4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transport protein
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
2RGBA 4BZQA 2FX3A 4IHQA 3B13B 3BERA 2O8DA 4A4DA 2IF0A 1CKEA 4YMWA 1U0LA 4ABYA 3WP0A 2ODNA 3BB4A 2JASA 4IOMA 4AY2A 1TEVA 4NONA 2RGAA 4F7WA 1OIWA 2WOOA 1LW7A 3G82C 3PQCA 1E2MA 1UBGA 1MV5A 4JIMA 1M34E 2XB4A 2ZRFA 4K46A 2ZRKA 4PR0A 3VHXA 2ZR9A 1ZBDA 1X8JA 4MGZR 1IBRA 4FN5A 3U7HB 3K53A 1VIYA 3K9LA 4D82A 3VMFA 4ESHA 5EUQB 1E69A 2YINC 1F48A 2ZTSA 5DISB 4LHYA 2GK6A 4DC9A 5P21A 2QTVB 1AN0A 2BM0A 2G1JA 2RB4A 3CF6R 5L3SB 1E4YA 1LF5A 3GPLA 1NKTA 3FE2A 3TKLA 1CBUA 4PFSA 1YE8A 5E3HA 1P75A 1DG1G 1OXXK 4KU4A 2RGXA 4C0QC 2XOKA 5J5CA 3B9PA 5TVKA 3HU2A 2IEZA 2FZLA 2YOGA 1OB5A 2OUKA 1JPNA 4EQ6B 2RHMA 2NO1A 2WWGA 3VR1A 1SZPA 2XXAA 3SOPA 3C5CA 4P4SA 4Q7LA 4PSVA 3UKDA 1VIAA 1NBMA 3MD0A 3QIAA 3A37A 4KBFA 2EQBA 2PLFA 3I3SR 4N1AA 3M0EA 4QNRA 2XTMA 4DDTA 4CEIA 1EFTA 2GRJA 2O8DB 5CJPA 1OLOA 4I81A 4PQRA 3RSLA 2BM1A 4HB4A 4LV5B 1T0JB 2QRZA 3LLMA 2HDNB 1HT2E 2FGJA 4NCKA 2AKAB 3VR6A 5SZKB 3IO3A 1FPMA 2JLRA 4Q1DA 1ESNA 3FGNA 5DI9A 4PC1A 4YLGA 4CVNA 2DPXA 2WZQA 1HUQA 2PX0A 5GJVC 5L3VA 1ZM7A 1R0YA 3TAHA 3TAUA 4LJAA 3CLVA 3GJXC 4QBIA 3FDIA 2XB2A 1IN4A 1BYIA 2TMKA 3HJNA 4Q00A 2Q3FA 1UF9A 3W8RA 5LPNA 3TQFA 4NE2A 4CIDA 4YONB 1N3BA 2DFNA 4OQXA 4BLQA 1AQYA 5GJBA 4URYR 2C03A 1GFIA 2ZRHA 4W7SA 2DFTA 5IT5A 1WCV1 1US8A 1ESMA 4FMCF 1YRBA 1PLKA 2HJGA 4LGMA 2JJ2D 3LVQE 4QBGB 4TN1A 1C9KA 1ELOA 5DSZA 1ZVQA 5FOTA 3U3OA 1VYTA 1W1WA 5E7MA 3K09C 1E9RA 1XTIA 1J7KA 2V6IA 2ZITA 2CMKA 3R8FA 2WWHA 1ZNXA 2IL1A 2VTKA 4C0KA 4A8JB 3A4MA 1GIAA 2CEAA 4IDNA 2HYIC 1HTWA 3ZDQA 5FBQB 4A36A 1G4AE 3X2SA 2EFCB 2XXAB 1Q1EA 3M4YA 4P4SB 3TUJC 3QKSB 4JLKA 2MSEB 1G6HA 3AP2A 3EA0A 4AKGA 4Z54A 3WYFA 2O8EA 3ZJYA 1W0JA 1JB1A 3DMDA 4CEIB 4J0QA 4MITA 4A0RA 1RYFA 3A1SA 5IF9A 5JEEA 4CF7A 1G5PA 4TWZA 1EGAA 1FL9A 1ZJ6A 4OJKA 1E2NA 1KNXA 1R10A 3ECCA 2GCNA 2QQ0A 2JLZA 1GVNB 1DAFA 2W2XA 2ZVPX 3D8BA 1LY1A 2ZS8A 5JJLA 3UG6A 3UK6A 3TVTA 4R98A 2YJTD 1ZIOA 1DG3A 2OBMA 3BFVA 3AVXA 1Z08A 5A0FA 2Q21A 1W36B 2O52A 3IGFA 1U90A 3QG1A 2WWWA 3QQ5A 2QMOA 2JJ1D 5L3RA 3W6OA 4BLSA 4TMZA 1NY5A 4QG7A 4KFSA 3K0FA 5CDFE 4E07A 2IYSA 1JXMA 2QAJA 3KFXA 4HAWA 1GG2A 1US8B 1A7JA 3ND8A 4KCGA 4LJ8A 5CB8A 2FFAA 3VX4A 1P2VA 2PJZA 1V5WA 2GESA 4NYMR 5EXXA 3FYHA 3A1WA 4CDGA 3KX2A 3MAAC 1ONBA 3ZZUA 3PCRB 2C2HA 3H4MA 2EU8A 1XCPA 3FMPB 1E9AA 1CR0A 2G0TA 2CVHA 4FXPA 2CXXA 4TMKA 2R9VA 3WHKA 1E9DA 3TIFA 1I2MA 2D2EA 4H1VA 2OXRA 1XX6A 2DWPA 3QKTA 3BWDD 1KKMA 4A9AA 2CDNA 3O8RA 3TR5A 3L0IB 1Z0KA 4NPHA 4LRWA 3DHWC 4POAA 4UKDA 3I32A 4CYMA 4JL5A 2EYUA 2XOKD 4D4KA 1P60A 3ZQ6A 2O8EB 3DKPA 3OEHD 4ITRC 4A2QA 4OI4A 2ZSFA 1I4LD 2QEQA 1JR3D 2ZAMA 4HB3A 3W9YA 3VR2A 5BYKA 1TUEA 2FEMA 3TRFA 4LBWA 3LBNA 2OCAA 4QXAA 1QHGA 1U8AA 4LJ7A 4PANA 3QG5A 2BJWA 1E1QD 2PCJA 4R9UC 4F93B 5B57C 3LLUA 1T3SA 1FP6A 2VPPA 1TL7C 1UJ2A 2WIAA 2FPKA 1TMKA 1VCNA 1HH4A 5EP2A 2KE5A 1MABB 2ZE5A 4KJZA 2P0EA 4HYYA 4C7OA 3QJYA 5TARA 1N5LA 2YC2C 2F9MA 2QAGA 1FX0A 1NG9A 4M1YA 3NXSA 2QG6A 3K0FB 3ND9A 1D6JA 5GJWC 1G7SA 1W4BA 4LJ5A 1KDPA 3U7GA 2R2AA 1AKEA 2J7PD 4TLDA 3TSOA 1W36C 2Z43A 2IYTA 1AS3A 1HEIA 1OW3B 4TL9A 1OYYA 1D9ZA 2QQEA 3CZPA 4M4SA 1U94A 2HT1A 2V7QA 2J3EA 2F3RA 3QXHA 3LO5A 1IY1A 2WVJA 1QHYA 5F98A 2YC4C 2RGGA 5KO2A 2IYYA 1JEDA 2HF8A 4GRAA 2OE2A 2VHCA 3GEEA 1XTSA 4FW9A 3JZAA 1KGDA 1S9DA 3X1WA 3SS8A 3GD7A 4D4JA 3RRMA 4X8LA 5AJWA 3SYKA 2CHQA 1UBFA 4DLYA 2GA8A 1Q21A 2VBCA 1P9NA 5EXTA 1R0ZA 1Q1QA 4NYMQ 1E99A 4L5BA 3QXXA 3CRW1 4LYAA 4UJ3A 2FFHA 4BFVA 3VKHA 2ZSAA 1OFIA 5E7JA 2WKPA 3KFVA 3TE6A 3ZYCA 3CH4B 1Z6XA 3R7WA 8OHMA 3GQBA 1VCMA 1GM5A 3RRNA 4JL6A 1I4DD 4BZPA 1E2KA 4JLMA 1KI8A 2E9SA 3AKCA 4C7OB 3PEUA 1CXZA 1B23P 3ZD7A 4C0AC 1AA9A 2ZI6A 5IRCD 2QAGB 1FX0B 2BDTA 2AD5A 3EG5A 3TLXA 1SVIA 1IN7A 1TQ2A 4HLCA 821PA 4UNRA 1DTSA 2PT7A 3WMGA 2OCBA 1KYIA 1E9FA 4LHVA 3GJ6A 4JLPA 4QL3A 3T1VA 3CO5A 2ZE8A 3SJZA 3HU3A 5FBWB 2WAYA 1E2JA 3L0OA 4XJXA 4XVRA 1II9A 3FKSA 3PUYA 2VHTA 1SVWA 1E2HA 2SHKA 2UZIR 3OIWA 1NY6A 2RAPA 1YZQA 1FMJA 3QPVA 2G83A 2XTNA 4XTRA 4MRPA 2A5GA 2IHYA 1ZCBA 1NBME 3OE7D 4DUGA 4TMTA 1C4OA 1XJQA 2FPMA 4RZXA 1BIFA 2Z0MA 3LH5A 2W83A 2WJYA 4D2IA 1K5DA 3P32A 1KK2A 3Q9LA 2P6UA 1KY3A 4IXNA 3KXIA 5DI3A 4B44A 3NWJA 2FSIA 2NG1A 5ELXA 2Q9AA 1Z2CA 4B2PA 1ANKA 5FOVA 3SN6A 1N5IA 3SJAA 1AZTA 3R7WB 3GEIA 4NZYA 1YU9A 2AFIE 2GAOA 3C15C 1N5KA 4K81B 3DDCA 4Q9IA 5IK2D 4CGZA 4Q9LA 4IEIA 1E2FA 2I3BA 3K70D 1X6VA 3U3KA 2IT1A 5K8UA 3AV0B 1T4GA 3B60A 3QVVA 4DCUA 3P27A 3L82B 2CE2X 4BECA 1XCGB 2C96A 3AEZA 3CPEA 2VSFA 1VMAA 3PUZA 4M22A 4MKIA 2PH1A 2VHQA 1WMSA 2QAGC 3RSOA 3GJ7A 4PC7A 2BJVA 3ZVRA 4N3NA 3A36A 4BRWA 2QPOA 2WMOB 3T35A 4TYPA 1G17A 4MRSA 1BO6A 1F6BA 2WMNB 1DS6A 2GILA 1SHZA 1ZM4A 3KXKA 2BEJA 2Z4RA 1R7RA 5EE9A 1BYUA 3WNCA 2C99A 1CULC 4O2RA 3IDQA 1T5LA 1PVOA 4LJYA 2F1RA 5FTKA 2DFKB 1XTQA 3PUXA 4HLDA 5G53C 1F2TA 4LPKA 1IHUA 4KVAA 2L0XA 3FFBA 4HDCA 3BRWD 1HQYE 3THOA 2RCNA 2V9PA 2V7QD 5JEDA 1NIJA 5B30A 3T61A 4QOSA 4ZCLA 5DE3A 4ERNA 5GJCA 1XNJA 2FEOA 2F1HA 4CEJA 3MJRA 1H8HD 2FGKA 3ZS8A 1E6CA 1CP2A 3T15A 4K8OA 2ERYA 5DI3B 4O0MA 3TGPA 3H0KA 4AG6A 2G1KA 3QF4A 4GP6A 5DO9A 1O87A 1MRSA 3LQRA 4DDVA 1MH1A 1MT0A 3DZDA 5DYIA 5ANRB 1E32A 2J0QA 4YC7A 2GF0A 3RC3A 5LB4A 4DJTA 3EWAA 3VKWA 2JDID 1ZUHA 1O3YA 2H5EA 2AKYA 5H1YA 2IK8A 3EXAA 3B8HA 1XXHA 2AFHE 3FHCB 4TQAA 2RMKA 1XFAA 5JJIA 4B6FA 1RFLA 2ORVA 4JL8A 4WZAE 4C0HA 2DYKA 2FWRA 1G8YA 2CHVA 1G3RA 1TX4B 3D3QA 1IXRC 4DSNA 2B21A 1KY2A 3NHAA 3OAAA 2G88A 4JLJA 4EIWA 5HKKD 3I61A 1NMYA 1U99A 3KKQA 3D7MA 3IILA 2AK3A 3QOFA 3R9IA 2H17A 1E1RD 1E2QA 4LJ4A 4L15A 3CRMA 4P32A 2IUTA 3RS5A 4R7ZA 4PXAA 3LQQA 4UNPA 2IS2A 3WNDA 4RD1A 4GZLA 4TTQA 2KBEA 3KJEA 2WOJA 3BC1A 4B76A 2KI5A 2QTHA 1G8HA 1P61B 1E94E 2V8OA 2XX3A 5FPYA 4D0GA 3VR5A 3GMTA 3EWSA 3UXMA 1ZM9A 2FF7A 5DLQC 3CIOA 4GZMA 3SFVA 3QXCA 3BORA 2ZROA 4G5OA 4ILEA 4DCVA 1XEXA 5HZHA 5AR1A 4CEJB 3LVRE 2ODEA 3WHLA 2Q9BA 2ZQ5A 1KSHA 1KK1A 4AC9A 1KI7A 4B3FX 3QF4B 2DWQA 4P4TA 4X8MA 2F55A 2OBNA 4B3DA 4D25A 2GVDC 1HY3A 3VKGA 2HT6A 3A1VA 2AHOA 3MWLA 4UQOA 1H8ED 1T91A 2JLXA 5DHAA 4JLBA 1CTQA 2C9CA 1QHXA 4B3BA 3OESA 1D2MA 3JVVA 3Q72A 3QF7A 2W00A 3CRVA 5AJYA 3AF4A 5BW8A 5HZKA 3GLGE 1FP7A 1XXHB 2IWRA 2XNDD 1NP6A 4PPFA 4LY6A 2Z5FA 4RZUA 4WAUA 1QHHA 2J5XA 2LKDA 3NBZC 3T34A 3I8SA 3VNVA 4IEEA 4EPRA 3EZ7A 5FI0B 2AWNA 4A2WA 4IOJA 2GHIA 2ECKA 4Q03A 3SC3A 2WAXA 2ANCA 4NCIA 4C0SA 5HR5A 3BK7A 3V00A 3RVBA 2CVFA 3K9NA 1Z2AA 3M6AA 4JT2A 1SVSA 2C78A 1UFQA 1Z29A 1UM8A 2IYUA 1E9SA 3FTQA 5FTMA 1SVOA 4F38A 3B1ZA 4PAQA 1G19A 4YMVA 3IKJA 1VG0B 2BBWA 1IJFA 4QFMA 3HR8A 4A6PA 1EXMA 2WSSA 2AR7A 3KDSE 5E4FA 1M6NA 4BFSA 5K8LA 4C3ZA 2O8FA 4FMCB 2QBYB 5EE0A 3W90A 1G64A 3AVTA 4DLXA 1GDDA 3DKVA 4I1SA 4F4IA 1LTQA 2ZE7A 1GUAA 3ZVLA 1UKEA 3C8UA 2ZJ8A 2XAUA 1LS1A 3LBIA 3QKUA 1DELA 4E22A 1ZU5A 4DKXA 1HT1E 1X86B 4R2HA 4C2UA 1BOFA 1DAGA 3ETLA 1N6PA 2GAAA 1HA3A 2W6ID 2UKDA 3SR0A 4KITB 3SQWA 1KO7A 2QPAA 4BWYA 3AVYA 5LDDC 2VP2A 3CR7A 2OT3B 1Z8FA 2GEVA 3NC0C 4CW7A 1F2UA 4IVRA 3BOSA 2JJ2A 1QHHB 2FNAA 2GF9A 2ZI4A 4XD7A 5EZ6B 3W6PA 4DT1A 1OXVA 3EAQA 4IDPA 3HP1A 3PR1A 4LBYA 2N1BA 3IBYA 2YYZA 4GI7A 5JHHB 1G3QA 1NLFA 1TF7A 1KAGA 2AD1A 1JBKA 2C5LA 1KHTA 5EQTA 4B48A 4HB0A 4HUTA 1R4AA 1YZUA 2CJWB 2WKQA 3MRSA 4DLWA 4V02A 3EC2A 3A1UA 4GNKA 4Z1MD 2B6HA 2F7SA 3N2EA 1JAIA 2REOA 1R0WA 5FOWA 4AYWA 1IN5A 4B47A 2D7CA 2FSFA 2P5TB 4LYHA 4AYXA 4BEBA 1ZD1A 1PLJA 4QRHA 3TUZC 3ZIAA 1VDZA 3I5YA 1R5OA 1KJWA 3RLFA 1AM4D 1KSJA 3ICQB 3SNHA 2PX3A 3K1JA 4D4MA 2FFQA 4C0JA 1XPRA 2VP9A 2O8FB 1RJ9A 2IX3A 4OK6A 4PC3A 3X1YA 2FJUA 1UDWA 1GKYA 2FOLA 4NU0A 1P62B 2V54A 3REFA 2NO7A 1XRJA 3BH0A 4A0GA 1VHTA 2UZ3A 2NOAA 2QN6A 4DLUA 2XZOA 1J70A 1WE2A 4E09A 4OL0A 4U00A 2JJ1A 2Q9CA 4HDOB 4OQMA 4BLTA 3AVQA 1GILA 1II8A 3KJGA 5C1BA 2CLSA 3IIKA 2PZGA 4MYTA 1IAQA 1E9CA 2P2LA 3PEVA 1F2UB 2W6JD 5FL7D 4KHZA 1C1YA 2EW1A 4M1SA 2W2VA 4MYUA 3K0AA 1FUKA 2BMDA 4NYJR 2GZDA 4DT1B 1VTKA 2A5YB 3AVOA 3IEVA 1VHLA 2H16A 1GNRA 1S96A 3BGWA 1JI0A 2O0KA 1JEEA 1M7GA 3VR3A 5JJKA 4D4LA 1DADA 3I8XA 5KSYA 2A2ZA 1SXJD 3EZ9A 5TY0A 4MRRA 1K5GA 2VF8A 2QA5A 1LB1B 2ZE6A 1NJGA 2PMDA 3CNNA 3PEWA 4DDUA 4FD2A 5JRZA 1J8MF 1DAMA 4B3XA 4LYJA 5F9FA 3OEHA 2DCUA 3KJIA 4Q47A 3PIRA 1E98A 4Q48A 4A0FA 4BQSA 4ASUA 3GLIA 3A4LA 1JR3A 1XWIA 3PG5A 1N6IA 3VHLB 1OF1A 1ZNWA 1RJ9B 1A82A 3PV0A 1XMIA 1E1QA 3H1TA 1Y63A 4IFEA 4OI2A 1ZMXA 1L2TA 3Q8XB 1W7AA 4NHOA 4IXMA 2JLQA 1Z0DA 2RHDA 1DO2A 1VKJA 1VYUA 4LZZA 4M9XA 4MA4A 4Q7JB 1U8YA 2WSSD 1FMLA 4LOAA 3GFOA 4JT4A 3Q7PA 4HB2A 3LXXA 4D0LB 1KZ7B 5AJZA 1Z83A 2WICA 1R2QA 5J47A 3QENA 2ZS7A 4DCNA 1IQPA 3QY0A 1II8B 4RD3A 1GSIA 2ZSEA 3DOEA 4P33A 5E7IA 4Q1AA 1XXHE 4DWJA 1DVRA 2PZEA 1YZLA 2J7PA 1Q0UA 2GDJA 2JJ8A 2ZI3A 3P1JA 2V1UA 3PEYA 2IC5A 2FFBA 4P0TA 3K0AB 1VPLA 2WBLC 3B5JA 4QNMA 3SJBA 3KQHA 2A3RA 1E2PA 2QP3A 5SZIA 1KDRA 5EE5B 1EX7A 3NBXX 3O8DA 5FUXA 5FOSA 4QJ5A 1E79D 3GLFE 1JAHA 2P67A 3AVVA 2GJKA 3HYRA 5BN5A 4NBSA 5H70A 2VP6A 3OEED 4XD7D 3I5XA 1N6OA 3X1XA 2G3YA 4YDSA 1RRFA 3EIHA 1G7RA 2NZ8A 3IIMA 5K8IA 4W5WA 4W9MC 4QKQA 3UMFA 1G20E 2IWHA 3RS4A 1NMXA 2HLDA 3IO5A 3GLIB 3KKPA 1J2JA 4Q9KA 2GVZC 1UADA 4OYHA 4NYJQ 4D81A 1HURA 4MUAA 1W47A 3MCAA 3U4QA 2P6RA 2A5DA 4LYFA 4OHZA 3ZIAD 4W5HA 2ZRAA 2QMEA 5JS7A 1ZD9A 1OFTA 3RAPR 3LV8A 3BB1A 2F3TA 3HU1A 4JVSB 3UPUA 2C9YA 3MWJA 1JJ7A 1VCIA 4C30A 1X1RA 4C4PA 1T3LA 1IJEA 2J7KA 2ZU6A 2BKUA 5JECA 1IXSB 4XWKA 2BCGY 2J0UA 3PUVA 3KTAA 1E0SA 1Q1BA 4TYNA 2QORA 3CWZA 1KSFX 5K8TA 1PUIA 4M53A 3ICEA 3ADDA 1P6XA 3WBJA 4PHFA 2DR3A 5EE1A 1KMHA 1YR6A 1G8FA 2J45A 1P9WA 1IONA 2WWYA 3THYA 3T5DA 1G291 1Q22A 1XU4A 4HEJA 4KVGA 4MDEA 3CKLA 4BFWA 4EJSA 4IKEA 2QMUA 1NF3A 4ZKEA 4EPXA 1W0KD 3MUFA 4Q4LA 1WF3A 4O25A 5C2JB 4JLAA 1DOAA 3CM0A 1NSFA 1AS0A 2GTPA 3VU9A 4BLRA 3OE7A 3V4RA 1G3MA 1NLZA 3EIEA 3QXSA 2ZYUX 3CX8A 4KXFB 3TJZA 2VHUA 4GMXA 1RPZA 1AGPA 2CHGA 1PJRA 3AP1A 4ZCMA 4B32A 5C46F 1NJFA 4BZXA 1M8PA 1EWQA 5A5GA 621PA 4OI1A 1NG1A 3KQUA 3DVLA 3EC1A 1NLYA 3KKMA 3GLHA 4OBEA 3U4QB 1W2HA 3SE0A 3UIEA 1XPUA 4LV8B 2NMVA 3SYNA 4WA7A 1M7HA 2LWIA 4FMDF 4Q19A 4JZKA 2OEPA 2OAP1 4ASUD 5FPHA 1G21E 2BVNA 3EASA 3GFTA 3I1FA 5IK2A 1KNQA 1NN1A 3ZZTA 5HPYB 2QMHA 2JIZD 1MO3A 2BV3A 3TVDA 4KSBA 1E2DA 1Z6AA 1ZAKA 3CRRA 1GZSA 2ZS9A 2ODWA 2MMCA 2J0UB 1Q57A 1DPFA 4FCWA 4PSAA 4RKFA 1V43A 3KTAB 5EP1A 2ZREA 4DLRA 5HCIA 3LRPA 1WXQA 5FPKA 3U44A 1G16A 1RRCA 4I1VA 1S1MA 5FTNA 1YRAA 5FR2A 2G9NA 1KMHB 2QTFA 4HAVA 5EXPA 4AK9A 1XB2A 3RS0A 4WZBE 1R8SA 3RHFA 4AKIA 2GZAA 2BBSA 3AB3A 3THYB 1OXUA 4B35A 1E9EA 2PJRA 2PT5A 2YWEA 4EJSB 1KI6A 1Z63A 3W5JA 5KSPA 4ZIRA 2FU5C 4IDHA 5HE9A 1SHKA 4IOKA 2QROA 3H86A 5B2ZA 1EESA 3QEOA 4QGAA 5CK5A 3VU9B 3ASYA 4OHYA 1W4RA 1U98A 3U7FB 2VEDA 1GWNA 3LAWA 3ONWA 4BLOA 4Q9JA 1YQTA 3GJ8A 1N25A 1TF2A 5D3MA 1AZSC 121PA 3SFZA 4PO8A 1H8HA 3IBGA 4PZLA 2YOHA 4HLQB 4UNNA 4L9WA 1ZU4A 3RS2A 3EPKA 3F3YA 3GLHB 1ZRHA 1JPJA 2ZETA 4P3YA 3FMFA 1Z22A 1WBBA 2J0SA 3TBKA 2WHXA 2Y8EA 1DEKA 3LD9A 2QP4A 2GCOA 4IFBA 2HLDD 4Q01A 4A15A 1W48A 2AXPA 1PV4A 2ZJOA 2JATA 4F91B 3NTUA 2JDIA 4Q9HA 5IDVA 1NL3A 2FPLA 3BIFA 4DLVA 2KSQA 2OILA 1CJMA 3GFPA 4ON9A 3T1OA 4ZDJA 5CB6A 2G0NA 2D3WA 4Q1CA 1DAKA 1LFDB 3K70B 1KK3A 3SHFA 4NKRA 1FFHA 2XSZD 1S8FA 1SQ5A 2VL7A 2CBZA 3IIJA 1SKQA 4CEHA 3Q3JB 1KJZA 1YZNA 4O2LA 4PO9A 4FWTA 2IXFA 5CM8B 3U44B 3E70C 2RGNA 1SULA 2IS1A 1KMQA 3OIVA 3AUXA 5HKKA 3QVUA 3C16C 2W58A 3C14C 1BH2A 1TAGA 4KSCA 1RW4A 5JSZA 2ORIA 1E1RA 1G3UA 3C7KA 2E87A 2ZANA 1YKSA 1Z47A 3O8CA 1A2BA 2WV9A 3THXA 2HJVA 2KBFA 4LX0A 5CYPA 1KI6B 3HYTA 1OFHA 2ZAOA 4Q02A 3GJ0A 2A5FA 4M1TA 4TZ6A 3CZQA 3TNFA 3SJCA 2WPDA 2ZRCA 2W0SA 3L8ZA 3NDPA 2CL6X 4TQ9A 4EJSC 2JLYA 1ZINA 2I1VB 5BN3A 3EPJA 3TQCA 2ODBA 4JKIA 2FN4A 3GLIE 3KUCA 1JR3E 5D3MB 4BGDA 3C5HA 1M7BA 4KLNA 5FBLB 1S2MA 2WKRA 1Q3TA 2JLVA 1E2LA 4XTCS 4TSFD 1U0HC 4QJ4A 1XEWY 1XZPA 2PZFA 1QZXA 2WJGA 1WA5A 1H8EA 4C0LA 2GCOB 4IOLA 1LS6A 3F5FA 3H2YA 4BASA 4II7A 4ZI2A 2VRWA 4RCYA 3AP3A 2VH5R 2XNDA 1KI3A 1R8QA 1OIXA 2CLCX 3QPUA 5TXGA 2B8TA 1FZQA 3A58B 2PMKA 2OG2A 4CEHB 2FSGA 1RKBA 4Q1EA 5DHFA 4DIEA 1N6NA 2BMJA 4LDJA 2QM7A 3IQXA 4MRNA 3K70C 3N70A 3FKQA 1P2TA 4Q1BA 5JSZB 2IYZA 2F43A 4X8HA 5FI1B 2WTUA 1J90A 1QG2A 1Z0IA 5EP4A 2EFEB 3THXB 3AVPA 3SBDA 1XMSA 5HCNA 1CR4A 3K9GA 1VG9B 3RWOA 3X1ZA 3VX3A 1COWD 1G41A 3X1DA 4WXPA 4BFYA 2QT0A 5AJVB 3UANA 3ADCA 2C98A 4YXWD 2J46A 3WBKA 4GOKA 4Q21A 2QP9X 3P4XA 4DRZA 2LCFA 4GPTA 3KB1A 4B73A 1KKLA 1XDBA 1S1CA 5F2EA 4DSOA 1OH7A 3WP1B 4PQFA 3FPAA 4DBLC 1WQ1R 3SI7A 2J1LA 2EWWA 1E0AA 1OFUX 5JI2E 1FNMA 2IXEA 2R44A 3IPXA 2NPIA 4PAMA 2ZRPA 4MDFA 2F1IA 3DL0A 3VR4A 4DB4A 5KOYA 4US2R 1RC8A 5H68A 1E0JA 2OZEA 2W6IA 4TL6A 1IY2A 4BRUA 1WP9A 5CK4A 2OLJA 3AF3A 2ZI7A 3I72A 1OB2A 2CCGA 5C18A 4ESVA 2ZM5A 1KI2A 2HXSA 3AF2A 4OHXA 2JEOA 2QRNA 1ZNZA 4M1KA 3KJHA 1E2EA 1T6NA 2YZ2A 2C77A 5JWRA 1CJUC 1Z3IX 4RJLA 1XCMA 4I99A 2YNMA 2PBRA 2Q3HA 3E5HA 1NVVR 4NYIR 3SDZA 1P7CA 1R5NA 2P3SA 4B6EA 4DZZA 4PZZA 3HPRA 4Z1MA 4V0NA 1J99A 2RGNC 4EFNA 3OIYA 1E2IA 1AQUA 4TLBA 2R65A 2HEIA 4KBGA 4KFTA 2FMXA 4KFUA 4FCTA 1ZC4A 3MGCA 4JJKA 5E95A 4AD8A 4D80A 3B1VA 2C9OA 2UVQA 3GJ5A 3U3MA 1BMFD 2VYFA 2GCPA 2H8KA 4KI0A 1FQJA 5FPTA 3A8TA 2CNWD 1WRBA 1F2TB 5CM9C 2KWIA 2WPDD 4YMTA 3OFND 5F9HA 4NMMA 2O0JA 3H84A 3CPJB 4URVR 2ZIAA 1XF9A 1KJYA 2ZYWX 2B7CA 3BBPA 4KO8A 1NI3A 5G41A 4L16A 5KDDA 1ZM3A 3T1TA 1ETUA 2H1LA 2IYRA 4OJQA 4RD2A 1CU1A 5DNYB 1FNNA 3E2IA 4JLVA 2IS4A 2OV2A 1MO6A 3LX8A 1MKYA 4RD0A 4PO1A 2W6JA 5FL7A 5J40A 5BWMA 5J4HA 5JFGA 1Z6TA 2ATXA 1JR6A 4G5RA 1ZUNB 1UAAA 3CPHA 3W3AA 3WXMA 3V9PA 3B82A 2V55B 3Q7QA 1CJKC 1P9RA 1KI9A 4HZUA 1SXJA 1PZNA 4B75A 2CL0X 3SHWA 2GJAA 1FW6A 1W5SA 4TZ0A 5SZJA 3DM9B 4QGGA 3AKYA 3BAFA 2OBLA 2QGZA 4G01B 4NCHA 1NIPA 4EPVA 4NDZA 1OPXA 2RGDA 2ZSBA 2Z83A 2V1XA 3U2QA 2ZRLA 4KYIB 4IVQA 3QNUA 4M1OA 3V4FA 5AUNB 3PFIA 4BFTA 4EFLA 4LUCA 1ZCAA 3RRYA 1QHNA 5CLQA 1L7VC 5DGXA 1IM2A 1Z0JA 1JJVA 2H18A 4QM7A 4DEXA 3RRZA 3LY5A 4CT4B 3CNOA 4KV9A 3WYGA 4ZDWA 1Q44A 2W0MA 3F0TA 1ODFA 3LW7A 2I4IA 3LWNA 1NVVQ 4NYIQ 4A1FA 2DY1A 3T06B 2FE4A 3TSWA 1SKYB 4MKGA 2CK3D 5FPSA 2ZU0C 2ANBA 3CX7A 1XEXB 2FA9A 2ZSDA 4LHWA 1NN5A 4RFSA 4F4CA 3EZ2A 4XWAA 2GETA 1OH8A 3L2OB 1DBSA 2VQSA 1E96A 1OE0A 2OSBA 3W6NA 1DARA 4DCTA 1Z28A 3RS3A 4HDQB 3AVWA 1UKVY 4MUBA 1N6KA 3CNLA 4U7DA 4HZUB 1SXJB 5G3ZA 1E79A 1OH6A 1OKKD 4H1UA 5SZHB 3AUYA 1Q1ZA 1VYVA 2DHRA 3CF2A 4QHTA 5BQ5A 5IHPA 3OEEA 2D2FA 4B2IA 5LD2B 3LA6A 2O5VA 4Q4AA 3S1AA 1U0JA 3I92A 4V0OA 4XH9B 1IN8A 4B34A 2PCLA 3QSYA 4WBSA 3DO6A 1YJ5A 2ORWA 3BH6A 2GJSA 1MO4A 2ZRNA 2X19A 5AWFC 1F3OA 5EUMA 1UPTA 3WMFA 5JWHA 1GOTA 1AKYA 1QDEA 1Z0AA 1LVGA 2WWFA 4B3CA 2NO6A 4HAZA 5AUQA 3UWKA 4L8GA 4OKSA 1XBTA 1OIVA 4LV6A 4MYHA 4CZ2A 3TMKA 1G9XA 2RGCA 3ZH9B 3SEAA 3AGPA 1HV8A 2GJ8A 2JA1A 3TR0A 2PL3A 1NKSA 2FDCA 4BUJA 4Y0AA 3ADBA 1P2SA 3ZD6A 2BC9A 5EZ5A 4V0KA 2F6RA 2NO0A 4RFSB 4S35A 1XD2A 2D7DA 5FBRB 721PA 4PHGA 2IXGA 1ZC3A 5DH9A 5FTJA 1TTTA 3WY9A 2LKCA 4JYBA 1E3MA 4TTPA 1Z5ZA 2A5JA 2E1RA 3T1QA 5KSZA 1H65A 2AN9A 2KB0A 2VIIA 2ZI9A 4I1OA 1W0KA 4RZ3A 4G5SA 1TUIA 1W4CA 4Z51A 3ADKA 2YHSA 4FMDB 3NIBA 4DVGA 2HF9A 2BIFA 2MSCB 1MOZA 3I73A 2J87A 1CR1A 3FB4A 4HAUA 1DAHA 2QY9A 2QE7D 4AKHA 4Q4AB 3S1AB 2R6GA 2WJVA 1SXJC 3IPYA 5BN4A 1U2RA 2YWGA 3AKEA 1ZUIA 2HCJB 2OO7A 4OK3A 4FIDA 4OQNA 4RFVA 1SVMA 4RCZA 2QGNA 3W34A 5TDHA 5KHOC 4PC6A 1DAEA 5LB2A 5LD2C 4Q66C 4HLUA 3U5ZB 4MH0R 4URXR 1AK2A 2VSXA 1W5TA 1YZKA 5GVRA 3K9HA 3EW9A 1GRQA 4HAXA 4LK2A 1OHHD 1YHNA 5FTLA 4NCJA 2AWOA 1RVDA 1BKDR 2WJHA 4A0HA 1P2UA 1KZGB 1KOFA 4M21A 5JHGB 1X3SA 4KAXA 4M0LA 4TTRA 1G7CA 4M8NE 4MQBA 4PHHA 2JIZA 3K8YA 1AIPA 1DE0A 2YVUA 1D5CA 3U3JA 5KNBA 1M74A 3AF0A 4DB2A 1KO1A 1QHSA 1XD2B 4M2LA 5JBQA 1G8PA 1UBEA 1D9XA 2HV8A 3PVSA 1FQKA 2BEKA 4A8JA 1L4UA 4JLOA 1EFUA 1M1YE 3BXZA 2A9KA 4PZYA 1TQDA 1G5TA 4JLDA 4A82A 3ZQJA 4GP7A 4TLEA 3CB4A 3UMRA 3QKSA 2G77B 3RNLA 2FG5A 3QI2A 4WVFA 2B8WA 3LDAA 4NTZA 4AI6A 4U5XA 1GRRA 4DIDA 1GTVA 5EJEA 2D62A 2IYLD 4QJ3A 1K6MA 2QI9C 4ACBA 1ZD8A 4AYTA 4AKEA 1N5JA 4TQUS 1QHIA 1NVUQ 1G4UR 3KKOA 3KZ1E 1KO8A 1KTVA 2X2FA 1S9HA 2ZRBA 2ZJ2A 3QXJA 4JVLA 2YOFA 3QUSA 4LSGA 4HZIA 4UXIA 3U3RA 1OYWA 4JKYA 1XD8A 4Q4HA 4S2EA 3UATA 2GXSA 4B43A 1N6HA 5G40A 3THWA 2WWXA 4RD4A 1TQ6A 3P26A 3AH8A 1OSNA 1YZTA 4RKEA 1OH5A 5BYJA 3BH7A 2JLUA 2RH5A 1S3SA 1Q20A 3P20A 1G5RA 1MRNA 2REXB 1SKYE 2N42A 2P5SA 4GFDA 1Z0FA 2ZJYA 4UNSA 4XSHA 3CX6A 1W44A 3ASZA 4XVUA 5L8VA 2H57A 2ZXUA 3QEJA 2QU8A 3J81k 2XSZA 3BE4A 4BFXA 1II0A 3BJIC 1AJEA 4G5QA 5J4VA 4CRWB 4DEYA 2PLRA 4BFZA 4XVQA 2ZI5A 2D06A 4B33A 3ZVNA 4N0EA 4GDFA 1T8TA 2FH5B 1KIMA 2MSDB 5DN6D 2V6JA 4DCSA 1Q12A 2VO1A 1UKYA 2RKOA 1EFCA 2D74A 4PC2A 2EVWX 4URZR 4CT5A 3GJ4A 3NH6A 1ZIPA 4US0R 1SXJE 3RS7A 4MGKR 3AVUA 2XITA 2REBA 1PLLA 1Z6GA 2AXNA 4FMBB 5LBIA 2ZPTX 4OHWA 2ZRDA 2FV8A 3ZLJA 1CR2A 4C2TA 2EFHB 2GXQA 2IYVA 3TH5A 1OT3A 4C9BA 1GL6A 4QBFA 1W46A 5CLLA 4EFMA 4XIGS 2MMGA 3HPQA 3T12A 4ZI3A 2DBYA 4Z8YA 4QGHA 4X8OA 2GNOA 2EFGA 4NCNA 2C95A 1HQCA 2JGNA 2G6BA 4TMXA 4GOJA 1UKZA 4KODA 2B7BA 4TSFA 1UEJA 1ZYUA 2AL7A 4LHZA 5CIQA 2J59A 1MABA 1XP8A 1OXSC 3CRQA 1G7TA 4Q4HB 1N0VC 5KU1A 2O8CA 3THWB 2BMFA 2X2EA 3DEFA 1E9BA 4W5JA 4ARZA 4DDWA 1OV4A 3W5IA 2R6CA 4HLUC 2ZVQX 4LI0A 3B6EA 4JMPA 3VNUA 1HE8B 4TL8A 3Q5EA 3AF1A 2YV5A 3A1TA 4JSTA 2BKEA 1NNEA 2GBLA 3WRYC 1ZNYA 2ZUCA 3L0PA 1T8UA 4ZCIA 1TEXA 5FOXA 1UBCA 4UJ5A 1JNYA 3D6TB 4B71A 2IUSA 4PHTA 3TUIC 4YMUA 4ZV4A 3R8CA 1HYQA 4QHSA 4DHEA 2O0HA 2F9LA 3G5UA 4OQLA 5FUWA 3NEJA 2Q6TA 3CUEF 3BFKA 1NMZA 1P73A 4OI0A 1E2GA 4IJMA 2CLDX 5JZVA 2OM2A 3NG1A 4TLCA 1NVWQ 4FINA 3O8BA 1JQLB 4A8JC 4WW0A 5AJXA 1CF4A 1P72A 1ZW6A 1COWA 1GRNA 4QBHA 4A6XA 3MFYA 1XZQA 2F1JA 1NN0A 1W2GA 3SZRA 1WB9A 1D8TA 4PSKA 2BWJA 3GP8A 4OHVA 4RZ2A 3PXGA 2EFDB 2Q0HA 4IVPA 1EFRA 4YXWA 2Z6VA 4H9GA 1Z06A 4R2IA 1NBMD 2J9RA 4GT1A 1FTSA 2XEXA 4TL7A 4TYWA 4Q7MB 2OAQ1 1ZM2A 2QENA 5KUTA 4ZDKA 3R9XA 4JSYA 1A4RA 3LNCA 3GCGA 1VG8A 3U6BA 4URWR 3DZ8A 2O8CB 5FL3A 5FUYA 4ARZB 4UXHA 5TV2A 2V4ZA 3GLGA 2HXYA 5GADl 5B58C 5DYGA 2C04A 4G1UC 3L8YA 421PA 3K0EA 2JLWA 4I1UA 3AKDA 3I62A 4EAQA 3GEHA 2R8RA 4EUNA 5JS8A 1TU3A 2NZJA 3QKRA 2OFXA 1W36D 2NQ2C 3MSXA 1L4YA 1NSTA 1M2OB 1CJTC 3DMNA 1VG1A 3OHMA 4TYYA 1GL9B 1EK0A 2XZLA 1B0UA 3FHOA 3RDPA 4JBWA 1X8LA 2ZR0A 5JRJA 1KO5A 5UKDA 1GNPA 3TK1A 2IYXA 1TPZA 1KO4A 2CL7X 2ZRJA 1XJ0A 4B2LA 2DB3A 4A92A 4WOPA 4GBMA 2NPFA 5J4KA 5KYKA 5TB5A 4TMVA 3R9WA 2GJ9A 3W8NA 3CR8A 3CF0A 1JXOA 1FUUA 1XEFA 1ZP6A 2CE7A 3F8TA 3QBVA 4DLSA 5FH9A 5JMTA 3T5GA 3Q85A 2WIBA 3OF5A 2QSYA 5JCPA 1TQ4A 3FWYA 5JI3E 1A5TA 2ERXA 5CITA 5FR1A 2R6FA 4LHXA 2BMEA 4GL2A 5JLJA 2PEYA 2ZUBA 4ZIRB 1BMFA 2QM8A 4NP6A 2ZRGA 4O3MA 3UMSA 1W0JD 2CNWA 2JAQA 4KYUA 1T3HA 3OFNA 2YWHA 1I4TD 2AK2A 5AUPB 2IYWA 2VP0A 1S4QA 3CBQA 2GZHA 1AGRA 2ZJZA 4IDQA 3LFUA 1LNZA 2IYQA 4Q1FA 3HR7A 4TYQA 3K0SA 1F5NA 2GXUA 4E03A 1N6RA 4HAYA 3GLGB 4R71A 3B85A 1LF0A 2GXAA 4V0MA 1P3JA 3FMOB 5BXQC 4QM6A 4RVCA 2DWOA 2IEYA 1GL7A 1YVDA 2OCYC 4E5UA 3KXLA 3KQLA 5B64A 5CJ2A 4JVNA 1P5ZB 1U81A 2JCSA 4D6PA 3P4YA 1I2DA 3QKRB 1FTNA 4TMWA 5JCZA 4XSGA 4JJZA 2XJ4A 1WDTA 2X1VA 4HI0E 4Q5IA 4BLPA 1U9IA 2P6NA 3N5CA 2ONJA 3WYAA 3DPUA 3NHBA 2GBLC 1JECA 1QVAA 1KDTA 3WMEA 4PPQA 1YZGA 3LX5A 4NL4H 4KLZA 1R0XA 1R5BA 1YR7A 4YDHB 2CCJA 4TLAA 2X77A 1EX6A 1RZ3A 2ZR7A 4G0NA 1QVRA 1MR3F 2BBOA 1TNDA 2QSZA 1L8QA 1NRJB 2NTYC 3D31A 4PX9A 5C4MA 3IEUA 1RRGA 5FUVA 2V3CC 3AM1A 4M9SA 2Q3MA 1KK0A 5TMPA 3VTKA 3U60B 3B2EA 4L4UA 4M1MA 1TF5A 4PPGA 4QHYA 5D3QA 2XJ9A 2IUUA 4BPBA 4JS0A 4Q7KA 1WBDA 2EYQA 1KDOA 2IW3A 1CRQA 3B78A 2ATVA 2PEZA 2JLSA 3FOZA 5KNDA 1X1SA 3JVUA 4AIIA 2XZPA 1Z6YA 3WRXC 1Y3AA 2VA8A 3LBHA 3N2IA 4HSEA 3NBYC 1GKUB 2BHRA 1EFRD 2IA5A 4G5GA 4NH0A 4DLTA 2ZEJA 1IXZA 2D4HA 4D0NA 2CK3A 4TT3A 4UXJA 1SGWA 3LW8A 3NH9A 4Q18A 5J4LA 3HDTA 3ZGXA 1RIFA 1TADA 1XTKA 1GITA 2X8AA 5CIWA 3W3ZB 5H8WA 3UWOA 1F60A 1HE1C 1SVKA 3NKVA 3L0SA 2AX4A 3B1YA 1CIPA 3MJHA 1GKIA 3NVAA 4IW3B 2WSMA 5HE8A 5FOUA 1G18A 1XTJA 2BCJQ 2A78A 3OIUA 4UNQA 1XPOA 4Q4JA 1G3IA 3VQTA 4XWOA 1Q3HA 1XJCA 2VHJA 3MMPA 5CYOA 2OLKA 4EPYA 2P65A 2H92A 3B9QA 4MKFA 3NDBB 2YWFA 4FI3C 1OKKA 4RD6A 1RRPA 4ACAA 4DSTA 5J4YA 3IHLA 3FMIA 3SYLA 1X8KA 1CLUA 4JBXA 2GKSA 3L43A 2OFWA 4EPWA 2HUPA 4LC0A 1IOZA 3DOFA 1NVXQ 4V03A 2F43B 2FZ4A 4ZKDA 3REGA 2NO9A 1D2EA 2A7QA 4DLZA 3ZVMA 4JLNA 1QRAA 1R6BX 3C4JA 1T9HA 2I1QA 4ZO4A 1BS1A 3Q5DA 3NC1C 4LJ9A 4AURA 1OJLA 5KDLA 1T0HB 4FWIB 2XTZA 4F92B 1P4SA 5L3QA 2OFOA 4MYCA 4Z8XA 2NGRA 5A4JA 1A1VA 1RE0A 2XNSA 1QG4A 2IS6A 1LV7A 3CW2A 2WM9B 2HCBA 3RWMB 1W4AA 4BFUA 1XMVA 1N6LA 3A4NA 2BOVA 4OQFA 5HTKA 3GLHE 1MO5A 4QGFA 2ZUDA 3EIQA 4KFRA 1E0KA 1S3GA 4PQYA 4QC2A 4Q4JB 3GLFA 1DAIA 1CJVC 2GEUA 1VCOA 2BBTA 1IN6A 521PA 4JYCA 3RYTC 3EZ6A 2C8VA 4GSYA 1CS4C 2R6AA 2ZJ5A 3SBEA 3CH5A 3CWQA 3K0CA 3RABA 4B3GA 4PPNA 3U7EB 1JQJC 221PA 1U9IC 4WXRA 2GK7A 2EWVA 2R6DA 3GJ3A 4RY2A 5KPJA 2ZYVX 3KKNA 2QE7A 3FKSD 2W2TA 2QT1A 4WIAA 2ZJAA 4M1WA 1YR8A 2IF2A 2QBYA 3KUDA 2HYDA 3AGQA 3SQXA 4C0BA 1NN3A 2ZRIA 3B7GA 2VF7A 4I4LA 3EPHA 1J8YF 4GMDA 4MRVA 1YR9A 2QNRA 4U02A 4OK5A 3VAAA 4IDOA 2B92A 4DUGD 5DIFA 3BS4A 1IY0A 5AUOB 3OZXA 1OHHA 1QF9A 1GP2A 4WZ6A 1K8RA 4US1R 2RGEA 3QBTA 5KPDA 3EA5A 3KQNA 4N0DA 4EPTA 5L3QB 2OHFA 1XEWX 4LC1A 3IHWA 4AG5A 4DSUA 2VLIA 4JBYA 3VFDA 4FCVA 2ZYTX 3FFAA 5KDOA 4HATA 3PENA 3DM5A 4BEJA 5FFMA 1UEIA 2ASEA 4A2PA 4IRUB 4MGYR 5CDFA 2WJIA 5KNCA 1RYHA 1W49A 1XMJA 1JALA 2O8BA 3E1SA 2XGJA 3GLFB 2QZ4A 4LWZA 2KJQA 4TT3D 2DFLA 1QBKC 2CJWA 2FSHA 4LPSA 2WJJA 3BB3A 3PJRA 2Z4SA 1CEEA 3C41J 3KL4A 4URUR 1G6OA 4GOXA 3B1WA 4D26A 1N0UA 2IHBA 4JVMA 1KSGA 4EDHA 3U6KA 1G8GA 2ONKA 5EP3A 4HUQA 3MG9A 3KQKA 4M9ZA 2VP4A 4Y0VA 1KI1A 3LXRA 3MWKA 1N0WA 1N2CE 1T5IA 5AK0A 4ZPXA 3UG7A 3WNBA 3RC8A 1FOEB 3BFXA 3A6PC 1XTRA 1AS2A 2NIPA 3M1IA 1EFHA 1U8ZA 2GEDA 3O47A 4V0LA 3G0HA 4B74A 5GVSA 3PITA 4EKDA 3RANA 3AQ4A 4PTLA 1VECA 1G1MA 3IUYA 4XOIA 4MKHA 3NEYA 2J0VA 2ZJBA 1S0UA 4YMSA 3QE0A 1EWRA 4PAOA 4F4JA 3MLEA 5EE3A 3ZS9A 2WWIA 1KAOA 5FBVB 5KTYA 3EX7C 2OCPA 6Q21A 2QPTA 3IQWA 3TW8B 5EXSA 3ZZ0A 3SU8A 5KSOA 4P4UA 4V0ME 2GWHA 4BE7B 4LBZA 2OESA 1EG7A 1TU4A 5M04A 4LCBA 3EPLA 2ZRMA 3FVQA 3K09A 5L3SA 2K5UA 3QPWA 4L9SA 2O8BB 5DN6A 3CONA 2IBMA 3JZMA 2N46A 3TW4A 4YQFA 2VSOA 4LJ6A 2J41A 3BD9A 4DXAA 1GNQA 2QUZA 3EZFA 3MWYW 3PUWA 4AWXA 1CRPA 1D2NA 1SVLA 2OXCA 4M9QA 3I4LA 3OAAD 5C4GB 5JWOA 1A2KC 1OXTA 4P31A 3FHTA 4RSGA 4HUQB 2QL6A 2VP5A 4LBVA 3R20A 2R62A 2YKGA 1DO0A 1UDXA 4MGIR 1KI4A 3B1XA 4EQ6A 1E4VA 3KB2A 5G3YA 3U61B 1GAJA 1XD9A 2H7VA 3K0CC 5F3WB 3EARA 3HWSA 3TSZA 2CCKA 1Z07A 2A30A 4ZDIA 1PUJA 3NBFA 4G3XA
chains in the Genus database with same CATH superfamily
1CQZA 2C7VA 3T7TA 4Y9RA 5EVJA 4F71A 4BZQA 3JTMA 5BW6B 3MOSA 1W25A 3MJCA 1SM4A 1KDVA 5EZYB 4G6ZA 4UDNA 1PNOA 1OU0A 1QNFA 2A4KA 4UTZA 1JR4A 1QRDA 2BSAA 1SXIA 3EVTA 2H2IA 2ODNA 2NVWA 2ZJ7A 3BB4A 4ZT3A 4ZT6A 2P0AA 4DF3A 4AY2A 1U9JA 1TEVA 4F7WA 3CUTA 3EG9A 5E6UA 1ZNQO 1E2MA 3Q3HA 4FZ3A 1M34E 2XB4A 1RQRA 2ZRFA 4IIYA 4K46A 2D0PB 1BX3A 2N47A 2ZR9A 4MNTA 4OCZA 1D0SA 4PR0A 3P2IA 3VHXA 1EHYA 1TTHA 1LA2A 5ALTA 3ZVKA 4LRSB 1VI2A 2ZVDA 1IBRA 1KZ1A 2NT4A 5LMZA 3Q7EA 2OORA 1OT5A 3K9LA 1CVLA 1NFQA 1FP4B 4EMUA 2BFFA 4ESHA 2ZTSA 1F48A 1JHQA 1QOZA 4LHYA 1N5MA 3GMSA 4E51A 1F9EA 2QTVB 1P1JA 1ZZGA 2XWPA 3N3AC 2G1JA 3UOWA 1PQUA 3WNQA 4GWGA 2RB4A 1LF5A 3GUCA 2P8SA 3ONFA 4TTJA 4Z3DA 4BMVA 4EHLA 3PSAA 4ENSA 1MCZA 3LMKA 3D6AA 1HFWA 3JTEA 1A69A 1CBUA 1R9GA 1QIHA 1ODCA 4IGKA 3CB2A 1UFOA 2FSSA 1UAYA 2XOKA 2YZNA 3AUAA 3B9PA 3DT6A 3KPJA 1TCCA 2IEZA 2FZLA 3R77A 4OGWA 2FZEA 3S8YA 1C1DB 3M6MD 1NR5A 2VCHA 3OMWA 1BN6A 3UB2A 1I5EA 4EQ6B 1MTOA 4ML3A 2ILTA 2YQ4A 4B4KA 4UUMA 3SOPA 2XXAA 1E5TA 4CTOA 4PSVA 1OYOA 1Y8CA 1VIAA 2X6TA 4L76A 1DEXA 3BMQA 3MD0A 2CLIB 4CWAA 1IUPA 3I3SR 1KORA 2GAJA 3U1BA 3VTZA 4KUGA 1VRVA 1NTRA 3ZWBA 2GRJA 2O8DB 4NCXA 4I81A 1NV8A 3NQ41 1M2EA 4JWTA 4LV5B 1T0JB 1RI1A 2QRZA 3LLMA 3NVDA 2OPHA 2HDNB 4Z9YA 2HL6A 4BRSA 4C5AA 3I2KA 4MR9A 2AKAB 2O3QA 3LUGA 3WLHA 1FPMA 1HMYA 3PGKA 2EX1A 1ESNA 1PFKA 1FLDA 4CVNA 1ZK2A 4LNHA 5KWIA 5ICEA 5L3VA 3CUKA 2C5EA 1YDEA 1ZA2A 3JWHA 1G9TA 3OT4A 3TAUA 5I9LA 1DG9A 4WJKB 4X9XA 1EPUA 4QBIA 1H6AA 2XB2A 2JGKA 2TMKA 3PNMA 6GPBA 1ONOA 1UF9A 3CS3A 4MTCA 3WLJA 3FYUB 2Z8YM 3T4XA 4ILKA 2NZWA 3DZCA 2DFNA 3SHOA 4FPXA 4JB2A 2P4QA 4KIGA 3BMNA 5JAHA 3ICCA 5DHUA 1GFIA 4G0UA 2YUIA 1HDCA 3JZIA 4OOFA 3EVAA 3JARB 2H08A 1ESMA 3WWEA 5CEFA 4FFVA 5LKAA 3VH4A 5IPFA 4E5KA 2PQ0A 4PR3A 1PLKA 3Q1KA 4QOGA 4B0OA 4QBGB 4N6GA 4B79A 4YDQA 1IIBA 5E7MA 3K15A 1E9RA 3TEJA 1NPDA 1FYEA 4JLUA 3DEZA 3R8FA 3PVCA 2VQFB 4DR6B 1HQKA 1OI4A 1CY1A 2Z56A 3T9AA 4BMZA 3TKAA 1RM0A 1HTWA 1Z4IA 3ZDQA 4OSOA 3P96A 1UZNA 1APBA 3A4TA 3GR6A 1XZBA 3M4YA 3TUJC 3HGMA 1EBUA 1BCRA 1A4UA 2G4CA 2ISQA 3QKSB 4HRXA 1MB4A 2MSEB 3NT5A 4L9RA 4NS1A 2WHYA 3EA0A 4OHPA 1CFZA 1I3LA 3WYFA 1NUSA 4Q6BA 5FAKA 3PLNA 4CEIB 4Y2RA 1Z3CA 4MITA 1RYFA 4IDFA 4LXYA 4S24A 5IF9A 5JEEA 4JQCA 4TWZA 4ARCA 4OJKA 4CCYB 1X9HA 1L7QA 3ECCA 5CA0A 4LSMA 2QQ0A 2JNWA 2X76A 4WEOA 2R7KA 1GVNB 4ZCTA 2Y1XA 2XMBA 3MWEB 4N48A 1YU6A 3QA9A 4CFSA 1CSEE 1LY1A 2I6QA 3L7YA 5HCUA 2FQWA 1Q0LA 1UKCA 1I3KA 2V7UA 5MFZA 2CFIA 5DP1A 2NUPB 3TVTA 4R98A 3ZWOA 4W7IA 5C34B 4U7PB 3WLLA 2OBMA 3FPJA 1W36B 4XW2A 1U90A 4HL6A 4BLSA 4W5TA 3W6OA 5H4GA 4GF5A 1XGKA 4TMZA 5JLAA 2IXBA 4FE7A 4QG7A 1XK6A 3SK0A 3K0FA 1GGMA 3RC7A 2HX1A 1EVIA 1S7CA 2WD7A 3TZKA 4KEAA 2IYSA 4E07A 1XLWA 4K9NA 2OORC 2QAJA 3EXEA 1GCOA 1GG2A 2OHIA 3FUVA 5CB8A 1JVBA 3BHMA 4J1SA 4LJ8A 3KQVA 1WDMA 3TW0A 4NYMR 2ZBPA 3VX4A 1E58A 1L4KA 3GUYA 3JAKB 2XMDA 4Q3BA 1NM5A 4U2CA 1X94A 3A1WA 2BGJA 2O23A 3KX2A 3REQA 1B3BA 4MVYA 4R68A 3L6DA 3TEFA 1G2PA 2CJFA 3GDHA 1BXZA 3PCRB 3ZZUA 3IAFA 1EM8B 2V5AA 2Y6VA 3FMPB 3FRHA 3KR1A 3VR3D 3G9UA 1U7XA 4M1QA 1CR0A 2G0TA 4MVCA 3UY4A 3L92A 4B40A 4FXPA 1YNOA 3HE3A 1L0BA 3V33A 4AUNA 1NYRA 3VJRA 1SK9A 5EIXA 1U0RA 4IF4A 5DNEA 2QJRA 3U40A 2OXRA 1UJ4A 3NT2A 4X95A 5EXEA 2VFAA 3QKTA 4NICA 2QRMA 3ZXXA 2CDNA 2HU5A 3JQAD 5HUJA 4YJ3A 3DHWC 3FUTA 5BVGA 4OA8A 2BHTA 3QA3E 3VXKA 5FLXA 2X0DA 2F59A 3OFKA 3ZQ6A 2QRHA 1XMXA 5LUBA 1FX1A 2YHIB 3JD3A 4KIUA 1RWBA 1PSDA 2C4HA 2W5UA 2ZSFA 4AKSA 2QEQA 3NHUA 1QGUA 4OMFG 4BVGA 4PINA 4QVIA 3ZGOA 5BYKA 2FEMA 5CXXA 4LBWA 1E5QA 2XXJA 4PANA 2XQVA 4KO3S 3QG5A 2PCJA 1K7SN 4QDOA 4F93B 4DUYB 3HWX1 4V1CB 1GV0A 1MIOB 1HLGA 4L27A 5A6VA 3RYCB 1TL7C 4KYTA 5CB4A 2B3TA 3OU7A 1N5RA 5KNDH 4JSRA 3EF1A 5EP2A 1MABB 4I5DA 4HH4A 5DBEX 2E6KA 3ON5A 4HN9A 4HYYA 4LTDA 3TLZA 4C7OA 1SBYA 3QJYA 1OX6A 4E5PA 1VE6A 4KQKA 1EP3B 2FUCA 4PG4A 2X0NA 3GYBA 4EHIA 2HPVA 1YFZA 4M1YA 3NXSA 5HM8A 2QG6A 3ZBUA 3FCEA 1WR8A 3ZYZA 2ZJ6A 4M6WB 2J9FA 4MCIA 1T2DA 3PDWA 4KN5A 5F78A 1U1EA 5CVUA 2HH9A 1P6UA 1YCFA 2R2AA 3OEWA 5HGJA 1TO1E 2EHDA 5BYAA 1PSWA 1FC0A 4G67A 5LQUA 2B78A 1HEIA 1OW3B 2O2SA 3W2HA 5AI4A 1D9ZA 3JW8A 4UEWA 4B82A 3JD2A 2QQEA 2X4GA 1E4EB 2HSDA 2ZFUA 4OAQA 4M4SA 3K6SA 2MYTA 3ENNA 2PR2A 1XDDA 3TL6A 5ICMA 5JE8A 1HK7A 3LO5A 1MVNA 3QXHA 4ER5A 4ONEA 4CODB 3CPSA 3RSGA 2YC4C 1I1NA 3MN1A 4KWIA 5FOVA 2QWXA 1JEDA 4GMGA 2B4KA 4BMYA 2OE2A 4TV9F 2VHCA 3U4IA 2PLNA 1NJ8A 3X1WA 3SS8A 3SVTA 1K92A 2CKMA 5KSWB 4D4JA 1N8NA 3TM5A 3CUSA 2P75A 1UBFA 4DLYA 1U7WA 3QVTA 5DSXA 2ZDGA 1Y8AA 1XHFA 2WVHA 4PX5A 4NYMQ 5EFZA 1XRLA 1ZGJA 3B48A 1B41A 1V8PA 2PZBA 2C2OA 3CRW1 3IUNA 2JIMA 4LHEA 4UJ3A 2DPYA 2FFHA 4FHEA 4XASA 4OHCA 1AV7A 1OFIA 2FPIB 2WKPA 3KFVA 3TE6A 2JGLA 2XHZA 4ALIA 1OWNA 1PGOA 5IAKA 3R7WA 2VUTA 4RL6A 1RSZA 3GQBA 4RHXA 1BQ4A 5B4VA 4JL6A 3V8PA 3ILHA 2FR8A 3GB9A 4JBHA 1CUZA 5B6IA 5L53A 1KTIA 1B23P 4E3ZA 5BW5A 2DLDA 3GDGA 5JYDA 3GN1A 1FX0B 2BDTA 2AD5A 3EG5A 4AP5A 2Q1TA 5IUKC 5C1PA 4JYPA 3GZNB 2VDOB 3DAGA 5EA2A 5B3AA 3SC2A 3X2FA 4D1YA 5IVHA 3V80A 2C0PA 4RANA 2OCBA 3K1ZA 1SUSA 4LSZA 3MJ4A 1Y4AE 1E9FA 1V1RA 4GOND 4JLPA 1LBSA 4QL3A 5J2TB 1CUWA 3EZGA 5FBWB 2WAYA 3L0OA 4H3KB 5LYJA 2Q8NA 3EDYA 4CHGA 4RMNA 2OQIA 3FKSA 2BSQA 5I47A 1WNFA 1QP8A 1B14A 1T1EA 4F3RA 2SHKA 5EY5B 1FIUA 1EXWA 2HB6A 4MR7A 2IOFA 3RAFC 1G98A 5F52A 4CUZA 3RSCA 1YZQA 3P45A 4KQIA 4UCFA 1NM5C 3QPVA 2H2AA 1U2TA 5DIZA 2PMCA 2IHYA 1XYVA 4BO0A 2CXHA 2EQAA 6YASA 1PQPA 1NBME 4UW9A 4WGFA 2APJA 3Q41A 2JEZA 2D3TA 3HYNA 4TMTA 1B6SA 3TIIA 4UVEA 1X2EA 2EJTA 4RZXA 3QLUA 3K8ZA 4GRDA 2Z0MA 2FWMX 5KINB 1U5BA 1N8SA 1RXUA 1W30A 2PIAA 1EJ2A 2TS1A 1HE4A 4K6HA 4WCDA 5ENZA 3WJ2A 5AKKA 4NJOA 1OWPA 4FMPA 5FFFA 3Q9LA 3O4HA 1KY3A 1O95A 5J59A 3VSDA 5IUJC 2WU4A 3DV2A 5AOCA 3P9RA 2WLTA 5DI3A 1F0YA 4QFDA 2NG1A 4YWHA 4P4GA 3T99A 3V4PB 3KXDA 2Q9AA 3M1LA 1T9DA 1VKZA 3MBIA 4MUNA 2DU8A 3CLSD 4MVWA 3SN6A 3SJAA 2J07A 4N3AA 3E5NA 2EKBA 3NGXA 3CT6A 4FYWA 1KVSA 2RHGB 5SYAA 2ZCUA 1T2CA 2AFIE 4XX1A 2M6SA 1O94A 4MV6A 2HA7A 3FD8A 1N5KA 1QUFA 2DPGA 4BNKA 1WQ3A 3A1FA 5EQFA 1BFDA 3WL6A 3WTBA 1H93A 2W2NA 3K70D 3U3KA 2IT1A 4I50B 4LF7B 4QA9A 1T4GA 1J0BA 1THMA 5JAMA 4W5NA 1KRWA 1XCGB 4RJTA 4IHKA 1P19A 1QMPA 3SFTA 4DLPA 2L18A 1VMAA 2P3QA 3PUZA 2EBHX 4LW8A 3TLMA 3TR6A 2VQEB 4HWPA 4P98A 4EMSA 3MM4A 3MA0A 3ZVRA 4JUCA 4L6CA 4R5MA 5KMGA 2BRUA 2ZIFA 2XGGA 3T3DA 4YASA 4DQLA 2WMOB 1S2IA 4UZSA 2RCYA 3DH0A 5T67A 4L0MA 3KXKA 1DS6A 1PKXA 2GILA 3MMZA 4UUNA 3QU9A 4XJSA 2Z4RA 4FDVA 4CMEA 1R7RA 4TKMA 2R84A 3LUBA 5EE9A 4R9SA 5DBHX 2VPQA 1PJSA 1ULTA 1CULC 2C99A 2RKWA 3IDQA 3RJMA 1T5LA 3T5CA 5BOSB 1IRXA 1GAQA 4RK5A 5FTKA 1OZAA 3U81A 1W59A 2E21A 2F64A 3DEAA 3O2QB 3PUXA 4JB8A 4EZBA 3TGLA 4C04A 1OGYA 2ZVJA 3PWZA 3W6ZA 3BRWD 5EPUA 3THOA 5C5DA 1GQQA 4H7FA 1H2ZA 4S1OA 3A0RB 4HGPA 4WTOA 5IFKA 2YVLA 1OC2A 2JW5A 3OCYA 4I6EA 4JLSA 4QOSA 4XB6B 3LNTA 1XNJA 2IJGX 3PTLA 3PZRA 4TXLA 3I9LA 3ZS8A 2Z58A 5DYWA 3T15A 3TNLA 5KQSA 1KH3A 4LFBB 4O0MA 1ZWLA 1FTGA 3MQ2A 2XMGA 3OJCA 2G1KA 4AG6A 2ECQA 4N4AA 1MT0A 1C1XB 2PUHA 3Q8LA 2QL5A 2BE9A 1G8MA 2D6FA 3PNBA 3RC3A 4D3YA 4DJTA 4P86A 1IBSA 3VKWA 1TZCA 3BIWA 5JXGA 2AKYA 3NTOA 1Z26A 2JFVA 3FOFC 1CS0A 1YJBA 3LCJA 5JJIA 2IEIA 2XWJI 1OZGA 3EUFA 3GLVA 1TX4B 5IM4F 1XA0A 2FR8C 4HNRA 3WGQA 3NHAA 7ADHA 3TEMA 2H1IA 1XVIA 3A10A 3GG9A 5CPBA 4U6SA 3ZWPA 1TJYA 1UZUA 1ZMOA 2R7AA 4BV8A 4R2KA 5HKKD 5K6RA 3I61A 2YRWA 1NMYA 3DVAB 3FDFA 5I9BA 1YRYE 2BTQA 3QOFA 3QFCA 3LY9A 1VMEA 1YNSA 3H9QA 5IU6A 2GTHA 4HDAA 2VRCD 2V4UA 2C8KA 4JNCA 2IUTA 1PG2A 2O3UA 5IN5A 1L3CA 1WHSB 5F7JA 5BV7A 1TEHA 3IBCA 4L75A 3LQQA 1M1ZA 5HK9A 4Z4EA 1LSUA 3CLTD 3FSJX 3ML1A 4NG4A 3TTUA 2CGEA 1PTKA 2XWSA 4GO1A 4RD1A 1HORA 2KBEA 2WOJA 4B76A 3HFSA 1G8HA 1BN7A 3L6UA 1IHDA 1RMQA 2V8OA 1W1UA 2PRYA 2XX3A 5F21A 4ZU1X 3VR5A 4D0GA 3ZDBA 3OOSA 4C4SA 3CVWA 4JI1B 1NVTA 4N40A 2HDWA 3KOOA 4TGLA 1UOPA 2FF7A 3UXMA 4OB6A 4XVHA 1KJIA 3KYDA 2A94A 3HCOA 2X8JB 3LQ2A 3S4YA 3EPPA 3H1GA 1CJSA 3BWCA 3WHLA 3UJBA 2JH9A 2P9CA 2Q9BA 3H8WA 3PL5A 4YYEA 2CZQA 4GPZA 4B3FX 3QLUC 3QF4B 2C9MA 1JFLA 4UBOA 4K3UA 4RGVA 2GVDC 4J0EA 4TWRA 4P82A 3MWLA 4UQOA 2FHSA 5BSUA 3ROGA 1K7XB 1M1YB 2ZATA 3EVFA 1O95C 1S4MA 2JLXA 3EQ7A 1NDHA 3SF0A 2XUPA 1RXWA 3TYXA 3JVVA 1PDWA 3CRVA 1M2HA 2BFWA 3F3MA 5A7HA 3RK4A 4AIRA 4X7MA 1FFDA 2Z5FA 4WNIA 1QHHA 2LKDA 4Q4DA 3I8SA 3VNVA 3KR2A 3EZ7A 5FI0B 1KL7A 5JVDA 4IOJA 3EF0A 1IQ0A 1O94C 2GHIA 3I09A 4MWTA 4Z7JA 3ZD7A 3L4EA 1C1HA 1Y9ZA 1VE1A 4PYKA 3RT9A 2ADFA 3PKIA 2NNLD 4ND1A 4C0SA 1YB1A 1Z0UA 2JFWA 4DM3A 5KX5A 1LI4A 4GPEA 1UJBA 3FYDA 1J23A 1DJNA 2CVFA 3K9NA 3RVBA 3T54A 2V7VA 2VYNA 4NENA 2GD6A 1ZUD1 2C78A 2O0MA 3NBKA 5IKOA 1CY0A 3ZHQA 1UM8A 2C4TA 2XD4A 1E9SA 1SVOA 4FDAA 4M55A 5DHSA 4CM5A 4F38A 4DSZA 4PAQA 4WKNA 1G19A 4OSEA 3IKJA 5E8JA 5FORA 4GKVA 4DDKA 1AKWA 2BBWA 2F1OA 2Y0PA 4ZVTA 3ESCA 1IJFA 2BRUC 3OD1A 4MLDA 4D9BA 1RZVA 3S99A 3HR8A 4IX1A 4PYNA 1LUAA 2BHSA 2BZGA 2C4WA 2WSSA 2AR7A 3B3JA 4CMEC 3GUZA 5E4FA 1M6NA 2OCGA 4FMCB 4JHXA 2VI5A 3AI7A 3JWJA 5EMHA 1G64A 3PA8A 4KUHA 4X1YB 4IO1A 3S2GA 4O4IB 1GDDA 1U6JA 3I1YA 3L8MA 1AG9A 1QCDA 4MOWA 4RQAA 4V1CI 4PNHA 2YICA 1ZH8A 2O2JA 1CJCA 2ZWVA 1XLUA 1LS1A 2WA2A 2XRMA 1DELA 1Z2NX 3E9NA 3HN7A 4L4YA 3KQMA 4EF6A 1X7YB 4C6TB 1AMOA 3LIPA 3LP6A 4L28A 3AU9A 4WFQA 4RVGA 4AKTA 1DAGA 3PQ7A 2H31A 2YMMA 2GAAA 3EUAA 3H8JA 3SR0A 3TKYA 1FSFA 3V4ZA 5AW3A 2NO5A 2QPAA 3OCCA 4LIPD 2ECPA 3CR7A 2AF3C 3DXFA 3L0CA 5IUNC 4AZVA 2VJAA 4DV1B 5KB3A 4BXOA 4IVRA 1H2YA 3BOSA 2JGRA 1MVOA 5JD3A 2GF9A 3AZPA 1ZD5A 5AH0A 5EZ6B 1ISMA 1YFKA 2HRRA 1LCIA 3HP1A 3EOBI 4LBYA 3DE5X 2N1BA 1Y9DA 3RSQA 3IBYA 2F2TA 4RHCA 3BD7A 3KBOA 5BV0A 4RK7A 4JWKA 1U1CA 1Z4JA 5TGZA 2JFHA 4R51A 1KAGA 2A9PA 2AD1A 3UO8B 3R3JA 4IIJA 5AJUA 5EQTA 3HY4A 3M9WA 1T15A 2CJWB 2WKQA 3GRVA 3MRSA 4R01A 2GZ3A 4D8WA 4E12A 1JFFA 5JPDA 4F5YA 5BWBA 2CUTA 2X42A 3Q9NA 1WSWA 1LQTA 1JAIA 3DE6X 1PI3A 1EXVA 4AYWA 1KC1A 3KB6A 1Y42X 3K05A 4MP3A 4PZDA 4B47A 1NPYA 5U4XA 3T9CA 3I5YA 3UTCA 3UHOA 2A14A 3IR6A 3RLFA 2Q3LA 1AM4D 1FLNA 3C3EA 3ES9A 3ICQB 3WAJA 6LDHA 3SNHA 3ND7A 3DCIA 3G2KA 5J5AA 1QFJA 1HDEA 1F38A 1MJGA 3ONVA 2B8EA 4OF4A 2JGEA 2PO5A 3ESYA 1DMSA 3H1FA 1RJ9A 3KWFA 3PFWO 5C8YA 4NU0A 1P62B 1WY5A 4F72A 3REFA 3L8DA 5KVQA 3BH0A 4A0GA 1LJ8A 1ST2A 1KZ9A 2NOAA 3GLSA 4HGOA 3I6ZA 1T1JA 1GPAA 1RBMA 1G21B 2CB0A 4NPAA 2AG1A 5CFNA 1RU3A 1T4MA 2RHLA 4U00A 3F96A 2JJ1A 4W8GA 1Y6FA 1HOTA 3FNHA 4HDOB 3F71A 4P2BA 1CT9A 2ECOA 4BLTA 2E1PA 3HCWA 2GLTA 3AVQA 3JALA 5C1BA 4I4NA 3ACDA 3GFBA 1VLHA 1BKSB 1IAQA 2EKLA 1FDOA 2PZGA 3Q6MA 3JATB 2P2LA 3RVMA 1JR6A 2Z9CA 1ACLA 5A6SB 2CLMB 4WK6A 4XFJA 2I33A 2CLHB 4H7DA 4M1SA 4UU8A 3DBLA 4FDLA 1WUHS 2ACWA 1JG2A 2GZDA 5AP9A 2MJLA 3W3AD 4FSHA 4DT1B 1GAEO 2RARA 5DP2A 2BPOA 2H16A 4U6NA 5GQSA 1R9JA 5HWSA 1DADA 2QTAA 1QH1A 5KSYA 4HDMB 1SXJD 3TW6A 3EZ9A 5TY0A 4D9HA 2OD2A 3VDXA 2QA5A 3NX4A 1JPVA 2OKGA 4FR5A 1LB1B 1T2NA 3OG9A 1SPBS 5THKA 2HQ1A 3K9WA 3AEQB 2V7XA 3CNNA 3NIDB 4JC4A 4DDUA 3G2NA 4ENVA 1DAMA 4XJVA 1XP5A 2FK8A 2GPYA 4BMPB 3G0DA 5F9FA 3OEHA 2D0OB 3AHGA 2DCUA 3UWSA 2BMAA 1M1NA 4A0FA 4BQSA 1QVWA 1XWIA 2X0RA 1N6IA 5DOVA 5A0VA 3BWMA 2DKFA 4AZTA 1QB8A 2LV8A 4LDPA 4OQYA 1A9XB 5DEIA 1Y63A 2J6CA 1W7AA 3D3JA 3SZGA 2O59A 2UUPA 4PE5B 1VYUA 2YFHA 3G85A 2E5FA 3NUZA 2ZBUA 4MA4A 4MRMB 3UZUA 4F04A 4K6KA 4EBFA 2QIPA 3BWYA 3I58A 4IMPA 3S70A 4RLQA 1FMLA 1U9YA 3BF7A 4LXUA 4MVJE 3A9SA 2HK8A 3HEBA 2W8BB 4GNRA 1FYWA 3BL8A 3DOUA 3UJDA 3B2NA 1KZ7B 3RUCA 2R1VB 3M4JA 2R7NA 2RHCA 1IQPA 5CAEB 4QDJA 5F51A 1Z9BA 4RD3A 3DDOA 3DOEA 2ET6A 5E7IA 1TB4A 1GTZA 1XXHE 3AFMA 1DVRA 3G2QA 4FLEA 3W2GA 2J7PA 3PEYA 1LQUA 4OQZA 4U7WA 4WFKA 4P0TA 3K0AB 3MRVA 3B5JA 4RF5A 5A5VA 3KQHA 3CLKA 1E2PA 2O4CA 2PVPA 1SQGA 2GEJA 4G36A 1KDRA 4FNGA 2ZWAA 3E5RA 5EE5B 3NBXX 3O8DA 1E7YA 1EFVB 1T5TA 4FN4A 3NVMB 4ARIA 3GLFE 4RVSA 3DEKA 4OV6B 4ZAYA 2DR0A 2MYPA 2F4VB 1DV2A 5BN5A 3ZJVA 1OBCA 1U7HA 1N6OA 3A11A 1MC5A 1TAHA 3BA1A 3PE6A 4CT0A 4NHEA 4W5WA 2XDYA 4BNFA 1CY6A 3EW7A 2C7BA 4ALJA 3LF1A 1RJWA 2Y27A 2W2LD 3H4VA 3UMFA 3UCEA 1FMFA 4TLLB 3IO5A 4R2LA 4IM7A 2BFEB 4G4JA 4LRYA 3RIMA 5JC8A 1RCTE 4RCVA 5L51A 1FVXA 3FPBA 5HS6A 4D81A 3AM4A 1PGJA 1W47A 3HJHA 1QX3A 4UNIA 3MCAA 2P6RA 4LYFA 1KOJA 3ZIAD 3MYRA 1HI9A 5JS7A 3B3QA 1OFTA 3OTIA 3E9RA 3ILXA 4GMHA 3CQ9A 4P81A 5SY9A 3UPUA 3D9QX 4LRTB 5EQDA 2V8BA 1WZ2A 2Q0SA 2C9YA 1U2PA 3MWJA 2QJTA 1ECJA 1GG5A 3ODGA 2IZ7A 1X1RA 5DX1A 4C4PA 1MD9A 2ORYA 3KSUA 4S3MA 1KWKA 1AHHA 1ISSA 3I8OA 1T3LA 1IJEA 2X2OA 1IXSB 1TECE 2DE0X 4MQFB 2X5JO 4F06A 2LD4A 2P2DA 3P8ZA 3KLPX 3MYYA 4TYNA 2QORA 3TO5A 4L22A 3ND5A 3Q6IA 1C9EA 1ISJA 1IZ7A 4L2IA 4PHFA 5EE1A 3WBJA 4FB5A 4HNVA 5AVJA 1JFTA 2J45A 4MHOA 3PXXA 3RUIA 2Z04A 1IONA 1VPTA 2ZLBA 2WF9A 3ELWA 3T5DA 1G291 1Q22A 2DQKA 1P1FA 3L7OA 4F86A 1ODLA 3CKLA 4EJSA 3Q7TA 3MUFA 4UCQA 1WIWA 4D4GA 3UBMA 1UT8A 3TZ6A 3VC3A 3VZQA 4TS3A 4E31A 3L4KA 2XCTB 5NLLA 3T0GA 2NAFA 3TXYA 2PZMA 3VR0A 4AAYA 3ER9A 4YA6A 2J33A 3UT6A 3BCRA 4KXFB 1PBNA 1YZVA 2H9AA 3R1IA 4M7PA 1ODJA 1WETA 2VHUA 1AGPA 1X38A 2C2KA 2CHGA 3AP1A 4K86A 5LA6B 3W8FA 4AVYA 4ZCMA 5F23A 4BZXA 3I0NA 3W5BA 2R00C 3F6PA 3N2GB 1KYVA 1EWQA 1NUTA 5GV7A 2C3YA 3GT0A 1HRKA 2O6HA 5K0CA 2QI9F 2V7PA 3DVLA 1IUOA 3PR2B 5ITZA 1CD5A 3U4QB 4GHWA 2H3EA 1FSGA 1YS2X 4TXMA 1YVEI 4X1IA 2MIIA 4NAVA 4GXNA 4Y30A 4CM4A 4QU0A 3AO0B 2Z2JA 4M0UA 2BVNA 2CDCA 1UMCA 3I1FA 2IU3A 3FBWA 1KNQA 1TZ2A 3AONB 1CUVA 1I6MA 1HGXA 3U16A 3MCUA 3Q3IA 4L9AA 3TVDA 4Y18A 4R16A 1PR6A 3AHJA 1Z6AA 3THRA 3DL2A 1QGED 1GN9A 3Q11A 1GZSA 5CVJA 4DJAA 2J0UB 2A58A 1DPFA 1SUIA 4O2AF 1ZOPA 4BVLA 5CA1B 1ZOOA 3GGGA 4I1VA 5IAAA 1KRHA 3DJFA 2BW0A 3EYAA 3PEEA 5U4QA 1C7FA 1KMHB 2FZWA 5EXPA 4AK9A 1XB2A 5DBGA 4EGAA 1ML3A 1EA7A 3GRUA 3RS0A 5DTEA 5AQEA 4BO4A 3ERCA 3EIXA 4IVNA 1I7LA 4ZEXA 3K2BA 3LYHA 1UM9A 3SS9X 4AKIA 4IXWA 1OXUA 1QYIA 4KMOA 3DMGA 1E9EA 2IUFA 3A6EA 4LJLA 4Z0PA 5G1NA 5HA5A 1DQZA 1A9YA 1U65A 2NSLA 1JI3A 3C8DA 5KSPA 2N3ZA 2Z6AA 2J6IA 1FP1D 4IOKA 3H86A 3B6KA 3LUFA 3QEOA 5CK5A 4BX0A 1JJFA 3ASYA 4XCQA 3ICVA 4BRZA 5CXUA 1KFEB 1OZHA 3AUFA 1GWNA 3LAWA 5DVZA 3FFXA 1VLLA 3ONWA 4V3BA 3SZ3A 5C8ZA 4PIMA 2UVPA 1MV8A 3PC3A 3RSHA 4R2XA 4EJFA 3FWPA 3RUEA 3UCFA 4PZLA 5K6TA 2YOHA 5CR9A 2P68A 4HDNB 1LPOA 1BG6A 1UT5A 2B0CA 4FDUA 3EPKA 1QZZA 2QLFA 3BHIA 1ZRHA 1OMOA 1MH9A 3S2ZA 1WXGA 2VYQA 3OPXA 2NU8B 3BA6A 2J0SA 1EWVA 1GLNA 3DE1X 1ABFA 1IMOA 3H6HA 1XFDA 1BX0A 1DEKA 2GEBA 1UH5A 2IOQA 3AOEA 5FNVA 5IFLA 4EHHA 5K4GA 4JKOA 4EVQA 3DMHA 2JATA 5IDVA 4N9QA 1D1TA 2C2ZA 3B6IA 3QJ5A 3ZGLA 1BHSA 1PHRA 5LJIA 3G8BA 3PNVA 3INTA 2D3WA 2QUHA 2TMYA 5A9SB 1YL5A 1FFHA 4OM7A 2OYRA 1SQ5A 1QKKA 2VL7A 3TD6A 1KBQA 1MEOA 2I29A 4WLFA 5EYPB 3WB9A 4C4OA 3TOSA 4G9GA 3SNKA 4O2LA 4HYQA 2IXFA 2R66A 5CM8B 4NJMB 3E70C 2RGNA 3CTMA 1G66A 3QU2A 4NMLA 3FTNA 4E4RA 5K45A 2P9YA 1KMQA 3UENA 3LXMA 3K9FC 5DWQA 3QVUA 1QQAA 4Z5XA 2W58A 3C98A 1E3TA 4ECAA 1BHJA 1E1RA 3G2JA 3C7KA 3HNOA 5TEWA 1C8BA 2OC9A 2HJVA 4RMHA 2E4WA 5A3QA 4C08A 4MQ6A 4P58A 3N6VA 4TZTA 5CYPA 3DUFB 3W04A 5JO0A 1KPGA 2VDQB 4IQ8A 3DMFA 1QU3A 3OWOA 3OOEA 4G4IA 3HN6A 3TNFA 3WGTA 1JXQA 1Z4NA 1V47A 4EJSC 1RCFA 3I04A 4BDSA 4U39A 1SU4A 4FYIA 4BLWA 3CCFA 4B3HA 1U0TA 2AZ4A 1KIAA 2GARA 1QXSA 3I45A 4YRCA 5JS2A 5BN3A 4B3RB 3C24A 1E3DA 1WPGA 3DBHB 3ITEA 3KUCA 3GLIE 3DNMA 4PYMA 3IT3A 5D3MB 2DLCX 2VAXA 1EDEA 1M7BA 4RVDA 4KLNA 5CM2Z 1WXHA 3A2MA 1N2IA 3L93A 1J5PA 3V42A 1PW7A 3U3XA 1GCAA 4JUBA 1CUXA 3AI3A 4P0PB 3VNRA 2PZFA 1T1GA 2JI6A 2BUAA 5AOBA 4JEUA 3TSCA 4WLUA 1WA5A 5KVSA 4RNDB 2GCOB 4IOLA 2R1UA 1H2WA 5DGDA 3TPCA 2JIBA 3K2IA 5EJ7A 5FEMA 3H2YA 5F1KA 5L6MB 1AGNA 4L51A 4DBVO 3LYUA 3MIIA 1J39A 3WL5A 1NU8A 4HFRA 5KVAA 2VRWA 3ZJUA 2VH5R 4OREX 5A04A 1R8QA 3R7FA 1I01A 2D5LA 2DRIA 2FCAA 3L79A 2RAFA 3BWEA 2H2DA 2PMKA 1C3OA 1N2CB 4NBKA 1P7VA 5CYGA 1BW9A 1F0NA 4CIXA 3CLRC 3JWPA 4MRNA 5BQFA 1GD1O 3FKQA 2ZZNA 4Q1BA 3RKSA 2IYZA 5FI1B 4GVXA 3WZMA 2NACA 3LFHA 1D6SA 4RWZA 4LDRA 3ZZMA 3THXB 1QOPB 4GGPA 2WB2A 5AKHA 3DCYA 5HCNA 2VSQA 4CU2A 2WI8A 1XTTA 1ZGCA 2WUDA 3X1ZA 3J7AC 3X1DA 4WXPA 3GX1A 3Q3GE 1BXRA 1DEHA 2I1LA 5AJVB 1BFUA 2QLLA 3BTVA 4H4CA 4PSCA 1B6GA 1DEOA 4NAHA 5B3KA 1XIVA 5DGCA 2VUSA 2QP9X 4DRZA 3C45A 4QVGA 3H4IA 1GPKA 1KKLA 1NUUA 4JUDX 2RHOA 4P34A 5T4EA 3FPAA 4QSHA 2BM9A 2VNIA 4JENA 3SI7A 3JQGB 3PX2A 1I2CA 1E0AA 1P31A 4QXMA 1H05A 4KOAA 4PRKA 3WOVA 4C05A 4Q6WA 5JI2E 4UAJA 1XZCA 1Y3BE 2GBPA 2NPIA 4TS9A 3DL0A 4CF6A 3VR4A 1IZ9A 5DNAA 1HBJA 5KOYA 2GYWA 3H17A 2HTEA 1MB9A 2OZEA 2HHCA 3OOYA 4RIIA 4GP9A 1NOJA 2Q6KA 4ZVNA 3ZCVA 1CUFA 1DWPA 1GNLA 1QYWA 2M9MA 2YTZA 4BRUA 4C7MA 3AF3A 4AZ0A 1AUPA 1RKXA 5H16A 4EELA 5C18A 1EUQA 4ESVA 2VF4X 3AOEC 3MJVA 4OHXA 2FG7C 1ZI8A 4NZOA 1VE7A 1OOEA 1NAHA 4ZAGA 4M1KA 5HQTA 3KPWA 1W6UA 5GAJA 1Y7PA 2C77A 2XF2A 5CG2A 2DZDA 3H9UA 3RHTA 4B8WA 4EI8A 5HBGA 3IV7A 1ST3A 2DTEA 5E0KB 4ZVLA 2PQ2A 1QMGA 2W4IA 4KWTA 2GPAA 2YNMA 2PBRA 1U0EA 2Q3HA 1NVVR 3E5HA 4B6EA 5EIHA 4DZZA 3F6BX 1H2XA 3N74A 3DOOA 5K3FA 5LLDA 4INAA 1DCKA 4V0NA 2RGNC 3IAM6 4Z2AA 4QEZA 3KQOA 2JIPA 4B85A 4QECA 3E7FA 1C3XA 3AHCA 2YH2A 1ZRMA 3IUJA 1AQUA 1A8HA 1NSYA 5JZSA 1WZCA 2FX5A 2Q3DA 1NF2A 3DAFA 3DTNA 3QBDA 5IZ4A 2FMXA 4MUKA 1N2HA 1KYXA 1WABA 1YHYA 3MINB 3KT0A 2FMIA 4PLTA 5H59A 1P0PA 5I45A 2WNIA 4LS3A 1C7JA 2QVBA 3B1VA 5E95A 4AD8A 5CCXA 1ZLYA 3PXAA 2PN1A 3GP3A 2H8KA 4PWYA 2JBAB 4DA9A 4FGJA 3A8TA 1GPJA 2CNWD 3RTBA 4C4AA 3MOIA 5LR6A 2KWIA 3VC1A 1EGVB 2HNAA 2YJGA 1EFLA 2JFFA 3IUBA 4A2CA 4P8RA 3P7MA 2J3JA 1IQRA 3JQPA 4KXMA 3NNDA 1FUYB 1KHHA 3BBPA 5G0SA 4QUDA 3EY9A 1N3YA 5KREA 4L16A 4CM6A 2ONYA 2OOKA 5KDDA 5AW2A 4UASA 2IYRA 4MUMA 3CG4A 2PUFA 3RIXA 3DP9A 2PRSA 3MS2A 4R1PA 1TA9A 1TMOA 2OV2A 2O9JA 1MO6A 1RWVA 1MKYA 2H1WA 2B3DA 1F06A 2W6JA 3KEQA 1P29A 3LX8A 4UQPA 1Z6TA 2ATXA 2VDNB 1CZUA 2EJVA 3WIBA 3QX7A 5AKEA 5G0TA 4IKOA 4YRSA 2E4AA 2V7BA 4H60A 1V96A 5BMVF 3V9PA 2ERCA 3B82A 3PNKA 4QUBA 2CV0A 4C89A 4S04A 3WL4A 4D02A 4UEKA 1P9RA 3V7FA 1KI9A 2X15A 3DULA 4B75A 1W73A 3B53X 1WW8A 3INGA 1QKI