4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
2ERYA 1M6NA 4IVRA 1KKLA 2ERXA 2ZQ5A 2DCUA 3ASYA 2J7KA 4PC7A 4X8OA 1TTTA 1GAJA 1IHUA 2HDNB 3JVUA 3SJCA 2O0HA 3H84A 5KU1A 2IYUA 3QG5A 1II0A 5UKDA 4EUNA 3ICEA 2Z5FA 2IYLD 1QZXA 4U00A 1Q57A 4XTRA 3CX6A 4AKEA 1L4UA 4C0JA 1E0KA 4LY6A 3Q7QA 2R6DA 1OH7A 3OAAD 4WIAA 3KQHA 1N6HA 3OF5A 4LGMA 3BGWA 1VHTA 3QKSA 4B3DA 5C46F 1KI1A 2NZJA 1U8AA 1SGWA 4I4LA 4M1WA 2D2EA 2C03A 4US1R 5A0FA 5FI0B 3KB2A 4C2TA 1YRAA 3RLFA 3RRYA 2KBEA 3PEUA 3WYAA 4JLKA 3WY9A 1XJQA 2WAYA 4X8LA 3U61B 1ZNZA 1K5GA 1EFHA 1UAAA 2OCPA 4W7SA 2HXYA 2F43B 2V7QA 4KLZA 4DSTA 1OXUA 4URXR 3D6TB 2OBLA 4AKHA 4JVLA 1ZCBA 3PQCA 4A8JB 4A8JC 1LB1B 2NMVA 2FN4A 4PHGA 5FH9A 4GI7A 4EIWA 3IUYA 2FMXA 3BD9A 3D31A 2XAUA 4G01B 2C96A 1W36C 4XWKA 2O8DB 4NMMA 5C4MA 2P65A 1W4RA 2YC4C 2CBZA 2ZSDA 4DEYA 1Q21A 1W44A 3HP1A 1AJEA 3LRPA 3LDAA 1NLFA 521PA 5A5GA 5JSZB 1QG4A 2QE7A 1OXXK 1IJFA 4OK6A 2EU8A 2MMGA 1KY3A 1VG8A 3T12A 1G20E 1IN8A 5H1YA 3U5ZB 3ZQ6A 3D7MA 1KI2A 3E1SA 1AGRA 1KJYA 3AVPA 1KAOA 2KB0A 4JLJA 4UQOA 4Q1BA 4LBWA 1ZP6A 4PZZA 4OBEA 4YONB 4CVNA 1R5NA 1E9AA 2EVWX 3GJ0A 4Q4HB 2BBOA 5JJKA 1Q1BA 2PJZA 1ZC4A 1US8A 4BFTA 4QM6A 2GHIA 4MRSA 2YWHA 1N6RA 1XPUA 1SZPA 2BOVA 4GZLA 4LJ9A 5JFGA 3W8NA 1NN3A 1CKEA 2J1LA 3BH6A 2OAQ1 3EC2A 1H8HD 1NP6A 3GEEA 2P6UA 1Z6TA 5HCNA 1JJVA 1KJZA 3IPXA 1UBEA 1J7KA 3B60A 3ZDQA 1G3QA 1P62B 1UKVY 2LKCA 1CIPA 2IW3A 4PTLA 1UFQA 1HTWA 4K46A 1F5NA 3TNFA 2QI9C 4GP6A 2ZAOA 4TMWA 2DB3A 4RVCA 2CXXA 5JEEA 2RAPA 1T3SA 1E99A 2B8WA 3GD7A 3R9IA 4X8HA 4ZDWA 4YDHB 2EYQA 5DYGA 2OV2A 1F3OA 5JBQA 2QG6A 5L3VA 2GBLC 4C4PA 5JEDA 1U98A 4HAZA 1EFUA 3QXCA 4QG7A 821PA 1JQJC 3A4NA 2HCBA 3B13B 1O87A 2DWOA 1NJFA 4IDHA 3AKEA 4FMDB 3I61A 4IVQA 4OKSA 1XD2A 4M1OA 4BGDA 3K0SA 1ZINA 3QG1A 2VHJA 3V9PA 1OHHA 3PUVA 2QBYB 1KK0A 3BJIC 4NL4H 2QM7A 3CF0A 2JJ2D 5SZIA 2VP0A 2IS6A 1CR0A 3TQFA 3QBVA 4S35A 1XZQA 4QXAA 1P9NA 2JLXA 4C0QC 3CBQA 2W6JA 4LC1A 4Q9LA 4AKGA 1P72A 2GVZC 4XVQA 4ILEA 2W0MA 2C95A 1XEXB 3CWZA 3T1TA 3E5HA 2O5VA 3AB3A 4G5QA 3RVBA 1NY5A 4O2LA 1NRJB 3BB3A 1UBGA 5LD2C 2Z83A 2QEQA 1KSFX 1NSTA 3CR8A 4Q66C 2NPFA 5LD2B 1P2VA 5DE3A 3CRRA 1SVIA 1P2TA 3KXIA 4OQXA 3CNLA 4BFZA 4ERNA 1QHXA 1SXJA 1S8FA 1YZLA 1MRNA 3MJHA 3BK7A 4R7ZA 4WW0A 1DAEA 2EFCB 2X2EA 4BWYA 2P5TB 2W6ID 1DVRA 5L3SA 1NN5A 2Z4RA 3QKRA 3PVSA 3ECCA 3GPLA 1TADA 3FPAA 4TZ6A 1FFHA 4JSTA 1TQ6A 3ADCA 2G88A 1R8SA 2JJ1D 1KZGB 2JJ1A 3DPUA 4BFXA 2QNRA 1CJUC 1GFIA 1ELOA 4G5OA 1O3YA 4ON9A 1Z63A 1TMKA 3CPJB 1OXTA 3A4LA 3AVXA 1G5RA 1IQPA 4QJ5A 2Q0HA 1E1QA 4TQUS 4ZCMA 2ZSAA 1E9CA 3MWKA 3NBYC 1OIXA 2F6RA 2VPPA 2WOOA 2AXNA 3BH7A 4AIIA 4BQSA 1LTQA 3HR8A 2ZE6A 3GLIB 4YDSA 2QSYA 1E2KA 5FPSA 1G41A 1RPZA 2DFKB 2BV3A 2D3WA 3QNUA 4GSYA 3U7EB 3WMFA 5K8IA 1FQKA 4UJ3A 4DCVA 1R5BA 2P2LA 3RS5A 1WDTA 4V03A 3GQBA 2VH5R 3H4MA 3SQWA 2NO9A 3N2EA 1ZW6A 4U02A 3VR1A 5K8TA 5B57C 3TAUA 2OXCA 3KJHA 3SYKA 1YZNA 2DYKA 1M1YE 4TSFA 2WHXA 1CTQA 3K09A 4FI3C 4D6PA 1VG1A 2VP4A 4F4CA 3GJ5A 4JYBA 4NYJQ 4JVSB 2QMUA 2QA5A 1DG1G 1NVUQ 2KJQA 1UKZA 1E69A 2GNOA 2QAJA 2ZJ5A 2ZRCA 1FTNA 3J81k 4A2QA 1ZUHA 2JEOA 4US0R 2SHKA 1OB5A 2DR3A 2Z0MA 2XSZA 1TUEA 3KL4A 3W6NA 1E0SA 2GWHA 5KDOA 1XP8A 2FF7A 3B7GA 2H16A 5CDFA 1MR3F 1AZSC 2QSZA 3F5FA 2QPOA 5TARA 1PVOA 4IVPA 2GDJA 1KTVA 2VHUA 4RD4A 1U8ZA 4D25A 4QBGB 4DKXA 4FD2A 1JR3A 1RFLA 1Z0JA 3HYRA 2YWEA 5FR2A 1XPOA 5BW8A 1XDBA 3I32A 2CVHA 1J70A 3T5GA 2IYTA 1YR8A 1H8HA 3M0EA 3K8YA 1E0AA 3GLIA 4I1UA 2BHRA 2PZGA 2MMCA 3AQ4A 3TAHA 5DGXA 1X8KA 4LV6A 5KDDA 3G0HA 3FVQA 5TDHA 1JR3E 1WF3A 1FNNA 1N6IA 3CRMA 3M4YA 4B6EA 4Q9JA 4HB4A 2BWJA 4HAYA 1T8UA 2J0UB 4DLXA 1IXRC 3ZIAD 4FMDF 1G8HA 5JHHB 3QPUA 2G0TA 2WPDD 2P3SA 4QKQA 2XJ9A 1OPXA 2NO1A 3CPHA 4YQFA 1GVNB 4A0FA 3OIUA 3GJ3A 1KK1A 4OK3A 1KO7A 2PX0A 3VHXA 3QF4B 1EK0A 3UMRA 3HPQA 4LV5B 4HUQB 4ITRC 3CH4B 2GK7A 4WXPA 2V1XA 3KQKA 1MH1A 2EYUA 5G3ZA 4MDFA 1BKDR 2CVFA 2ZROA 1N3BA 4HZUA 1NMYA 2BMJA 4YMTA 1QBKC 3B5JA 4PSKA 1A2BA 1QHHB 1RRPA 3G82C 1KSGA 3U3MA 4KITB 1KIMA 4IOMA 1HYQA 1WE2A 1L8QA 2F7SA 1QHYA 2ZRJA 1HA3A 4KI0A 3LBIA 2CLDX 2QU8A 1NN0A 4JLAA 3TE6A 1E0JA 3WMGA 2ZEJA 1S0UA 2A7QA 1JECA 2EQBA 2WOJA 2YOHA 2ZS9A 3I1FA 4KYUA 4POAA 4GPTA 1XBTA 3C41J 5IRCD 4BLRA 2N46A 4P4TA 5IF9A 2ZJ2A 1CRQA 4HB3A 4O2RA 1DAGA 3NEYA 2A2ZA 5E7JA 3U3OA 5FOUA 2ZTSA 2JLVA 1XXHA 2RHMA 4QBIA 4BE7B 5HE9A 1ZCAA 1GL7A 4M8NE 3RS7A 1W4BA 1SXJC 2GF0A 3THOA 5FBVB 1I2DA 2ORVA 2PX3A 3LXRA 4HSEA 1AZTA 3KUDA 4LYJA 4Q21A 3KFXA 4WBSA 3NG1A 4ACAA 1LY1A 4LJ7A 4TTRA 4BFVA 5AUPB 5FI1B 2XB4A 3THYA 2PCJA 5LB2A 4URUR 1UADA 1KI6A 1U9IA 1GRNA 4IHQA 4WZ6A 5HCIA 1XXHE 3TK1A 4YMSA 1G1MA 3AVUA 1EFRA 4KSCA 1EFRD 3SYLA 1G19A 2W2TA 2CK3A 3UG7A 3VR3A 2PMDA 2WJVA 2HLDD 2RKOA 2XNSA 3X1WA 4TN1A 3ZGXA 1ZBDA 2A9KA 2D7CA 1Q20A 3FFBA 4TT3D 3MGCA 1JPJA 4ZO4A 4JJKA 4XD7A 3AP2A 1J90A 2PEZA 4DSUA 3TW8B 4Z8YA 2JLUA 3TSZA 3WRXC 1R7RA 2OBNA 221PA 4PQFA 2AL7A 2OCAA 3GJ4A 4MITA 4QOSA 2PL3A 4B2IA 1Z2CA 4DVGA 4MGYR 3SFVA 2KSQA 1OFTA 2JCSA 3I8SA 3T5DA 4AYTA 1X8JA 3E2IA 3EZ2A 5LPNA 2C8VA 1XX6A 2LWIA 4NKRA 4WVFA 2FU5C 4DT1A 4W5WA 1OLOA 1KDPA 5H68A 4H9GA 3UXMA 2ZRFA 3LLMA 4TWZA 2VHQA 2Z6VA 3ZZ0A 2GVDC 2KI5A 3IO3A 4X8MA 5CM9C 2EFDB 2NGRA 4A36A 1BYUA 1D8TA 2WKQA 4HLUA 5FR1A 1YHNA 2FPKA 3NH6A 4BZPA 2VLIA 3Q72A 4HLUC 4Q1DA 4DDTA 4Q4LA 3KTAA 1KI7A 1II8B 5JJLA 2VL7A 3SE0A 2OE2A 1Z06A 3WYFA 1DAHA 2X19A 1P5ZB 4GZMA 1N6KA 1OXSC 1XTSA 1F48A 3QOFA 1LNZA 2C98A 2IX3A 3EAQA 2J3EA 3A1TA 5J4HA 1JJ7A 1IM2A 4IRUB 1DAMA 4V0OA 4DUGA 1NI3A 2P0EA 3DMNA 1DE0A 5CYOA 3AGQA 3SR0A 3DOFA 1QVAA 2ZANA 3VMFA 1JB1A 2KWIA 2XNDD 3UWKA 2AKAB 4M9XA 2IHYA 2PJRA 3RDPA 3V4RA 4MYUA 3TSWA 1NIJA 4MQBA 1RE0A 4NCKA 3DOEA 4NP6A 4L15A 5AK0A 2VSFA 4D82A 5DISB 1E96A 2ZREA 3PCRB 1ZM9A 3B1VA 3WNBA 1BS1A 2W2VA 3MLEA 1KI6B 1YRBA 2P6RA 2NG1A 4JKIA 3WHKA 3THYB 2QUZA 5AUQA 4Q1AA 1ZAKA 1U2RA 2JLRA 3NVAA 1GIAA 4ZDKA 2FOLA 2ZI7A 3MUFA 5EXSA 2VP6A 5F3WB 3KQUA 1W2HA 1W0JA 3U2QA 1NBMD 4TYPA 3QENA 5E4FA 2QP4A 2A5DA 1M7GA 4BLOA 8OHMA 2OSBA 4PPNA 4A1FA 1E2LA 1XJ0A 1RIFA 4UXHA 2XB2A 4TLEA 3K53A 1WP9A 2KBFA 2IHBA 2WKPA 3MSXA 3OEHA 3OIVA 1Z29A 3FB4A 5EP3A 2HXSA 4GBMA 2JLSA 3A36A 1XEFA 3M6AA 4HZIA 2C78A 3VU9B 4W9MC 1TPZA 2GXAA 4B43A 5J4KA 3AH8A 5JZVA 2FSGA 2BDTA 2ZE7A 4B75A 1G3IA 3VR4A 4OHXA 1EXMA 1E9EA 2ORIA 1YZTA 2Q9AA 1XTKA 1IY0A 2ZRKA 2ODNA 4L8GA 4Q7MB 3F0TA 4NPHA 5TB5A 4ZIRB 1E2GA 3JZAA 4B47A 1QHGA 2ZRAA 2D06A 3AVQA 4Q4HA 4PX9A 1TX4B 3U6KA 1YZQA 5D3MB 5EXPA 3K70C 4B74A 5F9FA 5FUXA 3EZ7A 4JS0A 1U99A 1P73A 3NC0C 5E7MA 1CBUA 5FOVA 2ORWA 4F4IA 5GJVC 3QXSA 2NO6A 5B58C 4WXRA 1UBFA 4K81B 1S4QA 1WRBA 3RABA 3N2IA 1XTRA 5EE3A 1RVDA 3THWB 4KSBA 5JWHA 2ZSBA 4YMWA 1FUUA 4CEIB 3EARA 2ZAMA 4KLNA 1EWQA 2EFHB 3I5XA 1A2KC 2WWXA 421PA 4Q48A 1XWIA 1GP2A 3RRZA 1Z8FA 4MDEA 3T61A 1D2EA 5C4GB 1AIPA 1NG9A 4OJQA 2IC5A 3SZRA 1N0WA 4WAUA 1OH8A 1SVSA 1U81A 1XRJA 4CRWB 5DHAA 4TMXA 3FKSD 5JI2E 1TL7C 2VBCA 3BBPA 4GOXA 3ZS8A 5AJZA 4C0LA 1W1WA 2F55A 4DSNA 2F3RA 2GXSA 4F92B 3I92A 3K0FA 2DWQA 3KX2A 3FHOA 3KJIA 4DCUA 4AC9A 4Z54A 1Z5ZA 4ABYA 1MO3A 3Q3JB 4BECA 1OXVA 2ONJA 1VHLA 1XTQA 4IKEA 1NLZA 4MKFA 4CT4B 4C0BA 1R8QA 4QJ4A 3K9LA 5F9HA 1N5LA 1HY3A 3IIJA 4A6PA 2W00A 2VO1A 3WNDA 4HLCA 5EE0A 4OQFA 3W6OA 4BLSA 1D9XA 1ZD9A 4UXJA 1KI9A 2AHOA 2H5EA 3SQXA 5CK4A 5BYKA 1N6NA 3CZQA 5GJBA 1F2UB 4EDHA 4DC9A 3A6PC 5ANRB 2ZPTX 2WWIA 2NZ8A 4DBLC 1FW6A 1VYUA 2RGBA 4TT3A 3C16C 2XXAA 4JBWA 1QDEA 2CCKA 3LVRE 4MKGA 4IFEA 3VU9A 3TIFA 1YZGA 4AYXA 5K8UA 2V6IA 3R9XA 5TXGA 3W9YA 4KYIB 5FPKA 2JAQA 1G5TA 1LFDB 1FP6A 1L7VC 2JDIA 2O52A 2VEDA 3MRSA 3O47A 4QGGA 4QHYA 4OHYA 1E3MA 3K1JA 4TLAA 2YJTD 1P4SA 2V55B 2Q3HA 2BIFA 2C77A 3K0EA 4OHVA 3T34A 1XD8A 5BYJA 1XMIA 1IOZA 1KDRA 4NONA 1ZNXA 3IGFA 4LZZA 4CT5A 2ODWA 1VPLA 1UJ2A 2OCYC 2YZ2A 4OHWA 1R0YA 5H8WA 1KSJA 3BFXA 4FW9A 4QBFA 2BVNA 2XTZA 5KSPA 4NH0A 1IXZA 1M2OB 2RGXA 5BWMA 4URVR 3QF7A 4LPKA 4C9BA 3GFOA 5FBRB 5FTLA 3Q85A 5FOWA 5JLJA 3ZD6A 2GEUA 2PT7A 1W4CA 4BLTA 1F2TA 4O3MA 1JI0A 2RB4A 2GZDA 3NH9A 2CJWA 3KJEA 1Q1EA 1XTIA 4RSGA 4R98A 3CO5A 2GA8A 5L3RA 5C2JB 4ZDJA 5SZHB 2GCOA 4RCZA 2B7CA 2VHCA 4KXFB 1HEIA 3GJXC 2XSZD 2QT0A 1NIPA 1NKTA 5AWFC 3FGNA 4KFTA 2CHQA 4LOAA 3OE7A 1ODFA 4XIGS 3TUZC 3U7FB 3C7KA 1D2MA 2GAAA 4M53A 4R2IA 1Q1ZA 3D8BA 2DWPA 2B8TA 4PANA 4QHTA 1G7SA 4L9SA 3WP1B 1YJ5A 4MGZR 3I3SR 2UKDA 3V4FA 3QEOA 4C30A 4DHEA 4YMUA 5JCPA 5JRZA 2OUKA 4ESVA 1Q1QA 3KDSE 1G16A 2AWOA 2EFGA 4UXIA 2GF9A 1GUAA 1FNMA 5DH9A 4RY2A 4A0HA 2IYYA 2R2AA 4BEBA 3SBEA 2YC2C 3W3ZB 3U44A 5DI3B 2CNWA 1CJKC 1VG0B 4P31A 4Q47A 5AJWA 5E7IA 2K5UA 3VR6A 2YYZA 1KYIA 1G7RA 3G5UA 3VTKA 4RZXA 3F8TA 3QIAA 3KJGA 2GEDA 5DO9A 2FZLA 2OHFA 5EZ6B 5FBWB 4B73A 3C4JA 3RAPR 4U5XA 1XEXA 3TVDA 3EZFA 2XXAB 2JJ8A 4I81A 1YR6A 1SKQA 2G3YA 4A2PA 4EFLA 3D3QA 1E6CA 2BJWA 4F38A 2C99A 1T3LA 5CB8A 2BMFA 3FMFA 2QORA 2GZHA 2WIAA 3GFTA 2JA1A 1SHKA 4IOJA 1KHTA 2A78A 3IKJA 1S9HA 1X86B 3PITA 1G3MA 1OF1A 2I1QA 3B2EA 3SI7A 2YINC 5IT5A 1E2DA 1N6PA 4TMZA 4DDVA 1UM8A 2WWHA 1RJ9A 3UIEA 4N3NA 4YXWA 1IN6A 1KO8A 2JJ2A 2ZU6A 3DM5A 2V6JA 4Z1MA 4BZXA 2J0SA 2Z43A 1W0KA 1COWD 4TL6A 4B76A 4MKHA 2GAOA 4AKIA 3UMSA 5TVKA 2HYIC 5JMTA 3AF0A 1E98A 3TSOA 4PO1A 1EX6A 3FKSA 4CEHA 3IILA 1ZMXA 5KO2A 1FMLA 1G8FA 3Q7PA 2CLSA 3UATA 3UKDA 1EG7A 1PZNA 2GJ8A 4ARZB 1G17A 1AGPA 4QJ3A 4A92A 2GBLA 5L3QA 2IYVA 1OKKA 3FDIA 5DI3A 1XU4A 2AN9A 2X77A 2VF8A 3L0PA 3CKLA 3C5HA 4B33A 4CDGA 3VNUA 1MT0A 4Q5IA 3I5YA 1IXSB 2ZRBA 1QHIA 1HQCA 1II9A 2ZSFA 4BRWA 1KK3A 1NL3A 2GRJA 3SS8A 2OLKA 2QRZA 4Q1CA 4HLQB 4DIEA 4TZ0A 4PAMA 2AK2A 1W48A 4PSVA 1FZQA 2IF0A 4AWXA 5AUNB 1MO5A 4BLQA 2RGNA 2P5SA 3K70D 1ETUA 1XNJA 3TW4A 1XMJA 2VP9A 4C0SA 1JBKA 5B64A 4WA7A 1TUIA 1E9FA 3TJZA 2BM0A 2OESA 2ZUDA 4LHZA 3TMKA 1QHSA 4AG6A 4GT1A 3OIYA 2B6HA 4C7OA 3IBYA 2BCGY 2WM9B 1GTVA 1AS0A 1MKYA 1CP2A 3BH0A 2JLQA 3A1WA 2O8EA 2G1KA 4GDFA 2WJHA 3KKQA 3OHMA 1DAKA 4M9SA 1KMHB 1KK2A 4CW7A 4D4MA 4P33A 2FEMA 1OKKD 1XF9A 4E07A 2REOA 4Y0AA 3DHWC 4CIDA 2ZVQX 1PLJA 3W5JA 4JLNA 1N0VC 4CEJB 4IXNA 2FFBA 3IQXA 1J2JA 1NVVQ 1DARA 2J87A 4ZDIA 3UK6A 5JCZA 2YNMA 4D0LB 4BUJA 2GXUA 3VR2A 2ZJ8A 5JI3E 3SHFA 3B9QA 4PPGA 3AKYA 4JYCA 1PUIA 2GCPA 2ZI3A 4TMVA 2ZI4A 3X1XA 2MSEB 3ND9A 2XZOA 4KO8A 3HDTA 1DAFA 2PLRA 1GNRA 1HUQA 2ZJZA 3T1OA 4KJZA 4XSHA 2GXQA 1D9ZA 2HT1A 5HZHA 2FWRA 4YC7A 2J46A 2HF8A 4A8JA 2OT3B 2XTNA 4DJTA 4D0NA 4DLZA 5J4YA 4NE2A 1ZIOA 1RJ9B 3CUEF 4EFNA 2J7PA 4NTZA 4A4DA 4OYHA 1A1VA 1TNDA 3SNHA 4Q18A 1W7AA 3IEVA 1B0UA 1JR3D 4MUAA 3THXB 1P2SA 1G6HA 3CF2A 3LH5A 1TU4A 5IK2D 2W58A 4MUBA 1NMXA 2V54A 4QM7A 1GKUB 4V0KA 1AM4D 2FFAA 3HWSA 2QTVB 1OH5A 5EE1A 1GNPA 2IWRA 1YE8A 2N1BA 5JS8A 3KKMA 1VYTA 2I1VB 4B6FA 1R5OA 3LLUA 5SZJA 4C7OB 1VCMA 1FOEB 2P67A 1Y63A 4I1OA 4CF7A 2EFEB 1FMJA 3W34A 1ANKA 1OIWA 5DYIA 3U7GA 2ONKA 2F1HA 4DEXA 4E22A 4EPTA 4KODA 1DTSA 4BFYA 3FKQA 4CZ2A 2WKRA 1K5DA 5CJPA 1MOZA 3A4MA 3CX7A 3GFPA 5G40A 3P4XA 4QGHA 3T15A 1E32A 2IYSA 2D7DA 2BCJQ 2VTKA 3OESA 1KNXA 2MSCB 2ZJBA 6Q21A 3WBKA 2XOKD 2OLJA 1QVRA 2Y8EA 3I4LA 2ZRGA 3LXXA 3R9WA 4Q4AB 1XCPA 2FPLA 4DRZA 2AX4A 3K0FB 4TMKA 3VAAA 1TF5A 2GCNA 3GLGA 3HR7A 1MV5A 2XX3A 3IEUA 3K09C 3UMFA 2O0KA 3OEHD 4YXWD 1UF9A 2IEYA 3WYGA 4OI2A 1XEWX 1AS2A 2H1LA 2XITA 3GLFA 4PZYA 4IW3B 3DKVA 1FPMA 4OK5A 3FWYA 3K0AB 4B35A 1V43A 4HB0A 1COWA 2IEZA 4B3BA 5J4LA 1PUJA 1M74A 2ZJYA 1SVWA 5LDDC 1GOTA 2PZEA 2CHVA 1E2NA 4M1SA 2AK3A 4Q7JB 2OXRA 1GDDA 1G3UA 2FNAA 2JIZD 1RRGA 2WJGA 5FBLB 1IBRA 1MO6A 4V0MA 3VKWA 1UPTA 4JBYA 4ESHA 1SXJB 2ATXA 1FP7A 1M8PA 2F3TA 1LV7A 2QROA 2CJWB 2BKUA 3IIMA 2GILA 1TF7A 4L16A 3Q8XB 3WXMA 2OO7A 1EFCA 4QGAA 2R6FA 3AP1A 3TVTA 5CIWA 3EPJA 3QQ5A 2IS1A 3A1UA 1KDTA 5FPYA 4FIDA 3QJYA 1DO2A 4FWIB 1Z47A 1ZU4A 2OILA 1IY1A 4LPSA 1I2MA 2XZLA 1E1RA 2G6BA 1YR9A 4DDUA 1KSHA 2QQEA 1OFIA 1E2MA 5EE9A 5JWRA 2G1JA 3R7WB 3X1DA 5FL7D 1E2HA 2HJGA 1U90A 4LHVA 4EQ6B 4O0MA 5FOXA 1E2IA 3FYHA 4MA4A 3QSYA 3LAWA 3NBXX 3BS4A 4C0KA 1M7HA 3O8DA 5DN6A 1G7CA 2JLWA 4A82A 3U7HB 1W0KD 3EIEA 3AVOA 1EWRA 1BMFA 4BFUA 1Z6AA 3K9HA 2Q3MA 1V5WA 5EQTA 2Q21A 4LDJA 1U8YA 4QHSA 1QHHA 1Z6YA 4TL8A 5GJWC 2V1UA 3BB1A 3H1TA 1E79D 3L0SA 2ZRNA 1ZC3A 4LJ4A 4TYYA 1GKYA 2E1RA 621PA 5DHFA 4Q19A 4R71A 4B2PA 4B3FX 4KU4A 3LNCA 2ZJOA 4EPVA 4B44A 4J0QA 4NBSA 4PHHA 1CR4A 3THXA 4ACBA 3LO5A 3GLHA 3QPWA 3T06B 5FOTA 4Q1FA 5L8VA 2ZJAA 1M34E 2BMDA 4HEJA 1VIAA 1NN1A 2QL6A 2WJJA 2CMKA 3EW9A 3DMDA 1CU1A 1G5PA 1VIYA 3DL0A 4RZ2A 3GLGE 4Z51A 1OYWA 1OB2A 2UZIR 5M04A 4D80A 1EX7A 4DCNA 3GLGB 4XWAA 4HLDA 3RRNA 3N70A 2X1VA 4NCHA 1KGDA 4LJ5A 4NYMQ 5EP4A 1Z0KA 1YR7A 5EP1A 5FPTA 4M22A 1QRAA 3A1VA 1JEEA 5IK2A 1IONA 1NKSA 2WSSD 1NMZA 2IYZA 3ICQB 2BBSA 4M2LA 2FJUA 3ZZUA 2WJYA 2YOFA 2ZYUX 1B23P 3P4YA 1OYYA 3BXZA 3X2SA 3L2OB 1Y3AA 4E03A 4Q1EA 2FEOA 1VDZA 1SKYB 3TBKA 1UBCA 1E2JA 1N5IA 2Q6TA 2F9MA 1OH6A 1CF4A 4MYCA 1SVOA 2C2HA 4TLCA 1E9BA 1RZ3A 4RD6A 1VECA 2QP9X 2REBA 3ZH9B 3QKUA 2YWFA 2ZXUA 2UZ3A 2VIIA 4XVRA 5C18A 1XFAA 1R0WA 2WPDA 4GMDA 2J5XA 2H92A 2GJSA 2V9PA 3L0OA 1HE1C 4HI0E 2BEKA 3DDCA 3TH5A 4RKEA 4D4JA 3B1ZA 4D4LA 5BN3A 2XOKA 4PAQA 3AUYA 4D2IA 3GLFB 1QHNA 3QUSA 4JBXA 3DEFA 4FCVA 1KAGA 1GRRA 1ZM7A 2KE5A 1NVXQ 1XTJA 4HUQA 5BN5A 3B8HA 4P32A 4DDWA 1VCNA 1C1YA 1TU3A 3L8ZA 1VTKA 2ZETA 4NYMR 2R44A 1AN0A 3KTAB 1TF2A 1N6LA 4IOKA 4PQRA 4YLGA 4GOKA 3SFZA 3O8CA 3CPEA 3THWA 4NCIA 4XH9B 2YHSA 4TLBA 4QBHA 3AP3A 2GJ9A 1FX0B 4JLPA 4DSOA 4RD3A 4JLDA 1SVMA 3CRW1 3I62A 4RZ3A 2C9YA 3W90A 5EE5B 1T91A 3UANA 5J47A 5JRJA 3OFNA 2JIZA 1OE0A 1Z0DA 1YQTA 2UVQA 3FHCB 5TMPA 2DPXA 4M21A 5J4VA 2A5FA 2CDNA 3RC3A 4IDOA 2QTHA 4PR0A 4EAQA 2ZE5A 3CNNA 4TL7A 4CGZA 2LKDA 3CF6R 3IHWA 4PHFA 3CM0A 2CL6X 1P75A 3QKSB 3U6BA 4NU0A 4K8OA 5TY0A 2FV8A 3MCAA 4JMPA 5KSZA 4NYJR 4PPQA 1EFTA 4JL5A 1CEEA 3KQNA 2J59A 3BERA 4OQNA 1D2NA 4XOIA 2EWVA 2GEVA 2BBWA 3FMIA 4LJYA 1T6NA 1T9HA 1Q22A 4PC6A 4V02A 4I99A 4B48A 2B21A 1Z6GA 2AKYA 4Q03A 1WA5A 5CJ2A 4C2UA 4LHYA 4OI4A 4Q7KA 5HKKA 2QAGC 4G0NA 4AK9A 3ADDA 4LUCA 2F1IA 1DS6A 3IIKA 1SXJE 2IYQA 4AI6A 2WWFA 5SZKB 5G41A 3BAFA 3RS3A 2NIPA 3B82A 1DADA 1JQLB 2YOGA 2RGAA 5FL3A 1HT1E 4JJZA 2HYDA 5D3MA 4HUTA 1P2UA 4B3GA 4PO9A 2CL0X 2IYXA 2IBMA 2WWWA 4G5SA 3ZQJA 4HZUB 2VSOA 4ZPXA 3QPVA 5DSZA 4LK2A 2XGJA 1MABA 4D26A 2HLDA 3WP0A 5JSZA 3O8RA 4B71A 3KB1A 5IDVA 4F7WA 4Q9IA 4QFMA 5F98A 3T35A 1DEKA 1VKJA 2RMKA 2HCJB 3KKNA 2D62A 1GZSA 4GNKA 4XD7D 4LJ6A 2ZRLA 3FFAA 5B2ZA 4TSFD 5L3QB 5AUOB 1M7BA 2IS2A 1ZJ6A 2NPIA 3RYTC 4MYHA 2HUPA 3JZMA 5FOSA 3VX3A 1W36D 3OZXA 4Q01A 4OHZA 2VRWA 3ZVRA 3MWLA 2FSHA 3FTQA 3LX8A 3T1VA 2IL1A 4LBZA 1FX0A 2QMHA 3H86A 5HE8A 3VFDA 2WBLC 4BASA 2VP2A 3KFVA 2WV9A 1F6BA 3ZYCA 3AVWA 5HTKA 2D74A 1GNQA 4TYNA 1KOFA 2J7PD 2QRNA 5KOYA 1G9XA 3TUIC 3AEZA 1N0UA 3W6PA 5K8LA 4JVNA 1UDWA 2A3RA 2V3CC 2VQSA 3VKGA 1U9IC 1GWNA 4DLSA 2ATVA 2QM8A 2R6GA 1HH4A 2WMOB 3A1SA 3PUZA 4FMBB 3OEEA 1Z08A 4P4UA 1S3GA 3V00A 4JSYA 4OQMA 4DB4A 3AF2A 4LBYA 1E79A 2OG2A 4D81A 4XJXA 2AFIE 3LQQA 1MABB 3BFVA 2W2XA 3LVQE 5JECA 2XEXA 1XXHB 5BQ5A 3EPKA 2RH5A 4IOLA 1E2PA 2OCBA 2PZFA 3TUJC 5KDLA 3EG5A 3LBNA 1JXMA 1TQDA 1W36B 3EZ6A 4N1AA 1OT3A 3RRMA 1KMQA 4EJSC 1ZNWA 4KAXA 4JLMA 3QBTA 3IQWA 1Z22A 3SDZA 2AD1A 2R6CA 3RWMB 3KZ1E 4UKDA 4TMTA 1HV8A 1CJVC 4NCJA 4QL3A 4TLDA 3RHFA 3NBFA 1Z0IA 3PEWA 3ASZA 3DKPA 4Q7LA 1OJLA 3LW7A 3MAAC 1XD9A 1JPNA 3CZPA 1AA9A 3OEED 4P0TA 5E3HA 3AV0B 4FMCF 3RANA 1H8EA 5B30A 3P20A 1OHHD 3L0IB 1AS3A 1KI4A 4GP7A 1GITA 1T5IA 1TQ2A 4Z1MD 1E4YA 2E87A 2ZRDA 4JL6A 3ZJYA 3C15C 3LV8A 3PXGA 3PG5A 2WZQA 1VG9B 2CNWD 3NWJA 1SQ5A 4LC0A 4UJ5A 4HATA 4FINA 3A37A 4C0AC 4M9QA 5HPYB 2QAGB 1YKSA 3QXXA 5C1BA 1C4OA 4NYIQ 2XZPA 1Q12A 1JR6A 2PEYA 5F2EA 5EUQB 2A30A 3NKVA 4BLPA 5AJXA 3DM9B 3U60B 4QGFA 2CEAA 4GL2A 2R9VA 1X1SA 3PENA 1BO6A 4G5GA 3SBDA 3SOPA 1P6XA 4Q02A 4XSGA 2RGDA 3NBZC 5P21A 2IUUA 1YZKA 3DZ8A 3P27A 3BOSA 3WRYC 5KUTA 4PSAA 3X1ZA 4PC3A 1CS4C 1JALA 4HYYA 5KTYA 1J99A 3HPRA 1BH2A 2A5JA 2F43A 3CR7A 1ONBA 5GJCA 2IYRA 5GVRA 1G8YA 3QI2A 3EASA 3HU2A 4GOJA 1SVLA 2YKGA 4W5HA 2QGNA 1L2TA 2HEIA 4U7DA 2ZUBA 3H2YA 2ZUCA 3QEJA 4RD0A 4WOPA 4CEJA 4LSGA 3HU3A 2RGGA 2OBMA 1S96A 1E4VA 4MH0R 1ESNA 1XPRA 1HQYE 4Q9HA 1CR2A 4TQAA 4KFUA 2IA5A 5FFMA 4FN5A 5J5CA 1XZPA 2QPTA 1OFUX 2NQ2C 4HDOB 5JS7A 3EWSA 2ANCA 5FUWA 1JAIA 3B1XA 1SULA 5A4JA 2PLFA 3PR1A 1OIVA 3S1AB 4R2HA 3GEIA 2J0QA 3EX7C 1ZM3A 3NXSA 4RZUA 1SVKA 3C14C 3IO5A 721PA 3QVVA 4RD2A 2VHTA 5KHOC 1NBME 5KPJA 1U0LA 4MGIR 1J8MF 4JIMA 3QKTA 4DLUA 3WNCA 4GMXA 4KVGA 3K9GA 2OFOA 5DIFA 1U0HC 3F3YA 3NIBA 3ZZTA 5TV2A 1K8RA 5IHPA 2C5LA 1XJCA 2G77B 3LW8A 3P26A 3AVVA 1U0JA 2FDCA 1N5JA 1ZUIA 1PJRA 2G0NA 3B78A 2WSSA 5KYKA 3BRWD 1X6VA 3CRVA 3EPHA 2HV8A 4OQLA 2RHDA 3LWNA 5FTMA 1G8GA 1NSFA 2IXEA 5FBQB 3CB4A 4WZAE 3SEAA 2ASEA 4PC1A 3VX4A 4EJSB 1N25A 4HDCA 3GLIE 3U3RA 2X2FA 1JXOA 1G21E 2CCGA 3H0KA 1W5TA 4JLVA 2O8EB 3HJNA 3Q5EA 4JT2A 3DO6A 2N42A 3QF4A 3T1QA 4G1UC 1ZD8A 4TTQA 3GEHA 1LS6A 2GKSA 3TLXA 1Q3HA 1DO0A 4OL0A 4C3ZA 2FFQA 1IN7A 3B85A 3KKOA 2QN6A 4CEHB 1RRCA 3TRFA 4ZI3A 4IEIA 4TTPA 3VKHA 3SC3A 3PV0A 2GZAA 3CLVA 3TKLA 1CXZA 1XEWY 5AR1A 1Q3TA 2RGCA 3RS2A 4ASUD 1NY6A 2OFXA 4YMVA 1JNYA 4BFWA 1FQJA 3VR5A 2YV5A 5KSOA 1RRFA 4FMCB 4LHXA 2PBRA 4IDPA 3CH5A 4ZKDA 1FL9A 2DFNA 3QVUA 2PT5A 4KFRA 3IDQA 1X3SA 4US2R 1X8LA 5J40A 2WJIA 4QRHA 1RYFA 1GL6A 2A5GA 4DB2A 3JVVA 1TAGA 4TYWA 3GJ8A 5JHGB 1NBMA 1DELA 5LBIA 1XMSA 2FSIA 1P7CA 4LCBA 5JJIA 1W47A 2G9NA 3K9NA 1E2EA 3LY5A 1NG1A 1F60A 2C9OA 1UEIA 3BIFA 1KO4A 2ZYVX 4M0LA 4KCGA 4LWZA 3RS4A 4M9ZA 3KKPA 1T8TA 4NCNA 4A15A 4JLBA 3WBJA 4DLTA 5KNDA 4URYR 2O8CB 1ZIPA 2HJVA 2IXGA 3Q5DA 4DT1B 1Z07A 4JZKA 4UNPA 3LX5A 2FGKA 1I4DD 2H8KA 3CNOA 3U44B 1TEXA 2IS4A 4RKFA 2AR7A 3AF1A 2IUTA 1E9RA 1MRSA 1KMHA 4HAXA 4N0DA 1JAHA 4F93B 3AM1A 1TQ4A 2FA9A 4LJAA 1UKEA 2IT1A 3BE4A 3QY0A 1R10A 1Z0AA 4MRVA 2JGNA 1S1MA 4LV8B 1Z83A 4D4KA 2WVJA 3SYNA 3Q9LA 3WMEA 4DLWA 4URWR 1SKYE 1SXJD 3PUXA 4M1YA 2WAXA 4GFDA 2RCNA 5FTKA 4L5BA 3ADKA 2FFHA 2ODBA 3W8RA 2ZSEA 1W0JD 4XVUA 3MFYA 1RC8A 2WWYA 4CEIA 1CJTC 1G6OA 2OFWA 2JASA 4HAWA 1A4RA 4LI0A 3SN6A 4UNNA 4W5JA 3EXAA 5CDFE 1H8ED 3B1WA 3QKRB 4KBGA 1F2TB 4PPFA 4PQYA 2H7VA 1EESA 4S2EA 3RWOA 1ESMA 2I3BA 2ZRPA 4EJSA 1L4YA 3N5CA 2CE7A 1WBBA 2FG5A 2OEPA 4TQ9A 4BEJA 4G5RA 1G8PA 2H17A 1TEVA 3NEJA 4PAOA 3K0AA 1GM5A 2XJ4A 3CONA 4H1VA 3EA0A 2AWNA 3BORA 1FUKA 4AYWA 1JEDA 1RKBA 5EUMA 2O8DA 3ZS9A 4KBFA 3U4QB 2QTFA 3L43A 1YVDA 2ANBA 3MMPA 2NO7A 4RJLA 1FTSA 2W6JD 2O8FB 2OM2A 1ZU5A 2QY9A 3TR0A 3GLFE 4DUGD 4RFSB 4PFSA 4Q4AA 4BPBA 3C8UA 2R8RA 3SJAA 4TYQA 3KXKA 1WQ1R 4PC2A 1ZNYA 3FOZA 3KUCA 1R6BX 1W46A 3A8TA 4RD1A 1I4TD 2E9SA 3NC1C 3ZVLA 5CITA 3TR5A 2VA8A 4IDQA 2GCOB 4M1KA 3R8FA 3ZD7A 4A2WA 3RC8A 2PMKA 4GRAA 4XTCS 5G3YA 1D5CA 4RFVA 2IWHA 2JATA 3I8XA 2CK3D 4DWJA 3R8CA 2DBYA 1EGAA 4F91B 1W4AA 3ZLJA 2ZI5A 4IXMA 3EPLA 5H70A 1GL9B 1T4GA 4JL8A 3FMOB 2C9CA 2BC9A 1BYIA 1VCOA 1W49A 2O8CA 2IK8A 2DFLA 2A5YB 3B6EA 4DIDA 2ZR7A 3CIOA 1AQYA 2DY1A 2ZIAA 3EA5A 4EPYA 3QE0A 1S1CA 4ZIRA 2W0SA 3MWJA 2O8BA 2V4ZA 2V7QD 1E9SA 2PCLA 1ZVQA 2TMKA 2ZR9A 3X1YA 4AURA 3LBHA 4RCYA 1BIFA 1DAIA 1P61B 1XCGB 4HDQB 3HYTA 5G53C 1AKYA 3B1YA 3AVTA 2Q3FA 3CRQA 3QXJA 1R2QA 2ZRHA 3ZIAA 3GJ7A 1AK2A 2VF7A 1D6JA 1OFHA 2F1RA 3BB4A 3C5CA 1YU9A 3U3JA 2JLYA 5KNCA 4WZBE 1E2QA 4IEEA 5CLLA 3UPUA 2VYFA 3CX8A 4A0RA 1VMAA 2QQ0A 1XB2A 3OIWA 4AG5A 3HU1A 2QE7D 1T5LA 2F9LA 4XWOA 1R4AA 2AXPA 2ZYWX 2C04A 1KKMA 5CIQA 2MSDB 4Y0VA 1KDOA 4HAVA 3EIQA 1F2UA 1G18A 2JLZA 1RYHA 3TGPA 3MG9A 5BN4A 1CULC 1NF3A 1ZD1A 3L8YA 1CR1A 1GKIA 2ZITA 5D3QA 5CB6A 2WSMA 2F1JA 1U94A 2GJKA 1P9RA 3EC1A 4FCWA 4BFSA 2QP3A 2R6AA 2XNDA 4EKDA 3B9PA 4OI1A 3GCGA 4V0LA 4A6XA 4L4UA 1P3JA 4P4SB 1OSNA 3S1AA 4BZQA 2LCFA 3AKCA 4EPXA 2H57A 1ZYUA 2RGNC 2FPMA 1WBDA 3NDBB 3P1JA 4KV9A 4OJKA 1T3HA 3A58B 4NDZA 5EZ5A 1IAQA 2J0UA 4URZR 1KZ7B 3MWYW 1E94E 2NTYC 2CE2X 2GJAA 3AF4A 4B3XA 1VCIA 4UNRA 5FTNA 3CW2A 5GADl 4L9WA 1R0ZA 3GLHB 3DZDA 4HAUA 4B34A 3DVLA 2FGJA 3UWOA 2O0JA 3SU8A 5AJVB 4DXAA 1P9WA 2QENA 2W6IA 2B7BA 3KQLA 3IPYA 3CWQA 2XTMA 3FMPB 4DZZA 1G4UR 1AKEA 2WIBA 2RGEA 4QNMA 5JWOA 1QG2A 3PUWA 1LF5A 1PLKA 3WHLA 4MRPA 5KSYA 2VSXA 3PFIA 1KY2A 2GETA 4EFMA 5EJEA 3GP8A 3PEVA 3RNLA 4LJ8A 3SJBA 5HKKD 2BM1A 2O8BB 1KI3A 1Z0FA 2WMNB 1G64A 1E1RD 1E1QD 2ZU0C 3PIRA 2ECKA 3OFND 3MD0A 4G3XA 4JVMA 4B3CA 2WWGA 3VQTA 1Z6XA 4HB2A 4EQ6A 3BWDD 4OI0A 2ZS7A 3RSLA 4II7A 2GESA 2ZRMA 1KJWA 4PZLA 1WB9A 1PV4A 3L82B 3VHLB 2YWGA 1NLYA 4Q9KA 2EW1A 4E5UA 1J8YF 5FUYA 4ZI2A 3AGPA 5CLQA 1IJEA 3LD9A 5KPDA 3AKDA 1AQUA 2P6NA 1A5TA 4DLYA 2IYWA 5ELXA 2R62A 1ZM4A 4PO8A 3M1IA 3K70B 2QBYA 2ZR0A 1S2MA 2R65A 4LYAA 2AFHE 5LB4A 1W2GA 1T0HB 1A7JA 4QC2A 1GILA 4DCTA 3SHWA 3VNVA 4KVAA 3PJRA 2QAGA 2DFTA 1HURA 1C9KA 2BEJA 3W3AA 1BOFA 1HE8B 121PA 3PUYA 3R7WA 3ND8A 3O8BA 4I1VA 4UNQA 3EZ9A 2QGZA 3BC1A 4UNSA 3K0CA 5AJYA 2JDID 1KI8A 1Z2AA 2OZEA 1UEJA 3GLHE 4LRWA 5FL7A 5EXXA 1XCMA 3BFKA 4NZYA 5CYPA 4LX0A 4N0EA 1IY2A 4ZCLA 1RW4A 4JKYA 4FWTA 4M1MA 2I4IA 5L3SB 4LYHA 2X8AA 5CM8B 1T0JB 2ZM5A 1DBSA 4MYTA 3NTUA 2B92A 3LA6A 4JLOA 3ADBA 1CJMA 4ZKEA 1DOAA 2CL7X 3QXHA 4B2LA 3REGA 4Q4JB 3NHBA 1A82A 2HF9A 1ZRHA 2ZI6A 2NOAA 4DCSA 1BMFD 2J0VA 1NJGA 4Q4JA 2DHRA 1YZUA 1IN5A 5CK5A 1N5KA 3KXLA 4LYFA 5DLQC 3SJZA 1N6OA 2ZS8A 4P3YA 3REFA 2FE4A 2CHGA 2Q9CA 2FZ4A 4O25A 4MRNA 4TL9A 2CLCX 2Z4SA 4Z8XA 1G7TA 1NVWQ 4DLVA 4F4JA 4MKIA 3AVYA 4KFSA 1II8A 1UKYA 3EWAA 5HR5A 3OAAA 4JT4A 2ODEA 4A0GA 4NYIR 1K6MA 4IJMA 4ARZA 4A9AA 3E70C 3P32A 4ZCIA 2VP5A 4M4SA 5BXQC 4NHOA 4MGKR 4IDNA 1CLUA 1LVGA 2ZRIA 1E2FA 2IUSA 4Q00A 5EXTA 1WMSA 3K0CC 3LFUA 2QZ4A 2J41A 4EPRA 2BKEA 1I4LD 2NO0A 3IBGA 3ZVNA 1WCV1 5DN6D 1XMVA 2ZVPX 3TQCA 2EWWA 2BBTA 3IHLA 2WTUA 1G4AE 4IFBA 2ZE8A 2J9RA 2GTPA 3FHTA 1IN4A 3AUXA 1ZUNB 2WICA 4QNRA 2QMEA 1OV4A 2FH5B 3OE7D 1G3RA 3ONWA 4PHTA 1GRQA 5DI9A 2G83A 1HT2E 1Z3IX 3EIHA 1XD2B 1GG2A 4PXAA 2OAP1 2QT1A 5FUVA 1S3SA 1X1RA 2REXB 4LBVA 4D0GA 1DPFA 4RFSA 2PH1A 2HT6A 2D4HA 4E09A 4LHWA 4AY2A 2FX3A 1NNEA 2D2FA 3ETLA 1KO1A 1UDXA 5DNYB 1Q44A 4V0NA 3RS0A 5HZKA 1LF0A 4C0HA 3GMTA 3FE2A 4ASUA 1LS1A 1S9DA 3LQRA 5EP2A 1ZM2A 2QPAA 1Q0UA 3W5IA 3I73A 4M1TA 1SHZA 2YVUA 1QF9A 3RSOA 1OW3B 2L0XA 1PLLA 2BMEA 2J45A 3U4QA 1R0XA 3MJRA 5E95A 4FXPA 4DLRA 5GVSA 4R9UC 1H65A 2O8FA 4KHZA 4B32A 3ZVMA 4FCTA 1VYVA 5KNBA 2W83A 2QMOA 4P4SA 3GJ6A 1CRPA 2ZYTX 2ZI9A 3NDPA 1NVVR 2FSFA 4H1UA 4ZV4A 3R20A 4AD8A 3I72A 1US8B 3U3KA 3UG6A 4BRUA 1MO4A 4V0ME 1GSIA 4EPWA 1W5SA 1WXQA 2IF2A 2IXFA 1E9DA 1G291 1Z28A 2GK6A 2V8OA 5FPHA 5FTJA 1KO5A 2AD5A 2BJVA 3NHAA 1N2CE 1LW7A 2H18A 3PEYA 4CYMA 3AF3A 4MRRA 1KNQA 1DG3A 1P60A 2Q9BA 4I1SA 2CCJA
chains in the Genus database with same CATH superfamily
5ELMA 4GU5A 3ZWNA 3IDAA 2ZSUA 5D84A 1M6NA 2QTCA 5HM6A 4CNQA 5E9AA 1KKLA 3V46A 1YS6A 1DCTA 2ZQ5A 3VJKA 2J7KA 4QFCA 4QBTA 1OXMA 3RJ5A 5FWYB 2ZUSA 3P2IA 2Z1NA 5IAKA 2JC3A 5KAPA 1QH9A 5T41A 2I6XA 3G0BA 4KNWA 5JXGA 2VBGA 1TMGE 2FZGA 3U13A 4GPAA 4KUGA 1DLJA 1II0A 5AI4A 1H0RA 5EY5B 3ICEA 2Z5FA 4C03A 3SIPA 1XAIA 2ZPAA 2HQ1A 4C4RA 4C0JA 4B3RB 3R5SA 1THZA 3GU3A 5KMGA 2CSUA 1K88A 2JFWA 3MCTA 3OF5A 1Y33E 1NV8A 3FSEA 3OAAD 4LGMA 3L7BA 1C1XB 4G5FA 4QTXA 1KI1A 4M7RA 4D41A 1SGWA 3BQ9A 4DJFC 4EHAA 2JA2A 4M1WA 2D2EA 1T9GS 2C03A 3LOQA 4GRDA 1L5GB 3FCCA 3NZEA 1KS2A 1IL0A 1NZFA 1WSBA 1JHYA 3OE4A 1GGHA 4M99A 4C2TA 2KBEA 2B4KA 3WYAA 4FFOA 1XJQA 2WAYA 5KWVA 1HT0A 4CKCA 3ZV4A 4X8LA 2PTHA 1E8NA 3HGTA 1ZNZA 2CBGA 4BO3A 3ZI0A 1UAAA 5AVQA 1K8XB 1GUZA 2VXYA 4WHMA 5EWLB 4QRIA 3ZTWA 2ALJA 1C30A 3WWEA 4EUFA 2C7QA 2WINI 4H16A 4P7BA 3WJ2A 3D6TB 3IMEA 7MDHA 4UUMA 1IDN1 4JVLA 3PQCA 2W6OA 4K6OA 1LB1B 4DRXB 1P45A 5AK5A 3VPCA 1RXEA 2JVIA 1UEXC 2WA1A 1G55A 4PHGA 4F8EA 1TMYA 3QLTA 1VGQA 4GI7A 2VJDA 3REOA 3BD9A 4EIWA 3LSTA 1NDQA 1EZZA 2DQKA 4G01B 4I50B 1DC8A 4LXXA 4KR7A 1K5HA 2AIRA 2O8DB 4QU0A 2QW1A 4YDRA 1CYDA 5TQJA 1F06A 3CNHA 2WF6A 1SOAA 3IAAA 5EI5A 2P65A 2YZNA 3R44A 3NORA 5H81A 4BBAA 3PE3A 2CBZA 1QP0A 4KLAA 1FU8A 2SKEA 1U2PA 1Q21A 4B6PA 16PKA 1AJEA 1NLFA 2OG1A 1CY7A 1QG4A 3TTWA 5HFAA 1IJFA 2EU8A 3AO0B 1SIUA 1R3UA 3K16A 1VG8A 1B1CA 3WMRA 5IJWA 4J3FA 1AUXA 1AVTA 4H08A 1K5PA 2NVUA 3NTVA 4L51A 1AGRA 1ZGHA 4BNHA 2J33A 3AVPA 3G5LA 1J2UA 5K8VA 2GERA 1OXKB 2I87A 4Q1BA 4LBWA 3JAKB 4YONB 4CVNA 1K7YA 1L7BA 2WSIA 2HHHB 1Q1BA 2PJZA 2YJZA 1US8A 1T0UA 5L3VA 1E62A 3ME5A 1NBHA 4KE9A 4EBBA 5C0OE 2P2ZA 4CIXA 3TWOA 1PKXA 2Q6OA 4GZLA 4PONA 4ARVA 3FI0A 4DQXA 1CKEA 1U7TA 1J8VA 1E1YA 3BH6A 3DW3X 4MLPA 3RIYA 2IXDA 3A1DA 2ID4A 2R4TA 3FPCA 3D6NB 5AHRA 3VOAA 3TX2A 1SELA 4CQMD 3LLSA 4PGGA 2P6UA 1Z6TA 3IUNA 5HCNA 1KJZA 4ISBA 3IPXA 1UBEA 4M37A 5J2UA 2KMLA 1G3QA 1P62B 4R51A 5A71A 3ZIDA 1YJXA 1Q16A 2FCAA 2IW3A 3GDWA 1FLAA 4PZCA 1CRWG 1FP1D 1ZQ1A 2H7CA 2A14A 2QI9C 4I1IA 3WGZA 1XZDA 2IDKA 2Z9BA 3G02A 2CXXA 4AZ0B 1PJCA 5JEEA 4O5OA 4K28A 3IP6A 4EGFA 1E99A 3GD7A 4O4HB 1M10A 4ZDWA 2EYQA 3K1AB 5ALYA 3RASA 1F3OA 5IAGA 1SG6A 2GBLC 3BD6A 4J9UE 5TQ0B 3LWZA 4PN7A 3WKEA 2Z04A 3ZQ4A 3E9NA 3HCBA 3VZPA 1YJQA 5CXQA 1HEUA 3WV5A 2DFDA 5F4ZA 1JQJC 1V4BA 5CNIA 4F2PA 3A4NA 3B13B 1M1YA 5AJUA 3HY6A 3CNEA 2OB1A 3STVA 3VKFA 4DMLA 2I76A 2GN2A 4OKSA 1RYDA 4M1OA 3K0SA 2IJGX 5A4IS 4WUTA 3L01A 4XX1A 3V9PA 3PUVA 1KK0A 3E7PA 3IUQA 2Q41A 3LPNA 1WUKS 4DM3A 5SZIA 4UU1A 3N2ZB 1CR0A 3HK2A 5EPEA 1C9MA 1BQ3A 1SA0B 5LWHA 5G0VA 1E8MA 2EIHA 3FTNA 4CV1A 1XZQA 1J9GA 1VB3A 4Q6BA 4H1TA 1I1HA 3N2KB 2CLIB 2DP4E 3S28A 1NJ8A 1N2HA 1FSSA 3CBQA 3P2EA 2R8XA 1P19A 1PJ3A 4REOA 1P72A 4XYGA 4XVQA 3DFFA 2ATCA 1NVKA 3LXMA 2FWJA 4F9GA 2EF0A 1XKLA 1HETA 3II6X 5BXYA 3BB3A 5LD2C 4AO8A 1MQAA 3GYBA 3JQFC 2Z2YA 2QRGA 1ZOOA 2P1DA 3KXIA 4UDXX 1OWNA 1YZLA 3UCXA 2WYOA 4WW0A 4UEJA 5FIUA 1Q74A 1ISPA 2X2EA 1E3WA 3M34A 4BWYA 2OQRA 5L3SA 3N2GA 1KDZA 1NN5A 3L07A 3EZLA 3RV3A 4WDRA 1GPKA 1CK4A 1X7YA 3OZDA 2ZAGA 3QLJA 4QUAA 1WVMA 3SZ3A 2HBQA 3A05A 2ZZKA 3H5VA 4HS9A 2OV6A 2YY5A 2G88A 4RDHA 3ZIUA 2PO5A 4CKEB 1QRSA 1R8SA 1R8JA 1E1KA 4IGIA 3H5WA 2PYZA 1EWYA 1KZGB 2C1XA 3CEJA 3DPUA 3FI9A 3IC5A 1YZFA 4G5OA 3ZJTA 1GFIA 1ELOA 2VCHA 1TMKA 5DXAA 2RI1A 4QARA 1G5RA 2VNIA 4TQUS 2FKAA 3BXEA 2C83A 3NHYA 1JKXA 1L5HA 1OIXA 2I6SA 2V6BA 1CUHA 2VPPA 3BH7A 2WOOA 4X54A 2IIVA 4IMPA 1A4UA 3IAS1 3HR8A 4N5HX 4UMFA 3I4CA 2ZE6A 1BE1A 2PZMA 4YDSA 2ACWA 2H1RA 3D4BA 2H4YA 3PIIA 3HJCA 5FPSA 1G41A 1JHDA 3L8EA 1VOTA 1WDMA 1XELA 4CLHA 5K3EA 3SZUA 2BV3A 1CP3A 3KVVA 3PSAA 2BHTA 5F5XA 5AOAA 4P5EA 3TFWA 3SX2A 1EQUA 1ZW1A 1WDTA 1H9CA 3GQBA 4X91A 2VH5R 3CVWA 2XMGA 2FEXA 3AERB 4C22A 1XNRB 1ZW6A 2VNSA 1P91A 3DE6X 4E88A 3HB4X 2YY6A 4BQQA 5B57C 1M5RA 3ZHOA 1ZY2A 2QL7A 4I2VA 5TMDA 1M1YE 3M6XA 4XQCA 4H7HA 2VP4A 1Z4IA 3GJ5A 1VFNA 1N8SA 5HG0A 2PVPA 4DA7A 3GZNB 3WLAA 2KJQA 3HBFA 2GNOA 2W8BA 2QAJA 4J7XA 2J30A 3J81k 2E4YA 1RZRD 1JR4A 4A2QA 1MNQA 2JEOA 4TXNA 1YIOA 1U0NA 2SNIE 3HO6A 5KOHB 2DR3A 2F3SA 2CXHA 2A5LA 3DDSA 3FDZA 2XSZA 1TUEA 4U0JA 4Z0TA 3W6NA 2OM6A 2XAAA 5FEUA 3O4GA 1N2SA 3ZZMA 3L6CA 5CDFA 5U4XA 3UT5A 5CFMA 4MLZA 4BMOB 2QSZA 5TARA 2WHPA 5FADA 5IAOA 3K73O 2GDJA 1KTVA 1QO7A 1RAGA 3EVAA 1U8ZA 3NJ4A 5KX5F 2FVXA 1PFGA 4D8XA 2P2SA 4FD2A 1JR3A 2OBBA 4U7HA 1ZZGA 2ZIFA 1RFLA 2CVQA 5FR2A 2AEJA 2ZBRA 1GZHB 5T4BA 5ICCA 3I32A 5LA6B 2J48A 1J70A 5GPBA 4R2JA 1K98A 3R6WA 3QXGA 4RABA 1U5BA 2PY6A 1V6SA 2WAOA 1MJNA 1X92A 3GEGA 3QFTA 1Y4AE 5L3ZA 1T8YA 2RH4A 3K6SA 3DT9A 3AK4A 5T6BA 3TAHA 5AM1A 5KIAA 1AUQA 5LOVF 1GA4A 3GUZA 4NC9A 5HA5A 4CI9A 5TDHA 4CQMB 5C7IO 4K7JA 2V6GA 2V8BA 4Z99A 2BWJA 2CC2A 3AIOA 5CFLA 3DMYA 2AOUA 3M6WA 2HA3A 1YL5A 1IWOA 3NHPA 5J43A 2ESRA 4UBIA 5F1PA 4JP2A 3W7VA 4C5CA 3DOCA 4YQFA 5I5EA 4NNJA 2GKGA 3SVLA 2WE8A 3GJ3A 3PE6A 3QP9A 4Z9BA 4K1XA 5DT9A 4CM3A 2N47A 5AXBA 3ROGA 5C80A 4RZQA 2PX0A 3QF4B 5CVEA 1E3TA 4DZTA 3R5XA 5AVWA 4REMA 2QLJA 3DFUA 4PLWA 1RPJA 4ITRC 4BNUA 5JUWA 3CH4B 3VV3A 4WXPA 1DIHA 3O8QB 4IX1A 1AH2A 3PX3A 3FMVA 3KQKA 3QVJA 1QORA 3OX4A 5G3ZA 3IR7A 2YZKA 1H9BA 4K0KB 4XSVA 1YS7A 3ORRA 1IEQA 1EVKA 3I39X 2QYOA 2AZTA 3IBSA 4YI5A 1NMYA 6REQA 5HIAA 5TLSA 2Q5JA 1QLWA 1UDCA 1QBKC 3F7NA 5CJJA 1HE2A 4HDKB 2ZUTA 5L9AA 1MJFA 1ZRSA 1EB9A 2VP3A 1DINA 3B5JA 3HFGA 3V7WA 4PWYA 1QHHB 3CEHA 1RRPA 3FYTA 4DV7B 3M1YA 1KJIA 1HYQA 2VH2A 3GDHA 2JIRA 2EW2A 2F7SA 1ZH2A 2F8MA 2Q5IA 3IJEB 4RLFA 4WECA 2Q4EA 1WMFA 3D5EA 3WMGA 4QECA 4JLAA 3UY4A 3E0XA 2R7MA 5AK3A 1EBBA 2M6LA 2A7QA 3OA2A 4HBZA 1QX3A 2EQBA 2O4UX 2OZVA 5EMMA 2HNBA 4QOIA 5AO9A 1ECLA 2GLUA 3C41J 2JAXA 2O2CA 1X87A 3SHTA 2N46A 5K0BA 1AHNA 4YWHA 3ETEA 3FOBA 3ITEA 3NEYA 4IIUA 2B30A 4XIIA 4A0QA 4F12A 4LRQA 3T4EA 4AJ2A 2C0CA 2CJYA 2W98A 4QXMA 5C4IA 3KUUA 1QYXA 2E3JA 2ODAA 5KZMB 4UOEA 3N74A 4H0FA 4ZPJA 2DSTA 5A3JA 2AR0A 3GLKA 5DTIA 1SXJC 2GF0A 1U2GA 1ZRMA 2WJPA 1GRVA 3VDNB 4B6JA 8ABPA 3IMKA 3ZV6A 1J2TA 4LYJA 1ONOA 2CFRA 4P98A 2HJHA 1DQSA 2JNWA 3A9RA 3NG1A 3T9BA 1SU7A 3AW8A 4MV4A 1YA4A 3H11A 3ROQA 4ACAA 4AS3A 1TC1A 4ZMBA 1E6EA 4UHCA 4MPPA 1UADA 4WZ6A 3S2ZA 2W2LD 3ER8A 5F2NA 3NUGA 4MW9A 4F9EA 1EFRA 1MMFB 3IEIA 4YY3B 3SYLA 2W2TA 4B4OA 3TRHA 2PMDA 2F8LA 2XNSA 4RF3A 4UM9D 2WWTA 3W6ZA 3X1WA 1V9SA 4TN1A 1SPXA 1Q20A 1AUOA 2XNHA 3ANTA 3MGCA 4YALA 3VU1A 4BNIA 4XD7A 3TJRA 4ZGBA 3H0CA 2QR5A 3TW8B 4L07A 3FTEA 1MCZA 3RKSA 3K9BA 2FN9A 4GI1A 2P5UA 221PA 3L4EA 1V41E 3PA6A 2IELA 4PQFA 1CRZA 3KOXA 4II3A 4MICA 4QOSA 1TAHA 3OLZA 1TO2E 4UAVA 4D9CA 1K8YB 2KSQA 3T5DA 1X8JA 2Z08A 3BJMA 2C8VA 5FA6A 5D2CA 2LWIA 2M9MA 3ZJ4A 2C20A 4IS3A 4N76A 1J25A 1GA1A 3E7WA 3QU9A 5H68A 3PDIA 4H9GA 4YRKA 5BSHA 3C8DA 2ZRFA 3T3NA 2B8EA 3W8DA 3LLMA 2Z6VA 1KEWA 4C3UA 1YCDA 1AGYA 1A72A 2GVDC 3CTMA 4ENWA 5CM9C 3UK0A 2Q8PA 3OPXA 4V0RA 4HH0A 1Q6ZA 3FJOA 3SIXA 2VDNB 2XADA 1FMFA 1DXHA 1HYGA 1M72A 3L02A 3OZGA 2PPVA 1EP1B 5FPTA 3RJZA 4BMVA 3T7IA 4BZPA 3A25A 1C1XA 3TNLA 2V7XA 4WESB 1DXQA 1L7PA 2VF4X 4Q1DA 3TM4A 2FI1A 1U7XA 2FUKA 4Y2QA 4GIBA 1JZQA 1KI7A 3W4JA 5JZOA 5ER9A 4KTTE 1RQRA 4NOKA 1R6XA 4D4HA 3WYFA 1DAHA 1XCJA 4W5NA 5FLKA 3KC2A 2Y6VA 1O6BA 4MV7A 4C89A 5LLDA 1CE8A 2RK6A 2VWQA 3D6HA 1F3LA 3GDGA 4MWEA 2B94A 2C98A 5LOVB 4IAOA 2IDMA 4FGZA 2IX3A 1LLDA 4GWLA 2L17A 3VSEA 3UJBA 4I50F 4BP9A 3LUFA 4DUGA 1DAMA 4V0OA 4ENPA 1Z33A 2P0EA 1GG5A 2BFBA 1NMEA 1G60A 1VRVA 2RC6A 2JD0A 2Z8YA 1QFZA 1HDEA 1LX6A 1U7OA 4OOFA 2AC7A 3DOFA 3LPCA 1QVAA 3VMFA 4GF5A 4G85A 2Y1DA 5CT4A 3BGOS 2PJRA 3H8SA 4ITVA 2HR1A 4MYUA 3R24A 1SUBA 3HCNA 2FUNB 3DOEA 1H2BA 4N3CA 5MN6A 4ZWNA 3H5TA 4L15A 4QULA 3WL6A 5HQ3A 1E5DA 1Y3IA 4GR5A 4D82A 2OCIA 3B1VA 3KWJA 1XOIA 4XARA 2R0QC 1FFAA 3PNKA 1R5JA 2P6RA 3F6BX 4YP1A 2QUZA 3UJDA 4MUHA 4D3SA 4ZJUA 1SNYA 1QQ6A 2I7TA 3O1LA 5HTOA 3LUHA 4CMBA 2VP6A 2MINA 2FPPA 3KQUA 3DD1A 2PSEA 2YJ5A 3U2QA 4HQNA 4WL0A 1QG0A 1M7GA 3ZOZA 1YNSA 2O1EA 4PPNA 1WUHS 3RW9A 5KYGA 4OUDA 1RIFA 1HDGO 1VJTA 3FRHA 3EVCA 5ALPA 1DC7A 3T41A 3OQIB 2IHBA 2WKPA 4LJLA 1D4AA 2QVGA 4DR7B 3SX0A 4JOSA 1TJYA 1T0IA 1XRSB 2JLSA 2NVOA 3A36A 3JQGA 2XUJA 4G5HA 4GBMA 4GI5A 1BQ4A 2MSKA 3OUUA 1SH7A 1A9XA 4W9MC 3U1TA 4KO4S 2BDTA 1G3IA 3BMCA 2ZUFA 3WL8A 2GD1O 4OHXA 3NWPA 1YZTA 5TT0A 5JQGF 1GEEA 1XTKA 1KYWA 4ARAA 4GPEA 3MT7A 2PRZA 1V7ZA 1FU7A 1N9GA 2ODNA 4JUDX 4L8GA 4RVSA 3VBEA 4CKBA 5BOSA 1Z56C 3F6EX 2ODPA 3NYRA 1M8KA 2ZBGA 1UXGA 2HM7A 1EM8A 3B20A 3PLRA 4B47A 2D06A 5HRAA 2P0YA 2PRYA 3HU5A 1YRLA 3AVQA 3BYZA 3BGIA 2KX7A 3AR4A 4MARA 4PX9A 1N2BA 3U6KA 4DCMA 1L4KA 3RK0A 5JBNA 1QRRA 2IH2A 3RVOA 3B1FA 4B74A 4RVGA 2QRVA 1H9AA 3EZ7A 2JIQA 3Q8LA 1YB7A 1Z17A 5E7MA 1EG2A 5AI5A 1IRIA 4CLDA 4XIJA 1IOLA 2P41A 1NNSA 1VE5A 4MQFB 4ONEA 5F5NA 2GBPA 4WXRA 1UBFA 3DV0A 3QY9A 5D6NA 3TX6A 1S4QA 3UV6A 1JWBB 1J24A 1NULA 4KXQA 3T38A 3N2IA 1XTRA 2V9CA 1Z7BA 4BVJA 5JWHA 3EMDA 1AF4A 1AOXA 5AHOA 3ZTTA 3IRVA 5BT8A 2UYHA 4KR3A 2ATIA 3NQ41 5JBIA 1Y7HA 3CYFA 1GFSA 3X0DA 3DLBA 3EDCA 3JSXA 2YS7A 2BHNA 3LMKA 1RYEA 4BNDB 2PKQP 1NG9A 4OJQA 3WGKA 2WP0A 2EW8A 1Y1RA 2XVAA 3CH7A 3DHNA 4OGWA 1PEKE 3D8UA 1N0WA 4S0XA 4WAUA 1ZKDA 3BZBA 2UUCB 2PUWA 3ZJVA 1K89A 5DHAA 3CZRA 2Z5LA 1TL7C 1GKLA 1XNHA 2XKKA 1YS1X 2QX9A 3TSAA 2JFVA 2ZYHA 5G0UA 3R7BA 3OSUA 5D8DA 1VL8A 4F92B 3I92A 4CUJA 5JDCC 3BGDA 4WTOA 3OLXA 4BC0A 3U17A 3HYSA 2FW7A 1NRIA 1OXVA 4JQZA 4UC0A 5A4FS 5CDGA 1VHLA 3QX9A 4Y6RA 1H2WA 3W05A 3BCSA 1NLZA 1X7YB 2NNWB 3IP5A 3NYQA 4B17A 2GUWA 2FQYA 1R8QA 2OV1A 3KJNA 4ZOLA 1AXRA 4OHPA 4AWAA 4A6PA 1CF2O 2W00A 5BORA 1JJAA 4ENVA 1D9XA 3NT4A 4ZRDA 1L7RA 1XYGA 3CN7A 3LYLA 1KI9A 3U7QB 2AHOA 2H5EA 4IWYA 4R8VA 4UREA 5BYKA 1DXYA 1N6NA 2WKSA 5K5EA 1WCIB 3CZQA 3LF1A 3AZQA 4GMKA 1NURA 2YHIA 3OZRA 1JVSA 3Q7EA 1J1UA 2ZPTX 5H9VA 3R3ZA 1PVVA 2AJDA 2IDZA 2X4GA 3VU9A 4AYXA 5AI0A 2C7PA 5K8UA 5ILGA 2K7ZA 4HDRB 1ODCA 5TXGA 4ID3A 1EAYA 1YBVA 4KYIB 4OXXA 2IEIA 3ZWQA 3WC4A 3O91A 5IXYA 2QLLA 4LRSB 1B16A 2N3ZA 2W6QA 2Z5GA 1P0FA 3MINB 3O47A 2VEDA 1RTTA 3CLTC 4G4SP 3UOGA 1FX1A 3CB2A 4R40A 4X3OA 1LI7A 3GAAA 3T34A 3GJZA 1EJ6A 3KSRA 4OHVA 5I3ZA 4CKWA 1XWWA 3QVOA 4DPKA 5L4LA 1LI5A 2WU3A 4MVJA 2F4VB 1LKZA 2HKIA 2G8LA 3UXYA 3GNLA 5HJ7A 1YH3A 3GJTA 2ZSJA 4GP9A 2WC1A 3DZJA 1PJLA 3QLEA 2PG3A 1W8IA 5G4KA 3HA5A 5LYJF 5EHXA 2VTVA 1T9KA 1HOTA 3G0GA 1UJ2A 1VZ2A 2OCYC 3HCCA 3CISA 3L7YA 4OHWA 5H8WA 1K68A 4WCVA 3A1NA 3BFXA 3EISA 3EFOB 2NU8A 1X2BA 2XTZA 4RL4A 5KSPA 3NKLA 3QJ5A 2W70A 4MEAA 5BWMA 1XZBA 1XDUA 2EHJA 4MQEB 3AY6A 3WGLA 3KHKA 3GFOA 3A9TA 5JLJA 1SEPA 1K7CA 2GEUA 3C39A 2I9KA 4FQ5A 3E5NA 3UW1A 4DR1B 1JLLA 2Z8XA 1XLTC 3KJEA 1XTIA 3M6UA 2WVAA 3TXYA 3A3KA 5C2JB 4EYGA 2DG2A 1RJFA 2LBPA 3RTBA 4YHHB 2GAJA 2P9FA 4RCZA 3ETCA 4B7UA 2IPXA 1W88B 3GJXC 3OTGA 2JFHA 1RQGA 4B5LA 2IZ7A 1NKTA 2PK3A 3FGNA 3OZ7A 1FLVA 1J2EA 1V0JA 2J9ZB 4LOAA 3FRIA 4EHLA 3OE7A 1ODFA 2PGDA 3IEKA 5LLTA 2FSUA 3C7KA 2XYVA 3WGVA 1SWWA 4C4SA 1D2MA 4YRLA 4R2IA 3G0OA 2B8TA 1N2ZA 3D9QX 2CFCA 4MVJE 2WLSA 4FSXA 4YT8A 1G7SA 1H05A 1XR3A 3I3SR 4LIPD 4B31A 1GSAA 5JCPA 4UAJA 1V1MA 1UP6A 2Z58A 1DX6A 2JI6A 3C7DB 3KDSE 3CX4A 4Q3EA 5CW2A 1UZMA 2EFGA 5ALJA 1XO1A 1VI2A 3DVRX 2Q1TA 4RY2A 4CIYA 4EX7A 3N2GB 1V1MB 4II2A 3R41A 2GD6A 4DDKA 3GI1A 1OZ0A 3UUFA 3ZCSA 4BO8A 3IRUA 4A2CA 5KVAA 2XODA 3MTJA 3QFSA 4IHJA 5ESRA 4CM4A 3N6RA 5AVJA 1I0IA 4CJXA 1BJRE 1QC5A 3R5HA 1LCIA 4K26A 4RJJA 4MAMA 3VR6A 3WGGA 5IJ9A 4A3SA 2KYRA 1KYIA 4GEKA 1WCYA 4FYKA 4ER5A 1SCAA 1UKAA 2Y77A 1KXZA 5FBWB 2OHFA 3WFJA 5TQ2A 1RP1A 3ZWPA 4F3NA 1TRKA 3LKVA 2VS1A 2H5LA 3EEYA 5DWDA 3CVUA 1D5WA 4FX2A 4I81A 4TVBA 1SKQA 4LRXA 2BD0A 3AEXA 1VRWA 1RD4A 1T3LA 5CB8A 4BKUA 2WQZA 1ZJYA 3SS7X 4D44A 5AKHA 4LE0A 1JX6A 5C7LO 5AM0A 3T7DA 3GFTA 3T0GA 3PT5A 4DLLA 3I1YA 4NJMB 4FBLA 2JA1A 5IBRA 1SHKA 1H6BA 1ZOLA 2B2XA 2PV7A 3MLBA 4LWOA 1V71A 1E6LA 3HFSA 3S2IA 4XYLA 1S9HA 5EGNA 3PITA 4RTRA 4XYMA 3B2EA 4ARIA 9ABPA 4KP7A 1K7EB 2VRCA 1N6PA 1WHSA 3P96A 3WQBA 5I9IA 3UBTA 1YJAA 2WD7B 4A27A 1T5BA 3GQBB 3IX7A 3Q0IA 1IN6A 2VJMA 3DM5A 1RQNA 4BZXA 2K6GA 2ES4A 3D02A 4Z1MA 5JIBA 4JYPA 3L6RA 4B76A 3OZAA 3W8FA 4ZARA 1JHOA 3UMSA 5AK4A 2H4ZA 3FTDA 4ZT3A 4HRVA 2HYIC 4JC8A 1Y9JA 3NBUA 4Z4IA 3Q3EA 3TIIA 4GS5A 2P6OA 1QK4A 3TSOA 1MV8A 1SUDA 3FKSA 4CEHA 1U3UA 3H1AA 4TWBA 4WN9A 1PD0A 5JJ5A 3CEMA 3Q7PA 4MJLA 1UJ4A 4MJ7A 4KQXA 3UKDA 2C00A 1ONNA 2HSEA 1XJWA 5DU2A 2HZBA 3KT0A 4I08A 3ZV3A 4GGPA 2GJ8A 4IFTA 4F5WA 4QJ3A 4JKOA 5BO5A 1KERA 2FYTA 2GBLA 3FMGA 2GZ3A 4KTVE 1KJ9A 2I4NA 1M6WA 1U3WA 3D2LA 3FDIA 5J9FA 1I3KA 1XU4A 4B33A 4CDGA 1RRVA 3UQYS 4LZAA 1SHJA 1K66A 4BRWA 3FWHA 1KK3A 3VUEA 1PI3A 5BNFA 3LUPA 2H06A 2ZYGA 1RQ7A 2IYPA 3GRRA 2P35A 3NHKA 3P19A 4Q1CA 4RMHA 3JATA 4DIEA 4PAMA 3DZIA 2JKVA 3GUVA 4PSVA 2R60A 1C1DA 3DL4A 4FYXA 1Z4NA 2XQKA 1V37A 4PW0A 1OX4A 2XUAA 1FB5A 2BFNA 3FCAA 3M1AA 4D4IA 1U6IA 1QZUA 3VYVA 1YDEA 2VPTA 4JI6B 3BKWA 4P86A 3G8AA 4PYLA 3CUVA 3NWOA 4N5DA 1R88A 5LYJB 2NVWA 2CY0A 1QGED 4WA7A 4YRIA 1DSSG 1MF7A 1TUIA 2YN4A 3ABZA 2H5IA 5CGZA 2WTAA 3TJZA 3TMKA 4AKTA 1BVHA 5B7GA 4TKUA 1ENPA 3E3MA 4BRZA 4BP1A 5EKTA 1T4DA 3F1KA 3MJFA 2WM9B 1GTVA 1E5VA 1QIHA 3HGQA 3N2KA 2JLQA 3ENZA 3A1WA 3PFBA 5IN4A 4JP8A 2G1KA 4XGNA 4F72A 4GDFA 2QTTA 4JR1A 3M5PA 3ZQUA 1R18A 4D4MA 2VUUA 4BMNA 3P9KA 4E07A 3ZXIA 4P3OA 3SZLA 4CIDA 2NU7B 2D6FA 1N2CA 1XQYA 3OOSA 2PZ8A 4CEJB 2ZIXA 4IXNA 1NW7A 5E0KB 2I71A 4AICA 3NASA 4A92A 2HA7A 1VLZA 2QJTA 4R9RA 2GXUA 1HNZB 4Q7QA 1MA0A 4QTUB 5JMOA 4U6SA 4CV0A 1DFGA 2GM9A 2AOUB 3C8HA 4JYMA 2D3TA 2GCPA 1OILA 2ZI3A 4PPGA 2DBRA 2MSEB 2VCYA 1T6ZA 3HSKA 3NBMA 2FWNA 1KYZA 2C2ZA 2OK7A 4KO8A 1GNRA 1HUQA 3OCYA 1OH7A 2PKRA 3K20A 3T1OA 1M2NA 4K6HA 3HCEA 1NVFA 1BX3A 1D9ZA 1NX9A 1VE6A 2CWDA 4XIYA 1E6UA 4G8DA 3PUJA 3L7JA 3RU9A 4DREA 2HT1A 5JD5A 2GFHA 4YC7A 4YCDA 2NLOA 2XTNA 1KDYA 4DLZA 3ELBA 2CHFA 4EFNA 5IJ0B 2J7PA 1KZYC 5KNDA 4H2DA 4FJ1A 4AZ3B 2A67A 3HI6A 4OYHA 3H5AA 2HQRA 5H02A 4FHCA 1DRJA 3PT9A 1OAOA 4DLPA 4PEVA 4F4FA 4Q18A 1DCKA 1JR3D 4GZ5A 5DGHA 3THXB 5KCMA 1P2SA 3L5OA 1HZZA 3E0QA 3PFFA 4WLUA 4DUYB 5LUAA 1IQ0A 2ZT7A 2ID9A 1NMXA 2V54A 3P9CA 3Q1KA 4AG3A 1AM4D 2FFAA 3HWSA 3BJZA 4YT4A 1EMDA 3HL0A 4FE4A 5DZSA 3NTRA 4YQZA 4EBFA 5JS8A 1VYTA 1RYYA 2FPXA 4B6FA 3LLUA 1B93A 3JQ9A 2ZUVA 3PZRA 2WK1A 4I1OA 1XDDA 2XVMA 5MN4A 3H11B 1E3DA 1OIWA 4DL9A 4ZHQA 2CNLA 4L08A 5DYIA 4AZ0A 3KQVA 1O5TA 2YYAA 1BAPA 1GTJ1 1MTZA 1Y1PA 1WMAA 2F1HA 5EKXA 4EPTA 1JMYA 1U7DA 3AG6A 4FUQA 2LGJA 2PIDA 3M8KA 2WKRA 4JUCA 4OLJA 2VJMB 3CJRA 2O7QA 3A4MA 3NC4A 5CJPA 5CT5A 5G40A 1UP4A 1E32A 2EZ4A 2IYSA 2BGJA 3BMOB 4XJSA 1W30A 5K0LA 3GIDA 3WBKA 1UT8A 2IOQA 3JR7A 4DJDC 4OL9A 2CV2A 1U28C 4X94A 1HDRA 4FJ2A 3DONA 3ZDEA 5LYYA 3TCXB 2YMPA 4RFLA 1ZCFA 4Q4AB 4QUDA 1L1QA 5IVIA 3AF6A 4FC7A 6NULA 3VAAA 1YBAA 1FFDA 2GCNA 2FMTA 3C43A 1TM3E 3GLGA 2PSFA 2QN2A 1RACA 1QIGA 4EATA 4AT1A 5CCXA 1WMEA 3HR7A 4B87A 1NQ5A 1XRRA 3OEHD 5CR9A 1UF9A 2IEYA 3OT4A 3PHCA 4C7VA 1XEWX 3MFQA 2H1LA 3OTQA 3TQSA 3ANMA 1D1SA 3NIWA 4PZYA 3GLFA 3LU1A 4IW3B 1FPMA 3OZEA 3WFZA 5KTRA 1AKTA 4B3BA 1PUJA 2VOJA 2ZJYA 3TTXA 2FEAA 5H3CA 2PZEA 4DR2B 4M1SA 2O2SA 1ONPA 3K9QO 1GDDA 3DKRA 1LD3A 3KSUA 4PBSA 4Q7JB 2JIZD 4RPLA 4IO0A 2XMBA 2WJGA 2C61A 3LGXA 1YOBA 4TV9B 2OYRA 5FBLB 4JMLA 5D7BA 4KDCA 1VZ3A 3EDQA 3X1KA 3F1LA 1UPTA 3O75A 3R3XA 4L2IA 1SXJB 4ESHA 2QRVB 4XCVA 4B1FA 2JBAA 1X7DA 5CVCA 3IIMA 1GFZA 4JQCA 1TF7A 3L0BA 4L16A 3S8YA 2HMSA 3Q8XB 3WXMA 4ZICA 5C53B 1SXPA 1G6Q1 2R6FA 3AP1A 2C5SA 3H5LA 3B8EA 2YV2A 1VMKA 1O94A 3PC2A 3QQ5A 4FGWA 2XZDA 3A1UA 5AIAA 1KDTA 4HH3C 3VDQA 4L5YA 1DO2A 1SCBA 4FWIB 1JZSA 2C4NA 2L19A 4MUYA 1DMSA 1ZU4A 2OILA 1IY1A 3AOGA 3IFSA 2BISA 3N8IA 4J0GA 2C8KA 3IDSA 4RUKA 4BGUA 1EFLA 4O4LB 1W6UA 3V1UA 4FOPA 2ZAYA 5EE9A 1SRRA 5ARCA 1L7OA 3TJMA 1T3TA 3FZQA 4HTFB 3CVXA 4MP3A 1QGUB 5FNVA 3WDSA 1XAHA 3OD1A 4LHVA 3Q8KA 2Q6IA 1PR0A 5K99A 2VYCA 1MXFA 3G8YA 4O0MA 5FOXA 1ZVVA 2Q1SA 2ZKLA 3NATA 4CMIB 3LAWA 4EY4A 3RVRA 1OV6A 1G7CA 2Q62A 5BY2A 1PAUA 1JDSA 1E3JA 3EIEA 4O4JA 3ESAA 1D0IA 3AVOA 1KC1A 1PG2A 2VNHA 1EWRA 1NYTA 2AG1A 1BMFA 2YFHA 3HRKA 1P29A 4K3VA 4MA0A 5THXA 5B53A 4B6RA 3QW2A 1EH5A 4IIDA 2AI1A 4D9KA 5K4GA 3B1JA 1JSXA 1O96B 4WASA 1EQ2A 2FWPA 2Q21A 3NHMA 1TCAA 1TUBB 3D8NA 4NBTA 3WNVA 3M81A 4O63O 3RUIA 1Z6YA 1DWQA 1RI5A 5GJWC 4OV6B 1E92A 3H1TA 5FP0A 1AX9A 1ZC3A 4FBMA 1QTRA 3VDMA 4TYYA 5DHFA 5KAMA 4B3FX 1P44A 4CLXA 2QU7A 1QO9A 3RG2A 5BVGB 3BWXA 3RARA 4B44A 1CR4A 2HZ7A 3THXA 1BRTA 2VAWA 4PYNA 1YBHA 1AU9A 3HCOA 5E0OA 5L8VA 4U8HA 1IZ0A 4BQEA 1U3DA 2NP6A 4R2MA 4JI0B 2YIVX 3ON5A 4HBGA 1VIYA 3DL0A 1JIIA 2JFYA 3LO8A 1JEOA 2RGUA 4Z51A 1OYWA 5AVOA 5KYNA 1D8AA 3EXEB 4XWAA 3AILA 1JKJA 5CH5A 3ZDAA 1FYWA 2OR3A 2HQBA 1V5EA 2C97A 2X1VA 3N76A 2WFLA 3PX2A 1U1FA 2AE1A 3P2JA 1YR7A 4FFVA 4NYMQ 5EP1A 4C6TA 2J5BA 4M22A 1SU4A 2J9FB 3ICQB 4O0LA 1NMZA 2IYZA 5FCDA 2BBSA 4M46A 4ZZ1A 4DJEC 2FJUA 2H31A 2YFKA 3LG2A 1PR3A 2EGUA 4ZREA 3WYBA 3FFTA 1OYYA 4HH1A 5EFOA 3L2OB 4E03A 1VDZA 1SKYB 2FPRA 2P78A 4JODA 5G4KB 3NDIA 3LTNC 4JI7B 1UBCA 5C7OO 2F3QA 3ZGZA 1Y9AA 2Q6TA 3K8ZA 3QOWA 1OH6A 1XN4A 2FPWA 4MYCA 4R2WA 2EGGA 3D6UA 1EA7A 4HRYA 1OAKA 3DT6A 4FNGA 4GXTA 1VECA 4YHBA 2REBA 3EXFB 1X1TA 5FA8A 4OO3A 2UZ3A 3DC7A 2QWXA 4KSYA 1FRVA 1K7FB 2R97A 4W7IA 2SCUA 1R0WA 4XVRA 1WXFA 2J5XA 2H92A 3I45A 4CF4A 5C18A 2V9PA 2H1FA 2XMSA 3DDCA 3TH5A 4RKEA 3U1VA 3TQRA 3FM9A 3MPOA 4QDUA 2XOKA 5FO1A 1VI5A 2W22A 5KJ6A 3UHOA 5KVSA 5TC4A 5CRIA 2JLWA 1UQRA 3OLVA 3S0JA 5GV7A 5B6PA 2WUGA 1PR4A 1S2IA 1U0SY 1GRRA 1XZKA 1NVXQ 2QDXA 1K9VF 2Z3VA 4GNRA 4PCUA 5ALOA 4W5TA 1UK7A 1CY2A 2C84A 2JBHA 4P32A 4DDWA 3F9IA 5ALVA 1UJCA 3L8ZA 1C81A 4L6AA 2MT9A 3NOOA 4XGQA 1TF2A 4YLGA 3F4KA 1YQ9A 2E4ZA 1UWLA 3AMVA 2NXWA 1X77A 2Q45A 2XWPA 1ENYA 2JVJA 3DV0B 3AP3A 4FBGA 4OATA 1G2PA 4KE7A 4PAGA 4QBHA 1MOSA 2RBKA 1WETA 1TM7E 5TVGA 2PUDA 4FDAA 3I62A 4RZ3A 1BFKA 4TYMA 1ATZA 5CG2A 1DV1A 4Y2VA 3UANA 5J47A 3DTVA 2XB6A 3O4RA 1HZZC 4GBJA 1HYEA 1YQTA 3BVPA 5CT8A 4D92A 1XTTA 5TMPA 3PNPA 4P8RA 2A5FA 5E9QA 3EPRA 5JJCA 3L9WA 3D6MA