4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
1KKMA 2DPXA 3UXMA 1KO5A 2W6IA 1G19A 4EJSC 2G1JA 1I2DA 4YDSA 4B6EA 4S2EA 1G3QA 2O8CA 4Q1BA 2KE5A 4DCUA 2XJ4A 2B21A 3QEJA 5G3YA 5EP2A 4EPRA 1I4LD 2D7CA 4GP7A 1W4RA 1W1WA 1GKYA 5DE3A 1VCIA 4HI0E 1KI8A 2GKSA 4I99A 4R2IA 3TVDA 1Z47A 5FOTA 4BE7B 4B3BA 1M7HA 4DEXA 4H1UA 2ZTSA 2BEJA 1CTQA 4RKFA 5EQTA 2GJAA 3H86A 4OK5A 3CX8A 4DEYA 1XD2A 1N25A 4AG6A 2ZI6A 1GKUB 5DGXA 4LDJA 2ZITA 2EVWX 2WZQA 2VEDA 1EESA 2NZ8A 2J7PD 5SZJA 4AWXA 2FOLA 5CK4A 4Z8YA 3RHFA 1ZNXA 1QHYA 3NEYA 4PPQA 5JRZA 2ZJ2A 4CEHB 2EFHB 3BRWD 4Q9IA 1T91A 2B8TA 2Z5FA 2QORA 3M0EA 4LPKA 5AJYA 2G0NA 4E07A 4EPTA 1J2JA 5TV2A 4F93B 5LD2B 1G9XA 3I8XA 1XEFA 3MWLA 4GOJA 1RZ3A 1OKKD 2G88A 4K46A 3ZIAD 1KMHA 3RC3A 1ZNZA 2GBLA 2YJTD 3EPHA 2A5GA 4PPFA 1W5TA 2ZIAA 4ZKEA 3C5HA 3QIAA 2DYKA 3LDAA 4LJ8A 1G7CA 3GLFE 1XDBA 2PT7A 4HB2A 4IKEA 4CT4B 3CRVA 5GADl 1R6BX 1QVAA 2ZVQX 4IHQA 5EXTA 4LJ5A 2ZRAA 2Q21A 1G5RA 1QDEA 1R0WA 1WDTA 1X8JA 2Z6VA 1XP8A 3A1WA 3GJ8A 3THYA 2FV8A 3KJIA 4LHWA 3W5IA 3WMEA 3ZQJA 2QMHA 4NP6A 2ZRLA 2ORVA 2Q0HA 5FI1B 2BHRA 1YVDA 1JB1A 4EPXA 3I61A 1KKLA 3W5JA 1UKVY 3KKOA 4ZCLA 3OIUA 2IHYA 2IUUA 3LLMA 1DPFA 2VQSA 5C2JB 1TNDA 2RHDA 1ZINA 1NVUQ 4HDQB 4V03A 2GTPA 3PCRB 3RS7A 3LD9A 3NBXX 1EX6A 5D3MB 1XXHE 2JIZD 4LC0A 1KIMA 4RCZA 4QGHA 4QGGA 5JWHA 2VP2A 1GILA 3KB2A 4HAYA 5B64A 1XBTA 2WWGA 2PLRA 1ESNA 4C9BA 4HLUC 1JAIA 2OEPA 3PEVA 2RB4A 4DSOA 2ZM5A 2C8VA 3CKLA 4U5XA 4ARZA 3LX5A 3OEHA 3AVXA 1WB9A 2GEUA 2RGEA 5KSOA 1NLFA 5HKKD 1ZC3A 2A5FA 3Q85A 1T5IA 2QAGA 2GCNA 2O52A 1W2HA 1HURA 1UKEA 3ND8A 1UBFA 1W48A 3BB3A 3QXHA 5BWMA 1QHNA 3IIJA 1G64A 4QHYA 4Y0VA 1KSFX 5IRCD 4BEJA 2CK3D 4Q4HB 1G3UA 4RD4A 4WZBE 4M1OA 4AIIA 4C0JA 2IYRA 1S1MA 2WPDD 5E3HA 5J40A 3W9YA 2ERYA 2J41A 4KLNA 4M22A 3P4XA 4A8JA 1H8HA 2PBRA 3RS4A 3L0PA 2GA8A 5A5GA 4JLVA 2FWRA 2C96A 4PTLA 3E2IA 1QG2A 4EAQA 1XZQA 4DLWA 1A1VA 1WF3A 2DR3A 2VHJA 5JSZB 1PLKA 3IBGA 3TK1A 2GF0A 1P9WA 1G4AE 5EXXA 1X8LA 5B2ZA 4LGMA 3MGCA 1C4OA 2IA5A 2NPFA 3KUCA 1T4GA 3ZZUA 3QSYA 2Z43A 1RKBA 3CX6A 4QOSA 4C0SA 1FP7A 2IC5A 4F4JA 3WBKA 2WWWA 4MGIR 4JL8A 3A4NA 3LQQA 2JLXA 1EFCA 4L9WA 1Z6TA 1R0XA 4Q01A 1LTQA 1P4SA 4MYTA 1VIYA 2MMCA 1S96A 2EFEB 1S8FA 2GZDA 2CLSA 2G9NA 3IDQA 2V4ZA 3HYTA 1E9DA 2FEOA 1DG1G 3U7GA 2GF9A 3RS5A 2FE4A 1Z6AA 1ZM4A 4GP6A 1A7JA 3X1DA 3L43A 5E7IA 1HYQA 3CRMA 1CXZA 1SULA 2AWNA 2IT1A 3BORA 3CRRA 1MO3A 2AD1A 5JEEA 4TMVA 1Z83A 2AR7A 4Q5IA 2NGRA 1WBDA 3C7KA 2XTNA 4DUGD 3GLHE 5GJVC 3B2EA 5ANRB 1IBRA 4P4SA 1Z3IX 4HUQA 3GLGB 3CH5A 2GRJA 3EAQA 1U0JA 3ZD6A 4MRNA 1NMXA 1EWQA 4HATA 2C9YA 1SVSA 1XTJA 5DH9A 3RSOA 4Q4LA 4A4DA 3EPLA 4CEJB 1EK0A 1NN3A 2YVUA 3KTAB 3R9IA 3O8DA 4NKRA 1OE0A 4XWOA 1F48A 4D0LB 3ZVMA 4C4PA 2AN9A 2QZ4A 1CR2A 2IS4A 3U6KA 1OIWA 1QF9A 2ZAMA 1L8QA 2BCJQ 3LVRE 4Q9HA 2C5LA 1HTWA 1VYUA 5EP3A 1Q1BA 4TWZA 2V6IA 3QQ5A 4XTCS 3EPKA 1DE0A 1P9RA 2R6AA 1G8GA 4Q7LA 2WOJA 1CR4A 1G21E 1XXHB 4PZYA 4B6FA 4ZDKA 5JCZA 2QBYB 2J46A 3FWYA 5KNCA 3EWAA 4Q7JB 4V0ME 4MUAA 4B3CA 1SXJE 4A0FA 3G5UA 2EWVA 5GJBA 5F98A 2E87A 1TTTA 3GLIE 2CLCX 1N5KA 1E96A 1LV7A 1XNJA 2CL7X 2VRWA 4M1WA 4WOPA 4DLYA 3DVLA 3AP2A 1XCMA 1AS2A 421PA 5DHAA 2WSSD 1LF5A 1VG1A 3MWKA 4FCWA 3EC1A 2P5TB 1RVDA 1Z0AA 3AV0B 1R10A 1SVLA 1T3SA 4K81B 5FPTA 4NU0A 1CLUA 4B35A 3CWQA 1XRJA 4PXAA 2CXXA 1XJCA 5AJVB 821PA 2QPOA 2RGNC 2CDNA 2VP5A 1AQUA 1E2HA 5KUTA 5JRJA 1US8B 4JVMA 2MMGA 2KBFA 2ZE6A 5CJ2A 4E03A 4UNSA 3B85A 5CB6A 4GRAA 2ZRJA 5EE5B 4JVSB 3EC2A 5EP1A 4D82A 3LO5A 1J70A 1P5ZB 4NZYA 2J7PA 1G3IA 4EKDA 1KDTA 4NHOA 1Z63A 1GRNA 1T6NA 2J9RA 5FOVA 4G0NA 4OQFA 4L5BA 3K9HA 1TL7C 2WMOB 2DB3A 3VR4A 4B3DA 1A2BA 4D4MA 5JECA 3GFPA 4BFWA 1PVOA 1L2TA 1FMJA 1OXUA 1SVMA 5TY0A 2PL3A 2GXAA 1OKKA 1EFRD 3ZIAA 4QHTA 4GMDA 2CHVA 1E79D 2Z0MA 4YMWA 3A1UA 3NC1C 2PMKA 4BFSA 2FH5B 3P20A 2HCBA 1SXJD 1U9IC 1LB1B 4S35A 1TU3A 4LSGA 2P65A 3JVUA 2BM0A 2B7BA 3VU9B 2HUPA 5FOUA 5AUOB 4URVR 3ZVRA 4DJTA 1WQ1R 1E2PA 1XJQA 2IXFA 1N6LA 1T8TA 2QSZA 3CNOA 3LY5A 1GZSA 1G291 3K0EA 2VF7A 4II7A 1CJMA 2YZ2A 3GLHB 4PO8A 3VX3A 2O8DA 4HAXA 2C9OA 4NPHA 3F3YA 4BZPA 5FPHA 5B58C 1ZD1A 4ZIRA 2RMKA 3AUYA 2IF2A 1KO7A 3CLVA 3DL0A 4KVAA 1RRGA 3TGPA 4JYBA 4TYYA 1G6OA 2CE2X 4BLPA 5GJWC 3OIVA 3SOPA 3O8BA 3H0KA 2JIZA 1U98A 3ZVLA 4URUR 2MSCB 3W34A 4KV9A 3ZS8A 2LKCA 4B2IA 4M8NE 4DLTA 4I4LA 2JJ1D 3PFIA 4DKXA 3QEOA 3B1ZA 2ONJA 2REOA 2R6DA 1P2VA 2JLRA 4D4KA 2WJGA 5HKKA 1UDXA 2VF8A 4B33A 4A15A 1W0JD 1XTIA 4WIAA 2PX0A 5EXSA 1HQCA 1UADA 2VSXA 3K0FA 5J4VA 2X19A 4L8GA 3ADKA 2DY1A 4JLAA 3PV0A 5FOWA 2XTZA 2JGNA 3NHAA 4AKIA 3FB4A 3K0AB 4RD2A 3B1WA 4KFTA 3H2YA 4CEIB 3AF4A 3SDZA 1KI4A 5G53C 5BXQC 4HEJA 1NKSA 2BJVA 2WPDA 3KUDA 1NVVQ 3GLIB 4TT3D 4PSVA 1ZM3A 4TMTA 4JIMA 4V0OA 1IXZA 3DDCA 4IXNA 3CRW1 1ZMXA 5E7MA 1W4CA 1DAEA 3ONWA 4Q1EA 4RY2A 4D4JA 4DCSA 4US1R 1IONA 1LF0A 2XTMA 2Z83A 3AP3A 4IVQA 5EE1A 3GLFA 2F43B 2ZRFA 2FF7A 3UMFA 4CEJA 1KO8A 1YE8A 3UG7A 3VKGA 2JASA 3C41J 2RAPA 4P4TA 4D4LA 4M21A 5L3QA 1KNQA 2OFXA 1ZW6A 2EYQA 1T8UA 3L82B 1GFIA 3R7WA 3WYGA 4A82A 4DDWA 1KJYA 1SKQA 4Z8XA 2O8FA 3WRYC 1WP9A 3KDSE 2A7QA 1TUEA 2W58A 2D2FA 2V54A 3FDIA 4LYAA 4E22A 4OK3A 1N0VC 2N46A 3D8BA 1Z08A 2ZS8A 3R8CA 2BC9A 4HAVA 5IK2D 3AF0A 2R2AA 4DZZA 1JR3E 1KTVA 2QTHA 1XD2B 2A5JA 1R7RA 1U8AA 3EIHA 4XVQA 4D2IA 2H18A 3KJEA 3C5CA 3LRPA 3W3AA 2J7KA 4BASA 1OFHA 1GL7A 5EP4A 1A2KC 3SBEA 1G7TA 1OFIA 3LNCA 4W5WA 2FN4A 3ADBA 3MJRA 3WY9A 4A1FA 3LBNA 5LBIA 3AKCA 3SJBA 5FPYA 1KJWA 4F4CA 4UJ3A 4HB4A 4UNQA 3I73A 4RD3A 2ZRNA 3NXSA 2IYQA 3Q5EA 3U4QB 4HLQB 1P61B 4RD0A 4NCJA 2OXRA 2HLDD 3K9NA 3AVPA 4JBWA 3VKHA 1D9XA 3A1TA 4KBFA 2O5VA 1MRSA 1NY6A 3ETLA 4XVRA 1BKDR 5EE0A 4LBWA 2DFKB 3RDPA 721PA 4UNNA 3GD7A 3PUXA 1NN5A 2OLKA 2KI5A 1IAQA 3THYB 1D5CA 2ZE5A 2ZRBA 3K70D 1XD9A 2HF9A 4QGAA 4YXWD 3WBJA 2BCGY 2OCAA 4US2R 4IJMA 5F3WB 1US8A 3AF2A 4PPGA 1QHHA 3RS3A 1QHIA 2IUSA 5DO9A 4AG5A 2I4IA 4W5JA 2JLZA 1CR0A 2VSOA 4HAZA 2BDTA 4GDFA 2ZYWX 1MO6A 3MCAA 4RZ2A 1OXTA 4YMSA 3A4LA 5TMPA 2CJWA 2KBEA 4FIDA 4JLJA 4ZDJA 3ZVNA 1XTKA 3K53A 1YZKA 1GM5A 3ICEA 2D2EA 3C16C 2IBMA 1XMJA 3UK6A 1E4YA 4LYHA 3W6OA 4UXHA 3PG5A 4ARZB 1S2MA 1ZUHA 2QMEA 1JR3D 2JJ8A 1NG9A 5JMTA 2GEDA 3BH0A 3AGPA 4W9MC 5J5CA 4IFBA 2QAGB 4KLZA 4GI7A 2MSEB 4PAOA 3CF6R 3U3JA 1COWD 2W2XA 3IPYA 4QBIA 2QP9X 1LFDB 1Z6GA 4TYWA 3QOFA 1SZPA 3QF4A 2WSSA 3PUVA 5DLQC 2NIPA 3L0IB 1XEWY 1XU4A 2PEZA 1HE8B 4DLZA 2QPTA 1D6JA 3JVVA 3HR8A 1FZQA 3A4MA 3DEFA 2WMNB 4A8JB 2JAQA 4RVCA 5JWRA 3VX4A 3PQCA 4BLRA 3U6BA 1NG1A 3LVQE 3TMKA 3KXKA 2YV5A 5JCPA 2JATA 3UMSA 3Q3JB 3BIFA 5J4YA 4C2UA 5AUNB 4LHXA 1SVWA 1N6KA 2J3EA 1ZP6A 4QG7A 3LWNA 2W0MA 3QPUA 2ZI3A 1UEIA 1YJ5A 4UQOA 4E5UA 1AS3A 1UM8A 4Q18A 2HJVA 2VL7A 4Q9JA 3SHFA 4GPTA 3EPJA 1GIAA 1ZD9A 1Z6YA 2OAP1 4KXFB 2NO0A 1Z2AA 3K09A 2QSYA 2BBSA 4ZCMA 2WM9B 3AEZA 1U0LA 2J5XA 5KTYA 2IEZA 3PUWA 2IL1A 4G5GA 4HAWA 2FZ4A 1G6HA 2PCLA 5FTLA 3LBIA 2VHTA 2ZROA 1EFRA 2FDCA 1ZIOA 4YQFA 5KPDA 1RRCA 2ZR7A 1E79A 1Z0JA 1MO4A 4BFTA 1KHTA 5ELXA 2FPKA 2G1KA 2X2FA 2KB0A 4EPWA 1KGDA 2OXCA 4LI0A 4BZQA 1SXJA 2QUZA 3T61A 3UKDA 2QU8A 3CRQA 3HYRA 1UJ2A 4FCVA 2GVZC 1SGWA 3NHBA 4BLTA 4C0QC 2X1VA 5TXGA 3BJIC 2XEXA 4LZZA 2LCFA 4ZDWA 3TUZC 5FUXA 2RGCA 1E2MA 3B6EA 1VHTA 3BFXA 3TUJC 3PEYA 1OF1A 1ZRHA 1IJEA 1ANKA 1RIFA 4HUQB 4P4SB 4BEBA 4YMVA 2F43A 1N0UA 1CJKC 1F6BA 1MR3F 1KYIA 3MD0A 2IYWA 4B75A 4XJXA 1R5BA 3T34A 4MGZR 1G3MA 3AKEA 2QTVB 3LA6A 3O8CA 1DADA 1G7SA 3HP1A 4LBYA 2GCOA 4HUTA 3M1IA 4MITA 4PC1A 3H1TA 3EZ7A 4DWJA 4KSBA 2QP3A 5H8WA 3QENA 1IN6A 2D06A 2OZEA 4H9GA 5FTJA 4IDNA 2IXGA 4JJKA 2PMDA 2O8FB 3FMPB 1XMIA 4MRSA 3FMIA 4IVRA 4DXAA 5CB8A 2EFGA 3IGFA 4ITRC 2P2LA 3WNBA 5CM8B 2JJ1A 4I1OA 4OHVA 4B2PA 1Q20A 3QY0A 3CR8A 1J8MF 3DZDA 4NYJR 1CF4A 2IYVA 5L3SA 2J0QA 1GTVA 3LXXA 4FWIB 1E0JA 3F8TA 4IDPA 1W0JA 2BKEA 5FPSA 5IT5A 1W4BA 1XEXA 5HR5A 1JECA 4JVLA 4MKIA 4ERNA 4A0GA 3T5DA 2MSDB 2XB4A 1FQKA 3SFZA 5JHHB 3UIEA 3ZDQA 5JHGB 4HLDA 1NMYA 4URZR 4WBSA 1E2FA 1G3RA 4RD1A 4CVNA 3WRXC 4MA4A 3RABA 4DSNA 3R8FA 3EXAA 4IOLA 2ERXA 3P26A 4BFVA 1QRAA 2ODWA 3RSLA 2ZQ5A 2OE2A 1KI9A 4WZ6A 5KDDA 4TT3A 3U4QA 1UBEA 2IYSA 1KK2A 1L7VC 4TLAA 1JJ7A 4BLSA 1XMSA 3NG1A 1OIXA 1IN4A 2O0HA 3RRMA 2GK7A 1BMFD 5FBQB 2WBLC 4Q7KA 2WV9A 1N5JA 1E2NA 4G5RA 3KQNA 4OI0A 3B82A 2R6FA 2WKPA 3QKTA 3ZJYA 4C0KA 4ESHA 5L3VA 4ON9A 2WIAA 3SJCA 4EFLA 3U3MA 4QHSA 1E9AA 1U94A 4D81A 2QRZA 3C14C 5KO2A 2P6NA 4GBMA 1IY0A 1DAIA 4JVNA 4RSGA 4TLEA 3BS4A 3AVUA 5JJKA 2QA5A 2YWHA 3EW9A 2ANBA 1KK1A 1GNQA 3KKMA 4JJZA 2Z4RA 1ODFA 2P6UA 4JT2A 4Y0AA 2G77B 2FSFA 5IK2A 2J59A 3EZFA 2QI9C 4LC1A 4B48A 2C03A 2F6RA 4PAQA 4MQBA 2WHXA 3D7MA 5E7JA 1R8SA 1NIJA 2ZJ5A 4E09A 1YR7A 3V4RA 2XXAA 2P67A 2CL0X 5P21A 3HDTA 5JEDA 5M04A 4A2PA 1U81A 1FMLA 5LD2C 4BUJA 5AK0A 4A36A 2BBTA 2WVJA 2F9LA 4RZ3A 4A2WA 4OJQA 3AKDA 4O2RA 3EG5A 4DBLC 1VTKA 1W0KD 3C8UA 1XX6A 2D74A 1D2NA 2DFTA 4QL3A 4TL8A 2F3RA 3P27A 2HV8A 1IQPA 5HZKA 3U2QA 1KI6B 1DO0A 2PT5A 1KO1A 2V55B 1IJFA 2BV3A 2OLJA 1OXXK 4DLUA 4V0LA 3WNDA 4B43A 1K8RA 3REGA 2IX3A 3VR3A 1W44A 3ASZA 2HLDA 1KI2A 3IIKA 3LV8A 1OH6A 1W49A 3L8ZA 3H84A 4WA7A 5J4KA 3TQFA 3LH5A 4LUCA 2IEYA 3NDBB 5JJIA 5AJZA 2CL6X 4B3GA 3GJ6A 1G41A 1R8QA 4AY2A 2IYUA 2WJIA 3BERA 4YXWA 3BE4A 3VR6A 4D26A 4ZDIA 3TUIC 4DIDA 5JS7A 2O8DB 4DLSA 1Y63A 2GCPA 2QMUA 4ZIRB 4HSEA 4TQAA 4O25A 1ZVQA 3SYKA 2WIBA 4JZKA 1MO5A 1E2GA 3WYFA 1P62B 4ILEA 3D31A 4A2QA 3BH7A 1FNMA 3S1AA 3KZ1E 1E2KA 2H57A 1TPZA 1KAGA 4R7ZA 4FXPA 1AK2A 1BH2A 1ZM2A 3BB1A 2TMKA 3LX8A 4F91B 5UKDA 1AQYA 1G8PA 4M9ZA 4G5QA 2XZOA 4TMWA 1YZNA 2EW1A 1EGAA 5FI0B 2HYIC 1JR3A 1X3SA 1ZUIA 4TYQA 3SYLA 1TX4B 5DI9A 4EJSA 3K0FB 4HDOB 3CR7A 1COWA 1M7GA 4OBEA 4XTRA 3MFYA 4ZV4A 1PV4A 3SI7A 2OESA 3DKVA 3MRSA 2XGJA 521PA 1E2JA 5FTNA 1F60A 2D62A 1Q12A 1W7AA 3F5FA 1VYTA 5FL7D 2R8RA 2ZYUX 4PFSA 4PO1A 4TLBA 4TLDA 3QKRA 4PX9A 4URWR 4BFXA 2ZRKA 3V9PA 2B6HA 1R5OA 1DG3A 1UKZA 1ZIPA 4NL4H 5DISB 4PSAA 1W36C 3P32A 1XF9A 3GLFB 4M1TA 2DFNA 2KSQA 2ZAOA 5H1YA 1Z8FA 2AWOA 1CJUC 2BMDA 2HEIA 1E1RD 5L3QB 3GFOA 4AC9A 1N3BA 2XAUA 4HZIA 4B47A 3R7WB 3WYAA 5JJLA 4KU4A 5GVSA 1Z29A 3AGQA 2ZPTX 3AVTA 4QJ3A 1VIAA 3RRZA 4KFSA 2ZRIA 1IOZA 1ZM9A 2FA9A 2QEQA 3Q8XB 2RGXA 3CO5A 1SVKA 4TTPA 1NP6A 1XZPA 2IXEA 2GXSA 4TSFD 3NWJA 5JZVA 1N6PA 2ZRHA 1YZQA 2WKQA 1GOTA 1II9A 2JEOA 4IDOA 4B32A 5KDLA 3GJ5A 4LX0A 2REXB 4A0HA 1KDRA 2QGNA 1ZAKA 4RFVA 4W7SA 3RNLA 2C78A 3HR7A 1SHZA 4TZ6A 2ZU6A 1R4AA 2XX3A 2BBWA 4M9SA 3OHMA 4KODA 1Q3TA 1SHKA 4OQMA 1KZ7B 4HB3A 4DB4A 3LBHA 5AJWA 1P2SA 1YU9A 2V6JA 2ATXA 1DS6A 1ZU4A 5J47A 4BWYA 1TQDA 3L0SA 4LY6A 1MKYA 1S1CA 3TRFA 4LJ4A 2RGBA 1TMKA 1DO2A 2J0VA 1N5LA 4JL5A 4YDHB 3X1ZA 2WTUA 4JLKA 1KDOA 5IHPA 2F1RA 2ZSDA 5JI3E 3BWDD 3ZD7A 1IN5A 3GEEA 1XPOA 1Z0IA 1F5NA 4CGZA 2H5EA 2OCBA 2OM2A 2HCJB 4FMDF 4LJ6A 1Q1EA 3NEJA 3Q9LA 4D0GA 4PC6A 6Q21A 3BD9A 2HXSA 2QAJA 3B5JA 4HLUA 1UKYA 1NL3A 3PENA 4YMUA 4C0HA 1NVWQ 2UZIR 3QKSA 4PQYA 3QKUA 1YHNA 4C7OA 1CS4C 5FOXA 2PLFA 2F1JA 2XOKD 4MGYR 2YWEA 1TQ6A 1QHHB 4DSTA 4MUBA 3QXCA 4BLQA 4X8OA 1M74A 1X1SA 3U7FB 4GZMA 4OHXA 5L3RA 4CRWB 2VTKA 2CJWB 4GOXA 2PEYA 2ZSAA 2V3CC 2FFBA 4BRUA 2EFDB 1E1QD 3VNVA 1PJRA 4PHTA 1G5TA 3MG9A 3MMPA 2QE7D 3RWOA 3VR1A 3PUYA 1QHSA 2CCJA 1KI6A 4QKQA 3WHKA 5FTKA 4QNMA 5AR1A 1SKYE 4KFUA 1F2UB 4RD6A 5TB5A 4PZZA 3FVQA 4NH0A 3CX7A 5C18A 5EJEA 2HF8A 3CBQA 5AUPB 2XZLA 3WP1B 3VMFA 4QNRA 3BC1A 1E9EA 4KI0A 3CW2A 3CPEA 3MWYW 1BMFA 3QF4B 4YMTA 3FTQA 4KBGA 3WMFA 2ZRDA 2WWHA 1NJGA 4JLBA 4TZ0A 4GSYA 5GVRA 3BGWA 2QTFA 4F92B 1PLJA 1Q57A 1VKJA 4POAA 5CK5A 3U3OA 4A6XA 4IEIA 2VP9A 2VP0A 4KAXA 4R9UC 4KSCA 3W6PA 2A5YB 1U2RA 4PSKA 4AK9A 2ASEA 3FHCB 3P4YA 4CZ2A 4C30A 2ZJAA 4OYHA 4AYXA 4C0BA 3QG5A 2JJ2D 2WJHA 3FFAA 1ZBDA 3B1YA 4Q66C 4Q02A 5G41A 2EQBA 2VP4A 2JDID 4HAUA 5FUVA 3I72A 3LW8A 4BFZA 4GL2A 3RWMB 3THXA 1JI0A 2Q3MA 5LDDC 2ZUCA 3KXIA 4OI4A 3RANA 5L8VA 2O8EA 4PQFA 2ZI4A 1HA3A 3SJZA 4JKYA 5KU1A 4LBZA 2YINC 1ESMA 1KNXA 1G4UR 5HZHA 3CM0A 5SZHB 2P3SA 4OQXA 4PHGA 1W0KA 4JS0A 1P75A 3GCGA 1UDWA 3VKWA 2XITA 3IPXA 4F7WA 2ZE8A 4MGKR 3CF0A 5EUMA 2ZXUA 1AJEA 4G5SA 4P4UA 1KK3A 1ZNYA 4US0R 2W2VA 2AL7A 1OH5A 3SU8A 3CIOA 4ACBA 4Q48A 3TW8B 1KOFA 2FSIA 2C77A 4NYIR 4B3FX 3NC0C 3ICQB 3TBKA 2ORWA 4G5OA 3CNNA 1SXJB 1ZCAA 4HZUA 1I2MA 4D25A 1IN8A 2OBNA 3UANA 2OG2A 1CIPA 1U8YA 3NIBA 2FFHA 1ZNWA 3KFVA 2JLQA 3EIEA 5A0FA 3CB4A 3IO5A 3ZS9A 2FPMA 2ATVA 3MJHA 3DZ8A 3SJAA 2L0XA 3AF1A 4XD7D 5K8LA 2WJJA 1X86B 3HJNA 4V0NA 4QM7A 4P31A 4RFSA 2FPLA 3DHWC 2XB2A 2BMJA 2REBA 4M4SA 1S4QA 1TF5A 1JAHA 3I4LA 4JSYA 4DDTA 3TR0A 2GK6A 2GCOB 4TMZA 2ZR9A 1GNPA 2BWJA 1T3LA 4I81A 4KO8A 4FCTA 1TEVA 1NSTA 4EDHA 1FW6A 4I1SA 4TQUS 3L0OA 4DDUA 8OHMA 3GJ7A 4GT1A 5DSZA 1JEEA 3O8RA 3ADCA 4AKGA 2N1BA 3GEIA 1P9NA 4C3ZA 2DWPA 2ZEJA 1FX0A 4IOMA 5BYKA 5L3SB 2K5UA 1P6XA 3PITA 1W47A 2WWFA 5AJXA 2LWIA 1XEXB 2HDNB 1BOFA 1T5LA 1N6HA 4LRWA 3CUEF 3BH6A 1P73A 1J7KA 2RGDA 5EZ5A 2OSBA 3DO6A 3QJYA 4JKIA 3DKPA 5CYPA 4ZCIA 1OIVA 4ESVA 4BPBA 2O8BA 4MKFA 3AKYA 2VSFA 3I92A 2ZJBA 3GJ3A 3JZAA 2C95A 2GZHA 5KNBA 2RGNA 1G8YA 1KSGA 3I62A 2PH1A 3KB1A 2QRNA 1GP2A 3IIMA 5E4FA 5FL7A 4O3MA 2E9SA 1P2TA 5FBLB 1SKYB 1DEKA 4FW9A 3GP8A 4EQ6A 2PJZA 3TR5A 4QGFA 4V0KA 1WRBA 3E1SA 1KAOA 4HB0A 4NYJQ 1DARA 3TQCA 4C0AC 4MDEA 1SQ5A 1VDZA 1E1RA 2VHUA 4LPSA 4XWAA 4B71A 3B1XA 3GEHA 1N6OA 3BFVA 1PZNA 3QF7A 1E9SA 3EARA 2NG1A 3HU3A 2VA8A 1OH8A 3W90A 4Z1MD 2IYZA 2J0UA 3N2EA 5BN5A 2NQ2C 1WE2A 5F2EA 2NMVA 3SQWA 5FL3A 2D7DA 1EFUA 1Z5ZA 4TSFA 3D6TB 1VECA 4DSUA 1CULC 4EUNA 5K8UA 5C1BA 1OPXA 1L4YA 2RCNA 1Z28A 3K1JA 4BLOA 4XVUA 4RZXA 1FTNA 4B76A 4JLDA 1XPRA 2XXAB 3ZLJA 2J87A 3FOZA 4ASUD 2KJQA 4B2LA 1EWRA 2YOFA 1U9IA 2QQ0A 2ONKA 1S3SA 2P6RA 4LCBA 2GXUA 2JLVA 3B9QA 5EZ6B 2GBLC 4AD8A 2ZYTX 3SBDA 1BO6A 2OHFA 1DOAA 2BM1A 3AB3A 1YZGA 2ZVPX 1X1RA 1I4TD 1LS6A 3IKJA 2J1LA 1PUJA 5C4MA 4FN5A 3A8TA 3T1VA 2JLUA 1LY1A 4PR0A 1F2UA 4Q4AB 4M9QA 3A1SA 3RRYA 4KJZA 3TLXA 4CYMA 1IM2A 3QVVA 3QVUA 5FBWB 1LVGA 3B7GA 5CITA 3BXZA 5FR1A 2HT1A 1NI3A 2QM7A 3HPQA 1VG9B 2NO9A 2ZJZA 4IDQA 3OAAD 2OO7A 3FMFA 4IXMA 3R9XA 4PAMA 4OL0A 2GHIA 3SR0A 1IY2A 4Z54A 2P0EA 4NCHA 3ZZ0A 1C1YA 1J8YF 3THOA 1JQJC 1TEXA 4PANA 2VPPA 4IRUB 3TSZA 1LW7A 3V00A 5J4HA 3W3ZB 2QPAA 4PC7A 1RJ9B 1NMZA 3K70B 2GETA 2G83A 2GEVA 3GJ4A 3T1OA 4L4UA 2V1XA 2DFLA 2XOKA 4FD2A 4G1UC 4WXPA 4EPVA 2GAAA 5CM9C 2AX4A 1DAKA 5HCNA 3WP0A 3AVWA 2YYZA 1KI7A 5FPKA 3IEVA 3V4FA 4ACAA 5LPNA 3SE0A 1BIFA 5F9FA 3UPUA 1VYVA 3B9PA 4NYMR 3S1AB 4PO9A 2GJ9A 1XEWX 3CWZA 2IYLD 3DMNA 1P60A 2UZ3A 2FG5A 3VR2A 1E1QA 2QAGC 3PUZA 1E6CA 2RH5A 2W0SA 5E95A 3ZQ6A 2ANCA 4QBGB 4TL9A 2QE7A 1FL9A 3IEUA 1E99A 2ZI9A 1E2IA 1II8A 3DOEA 2V1UA 4DIEA 4G01B 3X1XA 4X8LA 1U90A 3B1VA 3VQTA 3AP1A 1OYWA 2Q6TA 3R20A 4EJSB 1YRBA 4P32A 5EXPA 1RPZA 1XWIA 2KWIA 2IWRA 3PJRA 2IS1A 3TH5A 3UWKA 1XPUA 5JFGA 1D2MA 5K8IA 1F3OA 3K9LA 3KJGA 1RYFA 2FNAA 4A8JC 4OHZA 5CJPA 5DIFA 1J90A 2PZEA 4RCYA 1OV4A 3RS2A 3A37A 4TYNA 1E9RA 4P33A 3T35A 5BW8A 4DVGA 3AQ4A 1H8ED 4ZKDA 2AFHE 4JL6A 3QXSA 4PC2A 2BIFA 4WXRA 3QKRB 5KDOA 3RLFA 3SZRA 2CHQA 3X2SA 3SC3A 4PQRA 2IK8A 1NKTA 4DCTA 3A6PC 2F7SA 1OFUX 2JJ2A 3ZH9B 3OEED 4Q4JA 2ZRMA 1AGRA 1FNNA 1GKIA 4Q7MB 1ZD8A 4LJ7A 3G0HA 4FINA 5FBRB 2JDIA 3SNHA 1Z07A 3A58B 4U7DA 2QY9A 1M7BA 1EFTA 4GNKA 4AURA 4DLRA 3SHWA 5DYIA 2O0JA 4N3NA 5H68A 2ZETA 3B8HA 3E5HA 4ZI2A 4KCGA 2I3BA 1JNYA 2ODNA 1NBME 2R6CA 3K9GA 4RZUA 1UEJA 2I1VB 1AN0A 2FJUA 2R6GA 3MSXA 2AK3A 2DWQA 3OZXA 4QJ4A 3X1YA 2C99A 1ETUA 3TKLA 1Q21A 4N0DA 1FUUA 2D4HA 2CVHA 3THWA 2OV2A 2R44A 5FOSA 1W5SA 2OCYC 1IY1A 1LNZA 2A9KA 5EE3A 4LYFA 2ZS9A 1NVXQ 2ODEA 3WNCA 4LHZA 1G8HA 1K5GA 4TL6A 4QFMA 1GRQA 2BEKA 4URXR 2CBZA 1E0SA 5CDFE 3I32A 1DVRA 2VO1A 4ZI3A 2J0SA 2XNSA 1DAHA 1EFHA 3QE0A 4EFNA 2HT6A 1QG4A 2A2ZA 2NPIA 2Z4SA 1OXSC 3FKQA 4XD7A 2IW3A 4JLOA 2ZU0C 1M6NA 2EWWA 2WWYA 2QENA 1B0UA 1G7RA 3EZ6A 4JLPA 5FTMA 3HU1A 5CIQA 3UMRA 3QPVA 1OSNA 2CCKA 4PHFA 4DB2A 1AKEA 3OE7D 4JLMA 1KI3A 1T3HA 2ZR0A 1UAAA 1R2QA 3KKNA 3SQXA 1DELA 3QKSB 2LKDA 2BVNA 4C7OB 2PJRA 3GLGE 5DN6D 5KSYA 3U61B 4KFRA 4B73A 5A4JA 2FFQA 1X6VA 1YZLA 2CMKA 2BMFA 3QXJA 2QT1A 4JYCA 4PHHA 3VFDA 1U8ZA 3B13B 2GZAA 2QG6A 5JLJA 1MOZA 1J99A 1CJTC 4O2LA 3RYTC 4YC7A 3EA5A 2R65A 2V8OA 3QI2A 3I5XA 1AIPA 3REFA 3SEAA 2OAQ1 4R98A 3T1TA 3NH6A 3N2IA 1M2OB 1F2TA 4X8HA 4LV5B 3AH8A 1NBMD 4GFDA 1UFQA 4IW3B 3VTKA 1Q22A 3EASA 1Z0FA 3EA0A 4F4IA 4J0QA 2YWFA 2GJSA 2C04A 4P0TA 4BFYA 5IF9A 2W00A 4Q4AA 1FP6A 2W6JD 1W36D 3AM1A 1TQ4A 4NDZA 2AD5A 4NTZA 1T9HA 3NVAA 1G18A 2IYTA 4OHWA 4DDVA 1P72A 5KPJA 3N70A 1Q1QA 5K8TA 1M8PA 1KDPA 1IXSB 2QL6A 2VIIA 3BOSA 1UBGA 3IBYA 4AI6A 1XTQA 5DNYB 5KNDA 3R9WA 2NOAA 3H4MA 1FOEB 3LXRA 2WJVA 4MYHA 1RJ9A 4Q1CA 1Z22A 1MABA 4FMBB 4MYCA 5TARA 3T12A 1CR1A 2VHCA 1VG8A 2ORIA 2QMOA 2W83A 4MRPA 1W4AA 4Z1MA 1MT0A 2BJWA 2QT0A 4DT1A 4A0RA 1T0HB 3W8RA 1ONBA 4OJKA 4AKEA 2BMEA 1E9CA 4DCNA 1PUIA 1GSIA 2QN6A 1JPJA 2ZYVX 1I4DD 3UWOA 3PEUA 4NMMA 1KJZA 2FEMA 2FU5C 4IOKA 4ASUA 3THXB 1XJ0A 2CE7A 2H17A 2PCJA 3KQHA 3B78A 4N0EA 2GVDC 5HE8A 2O8EB 1HT1E 1HUQA 3I8SA 5C4GB 1CBUA 2FSGA 3NBZC 4TN1A 1S9HA 3FKSD 2JA1A 4FMCB 1ZUNB 4B3XA 4Q1FA 2IWHA 1YR6A 2IYXA 3HU2A 3M4YA 4KVGA 1W36B 1G17A 4FWTA 1GL9B 1UF9A 1YKSA 2CHGA 2VHQA 3FPAA 1OLOA 5DHFA 4LJ9A 4TMKA 4NONA 4MKHA 3RVBA 1D9ZA 3FE2A 1TAGA 5BN4A 3OAAA 2C98A 1Q0UA 2FSHA 3D3QA 4HZUB 1OFTA 1XTRA 4CT5A 1JXMA 3GFTA 3NKVA 4LBVA 2CEAA 1KZGB 1OHHD 4QBHA 2F1IA 1GDDA 2JLSA 3OFND 4B74A 3KQLA 3TJZA 2Q9BA 4Q1DA 2XNDD 1AZTA 4M1SA 4TL7A 4D6PA 3M6AA 4YLGA 3BFKA 1HE1C 3CONA 4RFSB 4C0LA 1Q44A 1ZC4A 3KFXA 4NCKA 1CKEA 2Y8EA 2XZPA 1GNRA 1QBKC 4LJYA 5DI3B 4WVFA 2OUKA 1P7CA 4HDCA 4L9SA 1KK0A 4AKHA 5B30A 2VP6A 4OQLA 1D8TA 4NYIQ 4DRZA 5FBVB 2CCGA 3EX7C 3KKPA 4OK6A 121PA 2VLIA 1VG0B 4LOAA 5JS8A 3QNUA 5BN3A 3KKQA 1Z2CA 2RGAA 1FX0B 1TF2A 1AS0A 1NJFA 1YR8A 3FHOA 1II0A 4Q9LA 1W46A 2IUTA 2ZJOA 4MDFA 3NH9A 4ABYA 1IN7A 4MRVA 1FFHA 4MH0R 5IDVA 3WMGA 2FGKA 2ZJ8A 2HYDA 3DOFA 2WWXA 3TAUA 2O8BB 3AVVA 1OH7A 5CLLA 1OXVA 3I3SR 3IO3A 3CZPA 2RKOA 4U00A 3RRNA 1H8EA 1CJVC 1TADA 3CZQA 1A5TA 4Q1AA 2WKRA 1FQJA 2QQEA 1EX7A 1OB5A 3Q7QA 4Q9KA 4EQ6B 3VAAA 1CU1A 4IEEA 1KMQA 3TW4A 4N1AA 2ZUBA 4CEHA 1R0ZA 4LWZA 4PPNA 1EXMA 1O3YA 2FMXA 3OEEA 4IFEA 4IDHA 2ZE7A 4HLCA 3FFBA 1Z06A 2BKUA 2CVFA 2GWHA 2QP4A 4F38A 2B92A 4D80A 2V9PA 2YC2C 4JBXA 1RRFA 4JMPA 2A5DA 1AKYA 1CEEA 2J0UB 1W2GA 1E9FA 4OI2A 1ZJ6A 4OHYA 2X8AA 1O87A 2AHOA 2CNWD 2ZSBA 1OT3A 4LHYA 1VCNA 4OI1A 1R0YA 4EPYA 4M53A 3K0CC 4A6PA 3ND9A 1DTSA 3IQXA 1K5DA 2DBYA 2ZSFA 5FH9A 2A3RA 2B8WA 1JR6A 4L16A 1E4VA 2ZREA 3AVYA 3KX2A 2X2EA 1BYUA 2Q3HA 3KXLA 2W2TA 1G8FA 1ZYUA 3MUFA 1N6RA 4UKDA 1JXOA 2DWOA 2GJKA 4UJ5A 3GPLA 3U44B 2FZLA 4G3XA 4DCVA 2ZJYA 1XMVA 2CLDX 2EYUA 2RGGA 3RS0A 1RE0A 4O0MA 1WBBA 1EG7A 1TU4A 1MRNA 3BBPA 5FR2A 1VCMA 3QBTA 3KQUA 2WSMA 5D3MA 5KYKA 2ZRPA 1FPMA 2DCUA 1YZUA 2OILA 2YKGA 4PZLA 3Q7PA 2FFAA 3VHXA 1Z0DA 2J45A 2XSZD 4X8MA 2GJ8A 5CYOA 4EFMA 3NTUA 1JEDA 3B60A 1N6IA 3PR1A 5F9HA 1DAGA 4R2HA 3AF3A 2YOGA 1M34E 2VH5R 1N5IA 1KY2A 3OE7A 4LV8B 3QUSA 3A1VA 1XD8A 2IF0A 4M2LA 2BOVA 4MKGA 1P3JA 4TTRA 4FI3C 5HE9A 3T15A 4B44A 1ZM7A 2AXPA 3DPUA 1KSHA 3U60B 1GL6A 2WICA 2WWIA 1E3MA 4ZPXA 5DN6A 5KSZA 4Q4HA 3PIRA 2AXNA 5BQ5A 4BECA 3LLUA 4M0LA 1HQYE 1AGPA 1RYHA 1BYIA 2SHKA 2V7QD 5FUYA 2A78A 4QM6A 2F3TA 3LQRA 1BS1A 5EUQB 1NLYA 1RW4A 5DYGA 2OCPA 1NRJB 2G0TA 3NBFA 5JSZA 3RAPR 4BRWA 1T0JB 4DLVA 3J81k 2W6ID 1HEIA 4BFUA 1NBMA 2GNOA 4Q19A 2C9CA 2QM8A 4EIWA 5HPYB 2ZANA 4GZLA 3WXMA 1II8B 4D0NA 4W5HA 5JWOA 3KJHA 2W6JA 1NLZA 3X1WA 2VBCA 4TMXA 5CLQA 1E98A 1HY3A 2PX3A 3L8YA 1SVIA 3C4JA 4A9AA 621PA 3AVQA 1JJVA 2ZI5A 4R71A 3ADDA 2ZRCA 1ZU5A 5C46F 5SZKB 1HT2E 2WAXA 1QVRA 4DLXA 3GJ0A 3MWJA 3IUYA 3W6NA 2F55A 4I1VA 3CF2A 2WAYA 3E70C 4KYUA 4V02A 4LHVA 1YRAA 3GJXC 4NYMQ 5CDFA 2EFCB 3TSOA 1OB2A 4CIDA 2RHMA 1HH4A 4M1MA 1IXRC 1E2DA 3EIQA 1VPLA 1OJLA 4IOJA 1XB2A 3SYNA 1S0UA 2CK3A 3ZGXA 3IILA 4JLNA 1E2QA 4WZAE 4H1VA 1A4RA 4Q4JB 5B57C 5DI3A 1HV8A 3FGNA 1KSJA 1TUIA 3K09C 1B23P 1E2EA 2GAOA 1DAFA 2GESA 2ZSEA 1E9BA 1WXQA 1RFLA 3HWSA 5GJCA 1A82A 4I1UA 3EWSA 1NN0A 1TF7A 3GLGA 1G20E 3ZZTA 4BZXA 4TQ9A 1N2CE 4C2TA 3CH4B 3TIFA 3CPHA 3FKSA 3KTAA 1VCOA 2O8CB 4LV6A 3UG6A 4NCIA 1SXJC 3PEWA 1MH1A 3ZYCA 3TE6A 2IHBA 2NTYC 3EZ9A 3CPJB 4Q03A 4XOIA 3THWB 1K6MA 2BBOA 3IQWA 5LB4A 4PC3A 1U99A 1WA5A 4ZO4A 3OIYA 3DMDA 1KY3A 4MYUA 1S3GA 2PZFA 1NNEA 3K8YA 3P1JA 1WMSA 2B7CA 3SFVA 4RKEA 1H65A 2HJGA 1LS1A 3SS8A 1R5NA 1S9DA 2H1LA 3KQKA 3VR5A 1JQLB 1OHHA 1XXHA 3OFNA 3K0CA 2QBYA 2DHRA 2XNDA 4RJLA 1XCGB 4XSHA 3I1FA 2HXYA 1CRQA 1YZTA 3GQBA 1E69A 2G6BA 3OEHD 2H16A 4P3YA 1GAJA 3VHLB 1NN1A 2OT3B 5KHOC 1C9KA 2QGZA 1Y3AA 2H7VA 2H92A 4WAUA 4UNRA 1KMHB 2JCSA 4WW0A 3LW7A 4L15A 1UBCA 1Z0KA 2Q9AA 3AUXA 2GXQA 3EZ2A 5AWFC 5TVKA 4DUGA 3QG1A 1G5PA 1OW3B 2F9MA 3JZMA 3TVTA 4XSGA 1VHLA 3QBVA 3DM5A 1P2UA 4QC2A 1E0AA 1OYYA 1YR9A 5HTKA 3QPWA 4FMCF 1WCV1 3PXGA 4KHZA 3W8NA 4NBSA 3TSWA 2UVQA 3ASYA 4UXIA 1H8HD 1UPTA 2UKDA 5CIWA 5H70A 1AZSC 1Q3HA 1E94E 2NO6A 2OFWA 3U44A 4AYWA 4AYTA 4UNPA 5SZIA 1JBKA 1V5WA 1RRPA 1F2TB 2AKAB 3AVOA 3OESA 4JSTA 4Z51A 2EU8A 1G1MA 3K0SA 5FUWA 3BAFA 3BK7A 1ZCBA 2AKYA 3OIWA 4UXJA 1E32A 4BGDA 4K8OA 1ELOA 1L4UA 3IHWA 4NE2A 3I5YA 2JLWA 4OKSA 4DC9A 3CNLA 1JPNA 3T5GA 2N42A 4LK2A 2D3WA 2QNRA 3BB4A 4XIGS 3OF5A 3FYHA 1AA9A 1GRRA 2GILA 5G3ZA 1Z6XA 5AUQA 2FX3A 3Q72A 3FMOB 2OBMA 3T1QA 2H8KA 4XWKA 3TAHA 1FUKA 2JLYA 1GVNB 2OBLA 4KYIB 5D3QA 1GUAA 3TNFA 2YNMA 3U3RA 4MRRA 5KOYA 1MABB 4QRHA 3Q5DA 1G16A 2A30A 4XH9B 5G40A 4KITB 4BQSA 1QHXA 4URYR 2R9VA 2YOHA 4DT1B 3O47A 4CF7A 2R62A 4LYJA 1U0HC 2ZS7A 2CNWA 2O0KA 4TLCA 1V43A 2QROA 3A36A 3NBYC 4CDGA 1SVOA 4OQNA 3WHLA 3VU9A 3UATA 3G82C 3NDPA 3PVSA 1TQ2A 2G3YA 3ECCA 3LFUA 3GMTA 4HYYA 1E2LA 2ODBA 4DHEA 1PLLA 5BYJA 3MLEA 2VYFA 4Q47A 3QXXA 1KI1A 1IHUA 2WOOA 4QJ5A 3RC8A 3T06B 4GOKA 5TDHA 4Q21A 3GLHA 1CP2A 4QBFA 5HCIA 2E1RA 2NZJA 5LB2A 1N0WA 1KO4A 3F0TA 1M1YE 3U7EB 1XCPA 221PA 2YHSA 4FMDB 3C15C 2IS6A 3U7HB 2ECKA 2GDJA 1NY5A 1QHGA 3HPRA 5J4LA 5JBQA 2OFOA 4NCNA 2XJ9A 1JALA 1NVVR 3LAWA 2Q9CA 1RC8A 5FFMA 3N5CA 2XSZA 2X77A 1GWNA 2AFIE 2FGJA 4JBYA 1NSFA 2AK2A 4GMXA 4QXAA 4TTQA 4LJAA 4CW7A 3K70C 3IHLA 2ZUDA 2IS2A 2WJYA 2ZI7A 3DM9B 5EE9A 4B34A 4YONB 4M1KA 4IVPA 2I1QA 4U02A 4TYPA 5KSPA 4M9XA 1CRPA 1XTSA 2PZGA 1FTSA 1E0KA 1DBSA 2NO1A 4M1YA 3U5ZB 2F1HA 3K0AA 1YQTA 4Q00A 1AM4D 4V0MA 1NIPA 1X8KA 2P5SA 3U3KA 4CEIA 1QZXA 2NO7A 3MAAC 2YWGA 2V7QA 3FHTA 1GG2A 2C2HA 1NF3A 3GLIA 2Q3FA 1GITA 1DAMA 1N6NA 4A92A 1MV5A 1VMAA 1D2EA 3VNUA 1Q1ZA 2YC4C 3L2OB 3KL4A 4JT4A 2IYYA 2ZRGA 3SN6A 5JI2E 1XFAA
chains in the Genus database with same CATH superfamily
3HRKA 1KO5A 3RFXA 1G19A 4JUDX 3OJFA 1SFRA 4E7PA 1WUIS 3ESYA 5JCXA 1R6DA 1ZIDA 4UVDA 4YRIA 4ZFNA 4ZJYA 3TZBA 3K71B 1AKRA 3A05A 4E12A 4EO7A 1RYMA 4DCUA 3ONFA 3F6CA 3QEJA 2HBYA 4IXTA 1I4LD 3OEYA 4DPLA 2Q8NA 4K88A 4RPJA 1IZ8A 3M34A 3QBEA 1SJ9A 1VCIA 4HI0E 1A4UA 1KI8A 2GKSA 3B70A 4YLEA 1Z47A 5FOTA 1KU0A 3IVCA 2BEJA 2HLHA 2I9PA 1CTQA 4RKFA 1QU3A 1PS9A 2PS1A 4C7VA 4OK5A 3EG9B 4QU5A 3SJUA 5A05A 3IOEA 4AG6A 1NQAO 1Q3KA 2GLTA 1C3OB 4LDJA 4F2GA 1K1EA 2NZ8A 4PICA 2TSYB 3AC0A 4KIJA 4R1UA 2FOLA 1HNZB 1LSSA 3SVTA 3H2IA 5ELMA 3RHFA 2XDAA 1MC8A 4G63A 1THZA 4WY8A 4L9AA 1FDIA 5JRZA 4CEHB 2EFHB 2VHWA 1T91A 2Z5FA 3N6VA 3VR4D 5MF6A 1XLWA 2G0NA 2I7DA 2VAWA 4AJ4A 3SQNA 4UU1A 4YYEA 3I8XA 3W7VA 1UQTA 4GOJA 3OZDA 3I9KA 1W19A 5KQPA 1M34A 2BTQB 2Q5HA 3WX0A 4EGQA 5LUAA 1RLIA 5LVAA 2IQIA 3NNNA 2GBLA 4RACA 4C05A 3EPHA 4UU0A 5ER9A 5IZCC 1RKXA 3ZWKA 1KGSA 4JCOA 4NJEA 4EX6A 1PJCA 1RWNA 2IHZA 3A1EA 1WCYA 3BXEA 2XUHA 4E4TA 4KR2A 2YDXA 3CRVA 4HP8A 5A0TA 2HCFA 1R6VA 5EXTA 4LZJA 3ZWVA 4LJ5A 5K05A 2Q2QA 4E2XA 1PTJC 1XMOB 1X8JA 2G17A 5AI6A 2Z6VA 4UPDA 2WMDA 1W94A 3A1WA 3GJ8A 4N3GA 5AJHA 1IJBA 4Z99A 1UBHS 4BATA 1MJGM 2P4UA 3ETEA 4YHBA 3WMEA 1MGOA 4NP6A 3C5WP 5KAMA 2ORVA 3DWGA 2PVSA 1PZMA 3ROEA 5K20A 1JB1A 1T5BA 4O4IB 3I61A 1P39A 3W5JA 4CPDA 5B3AA 1U9YA 2C2BA 1N2SA 2BGUA 4UM7A 3DFMA 4FOLA 4OQPA 3DHVA 4ZCLA 3LLMA 1DPFA 1BC5A 2PL5A 4GKAA 3E3NA 1AK1A 4YALA 4EVSA 1TNDA 2X7XA 1NVUQ 3A3NA 4HDQB 4V03A 2YICA 3I0ZA 4CTKA 4FHFA 4HNQA 3S99A 4TV9A 3NBXX 1EX6A 2DETA 2YJ4A 4OF4A 3T8YA 1BVRA 4BX2A 3F78A 5BPFA 3C70A 1P1BA 1ORIA 2I2WA 2I99A 3FF4A 3KB2A 4KX5A 5JWHA 3W9SA 5B64A 2BGLA 3CT6A 1E1CB 1BWRA 3M70A 2PLRA 5K8VA 4BNYA 2OEPA 2C54A 5K3DA 2RB4A 5LC1A 2HXGA 1LBEA 2FQ1A 2W43A 1TEHA 3EVFA 4XWTA 3ZNNA 3IH5A 2ZM5A 4CQMA 3V8NA 2GEUA 1NLFA 2ACWA 4GI2A 5K03A 4L08A 1QO0D 1ZISA 3OQHA 2XUKA 3Q85A 3NIDB 5DCUA 3B36A 2QAGA 4FYKA 3S70A 2WTEA 4L9RA 2O52A 1HURA 3KKLA 3ND8A 3COJA 1G64A 4IHJF 4EKYA 4TUYB 1JWBB 2QL7A 2XBLA 1G3UA 3W2GA 4RD4A 2CZQA 2ZIEA 5JSYA 5AKHA 4M1OA 4AIIA 1BRMA 1WY7A 3HA2A 1Q91A 2IYRA 4GZ3A 4KOEC 5E3HA 1W35A 3O94A 5J40A 1E7MA 1T9ZA 3OO0A 3ZEIA 2JI7A 5B55A 4ZYLA 1H6AA 3KOWA 3BWEA 1TM3E 5LLTA 3RS4A 1N4AA 4UHDA 3PHGA 2FWRA 4HWKA 1JEYA 4LZLA 4EHKA 3OOHA 4AX4A 1QF6A 2BHSA 2IPAB 2RHWA 3IAXA 1DNPA 3O84A 3OUUA 3UT5B 3DFFA 2ZBRA 1N2CA 3LOPA 3PRJA 4NESA 3FIUA 2IOQA 3MGCA 4OUKX 2GPYA 3UK7A 1C4OA 2B4KA 4YRGA 4N41A 3KV1A 4M0EA 4QDZA 3QSYA 2Z43A 4N0MA 5CT9A 2WKSA 3VI4B 2IC5A 4KQ2A 4B4VA 3NRBA 2ISQA 1NXXA 2NQ8A 3GYGA 2MSWA 3NM5A 1AG9A 1O5OA 1WZIA 3A4NA 1N75A 5K3CA 4IIJB 2H4HA 2MHCA 2O2YA 4OH1A 1EFCA 5AW9A 4B83A 4UBNA 3JATB 1XR3A 5BNTA 1S8FA 2GZDA 1E7QA 1J0EA 4BBAA 1MRZA 3OQOA 3MWGA 2V4ZA 4NR0A 3HYTA 1Y98A 1EAMA 3LUKA 1E9DA 2XV1A 2IDZA 5EWMB 2X0FA 3SR3A 1DV1A 4MS1B 4QBTA 2HNKA 1XA0A 2KPOA 1RXIA 2YJGA 1GA1A 3L43A 1SD5A 4P93A 2QNBA 1B76A 3CRMA 1CXZA 3TCXB 2PYIA 3VBEA 1H9CA 2YHBA 1CUDA 3QI7A 2BLNA 4Y1GA 4LJRA 2IT1A 2DFDA 3OECA 2IDJA 4KAFA 3R3HA 1DLIA 2BFCA 2OO5C 4S1TA 3MTBA 3WBFA 1MO3A 1TAHA 2AD1A 3BHMA 3WWDA 4AAYA 4C7XA 5B2EA 2HA2A 4HEQA 4MS4B 4Q5IA 3DBRA 3SKYA 4HDSA 2JS7A 1WBDA 3C7KA 4JEUA 4DDMA 4ND5A 4JQSA 2YWXA 4DLPA 4JHXA 5GJVC 3TM5A 1SCKA 1EEXB 1IBRA 2I29A 3B2EA 1CB7A 4ROTA 7AT1A 3GLGB 3ZD6A 3EAQA 2ENWA 4MRNA 1NMXA 2BP7B 2GI4A 1GPBA 2EFYA 4LOKA 2B5VA 1XTJA 5I7UA 4Q4LA 4X54A 1EK0A 4TROA 3D7NA 2DEUA 3COYA 3R9IA 2DQYA 4R40A 3CZ4A 5MHTA 1FQOA 4NKRA 2WINI 4DV4B 3WLJA 4EW3A 4D0LB 3R5HA 1V3QE 2F48A 2R7AA 3V80A 4PF1A 1EXVA 1YDHA 3U6KA 1OIWA 1ZPDA 4RIEA 4X44A 4YJHA 2CMDA 2QLMA 2IS4A 3KTFA 2PLNA 3CIFA 2C5LA 2XUPA 4TXLA 2X0NA 2IIPA 2O07A 3F3KA 1M83A 3WK4A 1FFEA 2E48A 3I6IA 3L6EA 5BSRA 2VNIA 5EP3A 1P6UA 3DD1A 3LL4A 1Q1BA 5ERGB 3FZEA 3B6KA 3DLAA 2WUGA 5SYMA 3AEYA 4WKOA 2Y1GA 1DE0A 1FJGB 2O7NA 3MGGA 3F7TA 2R6AA 3JAWA 2HIGA 5BSUA 3LIIA 3W6UA 1CR4A 1G21E 1XXHB 2ZUSA 3IX7A 1C3LA 4PZYA 1YJ8A 3HGMA 4B6FA 1B1CA 1WMFA 2C7GA 3CC8A 4Q15A 3RW9A 1NTRA 2KW5A 4Q7JB 1P4RA 4QIHA 5BUQA 3MJEA 3CV3A 1TI7A 2X23A 3AK4A 3JQEA 1PV2A 1SXJE 4MUAA 1U3TA 1KORA 3NGLA 1VP3A 2JGEA 5GJBA 2B82A 2CF6A 5CVEA 5ICEA 4DDHA 3GLIE 3VDMA 1N5KA 2J5BA 1C2TA 1LV7A 2CL7X 1HZZA 2HLNA 4AU1A 4DLYA 4E6PA 3KYCB 4XAQA 5IT4A 3R6DA 1XCMA 1AS2A 4QDXA 4P98A 1XNQB 4AMUA 4GX0A 3DFIA 2REQA 4XIFA 5DHAA 1O97D 2VXCA 3AX6A 3Q15C 3MNFA 4J4BA 4BP9A 3L7DA 4GNRA 1NTOA 1W1UA 3G49A 4FWBA 3HUDA 3WLRA 3A1CA 2P5TB 3GCWA 1T1JA 1Y9DA 1RVDA 3S28A 4WZBB 1EVKA 4W1QA 3AV0B 2Y1WA 3NHRA 4RXTA 3U4DA 1MD9A 2SCUB 3FOCA 3IA7A 2WU8A 2W6NA 4NU0A 3TOXA 2WG2A 1CLUA 4O63O 3TTWA 2R6HA 4JC4A 2DE0X 1D6MA 3RVJA 1XJCA 2PGAA 2Q6LA 4WMLA 4AB1A 4OB8A 4BNTA 2OBFA 2AUTA 4H15A 1E2HA 1HGXA 4IMPA 5JRJA 1R8JA 3LU1A 2QD2A 4NVRA 2KBFA 3DR3A 3ZDZB 1ZK4A 1SBTA 3WK6A 4UNSA 2FOIA 4IX1A 1PIWA 4E30A 3PJEA 4CLOB 5AO9A 2ZFUA 2ZRJA 1W1IA 4N8EA 1N7IA 4TLMB 1H2AS 3PIDA 1OXBB 4Y7DA 1J70A 4GM1A 1P5ZB 1Y5LA 2VBGA 5B1HA 4NZYA 2H0QA 4EKDA 1KDTA 2A9QA 1FMCA 3FA2A 4KIUA 1T6NA 2Q0QA 2EG9A 3WAKA 5ELXA 1OROA 1ZN9A 1L4FA 3F71A 1XZLA 4L28A 3VXKA 1ICIA 3VR4A 1JVBA 4BFWA 1PR1A 1QHEA 3O7MA 4NENA 4BO4A 5FUQA 2RHGB 2PL3A 2QRLA 2VJMB 2YJNA 5CEJA 1RIIA 4QHTA 2IHTA 5EKSA 4GMDA 3ORYA 1E79D 1VP9A 2AOTA 3GX1A 3QE2A 1ZD2P 4EJMA 4R84A 1VBNA 4PGGA 4YMWA 2J85A 3NDIA 3OPNA 4P08A 2QWXA 4XUDA 1N9GA 5B3JC 1SUFA 1JQ5A 1U7OA 2HCBA 1U9IC 3GG2A 3OP1A 4E2WA 3BRQA 3OD1A 5FULA 4KREA 1WIWA 3VU9B 2RH4A 5DBHX 3CA8A 4DJTA 1EWTA 1XJQA 1N6LA 2O4CA 4OLJA 1RHRA 4AM8A 3ZOKA 1VSQA 3LY5A 1E7WA 3IMFA 1B3RA 1GZSA 2I67A 3MWEA 4D9IA 4JCCA 3IKVA 4PRLA 4AXXA 1SVNA 1U3UA 3QNWA 2VUSA 4ZAGA 5HMLA 4KQWA 3I52A 1TT5A 3F3YA 2Q7XA 5FPHA 4MW1A 1UANA 2ZWAA 3NX4A 4XM0A 3UZUA 1C1XA 1SUWA 3CLVA 2WWTA 3KR1A 3GPBA 3N0TA 4KW7A 4I55F 3STWA 1OR8A 2HRDA 4TMFA 3SOPA 3O8BA 3QX7A 3R3XA 1UT8A 5IT0A 1CW2B 1FTGA 2JZNA 5FNZA 3WGNA 4OBXA 5DP2A 4ZVSA 4ALKA 5JXHA 4ERXA 4FGZA 3C6QA 3K0BA 4KAAA 3W34A 3ZS8A 3LTNC 3LMKA 2ST1A 5ALTA 3FTEA 3ZYZA 1GQQA 2YY6A 1LZLA 1E3IA 1THTA 4ZMBA 4N5MA 4IDEA 2JLRA 3OX2A 2FB9A 3HDHA 5CW1A 4B33A 1QO0A 1W0JD 3IBFA 4NRDA 5TF4A 4EGJA 1S02A 2E37A 2PVPA 3EEYA 5BRNA 3HEMA 1QF7A 3DE2X 3ADKA 2DY1A 4QD3A 1VSTA 3PV0A 2FFRA 3A7DA 1TT7A 2CJYA 3NHAA 3PKIA 3PE3A 4H7HA 4ZOAA 2FW6A 4CU2A 2FRVA 3HB9A 4MPDA 4MWOA 4J2OA 5IUNC 3LBFA 3EVCA 1LRLA 3BPSA 2YXBA 5BXQC 2BJVA 4W5QA 1LBHA 3CLUC 2H52A 4XJVA 5J59A 1GPJA 4W9NA 1OZAA 4JIMA 4O4HB 4V0OA 1IXZA 3B1JA 3DDCA 3HKDA 4IXNA 4KGVA 5E7MA 1ZMXA 5AOCA 1W4CA 4OUDB 4ZT2A 2ZLBA 3IODA 4RQBA 3UWSA 4F9FA 1SN7A 1M6EX 4D4JA 4DCSA 1S89A 2AZDA 1LF0A 4Z2YA 2XTMA 4C03A 5MFPA 8MHTA 3OU2A 5EE1A 3QHQA 2G28A 1TPYA 1EP1B 2FF7A 4JI1B 4F5WA 1KVRA 3RE1A 2OYSA 3IJPA 2RAPA 4B7XA 2WD9A 1JILA 4ZHQF 4M21A 3G2KA 1V2HE 1KNQA 1RJDA 2OFXA 2V0CA 2ZB3A 1EHIA 1GFIA 1GUZA 2ZPUA 3R7WA 3WYGA 4A82A 6ABPA 1O57A 5IJAA 3F8SA 4GHWA 4MUYA 5FLXA 3HYLA 1ULSA 3DBLA 4E22A 4BMSA 3C6YA 1Q7GA 1YL7A 4GVPA 1Z08A 1AUQA 1LK5A 4HGRA 3GFBA 4Y9RA 3KT6A 3PFWO 1N8TA 3T38A 5CXQA 1T8PA 5IK2D 3GZTB 2R2AA 2QLBA 1JR3E 1KTVA 2AA3A 3WOVA 2W2PA 1FLDA 3UC9A 2QTHA 2A5JA 1R7RA 2JIDA 4XVQA 1EM6A 1EU1A 2WAMA 4K03A 2H18A 2PX4A 2DECA 2BD0A 5E9AA 3QUBA 3IKMB 2K87A 4UMDA 2NYRA 3RUFA 2J7KA 3VYRB 1OFHA 1GL7A 2O7QA 2XNJA 3G6WA 1WXXA 3DAPA 1A2KC 3RK4A 4C4ZA 2XQJA 3O6VA 3SBEA 1G7TA 1KIFA 1K66A 1MJHA 2COEA 2QTBA 3N8KA 3PFKA 4XUEA 4OREX 2FN4A 3WS7A 3MJRA 4ALNA 5L7TA 3ADBA 5I9LA 2CFRA 3AEQB 5LBIA 3V33A 3SJBA 4YBZA 2G1PA 1KJWA 2PL1A 2E85A 4YRTA 3LZDA 2XMSA 4RD3A 3CVVA 2IYQA 1M34B 3ANNA 2PWBA 3Q5EA 2NUAA 1A9QA 3K4QA 5B3KA 4JUCA 2Q5FA 1CQWA 2YHIB 1FFWA 4PN3A 1QYIA 4N5HX 3G0DA 2VDKB 4NJEB 5IW8A 3W2HA 7MDHA 1F8FA 2O5VA 4YJ2A 1I3LA 3EGDA 4RU1A 2BT4A 2G9VA 4TV8B 4EJ2A 4M54A 3BMQB 2UUOA 4LBWA 2DFKB 5DXJA 4LYDA 5KTOA 3K9FC 4UNNA 3HL4A 4MMZB 5DLEA 1P3DA 3GD7A 3PUXA 1NN5A 4MHSA 2OLKA 3TTYA 2ZW9A 3CY6A 3FETA 4J91A 2XXBA 2V0GA 2ZE5A 2ZRBA 3OTHA 3HI6A 4QGAA 3K70D 1I14A 5IABA 1J2YA 2HY7A 4QNNA 1YGPA 2ZTMA 1W9MA 2WAAA 2PMEA 4UUQA 4Y1RA 4N3CA 2AZ4A 4L3WA 3AF2A 4LYEA 1N5MA 5C3MA 5F3WB 4CLDA 3WLQA 1PEAA 1MIOA 2A9VA 2GAJA 5LZ8A 1USWA 5HXAA 5LN1A 4FYIA 1M6YA 2DLCX 4RS4A 1CR0A 1MV8A 2G7MC 2BDTA 2RK6A 2VSOA 4LXIA 5HDQA 3SYTA 5FEUA 1MO6A 1GQYA 2YZKA 5DPMA 3OQBA 4ZAWA 3RK0A 5C8DA 2QM0A 5EIOA 1U3WA 1KJ9A 3RSHA 3ZVNA 3WK9A 4BC1A 2H5IA 4S1WA 3DONA 1YZKA 2I8AA 4J9UE 4JXJA 5DKFA 1J23A 2D2EA 5LZ9A 3DMYA 5I7RA 4GUDA 4WNYA 3V3TA 1V6CA 1E4YA 3BN3A 1T9DA 4QUJA 3HWRA 1CJSA 1S2MA 2QMEA 4P4GA 8LDHA 2QVLA 2JJ8A 1NI4A 2PZMA 2GEDA 3BH0A 2J9YB 4AY3A 3VTAA 1NG9A 5J5CA 3JQBA 4Z7OB 1O6FA 4IFBA 2QAGB 1ODSA 3VYWA 1H1TA 1GPAA 3C6MA 4PAOA 1RT9A 3VO9A 3ENWA 1KWKA 4HFJA 3N2NA 2B4YA 3ESZA 4N0QA 5AK4A 2GCGA 3IT2A 1Z6GA 3VOSA 2HJSA 1Z16A 3OIFA 4EGFA 2YHUA 3QF4A 4L5IA 2XPCA 4AQDA 4B81A 2MYUA 1QCZA 2NU6A 2C4MA 5JCOC 2PEZA 3QVXA 5FI3A 3V42A 2C7PA 3A0RB 1I4WA 3JVVA 4IVNA 5D5HA 2YFYA 1RI3A 2ZK7A 1XOIA 3FNQA 4C7KA 3QY9A 1KL7A 3IPCA 4MVJP 5BSVA 4RTKA 2Y9MB 3PQCA 3FZYA 1JEYB 1NW4A 1PHPA 4PWZA 4OHPA 3WLNA 3NHSA 1XIVA 2WYUA 3VZBA 5AQ1A 1RWPA 4UM9D 4EKNB 2JATA 4J0CA 1TMOA 3CISA 3UMSA 3QBJA 4X95A 3BIFA 3BL5A 5J4YA 5AUNB 2DZDA 2WUEA 1EH5A 4GQIA 3BE6A 3L7LA 4PWYA 3DMTC 1AKNA 1N7GA 2B2XA 5DBOA 2XECA 1SCIA 3QPUA 4QYMA 1J9GA 2P9QA 3A6ZA 2QUBA 3GH1A 3P0EA 1KDZA 3RFTA 3PCTA 1KP2A 4G41A 1SK8A 5I7EA 3HB7A 3LWDA 1BJTA 3MTJA 1ZD9A 2X15A 3ZN2A 1Q0ZA 3GDFA 3PD7A 3L84A 3ZWQA 2BBSA 2X3YA 2WM9B 3AEZA 3F1LA 2YYSA 2GARA 2EJTA 2ZGVA 3I0NA 1W85A 3ABOB 3IALA 2FZ4A 4NG5A 3KTOA 1A8IA 5JTTA 4BY9E 3DBVO 1XE3A 3HY4A 1LPSA 4V2IA 5JDCA 2QTGA 4YQFA 1QCCA 4J29A 3RQIA 1E79A 1Z0JA 4RMHA 2Q4EA 1PE0A 1XRMA 3JWEA 1LVHA 3WLHA 3NBUA 4BTEA 4D44A 5JC1A 3FBGA 3G9UA 1SQFA 4BJ1A 3QJ5A 3O93A 4U2EA 1Y4AE 1A27A 2XUAA 4JOCA 2G1KA 1VHQA 1HT3A 3G0GA 5EKDA 4DMHA 5JFOA 2GPNA 2ZT8A 1I94B 3PQEA 2BFCB 3AUTA 4C6TB 1TVCA 2VQEB 4Y7CA 1UJ2A 4ZVRA 1SGWA 2NV2B 1NT4A 4LRYA 3L0CA 2HHLA 2X1VA 4BLTA 2HHAA 2XEXA 2NZWA 2ZVDA 2IX9A 1Z8DA 3DBRB 4HDSB 4KXLA 5FUXA 4FGJA 5NULA 1JDJA 5FDFA 5JS1A 2Q5JA 3BFXA 3RPEA 3PEYA 1I3CA 1OF1A 1X3LA 3BQ9A 1LPAB 5F1KA 5DCYA 5IWAB 2CNBA 2R1UA 4MQUA 2F43A 2RE8A 1DP4A 1N0UA 3MD0A 1F6BA 3S6JA 1KYIA 2IYWA 4XGKA 3W4IA 1R5BA 3WQHA 2WE7A 4MGZR 1Y6GA 3HWWA 3O8CA 4Y6LA 3HMKA 1KEZA 3KIPA 1G7SA 2EKPA 2GCOA 1YOVA 2FP4A 3DHNA 4HUTA 1H5QA 3BHJA 4MITA 3Q40A 1NGSA 3H1TA 5H8WA 1U11A 2JD1A 2QP3A 2PUBA 3G1UA 4Y6QA 1A5BB 2D06A 3OM8A 3TNJA 4IDNA 1KFEB 1RMQA 3OCJA 2YRXA 4M0FA 3ZBQA 4DCPA 1NYTA 4YJHB 3RS9A 1N32B 3LPDA 1J0DA 1TK9A 1UFVA 1XU9A 1XMIA 1Y9ZA 2OUIA 2WM3A 2X7JA 2GGSA 3FMIA 4CU5A 1VKOA 2IZ1A 4ENQA 1JSXA 3IGFA 4IY1A 2J5RA 1GPKA 1HSOA 3A26A 1UIMA 3D5TA 3NGMA 1GTVA 1FFXA 3RWBA 1E0JA 3F8TA 4HUJA 1W0JA 2ZYHA 3NNSA 4KTVE 3BCRA 4EP1A 4HPJB 1ZEJA 4UOZA 4D9BA 1GPUA 3JAWB 4JVLA 1ZGGA 4MKIA 3ZU4A 5J23A 2AEJA 2Y2VA 2R25B 3S68A 2JJYA 4ERNA 4OV6B 4MWZA 3SFZA 2JFNA 1J21A 4LMRA 3UIEA 2VJOA 2E4YA 3OLVA 5JHHB 3MAJA 4URZR 1S2NA 1G3RA 4RD1A 4MA4A 4EW6A 3R75A 4IOLA 5LYJA 1P5HA 4ZJZA 3E9ZA 1KBOA 5AW2A 1QRAA 5KQRA 2YXNA 6CHYA 3RVNA 3MTEA 1KI9A 4WZ6A 3ROPA 4I8XA 3V8QA 1XUOA 3N39C 4IIHA 1A9PA 1L7VC 1P4HA 1PG5A 3A6HA 3B20A 2CUKA 4JNKA 1B3BA 4N40A 5CT6A 3PD1A 1DC6A 1HRDA 2REQB 3TZLA 2ILVA 3CH7A 4NNJA 3RV4A 3R0VA 1Z82A 3G5LA 4IGFA 4AJLA 5HS6A 1ND6A 1CUCA 3VOAA 2XWSA 1X92A 2Q5IA 3WL8A 3B82A 5AHOA 4ZMRA 3QKTA 3G2PA 3ZJYA 3U1TA 5L3VA 3KUXA 1D4FA 2EHDA 1B7GO 3VPBA 4QHSA 4NZZA 2SKDA 1U94A 4KI7A 4D81A 3PKZA 5DTQA 2E89A 4TKVA 1C9YA 1YK1A 4GBMA 1VMDA 4KUGA 4B6OA 1ONPA 4RSGA 2VOJA 3GPCA 2BFBA 4X65B 2UZ4A 1H2HA 2BZGA 2QA5A 1JFLA 3EBLA 3N3AC 1DV2A 3DEIA 4JJZA 2Z4RA 1ODFA 4K6MA 4BCCA 4ZVVA 4AZVA 4MRAA 2EJVA 1J56A 1KEKA 3H2SA 2JFFA 4OVKA 4LC1A 3EZFA 2QI9C 5IK2A 1ZXLA 2C03A 2QTZA 2ZSJA 2VCHA 3PRKE 5E7JA 1VE1A 2UYCA 3L77A 3S2ZA 4GEGA 2CL0X 4G26A 3WOHA 2CV1A 4XB2A 2Y0PA 3PR3A 1TK3A 4LGVA 1TTQB 5C8XA 2HZ7A 4UZSA 2HA5A 1FQWA 3JSXA 4HNSA 4E14A 2WVJA 3OF2A 2UZ0A 2WU0A 3K0KA 3UAWA 2UUBB 2YXLA 4KDCA 4AO8A 3AKDA 4O2RA 3CE6A 4PYIA 4MIYA 5EHIA 3C8UA 5K1ZA 4RK1A 1AB5A 4O4LF 1DOZA 3F4KA 2JCGA 2FX2A 4TL8A 2HV8A 2H1VA 2PWAA 4NENB 3U2QA 1ACLA 5T8KC 1A5ZA 1SIOA 1IRIA 1ZD4A 2PT5A 3KRTA 5LQJA 2CXPA 1EXNA 2BV3A 4UHEA 1Z5VA 2B7LA 1EJ6A 2NXJA 3REGA 2Q0SA 4K5QA 2AOTB 4G8DA 2P6PA 3ASZA 5AQEA 3UJBA 2HGSA 2IHKA 3I6BA 4DOMA 2AXQA 1I2AA 4RTQA 1EQAA 3L8ZA 5JAIA 1N9GB 4BQNA 3H84A 4WA7A 2EL9A 1SEVA 3ENKA 1FS5A 1BQ4A 2C4HA 2FQXA 3OURA 4K7JA 5CFMA 3CLKA 2R00A 3K4HA 4MWTA 1ZCJA 2EW2A 3GJ6A 3DLHA 3CFYA 4RK0A 3GGPA 2X5JO 5DGCA 2F3PA 2R8PA 5A2GA 4NABA 3KWFA 5B3LA 3MB5A 3MWEB 4CCSA 2RI6A 1V4BA 5DV9A 4DDKA 1P1HA 2BFFA 1VI5A 2WP0A 4DLSA 5FUBA 4MCHA 2X4IA 2GCPA 1TT5B 2NAPA 3CSUA 3R23A 3JWGA 4AJ1A 5AVZA 1C1XB 4R3WA 4TQAA 1V9SA 2LUOA 5KCZA 3L0YA 4JZKA 1MO5A 2UVPA 4S1NA 5DX0A 4JYAB 1P62B 3W78A 5K0BA 5ESRA 4JQZA 5B6JA 3L1KA 1B2LA 1MAHA 4MR9A 3SP1A 4HNTA 3UFBA 1N7JA 3COVA 2J6CA 3NEAA 4B3TB 2TMKA 3BSSA 3EEFA 1ECJA 4IP0A 4RIHA 3WQSB 1F6WA 1VA4A 4RTLA 3X1JA 1DJPA 2PA3A 3TDNA 4MR7A 1VGRA 4LVNA 1U6JA 2NXCA 5DI9A 4TSKA 3QX8A 3GJSA 2JRCA 2JRLA 2YDYA 2B78A 3CR7A 4OBEA 3PA6A 4XTRA 1E6UA 3MFYA 4PS0A 2PMWB 2PRIA 1PV4A 2B4QA 1LDEA 4YRLA 5AXBA 4LJKA 2G63A 1POXA 4JQOA 4K26A 3RGGA 3C1UA 4BX3A 4QOGA 1OBOA 2FPGB 2OESA 3DKVA 3G59A 4LE0A 2WQ7A 4BMVA 5C5EA 1R74A 4HLNA 5ADWA 1M8JA 1QV9A 4BZWA 1M1NA 5FTNA 3F7OA 1JKMA 1Q12A 3F5FA 3KC2A 1XC7A 2JAWA 2R8RA 1GZUA 2NXEA 4AKSA 1G8JA 3HKDB 2B1GA 2XMZA 1R5OA 3KZVA 1CLEA 4WXEA 3TPCA 1ZIPA 1OWNA 2VHXA 1S6YA 3QKWA 3HVRA 4BWGA 1IHDA 5MGBA 1XF9A 3D2BA 3OOWA 1JTVA 2QTVA 1K3UB 1Z8FA 4W5OA 3I42A 2XGOA 1SAYA 1Z75A 3A7EA 4YAOA 5JXGA 4DC1A 1AKWA 1EM8B 1V3TA 2P4EA 3GFOA 4HZIA 4RKRA 3R7WB 4AC9A 3JQ7B 4XYLA 5ICCA 2JFZA 4LYGA 3C3CA 3NGXA 2IUYA 3MJCA 4E1AA 2RI1A 4W8HA 3DBLB 3RRZA 3JCZA 3CO5A 4TTPA 4RTJA 2EDAA 1LTHR 1XZPA 3LUGA 5H3LA 1NE2A 3ZHZA 3AEXA 2NADA 2ZRHA 1ACJA 4CG1A 5AKEA 1GOTA 4IDOA 1LBTA 3O4IA 4A6DA 1RQGA 3D1VA 4LX0A 4A0SA 3B9BA 4BS9A 2X9GA 2IELA 3ZE0B 4QJBA 3HR7A 4KIFA 1R64A 2VZ0A 4HS9A 3FTDA 3L7CA 4FDAA 2Q7OE 3TZQA 4BV8A 5GONB 4OQMA 2FW0A 3MCZA 3EQ6A 3RIHA 4W5TA 2PUTA 3MSCA 3FWHA 3O3MB 4NDNE 4HB3A 1PNTA 4KXQA 4U63A 4CM3A 2PIDA 5T6BA 3SPXA 5GM2A 2RK4A 5IYZA 3HJRA 3F7MA 1A7AA 1D2HA 3FPKA 2V6JA 1AUOA 3GJZA 3P94A 2NVUB 5JZOA 4H7PA 4A73A 2ATXA 1DS6A 4PBRA 4PIPA 5JNSA 4ZXPA 4CLRA 2NACA 2P8JA 1HG1A 3BULA 1JZTA 4FOOA 3UUEA 4J7AA 1IHPA 1BX1A 4LJ4A 1CZOA 2FUEA 1K8YB 2G4LA 2NUAB 2WA2A 1N5LA 5H83A 1KDOA 2JBWA 3JQPA 2ZSDA 4NNOA 3OLQA 1WKVA 2PUJA 2VWGA 4PZUA 4YJ2B 4X3CA 3EGDB 3ZD7A 2GSDA 2A8YA 4E21A 1V3VA 3WLIA 2B69A 2H5EA 2OCBA 4RM3A 2OM2A 5K3SA 3P0IA 2CT8A 4FMDF 6Q21A 3REOA 4WJKB 1W88A 4L75A 3HCWA 1K6XA 2QMQA 4LC9A 3B5JA 4DV5B 4HRYA 2PPVA 1AXRA 1RPTA 5L9AA 4IGKA 1P18A 1C41A 3F6YA 2D0IA 1NVWQ 4C0HA 1OAKA 3OZAA 3QKSA 4YMUA 1YHNA 4RTPA 4C7OA 1CS4C 5FOXA 5BMVA 1F14A 1A2QA 1JNXX 1UC4B 3MELA 3AR7A 4RQUA 1CY7A 4EABA 5BN5B 1PBNA 4Y1RB 3UNXA 3FYSA 1JKXA 2N9UA 5KCMA 4DSTA 1AO0A 1MIOB 2Y27A 3PGJA 1R1DA 1G0NA 4MDYA 1HDIA 1PR4A 2YRFA 5I7AA 3NKLA 4G8CA 2SICE 3BXXA 5L3RA 2Q4BA 1Y5NA 2WY2D 2VTKA 3ZTTA 1CYDA 4LW8A 3H9EO 3OLXA 2PX6A 5BXYA 2HSEA 1J8FA 3AZOA 3D81A 3HO1A 1Z4LA 4MWCA 2PZ8A 1KEWA 2EFDB 2P77A 2QN9A 1FRVA 2ZYAA 4B8WA 1HOTA 5L4NA 5T4BA 1G5TA 3MG9A 1SOWA 3MMPA 1V0JA 5E8RA 2GAIA 2XRFA 5JVDF 3RWOA 2OYRA 3PUYA 5I48A 4EA9A 4BGEA 3KQMA 1NI4B 2FX5A 4MV5A 2AJBA 2FZGA 3FGOA 4GWKA 1P19A 1SKYE 2NYAA 2QSUA 4NBWA 2H4YA 4EL0A 3KAPA 2R8BA 4NFSA 4IINA 2VXBA 3UGTA 5EJEA 4J0IA 2DERA 2ARKA 3L6RA 4KI0A 3TKAA 2A6PA 4WZZA 3WYDA 1NJ6A 1QVWA 1T35A 3CW2A 3MWYW 3QF4B 4WEQA 4O4JA 5THXA 2PH7A 4OJMX 1O0SA 2NU6B 3R74A 2Z8XA 4X91A 2ZRDA 1IK4A 3SJ7A 1VSVA 2EW8A 1ODIA 4P84A 1F8GA 4R41A 1IZ9A 3LECA 2P0AA 5CK5A 5E6RA 1RWVA 1XQVA 4A6XA 4Z2AA 5HQ3A 4XUCA 3ZY2A 1U2RA 1X7ZB 4PSKA 1WKCA 5LQCA 4AK9A 3LX6A 3FHCB 4CZ2A 4ZQCB 1J5PA 1VM6A 1Z4KA 1B43A 2AFVA 2EOAA 2FG7C 2ZJAA 2JD2A 3OIGA 4FBGA 4GS5A 4JJAA 4C0BA 3QUCA 1WMBA 4O02B 4ZVKA 4D56A 4LIPD 3B1YA 3CEPB 1QIMA 1XQ9A 3Q7IA 1B15A 1C9JA 4Z5XA 1I5RA 1RI4A 5L6LB 4TWIA 3VZCA 2L69A 5BV1A 4B6SA 1WULS 2J4FA 4TT8A 3RWMB 4AULA 1T9GS 2EATA 1T2NA 1WABA 2Q3MA 4OHUA 4YUXA 4R0MA 3HYSA 4DR2B 2JIOA 4Z7QB 1O2DA 2NO5A 3N2LA 3G8BA 3FJOA 4MV3A 4BKPA 4JKYA 4OH7A 2X3UA 1U28C 4LBZA 5IUKC 5KU1A 1KNXA 1G4UR 1MUUA 5HZHA 3CM0A 4LZAA 4Y9UA 5SZHB 1OD6A 4D4HA 2H07A 1ZGCA 3O4RA 1Z2DA 3H2JA 4ID3A 4RJIA 1W85B 5M3BA 4ENUA 4LFCB 2WFAA 5DX1A 4RIFA 3GUCA 3UEOA 5TGTA 5BV2P 1KH1A 1ZY2A 5EUMA 2W7TA 3OJXA 3V46A 1KK3A 1ZNYA 2WU1A 3W0LB 2JHCA 1KYXA 4E1VA 1OH5A 1NW5A 2V5UA 3B5IA 4RDCA 1UXHA 3JD3A 3PZRA 5KAPA 1KOFA 2FSIA 1R9GA 2MU1A 4NYIR 4BAUA 3NC0C 4B3FX 1FSGA 1C3EA 3D4LA 4PY2A 3FZGA 4YJ3A 4AWAA 3I53A 2ORWA 4G5OA 5K8CA 3CNNA 2AN3A 2Y05A 1RWMA 1UKCA 5IULC 1Z35A 2OG2A 4Y9SA 1GKLA 4FK8A 5I7FA 3ULKA 3G9ZA 1IPEA 1NFRA 3GAZA 2F8LA 3IELA 1JEJA 1XAHA 1CEQA 3AUSA 2W70A 3KFVA 1XVVA 5DMXA 5HG0A 2W2NA 3IO5A 3ZS9A 5JAMA 1KE1A 2Y99A 3D8TA 3DZ8A 3Q3CA 3SJAA 4YQYA 3O26A 1A9YA 4OOFA 3HJNA 3TXAA 4QM7A 2W6CX 2IHJA 4RFSA 4BCDA 3DT8A 3AJDA 3I30X 2FPLA 4EBFA 2BISA 2BMJA 2V6MA 2ZPAA 3IRVA 4O33A 2FEWB 1S4QA 3MLBA 1BGWA 1VI6A 2GCOB 1YOVB 3ACCA 4TMZA 4XJSA 2WVAA 1T3LA 3IP8A 2B98A 5EI5A 2G70A 2QG4A 4DWVA 2A1TR 4KPUA 1XYVA 1ESEA 3OKAA 1BD3A 2VZ9A 4FCTA 1TEVA 1RLMA 4BU1A 2Q62A 5ERYA 2O50A 4F4UA 4WJZA 4TQUS 2IH5A 5EP1A 2FMHA 2BONA 2H2IA 4BEBA 5DK4A 3E9NA 3ADCA 4AKGA 1NUSA 4XCQA 4QOFA 1EJ2A 3B1KA 2YFQA 4FMPA 2DWPA 2WUWE 1P2BA 2GEKA 4DM7A 5HEKA 3VPSA 3DTNA 2K5UA 1P6XA 1FFXB 2V6GA 4F06A 4YUZA 2WWFA 3U17A 5AJXA 4FDMA 3K31A 1KQOA 1WVMA 2HDNB 3A31A 1BOFA 3RC9A 1Q5PA 4DZTA 5E4JA 4JP1A 3IAFA 3HL0A 1J1IA 1EZ1A 1JHPA 2RGDA 2V5VA 3GDHA 2EBWA 3O3NB 2OSBA 3DO6A 3KFLA 2FSVC 3DKPA 3QJYA 4XCVA 5CYPA 3ROTA 3S5JA 4ZCIA 4BPBA 4MKFA 1OC2A 2CVPA 2VSFA 3M6LA 4X0EA 2ZJBA 3TLCA 5LYJB 1ZD3A 3JZAA 2C95A 4JWKA 4OAQA 1PAUA 3D6VA 3DDWA 3ZQ4A 1P1RA 1G8YA 4K2AA 2QRNA 2R84A 3ZDBA 1P2TA 4IQ4A 2RD2A 2O9JA 1G60A 2QUJA 4MMXB 5HILA 4QXMA 2F3SA 4FW9A 4BEVA 1Y7LA 4AS2A 1Z12A 3WSWA 4D3XA 2VRNA 6REQA 4FFWA 1IZYA 2CD7A 4DKJA 3AERB 3I2KA 3E1SA</