4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
4JVSB 1E1RD 1U98A 1WB9A 1D2NA 2CHVA 1UBGA 3EZ7A 1DARA 4QGHA 4HLUA 2W6JA 3QKSA 1U99A 3TSOA 5KNCA 1VYVA 1Z22A 2ZRDA 2ECKA 3L8YA 2MMCA 4YXWD 1C1YA 3TQCA 2A5GA 2ASEA 1M1YE 2QP4A 1KY2A 3FMIA 1S96A 1ZNZA 2H92A 2ZRAA 3G82C 4NYIR 5A4JA 1Q3HA 2QMOA 4U5XA 1W36C 5FBVB 3QI2A 2LCFA 2RGNC 4Q9JA 1N2CE 4KSCA 1DG3A 2O5VA 2QQEA 4RCZA 2DFTA 1D8TA 4QOSA 3C4JA 3IHLA 5FFMA 1XCPA 3H0KA 4Q1AA 3KUDA 1VCNA 2JLWA 2X77A 2ZETA 2XTMA 3BAFA 3P1JA 4ESVA 4F91B 3U6BA 3LDAA 4K81B 2HCJB 2IUTA 1PLLA 4V0OA 3QIAA 2ZR7A 5DNYB 3SN6A 4BFUA 3SI7A 1K5DA 1XEXA 4UJ3A 3P4XA 1IAQA 2RMKA 2OAQ1 4M53A 3JZAA 3K0FA 4WZAE 1Q1BA 4QC2A 1ESNA 1MKYA 1GNPA 5KHOC 3M4YA 4Q4AA 3CPHA 5KSYA 2RGDA 1KDRA 2FSGA 1JI0A 3Q8XB 4YC7A 3WYAA 4EPYA 3B9QA 2B8WA 2JJ8A 4ZDJA 2VF7A 1XPOA 3QPVA 1SHZA 2R6AA 2QEQA 4Q03A 5K8LA 2YC4C 3K70D 2O8DA 4QG7A 3CR7A 4I4LA 1XD8A 5FL7A 2ZSDA 1IN4A 5CB8A 1OH6A 4QJ3A 3AP2A 4Q4JB 1F48A 3CRW1 5IHPA 5JECA 4B47A 2FJUA 3X1WA 3CZQA 4WXPA 3OE7A 3SR0A 4F38A 4JVNA 2GAOA 4V0MA 4WOPA 3U44B 1II8A 4QBFA 4D4JA 3NDBB 3CF0A 3K09A 2FFQA 1TF7A 2FSHA 3TAHA 3QG5A 1VIAA 4RKFA 1HQYE 4AYTA 2ODNA 1HV8A 4Q1CA 4QNRA 3U7GA 1VCOA 4KU4A 4IOLA 3EIQA 3PUXA 2QP9X 4A36A 1S3SA 4I1OA 2PT7A 4KSBA 4Z54A 1T8TA 5JJLA 2NTYC 1SHKA 3SNHA 1GL9B 3E70C 2JLVA 4DCVA 3FTQA 4NYJQ 1E94E 1NY6A 2FF7A 2ZVQX 5GJWC 3GLFB 3ZQ6A 3OEEA 2ZRJA 5BW8A 4A9AA 3TR0A 4H1UA 5CLLA 4DLXA 3IUYA 1DOAA 2FFHA 2H57A 3AVQA 2OBNA 4RZ2A 3ZVMA 1EFHA 2AK2A 2NO9A 1DO2A 2NGRA 4DLVA 1T5IA 3EWSA 1W49A 2HT6A 3AB3A 1QHNA 4NMMA 4DLRA 3IPYA 3JVUA 1P2VA 2EWVA 3CNOA 1J8MF 1Z6AA 2CE7A 4Q1FA 5DSZA 2VP5A 5H70A 2CLSA 4B2IA 3VR2A 2CDNA 5FPHA 4TL8A 3QENA 3K70C 4US2R 1LTQA 4PTLA 2C99A 1E79A 4HAZA 5JEEA 3HPQA 5EQTA 2OT3B 3HU2A 2ZJBA 4LJ5A 3IO3A 2PJZA 1WBBA 3Q7PA 1M6NA 2QPOA 4JLVA 4IOMA 2V3CC 1A7JA 2WMNB 2QP3A 1KIMA 1EESA 2WJIA 1JNYA 3ZZUA 2XXAB 3FPAA 3MAAC 4B44A 2VHCA 4HUQA 3TUIC 2W58A 2GEDA 3T1TA 3KXLA 4QHYA 3UMRA 4M4SA 2GILA 1E2QA 3AH8A 3SYKA 4XH9B 1R5NA 1ZM3A 1GITA 2O8BA 3EA5A 3EPJA 4AKEA 3AVPA 1HH4A 1P62B 1MO6A 3NTUA 1KI7A 4D81A 5KNBA 1IONA 1KDPA 2ZITA 3QKSB 3FGNA 3LW8A 1MOZA 1J90A 1C4OA 1EFUA 2P3SA 3TE6A 4M1YA 1HQCA 2CHQA 1COWD 1UADA 3HR7A 4TMWA 4QHTA 1P9NA 5H1YA 2ZI5A 2W2XA 3THWB 1LFDB 3KB2A 4R7ZA 4EQ6A 5AJVB 3WHKA 1ZINA 3AVOA 4D0NA 4X8OA 2CVFA 1RPZA 5FL3A 3UK6A 1VDZA 5E3HA 1Q1QA 4XSGA 3W6NA 4MUBA 3BC1A 5KSZA 1FZQA 2J3EA 5CK4A 4LC0A 4B2LA 4GL2A 2JAQA 1AQUA 3WYGA 4G01B 4B76A 2YC2C 4PSVA 2DBYA 1SGWA 1XCMA 1OLOA 2P6NA 2BM0A 2ZRFA 3SFZA 3TK1A 1F5NA 2GBLA 2E9SA 1X3SA 2WPDD 1P2SA 4TMKA 1IJEA 1ETUA 1LVGA 4LYAA 2AD1A 4LPSA 5E7MA 5L3RA 5C4GB 1ZC4A 2GXSA 4LV6A 3K0FB 4QBIA 3TIFA 1E0JA 2F43A 2IYRA 4Q4AB 2Q0HA 2QA5A 1YZNA 1I4TD 4JYBA 3X2SA 1XU4A 4GT1A 3GQBA 1DAHA 3IO5A 1YR6A 1ONBA 1Z0IA 5DI3A 3IIKA 3OESA 3RWOA 1CS4C 2D2FA 2KI5A 4OI4A 1GL6A 4D4LA 3P4YA 3L43A 1NL3A 4G5SA 2WWIA 2JLYA 2Z4SA 4LYHA 4FMCF 3L2OB 2ZUDA 1W4RA 2YYZA 4LY6A 1KTVA 5LBIA 3T61A 2A30A 4M8NE 2OFWA 1MV5A 5J4KA 3B7GA 1ZP6A 5JLJA 1G8FA 4US0R 2W6IA 1II8B 1M7HA 2XZPA 2IA5A 3O8CA 1ZM4A 2LKDA 4AURA 4DRZA 5JS7A 2QG6A 4NONA 1F60A 1KHTA 1Z08A 5KDLA 3KJHA 4P4UA 2PBRA 2CCJA 2QBYA 1Z6XA 3T1VA 4CYMA 3T5DA 2VPPA 2P5TB 3B78A 3CUEF 2O0KA 3QXJA 4POAA 2PH1A 4G1UC 2RGXA 2PZEA 3NEYA 4LHWA 1XD9A 2KWIA 4TQAA 5JWRA 5DHFA 3EPLA 2QAGA 2GVDC 4KBGA 5FBLB 3QSYA 2CL0X 2ZSEA 3R9IA 1SXJE 2ZU6A 4NYIQ 2J5XA 4QNMA 1U0LA 1OSNA 1LB1B 1N5IA 2J9RA 3Q5EA 2ERXA 5J4YA 3VFDA 1KI2A 4KJZA 5HE8A 4DC9A 1E9AA 2HT1A 4DB4A 5HKKD 5DN6A 4CW7A 1NG1A 1Z83A 2GJ8A 5F2EA 4PHGA 3CKLA 2KE5A 1KMHA 5EP2A 3VNVA 3RVBA 1ZD8A 1M7GA 3M6AA 4QGAA 1JQJC 4MDFA 3A1WA 2XGJA 2D62A 4JJZA 4EFLA 1JALA 3CRVA 5JHGB 1BYIA 3KKQA 5FOVA 1E2MA 3RS3A 1G291 1R5OA 4BUJA 4UNSA 1OXVA 1IN6A 4NYMQ 2IYLD 4FMDF 3VHLB 2UVQA 2EVWX 1XTIA 4B32A 1G7CA 3ZJYA 1S8FA 3QY0A 2QTVB 2JDIA 1W0KA 3RC3A 3FKSA 4BFYA 1DADA 4TTQA 3ZS8A 3GLGE 4M22A 4HLCA 3I8XA 4KI0A 1XXHE 4KFUA 5CJPA 1IJFA 1JEDA 4L4UA 3K0CC 4BLSA 1FP6A 2G77B 2IYYA 2J59A 2V6IA 2YKGA 2O8BB 2DFNA 2R6GA 2Y8EA 3K8YA 3LXRA 2AWNA 2WJVA 4QBHA 3B1ZA 4JLPA 4LJYA 3WMEA 3U3RA 2XZOA 1ZCAA 2JLZA 3NBYC 1T0JB 2ZS9A 2FWRA 5TDHA 4EKDA 4QFMA 5FPKA 4BFWA 1EFRA 3GMTA 5FI1B 1ZUNB 3HU1A 2CHGA 2O8EA 3B85A 1HE8B 4EQ6B 3ICQB 2L0XA 1P6XA 3KKNA 4LZZA 1ZVQA 1NKTA 3T1QA 1AZTA 1JJVA 1W1WA 2QY9A 1FTNA 3K0AA 4OJQA 5CIWA 3TSWA 4D80A 4D26A 2W6JD 1KO5A 2OCPA 4Q01A 221PA 4TLCA 4EIWA 3AUYA 4R9UC 3R8CA 4HZUA 3W3AA 1KO7A 1M34E 4JLJA 4GDFA 1L7VC 2R44A 5EP1A 2K5UA 4OQFA 4II7A 1ZNXA 2IBMA 4JYCA 1TUIA 2DB3A 3QG1A 5C4MA 2EYQA 1H65A 2ZYWX 4TLAA 3U4QA 4ACAA 4DDTA 4Q4LA 3LVQE 3AM1A 2GEUA 4P32A 3KKOA 1R0XA 4N3NA 2F43B 5DE3A 4B3GA 2WWYA 1KNXA 1PUIA 2G1JA 3RABA 2R6DA 1NMZA 1TF2A 2ATXA 3ADCA 4FD2A 1XEWX 1ZD9A 4X8LA 4XTCS 3T1OA 4C3ZA 3NBFA 1EG7A 5DI3B 5B30A 4XD7A 5B58C 1NIPA 1HA3A 2C03A 2N46A 2ZS8A 2NZ8A 4C4PA 1NN1A 2ZYVX 3ADDA 1IY0A 4ZDWA 3DHWC 4TT3A 1P2TA 3GP8A 1G3MA 2HJGA 2OZEA 4L5BA 2C2HA 3F5FA 1JR6A 1ZJ6A 3U7FB 3ZLJA 1BO6A 1NVVR 4XIGS 4DB2A 1QBKC 4HLQB 1CJKC 4GPTA 4BECA 1DPFA 1GFIA 3HU3A 4U00A 4DVGA 1XJQA 3VQTA 5FOSA 4QXAA 4HEJA 4DSOA 2HF8A 4HLUC 3EPKA 2N1BA 1P9RA 5FL7D 3AUXA 1RIFA 3B13B 5CYOA 2PMKA 5AJXA 3QKUA 3W5JA 2UZ3A 3EC1A 1TUEA 3RNLA 4DSNA 1OFTA 1VYUA 3K0EA 4JVMA 2QAGB 2AHOA 3OE7D 2OO7A 5G3ZA 1B0UA 4DDWA 3KJEA 5IF9A 3GJ8A 1S2MA 3DM5A 2DR3A 4QM6A 4TL6A 5J4VA 4URYR 2GHIA 2X2FA 3D6TB 2CL6X 3K1JA 4PX9A 1OH5A 2WOJA 4HDQB 2BBOA 2X19A 4LCBA 1FP7A 4A15A 3LFUA 2GK7A 3LO5A 1GAJA 1NI3A 2XTNA 1G7TA 2J7PA 1D5CA 2WOOA 4GP6A 4OI0A 3A36A 1KMHB 1Z06A 4QGFA 1KY3A 2FOLA 2CJWB 2W2TA 1G8YA 4YMTA 121PA 2V4ZA 1L4UA 2PEZA 2AK3A 1MRSA 2FFBA 3UMFA 4C0JA 1QHHA 3OEED 2PLRA 5AUPB 5GVRA 1II0A 2QTHA 2CCGA 4TYQA 1HURA 2TMKA 4DLTA 1E99A 1N6NA 2AX4A 4JBXA 3AF4A 1U9IA 1Z0FA 2HYIC 2EQBA 3R9XA 3J81k 3GJ0A 3ND9A 3WP1B 2P65A 1KDOA 4IKEA 4QHSA 5EP4A 4LYJA 4HB3A 1E79D 1T91A 4K8OA 5G41A 1E3MA 3SC3A 3UKDA 3LA6A 4BLOA 2O8CA 2QQ0A 4C0SA 4L9WA 4PQRA 2QT1A 4B34A 4JS0A 1AN0A 2IL1A 1G7SA 5GJVC 1KJYA 1D2MA 3GD7A 5B57C 3TR5A 1G5TA 1N25A 5GVSA 3DKPA 2G1KA 1UF9A 1NRJB 4PPQA 5L3SA 3K09C 1J7KA 3PEYA 2X8AA 1TPZA 5FI0B 2ZRBA 1S0UA 5H8WA 1J8YF 4R2HA 5FUXA 4YMUA 1E0SA 1XTKA 1XTRA 2ZXUA 1RRGA 2O8EB 2BDTA 2QORA 3CX8A 2EFDB 1OYYA 4O25A 2CLDX 5FPSA 4ZKDA 1ZM2A 2ZR9A 3K0AB 1SQ5A 2ZE5A 4QRHA 2C95A 2B21A 4W5JA 4F4JA 4DEYA 2I1VB 1D9XA 3DVLA 4A2QA 1XEWY 4NTZA 1YE8A 2IYZA 2DYKA 4MH0R 4HZUB 2VIIA 4TSFA 4MKIA 3UXMA 1SVOA 1Z6TA 2HCBA 3C14C 4YMVA 2F9MA 3RRNA 1X6VA 4AG5A 4HAXA 4TMVA 3F0TA 3QBTA 1P72A 3I62A 4D25A 2ZR0A 3SHWA 4DLSA 1OH7A 3U4QB 2A9KA 2IEZA 5EZ5A 3AGQA 4DCUA 1N6PA 2VHUA 4M9SA 4HLDA 4WVFA 1GSIA 1R10A 4ZCLA 4C30A 5BXQC 2OAP1 5E7JA 1KI6A 1KO8A 3MCAA 3O8DA 5KUTA 1DAGA 2C5LA 1GNQA 2A7QA 5EE3A 3SBDA 3NH6A 3SU8A 2ODEA 1IN8A 2JLQA 1W4CA 3KQHA 4B3DA 4I1SA 3FFAA 4ZO4A 1VG8A 4HDCA 3T34A 1KO1A 4HB2A 3FHCB 3HR8A 3WP0A 1ZC3A 5KO2A 4HATA 4EJSA 1ZRHA 4TTPA 4NDZA 4DIDA 3CNLA 2W2VA 4ASUA 2J87A 4P4TA 5AJYA 3QJYA 3N5CA 1JPNA 4BEBA 1SVSA 4E5UA 1EGAA 3WNCA 2GJSA 3A4MA 2CEAA 1CF4A 4DLUA 1X1RA 4AYWA 1XX6A 3FMFA 3IDQA 4P4SA 4A0GA 3M0EA 1TX4B 2ZSAA 4NBSA 1UM8A 4U02A 4BZPA 4Q4HA 1NVUQ 3ECCA 4NCIA 5L3QB 2HLDA 4I99A 4E09A 1YVDA 2ZE7A 2RKOA 3FFBA 2W6ID 3PUVA 1VG9B 1DAEA 1J99A 2G9NA 4G5RA 1U2RA 4MGKR 1IOZA 1K8RA 4DJTA 1C9KA 5HZHA 4B43A 1R0ZA 2BEKA 2J0SA 1E9CA 1RYHA 1XPUA 4HAYA 3PUWA 2SHKA 3NXSA 4LV5B 3LWNA 4PPFA 4FCTA 1Z47A 4PAMA 2ERYA 2CK3A 1YJ5A 3UPUA 2H5EA 3U3MA 5JWOA 1T3LA 2QRZA 1PLKA 4GNKA 1EX6A 1N6HA 2G83A 4A8JA 3DOFA 4JKYA 3BE4A 1QHHB 2V7QA 3TJZA 1CR1A 4I1UA 1N6KA 3LW7A 3HP1A 4DHEA 5JRZA 1OFIA 1Q44A 5BYJA 1N0VC 1KAGA 5DN6D 4FCWA 2Q9CA 1U94A 1GL7A 3M1IA 1Z6YA 2EW1A 1QHYA 2BM1A 4LJ6A 2FPKA 4LHVA 4NYMR 1US8A 2B92A 2C9OA 3AGPA 5CLQA 3G5UA 5EP3A 3TVTA 5KDDA 4LV8B 1UAAA 2HYDA 4TMXA 5JHHB 2O8CB 3REFA 2ZVPX 1HE1C 1Z6GA 3FHOA 4ON9A 5FTLA 3T06B 1XBTA 4IFBA 3EWAA 4V02A 3R7WA 3SQWA 1VCIA 1YKSA 1E2EA 1UKVY 2JDID 1W0KD 5GJCA 2J0QA 1UBCA 4L15A 2EWWA 3FKSD 1NVVQ 4FMCB 2XB4A 3U2QA 5TMPA 1G3RA 1TU4A 1CR0A 1W46A 3RLFA 4LJAA 3W5IA 4DXAA 1XD2A 2DWPA 4KITB 3U60B 2H8KA 3EIEA 4UXJA 5F3WB 4D82A 1E2HA 4Q02A 4XJXA 1I4LD 3CPEA 3UMSA 1XTQA 1AS2A 1W5TA 2GTPA 2UZIR 3KJIA 4I81A 1RC8A 1TL7C 2IYXA 1H8EA 2QNRA 2QAGC 4XSHA 1NLFA 3PUZA 1S9HA 2GWHA 1FX0A 1NP6A 2FZLA 2OLJA 3IEVA 4Q18A 3RS5A 3U3OA 4PC1A 4RJLA 4RY2A 4B74A 1EFRD 1M8PA 2OSBA 2NG1A 3B1WA 3MMPA 1G64A 2NMVA 2JEOA 2CBZA 4CF7A 4C2TA 1W2GA 3RANA 1BYUA 2C8VA 2CMKA 1NN5A 5C18A 2V55B 4Q7JB 1RKBA 2PZGA 5JS8A 2ZANA 2IUSA 4FIDA 2Q6TA 2I1QA 3TKLA 2HUPA 4QKQA 2FX3A 3I4LA 1MO5A 1ZW6A 4P33A 2V54A 3CF6R 1KI6B 2OILA 5J5CA 1X8LA 3E2IA 2E87A 3ETLA 3CB4A 4OKSA 5CK5A 1T3HA 2FFAA 4GRAA 2EU8A 4DWJA 4MA4A 5F98A 1JQLB 4JBYA 3CH4B 4M1WA 5FTJA 4WZ6A 3T35A 3VR3A 4AG6A 4A4DA 3FHTA 3H4MA 5EUQB 2XSZA 3PCRB 4A0RA 4C2UA 3WRXC 2RB4A 3OF5A 4NCJA 4O2LA 1DBSA 4OHZA 4D6PA 2GCPA 4MKFA 1Q57A 4FMDB 5KPDA 2WHXA 3RS2A 4EJSB 3BFXA 5F9HA 3DDCA 2Q21A 2JGNA 4JL6A 5C2JB 4YMWA 5A5GA 1OIXA 2ZIAA 1E9EA 1XDBA 3NC0C 3SE0A 2LKCA 2QPTA 1CJVC 4L16A 3TLXA 4XD7D 5KYKA 3MJHA 4NL4H 4DSTA 4ZDIA 1CR2A 1RJ9A 3B8HA 2PCLA 3K53A 1FTSA 1G19A 4P4SB 2BV3A 4TT3D 4DLWA 4CT4B 1EK0A 2XITA 1N5KA 1QDEA 4Q4HB 1OHHA 2GA8A 3Q9LA 3BFVA 4C9BA 3I61A 1QF9A 1E4VA 1S1CA 3QF7A 2ZAMA 3TW8B 1NVXQ 3KB1A 3BERA 3ZDQA 1LS1A 5TB5A 3PITA 2B8TA 3TVDA 1NSFA 4KAXA 5JJIA 2YNMA 2RH5A 5IRCD 1XTJA 3LBIA 5DH9A 3B60A 2ZI6A 5CJ2A 4BASA 4PFSA 3QUSA 1SXJA 3AKCA 4Q47A 2AWOA 2ZI9A 1VIYA 2FG5A 2ATVA 3WXMA 2KSQA 1IY2A 2QE7A 5K8UA 2YWGA 1EWRA 1NVWQ 1LS6A 1P7CA 1KI1A 3PFIA 2VP0A 4A8JB 4HAWA 4F92B 1NBMA 4ZDKA 1T5LA 2AFIE 3B9PA 2IK8A 1OJLA 1XP8A 1AIPA 4NCKA 1RW4A 1HUQA 4LI0A 1G5PA 4Q48A 4AKHA 5IT5A 4LC1A 2WZQA 3EZFA 2MSEB 2IF2A 4RD6A 1YR8A 4OI2A 1I4DD 2JCSA 1Q3TA 3Q85A 2ZI7A 1T6NA 1WF3A 5KSOA 5JFGA 2J7PD 1TEXA 3AVUA 1Z29A 2A5DA 2X1VA 2MSCB 3SJZA 2VO1A 3MD0A 2F1IA 5FOWA 3C5HA 3IBGA 1US8B 1Z2CA 1XEXB 4HAVA 3WRYC 4AD8A 2AD5A 2ZRCA 2GEVA 2ORWA 4TTRA 3B2EA 4A82A 4E22A 4Q5IA 4MGIR 3FE2A 4IVRA 4MDEA 4TMZA 2OHFA 3GLGA 2ZSFA 4GSYA 2H16A 4ILEA 3MRSA 5C1BA 4LHYA 3FWYA 1XXHA 3DZDA 3RRMA 4GZLA 1GRNA 2F6RA 5B2ZA 2RGBA 3R7WB 2P0EA 3LX8A 3QVUA 2O8DB 1IM2A 3OIVA 4RKEA 2AXPA 1SULA 1CJMA 4DUGA 2A5YB 3A58B 3EIHA 3VR6A 4AIIA 4EFNA 2GXAA 1E2DA 1GP2A 1XD2B 4M2LA 5JSZA 4LWZA 3FDIA 5JI2E 2BMEA 4LDJA 1G3QA 1XFAA 2WJJA 521PA 2BCJQ 4EDHA 4G5QA 3MFYA 1KYIA 2CL7X 2GXUA 1PZNA 3IQWA 3BOSA 3QE0A 3SBEA 1Z63A 2ODWA 3LXXA 4K46A 3RAPR 5BYKA 2WWWA 3QXSA 4V0KA 5JRJA 2OLKA 1FX0B 3TNFA 4B71A 1OH8A 1XJCA 1E6CA 1VTKA 2C9YA 3ZIAA 2E1RA 1OFHA 4BZQA 2WICA 4PO1A 2J1LA 3GLHA 4LX0A 3ZH9B 1U8YA 2QENA 3IGFA 8OHMA 3OEHA 4PHHA 1N6RA 4DT1A 2P67A 4JL8A 1CLUA 2ODBA 2CE2X 3W9YA 1NMYA 3LBHA 3BFKA 2ZM5A 2WKPA 2W0SA 2QGZA 4NH0A 4TL7A 5CYPA 1ELOA 5EXSA 4TYWA 4GI7A 2PEYA 1GKIA 4JIMA 4YQFA 3QXCA 2IXEA 3N70A 4G0NA 1SVWA 2VTKA 2ZUCA 3TUJC 1RE0A 4LK2A 4TN1A 4TSFD 5EE9A 2YOGA 1Z0DA 3A1VA 4LHXA 4MGZR 2ZE8A 4IXMA 1NBME 5HR5A 2P2LA 1W2HA 3DM9B 4LJ8A 4OHVA 2XZLA 4KLNA 1Z0AA 4PC2A 2B6HA 4JKIA 4RD4A 3RHFA 1XWIA 4IFEA 4LUCA 4YLGA 1PV4A 1NN0A 1DAIA 4OHYA 1Z5ZA 2OM2A 1U8AA 2G0TA 2IT1A 2FGJA 2MSDB 3CWQA 3GFOA 1CBUA 3TUZC 4DZZA 1G41A 2GETA 2YINC 1E9DA 1GWNA 4BLPA 4B35A 1OPXA 3KQNA 4Z8XA 1UKYA 2ZRIA 4CDGA 4EPXA 1MT0A 4JVLA 1YZTA 5SZJA 3ZD6A 2F7SA 3QKRA 3BB4A 4BQSA 1G17A 2QROA 5LD2B 3PEVA 4IDPA 1WE2A 4G3XA 2RGGA 2ZRNA 4HUQB 2ZREA 3NKVA 4UKDA 5DO9A 1FUUA 2O52A 2ZJAA 1RJ9B 1DE0A 3V4RA 2FDCA 2FZ4A 1L2TA 4M9ZA 3RS7A 4C0BA 4BE7B 5G53C 1LNZA 4EFMA 2HXYA 3RRZA 4Q7KA 3K0SA 4DCSA 4XWKA 2W0MA 2REBA 4Q21A 421PA 2NO1A 4DCNA 2DY1A 4JT4A 2RGCA 1I2DA 3MGCA 2V1XA 4ASUD 4W7SA 1YZLA 4MYTA 5JCZA 1K5GA 3B5JA 4IJMA 1WCV1 1KK0A 2GZHA 3KXIA 1HTWA 4DDVA 4HAUA 4B3BA 5FPYA 1O3YA 1SXJB 5EXXA 4NCHA 2ONJA 2YJTD 3KXKA 4Q9IA 4RD3A 2OCAA 2HLDD 4CEHA 4PXAA 5FBWB 1UFQA 2C9CA 4LJ7A 2PX3A 4WW0A 4OQXA 3GLHE 1JBKA 5E4FA 5BWMA 3DPUA 3FMPB 2AKYA 1WMSA 2ZE6A 3UIEA 2ZRLA 2ZYTX 3CONA 1TMKA 2R65A 1E2KA 2ZTSA 4C7OA 3CPJB 1S4QA 2YVUA 2R9VA 2R62A 1VCMA 2ZJ5A 1P75A 4Q1EA 3HPRA 2BJVA 3KQLA 1P9WA 4JLBA 1ANKA 2GZAA 5CITA 1I2MA 1P4SA 1W4BA 2CK3D 1OIWA 1XCGB 2YHSA 4KXFB 4PHFA 4TQ9A 2GCNA 2ZJ8A 3KDSE 4QGGA 1EX7A 4LYFA 1G1MA 1Z0JA 1P3JA 3L0OA 3Q5DA 5DI9A 4ITRC 1OB2A 2V7QD 4OQNA 2QSYA 1HYQA 3E1SA 4EPVA 2QI9C 3BH7A 5LB4A 4C0LA 1FL9A 1G20E 5AUNB 3GLGB 1RFLA 1JPJA 4PQYA 3O47A 3FMOB 3OIYA 4Q66C 4EJSC 3ZD7A 1XXHB 4FI3C 2V6JA 1N3BA 3PENA 4PZZA 2PT5A 1P73A 1QHSA 2WJYA 2YWEA 4KFRA 3VU9A 2RHMA 1Z28A 2YV5A 1IXSB 2PL3A 4WA7A 2BBSA 2VSXA 1ZU5A 3LLMA 5JSZB 1WXQA 4RD1A 3C7KA 1FMJA 3CRQA 2IS2A 1X8JA 2WTUA 5F9FA 4GZMA 4MITA 1MH1A 2JATA 5FTNA 2BHRA 5HPYB 3IIMA 4S35A 1IY1A 2NPIA 3LD9A 3WNBA 3ZGXA 4B73A 2HV8A 5J40A 3EG5A 3KUCA 1VG1A 4KBFA 5LDDC 2QBYB 3AF2A 4MKHA 5D3QA 3QF4A 4Z51A 5FTMA 2WWXA 3QEOA 1KNQA 1KI8A 4DBLC 3B6EA 1M2OB 3GLHB 1FUKA 5FUYA 1W5SA 1GOTA 2ANCA 4P31A 1KDTA 1ESMA 1CR4A 2QMHA 3NDPA 1N0WA 4KO8A 4IDQA 4Q19A 1KJZA 4DT1B 1WA5A 3L0IB 4CEIA 5ELXA 2G3YA 3BB3A 2AL7A 1H8ED 3I1FA 1F2UA 2GF0A 3X1DA 5EJEA 4DCTA 3IEUA 1AA9A 4A8JC 4RCYA 5AUOB 1IHUA 4GFDA 3I8SA 5J4HA 1U8ZA 4RZ3A 4TLEA 2XNDA 2PJRA 2C78A 1CJTC 1U0HC 2YWFA 1E0AA 1A5TA 4OQLA 1E2GA 3HYRA 2HXSA 2VHJA 2WV9A 2VRWA 1NJFA 1R8SA 3C8UA 4TLBA 1CEEA 2GZDA 4JLDA 4L9SA 1FQJA 1R7RA 4OHXA 5SZKB 2BBWA 3QKTA 1MO3A 1ODFA 2Z5FA 3W34A 3QKRB 3MWLA 1ZNWA 3N2EA 1WQ1R 3NBXX 4RZXA 4TZ6A 1E4YA 4URZR 2KBEA 4LBVA 3A8TA 3EZ2A 2XSZD 5DLQC 1UBEA 2ZEJA 3MLEA 1II9A 4WBSA 3W6OA 3QXXA 1XZPA 1EFTA 2DHRA 1S9DA 2NO0A 1NG9A 4ZI2A 1G8HA 2VA8A 1SKYE 2PMDA 2AR7A 1GILA 4V03A 2WWFA 4HYYA 3QOFA 3AVXA 3AVWA 2QRNA 3C16C 3GJ3A 2IWRA 4UNRA 4NZYA 1TQ2A 4EPWA 2IF0A 2OXCA 3OHMA 3PUYA 1G18A 1DAMA 3JVVA 5DHAA 1Z2AA 1M7BA 4LGMA 3MJRA 4B3CA 3THOA 3REGA 2IYQA 2RGAA 1TADA 3PVSA 1N6LA 2ONKA 1OHHD 4FW9A 4HZIA 4IHQA 4CIDA 4CEHB 3DL0A 1RRPA 4A0HA 2FMXA 2ORVA 3LH5A 3P20A 3F8TA 4CGZA 4BRUA 4BGDA 2BKEA 1S1MA 3CF2A 2J0VA 1OXTA 1Q12A 3TW4A 3ADBA 1SZPA 2DFKB 4OHWA 4BWYA 1XMIA 4C7OB 4B6EA 4LRWA 1GNRA 1SXJD 4C0AC 2Q9BA 2A5FA 1W47A 3KFVA 5FOTA 4GOJA 3EX7C 4PQFA 1KK1A 2FNAA 1GKYA 2ZUBA 1ZUHA 2FSIA 2QE7D 1W0JA 3RDPA 1JAIA 1NLZA 1YZUA 4B33A 3BH0A 1WRBA 4IXNA 2ZS7A 5FTKA 4LOAA 1NBMD 2QM8A 1G4UR 1UJ2A 1G5RA 2VYFA 2R8RA 5DIFA 3VKWA 3VKGA 4JSTA 4QL3A 2OV2A 3CR8A 1ZM9A 2IX3A 4A1FA 1CTQA 1E69A 1OE0A 4O2RA 4PHTA 4F7WA 6Q21A 3V9PA 2JLXA 1UKZA 3VR1A 4NCNA 4LBZA 4B2PA 1E2FA 3GEEA 1PVOA 3ZVLA 4A6PA 3OIWA 1KJWA 3I32A 2OBMA 3OIUA 4MUAA 4PC3A 3VU9B 1G16A 2Z6VA 4D2IA 5LD2C 1FQKA 2D06A 3SFVA 3C5CA 2P5SA 4Y0AA 2WM9B 2EFGA 5DISB 1IN5A 2NZJA 4N0EA 3WHLA 5CM9C 3F3YA 4AYXA 3FVQA 2ORIA 2NO6A 1FNMA 1KO4A 3FYHA 4C0KA 4OYHA 1VHTA 3UG6A 2GKSA 1U90A 1DELA 2ZRPA 1T3SA 2PZFA 4I1VA 3V00A 5JEDA 3I5XA 3AV0B 3GJ5A 4MGYR 2OFOA 2VLIA 1G3UA 3QEJA 3QF4B 4KODA 3L0SA 4DUGD 4IRUB 3I92A 3ZQJA 2FPLA 1W44A 4CVNA 1IXZA 5DGXA 821PA 4DEXA 1HEIA 1BMFA 1SXJC 1UDWA 5LB2A 5D3MA 1H8HA 1Z8FA 4MRVA 3S1AA 4CEIB 1ZBDA 5KSPA 4Q7MB 2ZRMA 4R98A 1HY3A 2CNWA 3AQ4A 1F2UB 3U7EB 4A0FA 1MRNA 5FUVA 4EAQA 4JLMA 1OXUA 3W6PA 2F55A 1XMJA 2EYUA 5FOXA 5CB6A 4KYUA 3ZIAD 1G3IA 3CNNA 4B3FX 2D7DA 1AGPA 1A1VA 2OUKA 4X8HA 1M74A 1GVNB 2XNSA 4NHOA 3OEHD 1ZU4A 1PLJA 2J45A 4BFVA 2JJ1A 2JLSA 4B48A 4MKGA 4HUTA 1QVRA 2GBLC 1A2KC 3EARA 2G0NA 2VSFA 4QM7A 2FH5B 2O0HA 1A82A 1BKDR 3BD9A 4A2PA 1GDDA 2ZJZA 1LV7A 2ZJOA 1E2NA 3FKQA 4M9XA 3SZRA 1GUAA 4BLTA 4RFSA 4Z8YA 5C46F 4Q1BA 2N42A 5FH9A 2A5JA 3ASZA 4W5HA 2IHBA 2RHDA 1TQ4A 3GEIA 2JA1A 3THWA 4LJ4A 5KNDA 1X8KA 4Y0VA 2HF9A 1CIPA 4URXR 1Z07A 2QU8A 4QJ4A 2NPFA 2GJAA 2FN4A 2RGEA 4JLOA 1SVLA 2XJ4A 2WJHA 1Q1ZA 4RZUA 4ZPXA 3NWJA 3AF1A 4HSEA 1R4AA 2J7KA 1KZ7B 2GCOA 4Q7LA 1VHLA 1VMAA 2VP2A 4E03A 2VP9A 4AI6A 2NQ2C 3I72A 3LRPA 3O8BA 1JEEA 2Z4RA 1V43A 3R20A 2AKAB 2LWIA 3GLFE 2GK6A 5K8IA 4DLZA 1ZD1A 2F3TA 2F3RA 2FEMA 2YZ2A 3NIBA 1V5WA 4PAOA 4Q1DA 4XWAA 3WY9A 3I5YA 3PIRA 3V4FA 2RCNA 1DO0A 5L3SB 2ZRGA 3EASA 5TVKA 4OJKA 1P60A 1UEIA 5IK2A 3VR4A 2FE4A 4BFSA 1NIJA 3EW9A 4GP7A 1OKKA 3BS4A 2YWHA 1OF1A 2GRJA 5JJKA 1R5BA 5HZKA 2Q3HA 2VL7A 2REOA 1QG4A 2ZI4A 5AR1A 4Z1MA 2XX3A 4G5GA 4V0NA 2DCUA 1RVDA 4HI0E 5IDVA 1F6BA 1KGDA 1NSTA 1TF5A 4EUNA 3MSXA 3VR5A 1AM4D 1OIVA 1E9SA 2QAJA 1ZUIA 5FBRB 4YONB 3RC8A 3UANA 1CP2A 3BORA 1NNEA 3AP1A 3MWJA 4UNQA 1AKYA 3CBQA 3CX6A 2REXB 2GNOA 3GJXC 3TMKA 5TY0A 4AK9A 3AVTA 1KKMA 2EFEB 1F2TA 1RZ3A 3AKDA 4M0LA 1F3OA 3SYNA 2H1LA 2ZI3A 3K9NA 3CZPA 1VECA 1QRAA 4CEJA 4XTRA 1X1SA 1J70A 1Q21A 3EA0A 3B1XA 3UATA 1XMVA 3W3ZB 2WSSA 2JASA 1XPRA 4PPNA 1R0WA 1CXZA 3I3SR 3BIFA 3LVRE 2JLUA 2IYVA 2JIZA 4UXHA 3SQXA 1VPLA 3RSLA 4UNPA 2WSMA 5M04A 2F1HA 5BN5A 4KYIB 1CJUC 3MWKA 4MYHA 5FBQB 3PXGA 1KAOA 3E5HA 2WMOB 1GIAA 1XMSA 4BLRA 1L4YA 2BWJA 4JSYA 1CULC 4LHZA 4P3YA 4LSGA 3SOPA 1UEJA 4TLDA 5KU1A 4M1SA 3BWDD 4V0LA 2ZYUX 3RS4A 3MUFA 4PAQA 1DEKA 3KJGA 2C98A 4E07A 1QZXA 2Z43A 1E9BA 3BK7A 2IWHA 2KBFA 2W83A 4AKGA 2AN9A 1Z3IX 3IPXA 4NE2A 4F93B 5AUQA 3CW2A 1DAFA 4ERNA 1EFCA 3AF3A 3KKPA 5FUWA 3L0PA 5EXTA 2BCGY 1TNDA 4IDNA 4KLZA 1LF5A 1KMQA 4KCGA 2Z0MA 3DMDA 3IBYA 2X2EA 3CH5A 5D3MB 4TYPA 2VEDA 2XAUA 1DS6A 2XOKA 3S1AB 1K6MA 5EZ6B 4AKIA 2BMFA 2C77A 2P6UA 2ZSBA 3U5ZB 3SHFA 1NKSA 2OXRA 3BGWA 4ZCMA 1E0KA 4TQUS 1NF3A 1KKLA 4OK6A 5K8TA 1J2JA 3LBNA 3Q72A 1GRRA 1CKEA 4LBWA 1N6IA 1T4GA 4HB4A 1MO4A 1G6OA 2WKQA 4Q9KA 1B23P 4JJKA 4FINA 3RS0A 1OT3A 2IYSA 5EE1A 4OI1A 3WMFA 2Q3MA 1GRQA 1T0HB 2BVNA 2IYTA 4AWXA 2EFCB 3D3QA 1KSGA 2BKUA 1E1QA 3QQ5A 1YZKA 1N0UA 3NEJA 2C04A 3SJCA 2GDJA 4V0ME 2UKDA 4RFSB 4Q00A 1TAGA 4KVGA 4M1OA 3OAAA 5TV2A 2XNDD 1ZCBA 4GOKA 4JBWA 1QG2A 2DPXA 2QL6A 2R6FA 2W00A 2P6RA 1OXXK 3TH5A 4GMXA 1JR3A 2H18A 3VNUA 2F1RA 3ZZTA 1UBFA 4BEJA 3TGPA 3NVAA 3OFNA 5TARA 3LV8A 1PUJA 3WNDA 2CXXA 2BC9A 3U3JA 4XOIA 3SS8A 1YR7A 3ASYA 3LQRA 3QVVA 2GCOB 5TXGA 3CRRA 4OBEA 3BJIC 2QM7A 4NP6A 4O3MA 2VQSA 1G4AE 1VYTA 2JJ2A 2RGNA 1A4RA 2WKRA 3X1XA 1DTSA 3A1SA 2IXFA 3C41J 2IS4A 2PX0A 4QBGB 2DWQA 4KHZA 3SYLA 4MRRA 3SJBA 3T5GA 2AFHE 1W7AA 4IW3B 3GEHA 4DSUA 3H2YA 2F1JA 4IEEA 3SJAA 3PR1A 1UKEA 3VX3A 3R9WA 3TQFA 1MABA 1VG0B 3PV0A 3HYTA 2ZAOA 2IUUA 2QUZA 4RFVA 4UJ5A 2FA9A 3NH9A 2QPAA 1TTTA 1RRCA 4LBYA 4L8GA 1LY1A 4XVRA 3LLUA 2J46A 3C15C 4D4KA 3N2IA 4PSAA 1AS0A 3CO5A 1A2BA 3SDZA 2NIPA 3G0HA 4A92A 1JXOA 3HWSA 3EZ9A 4NU0A 1YZQA 4HB0A 1FW6A 1XTSA 2PLFA 1ZMXA 2WBLC 4DDUA 2BEJA 3FB4A 2QMEA 2YOFA 3GLIA 4A2WA 3WBKA 1E1RA 1F2TB 1FNNA 2V1UA 2IW3A 1DVRA 1XF9A 1Z0KA 2FPMA 3GFTA 3KZ1E 4CEJB 5GJBA 4ZV4A 5JZVA 1AGRA 4PC6A 2QTFA 4W5WA 3U7HB 3EC2A 4FN5A 4PANA 1LW7A 1RYFA 4YXWA 3I73A 3P27A 3B1YA 3WBJA 3VX4A 4U7DA 3IKJA 3WYFA 3ZZ0A 2YOHA 5J47A 4NPHA 1D2EA 2ANBA 4F4IA 5LPNA 5B64A 2IEYA 4QJ5A 5J4LA 1U9IC 5FPTA 1Q1EA 1E9RA 4JLKA 1W0JD 3O8RA 4KFTA 4UQOA 1JXMA 5EE5B 2A2ZA 4P0TA 3CM0A 1JR3E 3JZMA 4IDOA 5CM8B 3KX2A 1KSJA 1YU9A 3ADKA 1KK3A 1P2UA 2DFLA 3AKEA 3GJ6A 3K9HA 1KSHA 1CRQA 2B7CA 2O8FA 1D9ZA 2CJWA 3A4NA 3H1TA 1OB5A 1T9HA 2WWGA 3A1TA 4JL5A 2D4HA 4ARZA 1AQYA 3KFXA 2ZROA 3B1VA 3L8ZA 4M1KA 4ZIRA 5JMTA 4X8MA 2BMJA 2OE2A 4HDOB 5CIQA 5AWFC 3KQUA 2KB0A 5E95A 1OW3B 1BH2A 1U81A 1KSFX 3CX7A 5P21A 1E2LA 5E7IA 2WIBA 1QVAA 1OXSC 4TWZA 4BPBA 2QGNA 1G7RA 2WJGA 2I4IA 1G9XA 4IEIA 1KI9A 3GJ7A 4OK3A 1FPMA 4W9MC 2XEXA 4DLYA 1JJ7A 3GPLA 4MYCA 3THXA 3MG9A 2Q9AA 1BMFD 3QPWA 5JI3E 5HTKA 4KFSA 3D31A 1H8HD 1IBRA 1E32A 1XNJA 2D74A 3NC1C 1WP9A 1XZQA 2V9PA 5KPJA 2CNWD 3A1UA 1X86B 4OQMA 4FWIB 4PPGA 3VTKA 4IDHA 3QBVA 3GLIE 4TMTA 3H84A 2H17A 2VP6A 2IYUA 4DKXA 2QT0A 4R2IA 3WMGA 3GCGA 5KTYA 4IVQA 5BN4A 3TRFA 4B3XA 4PO8A 1QHGA 4YMSA 1Y3AA 4WAUA 3LX5A 2HDNB 2VP4A 2WWHA 3K9GA 5EUMA 4CRWB 1LF0A 3HDTA 2QSZA 3D7MA 2JJ1D 2FV8A 4OL0A 3TSZA 1QHIA 1G6HA 1CU1A 1PJRA 3IIJA 4ZI3A 3THYA 2XJ9A 3UWOA 1MR3F 5UKDA 2GJKA 3BXZA 1W36B 2HJVA 1GG2A 2R6CA 1N6OA 3GFPA 3BH6A 4JT2A 1W4AA 2ZU0C 1KOFA 1NJGA 5AK0A 1FMLA 3ZVNA 2IS1A 3U61B 2IS6A 2GJ9A 1WBDA 4Q9LA 2GVZC 4H1VA 4B75A 1FOEB 1Y63A 1JECA 2R2AA 2OFXA 4BZXA 1UDXA 1SVKA 4MRSA 1MABB 2GESA 4G5OA 2QZ4A 1P5ZB 1TQ6A 3BBPA 2BMDA 4N1AA 4CT5A 3BB1A 1YRBA 4OK5A 4MRNA 2BJWA 3TBKA 2NOAA 2IYWA 3ONWA 3KL4A 3KTAA 5BQ5A 4GBMA 2ZRKA 4ESHA 1IXRC 5IK2D 1ZIPA 1N5LA 1L8QA 4WZBE 3AVVA 4FMBB 3R8FA 4Q9HA 1OKKD 2ZQ5A 2V8OA 3SEAA 4ABYA 3PEUA 2XTZA 1KK2A 1GM5A 3GJ4A 3GLIB 1OYWA 3X1ZA 4LJ9A 5EE0A 4XVQA 5DYGA 4Z1MD 4DIEA 3A37A 1GTVA 1GZSA 1SVMA 3P32A 2FU5C 3QNUA 2HEIA 1YZGA 2G88A 1GKUB 5JBQA 2ZJ2A 5GADl 4PZLA 1R8QA 2A78A 3A6PC 3Q3JB 1COWA 5CDFA 2J0UA 2VBCA 2KJQA 1ZAKA 5JCPA 4EPTA 1NY5A 2F9LA 5L3QA 1AKEA 3AEZA 5JWHA 721PA 4GOXA 1KI4A 1WDTA 3UWKA 4B6FA 3NHAA 4URWR 4PR0A 1E9FA 4M1TA 3LQQA 1RRFA 5FR1A 5H68A 1AJEA 3VAAA 2WSSD 2WVJA 3W8NA 4C0HA 2OBLA 2JIZD 3IQXA 3DO6A 4JMPA 1QHXA 3DOEA 4MYUA 1KI3A 4XVUA 4PC7A 5HE9A 1IQPA 4NYJR 5FOUA 3P26A 2BBTA 1ZIOA 2IC5A 4RD0A 1EWQA 4C0QC 5KOYA 2WPDA 2VHTA 2J41A 1JAHA 1ZYUA 5EXPA 4D4MA 2O8FB 4O0MA 1W48A 3IHWA 3MWYW 2FSFA 2WIAA 2ZRHA 2BOVA 3RYTC 4TYNA 4ARZB 3AP3A 4H9GA 1O87A 4TYYA 1EXMA 1YRAA 3DMNA 4YDHB 3RWMB 4ZIRB 3L82B 2XB2A 3Q7QA 4S2EA 2GXQA 2Z83A 4MQBA 3IILA 1NN3A 3RRYA 3PEWA 4YDSA 3EXAA 1DG1G 1YR9A 1ZNYA 3D8BA 3K70B 3U3KA 1R6BX 1P61B 2OG2A 1E2PA 4JLAA 2CVHA 1XRJA 4GMDA 4D0GA 1XJ0A 3B82A 4FXPA 2OCYC 3W8RA 2ZPTX 4UNNA 2QMUA 3THXB 1G8GA 3UG7A 3OZXA 1YHNA 4D0LB 2D2EA 2IHYA 2XOKD 4BFXA 2GAAA 1XEFA 4RD2A 3VKHA 4TZ0A 2FGKA 3QPUA 5G40A 3KQKA 4KV9A 5SZIA 3K0CA 4Q4JA 4N0DA 2H7VA 4XWOA 1SVIA 4AC9A 1HT2E 4NKRA 4PSKA 3RSOA 2OCBA 2DWOA 621PA 5AJWA 2OESA 5L8VA 2D7CA 2CCKA 2AXNA 3LY5A 3TAUA 3VHXA 1OV4A 3LAWA 4IVPA 5KDOA 5CDFE 3U44A 1CRPA 2NO7A 5HCIA 4TL9A 4JZKA 3FOZA 1R0YA 4FWTA 1SKQA 5DYIA 3THYB 5FR2A 4IOKA 1R2QA 1E96A 4PZYA 1E1QD 1U0JA 2JLRA 4JLNA 5ANRB 1S3GA 3CIOA 3CWZA 3AVYA 2G6BA 4F4CA 3DZ8A 2VF8A 3PQCA 3T15A 4EPRA 4ZCIA 4PO9A 1N5JA 5HKKA 3OAAD 3LNCA 1G21E 4J0QA 4WIAA 4RVCA 3T12A 1T8UA 2EFHB 1E2JA 1YQTA 3DKVA 4M1MA 5BN3A 1JR3D 3A4LA 1NLYA 4BLQA 2WAXA 1Q20A 3X1YA 3OFND 2GF9A 2ZJYA 3BRWD 3ICEA 2FEOA 1DAKA 3GLFA 3PJRA 1SKYB 3EZ6A 4ZKEA 1G8PA 2VH5R 1FFHA 1KZGB 4MRPA 1JB1A 2IXGA 3NG1A 1W36D 1OFUX 1Q22A 3KKMA 4RSGA 2JJ2D 4A6XA 2I3BA 1E2IA 1VKJA 2PCJA 3CLVA 5G3YA 1D6JA 3AKYA 2O0JA 3QXHA 1UPTA 2QN6A 4WXRA 5A0FA 2MMGA 4BFZA 2RAPA 5SZHB 1AS3A 3DEFA 4URUR 1TQDA 1IN7A 3KTAB 4BFTA 3W90A 2C96A 3ZS9A 3ZYCA 2OEPA 1AK2A 1TU3A 3PG5A 2VHQA 3EAQA 3ZVRA 1NMXA 4BRWA 3EPHA 5AJZA 4R71A 4M9QA 1BOFA 4US1R 1HT1E 1BIFA 3H86A 3U6KA 3NHBA 4LPKA 1AZSC 2VSOA 4IOJA 2XXAA 1ZM7A 2D3WA 1Q0UA 2CLCX 3HJNA 4AY2A 4UXIA 4CZ2A 2WAYA 2B7BA 3ND8A 3NBZC 3AF0A 1E98A 1TEVA 5HCNA 1XB2A 4FCVA 4KVAA 2BIFA 2J0UB 5L3VA 4M21A 3VMFA 2A3RA 2Q3FA 3K9LA 4ACBA 3CRMA 4URVR 1BS1A
chains in the Genus database with same CATH superfamily
1E1RD 3UGJA 2I03A 1FNBA 2GN2A 1WB9A 3FWKA 5JAOA 4GI3A 4EL0A 2OYRA 3EZ7A 4QGHA 4R68A 1D0SA 5E1DA 2YRWA 4S1TA 1YK1A 3TSOA 5JADA 1VYVA 3VNQA 3LL7A 4AY5A 3ROFA 3KDPA 1MW8X 4RV4A 3TCXB 1YAHA 1R9JA 2QP4A 3EIXA 4NNJA 3FMIA 3O4JA 1Y3DE 3R4VA 2H92A 1UPCA 1O58A 2B5VA 3G82C 2QMOA 2IYEA 2WU0A 3N0XA 5GM2A 4DWVA 1GAXA 3QI2A 3UGQA 3C3XA 2CFIA 3D4OA 4EPYA 3TLCA 4Q9JA 4ICIA 4JKOA 5IBPA 1N2CE 4HV4A 2O5VA 4QOSA 2SICE 4E46A 1VE6A 1N0IA 2AI2A 3C4JA 1XCPA 3IHLA 3OTGA 3B2NA 4Q1AA 1EM6A 1UOOA 1K8QA 3H2JA 4KGZA 4OU4A 5IULC 2PYDA 3U6BA 2ZBVA 4HYEA 3LDAA 2IYFA 4QGBA 2PNFA 4AZ3A 2IUTA 3N8IA 2FFJA 1D5WA 1RQLA 2LGJA 1R6VA 3OO1A 3WHIA 3LHDA 1RYDA 1I8TA 3M5WA 4R8RA 3SN6A 3IEMA 4C7BA 3E5RA 1JA9A 2XIQA 2FPGB 1Y6QA 1RZVA 4BQPA 4F4HA 3SI7A 1IMJA 4B5LA 4E4TA 4PX3A 3OPYI 4QFBA 3TEJA 4EUFA 1VE1A 2CFSA 4YAJA 4HY3A 3K6JA 2FN7A 2JKZA 4LS3A 3U9SA 3JZAA 2VUHB 3PNPA 4QC2A 4OHMA 1GNPA 3LX4A 4UBKA 1MJ5A 3CPHA 1ZOLA 1YZHA 4G1MB 2PR2A 3D3WA 5CA0A 1TC2A 2VF7A 4N48A 2R6AA 2OBFA 5K8LA 1T2VA 2EJWA 2F48A 1ORWA 3K70D 1UBJS 3CR7A 3DOIA 1XD8A 4I4LA 2Q2WA 5FWNA 5FL7A 1TCVA 2XB6A 5LSAA 3TLYA 5CFPA 4Q4JB 2BFNA 4M1QA 3EDMA 3FJYA 3R76A 5HSGA 1RHRA 3WLJA 5B2FA 5CXSA 3CRW1 3EGVA 3M82A 4GC5A 4XDHA 2W2KA 5IHPA 3ZTWA 1IN1A 4IGAA 3VHXB 4C1BA 2I91A 3SR0A 3IPRA 3JD3A 1TTPB 2JZOA 4NFYA 3CF0A 4MWOA 5E6SB 4PS1A 3K09A 3N2ZB 2GM3A 2YASA 1ML3A 3GUVA 2FFQA 1Z36A 1TF7A 4YCBA 3T52A 3UUWA 1PR6A 4HNUA 3ELDA 2ODNA 1PDVA 1PNRA 2R96A 1HV8A 3BTOA 3GLSA 4HCJA 1E5TA 2AN4A 2HMVA 2XXJA 2ZVJA 3OZTA 2FQXA 3K2BA 1VCOA 1XMPA 3BSSA 2FW7A 1W5FA 3AR4A 3PUXA 2Z5LA 4YY3B 1S3SA 1IZ9A 3FTDA 1HOXA 3IBFA 4KSBA 1ZHFA 3L8EA 4IHJF 5CAEB 5BN3B 3IOCA 4KBYA 3SNHA 5KWIA 2XUJA 3QPBA 1GA1A 2HN9A 1ZVJA 4NYJQ 2B1GA 3W6ZA 1DX6A 1NY6A 2FF7A 3C5EA 5JNTA 2DTEA 3GLFB 3ZQ6A 2QUBA 4Y7CA 5CLGA 2XDAA 4FX5A 4UU7A 5CLLA 2I9PA 3WRYC 3C98A 3RARA 2RGYA 1JLLB 1FTWA 2PL5A 2NUAB 1EFHA 2OFPA 3JR3A 3HL0A 1A76A 3FFXA 1BU5A 3UGKA 3TRJA 1VL5A 1ENYA 3AB3A 4WKPA 2Z56A 3JVUA 1EXVA 3IELA 5ALKA 5DSZA 2CE7A 4RANA 3E03A 5IBRA 2VP5A 1FSZA 5H02A 4BQEA 5B3KA 1Y1PA 2CDNA 4U6QA 4YJ2F 2MHCA 1J0EA 3PHLA 3QENA 1EGMB 4HDRA 4XQGA 1LTQA 2Y1XA 3A4VA 3FZQA 1E7YA 4PTLA 2EC5A 3QLTA 3UH0A 5EQTA 1OC2A 2ZJBA 3I2JA 1B0AA 4CG3A 3IEKA 3T5TA 1RRVA 3QH4A 2OHJA 1QIJA 3Q7PA 1DX4A 2QPOA 4YREA 1M2VB 5CFOA 1OYVA 1RI5A 3EJ6A 3MUEA 2ZIXB 4O4HA 5DT9A 1KIMA 1EESA 1NU8A 3K20A 5FB3A 2FRDA 3BIJA 2XXAB 1V1JA 1EDDA 3T3MB 1A9RA 2VHCA 1DAOA 1CB0A 4DYHA 2OTCA 2W58A 3T1TA 3I1YA 2VDWA 3UMRA 2LRHA 1E2QA 1YS2X 5JBNA 1RHMA 2P2YA 4IS2A 3CRNA 4RPJA 1R5NA 1TEHA 1VIMA 2O1WA 3O0DA 4KQXA 2HRDA 1WL8A 4P36A 3C3DA 5B58T 3JVDA 4AKEA 2V0CA 3L4EA 3Q7EA 3RYHB 1MC5A 2FPIB 3V2HA 3JWEA 3TI7A 3AEKA 3LUGA 2Q5CA 4PCVA 1JEQA 3RSCA 4LGYA 3WLLA 3ZCPA 2ZITA 4FDLA 4HEA1 3FGNA 3LW8A 4MJ7A 2AI3A 1R9MA 3G0GA 4HH4A 3JYPA 4BVHA 3AHCA 5C7OO 3HFJA 2P4HX 4LZWA 4PN7A 2OQRA 4FBGA 3ZCSA 3HR7A 5DX1A 5TQ0B 5TC4A 1C9MA 1KFKB 5H1YA 1VSUA 2B0JA 2J9FA 1LFDB 2VPWA 4ND6A 4TV9F 5AJVB 1T15A 4MJ3A 1TQHA 2A0XA 2O3TA 1YVUA 4JUFA 3Q2KA 3UK6A 3AEUA 3PE3A 4MUBA 1RPJA 2JK0A 5KVSA 1AKWA 1YL7A 2J3EA 4JOBA 4UBMA 4X3OA 4LC0A 3KTDA 1GXSA 1VJ0A 2AA3A 2IYOA 3DSRA 4R1PA 4FWBA 4QRDA 1AQUA 1SA0A 4MUXA 5GGYA 3WYGA 3SSAA 1RBYA 4CR7A 2PA3A 1PP4A 1LTHR 2Q6KA 2ZRFA 3SFZA 3L4JA 4ZXPA 1X80B 4B1FA 1XZIA 3JASB 2E9SA 1X3SA 2G4LA 3G8AA 4R2WA 3TIVA 5FDFA 3RVRA 4BB9A 1SKMA 4AMGA 2CXNA 5I9TA 1VL8A 4TMKA 3DV2A 2VC2B 5G1NA 5CB0A 4LPSA 1QYCA 4EX6A 3JQ7B 3AU8A 2JEZA 1ZC4A 5EJGA 3TCKA 4CCWA 5DM0A 1XPJA 2QD1A 4HDSB 4QBIA 3TIFA 1K7SN 1L7DA 3P2YA 3R24A 5ECWA 1LDGA 4JYBA 4K6FA 4F3TA 4JFRA 3AO0B 1XU4A 4GT1A 1T6BY 2AW5A 3UY4A 3RC7A 2J9GA 1Z0IA 3C7CB 3IIKA 4G4SP 4INOA 2D2FA 2D2IA 3P4YA 1QFXA 3IRVA 1L5NA 3SQNA 5C32A 5ARCA 4KAAA 5E0OA 3TTVA 5KB3A 1UMCA 4I46A 1DLIA 3RREA 3KPUA 2ZUDA 1RJFA 1W4RA 1U6KA 2YYZA 4KE8A 4LY6A 2UZ4A 1P3Y1 3W8DA 2D2XA 4MUJA 3TE7A 4BGUA 1GQ2A 2NXWA 2FPWA 2Q3DA 2EBWA 2X1LA 4INPA 5TQJA 3B7GA 5B5SA 5H9WA 5J4KA 3N2YA 4DE5A 2GM9A 2QF7A 3SXUB 1Z18A 4MR7A 5E9AA 5K0EA 2IA5A 1PK7A 1ZM4A 4MR9B 1RYNA 2ZBEA 3I0MA 2QG6A 2W2QA 3JQGB 4EO4A 3PFGA 2PBRA 2CCJA 2QBYA 1H05A 2ZPAA 3NOOA 4IIHA 1IUKA 3T1VA 3K1TA 1LRJA 5BQFA 3LHFA 3GK3A 3KB6A 4X97A 5GZ3A 2IOYA 4POAA 3EXHA 4F6RA 4MARA 1QGOA 3LUHA 1KFEB 1X87A 4JFAA 2D5LA 3FVVA 2UXBB 5JWRA 1SIUA 4DANA 4RTLA 4EHAA 4DR4B 2ZSEA 1NXTA 2ZU6A 3M8KA 2C84A 1U0LA 3M5CA 3B8EA 3GDHA 1NFRA 1U8TA 2J9RA 5ALQA 4ETWA 4JELA 3FB1A 1YZFA 4FJ0A 1KI2A 4Z7NB 5BVGB 4DC9A 1J00A 2V6FA 2XGOA 2VYQA 4F85A 3ANMA 1RACA 1DRUA 5DN6A 3AJ9A 3ZIDA 5DGHA 2GJ8A 1PT8A 3A3KA 1JHPA 1UXJA 2V65A 3KO8A 4KEAA 5B37A 4D42A 4DA8A 4B7CA 4PZDA 4EX7A 1QDLB 3GZJA 2M6RA 2MINA 1I5RA 4E88A 4GLJA 4YCDA 3I04M 4LXQA 1YA6A 2AX3A 2D62A 2I3ZA 1JALA 4FE4A 1X0XA 4QDOA 5ESXA 3CRVA 1TRKA 4ZPJA 3BHMA 3L1UA 3KKQA 5FOVA 1JW9B 1E2MA 3ZK7A 2ZYHA 4CV2A 3RS3A 4EHKA 3E0XA 5H16A 3P71T 4BUJA 2NVWA 2CJPA 3IVCA 1OXVA 1U2GC 4NYMQ 4KRYA 2IYLD 3FUVA 5IAAA 3A3NA 3UNXA 4OIMA 4KPFC 3PE6A 3EFOB 4J1QA 3TNDA 4CG2A 2IU0A 5JSQA 1QP4A 1LK0A 1IAVA 3PUIA 3ZGNA 3L0DA 1KE1A 3WB1A 4PNEA 2FW1A 3MMNA 1PJQA 1AV7A 3AFGA 3DW1X 4DA6A 1FA9A 2W2NA 4F6CA 3GLGE 4GPD1 1J2YA 4OFZA 1O97C 1JDBB 3I8XA 2KM1A 4KI0A 3R6DA 4GRIA 4HFRA 4FKBA 5CJPA 1IJFA 4B9AA 1DO8A 2IP1A 2O2DA 5E1BA 4RK7A 2HQBA 4BATA 1UM9B 4BLSA 2YL2A 2V6IA 4B7ZA 3DMTA 3T3OA 1EXWA 5F51A 5AKXA 3NALA 3QYAA 3MCUA 1YDGA 5BSUA 3M9LA 4RVDA 3ABQB 3T7DA 2AWNA 3RBZA 1FVXA 2EX4A 4BMDA 5EHNA 2QXYA 5M34A 1BX3A 3JQ8B 4CM1A 1T1RA 1NJ1A 3KQSA 4EHHA 3B3QA 2JLZA 4BN0A 13PKA 3NBYC 4P92A 1SVNA 2PGIA 5LNK1 2FWRA 3EY9A 3AOEC 4ZAYA 3GR6A 1XRMA 1C8LA 4YJFB 2XCUA 5FI1B 4R51A 2X86A 1ZJZA 3HU1A 2NT3A 3CUSA 4R3UC 2HLNA 4MLDA 3TZQA 3INYA 3NU1A 4CTNA 5L7TA 1Y9EA 4EQ6B 4ZZ3A 2L0XA 1GEEA 1NKTA 1AZTA 1JJVA 1W1WA 1BJRE 2XH8A 2Q4OA 1HYEA 2DLCX 3TKYA 1CERA 3IAXA 4D80A 3A4TA 1FDOA 2W6JD 2C0PA 2HF7A 3QZUA 1W85A 1Y1QA 2OCPA 3NT5A 1L6RA 4J0CA 3AUYA 3DVAA 4RLQA 3I4CA 1X74A 2P2SA 2Z6QA 1KO7A 4JLJA 2R6ZA 4RIHA 4B82A 4NBLA 4A5SA 4YCCA 3ZCTA 4XUEA 1OZHA 1IRXA 4Y1FA 1ZNXA 1DCMA 4P98A 2A94A 4D3XA 5KWJA 3WA7A 2Q1TA 4U2FA 3MHTA 4OHOA 3D0RA 2TS1A 4PLWA 5BWCA 1UBMS 2HRCA 3U3ZA 2DM6A 4ZHQB 1V6SA 5TX7A 4XQ0A 4ZQEA 1LDBA 4ACAA 5F1PA 1DGQA 1CY7A 1V25A 4B6GA 4OSEA 1ND5A 4Q3OA 4OYLA 3KOYA 4BMVA 4KQHA 2F43B 3DXZA 3CN7A 4KUGA 4K0RA 5DE3A 3UJBA 1TEZA 1U80A 5AM0A 3I6IA 4Z9XA 3ZDEA 3ONVA 3VDNB 1A5SB 1NMZA 2EZ4A 4X8LA 4XTCS 3GQBB 3O90A 2E18A 4KB5A 4MUAA 3WRYA 1UP4A 4UAVA 3ZU3A 5AJHA 1HA3A 2R6R1 2N46A 3OBIA 1NN1A 1DIOB 2X4LA 4S1VA 4WCFA 3INRA 3FDZB 4L5BA 4GXTA 1WVMA 5FO0A 4X7BA 1VLJA 1ZJ6A 4YAWA 3VOAA 3LU1A 5AD1A 5CB4A 3ZLJA 1BO6A 3NOVA 1M6HA 4XIGS 2WWVD 1RJGA 1DPFA 2Y1WA 4MQEA 3O84A 3JU3A 2WUGA 4U00A 1XJQA 3BRCA 3NTLA 4J7AA 4TTAA 5BNZA 4QXAA 4S0XA 5F7JA 4C21A 3BDVA 3EPKA 4K3VA 4P5DA 2OD7A 2XIJA 3Q0IA 1RIFA 3ROXA 3CVVA 4UE3S 1J6UA 3LPNA 3P45A 4HAIA 2HOQA 2XDYA 3NOXA 5AJXA 3ZU6A 1B14A 1T8PA 4RA6B 4BE9A 4DSNA 1OFTA 4O3FA 3ZTYA 2LD4A 3K0EA 4JVMA 3RRXA 2QAGB 3OE7D 2OO7A 5G3ZA 4J2OA 1I1HA 5E6RA 3GJ8A 1G21A 2EP8A 4JB0A 1SKBA 2VP3A 1Q50A 2EHDA 3H87A 4QM6A 3HACA 4MPTA 5AKEA 3MJCA 2CXRA 3VH2A 2CL6X 2J31A 4DJAA 2HQ1A 1AK9A 2WOJA 3P9SA 4HDQB 2X19A 1SG0A 1NE7A 3BD7A 3ICOA 3OWOA 5F1KA 5H59A 5I3CA 1CV2A 3AX6A 5KVCA 4ZMRA 3AJRA 4MUEA 1KWKA 1NI3A 3QUQA 2EGHA 2XXBA 1G7TA 4YUAA 1UZMA 2V6BA 2WOOA 4PCLA 1K63A 4OI0A 4PLZA 1Z06A 2XECA 4EHLA 1G8YA 1NR1A 3BE6A 4IL5A 5CT5A 121PA 1X15A 3MB5A 5GONA 3FCSB 4N01A 4C0JA 4MUGA 3FOWA 3KR0A 3MS7A 2PLRA 4EUEA 1QP8A 3QBJA 5B12A 1PIWA 2C5FA 2X9LA 4H1TA 3ND5A 3Q8KA 1ZSYA 1QZ3A 2VZ8A 4DLTA 1OAKA 2P3QA 3I42A 4FOSA 1C9YA 2CNOA 4MW4A 4HF7A 5EKSA 1TAHA 3F3MA 2HYIC 1YDMA 2EQBA 3H65A 4KV7A 1E3TA 3IMEA 1HR0B 1QE5A 5ENDA 1N8KA 3V33A 1FP1D 3MT0A 2C2XA 4D02A 2ZSJA 4II2A 4P3PA 1UOPA 1AVTA 4I8XA 1HNZB 1S8AA 2YDYA 3I3OA 1MZPA 4LYJA 1QKJA 1E79D 4UBJA 1AKRA 2DKOA 1E3MA 3SC3A 2DUMA 4BLOA 3BIOA 1TO6A 2EW2A 1QQAA 4R9RA 3FR7A 4WLOA 2O8CA 4C0SA 4L9WA 1XCJA 4PQRA 3E27A 2QT1A 2CSUA 1B26A 3VC3A 3GRUA 4JS0A 1AN0A 2R1TA 2JNWA 4WBXC 1W88A 5ALEA 1KJYA 5GJVC 2MTBA 4F9TA 3GD7A 5BUQA 4V0SA 3SYRA 5GVSA 3DKPA 5IXSA 1Q95A 2JFWA 1MG5A 1UBRS 3W2TA 2PSJA 2C2ZA 3N8KA 2EBFX 5IC4A 4PN3A 4AAYA 1ODKA 1TPZA 1XYYA 2ZRBA 5E3IA 1BFUA 2ZBUA 3FSEA 4DJ5X 5FUXA 4EHNA 2PKRA 1E0SA 3VOBA 5HRCA 4RXUA 5H80A 4NMWA 3C5VA 1XQXA 4LY3A 2QDXA 4IJVA 1YS1X 4BP1A 2CLDX 4TM7A 2EL9A 2OHXA 1G5IA 3WB0A 3K0AB 4AO6A 1SQ5A 4QRHA 4UU0A 2VBIA 3NHLA 1D2GA 5GAJA 3FNRA 1GPAA 4S3MA 4BNTA 2H5JA 1O5IA 4F4JA 1PZEA 2BZGA 4OLJA 5BMOA 1TQ8A 5EZYF 1XEWY 3GBPA 4E5PA 5LXTA 1YE8A 1C8KA 4YYEA 2IYZA 2VIIA 4MKIA 3RK4A 4JCCA 1MVLA 5HGJA 3H16A 2I3DA 4Z2AA 2F9MA 3FGOA 1PNOA 4X24A 1X6VA 1YQDA 1NZFA 5GV7A 3UV3A 4AJ2A 4HAXA 4JUAA 4DREA 1MAAA 5K0GA 3QBTA 3ENVA 4FYJA 3WMRA 4D25A 3H9CA 4KDRA 1OH7A 1E1LA 3FPBA 3NIFB 3PB3A 3U4QB 2DE0X 5D8DA 4Y1RA 1N2ZA 4KPUA 3AGQA 3VV2A 4D43A 1N6PA 3FR8A 4M9SA 5EA2A 2H5LA 2E4YA 2NWQA 1DI0A 2DLDA 1BQEA 3K1AB 4LMAA 1NMSA 1RM3A 1EEHA 2NV2B 4J43A 5BXQC 2C2YA 5D2CA 1K98A 5E7JA 1PKEA 2JFQA 2XOEA 3BDAA 3HSSA 2O2YA 5DYNA 1TAUA 3DMPA 2WT4A 4PFKA 2DQSA 3AHGA 4N7MA 1OZAA 3TZ6A 2CYBA 2WFZA 3RVKA 1PX2A 5F4ZA 2ACEA 2YIVX 2F90A 3ODGA 4I66A 4S1WA 4I1SA 3HY3A 1WSAA 4BXOA 2NZ2A 3A06A 3FFAA 4HGRA 3SYKA 4HDCA 3VYRB 3C1OA 3U7RA 1Z38A 3FHCB 4J49A 3HR8A 1ZC3A 1T5OA 3GYBA 4Q4CA 1PD1A 1ORDA 1U7WA 3PLAE 4KLCA 2GFQA 4XVHA 1AKUA 4BWFB 4NDZA 2PQ0A 3Q12A 1HNXB 1U8UA 1NPDA 1IPHA 4PGMA 4U2BA 2VXOA 4X91A 1EAYA 3SSNA 2JARA 2H1IA 1NXPA 2RC6A 3DLHA 1SVSA 4ZYYA 3F4LA 5DZSA 3C8ZA 5C1OA 5AKZA 2CEAA 1LBIA 3TEMA 4U6NA 2VPXA 1VXRA 1HDZA 3NORA 1X1RA 2FPXA 3ZD8A 1THMA 1WSWA 3DFKA 3ONDA 4G85A 4W63A 3IDQA 2VDMB 3AV3A 4FDTA 3M0EA 3V6LA 3OSUA 1UM8A 4MVJI 4DMRA 1WQ4A 3OCZA 2E5LB 4NCIA 4M0DA 2BW0A 3ABIA 5C37A 3UENA 1YVDA 2ZE7A 3D6AA 4FFPA 4R4JA 3FFBA 5CVVA 2HCRA 2X7JA 4JD5A 3SMVA 1EUYA 4BGIA 3L0ZA 4J9VA 1U2RA 2CNLA 4MGKR 1OGIA 4DJTA 3BE8A 4ZYXA 5JVDF 2BEWA 5KYGA 1MGOA 2BFMA 5I9BA 1CRLA 4Z2YA 2GFIA 1P4AA 4QPJC 2PX8A 1GNTA 1RMQA 3ZGZA 3UMBA 4QO7A 4Z0HO 4FFWA 4FUQA 3GB9A 2I2BA 4K05A 4OHBA 4FCTA 2WTBA 4FFLA 1WDKA 1Z4JA 3FAZA 3R0VA 4FZ3A 1YJ5A 2BFDB 2RAUA 3U3MA 1XCBA 1MO2A 1PLKA 4GE0A 5T4EA 1EX6A 3I64A 4HMOA 3OU2A 4A8JA 3FPFA 5ALPA 3N2GA 3DOFA 4JKYA 4O5AA 1VLQA 1NUUA 5KTPA 4HH1A 1IZ0A 2QG9A 2OECA 4M60A 1CR1A 2TMGA 2YZ7A 4D79A 3LW7A 2PANA 3Q3CA 4J7XA 1G59A 3MCTA 4KXXA 4HQRA 2D0IA 2P68A 3ZHSA 1ZICA 3P0RA 4C5BA 1Q44A 1VHJA 3U9LA 1KAGA 2Y76A 1F51E 4KQFA 4GRDA 3RVQA 4D6YA 1U94A 3TX2A 4EBBA 1PSDA 3R9XB 4O4LF 1ADCA 3AZOA 2IOFA 5HZGA 3MLAA 1GHTA 4DMCA 5A4FS 4LHVA 4QOJA 3AJAA 4C0WA 4GPAA 2SCUB 2XYVA 1JJFA 2B92A 3AGPA 3CW9A 5EMKA 3G5UA 4K9KA 4L1KA 3OEYA 3KVVA 2VTEA 5LZ5A 2WFLB 4YJ3B 1F8GA 5JHHB 2DKNA 2EIHA 3REFA 2B61A 5TMEA 4BU0A 3TO5A 2J0EA 3BHIA 3T06B 4F11A 1YJBA 1X8XA 2JKVA 3F6PA 1XBTA 3PQFA 3LC1O 3EWAA 4QQKA 1L8OA 2QTZA 2BTQB 3AL3A 5AOVA 1E2EA 1TZBA 4N9WA 1B3RA 3BTSA 3N28A 4L15A 3VO2A 3FKSD 4O08A 3U2QA 2HHHB 5EIOA 5HBGA 1G3RA 1QFJA 3HEBA 1W46A 7MHTA 3LVBA 4Y2XA 1QGUB 2QSUA 3FOBA 3HEMA 3P2MA 2H08A 3PC2A 4KXUA 4Q6BA 5GPBA 3EIEA 4AU1A 1NR5A 2FDRA 1QIKA 5AM1A 1SUIA 1MEEA 4Q02A 1I4LD 3EJWA 1CNEA 1W5TA 3TOXA 1U4NA 4IM7A 1TL7C 1LWNA 3DFIA 2IYXA 1IQ0A 1NLUA 4U0KA 2ZYDA 1NBAA 2QNRA 2QAGC 3X44A 5BXYA 3AIMA 4ZQFA 1S9HA 3PTZA 3T0GA 1P0PA 1NP6A 2JIQA 1RQPA 3QRWA 3VDMA 1IHOA 4XE5A 4CE6A 5CD1A 3IEVA 2XOXA 2VF4X 1RC0A 1AN9A 2NNWB 2PFKA 2RBKA 4A8HA 5LP6B 1V16B 2YHBA 3B1WA 2OXEA 3MMPA 4GPEA 1BXZA 5KQRA 2NMVA 4JJ7A 1NVDA 2Q07A 4PSCA 4RX1A 1I6LA 3A1DA 2X8WA 1EHIA 4NEHB 2EG9A 2IUSA 3KUUA 3EE6A 1O1YA 3VGPA 4DJJA 3L77A 1OAOA 3C6MA 3I28A 5I7EA 1V9SA 4PYKA 5ALSA 5AI4A 2NXNA 3TKLA 4UM9B 3WYCA 4L2IA 1TU0A 1ZW6A 1Y89A 4MKRA 1DEHA 2RD2A 5J5CA 5E4JA 4GUDA 1TCAA 3W3AD 1PWXA 1BE0A 1X8LA 3VXKA 2E87A 5KC8A 1WXDA 3CB4A 1VMDA 4M86A 1T9KA 1D2HA 1GYQA 3GJSA 4F4DA 3ZNPA 3EXFA 3T4EA 1XA3A 3JQAB 4K6OA 1I36A 3KLOA 4EAAA 1RM5A 2BPOA 3HA2A 3P52A 4A4DA 1ATIA 2NYAA 1J07A 1J39A 3PCRB 4NIMA 4ALKA 2IIQA 4M37A 4DS3A 2RB4A 4CT0A 1PU2A 3P97A 4WDQA 5H4HA 4D6PA 2GCPA 4MKFA 1ORTA 3H9GA 1WF6A 1DUIA 1WCIB 4EJSB 5I7VA 1AF7A 4KMRA 4EP1A 1OAAA 2Q21A 2R5NA 2ZB2A 2X8BA 1V1RB 1JPVA 3UHJA 2IYAA 1E60A 3HDGA 3SE0A 5KMGA 2A1IA 1JEJA 1PK8A 3ESDA 1CJVC 3TLXA 1ESZA 3OX2A 5INTA 3STTA 1V3QE 4BBJA 4XD7D 1LWOA 4MYRA 4MW9A 4NL4H 3VC1A 1O6ZA 3FFWA 2W2PA 3AF6A 1ZMTA 2IZ7A 2G28A 3RIMA 4P4SB 2BV3A 4BCBA 4MRMB 4DLWA 4D45A 3S0JA 4Y6GB 3L7AA 2XITA 2I4MA 1TVCA 1MH9A 1N5KA 2HWXA 2Q1YA 2ZOSA 3V55A 1W6RA 1M3SA 2GA8A 3AUAA 3Q9LA 3I61A 1QF9A 2DR2A 4KIUA 2ZAMA 4X1IB 4E1BA 4COOA 2QMZA 3DDUA 1LS1A 1NPTO 1HE5A 1NWHA 4LXYA 3PYLA 3PITA 3BL8A 4FEYA 3WL8A 2OHIA 4OHFA 5JJIA 4TSRA 3G9UA 2V7BA 3LBIA 4R7TA 3DNFA 2VAPA 2C1EA 1HRDA 2B78A 2PFSA 2PV7A 2PQ2A 2HFKA 4M8SA 4RJIA 4WNAB 1K2VN 4UFOA 3WXMA 2R85A 3OU7A 5K8UA 1EWRA 4KOEC 1JH8A 2NU6A 1D04A 3PFIA 1B8VA 4JDPA 1QQBA 1BE1A 1C41A 3BGOS 3W1WA 1MNQA 3BSYA 3MRVA 4F92B 3IPCA 1X1EA 4AZ0A 3EIUA 1AGXA 1T5LA 1O2DA 1MEOA 3PLNA 1GKLA 2O8NA 4HFMA 4PIVA 4LI0A 2UUAB 1E20A 1XO1A 2WZQA 3EZFA 5C1IA 4U8HA 3WK4A 1Z5WA 2IV7A 1EE9A 4NOJA 4RK0A 1Q3TA 3E3LA 2ZI7A 3H5AA 1C3OA 3Q85A 4QYIB 1B16A 1BDJA 4EVSA 5KSOA 4DRXA 4BEWA 2XCQA 3QVKA 4Z9AA 1VKHA 3GMSA 3VPFA 5JFGA 3AVUA 2A5DA 1C1XA 3SJZA 1KAQA 3BWXA 4ETMA 3MD0A 1H1DA 3JQQA 5B6PA 5LQUA 5FRDA 4KTVE 4X1YA 1E59A 3IHTA 4D8WA 1FEZA 3B2EA 4GMKA 4E22A 4HWGA 3TD9A 2DPLA 1WMAA 2RJOA 3DOJA 4Q5IA 4MGIR 5FJJA 1PDOA 1NI4B 3N6XA 4MDEA 3C24A 2I55A 4FDUA 2ZSFA 4GXRA 2H16A 4ILEA 5L4SA 4YPFA 3MRSA 4LHYA 4J0FA 1FS6A 4J90A 1WV0A 1OX6A 3UT5A 4CM9D 1GRNA 4N5IX 5B2ZA 3K92A 2W6CX 1NKVA 5FNVF 4WN9B 4HDAA 1R74A 2BT4A 1OTXA 2A5YB 1DJNA 3AOGA 4I9HA 4JH0A 5IVIA 1FE8A 1E2DA 1CQJB 4LNHA 4UMFA 3NMUF 4LMPA 1IRIA 5EOVA 5AVUA 4UPDA 3TQHA 1UMKA 1XK7A 2XVAA 4L6AA 3GJZA 2G06A 2CLMB 2OV4A 3AXSA 3AEYA 2YW9A 3HCCA 3UXHA 2X6RA 1FU8A 1EM8A 4BFLA 1VIVA 4MVJF 3QE0A 1H3FA 2F8MA 3RUHA 4Z0PA 3VPXA 3CC8A 1I7NA 2PH5A 1SHJA 4V0KA 4BVJA 5BQ3A 1FX0B 3NZEA 4RHCA 4H16A 1OH8A 1XJCA 1C5KA 1VTKA 2WYUA 4GQAA 1Q0SA 4HTFA 3PF9A 5C7YA 3SIRA 1OLXB 3U7IA 1I13A 4ZYWA 5AVZA 5LQRA 3R6TA 4G24A 4H6XA 1MFZA 4EJMA 2X0NA 1W9MA 1CLUA 2NUBA 1JG6A 1RAGA 2H4XA 3BFKA 4YRBA 2WKPA 4ZYVA 1T0UA 4NH0A 4YHHB 5DEIA 4JEIA 1J1IA 3QVOA 1EZ1A 2RK3A 2WJ3A 2H1CA 1JV2B 4EM6A 4ND1A 4G0NA 2O07A 2F3QA 5JC1A 3FPHA 2VTKA 2QTRA 3DZGA 3ITDA 2MSWA 2Q4BA 1RE0A 4HEA6 1XRLA 2ID7A 2JBAA 4LK2A 4N7JA 4NC9A 1W1IA 3RVDA 4JJ6A 1RTTA 4LHXA 3T38A 4MGZR 1R0LA 1Q84A 1EX9A 5HR5A 3SQMA 2N75A 1IHXA 1Z0AA 1UIRA 2AG8A 4AP6A 4CQNA 1EA5A 5JMPA 5CDHA 4DCCA 4YLGA 1TM7E 2M32A 3ZV4A 5C8YA 1ZITA 2QQGA 2OM2A 2G0TA 2RHJA 1YQWA 1QCCA 1Z8NA 2EV9A 2FGJA 4Y6OA 3TZEA 3PQEA 3CWQA 3GFOA 4ATNA 1CBUA 1BDMA 1LPSA 1OBCA 4B6JA 4DZZA 3BK2A 1E9DA 3WOVA 4FHGA 4OHPA 3VZCA 2YJ4A 1BVUA 1W5AA 2ZRIA 4Z8XA 1LI5A 1AQJA 1MT0A 1C0PA 4JVLA 4OFBA 1YR3A 3PJDA 2KHZA 1RM4A 1W19A 1XDSA 4G5HA 1WTCA 5FFNA 3TDNA 2QROA 5LD2B 4U2GA 2BFOA 3PEVA 3W9BA 1ODIA 2NYUA 4TKZA 3NHUA 4FFVA 2ZRNA 4TT8A 3JSXA 1JLRA 1FUUA 2O52A 1RJ9B 4XYGA 3V4RA 3RS7A 4WX2B 5AK3A 1LNZA 5G53C 3ENNA 4EFMA 4UUPA 3T0FA 4ARSA 1EQ2A 5DP2A 5LBTA 4Q21A 1R4ZA 3FBTA 2DY1A 4JQYA 5EYPB 1DB3A 4ZU1X 2C82A 3NHYA 3Q6IA 1KFCB 4I4TB 5SICE 2O48X 3T7AA 2VJOA 5CA1A 4DV3B 2Z2YA 1D07A 3RYIA 4MYTA 5JCZA 2XMRA 3KVOA 2VK1A 3FSRA 3G68A 4DQVA 1H1TA 1EJ0A 1HTWA 4MCIA 4DLAA 5DJ5A 1SXJB 1QX3A 2RHLA 5EXXA 4GF5A 2ONJA 1DBWA 3GVHA 3DCNA 4M0MA 2HW8A 2XYHA 1YIDA 4FYKA 5CYGA 3KXKA 4Q9IA 3BMOB 2FPRA 2OOKA 3MWEB 5H3LA 2JI8A 3MCZA 1N7HA 3VPDA 4LJ7A 4QQRA 1WPGA 3D0OA 3EDCA 5C3UA 2B69A 1DCKA 3V1KA 1SJ9A 1Y6RA 3S2YA 1WMSA 1OXBB 2ZE6A 4FCCA 5K6AC 2I6SA 2ZYTX 5JG7A 3CONA 1XDGA 2ZTSA 4LYDA 1EDOA 4HEHA 1S4QA 1U8CB 2YVUA 2R9VA 4PBRA 1AQNA 1JQ5A 4C7OA 4QPNA 4XIYA 1VCMA 2HK8A 2ZJ5A 5TS3A 3E82A 1XQVA 2BJVA 2I71A 5HQTA 1E92A 1QYIA 1ANKA 1TYAE 3F71A 2LIVA 1SC4A 3CINA 1P4SA 2D59A 4I2NA 4KN9S 2QVYX 4E5DA 3OFJA 4ZZ0A 1XJ5A 3ZCVA 3AESA 4XLTA 3LNTA 4TQ9A 2NUTA 1E1YA 3L0OA 4O1MA 4ITRC 1CEYA 3H0CA 2ERCA 4ZD6A 4EGJA 4OQNA 5D7BA 4DR5B 1N1EA 1GAWA 1UMDB 1F20A 2H0AA 3E1SA 1N1DA 2FQ1A 4M0KA 5HTOA 1NUAA 1UJMA 2C4KA 4DMGA 4CMHA 2GYYA 1RFLA 2FK7A 3HB7A 4CF5A 4EJSC 4D9EA 2XVYA 2D0OB 1VE5A 3JYNA 4FI3C 4ZJPA 1F12A 5L7WA 2ZUTA 4O2AA 2GYUA 4XR9A 4EVQA 2FEXA 4PZZA 4AX8A 3CCBA 4P9NA 5JW6A 2YWEA 1QO0D 3IEIA 4DZTA 1IBSA 1VGVA 1LBHA 1QKKA 5JYEA 1O0CA 1Z28A 1Z39A 4O33A 1NBWB 1IXSB 2H2GA 3E9YA 2BBSA 1ZU5A 1XLVA 2WDZA 3IH5A 1WXQA 3C7KA 3DBRB 1WW8A 3CRQA 3C70A 2ZIWB 1X8JA 4CQJA 1UANA 2J33A 1MH1A 5FTNA 2B6NA 2VVTA 2YWJA 1D4AA 2Q5OA 3TECE 2NPIA 4POOA 1YB1A 4UVIA 5CA0F 1AHIA 1P7ZA 4W1PA 2QZSA 2IH2A 3DAFA 2QBYB 3AF2A 4QJIA 1U2TA 2BP7B 2LZ0A 2WILA 3A2NA 4BNMA 1A88A 5AVYA 2JVIA 2R97A 1KNQA 1YOVA 3DWGA 4ALJA 3K0HA 4IR7A 3FWNA 4DBLC 1M2OB 4GX5A 5EHQA 4TKVB 1FUKA 1VCHA 2R25B 4GYYA 1Z0UA 1IOVA 3Q2IA 4G26A 4HC4A 1KDTA 1ESMA 1CR4A 3KPWA 5KJCA 1N0WA 3PNLA 4IDQA 3JQDA 4AMYA 2H1WA 3H5WA 5E1MA 3X43A 4BB6A 4KIWA 2FPPB 2ODPA 4D4IA 3BB3A 1LPAB 1CQIB 1JAXA 1H8ED 2AL7A 3QVTA 4N5DA 1CYEA 3CUVA 3X0DA 5HM6A 4FE7A 3HV0A 3WGHA 5FAKA 1AA9A 5AUOB 9ABPA 5ALGA 2H4FA 1R6XA 1E3WA 3TZCA 5KSWB 1IHUA 4BAGA 4KAJA 4W7IA 1BDBA 1B6GA 2JB9A 2P9CA 4TLEA 4XB2A 5F77A 5LNK6 1CJTC 2QTNA 2VJQA 3AHEA 1A5TA 3CGWA 4GX0A 4TYMA 1EP9A 5C4IA 4N5MA 1E2GA 3EVBA 4AMBA 4JUDX 4H4DA 3HYRA 2HA3A 3ZHQA 5ERYA 1SCJA 5BORA 1VB3A 1P39A 1Q0HA 3TBFA 2VRWA 2HA0A 5CGZA 3KQVA 2OQIA 2H2WA 3IAM1 1X0VA 1L5RA 3C8UA 1ZONA 2PFGA 1WHSB 4Y8VA 4YGYA 5L53A 3U37A 2OPBA 1JFTA 3EGXA 4O8CA 3VVBA 1ODFA 5FYQA 4FN4A 2A9VA 1PNVA 3AINA 4G1BA 3ZBTA 4OQDA 1ZNWA 3KCNA 3NBXX 1WQ1R 5IKMA 3NBUA 4IBOA 3I1IA 5DHSA 5BWLA 1H2HA 1RS0A 4QPCA 4M0CA 4M98A 2XSZD 2JHPA 3TF5A 4P3KA 7GPBA 3MLEA 5JH7A 2Z5GA 1SN7A 3A2KA 1UIMA 1A69A 1RVV1 4LOHA 3O9ZA 2DHEA 4RE6A 1QIGA 4WKOA 5TQ2B 1NX9A 1YE5A 3RTGA 3S5UA 3WSWA 2VA8A 1NG9A 4RGQA 1GILA 1ONNA 2QK4A 2WWFA 3OMLA 4KJXA 5DLPA 5AMXA 3UCXA 1F1BA 2P9YA 1EIWA 2Q4DA 3C16C 3KR2A 3GJ3A 4MWGA 4O4HF 3FPSA 4CKWB 4UNRA 1UFRA 3LPDA 4NZYA</