 4F3YA 1VJ0A 4HNGA 2EP7A 1NTOA 1E6UA 2VTEA 3NT5A 3PDJA 1YL5A 3ZU5A 1KVUA 3K96A 4WEQA 3FR7A 3JQ7A 3PP8A 4GGOA 4BNVA 2P9GA 4ND5A 4CLOA 1CF2O 1YL7A 2O50A 2OZPA 3Q11A 1NVMB 1AXGA 4RGBA 4XDZA 2X9VA 5TGDA 4BO3A 5JS6A 4YWJA 1E1NA 5F1KA 1ISFA 1HDRA 1UJMA 1P1KA 3DWFA 1E1KA 2HMUA 4LMPA 2PNFA 3GG2A 5AXAA 3AI3A 4MJLA 1MXHA 3LYLA 5JAIA 4YTEA 2JCYA 4GX2A 3DZJA 4XR4A 1NASA 3A4VA 4FFRA 3U4IA 4NBWA 5B12A 2W2KB 1PS9A 1KOLA 4BNYA 5A5EA 1ISHA 4IY1A 3E18A 4PLCA 3UVEA 4GVXA 1L1FA 5KVCA 5CEEA 3LC2O 4AG3A 4U0JA 1AHIA 3RWBA 4A73A 3H3FA 3H8VA 2C82A 3QHAA 3C24A 2YW9A 3UCEA 3ZWCA 3KHUA 2VYND 2IXAA 3WGTA 3PQDA 3NDRA 1RKXA 2ZTMA 2YV1A 3R3JA 2GN9A 2HQ1A 3ASUA 1Z6ZA 3R3SA 1D3AA 2Q4EA 3Q0EA 3WGQA 3ONFA 5BT9A 3GG9A 4RORA 3RBXA 1RM3A 3JYLA 3T4EA 4XYGA 4JXKA 3DBHA 5EMHA 3JD3A 2YV2A 3ZWYA 2FP4A 1QKIA 2C59A 2FN7A 4NBRA 1EE2A 3RCBA 3PPIA 5B4UA 4I5DA 1YJQA 4P4NA 5HRUA 2VN8A 5ER9A 4IQ8A 1XEAA 2NV6A 2VNAA 2GLXA 4J3FA 3N7UA 4U5QA 2C5AA 2WM3A 3RUEA 4BKOA 3H9QA 3H2ZA 5TT0A 3A06A 4G65A 3KM0A 3WSVA 2WMDA 4C7JA 4J4TA 5AYVA 5L95A 1F14A 4IGFA 5A02A 1W8DA 3OQBA 3K9QO 3IIEA 3U5TA 4LVCA 3ABIA 5DOVA 5L4NA 2PKQO 5BSGA 1J5PA 2D0IA 2JFGA 3B1JA 2UYYA 1I01A 5A3JA 1CYDA 1MB4A 2C0CA 3E9MA 2CUKA 5JC1A 3IL2A 4DUPA 1PU2A 1NAHA 3NTQA 1XQ6A 1HLDA 4D41A 1DPGA 2W98A 3HDYA 3TZKA 4KTVE 3Q9UA 3U62A 4ALLA 4WUVA 1E3IA 1I30A 2G17A 3PJFA 4YJFB 4IDCA 3PZBA 4TROA 3PHHA 4NH4A 2DLDA 1ZFNA 1D7OA 4DYVA 1LQTA 1DHTA 2I3GA 1Y1PA 3CMCO 3ZV4A 2Q2WA 1D1TA 2OP1A 1LDGA 1ENPA 1BG6A 1EVIA 1X13A 4GKVA 1R0KA 5TNXA 3VOSA 3WX0A 1B14A 2DBVO 2R00C 3G1TA 4IJWA 4DREA 1QYXA 2DC1A 2UDPA 3ICCA 4OXKA 3Q3CA 3WLFA 5AVOA 5A03A 1QSGA 3DBLB 1ARZA 3DEYX 4IDFA 3W8FA 1TLTA 4J1QA 3L6EA 3LLSA 2OBNA 3FBGA 3K31A 4BNLA 2C20A 3EZYA 2XXJA 3RQSA 4XR9A 2JD0A 1PQUA 2B5WA 3VPFA 3QY9A 4Q3NA 1TI7A 1WWKA 5A1TA 1UXKA 4WEOA 4BO5A 1AUPA 1LX6A 4LCJA 5KJ1A 4WK6A 1OBFO 3OF2A 5I7SA 3WR5A 3ZWVA 2HJRA 3HUDA 1HDZA 4WCDA 3C85A 3PFFA 3GR6A 1YONA 2FSSA 1H9AA 1XWFA 4E2ZA 5BSHA 3EVNA 1PR9A 1ISJA 2Q1WA 3AY3A 4MVJE 5GY7A 2PGJA 1B2LA 1JAYA 1LDMA 2JAPA 1GUZA 1BDBA 3A9WA 3PJGA 4RPJA 4MPDA 4YAEA 2O3TA 3GH3A 3F6YA 3L4BC 5B1YA 4CM9D 4L0QA 3GY0A 1LA2A 1X15A 4IDBA 4B79A 2ZB7A 2GN8A 4B7CA 3BYZA 1ZSVA 2FRDA 1LC0A 1N92A 1NQAO 1SCUA 2VYVA 3KSDO 2AE1A 2NU6A 2ZKLA 4LMRA 3RKRA 2GN4A 5KVSA 2NLOA 5DN9A 1MA0A 1PEDA 1H0KA 1DOHA 1EMDA 1GPJA 2WYWA 4PRKA 2I76A 3ZZNA 4EYEA 3AK4A 5KIAA 1U2GA 4FR5A 4DVJA 4YBZA 2C7GA 1T2CA 1KIFA 3C1AA 5TJHA 4JROA 5COAA 3NDIA 5F1PA 4CLXA 4EJ6A 4Z9XA 5K6AA 1ZEMA 4GKBA 5CEJA 2VQ3A 3D5TA 4GSKA 1LSOA 4RLSA 3BHJA 3PXXA 4CR7A 2E82A 1DDOA 4HFRA 3PVZA 1RM0A 4HBGA 3VZRA 1ADGA 2HMVA 3DO5A 3ZHYA 1ZIDA 3G0OA 1LUAA 4MVJG 3D3WA 4KP7A 4ND1A 4BNMA 1GV1A 2P4HX 3PHIA 4DMMA 3HN7A 1YDWA 3GMSA 1Z45A 4BNTA 1QRRA 3IJPA 3WQRA 4G81A 2C29D 2VHYA 1WDLA 3DR3A 4RDIA 1CQJA 1YRLA 3F47A 1F8FA 4WCFB 1NWCA 3AFMA 1ZK3A 1DRUA 3TN7A 1NR1A 4WOKA 5CHEA 4R68A 2ZQYA 3JQAA 3MOGA 4NJOA 1RYEA 1Y5RA 1I2BA 1ID1A 1UXHA 4JX8A 4OL9A 2H63A 2BFOA 2RAFA 2IDZA 4W9NA 3U0BA 1GQ2A 3WQSB 5FF9A 4FN4A 4CR6A 1UP7A 4WE3A 3S55A 4RQUA 3RBVA 5L7TA 1YO6A 2CVZA 2POQX 5BR7A 3RD5A 2VZ9A 4XCVA 3NDJA 5A06A 5DT9A 5TC4A 3GVHA 5CPBA 1VC2A 2X7HA 3C7DB 4AJLA 2JHFA 1QYVA 1E7QA 1Z82A 1EFLA 4R1NA 1JKIA 2Z1NA 3VH3A 4EEZA 2CFCA 3GFGA 1LDEA 4K6CA 5TSDA 3RFTA 4ESOA 4AJPA 2F00A 1B3RA 2UV8A 3RKUA 3DFZA 4I1IA 4YJHB 1MX3A 4LVUA 3BTVA 3G1UA 5JBIA 4WJZA 4E5PA 3WNVA 3INTA 4PG6A 5IN5A 2VUUA 4DLLA 1TT7A 3I83A 1KYQA 1CDOA 4IXTA 4AJJA 2AHRA 4N5LA 1XU7A 1PJ4A 4GLLA 3PQFA 3GVIA 3GRPA 2EIHA 2NADA 2D2IA 2OXIA 4L4SA 1OC4A 3UHAA 3W8DA 1UZLA 3E5MA 1CEQA 1H9BA 3HE3A 1FK8A 3GVXA 4IGEA 3O8QB 4LSWA 1T4DA 1P1FA 2C2YA 1UAGA 2VWPA 4WNIA 4R54A 4HX5A 4UREA 2Y67A 5AXDA 2PGLA 3ROPA 2YFQA 3E9QA 2VT3A 1OI7A 1UZMA 3M6IA 3ZHXA 2HRZA 3IQDB 1E3WB 2Y1EA 3WTCA 5ILOA 4N54A 1E7MA 4R1SA 4GH5A 3EVTA 3M1LA 3PYMA 4XB1A 2FPPA 1FDSA 2AW5A 1NBOA 1U4SA 4IZIA 4MP8A 3VTFA 1YB4A 2QIOA 1R4NA 4P4LA 2VTDA 3QWAA 4QTZA 3GQVA 2EWMA 4TKLA 4CV2A 4CQMD 1BXZA 4JNKA 4CMKA 1JLLA 3GNSA 5I8WA 1JWAB 3L4SO 4FQ8A 2HMTA 5EL0A 3GHYA 2HMSA 4BKRA 5IF3A 3PFWO 1I5RA 3ICPA 3PI7A 5CFZA 1BWSA 3OJFA 1WLYA 1RJWA 2C2XA 2FY8A 1BGVA 1N9GB 3WGYA 3ANNA 3FTNA 4OMUA 4CMCA 3WQQA 3VZSA 5HS4A 2CDBA 2PD4A 3LF2A 3UCFA 4J7XA 4A26A 4W99A 2TMDA 1QV7A 1J0XO 1BVRA 3FPCA 3K92A 3AFNA 3KYCA 2P9CA 2JJYA 3E82A 4N5NA 4BGIA 4BMVA 4DMLA 4L74A 3GN1A 2Q45A 4YXFA 1EVZA 5GZ6A 3PGXA 4AJ2A 3TWOA 3V1TC 2ZIZA 1MFPA 4IXWA 1T24A 4I5GA 5JPIA 1Q0LA 2Y68A 5C37A 3PHJA 2X9GA 1IHYA 3AWDA 3HSKA 2QX7A 5A9SB 4R41A 4ID9A 3L9XA 4FSHA 2RIRA 4XYMA 3EW7A 2C54A 3I6IA 3PWZA 4CL8A 2YDYA 4XWYA 3MJTA 3GEDA 1HT0A 5KJCA 1ZXBA 3VTZA 1HYEA 1ISMA 4E0BA 4DC1A 1JAXA 2OHXA 2Q50A 1DLJA 2GD1O 4Y8VA 4RPLA 1GUFA 4D44A 4GBJA 4TVBA 1IPEA 1P1HA 1SOVA 5TT1A 2DU8A 1BXGA 2Y1GA 1U8FO 3UAGA 4HNHA 2GZ1A 3H9EO 1WZIA 5DOZA 5I7EA 4F45A 2J5RA 3DBRA 2E4AA 1NM5A 3NEPX 1AXEA 1R37A 2H6EA 4FOOA 4KWIA 3DAPA 4NU5A 4M89A 4BO4A 4TRMA 3ZH2A 4R1UA 1NNUA 1ISIA 1XA0A 1IE3A 3D4PA 1U2DA 2FPGA 4MVJA 5ILGA 3ROKA 4CM8B 1KEVA 2YV3A 2FMUA 4RPKA 1GDHA 3ROMA 4XYEA 4CMIB 1E1LA 1HZZA 3JCZA 4AL4A 3ROQA 3S8MA 1U28A 2GASA 4PZEA 3JQ8B 3ZGYA 1N7GA 3PDUA 4UULA 2ZQZA 4B3HA 5IDXA 1DIRA 3HJAA 1CIVA 3GZNA 2WD7A 4AJNA 4BNNA 2VT2A 1QORA 3D4NA 4KUHA 2Y1OA 3E48A 1E5LA 3HDQA 4PG5A 2DBRA 2I65A 3A1NA 3MWDB 3M1AA 2WDZA 3W1VA 1GU7A 4J1SA 3WWZA 3SXPA 5C5IA 1HE2A 3DBVO 3D3EA 1C1XB 2FWMX 1A4IA 4Z0HO 4BOYA 2HUNA 4D79A 2P5YA 4YRBA 2IZZA 4IQGA 2PZMA 1TT5B 2CD9A 4KMSA 4TWRA 3L6DA 3QP9A 4DPKA 3D4OA 1IPFA 1YKFA 1C0KA 3Q9NA 5JDIA 5HBRA 3T7CA 2FZWA 3GNTA 1FMCA 3O26A 3ANLA 3CIFA 5T67A 1LEHA 4Z3KA 1HTBA 2FOIA 1KC1A 3FSRA 1W6UA 1WP4A 2YFHA 1Q7BA 4WOJA 3EC7A 3K73O 1JWBB 2RH8A 1GEEA 4CM5A 1I3MA 4I5EA 5TRTA 4RF3A 2PFGA 1PQPA 3JQBC 1PL7A 4UEJA 4EUFA 5TX7A 4TRRA 1DFGA 3V8BA 4MO2A 1DLIA 4UEKA 2IE0A 5JMPA 3BTSA 1H6CA 2PWZA 4DXHA 4MVJH 5JAQA 3V2UA 2PGDA 4NBVA 1Q0HA 4EUEA 3F5QA 2BGKA 2AEMA 4Z6KA 2GDZA 2NNLD 4AFNA 1WMAA 1MFZA 1OC2A 2J6IA 3G49A 1HYGA 2EXXA 2QW8A 4ZHSA 1R12A 1IZ9A 4Y6SA 3ZDFA 3S2FA 2CF6A 1G0OA 5JDIC 1ZBQA 4QEDA 1P1JA 2Q2VA 1M75A 3VKUA 1MG0A 4E32A 3OHSX 2YHIA 4EDFA 3LDHA 3GUYA 1E7SA 3LT2A 3JQ6A 3IJRA 1DEHA 2O7SA 1HL3A 1I0ZA 2Y0DA 3UUWA 4OKNA 2EW2A 4GLOA 3PYXA 2VRCA 1P0CA 2DQ4A 1N1EA 3GFBA 2JAHA 2BGMA 3BIOA 4BNUA 4CMHA 4DIOA 2BD0A 3TFOA 4J2OA 2GYYA 4II3A 2P4QA 1FJHA 2LDBA 4PLGA 3EMKA 1JVBA 1Q0QA 2GZ2A 4ZRMA 3PEFA 3QW2A 3W8EA 3ZV3A 4NMHA 1KY5A 3ONEA 3RU9A 1MLDA 3F9IA 1NQOA 4J7CA 1LDNA 1L7DA 3WMWA 2VHWA 3ZNQA 2J8ZA 4YJDA 4YPOA 4UVIA 4FFLA 3MTJA 1MXFA 3WIEA 4PLYA 1L7EA 1XDWA 2IODA 3RC7A 4BO8A 1KEWA 1ULUA 2O3QA 4MP6A 9LDTA 2EG9A 2AQHA 1PL8A 2DUUA 4O1MA 1LXCA 1A71A 2AQKA 1C1DB 1ONPA 1UDAA 3WBBA 4ZN6A 5I8ZA 1M67A 2O23A 5TLSA 4OYRA 2V6GA 3COSA 3SEFA 5EN4A 1BTOA 4Z0TA 1R4NB 1ORRA 3FBTA 4Z3DA 4NI5A 3X2FA 4Q3AA 1OOEA 3FHLA 3GUCA 1RM5A 3PIIA 3VVBA 2DT5A 4JN6B 3OP4A 4ZQGA 4B4UA 1LC3A 1QYCA 3W4KA 3PWKA 1C1XA 2EF1A 1VRWA 2ZTVA 4MINA 5K6AC 4OIMA 1XGKA 1R66A 1DHRA 3DDNA 3ETDA 4JBIA 1MC4A 1TT5A 5F21A 3CSDA 1LSSA 4PLVA 1GYRA 5G4LA 9LDBA 1EEHA 1EK5A 2QZZA 2BFMA 3UKOA 2X8LA 2CY0A 4M1QA 3VKVA 3WGGA 5ENDA 4XRRA 4BNGA 4NJMB 2PKRA 2Q1UA 5THQA 2GPTA 4Q39A 3SJ7A 2YUTA 1U8XX 3O38A 2PZKA 1VLLA 2NSDA 1O9BA 4FB5A 1C0LA 2EV9A 4RLHA 2X0JA 3HB4X 1NX6A 5DBFA 2PV7A 3SC4A 3QWIA 3OFSA 3RC9A 2DUWA 1J49A 1GYQA 5T6BA 4RVDA 4NK4A 5G0SA 1GQYA 1LTHR 4OSPA 2NQ8A 3IAHA 3ST7A 5K0ZA 2EGHA 1M76A 4OSOA 3ULKA 3TOZA 4MIEA 3CEAA 5CAEA 3DHEA 4QFCA 3ETGA 4QXMA 4AJIA 3S1LA 4GMGA 1MP0A 1NYTA 1WW8A 1K6XA 2J3KA 2E6UX 3EGOA 4U6SA 4AJEA 1Y8RB 4Q3BA 3VH2A 1ZZEA 4CM1A 2JHGA 1YE3A 3QVTA 1I24A 2X0NA 3NT2A 4CLHA 5U9CA 1VSVA 4UUNA 2C7VA 4DL9A 3V1YA 5AQ1A 4DTIA 4HY3A 3KV3O 3ENKA 1QMGA 2CSUA 2VWGA 3I9JA 1HRDA 3F4LA 3SX2A 4CV1A 1I3LA 4K1LA 4TZKA 5JLAA 4A27A 1ZJYA 4WCFC 5MGBA 4KQXA 5TIIA 2LDXA 4Y9DA 2H1SA 3S2IA 2HKIA 4L9RA 1P33A 2YJZA 4GGPA 3VVCA 2O2SA 3U49A 4DQUA 4NNJA 2C07A 1ZK4A 3UN1A 2ZB8A 4QFDA 4JJIA 2PR2A 3DOCA 3FD8A 2CF5A 4FFOA 2EHDA 4HKTA 2YY7A 1JU9A 2X22A 1GPDG 2W2KA 4R16A 5G0VA 1JDJA 3LU1A 5JSFA 1FDVA 5JO9A 4CODB 1IY8A 4DC0A 3RASA 2W8ZA 1NVTA 3GAZA 3RSHA 4IBOA 4YQYA 3WXBA 4CLEA 1X7HA 1W4ZA 4Y6RA 3GVPA 3DOOA 1XQ1A 2P5UA 1E3JA 4XQEA 1LNQA 3AI1A 1IB6A 3HADA 3INGA 4CM3A 4BO2A 2D5AA 1PJCA 3QIVA 4FFMA 3B70A 2JD1A 3IS3A 3TNLA 1QLJA 1BW9A 1QXSA 1MV8A 4M49A 3DB2A 2PKQP 4JQCA 4FOSA 3ZU4A 5COQA 4OM8A 1HETA 1I2ZA 4EI2A 1R0SA 1VKNA 3CKYA 5KJEA 3WWYA 1PJ2A 2NVBA 4IS2A 4FW8A 4PLHA 5FI3A 2Y66A 4K9DA 5U4QA 5IZCA 1E3SA 3W6UA 5DP1A 5JO0A 1AHHA 5KWEA 3EAGA 4FCCA 4UUOA 5KNLA 4YACA 4PG4A 4NFYA 5HM8A 1A7AA 1Y8QA 2GSDA 4XDYA 2BHLA 4D42A 3L07A 3C8MA 2VYVD 3EUWA 3UF0A 1CRWG 3W4IA 3PK0A 4CM4B 1NXQA 3FWZA 1PJ3A 4EBFA 2O3UA 4YT2A 4FDAA 4YR9A 4IZHA 3SJUA 4CMEC 1NR7A 2D3TA 1SZJG 3F4BA 1PGQA 2NU8A 5ICSA 1KBZA 3JQFA 4GX0A 3WICA 3JQ8A 1P9LA 1PJSA 1Z75A 3KZVA 4BO9A 5FWNA 5IFLA 2G1UA 2ZJ0A 2X0RA 4RVFA 4PCVA 2EKQA 2Y93A 3GZNB 1EQ2A 3D5QA 2EKPA 3ZV6A 4R9RA 2ZYAA 1DAOA 4E2XA 4J6FA 4FGSA 4QO8A 3TJRA 1EBFA 1ZK1A 4GVLA 4J2HA 5FI5A 1PWZA 2VWHA 1O89A 3OH8A 1OZAA 2Y0EA 1E7RA 1M2WA 4YAGA 1NQTA 3NGLA 5DULA 4G2NA 3RUDA 2PH3A 1UP4A 5CPFA 4YDRA 1GFSA 3LLVA 5JCXA 4BO1A 2OMEA 3ZWAA 1G6KA 3H3JA 4PLPA 2OBYA 3INRA 4J0EA 2QRJA 4S3MA 2VZ8A 2VHVA 2ZATA 2AE2A 1UXGA 4W4TA 1DC5A 5I9NA 2B4TO 3B1FA 2YHUA 3DZKA 3GK3A 4HUJA 1ADFA 1JKFA 3JYOA 2J5KA 4TRJA 2QQ5A 4W7HA 3M2TA 1HEUA 3IDSA 3Q1LA 3UH1A 4DLAA 1ZH8A 3U4HA 2VZ0A 1U7HA 1E92A 5IDYA 3VPSA 4P8RA 4A5OA 1HDOA 1ZEJA 4OO3A 3RBZA 3TPCA 2GR9A 2J3HA 4R69A 2DVMA 2NTJA 3I9MA 4W82A 1SB9A 2QRLA 4NJMA 4WPGA 2NVUB 1PIWA 3UICA 5KKCA
chains in the Genus database with same CATH superfamily
2VCYA 3QLUC 3SYTA 3GFRA 4NDNE 3SQNA 1E4EB 3VU9B 1FRVA 5F5NA 4BJ1A 4BO0A 4EY7A 5MFPA 4WA7A 1X6VA 1YD7A 3RJ9A 1A9RA 1HYHA 2P90A 2CXHA 4HL6A 2YOHA 4AD8A 2OB2A 4WY2A 1XFDA 1PT9A 3ET5A 2FPXA 1OA1A 2QX4A 4CF7A 4F92B 2F3UA 1HURA 3QKIA 1GAJA 3EZ7A 1ODKA 1WZUA 4EHFA 1YB6A 1RLTA 3KELA 2AN4A 4GX1A 3VX3A 2HY7A 5CFQA 3MCZA 3KB2A 4YWHA 4QOGA 2IXDA 3CU5A 3QJ5A 4WNCA 5EIWA 1M54A 4CFSA 4F6LA 4CIBA 3IKTA 2QP3A 3VHXB 4EZBA 1X7GA 1MCZA 2WTAA 2IUEA 4EPVA 4YQFA 2UUOA 2EDCA 1RACA 4TZTA 1M6EX 1WV0A 3O7WA 4EKGA 3FNHA 1F8GA 2Y99A 3NHKA 3I9LA 3P2KA 2CLLB 3UAOA 1W9HA 3CPSA 4ZO8A 3A58B 1FLAA 4EG0A 4B8ZA 1UKZA 4BTEA 2GZ3A 1NHGA 3EIXA 4BKMA 1ST3A 2OFWA 4TSKA 5J23A 3NHAA 1HRKA 2EJVA 4IG4A 3CLKA 1SQGA 3RBAA 4Q01A 1RJGA 1FRFS 5CDGA 2QNIA 4OUKX 4YAKA 1U98A 4F8EA 2GFQA 1T8RA 2DJ5A 2K2WA 3KB6A 2B8NA 4PSAA 3G8BA 2OFPA 2AX3A 1D2CA 4OREX 4UVDA 3T3DA 3TPZA 4IDAA 3JRNA 1O87A 4HYTA 2B1GA 2OXRA 1JU3A 3A14A 4LISA 1XQ9A 4RHFA 1OH7A 4CEJA 5DU2A 1CUFA 3HV2A 4RACA 2WZQA 1Z2OX 5EHIA 1S4MA 4TWAA 3LPLA 2IRWA 4FE7A 3TDNA 3LC0A 5C46F 3CUSA 1R7RA 1GADO 1CLUA 1QP4A 3NRCA 3T3OA 1GPBA 2RGNA 4QXPA 4WECA 4YCNA 1CHNA 5T57A 4RU1A 4YJGA 5JU6A 5IYZB 4PC3A 5G02A 2HH9A 3T9EA 3O8NA 5EMNA 4DT1A 3MINA 5DDIP 4R2JA 3NX4A 1FDUA 1KJJA 3FCSB 1KAHA 4MRSA 1FFCA 4IZOA 4B3BA 5JS2A 4M9UA 4URVR 1QBKC 4FWTA 5GMOA 1W96A 1B8UA 4UASA 4CM7A 1RNLA 2FLVA 3D2LA 1U0SY 3OLQA 1UMDA 4M98A 2FTKE 5KOHB 1VHDA 4M1MA 4TQUS 1XD9A 2JFQA 1S01A 5BVGB 3M6VA 4YREA 2IYNA 2J7PA 3IAS6 3IKMB 1BHO1 4LYJA 4PAMA 2GMWA 5GV7A 5H83A 2ZE7A 4AICA 4FC6A 3DE7X 3WGUA 1XK7A 1M9NA 3N2YA 4FE4A 1XPJA 3QNWA 4UE3S 3HBNA 3IKJA 1RWMA 1UM9A 2AMJA 5BWMA 2ECPA 2AZXA 3MQ2A 2BGUA 5CP8A 4ZVVA 1UKYA 3M5PA 4EHBA 1DFIA 2ZE6A 4P4GA 1QTRA 5FTKA 1TQDA 3NBYC 5A4KA 4YV1A 4CCYA 1QFJA 3P5SA 5B3KA 2BEVA 2QLNA 1HE4A 3D8SA 1OA0A 4YMSA 2RK3A 4CJXA 3JARB 5CEFA 5JQGF 2FUNB 5F3RA 4GI7A 4RV9A 1CZUA 2OBXA 3Q12A 4JCOA 3TSCA 4NCBA 4DSOA 2EWVA 4IJKA 1G60A 4CMAA 4P31A 2C7RA 5HRCA 4EHLA 1DWUA 1L8AA 3OA0A 4G1VA 4TV9B 4DDMA 2RD2A 5JVDB 2FWJA 4Y2PA 4WXMA 1JH9A 2O4UX 1P0FA 2N47A 1FNBA 1X8KA 2KM1A 3HVIA 3KVRA 3EYWA 5GONF 5EUQB 3KPJA 4LXHA 3MZ0A 3ORHA 1RI3A 3PDIB 3S5UA 2JAOA 4O4IA 5IEJA 1KMIY 3B52X 4IDHA 1QX4A 3IPYA 3PKZA 1TEXA 3EVAA 3T7RA 4L5AA 4D45A 3BXOA 4ND2A 3E8XA 2O3RA 1MJGM 2C3UA 3A4LA 3DHWC 2FMTA 3O4RA 1TB4A 5EJ6A 1SQFA 4ONEA 3RS2A 2AKYA 4KQWA 1CE8A 521PA 1SU6A 3PPYA 4GL4A 4UCWA 2GO7A 2JJMA 4PX2A 3QVLA 5J1TB 5LZ8A 4HAIA 1J8YF 4DZRA 2VRNA 3O90A 4FC7A 4XIJA 2FE1A 2QMZA 2VPPA 3C4JA 3IQWA 3OIGA 5EFOA 3IBTA 1MC5A 5IKPA 1GG2A 4WBNA 2A3NA 3ZJ5A 1P45A 1X86B 3CR7A 3HUUA 4LSMA 4DWVA 3TM5A 3EDOA 1WHTA 3DDHA 3AFGA 1EUDA 2X5JO 3VR3A 5DNDA 3ICVA 4OHCA 3ZIDA 1YR9A 4E4TA 4IDEA 5I9BA 3KG2A 4RESA 1GT6A 3DEZA 3JQGA 3QV2A 5TR9A 2C99A 5TV2A 2FFBA 2R4QA 2PD6A 1SHJA 1L5FA 3ZXIA 4L4XA 3QH4A 4FD3A 2AG8A 4QXRA 1NW8A 4TV8B 2H2GA 2YC4C 3G5MA 5THXA 2ZUFA 3UTDA 1Z17A 2D1TA 1N34B 4BO6A 5DH9A 5KJFA 4ZQBA 3LUFA 1I2AA 2DPXA 5AK6A 4LFAB 3EPJA 1DCTA 2PUTA 2ST1A 3Q85A 2HMWA 4UBLA 4XE5A 3T5BA 5BSGA 4KPYA 2VRBA 4BQNA 3SEAA 2HSZA 3GDWA 3X1XA 4EO7A 4ZA2A 5JYBA 2LRHA 2CUTA 1LB1B 3RU2A 1J2JA 2DH5A 2ZXFA 3VDQA 1Y6QA 1G8HA 3DVAB 3RSQA 1E3QA 1H9CA 1KY4A 2FXVA 2I7CA 4E3ZA 3U40A 4WLVA 3UT6A 2BCEA 1I51A 3BS4A 3P2OA 1FDWA 2XZPA 3PD1A 1J9EA 3PUXA 4NDAA 5SYAA 4KQKA 3EPRA 1SIBE 4F04A 1K6JA 1Z5OA 1ZQ9A 1KYIA 1XP8A 1SVLA 1AGRA 3WMXA 4QDJA 3IUJA 3THRA 2D1FA 3KX2A 4BMSA 1G2QA 3CEHA 3SR3A 3EQ7A 4UXIA 5D7BA 1YS4A 1F8UA 4TKMA 2J5BA 1T0BA 1YSCA 2AFHA 3PHGA 4HH3C 4JNCA 1GZSA 4ENPA 1H3EA 4JJAA 4TL8A 3V6MA 4RELA 5BRJA 3TIFA 1UBSB 4ANFA 3I1JA 1L5YA 3G9UA 4YRLA 3PD7A 2YDXA 4QA9A 3RC3A 3E2PA 1SEPA 1VA4A 1X7XB 2GPNA 2W5UA 3AETA 3O0DA 3GP3A 1G7RA 3O84A 5EIBC 1U0FA 2H29A 2DG2A 1JQDA 1TX4B 2IKSA 4X7BA 1FRNA 6REQA 1CUVA 3KOMA 1H4VB 1T3GA 2JJ2A 2JJ1D 2ZM6B 3PTAA 1E1CA 4IM7A 4O63O 2ZTUA 5BSEA 3V2IA 2BMFA 2Q8QA 2NTEA 3LC7O 4F93B 1L5LA 1ZD9A 1T9KA 4IJ5A 4INPA 5JSKA 3CN9A 3P7MA 5SZHB 1Q0SA 3W3AD 4IDUA 2QM7A 2ZPTX 5AOBA 3IVXA 1JHVA 1ZVMA 3LDUA 3GWGA 1ONNA 1XMIA 4BZXA 4X54A 1FP4A 5CDHA 5AW1A 2CDNA 1C9KA 1DB3A 1JDUA 4C2AA 1TM7E 2E6KA 2O2JA 2VHEA 2QVZX 3OM9A 5BSRA 5JSUA 3EPKA 2C7BA 1WF3A 4WOBA 5EQDA 1KQPA 1TK2A 4RIEA 1EDZA 1AURA 3ITKA 1PT5A 1U0TA 3M9XA 3SLRA 3HR8A 2WT9A 5TJ9A 3BREA 1TRHA 4RDHA 2Y05A 3DC7A 1VLVA 1DJPA 4A1FA 1RQGA 1HDIA 1M8GA 4XD7D 4IFTA 2CXTA 3CV3A 3ROZA 3OAAD 2I4RA 4IDDA 3WZMA 2ZQ5A 5I9TA 2AG6A 4Q9JA 3PR3A 4JKYA 3M4XA 1GNRA 3F6SA 4K46A 5HKLA 1BEZA 4ZAGA 1BAPA 4F12A 3KTOA 1NRXA 4YMVA 2IY8A 5E7IA 2HIAA 2Z2ZA 3BMNA 4YR7A 1BHQ1 4TXMA 1VI5A 2P7IA 2BM1A 5LA6F 2JS7A 2OCIA 2J7PD 4EZIA 2AR9A 2R8BA 3IE2A 3AWIA 5B55A 1X0VA 4X6XA 2PXHA 2YOGA 3DTNA 3NCTA 5HFJA 4B3CA 2YBEA 4Y2XA 3F3MA 4H7JA 4YRRA 4FSDA 2P4EA 4BKPA 1YVPA 1V1RB 2ZRAA 3OLYA 4EJFA 3X1JA 2ETVA 1W75A 4XCXA 2BR5A 5A7GA 1N2BA 3STTA 3LWBA 1D8AA 3H8JA 2C92A 2Y2VA 3OICA 7GPBA 4X8HA 3WLJA 2A5JA 4WNAB 4EJMA 1KI1A 2ZULA 5D3ZA 2F17A 2I7VA 2YS6A 3IB3A 2ZYDA 2D8AA 3UG7A 4BFWA 3RGGA 1SUAA 3Q9LA 2RGDA 4UARA 4HPJB 1X1BA 2J32A 4LX8A 4P54A 2Z6QA 4C4SA 4U7DA 4GE0A 3JD1A 1UR5A 5FKJA 3STHA 4BV2A 5I8PA 2DXIA 5JS1A 2ZZMA 2BZGA 3DTTA 4Y0VA 3LVFO 1EI9A 4A6XA 1TA4A 5CA1A 5E9AA 2XF8A 2Y71A 4JENA 1JTVA 1CJVC 5F7JA 4ZIRB 3PX7A 4E12A 1X0XA 3Q6MA 4A6EA 2VPWA 2CN1A 3OTOB 3KJGA 5C53B 1OZ0A 4RC9A 4RYDA 2A88A 2RBGA 1TADA 3LX8A 4RVHA 4BN4A 1SMKA 4E6PA 2AEFA 4JJ8A 5H82A 4DPLA 4DV7B 4OI4A 4II2A 3ESXA 1JQKA 1TZBA 1V26A 4YONB 3TM4A 4CMIA 4Y0NA 3VAAA 1ICEA 2B5VA 3FH0A 3KYCB 4JB0A 5AI0A 3WGLA 4ZMRA 3HCBA 4BS9A 2VO1A 1THTA 1O54A 4DIDA 1PZMA 1NXVA 4BNJA 1EDBA 2IYLD 4QGSA 5KYYA 1JPUA 2G82A 2WJHA 4OA8A 5ETJA 5SYNA 1NW6A 1DBVO 1Z8FA 3I39X 1YJBA 4G0ZA 4R7ZA 3VR0A 2KS6A 1L9KA 1XZEA 4OQ4A 2N9UA 1T1RA 4WFQA 4ZDKA 3H2KA 1B8VA 4XZ3A 5A9SA 1F4LA 1QHIA 5JXHA 4DADA 1FQJA 4AJHA 1P0PA 4A9AA 1R88A 5F2KA 1P7YA 1UBJS 5J4HA 3PNOA 4TQAA 3TNDA 1TECE 1XUOA 2R8ZA 4HQNA 1R5JA 2Q0QA 2OOSA 4Y7DA 4AP5A 4D57A 4EVQA 1ZHHA 4DDVA 3BD8A 1YF3A 4ON9A 1COWD 4TKVA 1NVEA 4UNQA 3ZNNA 3QBDA 2OAQ1 4D97A 5BV1A 3IXQA 4GR9A 3E9RA 4TTVA 3LY5A 2A1TR 4HDSA 1PLKA 3GJQA 3I5MA 2C5HA 3GIWA 4K81B 1IQUA 1LLQA 2HDNB 2VYCA 3I9V6 4KIJA 3ACCA 3EHEA 2ZRKA 3SP1A 4DJ5X 5ALYA 4EB6B 5DYWA 4N7RA 2CFTA 4ZDIA 4ABTA 2A7XA 4OI1A 1J6UA 1QWOA 3HGMA 1QTIA 4O4LB 4MTLA 1W93A 2WA1A 4E21A 1N5RA 4KMOA 4BIIA 2WJZB 2GBCA 3QOYA 2IP1A 4K03A 3KEOA 4DHWA 2F43B 4LCBA 4NE9A 2JGDA 3K0EA 3PHLA 4MAMA 1N2CA 1ISRA 4R31A 4WNYA 3IHLA 1IVYA 5FBKA 4FNMA 1JXAA 3GYBA 4Y67A 5KOIA 3VR1A 4DV1B 1A98A 4I19A 3PNBA 5BYJA 1XBTA 3GMTA 1R6VA 3GLHE 3LFTA 2BFBA 3M70A 3LE8A 4C76A 4D8VA 3LRTA 1P3Y1 2Q4BA 3EDRA 4TLBA 4HH0A 1ZM2A 2CYCA 3TB6A 3WS7A 2E4UA 3T54A 1GCOA 1YHYA 5K0NA 5TGTA 2W8BA 3HACA 3PLNA 3FPSA 3E9ZA 1Y6JA 3BKWA 2VRWA 3D6FA 2OAEA 1KI6B 4H7IA 4V2IA 5A4JA 2ZPAA 2XVYA 5HQ3A 2NUPA 5J2TA 2VXYA 4DLWA 2BW0A 1JJFA 4OB7A 1FZTA 2GSWA 4P38A 2DETA 4IFEA 5KSZA 4HK4A 3RF6A 2WKRA 2WSLA 3RSFA 1VLZA 3IQXA 4XVRA 2PVCA 3V48A 1TGYA 1P5FA 4P93A 1OB5A 3R8XA 2WW8A 4RH3A 5LR6A 1BS1A 3IH5A 3QKRA 1Y4UA 2E85A 2CJYA 2OD7A 1QRTA 3LHKA 4M1ZA 4FFDA 1GXSA 2QDKA 3JQGB 1B42A 2I9PA 4XASA 4LQDA 3ZDCA 4M37A 1H5UA 2Q29A 1QONA 3WYCA 3JQ9C 3QPCA 4ZP1A 2SKDA 5E1BA 3HXLA 1ZESA 3A6HA 1IOVA 3U3MA 4IWYA 3RVSA 1DEOA 2C03A 2RHTA 2NM0A 1SVMA 1U2RA 3D6HA 3SXUA 4BCDA 1IHUA 2W2MA 1NUUA 3MT7A 4RUKA 1HR0B 2O5VA 1T6ZA 1JDBC 1ZRMA 4L2IB 2HSWA 4LKRA 4G0YA 3PNKA 4IAOA 2X1HA 4KXFB 5GP1A 3WGOA 5ED0A 3BCSA 5AVXA 2CB9A 1PNOA 1L7NA 2DTXA 2R6R1 1E6WA 4NYIQ 5EERA 3R7LA 1T9BA 3K4PA 3LFHA 4JLDA 4C7OB 1VMKA 1LFAA 1X7ZA 2GS9A 3KR2A 3FF1A 1CJUC 4FGZA 1XHLA 4MV7A 1GT91 4MQUA 2RG7A 2XE7A 5AWFC 3GEEA 1J2TA 2PWYA 4OJKA 3WAGA 2IH2A 2C9OA 3C5EA 4UOZA 4FHFA 1Z68A 4KPGA 3ZE0B 2QF7A 1Y34E 1ILWA 1Z0UA 4Q16A 3DE2X 2GEVA 1PCXA 3CCBA 1JIJA 3L05A 1P6QA 1W88A 2HCTA 4DBLE 3Q7SA 1TM5E 3ZDZB 4C5AA 3RC2A 3ZUPA 4DJAA 1YR2A 3QEBZ 4OHKA 2VOJA 2VCEA 3U1TA 1Y63A 2P9EA 3M3DA 2AUNA 1V39A 3H1AA 5C7IO 5J3JA 4FYHA 3T7EA 3AEKA 4DEYA 3WTBA 3JQAB 3H4TA 1H4QA 2NP7A 2XVAA 3QEJA 4MW4A 2YJ4A 3JVVA 4HNSA 4DYDA 2GEBA 3C7CB 3EGVA 4I4IA 1Z15A 1UBNA 1Q7TA 2WMOB 1QIGA 4MQFA 3VPGA 4DRXA 4ZHQF 1UWLA 2SCUA 5A5FA 5B7GA 5CNMA 1KH2A 1C9JA 1KRHA 3KXKA 4S2UA 4UTPA 3LKVA 2IYYA 1SXJA 2ZRIA 4WKOA 2A6PA 4EA7A 5MDHA 3V00A 4N03A 3CJRA 1LLUA 2P9TA 4U8HA 1TMGE 1EVEA 1G18A 5CYOA 4IH1A 1NG1A 3WKBA 4C0JA 5H9WA 1MOZA 1N77A 4ZQFA 3N8KA 1XAGA 2YICA 3HG7A 4IMPA 2O8VA 3DCIA 3OEYA 3OQIA 3R7SA 4E5NA 2IY7A 3M5WA 4TX1A 3DM5A 4QDTA 3THSA 4RTSA 4WOCA 1UPTA 5A2QA 2ID4A 3IEKA 4XFJA 1P1RA 5HA5A 4BZPA 1JVSA 4E7OA 5L40A 3DL7A 1OIWA 5DTQA 3EH2A 3H6KA 1OVMA 3GHHA 4AG5A 1NLYA 2VJKA 4CGYA 4PIVA 1ADCA 1P7CA 1S4QA 1XL0A 3MJDA 4MOWA 2HN9A 1RQLA 1N7HA 1RWPA 2VSNA 3PFCA 4Q7QA 3NJ8A 1QE5A 2EJTA 4LJ5A 4CZ2A 1F2UA 3H2HA 1XZQA 1D04A 4F5ZA 1EXWA 2XZLA 3KSZO 2ZP1A 5EJAA 1IG3A 3B6EA 3BMNB 3HI4A 1MOSA 4AAYA 5IVHA 3AM5A 1E4YA 3K6SA 2GBIA 1NXSA 2Z2JA 5U1PA 4ZJZA 3DMTC 3ZQKA 1ND6A 1DC6A 4U0KA 3FPGA 3AY7A 2WJ3A 4X1KA 1XU4A 1U94A 4I50A 3ZN2A 3TXXA 4BLSA 5JSHA 5E9JA 1T4MA 3A9VA 4E2YA 3K16A 4RADA 2QP4A 2VUSA 1KNQA 5BWLA 2J1LA 4WT7A 1C0PA 3ROXA 3HZZA 4HAYA 3STWA 1YGPA 1MQAA 1S9DA 3VZQA 2ZITA 3EVGA 3EZLA 5JDCA 1R6BX 4BJHB 1JSCA 1RMQA 3PNSA 4XD7A 1JZTA 1Y5NA 3HEAA 1CF4A 3H2SA 3KVNA 4GD3Q 3VNQA 1OH8A 4LF6B 2BFFA 2XE6A 2ZUTA 3DXFA 1CCWA 4M8IA 2C0QA 3AEQB 4AMGA 2F1KA 2R2GA 4PZYA 4I1YA 5BUSA 5JYEA 4URXR 7YASA 2AOWA 2Y1KA 2OENG 4D3FA 1BJKA 2GJ9A 3CF4A 1QH0A 1TJ5A 4R4JA 1IXRC 2GRJA 2R5FA 4MEAA 4OFZA 4ZEMA 5DLYA 3C97A 4R0MA 1A72A 2F8TA 2PGNA 4A16A 1E2UA 1KSFX 2GN6A 1KO4A 2AYZA 1NFQA 3OIDA 1KK2A 4AYWA 1JLSA 3DDCA 4OYHA 5LC1A 3QXXA 4L8LA 1J8VA 3AIKA 1BMDA 8MHTA 4GU5A 3IVRA 4PYNA 3ZIAA 5ER6A 1RAAA 1H6DA 1WXDA 1QG0A 1SG6A 3C98A 4UAUA 1KJZA 3B7GA 2JJ2D 2JJ1A 3EOZA 4OCZA 2GJSA 3AVTA 2AYXA 2Q6VA 3ZWBA 1SBIA 3D2AA 1O95C 1U5AA 3QE3A 1E2IA 1JMYA 3B48A 3FPFA 3KLNA 1DJOA 3CXRA 4MUGA 4OHVA 5KCZA 4TMFA 3DZCA 4FFWA 3AJRA 3UUEA 1I33A 1KJNA 3CBQA 1J07A 5DIFA 2ZW9A 5FTMA 4OJNA 4M9QA 2PD3A 4QZVA 3QMVA 2GQ0A 3PENA 4I3HA 2HF9A 2ASEA 3E5RA 3UJ7A 1K3FA 1RMYA 3S6JA 1E59A 3I12A 2TSYB 1Z35A 3HGQA 3LKBA 4C4OA 1ABBA 5EAIA 2R3SA 4NMWA 1NW9B 2VQ6A 5A4DA 1K3UB 2Q99A 5AUQA 1SCUB 3GPCA 5BPHA 4R0VA 1OJ7A 1XTZA 3PTLA 5EXXA 3RUIA 3T3HA 5KREA 3OEHD 4YHBA 1ZUD1 1R6TA 4NXMB 2Z4SA 5JH7F 3OIWA 3U9TA 2DJIA 2VJLA 3CPHA 4B31A 4DWWA 2B9EA 4G4SP 4G89A 4JU8A 4ROSA 3UAXA 2FN8A 3OU6A 1Y0BA 1EAMA 3LPAA 3AUYA 2XZTA 2XUOA 3R0VA 1U0RA 1U99A 3FWYA 3ICQB 1GEGA 4ZOEA 2BFEB 4B74A 1NPYA 2WHRA 4QGBA 4DG9A 4K9QA 1XC7A 3RYHA 4KO3S 3N5CA 2YCLA 1GWNA 5IH7A 1ST2A 2YN0A 4QBIA 3RSGA 3DW3X 5JYCA 3FKJA 1BIFA 1T3SA 1Z0KA 1KC3A 1OLUB 3IQZA 4P53A 1SXJC 1SXGA 1KZ9A 2BR4A 2C9MA 5EVJA 3WKCA 4R3WA 1DUVG 1Z26A 1RJEA 3UK1A 1RM4A 2Q5HA 4L22A 3DD5A 2Z83A 3JSXA 2XVZA 2EW8A 2Q1XA 5IS2A 1H4SA 2VJBA 4U5XA 3GCZA 5HK8A 1DL5A 1H6AA 4DV2B 4CETA 2NACA 2WDPA 3QOWA 2CD7A 3K8YA 3EEQA 4L8YA 3F71A 1QOPB 3U3KA 3UA4A 3VR5A 3Q8KA 5FOXA 1WTCA 2O1WA 3DZFA 4RL6A 4WFJA 2BISA 4B43A 4CEJB 2XD9A 3O83A 4EFDA 1IHXA 4JZKA 4UJ5A 2CE2X 3M6XA 1TL7C 1E2PA 2XLBA 2LCIA 2W6CX 5CR9A 1XNGA 1ZBDA 1D4FA 5TMBA 3TZCA 4BUZA 3N1UA 3D1VA 1QGAA 5DN6A 3AVXA 1KMNA 3ILSA 4TSFD 2ZBFA 2V59A 1OLSA 3ILXA 2VDPB 4YP5A 5TQ2A 3DMDA 1NSYA 3TRKA 1YOVB 2C4UA 1JI3A 1AX9A 1DXYA 3PUKA 4Z9BA 3GDOA 3NW9A 4JLBA 3WAKA 3H65A 4FT2A 5JCPA 3B1WA 4OQPA 4TQGA 4EA8A 1KR5A 1LTKA 1ZWKA 2QGNA 2YRFA 4JP2A 2VSXA 4J4HA 3U3RA 3PI6A 2QG6A 3KWFA 3PRYA 3UMRA 2V1XA 1RE0A 3L9WA 1F17A 5JQWA 2IOHA 1Q1NA 1XXHE 2COKA 3C3KA 2B36A 3H9JA 4HYQA 2ZGVA 5DM2A 3RUCA 3FPJA 3ZDYB 1JXOA 3C16C 3MD9A 3V7WA 3FM9A 3CNLA 3T4PA 3UFXB 3WL5A 4F8JA 1G6HA 1R5NA 1E60A 1S9HA 5L9AA 4TXLA 3T3NA 1BSVA 4HNGA 1QP8A 1RHQA 5JNWA 4Z7NB 1Y8QB 2FVXA 5DI3B 3U3XA 4TTJA 3T7KA 1YS2X 1JMVA 2OQVA 2GDJA 2JLVA 4R1OA 3I2FA 2DHRA 2PMWB 2R1UA 2ZYIA 4UBJA 5TDHA 2RIPA 1QJCA 1RXVA 3T1NA 1XDUA 4WLNA 2PHZA 2IW3A 3H4VA 5CITA 5IT5A 5ALTA 5IN4A 3MERA 3O4FA 3Q3IA 5T8KA 4H7DA 4N5HX 1PNRA 4JV5B 1PZHA 3UA3A 2JJQA 4XVUA 4ZGWA 1KGSA 5GVRA 2ONCA 1V41E 1R0CA 2NXEA 3O8QA 4LBYA 4QYSA 2Z5FA 1ULHA 3AM4A 1E5DA 4EI8A 2FPKA 4TVSA 4JLKA 1C7EA 1KKMA 1JG2A 4K28A 2EAUA 4U1RA 4WVFA 3RS7A 1I5OA 4MQFB 3TLJA 4DRYA 2UVDA 4ZYVA 5IJ9A 2PTHA 5CX1B 1J1ZA 2AX4A 3QU5A 4BWGA 3N7AA 4YCJA 5D86A 2P5SA 2ZZKA 1GAEO 1D9XA 1Q19A 2VIIA 3GRUA 1PNQA 3DBIA 3IULA 3BXZA 3DT6A 3LSYA 3TB4A 4H1WA 2OAGA 4MIOA 4UD6A 3LQFA 1RXYA 1J5XA 2A9RA 1WUJS 2D1SA 2GPSA 3A1DA 3KL4A 3MT8A 2O07A 4Q1AA 4RXTA 2BMDA 5CVEA 3F5FA 4AJ4A 1U8ZA 2OGZA 4AF6A 1ADBA 2C77A 2C1EA 3OG9A 2WHXA 2IHKA 5ICMA 1SIWA 1C3OB 1TYCA 1K7CA 1YBVA 4GO1A 4LY3A 3V4SA 3FNEA 1X74A 2PZLA 1X1EA 1QG2A 4HJXA 4KIUA 1B6SA 4LQLA 3HZRA 3G2JA 3IT3A 4KXLA 2C4HA 3BXEA 4XJTA 5EWJA 2PL5A 4EB0A 1JLLB 2OTCA 3W6ZA 3SHFA 2OLEA 5JSQA 4EPYA 1WBDA 1H5QA 1V9SA 2HL6A 1NW4A 2P6OA 3Q15C 3ZQ6A 1XI2A 2D54A 4D6XA 1O95A 4FOTA 4E5UA 4ITVA 4CMBA 2OO5A 3AHCA 4J1TA 1JQAA 4PTLA 4HZUB 4B7ZA 1DJMA 5DM60 4D98A 5BR4A 1SEVA 1H2EA 3OD5A 3QNUA 2PRZA 3KETA 2VSFA 3ML1A 1WAMA 4MGKR 3A6DA 4XCQA 2HU5A 1II8B 1RKVA 4JBLA 5HEKA 7ADHA 4KDRA 4BVBA 1QC5A 2FPOA 5K3FA 3DE3X 4HRYA 1HSOA 1WV1A 3L49A 1SCQA 5IWAB 3DEIA 1WTAA 4C6RA 1ULSA 1PW5A 1QUFA 1S0UA 1LZKA 1QHHA 2MHCA 3DVAA 5GZ1A 5JH7B 3OWOA 1HOXA 1KZYC 1U04A 4R1QA 3L0CA 2W0SA 2W22A 2BKXA 1U3TA 3I01A 4D4KA 5CBKA 3WB0A 3SVLA 1QB7A 1SXHA 2WIJA 4XXHA 1QFSA 1VMEA 5AK5A 5TQJA 4EYOA 2VJOA 1B16A 5IAAA 3BGWA 4UVHA 3DC2A 4Q4JB 1WOMA 4PRYA 4N7MA 2VJMB 1NLZA 2LPMA 2VR1A 3S1AA 1JAZA 2UVQA 1UC4B 4NXNB 4H7HA 4F4CA 4FUQA 2B4RO 2V1UA 3ZWOA 1FTYA 2L0XA 4RNCA 3AY6A 4FPXA 3D6JA 3PQ5A 4B9EA 3X1ZA 2WK1A 3VA7A 1M33A 2E89A 4AUKA 3ZX4A 4NEHB 3NTVA 3K9LA 3KPVA 3KKNA 1UKEA 2XRMA 5TS3A 2OO5C 1CETA 4NHOA 4EVIA 1IAVA 4WACA 3C87A 4M7PA 3MMPA 2RGRA 3MIIA 1NP3A 4JA2A 4I55A 2R84A 2QMOA 4M86A 5AHOA 5NLLA 2OC9A 1WMSA 4KK3A 1JXMA 2GVDC 3LK6A 4GGMX 4AP6A 3H17A 3BE6A 1EX7A 1WZEA 2P11A 3K30A 4ZREA 3O9ZA 2B78A 4WD3A 5FX2A 2IU6A 1QRAA 1AIPA 4KE7A 1CUAA 4WBNF 3O21A 2E49A 3KS9A 1YJAA 2WF8A 4WA8A 4O59O 5EQTA 3WAJA 3A11A 3TZHA 4B4WA 1DV2A 3GRRA 4HQFA 2XW6A 3NTOA 1XCBA 3BA1A 1XKTA 3CX8A 3JAKB 3HHPA 2UAGA 2W6JA 3MAJA 2CZCA 4KOAA 2D2EA 2HSDA 4CRWB 5EJ5A 3TZQA 2O8FB 3S68A 3SYRA 1HQYE 2XRFA 1H0RA 3GROA 4H59A 5CLGA 4KPEC 3C4VA 1E0DA 3H4MA 3AILA 3V8RA 5BMVF 2QQEA 3E3OA 3P96A 3V55A 3GMDA 4LF4B 1G4AE 3HCCA 4H15A 4Q3CA 3U4GA 4ZMSA 2GBFA 3AEXA 4DQXA 5B5SA 1EWTA 3CR8A 4QM7A 2B20A 4WL0A 3SR0A 2ZAIA 4CKYA 4C1NA 3WFJA 1GU0A 2HPAA 3UEOA 4DMFA 4WMLA 1U3UA 3TCKA 2O0LA 3AVUA 2Z58A 3WL8A 3CXUA 4A0RA 2M6RA 4DE5A 2WWXA 1Z2PX 5C0OE 4F4HA 1AY0A 1W0JA 4E2FA 3O4VA 2GESA 1P4AA 1NN3A 3CUKA 3HN2A 4BCCA 1P44A 4DYHA 1GFIA 3W1EA 2IPLA 1PGOA 1O0SA 1QV9A 1AS0A 3JTMA 3VV2A 2CV0A 4Q93A 1WDKA 3KE9A 5TQVA 3TQQA 5BN3A 4OLAA 3GX1A 4DBZA 2L19A 1XCOA 2IEBA 1FNMA 1X3LA 1Y3DE 3BMQA 2AN1A 1QK3A 3BK2A 4R5HA 4RD1A 2O7RA 1I8TA 2G77B 3I8OA 3BFXA 2RCYA 4K2HA 4YEDA 1YMUA 3IDAA 4IWNA 4M1SA 3BIFA 4ZVKA 3QEMA 4YT4A 3QSYA 4JYAB 4G6ZA 4CCAA 4OUDB 5DHSA 4EELA 5F5XA 2VP6A 4MWSA 1QF9A 1SWVA 1NR5A 3OLWA 4JR0A 4D8WA 4E3WA 4QOIA 5JAZA 3RHSA 2YXEA 1Y6RA 4CCYB 1REQA 4J7AA 5HS6A 3BT7A 1FRQA 1JT9A 1SOAA 5JJBA 1CQIB 2I2FA 4GKAA 3FPLA 4Q7MB 2O8EA 1OX6A 3RROA 1U8TA 3TSAA 1WUKS 2GJAA 2XHZA 2CLEB 2WABA 3UHJA 1Q15A 1PS0A 2V7BA 4TV8F 3ZY2A 1A1VA 4YRJA 4NS1A 1KZHA 1SQ6A 3R9KA 1AF7A 3VZBA 1MGOA 2H1CA 3DEHA 4MV8A 3BRWA 1UDCA 1KI8A 1B3BA 3O03A 4A8HA 2XGMA 1KQ3A 4E33A 3U3JA 4XX0B 1XXHB 3N74A 5EIFA 1QIKA 3GC6A 1ORHA 1AZTA 2R4TA 3C6KA 4YIKA 3I45A 4EABA 4RHXA 4RMNA 4HS4A 3SLGA 4YCCA 1JHMA 1VL0A 2OE2A 3EF0A 1PZXA 2PT5A 3OOJA 1M10A 3IDFA 4M21A 4CV0A 2G72A 3LQ4A 3WL3A 2VZLA 2OORC 5BR1A 3L7LA 3C3EA 3H5TA 3ZE9A 4YJ2F 1KU0A 2PX6A 4GEKA 3KQOA 1VJCA 2J5XA 1Y42X 2CDAA 2VBIA 2ZBQA 2MMCA 1NKTA 1FNSA 1UDBA 1UEJA 3MXTA 4ZMBA 1MB2A 4GICA 3RUFA 4BQOA 2EP5A 5JROA 1DADA 1JW9B 2MR5A 4FYMA 1FTWA 2ZB4A 5INTA 3I0MA 2FPRA 4UVGA 3ENNA 1NY6A 4L75A 2B8TA 1Y3CE 5I7UA 3W5HA 1HNXB 4TV9F 3OU2A 2WAAA 3MC1A 4FNGA 4Y2QA 1BS9A 2CZGA 3PXDA 4G5RA 1TVEA 2ERCA 4JR1A 1IMOA 1ORWA 4LY0A 3IV9A 3LYHA 3M6AA 4PHTA 4LJYA 2IY9A 1CS0B 1ULAA 1X80A 1L1RA 1YR7A 2VZEA 1DO8A 3MWYW 4LN1A 4YC7A 5AHWA 3CVVA 2CGEA 2PJUA 1XMXA 3LZCA 5IJAA 1FVOA 3EY4A 3H83A 3ROGA 3OLXA 1NHWA 3CN7A 1V16A 2WB2A 3OOEA 3NJ4A 4FIZA 2HRCA 4DCPA 1Q6YA 3W3ZB 4C4PA 2OCKA 1P39A 1Z6QA 3CWQA 3CUWA 4KDFA 4NBTA 2PUHA 5EGNA 4A5SA 3W5DA 4CCSA 4EITA 4ZV9A 1AV7A 4OHWA 2C3OA 2G76A 2YWJA 2ZI9A 5KBYA 4D9MA 3CR3C 4CM9A 1YFZA 4Y3UA 3GJXC 2DKNA 2PMDA 4Y7CA 5DXJA 4OHUA 1E2BA 3OIUA 4B6EA 1Q1EA 4C21A 4ER5A 2CV2A 2YJ6A 1COWA 1WW2A 2GYUA 5LDGA 3R5SA 1W5EA 4PW0A 3X1WA 1ZAKA 1LVGA 2GCPA 2RHOA 1LF0A 1X9IA 3HCDA 4JT2A 4LPSA 3QM1A 1WR8A 4LF9B 1NOKA 4CNQA 2QI9C 1VSUA 4RHCA 1NW7A 1NTOA 2X6RA 3KEGA 3JVEA 3KJHA 4B33A 4JI1B 3WLNA 1GGFA 4BRSA 2PSSA 2GCNA 3PP8A 5IEBA 2AFHE 2CFSA 3NDPA 3W5VA 2P9GA 4FYWA 3RAGA 2UYOA 3OKAA 2J4FA 4CLOA 1D09A 1V1MB 1CF2O 1V5WA 2O50A 2OZPA 2WJAA 3RAFC 3QKRB 1NVMB 1AXGA 3RW9A 1ZUNA 2R87A 5AVQA 3BWBA 4YWJA 5D6OA 2DBYA 3SE0A 4BMDA 1GZHB 3WK8A 3GFVA 1HFEL 2G63A 2F55A 4JL6A 1P1KA 1RDFA 2JF0A 5TEWA 1X39A 1N3IA 2VP9A 3PC2A 3F0TA 5FNVA 4EHJA 1E1KA 3A4TA 1Z28A 2BKLA 2JBWA 1SKAA 4LMPA 3IPLA 2JVKA 4U4AA 4UU7A 4OL0A 1W581 2GXSA 1CQXA 5DE3A 3AI3A 4MJLA 4B17A 4JL8A 1KOFA 4INJA 4MUIA 1N36B 1AV6A 3LYLA 2QW1A 5JAIA 2E4WA 2Z4RA 4PS0A 4ZHQA 4XR4A 2IH4A 4BJ3A 3ERCA 3HPRA 1MVNA 2PS3A 4FFRA 2I2XB 1N9KA 2HI0A 4NBWA 1N75A 1QH8A 2W2KB 4KBYA 4P4SA 4TS1A 5G1OA 5IJXA 1N3YA 2PH7A 1GA4A 4BNYA 1L7PA 1A9SA 2RGUA 4GOJA 5DYNA 2CKDA 4IY1A 4IOLA 4MQMA 4PLCA 3RTDA 1KF0A 1AKWA 4DQKA 4E7PA 5K01A 4EYKA 3PDCA 3RVJA 1RHKA 1CT9A 5BNWA 3WZ2A 4EQ6A 3V7FA 3UJDA 2RMKA 3HSSA 2Y76A 1QH9A 3AL0C 1TKRA 4ZYLA 2AZDA 2C57A 2KPOA 2FLKA 2EZ4A 3ZOKA 2IHTA 3GRZA 3LBYA 3WJ1A 1QF6A 1GSIA 3LCMA 3ZDXB 4EG4A 1BA3A 1XZFA 4NYJR 3EVEA 4QJIA 4BLRA 3OZCA 3HSYA 4F91B 3OY7A 4N0QA 2GLTA 4IG9A 3ZHVA 1W6RA 2C5GA 4QDXA 3VR5H 4DS3A 5EMLA 1P3JA 3R3SA 5L3VA 3R7WA 1CUSA 4F4JA 3ONFA 1R00A 1TJ4A 3RBXA 4RORA 3WYDA 1RM3A 2Q4TA 4RHTA 3T4EA 4JXKA 4F3TA 1JT2A 1PQ4A 4KR6A 3KKEA 5LQSA 2JI7A 4D8YA 1UDXA 1QKIA 2C2HA 1O2DA 4JI4B 3PPIA 2VK8A 2W9XA 4I5DA 3FCXA 4YALA 2BI4A 1XEAA 2WWYA 3RVNA 5JD6A 2F1RA 2GLXA 3CRNA 3IMKA 4J3FA 2FDXA 4PYRA 3WMFA 4CI0B 3N7UA 5B64A 1ODSA 5CB8A 4EJ2A 1KO1A 2C98A 2J0UB 4JBYA 3RUEA 3VJKA 3K9FC 5EJFA 4Z1OA 1HA3A 3A06A 1SRRA 2D8MA 4W5WA 4JDUA 3U0VA 1G8AA 4ZEOA 5AYVA 4AN0A 5A02A 4ZXFA 4K3UA 4Q1VA 3U1BA 2HSGA 3OQBA 3DH0A 4X65B 1R6XA 3DOHA 3U5TA 1DINA 1XZJA 1UINA 4LQCA 4UHEA 4ACAA 2W48A 1W46A 2D0IA 2JFGA 2V4ZA 2VK4A 4ND8A 1I01A 4PZUA 4EA9A 1F1JA 5KNBH 3WIOA 2C0CA 1M2KA 1GITA 1XCGB 3IL2A 4H60A 1FP1D 3F7OA 3EULA 4ISBA 1XQ6A 4QUHA 3PQ2A 5SICE 4D41A 2WU3A 2VDVE 1XJQA 3AVOA 3HU1A 1G5PA 3IA7A 4KTVE 4OQDA 4DV0B 4M0FA 4XWGA 1I30A 1EGAA 3NHLA 5G1NA 5J4YA 1L4FA 1RKQA 2G17A 4LHWA 4ZXPA 4QTUB 2BE9A 3A05A 5TPZA 4ZYWA 1EM8B 4L28A 4A2QA 1S89A 1D7OA 4ZV7A 3QYFA 1LQTA 2PXCA 5HMLA 2IDJA 3CLSD 1VKJA 1NYLA 3N87A 4OHFA 4QPPA 4QXAA 4DANA 3DOEA 5AUNB 1GM5A 3CONA 3OZRA 1LDGA 4BNDB 1RAEA 1A69A 1ENPA 1PSWA 1KSGA 3CRQA 2GXAA 5IBRA 2EW1A 4FYYA 1Q5PA 4BN5A 2QZ4A 3NYIA 1B14A 1WXFA 2CMKA 1BX3A 2IOYA 3G1TA 3QEOA 2DC1A 2QUIA 3AX6A 4Q7JB 5EKDA 1EWQA 4OMCA 4CDMA 3KQLA 1CUBA 2WOJA 5IAGA 2C4WA 3DEYX 4QICA 4AKEA 1BDHA 2O8CB 1YDMA 1IN8A 2LWIA 2WQZA 4DCTA 3BJZA 2EBUA 2A9JA 3BH0A 3SZUA 1Z25A 3Q87B 3RQSA 3RIMA 1W85A 1PQUA 5ISMA 2B5WA 4ML3A 3LQRA 3AUJB 3JU3A 2C7OA 3T06B 2IP4A 1TI7A 2YMQA