4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
4ARZA 4BFSA 2SHKA 4IXNA 4QRHA 2X2EA 5CDFE 1XEFA 4A92A 2ZI3A 4NDZA 4XTRA 1UADA 4B44A 3V4RA 1Z29A 4LZZA 5KPDA 2J0UB 2GF0A 4Q1DA 3OAAD 2YWGA 4FMBB 4D4LA 5EP2A 3B7GA 3FB4A 4Q47A 1AZTA 2Y8EA 3CZPA 3ETLA 1ZCBA 3B1ZA 1Z47A 1BKDR 1DO2A 1E0KA 2QP4A 1W0KD 4P4TA 4JKYA 4RD3A 2V6IA 5CYOA 1YR8A 1Z83A 2VP2A 1G21E 4TMXA 2ZRCA 5CYPA 2JLXA 5KOYA 4HI0E 1XZPA 1JNYA 1H8EA 1UFQA 2PT5A 1KI3A 5EZ6B 3V4FA 2Q9BA 1RKBA 3GEHA 3RS4A 3CH5A 4RFSB 4HB3A 2AFIE 3OESA 5IF9A 3U2QA 4BLQA 1G8YA 2RGEA 2V6JA 1R7RA 5JWRA 3HU3A 2LWIA 1MKYA 4QKQA 2BC9A 4TMKA 5AUPB 1QVAA 4L9SA 4UXJA 1XWIA 1T5IA 4BFTA 1ZM4A 1Z5ZA 1US8A 5A5GA 2QQ0A 3SZRA 2A5FA 1YZQA 1ZUIA 4JVNA 2P6UA 2RMKA 1M2OB 2D62A 4AURA 2FFHA 4IW3B 1WRBA 2OCBA 3AP3A 4Q4JB 4DEYA 3GJ7A 4F4JA 1YZNA 4FIDA 1SXJE 2FPMA 2QSYA 2MMGA 3FMOB 1X6VA 3GLGE 2WPDD 4JVLA 5FTKA 3ZGXA 5JMTA 1WQ1R 2AX4A 5A0FA 4A36A 3I8XA 4YDHB 1HE1C 4EPYA 3B1YA 3FDIA 5EUMA 1QZXA 3P4XA 4A8JA 4FMCB 4WZ6A 1E94E 4TTPA 3WNCA 1XEWX 2DFLA 3R9WA 2RGNA 2WWHA 3NBFA 1M6NA 4N3NA 5CB6A 4US0R 3K9GA 1Y3AA 4L8GA 1OXXK 4JLAA 1YJ5A 2WJIA 2KBEA 2ZRAA 1W5TA 1KDOA 4C0SA 2PLFA 4XVUA 5IHPA 1S2MA 2XZPA 1FNNA 2ATVA 4DBLC 3VR5A 4BEJA 5CDFA 3U61B 4JIMA 4AKEA 4C0QC 4EKDA 1HY3A 4G0NA 2DB3A 4KBFA 1R0XA 1GRRA 2RHDA 2WIBA 5KUTA 4M9SA 4UNNA 1U8AA 4NU0A 5HE8A 2W6JA 3FHOA 1CR1A 3LLMA 1NN5A 2NPFA 3B60A 1HQYE 2A5GA 3KXLA 3P27A 1FOEB 3IEUA 3TR5A 3GLFB 2HCJB 4D6PA 2CXXA 1SXJA 1UM8A 1XTIA 3EZ6A 2IS6A 4C2TA 2C8VA 2G88A 4AC9A 4OJQA 3AF2A 5TDHA 2PMDA 1AK2A 4GNKA 1Q22A 3MJRA 1O87A 3NC1C 1DOAA 3AP2A 5DHFA 3QXHA 1P2UA 5AJXA 1R6BX 1GIAA 5J4KA 4CYMA 4I1SA 4KSCA 3VNUA 3RC3A 2O8EB 1LS6A 2REXB 4DLTA 4JLBA 1R0YA 2FH5B 1K6MA 2PX0A 3U7HB 1VTKA 3BOSA 1XBTA 4GFDA 2DPXA 2VTKA 2F7SA 1F2UB 2VHJA 3M1IA 1GOTA 2ZRKA 3AGQA 4JJKA 2IT1A 1WBDA 1GRNA 4XJXA 4BFVA 4A8JB 3KUDA 2NGRA 1VG9B 4UJ3A 2V55B 1RJ9B 1DAKA 4IOMA 2QA5A 4DLUA 1Q12A 1P2VA 421PA 3ZVRA 3K70D 2GNOA 1JR3A 1ZYUA 4LYJA 1TAGA 3PEVA 4FD2A 4A6PA 1OH5A 3CF6R 3LRPA 1Z0FA 1JQLB 2BM1A 2OILA 5DGXA 1W4AA 1QF9A 4HZUA 1OV4A 1NVVR 3W6OA 4I81A 2QROA 2RGGA 4B43A 2Q0HA 4XWKA 2UKDA 3ZLJA 4B3GA 5JZVA 1MRNA 3UMRA 4YMSA 1DARA 2MSCB 2WJVA 1NN0A 2ZAOA 5F9FA 3TW8B 1E69A 2HCBA 3TBKA 1VKJA 5BXQC 2ZS7A 2WKPA 5JJKA 1OH7A 5TB5A 1BOFA 4RZ2A 3GP8A 3DOEA 4C0LA 2EW1A 2J7KA 1DTSA 3QI2A 4OQMA 2V7QD 1G3MA 4TLEA 1UKZA 2IXGA 3TJZA 1LTQA 4A0HA 3FVQA 2F9MA 4JLVA 1I4LD 2VEDA 4ERNA 3R8CA 1TQ6A 1KO5A 2IYYA 2AWOA 4ACBA 2JAQA 2YYZA 3GLHB 2FV8A 4JBWA 4O25A 2D4HA 1L4YA 4FN5A 4JLMA 1N3BA 5C2JB 5L3QB 1FMLA 3GJXC 2XOKD 4NZYA 2ZI9A 4CF7A 1N6KA 1JBKA 1WB9A 4HEJA 2YOHA 3P20A 1T3HA 3SYLA 5FTJA 3WP1B 1Z0DA 2ZSAA 4AYWA 3MGCA 4AWXA 2GAAA 4FCVA 1VHTA 2CK3D 5P21A 2FNAA 1PJRA 5KTYA 3THOA 2XAUA 4RCZA 1P6XA 5FR1A 4C9BA 3QPWA 4LBWA 3WHKA 3LLUA 2GXQA 1KKMA 3RS0A 3SYNA 1C4OA 1QHSA 5CJ2A 2CLSA 1U0LA 3HPRA 1AIPA 1CRPA 2AD5A 4LSGA 3SC3A 2JA1A 4A15A 2XGJA 4CEIB 1Q1QA 3PFIA 3MSXA 3NBYC 3T1TA 3FTQA 2NO0A 4LBVA 1Z6XA 2WWFA 1VG0B 4Q4JA 5FBWB 5EZ5A 2CHQA 3QBTA 2QNRA 4KJZA 2P6NA 4QJ5A 4R98A 3VR2A 1DAEA 3H84A 4PPGA 1E96A 2EFCB 1T8TA 4B33A 1IJEA 3REGA 1DO0A 3OIWA 1NSFA 4L4UA 1OXUA 3O8CA 1KGDA 4R9UC 1MR3F 3U3JA 3WBJA 4AI6A 3S1AA 1D9ZA 1GL7A 4WOPA 5ELXA 1F60A 2A78A 2HJGA 3TE6A 4DRZA 1SVWA 5UKDA 3NBZC 4M53A 5D3MB 3C14C 3QY0A 1PZNA 2QTVB 1PLKA 4R2IA 1N0UA 4MYHA 2YWEA 2QM8A 1RYHA 1IN4A 1YQTA 2Z0MA 3U4QB 3LX5A 4BECA 3QG1A 2AWNA 3U44A 2QAGA 3BGWA 1U9IC 2Q9AA 3WRYC 4JSTA 3CX6A 4U7DA 3N2IA 3QXXA 4HAVA 4IJMA 3TNFA 1AJEA 1XD2B 2QU8A 3RS2A 4AKHA 4FCTA 1EESA 4KVGA 3UPUA 4LJYA 2D3WA 4HLCA 2BKEA 2DY1A 1W1WA 2O8FA 3T34A 4MYUA 3HPQA 2I1QA 2ONJA 4DHEA 4PQYA 4IEIA 1N2CE 2CHVA 3M0EA 1OIXA 2FOLA 4IDOA 5DHAA 2R44A 4TYWA 3OIYA 3PEYA 3OIUA 3PUVA 4PANA 5IK2D 1OB2A 4B2IA 5JJIA 4MUAA 5L3SB 2WWYA 3PVSA 4GOKA 1IQPA 3GD7A 3A4MA 1DAIA 2VRWA 1ZU5A 4ZCMA 4AIIA 3DMDA 5FOVA 4HZIA 1UEIA 4XOIA 1NG1A 3CBQA 3QF4B 2IYXA 2O8EA 1X1RA 2NZJA 4M9XA 4BWYA 1KSJA 1S4QA 4F7WA 4O2RA 4CEIA 1X1SA 5GJBA 1WBBA 2VQSA 3PEUA 1CKEA 8OHMA 4NE2A 1JEEA 2IYTA 4NH0A 4TLBA 3H2YA 3MD0A 1HE8B 1OFIA 2ZE5A 4RKEA 1ZNZA 2VO1A 2WV9A 4GBMA 2OHFA 1CR2A 2IYLD 1UBEA 2PCLA 2CBZA 3KQUA 4CEJB 3BRWD 4DJTA 3AUXA 1ODFA 3CKLA 3HDTA 1E0SA 3LDAA 4DLZA 4MH0R 2IHYA 3FE2A 1R5BA 5J4YA 4DC9A 4MRVA 3AVWA 2JLUA 2HXSA 3GEIA 1M7HA 1J2JA 2ZSBA 4JT2A 4A9AA 1IY2A 3KB1A 2QQEA 1KI6A 1JAIA 4A8JC 2DWQA 4OBEA 1KO1A 4JL6A 4YONB 3RRYA 1QHYA 3HR8A 4B6EA 1Q3HA 1E1QA 2RGNC 3MAAC 4DSNA 2FFBA 3CB4A 4EDHA 3QBVA 1RW4A 1WDTA 1G3IA 1N5IA 4AKGA 1MO5A 1G9XA 4ON9A 3F5FA 3AVTA 4DSOA 1ANKA 1F6BA 4URZR 5JEDA 1E9AA 1E6CA 3RVBA 1S9HA 1ZC4A 2NZ8A 3CR8A 3THYA 4KBGA 4B34A 2QZ4A 1E2LA 3LBIA 4TMTA 3PIRA 4Q7LA 3RDPA 4LJ6A 1CXZA 1PUIA 4QGGA 5EQTA 2TMKA 4EPXA 1W4BA 4V0OA 1NKSA 2F43B 2HV8A 2JEOA 2P2LA 4IKEA 3JZMA 5KSYA 1D2NA 1R2QA 1EK0A 2DYKA 3NH9A 3FGNA 1M7GA 2VP5A 4V0MA 4MUBA 1DG3A 4DDWA 1AQYA 4LYFA 4DXAA 4HAWA 2I1VB 2K5UA 4K8OA 4Z51A 3OF5A 2CCJA 1P60A 821PA 4K46A 3LV8A 1OXSC 4ESHA 5JFGA 3ZVLA 3L0SA 3AH8A 2ANCA 3ZJYA 2ZJ8A 4NYIR 1CR4A 4M1MA 5GJCA 3T1QA 1KDPA 3KQHA 1E2KA 2GETA 3H1TA 4JYCA 1T3SA 1JXMA 3U7FB 3BFKA 1ZNYA 3I32A 4Q1CA 1RPZA 1M7BA 1A4RA 1NN1A 2Q9CA 5GJVC 2YC4C 4Q03A 3TGPA 5FPTA 1BS1A 3DL0A 1E98A 4O3MA 2GZDA 4NYJR 1DADA 1A1VA 3TRFA 3WMGA 2BMEA 3FPAA 3K0AB 5FTNA 1XCMA 1CBUA 1OPXA 1TF7A 3K1JA 3CUEF 4V02A 2NTYC 4A1FA 4F38A 3RABA 1NMXA 1EFHA 1F2TA 2VIIA 4HAUA 3HP1A 3L0IB 4RFSA 2QMOA 3ICEA 3CIOA 5SZIA 2ODWA 5A4JA 1R8QA 2J9RA 221PA 1WP9A 3IQXA 2FPKA 2J46A 2H18A 1NRJB 3ADDA 1NY6A 2ZROA 4WXPA 4OQLA 2IYWA 5J4LA 4GL2A 1ZW6A 5FBRB 2DFTA 3GLHA 4HAYA 1Q20A 3UK6A 3AEZA 2ONKA 1D9XA 3RNLA 2OFOA 3SEAA 1X86B 2OXCA 4HYYA 2B92A 2YNMA 3T5GA 4TTRA 3DZDA 5L3QA 3OFND 1TL7C 2RHMA 4Q4AB 1GWNA 5TXGA 2BCJQ 3K09A 4YXWD 5D3MA 4UNQA 3AF3A 4B76A 1JR6A 3SFZA 4RSGA 4BASA 4U5XA 1GKIA 2XSZA 3K70B 2YJTD 4QGAA 3WYGA 2VP9A 3ZQ6A 3F8TA 4TWZA 5JSZB 1G64A 4MGIR 1FQJA 1E0JA 1XCPA 2VPPA 4X8LA 2PL3A 3ZS9A 1P72A 4IHQA 1HT2E 4GP6A 3I3SR 1T6NA 1GILA 4TLAA 2GJSA 3I5XA 2P3SA 4NCJA 1QHXA 2C96A 4LWZA 5FPYA 1C1YA 5JI3E 2QRNA 2D06A 5CLQA 1U9IA 2ZJ2A 3SDZA 1M8PA 1UBGA 2KJQA 4C7OA 2WZQA 2ZU0C 4V0ME 1W36B 1OFTA 4EAQA 3OEHA 1SVIA 1YZUA 2E1RA 5E7JA 5KSZA 1G4AE 4HLQB 4NYMQ 1E9EA 5GJWC 5HCIA 3K0AA 1OXTA 1ZRHA 1FFHA 2E9SA 2JIZD 2FDCA 4URWR 1XU4A 1L7VC 4W5WA 1TPZA 1G4UR 1TUEA 3MCAA 1N6PA 121PA 3HU2A 1G5TA 4UNSA 1E4VA 5JCZA 1PLJA 2LKDA 2CLDX 1I4DD 4US1R 4PAOA 4I1OA 2J0UA 2ZQ5A 2ZE7A 2B7BA 2QP9X 4I1UA 1MO3A 4B3XA 1Y63A 5FH9A 4QG7A 3N5CA 4RY2A 3QXCA 4MRRA 1YR9A 1F2TB 2GXSA 4FXPA 4KLZA 3TW4A 3NC0C 2CJWB 4UNPA 3U4QA 1JJVA 1N6HA 1ZIOA 3UKDA 3AKEA 1IXSB 4XIGS 1ZM7A 3DM9B 3UWKA 3GJ3A 4L9WA 5E7MA 5L3RA 4DT1A 3WMEA 4BFUA 1CF4A 1NJGA 3TIFA 1OXVA 1S1CA 4V0KA 5D3QA 4D0GA 4AY2A 5JRZA 2GCNA 2JATA 4TYPA 4AG6A 4DIEA 2WWIA 4NMMA 1A82A 1B23P 4ILEA 4IDNA 4Q19A 2VF8A 1QHGA 3U3MA 1RE0A 2VL7A 2O8FB 5DH9A 1X8KA 3GLHE 5LB2A 4AKIA 3CF2A 1RZ3A 5JHGB 2AD1A 1SVSA 1XXHA 3QVVA 3WBKA 2ORWA 2REBA 2FA9A 3THWA 2P67A 1AZSC 1ZM2A 4PHGA 3EIEA 5TY0A 1BIFA 4KFTA 4BFYA 2Q21A 2NIPA 3AUYA 3B9PA 2GJKA 4LY6A 4NCIA 5TVKA 3TR0A 2ORIA 2ZRIA 5B64A 2ZRJA 3CNNA 3AKCA 3SNHA 1ZM9A 3QKTA 4KFSA 4GP7A 2WJHA 1COWA 2JIZA 1XTSA 1TF2A 2AR7A 1ZNXA 4Q4HB 3IDQA 2BIFA 1EG7A 2NO9A 3EASA 5BYJA 3U5ZB 2OBLA 3J81k 2OO7A 4NPHA 3VAAA 1QHIA 2WSSA 3ECCA 4JVSB 1XP8A 2ODBA 1N0VC 1HV8A 4ASUA 1CIPA 2ZUBA 3QIAA 3VR4A 1PUJA 2CL0X 3QQ5A 4OK3A 3W9YA 4M0LA 4LRWA 4HLUC 2JLZA 2HLDD 3KL4A 5E95A 2REOA 3C4JA 1NBMA 1RFLA 1II8B 3A1TA 4I99A 4P3YA 4RZUA 3FYHA 1EFUA 3HJNA 4D80A 5DO9A 1SVMA 2B8WA 3CWZA 5F9HA 3GQBA 1JEDA 2J7PA 4ZO4A 3CX7A 3IO3A 5FBQB 3SHWA 1NL3A 3K0CC 4URYR 4V0NA 1OYYA 1XTJA 2BBSA 2OFWA 4N0EA 3K0EA 2FEOA 4M8NE 5HZHA 3E5HA 2FU5C 4LK2A 1HT1E 1F3OA 4HUQA 1Q57A 4FMCF 3SBEA 1FTSA 4PC7A 4URXR 1H8HD 2ZYVX 1NBMD 1VDZA 3CRRA 1U2RA 1G19A 3AM1A 4B75A 1FW6A 4DVGA 1MV5A 4QHYA 2QT0A 3VTKA 1TQDA 4Y0AA 4GRAA 5AJWA 2ZXUA 4ZDIA 2JLYA 1TEXA 1JAHA 2J0QA 3BIFA 2Z5FA 5B30A 1NI3A 2WSSD 3QKUA 2Z4RA 1DPFA 3EZ9A 2A5DA 1IM2A 4RCYA 3BD9A 2GCOA 1D2EA 3FOZA 3NEJA 3BWDD 1E9FA 5CIQA 3JVVA 3MJHA 1KDTA 2OUKA 4PX9A 4D0LB 2IEZA 2WOJA 2YINC 2F1RA 3QF4A 4TQ9A 2QENA 2F1HA 4DUGD 4BGDA 3PG5A 2A7QA 1LV7A 4YLGA 2OG2A 3Q5DA 2PZFA 2FMXA 4K81B 4M4SA 4B6FA 4KFUA 1V43A 1S8FA 2PJRA 5DN6A 3D31A 2ATXA 2OSBA 4R2HA 4MITA 5JEEA 2CNWD 3F3YA 2B6HA 3CPEA 1A2BA 3GMTA 4DDUA 4RD4A 3BFVA 2R6AA 1NBME 4R7ZA 3I92A 3LFUA 1ZD1A 5DI3B 2I3BA 1N6OA 3G82C 3GJ8A 4CEHA 1DAMA 1DVRA 2CE7A 5EXTA 2IWRA 4PSVA 3VFDA 4RD0A 5KPJA 2WMNB 2J0SA 3W5JA 3L8ZA 2VA8A 2FE4A 2A3RA 4EJSA 1E2FA 4Q7JB 5FI1B 3FKSD 2IS2A 1D8TA 1KY3A 1OYWA 3H4MA 1FX0B 1Z3IX 5JS7A 2FFQA 4HATA 4HAXA 1OB5A 1U0HC 1AA9A 4RJLA 1NF3A 2PJZA 3TQCA 4XVQA 4EUNA 4LHZA 3Q9LA 2GZAA 4WBSA 3ADCA 1AS2A 2O52A 3EPKA 3GFPA 2R8RA 5DLQC 2CCGA 3NVAA 4OK6A 4KAXA 5AWFC 2O8BB 2ZEJA 2AXNA 4GT1A 3WNBA 1GSIA 2MSEB 4P31A 5J47A 4MGZR 2F55A 3CONA 4PHFA 3T1VA 4PQRA 3UXMA 1KK0A 4M1KA 1QHHB 2JLVA 3AVYA 1D2MA 3LBHA 5FPHA 3ZYCA 4A0FA 1JB1A 4KO8A 4TYQA 3FFBA 1XEWY 3EA5A 4DSTA 3MUFA 4Y0VA 1UDXA 1NP6A 2DBYA 2F3TA 1G5RA 1Q0UA 2BCGY 3BH7A 2ERXA 2OCPA 4Q02A 3SBDA 4C3ZA 2HJVA 1W2HA 4PC6A 2LKCA 2G77B 1GVNB 4HLDA 1S3GA 1GP2A 3PJRA 2D7DA 1H8HA 2VP6A 2ZRHA 3IBGA 4IRUB 4C0HA 2IEYA 2ZRFA 3GLFE 1YZLA 4D0NA 2IBMA 4WA7A 2FFAA 1CLUA 3RSLA 2QTHA 3LVQE 1Z63A 2OLJA 1B0UA 5ANRB 3KZ1E 3CF0A 4L16A 1HH4A 3CPJB 2GAOA 4X8MA 1NNEA 4G5OA 1NSTA 3EC1A 4KVAA 4NCNA 2BWJA 2OBMA 4NONA 3ZIAA 5AJZA 2QY9A 4V0LA 5AK0A 3U3RA 2RGAA 4ZDWA 3RC8A 5DI9A 3SYKA 2ZYTX 4F4CA 3U7GA 4TN1A 3IKJA 1T0HB 3OE7A 2GVZC 2BM0A 4G5SA 4GZMA 3QKSB 2X2FA 4H1VA 2H92A 4ZDKA 3CM0A 3IILA 3KKOA 3GEEA 4MGKR 4PPQA 2GCPA 2JLRA 4QHSA 2NMVA 5FOUA 1G7RA 2C99A 1Z0JA 2AK3A 1ESMA 3MG9A 2CVHA 4B73A 5GVSA 4H1UA 3CRQA 3EARA 3RSOA 3UWOA 4II7A 4NKRA 5KDOA 5FL7D 5BW8A 5F3WB 4DLYA 3QE0A 4LHVA 1Z0IA 1FX0A 1SZPA 2FG5A 3Q3JB 5JWOA 5EE1A 3DKPA 4D81A 1P9NA 1UF9A 2ZRPA 1W0JA 2FGKA 1Q1BA 4RD6A 2XXAA 1SHZA 5G41A 2ZRBA 3MFYA 1KI1A 2R6CA 3AP1A 2ZU6A 4D4JA 3VQTA 1Z6YA 3EA0A 3GPLA 1BYIA 4JBXA 1EFRD 1ELOA 3OEED 4B32A 4M22A 1EXMA 3U7EB 3KXIA 1EFRA 4B3DA 4BZQA 4MYCA 2EFEB 5LBIA 1HURA 5C18A 5KNDA 3PQCA 1OFUX 4M21A 3GLIE 1Z06A 2N46A 1W48A 1G1MA 2IF2A 1N5JA 4M1SA 3UMSA 2GK6A 2GA8A 1W4CA 4OL0A 2JJ2D 3W6PA 1NIPA 1MT0A 1XD2A 2QPOA 2D74A 3B5JA 3KKQA 3KQNA 1W36D 5KNCA 1KNXA 2XEXA 1T0JB 4JLPA 2B21A 4MKGA 3HR7A 5KSOA 1II9A 3RAPR 4KSBA 2JCSA 3A4NA 1E2JA 4KFRA 2QT1A 3LQRA 1MRSA 2HF9A 4JL5A 4UXIA 5G53C 3U3KA 5B58C 1N5LA 2GBLC 3RRMA 2IC5A 3X1ZA 4B3BA 2O0JA 3PEWA 4HDOB 3B6EA 3GCGA 4PZZA 2R6DA 1E9SA 2YWFA 1SKYB 3MLEA 1VYTA 4IVQA 4CW7A 4BLOA 3BB1A 3AVVA 2W0MA 1EWRA 3WRXC 1AS3A 3EZFA 3FMIA 2D2FA 2H1LA 4E07A 2B8TA 4GPTA 3TAHA 2C9YA 2YZ2A 2RKOA 4FINA 1W4RA 2W2TA 1JPNA 4A2PA 2HT1A 3NIBA 4B2LA 4D26A 5EE0A 4Q9HA 1XPRA 2QSZA 2Z83A 1J99A 3ONWA 1KJYA 1DELA 3W8NA 4WAUA 4E22A 1G8HA 2XX3A 1A2KC 1KK1A 3IQWA 4QL3A 1BMFA 2R62A 4LPSA 4JVMA 1AKYA 1LFDB 4Q5IA 2G3YA 2AL7A 4PO1A 4MKFA 2CLCX 3B9QA 2G9NA 5DI3A 2F43A 2VF7A 4JYBA 1IXZA 3SHFA 2IYSA 2GBLA 4DLWA 5K8IA 1N0WA 3B78A 4E09A 1M1YE 2P5TB 4TYNA 1CJKC 3Q5EA 4P32A 2QP3A 1Q21A 3PV0A 3ZZ0A 3X1YA 4DSUA 2BJVA 2G1KA 1ZUHA 2VHQA 2N42A 4HLUA 3X1WA 3C5HA 1E2EA 1R0ZA 2XJ4A 1M34E 1SHKA 2BV3A 2IUSA 1KK2A 1IXRC 1I2MA 2IXFA 5JWHA 2VHTA 2RGDA 1KZGB 2XB4A 5CM9C 2GCOB 4MRPA 2WSMA 4NYMR 2VH5R 1XPUA 1U8ZA 4Z8YA 1ZC3A 2ZRDA 2V9PA 1S96A 1IBRA 3K0CA 5G3ZA 3ZZTA 4R71A 1G7TA 1KI4A 2XITA 1W44A 3C7KA 2XZOA 1I4TD 1JR3D 4FMDB 4PZYA 3KFXA 5EXSA 4HDCA 2PZEA 4OQFA 4RKFA 1OH6A 2OESA 3AVUA 2YOGA 1GITA 3I61A 4M1WA 3T1OA 1GTVA 3FHTA 5C1BA 1AGRA 1Z22A 3B1VA 4M1OA 3IPXA 4TYYA 2O0KA 1P7CA 2O0HA 2WIAA 4S35A 1IY1A 3KJHA 4A82A 2A5JA 4PO8A 5LDDC 2ZJ5A 2W6IA 5DIFA 1FTNA 1R10A 1HEIA 2EQBA 3E2IA 1YR7A 1AN0A 1E1RA 2QE7A 2ZS8A 4W5HA 2ZJZA 3EZ2A 3OE7D 1D5CA 1P4SA 3RHFA 3VKWA 5DSZA 4CEHB 2V4ZA 4XSHA 3RLFA 4TMVA 2KSQA 4KYIB 1ESNA 4MGYR 1GUAA 2V54A 4FI3C 1EX6A 2WOOA 3D7MA 3A8TA 4HUQB 2ECKA 4N1AA 2DR3A 2C77A 3IBYA 3KKNA 4Q4AA 2Q3FA 4URUR 3CRVA 4H9GA 3ZVNA 2QAGC 3SN6A 1XTQA 3V9PA 1KI7A 1XEXA 2FPLA 1Z0KA 3WYFA 1AM4D 4P4SA 4LJ7A 2UVQA 3PXGA 4EFLA 1SULA 5LPNA 1XZQA 1DAGA 1P62B 3AKYA 4OI0A 3R20A 1CS4C 2CK3A 3L2OB 4Q7KA 2CL6X 3EG5A 3FWYA 2ODEA 4QXAA 2WKQA 1T5LA 5J5CA 2QI9C 1YHNA 2PLRA 4JLJA 1SXJD 2OLKA 1Z6AA 4F91B 1SGWA 2GWHA 2ZTSA 3A1UA 3LNCA 1GZSA 2QN6A 4ARZB 3QJYA 1KJWA 4MKIA 1G17A 3BORA 3W34A 3I62A 4Q9IA 4FWIB 2X1VA 4GMXA 1P5ZB 1WCV1 1QG4A 3D6TB 4NYIQ 1P61B 1S0UA 1SKYE 1ZAKA 3A36A 4LGMA 4M2LA 4Q7MB 3RRZA 5M04A 1LY1A 1OHHD 4LHYA 4G5RA 1OT3A 2GESA 5CM8B 4E03A 4MA4A 1NLYA 1ZD9A 3M6AA 3KQKA 3K9LA 2XNSA 4PO9A 4WZBE 3OFNA 4LBZA 1E0AA 1LVGA 4AG5A 1T4GA 1LF0A 1RRPA 1XF9A 2QAJA 4GMDA 1LW7A 2ERYA 1E79D 3ZD7A 3MRSA 2ZSFA 3BC1A 3GJ4A 1G3RA 3IUYA 4LDJA 4CT5A 1QG2A 1KNQA 2ZAMA 3DEFA 3LQQA 2O8CA 3SR0A 3VU9A 3PUYA 3CRW1 4DIDA 4Q1BA 4RFVA 1DS6A 4IOKA 3LWNA 2MMCA 3T61A 4Q9KA 5FOWA 3A4LA 4P0TA 3NDPA 4TL7A 2YC2C 1UBCA 4I1VA 3QOFA 1IN5A 1W36C 3L0PA 1NIJA 2FWRA 4TMWA 2J1LA 4QFMA 2ANBA 1LB1B 5FOXA 4GDFA 1G3QA 1YU9A 2BOVA 2JJ8A 2RAPA 2ZRMA 2A9KA 1CRQA 3IIMA 5EE5B 3SQWA 3G5UA 1IOZA 1QHHA 4KXFB 1LNZA 2QPTA 4DEXA 3I73A 2W6ID 2KB0A 2NO7A 1OLOA 4HB4A 4OHVA 1ZBDA 4M9ZA 4B3FX 3K9NA 5E4FA 1KMHB 1W0JD 2HF8A 2ZJBA 1E3MA 1S9DA 1XEXB 4Z54A 3LAWA 1T91A 1YZGA 2ZPTX 1EFCA 5H68A 4QBFA 4ZIRB 1BYUA 4EQ6B 1GM5A 2G0TA 1YRBA 2IW3A 2X19A 3E70C 2IYUA 4POAA 5HPYB 1ZJ6A 4D4MA 2QGNA 2MSDB 3OZXA 4PFSA 1UBFA 3QSYA 1G8PA 4F93B 2WWGA 1UEJA 2FGJA 1E1QD 3H0KA 1HUQA 1II0A 2Z6VA 3A1SA 4DT1B 5AR1A 4OHXA 4C0AC 2ZRLA 3PUZA 4OYHA 2QM7A 1FUKA 2KI5A 3E1SA 3P4YA 5FOTA 4YMTA 2ASEA 2UZIR 2ZETA 3UG6A 3SJZA 1TNDA 1RYFA 3EAQA 5EP1A 3AGPA 4WVFA 4TZ6A 2XNDD 2RH5A 2FF7A 2YVUA 1GNRA 5HCNA 4LV8B 4BRWA 1XJQA 2RB4A 4F4IA 1VG8A 3CLVA 4LI0A 4EFNA 5C4MA 1W0KA 5FL7A 1TX4B 3B85A 3X2SA 4Q1EA 2FN4A 1P2SA 4LV6A 5BN4A 5FTLA 2O8CB 3K9HA 1DAHA 4OHWA 3VX4A 1IONA 1SKQA 3NEYA 1Q1ZA 4CT4B 1U90A 3PUWA 3X1DA 5DYIA 4L5BA 1HTWA 5GVRA 3T06B 1GKYA 3F0TA 4Q9JA 1TUIA 3EC2A 4TT3D 1GG2A 4E5UA 2PCJA 4D2IA 4DLRA 4XD7D 4DB2A 4DCNA 3IHWA 3RRNA 2ZUCA 5L3VA 4B48A 1TTTA 3CZQA 4KV9A 3THXB 3I1FA 1ZVQA 3QVUA 3DPUA 3IO5A 1YRAA 5SZHB 2NO6A 4RD2A 1OIVA 2GJ9A 2JGNA 1OJLA 5HR5A 2DWPA 2A2ZA 1KI6B 2ZJOA 3B82A 3BB4A 3SQXA 4XTCS 1FL9A 5EP3A 2H8KA 3FMFA 2GRJA 2PBRA 2AKAB 2ZVQX 3GJ0A 4G1UC 1CU1A 3WY9A 3ZDQA 2BBWA 3ASZA 3WP0A 5LD2C 2W00A 3OIVA 4QBGB 4Z1MA 2GJ8A 1Q1EA 1GAJA 4F92B 5TMPA 4QNRA 2J59A 1XFAA 4US2R 2EWWA 5HKKA 2CCKA 2J0VA 4UNRA 2IK8A 3AVXA 2OT3B 3H86A 1XDBA 2ZVPX 4IFBA 1N6RA 1UPTA 2PX3A 2JJ1A 3CX8A 2ZI4A 4JKIA 3K0SA 1US8B 1XB2A 2NPIA 2ZE8A 2N1BA 3TUJC 4EPTA 1OF1A 5EXPA 1P75A 4EPRA 5F98A 1OKKD 2HYDA 1GDDA 3AF1A 2QORA 2WM9B 1T9HA 2VSXA 5IK2A 1YVDA 1LS1A 2R2AA 2AXPA 2OCAA 1KO8A 4LCBA 4Q01A 2FEMA 1FQKA 1ZD8A 3VMFA 4C0JA 1VCNA 4BFZA 2ZE6A 3C16C 3MWLA 4KODA 1RIFA 3R9IA 1E2MA 2EYUA 2BJWA 3I4LA 1FP7A 4JSYA 1CJTC 2JDID 3B13B 5K8TA 3OEEA 1G20E 3RYTC 2V7QA 3EX7C 1UJ2A 2WICA 1ZINA 1CP2A 5FPSA 2YOFA 2RGCA 2Z4SA 3LBNA 1LF5A 2GK7A 1A5TA 1NMYA 4OQXA 3WHLA 3ZIAD 4X8HA 5HKKD 3C41J 3O8RA 1MABA 1BO6A 3TMKA 3T35A 1JJ7A 2F1IA 2IL1A 2OZEA 2IS4A 1XRJA 4EFMA 5KNBA 2PEZA 3QXJA 1MOZA 3U6BA 4Q1FA 4XSGA 4JLKA 4LJ9A 2BEKA 3BAFA 2GEDA 1W5SA 1DBSA 1CTQA 1WMSA 2E87A 5EXXA 4BQSA 3P26A 3THYB 4LYAA 3JZAA 4DCTA 4Z8XA 2JLQA 1XTKA 1E79A 1PVOA 1YKSA 5IRCD 2EFGA 4PSAA 3KX2A 3EZ7A 3VHXA 2CHGA 1XJCA 1JECA 2FJUA 2ZSEA 4PPFA 3UG7A 2QMUA 3L0OA 3U6KA 3R9XA 2GDJA 2PMKA 3D8BA 1QVRA 2O5VA 5SZJA 3EPJA 5JRJA 3K0FA 3FFAA 2HEIA 1U8YA 3EIHA 1KSGA 4LYHA 3VKGA 2H57A 2PH1A 2WJGA 1H8ED 2H7VA 4OHZA 4ZI3A 2YKGA 5AUOB 2FSGA 1EFTA 1FP6A 3HYRA 4TQAA 2QL6A 4JZKA 5KHOC 3GLFA 2V1XA 1P73A 1R0WA 4JMPA 3THWB 1G5PA 2QEQA 4B74A 5JLJA 2O8DB 3UMFA 3AKDA 1GL6A 4MYTA 1N5KA 3KDSE 4PTLA 4QGHA 5EJEA 1VCOA 3SOPA 3QNUA 1J7KA 1U99A 2NQ2C 5JECA 1KAGA 4B3CA 2YWHA 1JQJC 3D3QA 5G3YA 3R7WA 1KYIA 3WXMA 3AV0B 1TU3A 1XD8A 1KHTA 2W2XA 2WWXA 3LA6A 5EE3A 1XCGB 1VG1A 2ZITA 2J3EA 2J45A 4TT3A 1KMHA 1R5NA 3DDCA 4A0RA 1KO4A 4HB2A 3B2EA 1GNPA 4B2PA 2GF9A 2C03A 2AHOA 5GADl 1S3SA 4ZCIA 4PQFA 1ZNWA 4GOXA 3P32A 1YZTA 4XWAA 1TQ2A 4KYUA 1XXHB 4C2UA 2ZR7A 1KTVA 4PAMA 3EPLA 1N6IA 4YDSA 5FFMA 3ZZUA 1KZ7B 4PC1A 1NLZA 3QG5A 1OW3B 1SVLA 4LC1A 5SZKB 1NVUQ 1IAQA 5JCPA 3NG1A 3P1JA 2AN9A 2ORVA 2CDNA 2XNDA 2A30A 4U02A 4UQOA 2QTFA 4WIAA 4DCVA 1AGPA 1KIMA 2I4IA 3W90A 2BVNA 1IY0A 3MMPA 3QUSA 3VU9B 2IXEA 2FSHA 1O3YA 1YE8A 2J5XA 3Q85A 3TSWA 1ZMXA 3CNOA 3M4YA 4TL8A 2VHUA 1HYQA 1MO6A 2XXAB 2OBNA 5C46F 4MRNA 2IYQA 2P0EA 2QUZA 3ZQJA 3ND8A 3TLXA 4DLVA 4TL6A 2IX3A 5DNYB 2QBYA 3V00A 4M1TA 3RWOA 2D7CA 4CEJA 3AB3A 1KSFX 3KXKA 3KJIA 3T12A 2HUPA 3O8DA 5JJLA 5CITA 2R6FA 4FCWA 5F2EA 4TSFA 3TSOA 2H5EA 3B1XA 4TL9A 3MWJA 3TVDA 1AS0A 1VCIA 2ZRNA 1Z08A 2GZHA 3K0FB 3SFVA 3RWMB 1PLLA 3AF0A 2OXRA 2Q3HA 2WPDA 4PPNA 1E2IA 1L8QA 1V5WA 4GI7A 4OK5A 1ZCAA 1IN7A 2ZI6A 1E1RD 1R4AA 1G18A 2QE7D 3R7WB 2BEJA 2C04A 2L0XA 1J90A 5BYKA 5JSZA 3NDBB 2EFDB 2FSFA 1UAAA 1DE0A 4A0GA 3BB3A 4TSFD 1GRQA 2C95A 3N2EA 1NKTA 4P33A 4PR0A 5DISB 4B47A 1FPMA 2OV2A 4A2WA 3HYTA 4DLXA 1OFHA 3QENA 3KQLA 1KI8A 1WE2A 2GXUA 2XTZA 2ZRGA 3LO5A 1DAFA 1OIWA 1IHUA 1RRGA 3B1WA 2BBOA 3IGFA 5JI2E 2ZR0A 4JLOA 3CO5A 4EIWA 3K53A 4OI1A 3GLIB 1NG9A 4KHZA 1DEKA 4ITRC 2FZ4A 3OAAA 2JLWA 4BUJA 1R5OA 1VYUA 4PC2A 2W58A 4LJAA 5TV2A 3W3AA 4Q48A 4TLCA 3HU1A 1TQ4A 2RGBA 1CJVC 2C2HA 1E9RA 4U00A 3GJ5A 4BE7B 3TK1A 5AUQA 2KE5A 1Z2AA 3ZVMA 1S1MA 2F1JA 4YMVA 4OQNA 4MRSA 1N6NA 5IDVA 3ZH9B 2YV5A 1OHHA 5FL3A 5EUQB 1FZQA 5CK5A 2QAGB 1X8JA 5KDDA 3A58B 4GSYA 2B7CA 3C15C 2WVJA 2VP0A 4URVR 1N25A 1G6OA 1ZP6A 4B35A 1Z07A 2J7PD 2XSZD 1VHLA 1NMZA 3RS7A 4IFEA 1HQCA 2AFHE 5E7IA 1ZIPA 3I72A 2NO1A 4CZ2A 1U81A 1ONBA 1W47A 3GLGA 2GKSA 3S1AB 1AKEA 1G8FA 3AQ4A 3FKQA 2CJWA 2HLDA 1NVWQ 1VECA 4G01B 3QEOA 2BHRA 2Q3MA 1KO7A 3SS8A 4DZZA 3CR7A 1I2DA 2P5SA 5EE9A 2XJ9A 1MH1A 4KITB 2UZ3A 3O8BA 4QOSA 3AVOA 4RZ3A 2BMFA 1K8RA 3FMPB 5FOSA 1U0JA 3TAUA 4IVPA 4DKXA 1TF5A 1G3UA 4A4DA 3ADKA 4ZDJA 2ZYUX 2W83A 4QGFA 2CVFA 3O47A 4Q9LA 521PA 4QBIA 4BFXA 5J40A 1ZM3A 4BZXA 2PZGA 3I8SA 4W7SA 1NVVQ 4V03A 3Q72A 4Q4HA 3NKVA 1Z6TA 1J70A 2R65A 2X8AA 4BFWA 3NH6A 4XWOA 4OI2A 2WJYA 3EIQA 2PEYA 1JALA 4LJ4A 5JBQA 1P9RA 1E9DA 4CRWB 2WHXA 3CWQA 1D6JA 3EWSA 3FKSA 2DWOA 5CB8A 2ZR9A 2R9VA 1RJ9A 4JT4A 1RRFA 3GLIA 2IHBA 1E9BA 3BFXA 4DUGA 4D4KA 5K8LA 3C8UA 4JBYA 3ZS8A 4DB4A 1OKKA 3KTAB 1GL9B 2FSIA 2XZLA 2HDNB 2QG6A 3NHBA 4IDHA 2OE2A 3PITA 1KDRA 4EPVA 5H8WA 3TSZA 3NWJA 2ZANA 3FHCB 4ZKEA 2CNWA 4JJZA 1NLFA 1F5NA 3BS4A 2ZUDA 4EJSC 3QKRA 1BMFD 2BMDA 1G291 2QMHA 3IEVA 1W2GA 4TQUS 2RCNA 4LC0A 1P3JA 4EJSB 2CEAA 2IA5A 4DCUA 1SVOA 3A37A 3K8YA 1U94A 2F6RA 1EX7A 1XMJA 2KBFA 4OKSA 1SXJB 2EU8A 2C78A 3L82B 1R8SA 2BMJA 1CJMA 2GEUA 5CIWA 3W8RA 2J41A 3TUZC 2OCYC 3DOFA 4Q21A 3NXSA 2W6JD 5CLLA 4BLTA 1E2GA 5KU1A 4AD8A 1KJZA 3WNDA 2BKUA 1P2TA 3LXRA 2O8BA 3K09C 3CRMA 4Q00A 2RGXA 3THXA 3BBPA 1RRCA 1M74A 4G3XA 5KSPA 2XTNA 4Q1AA 4IXMA 4MQBA 4NCKA 2G0NA 2JJ1D 3VX3A 1XX6A 3AVQA 2NOAA 4PHHA 1VCMA 3GFOA 4JLNA 5L8VA 1N6LA 1X8LA 2FZLA 1F2UA 4HAZA 4G5QA 4XD7A 4ZCLA 4BPBA 2HT6A 5DE3A 1YZKA 2QBYB 3ASYA 4OJKA 5FI0B 4S2EA 4BLRA 3L43A 4PHTA 1IN8A 4ZKDA 4RVCA 2ZYWX 1TMKA 3DKVA 2CMKA 4C4PA 1Z0AA 3DVLA 1DG1G 5FTMA 5CK4A 3SJBA 3KKMA 2JJ2A 3LW7A 3BJIC 4X8OA 3QF7A 1E9CA 4HUTA 5JHHB 4ABYA 3NBXX 3CPHA 4NP6A 5J4VA 3SE0A 3VHLB 2WBLC 3KTAA 1XXHE 2VHCA 3ND9A 1XMSA 1Z2CA 4LBYA 4LOAA 1UKYA 5IT5A 3JVUA 5DYGA 3I5YA 3QPVA 1AQUA 4M9QA 4FW9A 2GHIA 2Z43A 4ASUD 2DFNA 2V8OA 4G5GA 1ETUA 1MO4A 2G1JA 4IVRA 5B57C 1QHNA 1TEVA 2EVWX 2QRZA 2IYZA 4IOJA 4ACAA 2V3CC 1L4UA 1K5DA 2ZSDA 4QM6A 4PAQA 1QBKC 2OM2A 4XH9B 4LHXA 4QJ3A 2XOKA 3IIKA 3X1XA 2QPAA 2OAQ1 4WZAE 3DMNA 4Q4LA 4YMWA 1G8GA 4NTZA 2EYQA 5H70A 4BRUA 3VNVA 4M1YA 4KI0A 1JI0A 1ZUNB 1VIYA 4RD1A 1W49A 4NBSA 1SQ5A 1E2NA 3DO6A 2F9LA 4IEEA 1TU4A 1GFIA 2JASA 1NY5A 2VLIA 1G7SA 2IS1A 2ZS9A 3NHAA 2DHRA 1A7JA 4ZIRA 1ZU4A 2XTMA 5L3SA 2IYVA 2JDIA 3PR1A 5FUWA 4TMZA 4ZPXA 5TARA 3G0HA 1W7AA 1UKEA 3KJEA 4CIDA 1OE0A 5G40A 4AK9A 4DWJA 1VPLA 2HYIC 3U44B 1QRAA 3VR6A 4WXRA 1VMAA 3HWSA 2VBCA 3UATA 3Q8XB 1XNJA 4JLDA 4XVRA 2QMEA 4QC2A 6Q21A 1E2DA 1E4YA 1XD9A 3RANA 2C98A 3LX8A 4P4UA 4LX0A 4NL4H 3GLGB 2AKYA 1CULC 1KMQA 2VYFA 3UIEA 4Q66C 2ZJAA 3LW8A 4ZI2A 3ZD6A 1XMIA 1EGAA 4A6XA 1SVKA 4W9MC 1X3SA 2C9OA 4DDTA 2HXYA 1J8MF 2PT7A 3R8FA 4C0KA 1GKUB 1KK3A 1E2PA 4MKHA 5FBLB 5DN6D 2WTUA 2C9CA 1F48A 4EQ6A 1G6HA 4C7OB 1H65A 2ZI7A 2XB2A 3LD9A 4BLPA 4KLNA 1WA5A 3TH5A 3UANA 2ZM5A 1XTRA 3QKSA 4NCHA 4HB0A 4GOJA 3QEJA 3VKHA 2J87A 4FMDF 2BDTA 5HZKA 1COWD 2G6BA 1UKVY 1TADA 4YMUA 2JLSA 1CR0A 4TLDA 1UDWA 2IWHA 4AYXA 1CJUC 2OEPA 2VSOA 3B8HA 3MWKA 2C5LA 2W2VA 3PCRB 4CDGA 1KI2A 3ADBA 3DZ8A 2IUTA 5LD2B 1II8A 1MABB 5JS8A 2KWIA 2WAXA 4BZPA 5H1YA 3VR3A 3PUXA 1OSNA 2VSFA 2GXAA 1CEEA 5BN3A 4UXHA 4LPKA 3RS5A 3RS3A 4QJ4A 2WWWA 1PV4A 3KB2A 3KFVA 3GJ6A 3CW2A 3NTUA 4P4SB 3TQFA 3A1WA 3SJAA 3W3ZB 4CVNA 5BWMA 3GFTA 5AUNB 3QPUA 4OI4A 4LUCA 4QBHA 4PSKA 2OFXA 1KY2A 1NVXQ 2Q6TA 2AK2A 1KAOA 1WXQA 3LH5A 3BH6A 3EWAA 2G83A 4BEBA 5KO2A 1C9KA 3DHWC 1Q44A 3BERA 4YQFA 5FUYA 1G16A 4LJ5A 5J4HA 2BBTA 3Q7PA 3KKPA 5FUVA 1JPJA 1OH8A 3T5DA 3OHMA 4D25A 4HSEA 4D82A 3QKRB 3IPYA 4YXWA 1Q3TA 4LJ8A 4O2LA 1NJFA 4IDQA 4TZ0A 2DCUA 2YHSA 2O8DA 3CH4B 1U98A 4LV5B 5FPKA 1XMVA 2V1UA 2EWVA 3AF4A 4OHYA 1BH2A 4BLSA 3Q7QA 4NYJQ 3WYAA 1L2TA 1E2HA 2IYRA 1T3LA 5KYKA 2ZI5A 5AJYA 4AYTA 4JS0A 2H16A 3MWYW 1Z6GA 3LXXA 4ESVA 3IIJA 5B2ZA 4PXAA 4B71A 3BK7A 3TKLA 721PA 1E99A 3U60B 1KOFA 2D2EA 3KUCA 3QXSA 1W46A 4DLSA 1E2QA 5FUXA 2IUUA 4W5JA 4Q18A 5BN5A 1SXJC 3U3OA 5HE9A 1EWQA 3CNLA 1VYVA 3KJGA 3N70A 1T8UA 3W5IA 1JXOA 1XJ0A 2WAYA 4DDVA 1IJFA 5CJPA 1JR3E 2NG1A 1P9WA 2P65A 3T15A 1FNMA 3SJCA 2P6RA 3OEHD 3TUIC 2ZIAA 3BE4A 1Z28A 3IHLA 1G41A 2GVDC 3LVRE 1RC8A 2WKRA 2IF0A 3AVPA 2W0SA 2ODNA 2GILA 2GJAA 2WMOB 4A2QA 3BXZA 2ZJYA 1YR6A 5HTKA 2OAP1 2LCFA 4Z1MD 2CL7X 4WW0A 3REFA 2F3RA 4NHOA 1WF3A 4FWTA 3ICQB 1IN6A 4JL8A 4UKDA 5C4GB 4LHWA 4IOLA 3EXAA 4KU4A 621PA 4IDPA 1FUUA 3K70C 3A6PC 2QGZA 3EPHA 5EP4A 1XPOA 4EPWA 1RVDA 4MDEA 4MDFA 3A1VA 4C30A 3BH0A 2X77A 3DM5A 2R6GA 4L15A 1KKLA 5FBVB 4QM7A 1G7CA 2EFHB 3VR1A 5KDLA 5E3HA 4I4LA 2VP4A 5K8UA 4ZV4A 2H17A 5BQ5A 4KCGA 2CE2X 2GTPA 3TVTA 4HDQB 3EW9A 4J0QA 1Z8FA 4N0DA 1KSHA 1VIAA 4RZXA 2FX3A 3W6NA 1NN3A 3WMFA 2A5YB 4HZUB 1HA3A 4YC7A 4PC3A 2DFKB 4O0MA 4DCSA 1QDEA 4CGZA 1GNQA 4QHTA 1J8YF 2ZREA 3SU8A 5LB4A 3L8YA 4TTQA 3C5CA 1E32A 2WJJA 5AJVB 5FR2A 1KI9A 4C0BA 2GEVA 3PENA 3LY5A 4QNMA 4GZLA 4UJ5A 3SI7A 4PZLA 1K5GA 1FMJA
chains in the Genus database with same CATH superfamily
1BWRA 1E58A 1M2EA 4PNHA 2SHKA 3ZWMA 4BNXA 1O7JA 4QRHA 2CVPA 3FAKA 2X6TA 3U39A 3X43A 3W1WA 5CDFE 3C1UA 4B9EA 5LP1A 1A8PA 2C2KA 3CLKA 2YRWA 4NVRA 4RV5A 1Y6JA 3ICVA 4HMPA 5AHXA 4CTNA 3Q8KA 1Z29A 2QVYX 3Q6NA 3LGSA 3W8EA 4RWEA 2LVBA 2Q49A 3HP7A 2AZMA 4AN1A 1FLDA 1CR6A 4G01B 3QE2A 3UUGA 3FB4A 1AZTA 4OXRA 1TA9A 4U6QA 3KJZA 1JP7A 1SBHA 2W2KB 2ICAA 2Y4NA 2JVKA 4OSEA 2QP4A 1ZD3A 5CT6A 1W0KD 3QJGA 4P4TA 1D2CA 4UDYX 5JVDB 5JUWA 5A4AA 2C9BA 3GBVA 1SCQA 4DCJA 5CYPA 3RJ5A 3GA7A 2M98A 3BVPA 4IQ4A 4LSZA 1Y4AE 4YV0A 2JLXA 5AKEA 2EX0A 5IYZF 4HI0E 4G0UA 2JCYA 1UFQA 2PT5A 1KI3A 2FAXA 1F4VA 3QQPA 4J43A 4LN1A 2GN8A 2CLIB 5F52A 5LYJA 2VH2A 1RKBA 3GEHA 3BILA 1PZFA 6AT1A 1XR3A 2HL6A 4B7XA 5FIUA 3M9WA 4KTVE 4HB3A 2AFIE 4RFSB 5ECGC 3GCZA 1OY1A 3ECSA 3IURA 5FUMA 2VRCA 2RGEA 3CC8A 1PCXA 1R7RA 2V6JA 1AD2A 4TKVB 2WAOA 5LP6C 3VPGA 1W9HA 1JZSA 2LWIA 2BC9A 4DARA 5AUPB 2NXJA 1EUYA 1PR0A 3DFZA 5ICFA 1SCAA 4L9SA 5KJEA 4PICA 4NC9A 4UVEA 1JA0A 5A5GA 2QQ0A 2DPGA 1KARA 3CJQA 4EY8A 1YZQA 2LR0A 2BF4A 1T9GR 4JVNA 4H7DA 4Q24A 5FYDA 4OQYA 2RMKA 1QH8A 4PPYA 3ES9A 1EA5A 1ATZA 1IB6A 1F4PA 5BSVA 1DIRA 4OX9B 2H29A 4AULA 4DEYA 1JTVA 3MLBA 4F4JA 4RTLA 1YZNA 2IYFA 1VYHA 2H2AA 5C34B 2QSYA 2YWXA 3L7KA 3MJEA 4LF7B 2QV0A 4U5QA 3REQB 4Y98A 5CVEA 2BR4A 2WPDD 1A7UA 1KEWA 4CFZA 1VQ1A 3AHCA 2QZJA 3CNQS 3HKBA 2VPTA 5HA5A 5JVDF 2A1UB 4A36A 3QKWA 5EYPB 4S12A 1G63A 4MS1B 4E51A 2YQ5A 1G0NA 3MW8A 1MO2A 1QP0A 1GAQA 1R15A 3O4VA 3S2YA 2BKLA 3BL5A 4KXWA 5CDUA 5EUMA 2WU0A 1TRKA 1QZXA 3SPXA 4WZ6A 3NM5A 1E94E 4Q3EA 4RQBA 2JZCA 3QI7A 1NBIA 1TYAE 3GZNB 5FO0A 3NBFA 1E3DA 1CS0A 1E3QA 4GEGA 1KEEA 2IGBA 4L8GA 4WDRA 4WEOA 3T4EA 1Z18A 3IX7A 1W5TA 1KDOA 2QN7A 2ZBVA 3VI3B 3C5WP 3GZJA 2C7VA 4NBUA 4F3CA 3IESA 3QPAA 1FNNA 2GPAA 1FRQA 2PNFA 4B4UA 3UOWA 4BEJA 4PBSA 5CDFA 3U61B 1H6CA 3FSRA 3R5TA 4G5XA 3F6SA 4ER5A 5HUJA 1DWUA 1VJGA 2H0RA 1F0YA 2DB3A 1K3TA 3KPUA 1JQ5A 4V1CA 2C2YA 5KUTA 1YUMA 3MMXA 3QIVA 4HH1A 2ARKA 4W1PA 4CFYA 1L1EA 2VVTA 3FHOA 3LLMA 4NNPA 2P2CA 1F7UA 2ST1A 2NPFA 2YHUA 1IPEA 3D6UA 2Y92A 4XM0A 2Q1WA 2Y1DA 3AYXB 2I2DA 3IEUA 4R81A 3GLFB 1N8TA 4D45A 3MGGA 1AY0A 1PTKA 1Y1LA 2CXXA 3D5QA 3L8FA 4JUAA 2LP4Y 3ZUGA 1CFJA 1YDMA 2QRPA 4FOLA 5MN6A 1E3LA 2O23A 1KBZA 1TT5A 3CEPB 1RKQA 3DVAA 3IULA 4MUXA 1DKMA 4AC9A 1RPAA 4OJQA 5EJ5A 1MXFA 3E5NA 3DBVO 3H1EA 3LQFA 3NC1C 3JWHA 5DHFA 1HLGA 1P2UA 3QXHA 3FTEA 1GIAA 2CUKA 2BMWA 1IK4A 3RC3A 2UZAA 3FZGA 2VNJA 2ZJ0A 3C7DB 5LZ5A 3RFXA 3DBLA 3ZG6A 3P2MA 3DAYA 3K1YA 4NAHA 3TD6A 3BK1A 3L0CA 3AFIA 5KNCD 1L4NA 2X0KA 4GFDA 2VTKA 2K7FA 2OBXA 2F7SA 5KVCA 1JDBB 1F2UB 1QHEA 2VHJA 4BMOB 3HM9A 1Z3CA 1FTGA 2IT1A 3AGQA 4AWAA 3VHQA 5DTEA 4YP1A 5CT8A 4XJXA 3S5JA 2H4FA 1UR5A 4K9MA 2NGRA 1X0XA 3TEJA 4YEDA 1PDOA 1JA1A 4UJ3A 2V55B 3C85A 1EQUA 2HK6A 1FFCA 3NVMB 2QA5A 3BTVA 4DLUA 1P2VA 4BBJA 1CS0B 4OLHA 421PA 5JV5A 2W5UA 4X91A 3K70D 2FP4A 1K5PA 4KO2S 3GVCA 4LYJA 2ADFA 4FD2A 5ESDA 3X0DA 5BVHB 5F73A 4A6PA 3KETA 2AS0A 3FUUA 2FVXA 3LO8A 4OMFG 3ESYA 3DPSA 2ZB3A 4H16A 1Y3CE 3LRPA 1Z0FA 2PD4A 2BM1A 4I14A 1QF9A 2DQZA 4ZAVA 1TKRA 2PAAA 1OV4A 3A6PC 3MINB 3Q10A 2RGGA 4KH1A 5JJCA 3O0TA 4QOFA 5BNWA 2Q0HA 4AJKA 5I9SA 5JZVA 2IP2A 1HTTA 3A4IA 4TYMA 5CH3A 2BE7A 1V2HE 2MSCB 2ZAOA 4C7BA 3ICPA 2HCBA 3TBKA 3IR5A 1VKJA 3OE1A 3HQ4O 1AKQA 1FK8A 1H66A 1QVWA 2ZS7A 2VI5A 1J6UA 2C2MA 2MSNA 3HGTA 2EF0A 2TMDA 4HNQA 5IG2A 3A1EA 3ZX5A 4C0LA 3DA8A 2J7KA 3IMCA 1J0BA 5FOQA 1LPNA 2IU4A 4UZEA 3TJZA 4UUAA 1UKZA 4HNVA 2NVOA 1DC3A 1KJ8A 4JLVA 4G4IA 4RGBA 1I4LD 4D8VA 5LLSA 2V65A 4ERNA 3I6YA 3R8CA 1KO5A 2IYYA 2PNJA 4ACBA 1NA5A 1W30A 2GN6A 2YW2A 1BGVA 2JVIA 3GLHB 4GE0A 2PV7A 4J6EA 4NU5A 5DRYA 4JBWA 3COYA 4O25A 3USZA 4LOJA 2G17A 1Y6QA 1EVZA 3IOCA 4K9PA 2WJ6A 3ZQ4A 4F9EA 2CXPA 5L3QB 3JRXA 1B26A 3QBDA 4E7OA 1FMLA 5DCUA 1CDOA 3QOXA 1UT8A 3DL7A 3H5IA 2HK7A 2YVKA 4NZYA 2W7TA 4BVHA 2EBHX 1J24A 1JBKA 1CERA 2H4XA 2QYHA 2YTZA 2YOHA 3EGDA 1PTJA 3N9IA 3RV3A 1UP4A 2C1XA 2OD9A 4ND6A 1RMYA 4R6WA 3VVBA 2QSUA 4AY6A 1T8RA 5IVIA 1C1XA 5ENVA 2R8XA 3WP1B 2O20A 5JTUA 1IBSA 2ZUSA 4HQNA 5H16A 4RTNA 2ZSAA 4AYWA 3DAPA 3MGCA 3T6KA 2AFRA 4YPVA 1QAOA 1VHTA 3ISVA 5P21A 3OBIA 4GXRA 3DBRB 4BV2A 4Z9FA 3T1HB 5FR1A 1W4ZA 3QPWA 4JAVC 1QC5B 2Q5FA 3LLUA 2X0NA 4DC1A 3HEMA 3RS0A 1GZUA 4GQBA 4II2A 1C4OA 1CW2B 1QHSA 2M32A 2UZ4A 3HPRA 2VYNA 4QNNA 4EG7A 1CRPA 2WP0A 4LKRA 1T5TA 4LSGA 3UUEA 3H19A 2XGJA 2X0DA 2R97A 5ITZB 1FX1A 3MSXA 3T1TA 3D7SA 4LBVA 2NTNA 1T0BA 2WWFA 2OZPA 1VG0B 4Q4JA 1GQYA 4UTVA 5KVVA 3I34X 4PM4A 3PDCA 1LUAA 5DCWA 5EZ5A 3WGZA 1AGXA 2AZXA 3QBTA 3SQLA 4EHHA 3TRHA 4Z3OA 2O0MA 5ESWA 1CQPA 3EZGA 4LSMA 4WCDA 4REQB 3VR2A 1GU1A 3H84A 1ZPDA 1OWOA 1E96A 5DWDA 3H13A 4HADA 4W1QA 4IUYA 3EIWA 4R40A 4B33A 4D74A 4BPRA 3OIWA 1NSFA 3DMRA 4X6YA 4IBOA 4DMCA 4FONA 1FU8A 3ANTA 4DANA 2P2NA 1V7CA 4XJTA 2BZSA 3L1JA 2HJGA 3TE6A 3I9KA 1U0GA 2NU7A 1XU7A 2WWTA 1EA7A 4D8UA 4GG1A 3HN2A 3IR7A 5BUSA 1QFZA 1U6KA 3L02A 1D0SA 4D9BA 2J6CA 1C3EA 2E4YA 2NU8A 4RLQA 2HRDA 1PO7A 1WR8A 4MYHA 4UE3S 2POCA 2QM8A 4JD5A 4L8YA 5AJHA 1YQTA 2Z0MA 3LX5A 1MB0A 1RXSA 1M8JA 4OB7A 4HJRA 2QAGA 3U44A 2P9ZA 1PS9A 1Z0ZA 3PHCA 3T9BA 2VT6A 4O4HA 5TX7A 2UYQA 3NHUA 4PZ9A 3TGWA 1E8NA 1PR4A 3QXXA 1I2AA 2FPRA 4IJMA 2WTXA 4YRAA 4HYTA 3I0ZA 1JV2B 4LJSA 1CLEA 2FR8C 2BGRA 3GFQA 3OIGA 4QJBA 4OJTA 4EARA 4AKHA 3Q2OA 3V1YA 2PUHA 4NPCA 3D6HA 1ZKDA 3UPUA 5F2NA 2GI4A 1OBOA 3LXUX 5EKSA 3JAWB 3TOVA 1TFUA 3NIDB 3T34A 3L79A 4P98A 4DHEA 1TO6A 1VB5A 2WC1A 3BEDA 4IEIA 2CHVA 4L5YA 4PQYA 4YRFA 3UCFA 2FOLA 3C5EA 1GSOA 4X00A 2I4OA 2A84A 2I2FA 1AKMA 1UBJS 2X7JA 3NVDA 1XLTC 1E2UA 1VJRA 2VATA 3OOSA 2HLPA 1ZFNA 2YYSA 4TS3A 1DAIA 2VRWA 1CUGA 1Z6QA 2VJCA 4M1EA 1PQPA 4KNWA 3HXTA 2VDJA 3TR6A 2J4FA 1INLA 4IKPA 1G21A 3QFSA 1U9ZA 2XTJA 3ETHA 3GJTA 2XE6A 1UEIA 2GFHA 3MTEA 4GW3A 4UAJA 4XOIA 4CM9A 5ES4B 2FR0A 2O8EA 4L4YA 5K0FA 3B6KA 2YQZA 1R0SA 3NFRA 4IWYA 1KE1A 1S4QA 1E4EA 3A9VA 1YI8A 1TRHA 2V7TA 4RVSA 1MX5A 3MSCA 4WBNB 1H22A 3M2PA 5F2KA 4DIUA 1CKEA 1EVIA 3FNIA 4DTCA 2Z57A 5T4BA 1QQ5A 4LRXA 4ZVSA 2PN1A 2X4LA 3C3BA 3LT5A 4J76A 4NH0A 4TLBA 4UVHA 4X6UA 3FWZA 2WWVD 4DM4A 2CT8A 1HE8B 1OFIA 5HFAA 4RKEA 1JJAA 5TMDA 2IW1A 4J0EA 3SIXA 3TMYA 3HDHA 4QEDA 4WNAA 1QS0A 2YN0A 5FNVB 1UBEA 4PBRA 4J2HA 1XQ6A 3GX1A 1D1SA 3MXTA 4DJTA 3GRFA 3KKKA 1Q1AA 3LDAA 3O9ZA 1UJNA 2IHYA 4RK7A 4WWHA 4D6XA 3OSUA 1IZ8A 3QHQA 5J4YA 2LDXA 3AVWA 4I5IA 4MV5A 1KEVA 2ZSBA 4JT2A 2QQEA 1XQWA 4H17A 4OGGA 4JQZA 2DWQA 3PFBA 2QWXA 3CEMA 1Q3HA 4INPA 2RGNC 4N8SA 3UENA 4CWAA 1PD0A 2Q3CA 1RW4A 1V4BA 4EDHA 1GUBA 1WDTA 1G3IA 1N5IA 1L8OA 1VE5A 4FGKA 4IEFB 4IHKA 5EPUA 3USES 1VJ0A 1ZN2A 3WISA 5KTSA 4ENQA 1QVVA 4HXGA 1M8KA 5LNK1 4X93A 2ILVA 4X66B 2VNSA 5I01A 3QE9Y 1E6CA 3OU6A 1S9HA 1ZC4A 1M66A 2HKIA 3CR8A 3THYA 3GA5A 3VM6A 2OK8A 5CX1A 4KBGA 4XRRA 1UDBA 4G4GA 2QXTA 2QZ4A 3LBIA 3GZ4A 1UOQA 1DBIA 1DRUA 2EARA 2IRWA 3IP1A 3COZA 3V48A 4LXUA 1MC8A 2PKRA 1TKCA 4G0YA 5IJ0A 1NKSA 2F43B 3JWJA 4FEGA 2WIJA 4OH1A 1EIWA 3OA2A 3JZMA 4RADA 2VH1A 3FOCA 1XFDA 3HA3A 4YMHA 1QHFA 1WOYA 4DR4B 3FGNA 1LDBA 1GPDG 1VE6A 3KIPA 2AZ4A 4RXUA 4DCVA 5CDTA 1QIGA 1VPDA 3ANXA 3PKZA 1AQYA 1RHRA 1XPJA 4YRIA 3O0DA 3QVTA 1QCCA 4K8OA 3CVJA 4OHBA 1SPXA 5KNLA 3LQ2A 1SCKA 5DN9A 1V1MB 1Z5WA 3OJCA 3T7JA 4RPGA 3SIWA 3QSGA 1JHVA 2C0PA 4PNPA 1PDWA 1GUYA 4ESHA 2QG4A 1Q95A 2XCUA 4MCAA 5EFOA 5JFGA 4RIEA 1CRWG 2C4HA 3L0SA 1IZ7A 2QF7A 4BNLA 3D6AA 3DLIA 1GPAA 1RBMA 1VBMA 3HNOA 3PD0A 5HQJA 1FS6A 1YS7A 1E63A 3TFOA 1MB4A 5GJCA 4RHTA 2WQZA 1QIKA 5AM1A 4BEWA 5AKHA 1T3SA 2D1YA 2IH4A 3U7FB 5MGBA 3IIEA 4GPBA 5H4HA 3IQIX 1A95A 1Q0TA 4C05A 3EBLA 1XVIA 3T94A 4EF5A 3VPFA 1NXXA 2V5VA 1W35A 2OHHA 3EXHC 3OD1A 5DDIP 3ZV7A 4EELA 3CVVA 1K66A 4JHLA 4LNAA 3KBOA 4WHMA 3U9TA 3W2HA 2JZNA 8OHMA 1QO7A 2VSQA 3CUSA 4MR9A 5JCOC 1M73E 3F5DA 1KC3A 5IW8A 4FD3A 4O3MA 4M7OA 3LUCA 4UHHA 5BWLA 1UK7A 2MSKA 5ECDA 2VTEA 1BC5A 1QCZA 1XCMA 1WSDA 1NXVA 1BVRA 3GMIA 4ARCA 2K2QB 3CUEF 3F49S 5JXWA 3N28A 3HVHA 4H3HB 4R7GA 1V6AA 4F38A 3DTYA 3RABA 4P5DA 5J1SB 1NMXA 1P5JA 1F2TA 1T2UA 2VIIA 3AJ9A 5KREA 2QMOA 2C5AA 2AE2A 2YV4A 3CIOA 3FNRA 3ZEIA 4CKWA 1PJAA 1BSVA 3O1HB 5HBGA 3IQXA 2FPKA 2J46A 1SC3A 4Y0VA 4J49A 2BHTA 1NDHA 4GL2A 3ZE7A 2DFTA 3LHFA 4HAYA 3UK6A 4PWYA 3MRXA 4W7IA 1YCGA 1I24A 4OSOA 2B4QA 2OFOA 1X86B 2HRZA 2B92A 4NMLA 5BNFA 2I3ZA 3ID6C 1Z26A 2YWCA 4Q4AB 4P22A 4YXWD 3FCXA 3K09A 3VC7A 3T1YB 5K0LA 4C2AA 3GEBA 3N8NA 3I04M 2VHXA 4TZKA 4UNQA 4B6PA 3A6DA 2VUHB 4K9KA 2W6PA 5ALGA 3CRZA 2BI4A 3SC6A 4R2WA 1LA2A 1N34B 2YJTD 2PXCA 2VP9A 1H2EA 5CNJA 1NYLA 1H93A 3DMYA 5FJJA 5JSZB 4MGIR 4PCVA 4EEZA 1VHDA 2BGUA 2HHHB 2W70A 5JW6A 1E0JA 2I6TA 4I50B 2VPPA 3GP5A 1C4XA 3L49A 4MEJA 1KBOA 1ZOOA 4OXYA 4TV9A 4X8LA 1XCLA 2A8YA 5KEIA 1P72A 1NW5A 1XAJA 3QWAA 4D0SA 3WGJA 3FGOA 3RFVA 4TLAA 5K8CA 4EI9A 1IBKB 2P3SA 1GUZA 1QHXA 1YB1A 2C96A 2VA9A 3FTDA 4NCJA 3JR3A 5FPYA 4KR9A 3JWIA 4DQUA 2QRNA 2D06A 4DREA 3SDZA 4C3VA 1D09A 3PUKA 4BQFA 4ITUA 1XNHA 1R9MA 3WKBA 1YUBA 1L5WA 2E1RA 1BW9A 2CVOA 2WR8A 1TOAA 3A6ZA 2UV8A 4WKNA 4AJEA 3UFBA 1G4AE 4NYMQ 1E9EA 1ND5A 1P77A 3GDGA 1PJZA 1JLRA 3PLRA 4HTFB 2J5KA 4J0IA 4F5DA 3FYCA 5HIMA 8ATCA 4D3DA 3GWZA 3DZCA 4DUYB 5GGXA 2ZBFA 4CKWB 1TPZA 2XWBF 2NUTB 1G4UR 1DQRA 1JHRA 121PA 4GVPA 2OYRA 1B93A 1E4VA 1P3Y1 1PAUA 2I55A 2LKDA 1NUTA 4S2UA 2VAWA 4PAOA 4I1OA 1AMUA 3MHTA 4ILKA 4FS3A 1O9BA 2WF9A 2J0UA 1G55A 2IXTA 2QM0A 3AG5A 2ZQ5A 3IMGA 1IMOA 1UOOA 4Z9YA 4ZYXA 3GVHA 2QP9X 4B0OA 4BU1A 4IMIB 1IXKA 3J81A 1MO3A 1NQ5A 2IHUA 3E22B 1UMDB 3Q0TA 4JN6B 5JXJA 2PU7A 4WJLA 2I6UA 4X1YA 4KK4A 4YS6A 4IR7A 4ZTUB 1GA1A 2VJPA 1A4IA 1PZXA 4RY2A 1XQ9A 1Z17A 3I9MA 4MB0A 1ONOA 2QZ9A 3IT3A 4I1RA 4OJYA 3T3PB 1UOPA 3A6FA 2JF0A 1FZTA 4FB5A 4O4JB 4U2FA 2JLAA 2VRBA 1UBUS 3KAQA 1P1IA 3CEHA 2BSXA 2HH9A 2ZTHA 4ZVKA 3DM9B 3KO8A 1VPEA 1XHLA 4MIOA 5LQCA 4L9WA 4YO8A 3STUA 4DCMA 3EFEA 5L3RA 5A6SB 2AFIB 4MJ7A 4BFUA 1OTXA 5HOQA 1NJGA 2BFOA 2JL1A 2IV3A 2I91A 1S1CA 3KVVA 3BGVA 5BVGA 1ZA1A 4AY2A 3CBGA 3ET4A 4PLYA 1CZNA 3UAGA 1KFEB 3HR4A 4AJNA 1A82A 1DPGA 3D8SA 1Q14A 3D4IA 1YF3A 1B23P 2VF8A 3KQQA 1UP6A 3TNDA 4C0XA 3F3KA 1L5QA 4UVDA 5LB2A 2NVBA 4AB1A 3DTVD 3EGIA 3KZVA 1EYZA 3JASA 4LX8A 4X45A 1VFNA 5JHGB 3PP8A 3VDQA 1QRTA 1AKWA 1XXHA 3CWCA 2POQX 1X7WB 2WG0A 3U4DA 3SJUA 2ZGVA 4TTTS 4PHGA 1C80A 2WFLA 3CJTA 3R7AA 4BB0A 5HK8A 3WMRA 1N2CA 4MS3A 3RC9A 2ZRIA 5IN4A 3CNNA 3TTXA 1G5FA 3SNHA 1DIAA 2QRKA 2W2NA 1OUMA 4O5OA 3N8GA 1QGAA 2D1SA 2RIRA 3AHIA 1COWA 2O7RA 3TS1A 1QWOA 1XTSA 4ZOCA 4ARUA 2AR7A 5IJ9B 1IIBA 4Q4HB 3E2PA 2Q3JA 3FY4A 3UICA 2OBLA 3T3EA 1O6CA 4J0KA 2X86A 1M75A 5U1PA 3VAAA 1OXKB 3LTEA 5AKKA 4MS1A 2WSSA 1T6BY 4L9RA 1EFPB 1U5CA 4JVSB 4QDOA 3I83A 4PX5A 3RPEA 3SX2A 4DDHA 4AJIA 2ODBA 2I8AA 2QMQA 1D4FA 5I7AA 1CIPA 2I8LA 1QBGA 2ZUBA 4BMPB 4YPFA 2GEKA 3NFYA 1OGYA 4LRWA 3SC2B 2HLDD 1FNCA 5JDIA 4OAOA 3UXYA 3JD1A 3RS9A 1N75A 4I99A 4P3YA 4EYOA 3FYHA 5IKEA 4KLRA 3AHGA 5DO9A 4CLRA 1SVMA 2ZXFA 1O4VA 1FLAA 3N39C 3KEMA 1XJ5A 1SA0B 3BGOS 3GQBA 1JEDA 3JQAD 1HE5A 2X14A 3QPCA 3RVKA 4CM4B 4RTKA 3OQIA 3T7SA 3IQFA 4BDSA 3K0CC 3LYUA 4JBHA 4PLWA 1MB2A 4N5LA 2CMFA 1OYYA 4V0NA 5AKGA 2BBSA 4ZZ1A 2R48A 4PGHA 4WFIA 4E31A 3KWJA 4U9IS 1JHAA 2FEOA 3GEDA 4YALA 3W5HA 4F2WA 1VIDA 2W4IA 2FU5C 3E5HA 4G56A 4L3OA 3ZGLA 1HT1E 2X7HA 4HUQA 4W9NA 1JLSA 3VR6H 5PGMA 4PC7A 1KEUA 4Q6WA 3DCNA 4WV3A 5DULA 2ZYVX 2P3OA 2Q0XA 1NBMD 3ZE6A 4EJFA 4LDNA 4MNTA 4R31A 5A3JA 2C4WA 2IYAA 3LL7A 4BQRA 3PU6A 5DK6A 4TS4A 1X38A 1YFZA 1TQDA 4K6OA 3EJ6A 1Y89A 2G09A 4O4IF 4ES6A 2BTEA 1YXMA 2I67A 2VPXA 3E0XA 3LQKA 3P0HA 2JLYA 1JAHA 2CNKA 5B30A 3G9QA 1P7PA 2WSSD 1GFWA 4TXJA 3GNSA 4M7WA 3NANA 5D3ZA 5IBPA 3BD9A 3NXKA 2HY7A 1LD3A 4RABA 2VJNA 1HG0A 2GCOA 3DQQA 5ELMA 4D9EA 1LLUA 3FOZA 2AOVA 1XZ8A 4LXXA 5BV7A 3JVVA 5K0JA 3HA5A 1UFVA 1BMQA 1DC4A 2OUKA 3RF7A 3STTA 2WOJA 4NQRA 1JDJA 2YINC 4KRYA 3FKJA 2ISSD 1KETA 2QN1A 3H99A 4NBNA 3VPAA 5JPCA 1X19A 2GT1A 2XMRA 4YLGA 4G4SP 2I22A 3Q5DA 4IAOA 3DW1X 5FADA 4N18A 2SECE 1T43A 2FMXA 3AK4A 2ZR8A 3EG9B 5K3BA 5T4HA 5JPIA 3C3AA 1JUDA 2ZQZA 2QX8A 3D31A 3MJ4A 4QT4A 1EVJA 3ZIDA 1JNXX 4FDUA 4FYVA 5I4BA 1MOPA 2FP3A 3OEWA 2CNWD 5IZ4A 2WHYA 1X80A 1CRLA 1A2BA 2HHJA 3NHWA 4DDUA 1H2BA 2PUGA 4MW9A 4PFKA 3K32A 3A11A 3TE7A 1Y1KE 2QRHA 2X2PA 2C2WA 3A6HA 3EVDA 3C3WA 2ET6A 4GKBA 3GD5A 3R74A 2I3BA 1Q1NA 2H63A 3G82C 5H83A 1CQXA 1DAMA 3TM5A 1DVRA 3A05A 4XLZA 5EXTA 4F4IA 5ITWA 5KU7A 4ZCQA 1IXYA 4U7FA 2J0SA 2HHLA 5KNBH 2IVZA 1NMEA 2I29A 5H02A 1W5AA 3AIOA 2IS2A 1EIZA 3HJUA 3TB4A 2X3FA 5GOTA 2W98A 1FX0B 2Y9MB 3FPFA 5JS7A 3ENQA 1JQKA 3OPYI 2Q28A 3OMXA 3RYFA 3I4FA 4WERA 3E15A 1U0HC 4RX1A 1OB5A 1QR2A 1QQBA 4RJLA 4Z4FA 1NF3A 2PJZA 4XVQA 2VQDA 4U63A 1SQ6A 4CCYB 3OCZA 5BUZA 1DMRA 1JZQA 1NGSA 2GZAA 4HWKA 5JNTA 3ADCA 3IVAA 5LP6A 1PEYA 2DX7A 2R8RA 1RD4A 4XUGB 5K6AA 4XW2A 2IIQA 4OK6A 5F5NA 1JSZA 5EHGA 2ZEJA 3D43A 2D5IA 2JD1A 4CM8A 1YCDA 1GSIA 4P31A 4TOIA 2KW5A 4WADA 3N1UA 4JROA 1BX0A 3T1VA 4AM8A 3UXMA 2QW8A 2QB5A 4XYGA 3PIIA 4A0FA 1JHPA 4QYTA 3IHTA 5JSYA 1B0ZA 4JI8B 3EA5A 5ENZA 5KJ1A 5IWCA 2DBYA 3LPMA 4MWTA 1E3WA 5JOQA 3OPXA 5EHNA 1GZ6A 2DUNA 2HQOA 4QXMA 4EKEA 2ERXA 1DC6A 1QR6A 2LIVA 3ZLBA 5DW3A 1Z5OA 4MS4B 3HG7A 2PYZA 2HJVA 1LSSA 2B8EA 3GAAA 4RBNA 1P2FA 4PC6A 2LKCA 3X1MA 1M76A 1RWNA 4QEKA 4F06A 3QUCA 4UC0A 3ZU2A 3PJRA 3MJDA 1U2TA 4Y2YA 1X7XA 1H8HA 2ZRHA 2IU0A 3EZYA 2FPGB 5JAZA 2WZCA 3V4OA 2Q1XA 4EG6A 3G8DA 1JHDA 1EM6A 1MA0A 3LRXA 1TEHA 4M0CA 1N7GA 3BRWA 4WA7A 5SYAA 3HJBA 3EGXA 3WK8A 2EJCA 2BH9A 1JMVA 1UMBA 3GUUA 1VKZA 1NATA 2YNMC 1XE3A 3G85A 3ILYA 1VM6A 2IHJA 3MERA 4G26A 4HBZA 5ANRB 3N5KA 1OD6A 1BG6A 1QO0A 4EG3A 2PAFA 1NNEA 3EC1A 3VVLA 3OU2A 2QOEA 4LGCA 4RMHA 1LKZA 4ENPA 4M8LA 1KVUA 1ZH8A 4NONA 4S1NA 5IHXA 4V0LA 4BO4A 5AK0A 2E3JA 3UHOA 2IP1A 2PS1A 5HGXA 3H9GA 3NYIA 3V1TC 3AEKB 1O94D 3U7GA 3I1IA 5AVXA 3IKJA 2WM8A 3SR4A 2ID4A 1T0HB 2MOKA 2QSJA 3N2NA 5IASA 2N1MA 1RTKA 4MR8B 4YAIA 4R84A 2QRUA 1W59A 2N47A 2GCPA 2IDJA 2DKFA 2VBFA 3WIOA 3AI7A 2XYVA 5J3JA 1ESMA 3N2GB 4PSDA 5GVSA 4FDMA 2A9PA 3QLJA 3B6ZA 2GCEA 2WG1A 4FHGA 4NKRA 3RQIA 3UWOA 3HXOA 3VISA 1J9GA 3PPXA 2BGGA 5KDOA 5THKA 2I6GA 4CKZA 2LD4A 1Z0IA 1FX0A 3KR1A 3NHKA 4BMSA 3HZZA 2IIBA 2YRFA 3IHKA 4QRIA 4RMJA 1SUSA 3OKFA 4RJJA 5EE1A 4PLTA 1Z4JA 2ZRPA 2PZ8A 5D1HA 4C1NA 2XXAA 1YFKA 5G1OA 3ZK8A 3FJ1A 1N57A 3QK7A 2V5AA 3AP1A 2ZU6A 1B3RA 3VQTA 1JHMA 5BQ3A 1BWPA 1SN7A 3EA0A 4F9FA 3GPLA 1BYIA 1NVGA 3OEED 4B32A 4M22A 3TVYA 3S6JA 1EXMA 3U7EB 1DV2A 2FX2A 3KSMA 4B3DA 3E35A 2X13A 1D6SA 3OQHA 4P92A 4R8LA 5AVKA 1J1ZA 2WHEA 2BGJA 3QMWA 4LDQA 5CLFA 1U7UA 2XKKA 5C18A 1WB5A 1J25A 3KB8A 1XNRB 2J9YB 3S2EA 2FDRA 1BN7A 1T5DX 2A0KA 4M21A 1Z06A 4TTIA 1ZGZA 1AUXA 5KYYB 4UVIA 3RVNA 2N46A 3QV1A 3SMQA 2PUEA 2IF2A 2CXTA 3S8MA 3C39A 1QYIA 3BTUA 5CJJA 2M6KA 1C5KA 4UFPA 1XD2A 1MT0A 1H2RS 3B5JA 4CMGA 2G8LA 2JHGA 4DM7A 4YASA 3OKCA 2G25A 2XEXA 4MJLA 5BSUA 4W5TA 4YRPA 4JI4B 1BE1A 4MKGA 1JH8A 1OPRA 2PD3A 3HR7A 3Q40A 1FSZA 1X2BA 1G60A 4B4OA 5TEVA 5B3LA 1E2JA 2BEWB 3KT8A 4WESA 2ECPA 3LQRA 4FFNA 1MRSA 4JLWA 1B42A 4UHBA 1OX4B 3WGLA 1KZYC 1S01A 1YKFA 2QD5A 1CZOA 1CZLA 1L5ZA 4MKZA 1VLQA 3SXPA 4YRLA 1N5LA 1Z4OA 5EHZA 4L5JA 4AY5A 5AW0A 4B3BA 2O0JA 3M1YA 3PI7A 2NZYA 4MAMA 3B6EA 4QU8A 3M34A 4D5EA 4MV8A 2R6DA 1E9SA 2YWFA 1H5NA 1SKYB 4OFXA 2ZWIA 4IVQA 4BX3A 4QODA 3AVVA 1DIGA 1XMOB 3WRXC 1AS3A 4JQSA 1J23A 3FMIA 4F6RB 4KO1S 2I3GA 4E07A 2B8TA 5B1HA 3TAHA 2C9YA 4YJFA 4MVJH 2CFRA 4JDPA 2PT9A 3NIBA 4R3NA 1V45E 5HDBB 1SURA 1JVSA 4HOYA 5EE0A 2PRZA 2Q4BA 2QSZA 1J99A 2ZYIA 1DELA 1KJYA 1V3QE 3A06A 4CHGA 3WO0A 4U7TB 1Q7BA 4DJJA 1DJMA 4HN2A 4L5CA 5L4NA 1BMFA 1EP9A 3E03A 3E2MA 5HMLA 3HA2A 4F2DA 1LFDB 3OOYA 2W8BA 3EXG2 1GO2A 3PFFA 1GQ2A 3PVCA 3ZY6A 2BLNA 1SUAA 2GD2A 5BORA 2OGTA 1QH9A 2VF7A 4Y9UA 2CLFB 1IXZA 3HYNA 5B3KA 3TTTA 5A5EA 4WINA 3RFFA 4J75A 4HQOA 1M1YE 1Z0SA 2PX4A 5WRFA 2Q2OA 3TTUA 3Q5EA 3PX2A 4J0FA 2FZEA 3ZZ0A 5I4CA 1T8PA 3NDBB 3LIIA 3PFKA 2G1KA 3HJGA 4HLUA 3C5HA 1H2HA 3LBFA 3R4VA 1N8NA 1M34E 3PSHA 1RWPA 1BE8A 4Q3CA 2O3SA 2IXFA 2E4ZA 2XB4A 3JQ6A 3IMEA 5CM9C 5AXBA 2MIIA 1N2OA 2VH5R 3OTIA 1U8ZA 3EHDA 4IX1A 3QOWA 4P4LA 4G0VA 2V9PA 4HDMA 5EOVA 4D9HA 3ZU6A 3HRHA 2QL5A 5G3ZA 1MB3A 3OJXA 2PRKA 1KWKA 2QRLA 2M1XA 4FTWA 3OO1A 4DMLA 2XZOA 1I4TD 3DLAA 4RSHA 4FMDB 2Q29A 4OMUA 4PZYA 5CNIA 5T8KC 1L7RA 4QQKA 3V7UA 3WZ2A 1ZHFA 4HDCA 4DIOA 3D6VA 1N7JA 2Q5EA 1OH6A 4EX7A 1RWMA 2VXOA 4N7MA 2OESA 1TO1E 5AM5A 5AESA 3AVUA 1EM8B 3EVNA 1GITA 3MIZA 1SXHA 4EY4A 2R7MA 2RHLA 5E2AA 1JKJA 2QM3A 3E3LA 2FZGA 2LBPA 3ROTA 4NFHA 1GYQA 3EODA 4M1OA 4INZA 4N76A 4TYYA 3LDGA 4C6TB 1QDLB 1E1LA 2BFDB 2WIAA 3NTVA 4EK9A 3ZNPA 4RPKA 3WB1A 3RAFC 4BCCA 2FN3A 1VI5A 4HG2A 1E5XA 4A82A 4WKPA 1KXZA 2D5CA 3EH2A 1PW7A 1HDXA 2GEFA 2P4HX 3D8UA 3NGLA 1OCEA 4IGEA 5BWOA 3UJPA 5L9AA 3WGYA 1FTNA 3LY7A 2YFYA 1W88B 1HEIA 2DH6A 3E2IA 2ZS8A 4WXEA 1ST3A 2I2BA 2QE7A 3B8EA 4ZQGA 5AM3A 5HYVA 3OU7A 3ORSA 4TXLA 2HRRA 3LP5A 1PK9A 3R6GA 4OSPA 2V4ZA 4UCQA 3RHFA 4EG5A 2EHDA 1U8CB 4L73A 3WDMA 4MVJE 1C50A 1KC1A 2PGIA 4IX9A 1GUAA 2V54A 3KNZA 2VYVA 1GXSB 3ROQA 5HIJA 3FUVA 4UOQA 3HI6A 3SZGA 1YRWA 1MHPA 2FVYA 1O0SA 2B9VA 2ECKA 3P19A 2CNOA 4M6WB 2OL4A 4M3NA 4N1AA 4Y6RA 5ICEA 2CZQA 3RYIA 4H9GA 4UUOA 1AE1A 2O2ZA 4AJ9A 2QAGC 2WG2A 4MJXA 1Y82A 3LUFA 3IMKA 1I5RA 2JFOA 2FPLA 2J9GA 2R5WA 3FGZA 3KQMA 3WGQA 2G70A 3H2IA 3PNBA 3PUJA 4LJ7A 3WWDA 2APJA 3P9PA 2Z8YM 3PXGA 3V97A 4BZWA 4P86A 3TTYA 2JFVA 1J2EA 2B4YA 1SULA 5LPNA 1P62B 1SU6A 1FDOA 2YIJA 4LK3A 2CL6X 1SG0A 2KM1A 3EG5A 2ODEA 3PC8A 4Q7KA 2WKQA 1T5LA 4Y6OA 3VSBA 4IQFA 4FYXA 2NM0A 5ALWA 1OZ0A 1NR5A 4HEA1 3CVUA 1NQAO 2OLKA 5BSGA 1AKUA 1V1RB 1PRYA 2Y0BA 5I5EA 1SOUA 3LNCA 2BZ0A 3C3PA 1K7SN 5IBCA 2PX8A 3TOZA 2YJ6A 3BORA 5CAEB 3A14A 4GMXA 4GUAA 4QGBA 4NYIQ 5C80A 4M2LA 2E4UA 4XIFA 5JO0A 5M04A 1WQ3A 1LY1A 1OI7A 1DJLA 1OHHD 1K89A 3CZCA 4MVWA 2Y05A 3FLAA 1ZD9A 1JQBA 4PSCA 4ZAXA 4MVJA 3K9LA 1IN1A 2JAUA 1YV9A 4LBZA 3W4KA 4NENA 5K0EA 1LF0A 4UU7A 1LW7A 1C3JA 1ENYA 1T0PA 1ZN7A 3JVDA 3G2NA 2ERYA 3O31A 1DB3A 3MRSA