4HZUA

Structure of a bacterial energy-coupling factor transporter
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
273
Chain Sequence
b'TENIISVDHLTYQYQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA
publication title Structure of a bacterial energy-coupling factor transporter.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
total genus 69
structure length 273
sequence length 276
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hzuA00
4LI0A 3LBHA 2ASEA 3QQ5A 2O8BB 3OIYA 2ERYA 2C99A 5TV2A 1JBKA 1SZPA 4PQYA 5D3QA 3MWYW 4C0KA 2LKCA 3AGQA 3CF2A 4QHYA 1KZ7B 1W4CA 2O8EA 3B82A 1VCMA 1XEXA 4GBMA 4NYIQ 4ZIRA 4JLMA 4QGHA 4YDHB 5CK4A 4BLRA 2BIFA 1S1CA 3B7GA 2E9SA 5BYJA 4XD7A 4X8HA 4CEHB 3U3JA 3RRYA 2D2EA 3FGNA 1TMKA 4NKRA 4CIDA 4G5GA 4GP7A 2AHOA 3BS4A 5EZ6B 5AUOB 3C41J 4MYCA 1S0UA 4JS0A 4NBSA 2DFTA 4PAMA 3EZ6A 1UKYA 4OKSA 1L8QA 3K0SA 5DYGA 2O0HA 3RAPR 2IS4A 1YR8A 1Z2CA 2G6BA 3A36A 4TLCA 1VCNA 3TRFA 3GJ7A 4PPFA 4LDJA 4BFYA 4PANA 4BLPA 3PG5A 4CGZA 4BLQA 3IIKA 2ODNA 4Q1CA 4MH0R 1N6LA 1RRGA 1T9HA 5DHAA 4B6FA 5HR5A 2EVWX 2N46A 3FHCB 3FVQA 4P4UA 1FOEB 4YQFA 2RGXA 1H8ED 1R0WA 4KLZA 3NH9A 1CKEA 2MSEB 1JPJA 2G0TA 1YZLA 4NYJQ 5CIWA 3U7EB 2UZ3A 4ZI3A 4B3FX 5J5CA 2Z4SA 4G01B 4U7DA 1G17A 1KI7A 4F92B 1UDXA 2VP4A 2IYQA 3T1OA 3HR7A 3GLHB 1FP7A 2FDCA 3SJZA 1T0HB 4OJQA 4DIEA 1X3SA 1SVKA 2YOFA 3PEVA 4PSKA 3R7WB 4AKGA 4TMVA 2IYXA 1NLFA 3QXXA 3UMRA 3KKOA 4D0LB 4D0NA 1RYFA 2NMVA 3FTQA 4XVUA 2FMXA 3QJYA 1KTVA 4I81A 3IPXA 1P4SA 2RHMA 1NNEA 3K0EA 3ZD6A 1II9A 5AUPB 5CM8B 4FD2A 3F3YA 5DHFA 4M8NE 1P5ZB 3IEVA 2X8AA 2WWWA 3KJIA 5HPYB 2QBYA 4HAZA 1ZC3A 4ZPXA 5AWFC 2QROA 2Q3HA 2ZJ5A 3L82B 3KUDA 3EC2A 4F4CA 3CPEA 1KK2A 1XEFA 4MGIR 2IK8A 1S9HA 2P2LA 2H17A 3GQBA 5C1BA 3RSOA 4CW7A 1M6NA 1U0HC 3KJHA 3FMFA 4NL4H 2XEXA 2ZVQX 4DUGD 2FH5B 1BYUA 1R8QA 2JLXA 4KFTA 4C2TA 1MH1A 1YZUA 3QBTA 1Q3TA 1DO0A 4MYHA 4AURA 4DDWA 2ZETA 1DAHA 1OFTA 1E2KA 2RGEA 4YMVA 1Z0AA 4Q1DA 1KI1A 2QA5A 4MRSA 5H68A 1N6NA 1WCV1 2FA9A 5F9HA 2V8OA 3UPUA 3VR1A 4M1WA 1WBBA 4CVNA 3B13B 2F1RA 1ZD9A 2H18A 4MKHA 5AJWA 2F7SA 2OM2A 4C4PA 3U7FB 2FFQA 4R9UC 1E3MA 3K0CA 5SZHB 5CITA 2C5LA 3B1YA 5FPYA 1XJCA 1DELA 1HQYE 4TLBA 3VKGA 5C4GB 2BEJA 4XVQA 3OE7D 3QXHA 4MGYR 2PLFA 4RZUA 3U7GA 3EA5A 3RANA 2ZAOA 5HTKA 4LPKA 1GNQA 1S4QA 3LBNA 1QRAA 3FFBA 3F0TA 3GLIB 1XTSA 4HAUA 3QEOA 3MMPA 1JALA 4UNSA 3CRMA 1W7AA 5KNBA 4OK3A 1WMSA 1W36B 5TARA 3TW8B 1VCIA 1EGAA 1Q12A 3NBZC 3LQQA 3NWJA 3ZYCA 2Q3FA 1FZQA 3AH8A 2OLKA 1GVNB 1CJVC 4RD2A 2ZE7A 1G3QA 2QEQA 2ZPTX 4A0HA 3IHWA 3TMKA 4G5QA 4B2PA 1XTQA 1G3RA 4NYIR 4URYR 4OHYA 1P9WA 3EX7C 1HY3A 3K70C 1E0AA 2O5VA 4YMWA 4EPWA 3B1XA 4ARZB 4DCUA 2ZIAA 3AVWA 1KOFA 4F4IA 5EE1A 4II7A 1G7CA 2C03A 2A9KA 1ODFA 4M22A 2A5GA 3HPRA 4PPGA 1E9BA 5K8UA 4XD7D 1VTKA 5B64A 2YWGA 5J4LA 3NXSA 3LBIA 4C7OA 3THOA 1G7SA 3ZLJA 5FUVA 2NO6A 1QDEA 2UVQA 5F3WB 3THXB 4EIWA 1HT1E 1ZUIA 3MSXA 2DYKA 1H65A 2WWIA 3IO5A 2B8TA 3DOFA 1JAHA 2A5YB 4H9GA 3WYFA 4KV9A 4D4KA 2WSSA 1JEEA 4DB4A 1QHSA 4LJ8A 3TLXA 1NRJB 3B5JA 2G83A 4LHZA 3IDQA 1E0JA 2RGCA 3CRW1 2H1LA 4ACAA 1XTRA 5AUQA 2G3YA 2J41A 3AGPA 5C4MA 1KYIA 5EP1A 2Z5FA 3K0CC 2JJ2A 2ZRMA 3L8YA 2WAYA 3T1TA 2CVHA 2J7PA 2CNWA 3UMSA 3GFPA 2BMFA 4BUJA 4EUNA 1A2BA 4Q03A 1RZ3A 3BE4A 4HZUB 5E7MA 1CR1A 4ZDWA 3LXRA 4C0SA 4Q47A 4Q21A 5CJ2A 1DAGA 5KSOA 2FZLA 4DLSA 5HE9A 3LY5A 3PEUA 4MRVA 1PLJA 1E98A 2W0MA 1MABB 1XFAA 1S1MA 2ZUDA 5HZKA 2RGAA 1VDZA 621PA 3SYLA 5FBQB 221PA 1IJFA 1Z6TA 2DBYA 1EXMA 1EX6A 3ADKA 1TADA 1W47A 4FMCF 4PHGA 4KJZA 4B43A 3ZQJA 2BKUA 4JL8A 1YKSA 2HF8A 2CHGA 4K46A 2VO1A 2OAQ1 1GNRA 1ZCBA 2GXUA 5JCZA 1N3BA 3IQXA 3D6TB 2H92A 3M0EA 2D3WA 1XPRA 5F2EA 2XITA 4E07A 3P26A 1Q57A 1P60A 4DSTA 2BC9A 1E2QA 2ZRFA 3SOPA 2DFKB 4NHOA 5GADl 5DN6D 3RS5A 3THWA 2Q3MA 2F1JA 1KI6A 2CEAA 4TLDA 4B35A 3CRVA 2IUTA 2BKEA 2PX0A 3K9LA 1YR7A 3AUYA 1JXMA 1MO6A 4F93B 1F60A 1Q44A 2ZI9A 3KKQA 3PUZA 1CLUA 1G18A 1G1MA 2IS6A 2AXPA 4JLNA 1KKMA 1WRBA 4A8JB 3IO3A 1AKEA 4URZR 4C0BA 3PXGA 2HCJB 2H8KA 1AK2A 4OHZA 3C8UA 3A58B 3G5UA 3KZ1E 5HCIA 2QP9X 3BAFA 3C5HA 2G1JA 4P0TA 2A78A 3VNUA 2GTPA 1OXXK 2ZVPX 4A15A 4NU0A 4D82A 2WVJA 3LW7A 3SE0A 4L9WA 4FN5A 4IOMA 4KU4A 3M4YA 4Q7LA 2QTFA 1ZCAA 3A4LA 5J40A 5KO2A 4LJ4A 4ZDKA 4H1UA 1N2CE 4M1KA 2RGNA 1M1YE 4PQFA 1NN3A 3KQUA 5EXXA 1N5KA 3A4MA 1ZM9A 1U2RA 4US1R 2ZYUX 3QF4B 1JEDA 3EZ9A 4F4JA 2IT1A 1IXRC 1KY2A 4JBWA 1XD2A 2ZREA 5SZIA 1P2TA 3DKPA 1XPUA 1OH8A 1G6OA 4EJSA 2HUPA 2VSOA 3BB1A 5E4FA 3TR5A 1KK1A 4BPBA 2BBOA 1YVDA 2VHJA 2Z4RA 2ZJZA 2G9NA 3I8XA 1D9ZA 2VF7A 3LRPA 3FE2A 3ZZTA 1IXZA 4CT4B 4KSBA 3U6KA 3CX7A 3QXCA 1GNPA 1LS1A 3LO5A 2O8DB 3ZGXA 2VSXA 2EU8A 2IWRA 3EZFA 3KTAA 2ZQ5A 5FTJA 2ZYWX 1KK0A 2GEUA 2O8FA 4LZZA 2XZOA 5IK2A 1CJUC 2WKQA 2V7QA 4O2RA 1ZNXA 2GDJA 3SFZA 1XZPA 4QG7A 1Z28A 1SQ5A 1RW4A 2IUSA 4JLAA 1YHNA 4G5RA 4Q9HA 2ZSEA 1N0UA 1IONA 1T3SA 2A7QA 4XJXA 4YMSA 4BLTA 1R5NA 3ICQB 4A36A 1E1QD 2K5UA 5ANRB 1T91A 2A5FA 1FW6A 3Q7QA 4ZI2A 2FZ4A 3R9IA 1E6CA 4OQNA 2ZJ2A 3NTUA 3KQKA 4LC0A 1W48A 4B3XA 4N0DA 1ZU5A 1E79D 2RH5A 2J3EA 2VYFA 2ZSDA 4HB4A 3IIMA 4ZO4A 2N1BA 4YONB 4YDSA 2REBA 2ZI5A 5EXPA 4KAXA 3SEAA 1IN6A 2ZJ8A 3H0KA 4OQFA 4Q4LA 4RD3A 3UANA 4C3ZA 1IXSB 5H1YA 2NGRA 2IYSA 1ZM2A 4C0HA 2ZJBA 4WXPA 1TU3A 3TSOA 1W2GA 4ESHA 1BH2A 2ZR9A 3VAAA 1DO2A 3GP8A 3M6AA 3F8TA 1L2TA 1N6KA 3CM0A 4L4UA 1R4AA 2CE2X 4B6EA 3VR5A 4BEBA 1WBDA 3P20A 1PUIA 4PZZA 4KYUA 2G1KA 1NL3A 1NVWQ 1KNQA 3U3MA 3WMGA 5FL3A 4RFSA 3BH6A 4Z51A 2O8EB 3DKVA 2RGNC 2WWGA 4HAXA 4ZIRB 1U98A 4AI6A 2D7CA 4IDNA 1PVOA 3QENA 4JBXA 4KBFA 4OI0A 3EPHA 2ZRDA 1SVMA 2YOGA 4WIAA 3UWOA 1O87A 1ONBA 1Z0KA 1VG8A 4GT1A 5IT5A 5KDDA 2CL6X 5KYKA 5FPTA 2VLIA 1JR6A 4AKEA 1CU1A 1UFQA 2BV3A 4DDUA 4EJSC 1Z08A 1U90A 2OAP1 3PVSA 5EE3A 1UKEA 1GILA 5JEDA 1EFRD 2LCFA 1JJVA 2C98A 3CNNA 2EFGA 2RMKA 3ZS9A 2WKPA 1W49A 2D74A 5CDFA 4NONA 4M1MA 2FPKA 2UZIR 2FSFA 4EQ6A 1KJYA 2ZSBA 3GLHE 3U3KA 1AM4D 1GP2A 4XH9B 1T3HA 3CH5A 1XXHA 5JI2E 4PAOA 4UKDA 3ADDA 2F1IA 2ZJYA 5EP3A 2CK3A 3AKCA 2QENA 1W5SA 4R2HA 3GLGA 1W44A 3RABA 2YJTD 2VL7A 3QSYA 4QGAA 3U2QA 3RRMA 5CLQA 4J0QA 5L3QA 2YHSA 4ZV4A 4G5OA 4IDHA 1ZUHA 3PQCA 2DWOA 1FPMA 2QMHA 4DLZA 2GILA 2GWHA 3PENA 4O25A 1TEXA 2R6AA 1ANKA 3V9PA 4JL5A 2GHIA 5FPHA 2BMDA 1O3YA 4B3BA 2AFIE 2KBEA 1IN4A 3B1ZA 3NC1C 1GL7A 4HDOB 2PEZA 1Q1ZA 2VH5R 2D06A 2REOA 4TL6A 1LB1B 1OSNA 4GP6A 2OHFA 3TW4A 5FTNA 1P61B 1Z06A 2CDNA 3BIFA 2GJSA 4O0MA 1E0KA 2NO1A 2ZSFA 4ITRC 1TF7A 4DLUA 2YVUA 2OBLA 4EPYA 3BH7A 2QN6A 2PX3A 2QBYB 2OFWA 4V0NA 5J47A 3K70B 4QM6A 4PHTA 4GMXA 2QSZA 1G6HA 1OXVA 4V0LA 5A0FA 4KCGA 1IY1A 4HZIA 2R62A 2RGDA 5DI3A 1E9AA 4HLUA 5FR1A 1L4YA 3DM5A 4JT2A 4JZKA 1PLLA 3PEWA 4P31A 5JWHA 3AVTA 3VHLB 5TDHA 2Z6VA 4U02A 1RVDA 3AVOA 3E2IA 2ZE5A 4LHVA 1XP8A 3TBKA 4PO9A 3IKJA 4XSGA 1P7CA 2QZ4A 4NYMQ 2VP0A 4TSFD 4DDVA 4M9QA 2WJHA 3LVQE 2V1XA 2QMEA 2JLSA 3CO5A 1P9NA 2J0VA 4TL8A 1T0JB 2PEYA 4JSTA 4JMPA 3WP1B 4DLRA 1ZJ6A 3NKVA 1EFHA 4MKFA 4AIIA 4E22A 3IUYA 1N6PA 1OJLA 3Q72A 3K9HA 4E09A 1II8A 2ORWA 2O0JA 4DWJA 1JJ7A 3S1AA 1K8RA 2GEVA 4IDPA 3A1WA 1Z3IX 4HAWA 3GLFA 1J99A 2JLVA 1KMQA 5EXTA 4WBSA 2C78A 5DSZA 1EFTA 3EARA 1P62B 5FOVA 2EW1A 4KLNA 1BMFA 3B1VA 4LBVA 4POAA 3SJBA 2ZU6A 1QG2A 1OW3B 3T12A 4AC9A 3AF1A 2X19A 2YINC 3BK7A 1GFIA 2BWJA 3PV0A 3ZZ0A 4B47A 1CEEA 5GJVC 421PA 1U8YA 3RWMB 4FINA 1C4OA 4I4LA 3GJ4A 3R20A 3BC1A 4B3CA 1ESNA 1M7HA 3REGA 2ODBA 3FFAA 5JJKA 4KHZA 1UBFA 3BD9A 1GKUB 5L3VA 3T1VA 1QVAA 1KSGA 4BFUA 1UBGA 1VYTA 2WPDD 4JLPA 4US2R 3BXZA 4CZ2A 2QY9A 1E1RD 2NO0A 4LX0A 1OKKA 3SZRA 4R7ZA 3FKQA 4LYAA 4ERNA 2YOHA 3B1WA 3P32A 3BFVA 1COWA 3PR1A 4P3YA 3T1QA 4HLUC 1ZNWA 3IPYA 2DPXA 2PBRA 3LV8A 1F48A 1LFDB 3BBPA 3TAHA 1P75A 2FJUA 4D26A 1X1RA 2EWWA 3MG9A 3L0SA 3OIUA 3C4JA 3TIFA 1C9KA 4C7OB 2H5EA 3TUZC 3B2EA 4BLOA 3EZ2A 4HUTA 1NKSA 1AS0A 4M21A 4P4SB 3CB4A 2IUUA 2ZRBA 4ZCIA 1MV5A 1NJGA 2V4ZA 4N1AA 4TL7A 1XDBA 1I4LD 2WIAA 2NIPA 3FMOB 4QGGA 721PA 1RRFA 4QJ5A 5LD2C 2F43A 1OFIA 2GXSA 2I4IA 3CZPA 5SZJA 5BWMA 1G8PA 5KHOC 1JQLB 4Z8XA 4OQLA 2CXXA 4NCNA 4X8LA 2DR3A 5CDFE 1JXOA 3C16C 4X8OA 2ZI4A 5EP4A 2J45A 1KKLA 3TSZA 3JZAA 4LSGA 1AA9A 4EPXA 2CK3D 3LX5A 1RRCA 1XXHE 3J81k 2QQ0A 2CMKA 3K0AA 4GRAA 1N5JA 4N0EA 5JHGB 2W2TA 1SXJA 2P6RA 4XTRA 4IVPA 3V4FA 1NY6A 3R8CA 4JLJA 1MO3A 3CWZA 3GLGE 3W6NA 3IILA 3L0OA 1LNZA 1SULA 4QXAA 2FEMA 3O8RA 4DCSA 5A4JA 4DXAA 3FYHA 5BN4A 4WA7A 5JLJA 1OE0A 3ETLA 1ZNYA 3IIJA 4TYWA 2W2XA 1Z6YA 4OK5A 4MQBA 2ZXUA 5FBRB 1ZINA 1E2JA 2IYZA 1J2JA 4S2EA 1VYUA 1ZM4A 1GOTA 5CIQA 1D6JA 2EFDB 2XAUA 2ZE6A 3DPUA 4D6PA 4XWAA 4OL0A 1W0JA 1ZIPA 1KI4A 1HEIA 3PUYA 4FCTA 2XNDA 5JI3E 4A92A 2GXAA 1GRRA 1Q1EA 2J0UA 3K9GA 2VTKA 3I8SA 3AF2A 4JBYA 1LY1A 1M7GA 3CRRA 4MUAA 1J70A 4TYPA 3ZVNA 2JIZD 2FG5A 4Y0VA 2AL7A 1XTJA 3OF5A 2ANCA 2WKRA 1XEWY 2GA8A 2J87A 1XWIA 2O52A 2QT0A 4DSOA 4PC3A 5EUQB 4W7SA 4LWZA 3UK6A 1NMZA 4QBGB 2XJ4A 2JLUA 4Q4JA 1S3GA 4FWIB 3THWB 4KVGA 4MYTA 3E1SA 3C15C 1DAKA 3BOSA 1KI6B 1KSJA 2EFHB 4NYMR 4QGFA 3K09A 2P5TB 2ZROA 4TL9A 3B9QA 3LQRA 4JIMA 2VEDA 3MAAC 5J4KA 4Q9IA 4WAUA 2D62A 2DHRA 1Z8FA 1XD9A 3I4LA 3AKEA 3CLVA 3DL0A 5G41A 2IW3A 2OCAA 3AB3A 3OIWA 2AR7A 3QF7A 4HLQB 2ZR7A 5FUXA 4DLTA 5LPNA 3PUWA 1KSHA 1XCPA 3DM9B 1Q21A 4WZAE 3I73A 3CPHA 3W6PA 5AJVB 2R9VA 1KY3A 2YZ2A 3UATA 5JWOA 1AZTA 1QHHA 5TY0A 1Z0JA 1OB2A 1RE0A 4RCZA 2ZRIA 4WOPA 4R71A 4CF7A 1GUAA 1IN5A 5L3RA 1TQ2A 2EYUA 5HCNA 1SXJC 1Z2AA 4D4LA 5C46F 3T06B 3QKRA 5FUYA 4PR0A 2WWXA 2IBMA 1GDDA 1HUQA 4TTRA 2ERXA 2ODEA 1ZM7A 1Q20A 4MITA 4D0GA 2KWIA 3PUVA 2AKYA 5EUMA 3E70C 2ZRCA 3SQXA 3EIEA 1XD2B 3V4RA 4OHWA 5CK5A 3ZDQA 4EJSB 1P2SA 2HCBA 2QL6A 4QC2A 1E2GA 1VKJA 4PZLA 1G5RA 4FMDF 4Q1FA 3MJHA 1PV4A 2ZRKA 4RJLA 1W1WA 1X8JA 3ZVRA 3L8ZA 1OHHA 4M4SA 3AKDA 4DVGA 4YMUA 3IHLA 3G0HA 3SS8A 3KTAB 4PHHA 2O8FB 1YZNA 2CBZA 4HB3A 4RD1A 4Y0AA 4QM7A 1TU4A 3FOZA 1Z6XA 3RLFA 2XOKA 4JSYA 5DIFA 3X1DA 2GZAA 5B2ZA 4ZCLA 5JEEA 1OKKD 1UM8A 3ZQ6A 4M2LA 2KB0A 5F9FA 4G0NA 1W0KA 4ZKDA 4RY2A 5JCPA 5EP2A 3CNOA 4OQMA 1LTQA 2PMKA 3AF0A 1JI0A 1FX0A 4L16A 4PC7A 4Q02A 5J4HA 1VHLA 4MGZR 2KI5A 3BORA 2CVFA 1UAAA 4RKEA 4US0R 3CWQA 3K09C 3L43A 2CHQA 4HDCA 5KSYA 3HP1A 1PUJA 4JLVA 4AD8A 1DEKA 1E4VA 1IQPA 2JDIA 1Q0UA 4BLSA 2J59A 3N5CA 1ELOA 1PLKA 1W4RA 3QPWA 4B32A 2GF9A 2ZRNA 4G3XA 2FSHA 3CZQA 4GOKA 1YRAA 4BWYA 3L0IB 5LDDC 2BJVA 5DLQC 4L9SA 1IJEA 1GZSA 5JMTA 1NY5A 2L0XA 1CR2A 2Q21A 4XIGS 1NLZA 1G41A 4TQ9A 4K81B 2QM8A 1CBUA 3DDCA 1X8LA 3DHWC 4V0MA 3QI2A 1XRJA 2RAPA 1G21E 4P32A 2VP9A 2V9PA 5BQ5A 2X2EA 1G19A 3EXAA 4PC2A 1KI2A 3IBGA 2NQ2C 3D8BA 4ZKEA 1GSIA 4LJ9A 4AWXA 3H2YA 5DE3A 2OBNA 3ECCA 1KDRA 1SVSA 3SBEA 3QY0A 2IF2A 4NCIA 3OEEA 1GRNA 5J4VA 2JLQA 4IEEA 1GKIA 3TQCA 3VR2A 1YE8A 3I5XA 2HV8A 3TH5A 3ZS8A 1E2HA 2I1QA 3OHMA 3NG1A 4LJ7A 4MKIA 5AR1A 3RNLA 3U6BA 1R0XA 1KK3A 3AF4A 2C04A 1P6XA 2QG6A 3CR7A 3QG1A 3RC3A 2OFXA 2ZANA 1GG2A 2GBLA 4B34A 5FOUA 5EE5B 2P0EA 1IOZA 4BFZA 2PL3A 4B73A 3EG5A 3T15A 2ZRPA 5CB8A 4KFUA 3TUJC 3EIQA 4EQ6B 1KMHA 2EYQA 2GAAA 4CEHA 2AWOA 4D2IA 4C0AC 2W6JA 4OBEA 1B23P 3ZVLA 1XXHB 3ICEA 2B7BA 4JL6A 3CNLA 1RPZA 2R6CA 2OFOA 3Q5DA 1BS1A 4FMBB 3GLGB 4DKXA 2QGZA 1ZW6A 1Z6AA 3ADCA 3RSLA 4LRWA 2WWYA 5TVKA 5L3QB 1G16A 1KO5A 1UF9A 2V55B 4ILEA 4CDGA 4TZ0A 1RKBA 1E9SA 2ATVA 4FW9A 4EFNA 3LX8A 1FMJA 1D8TA 1FTSA 5E7IA 1AIPA 1J7KA 2WHXA 5JRJA 3K70D 3KQHA 2HJVA 2OLJA 2GF0A 3OEHA 4EKDA 1ETUA 4HUQA 4M1OA 5L3SA 4Q4AA 4GZLA 1M34E 3U44A 1NG1A 2F9LA 5LBIA 2IYTA 3ZIAA 4DJTA 3NVAA 4LY6A 2WOOA 2VBCA 2IYRA 5BYKA 4A0FA 1HE8B 3RWOA 4YMTA 2IXFA 1E2IA 3FHOA 2ZRGA 5ELXA 1QHXA 4LHYA 5FUWA 1U9IA 4M9SA 4FIDA 1Z0DA 3BRWD 4QHSA 3SQWA 2NZ8A 1X6VA 2OUKA 1E2PA 5K8TA 2IEZA 1NMXA 2IHYA 3AQ4A 3QVVA 2PT7A 4RZ2A 4AYTA 5DI3B 1J8YF 4RCYA 3SJAA 3QOFA 1Z07A 2ZS9A 5CLLA 3U3OA 3MRSA 4W5JA 3I5YA 4FWTA 2J1LA 2WZQA 1JQJC 1FQKA 3AV0B 1M8PA 2WWFA 1FMLA 2CCGA 4QKQA 2XTZA 1OB5A 2BMEA 2J5XA 1OIVA 2D7DA 1DAFA 2GBLC 2PH1A 4JLDA 4UNQA 2EWVA 5LD2B 3B78A 1OXTA 3O8BA 4DZZA 5HKKA 4IXMA 3PJRA 4DCNA 3NHAA 2TMKA 3SHWA 2IS1A 4TMTA 1UADA 4TMXA 4Q19A 4B44A 4Z54A 4O2LA 3RYTC 3NDBB 1W0KD 1II8B 4HB2A 1KO8A 1M7BA 2WM9B 4NP6A 4DIDA 2C8VA 2J0SA 1OT3A 1S96A 3BWDD 3S1AB 4DT1A 2QT1A 2FSGA 4TMWA 2OE2A 4UXHA 1QVRA 2LKDA 3I72A 2P3SA 3GLFB 5UKDA 2HT6A 5FI0B 4F38A 3QPUA 1KAGA 5FTKA 1R10A 3TK1A 1YZGA 3ZVMA 2FX3A 4BZQA 1LF5A 2JDID 1U0JA 1W5TA 4E5UA 3SC3A 1CS4C 3DOEA 6Q21A 1GTVA 3WNCA 1MT0A 1WB9A 1M2OB 1SHKA 3QKTA 3LW8A 4M1YA 4R2IA 3X1YA 1JB1A 2FN4A 2IXEA 4LC1A 3WBJA 2OXRA 3PCRB 1T5IA 5DISB 2IC5A 3OAAA 2Z83A 1MKYA 4Q9JA 4V0ME 1U9IC 4AG6A 3GLIA 1NKTA 2ZJAA 2HXSA 1LVGA 4C0LA 1ZM3A 2KSQA 1RJ9A 1R6BX 1NMYA 1OF1A 4A2WA 2VSFA 4PO1A 4PZYA 1F2UA 3DMNA 1ZRHA 2R6GA 5LB2A 4YXWA 2VA8A 2WSSD 4X8MA 5FOXA 3RS3A 4BFVA 4C0JA 1TQ4A 1IAQA 5K8IA 1H8HA 1ZIOA 4ZDIA 1QZXA 2X2FA 3TGPA 5SZKB 3VX3A 3UXMA 3DMDA 1G291 2CLCX 1QHYA 4NCJA 2JJ1A 3RS0A 1VYVA 3TKLA 3NH6A 1U94A 5KUTA 1AQUA 2E87A 3LFUA 3SJCA 3HR8A 4MKGA 3X1XA 3FWYA 4IOLA 5FH9A 2JJ2D 3UIEA 2J7PD 4W5WA 1NBMA 2CNWD 2R65A 4W9MC 3K0FA 1XEXB 2JEOA 5EXSA 1IM2A 4AY2A 5DNYB 2F43B 4BFWA 1U0LA 2QGNA 4LGMA 2WAXA 3REFA 4BRUA 4MRPA 3VNVA 2BBSA 3W3AA 5BW8A 2WMOB 3OFNA 4L15A 4MDEA 1FQJA 1V43A 3CKLA 4M1SA 1QHGA 4IEIA 2BCGY 3I32A 3VFDA 4AG5A 2C95A 3RS2A 1E99A 3K0AB 4QNMA 1SVOA 1SXJB 4Q1EA 2OEPA 1OYWA 4Q48A 1WP9A 2E1RA 2RGBA 4M0LA 1PJRA 5JWRA 4A6PA 2FFAA 3QUSA 2FE4A 2ZU0C 4LOAA 4BRWA 5FPSA 5JECA 3U4QA 4IVQA 3WMFA 2ZRHA 3KFXA 1KSFX 1GL6A 2JLWA 4G1UC 1AS2A 3OEHD 2R8RA 2NPIA 4A4DA 2YWHA 2OCYC 1DPFA 2OILA 2FFHA 1CIPA 4IOJA 1S2MA 2OT3B 2QSYA 5H8WA 4Z1MA 1NIJA 2KE5A 5GJWC 2ZI6A 4DHEA 1TUIA 3QVUA 2VRWA 1WF3A 3W9YA 3CONA 1Q1BA 3UG7A 4KYIB 4E03A 3T34A 3KDSE 1TQ6A 2BM0A 2V3CC 2J0UB 1WDTA 3EW9A 1SKYB 4W5HA 4HZUA 1K5GA 4PPQA 4KI0A 2FPLA 1UEIA 5HZHA 2C9CA 1EFUA 3VHXA 1G7TA 5CYOA 1N6RA 4TN1A 3W6OA 4TMKA 4XWOA 1KO7A 5JZVA 3C7KA 821PA 3NBYC 4B74A 2AD5A 1E2FA 1G3MA 2JLRA 2QAGA 3GFTA 4LJYA 4C0QC 2NOAA 4ZDJA 2BDTA 1R2QA 2ZE8A 2ZSAA 2FOLA 4A82A 2VHTA 3A1UA 3KL4A 2GESA 2WWHA 3K8YA 3N2IA 3O47A 4CYMA 1R5OA 1WQ1R 4B2IA 3KB1A 1ZBDA 1GWNA 4WW0A 2AWNA 1HURA 1KJWA 2EFCB 3W34A 4QBHA 1IBRA 5AUNB 1H8EA 5KDOA 4UNNA 4EFMA 3GJ0A 1SVIA 2QRNA 2KBFA 1NSTA 1BIFA 3EAQA 3MD0A 2NZJA 3FMIA 2H57A 1RIFA 2YKGA 2I1VB 4URXR 1QHHB 2HXYA 4QRHA 5E3HA 4C9BA 3KQLA 1VG9B 2OZEA 5BXQC 1G8HA 2FPMA 4GZMA 3W90A 3H86A 1B0UA 3L0PA 4D81A 2YWFA 4DLXA 1N25A 1AGRA 1UKVY 4IFEA 1NVVR 4IKEA 5FOWA 1AQYA 1NVUQ 4KSCA 4TYQA 5FR2A 1E4YA 1RFLA 3PIRA 3NEYA 1N6HA 5FI1B 3O8DA 1XMSA 4IFBA 1N6OA 1AJEA 4CEJA 4DSUA 5IK2D 1E9CA 3W3ZB 2V7QD 4EDHA 4GNKA 1T8UA 2VHCA 3VTKA 1MO4A 3QXSA 3WYAA 1U99A 3QKSA 4IRUB 2HEIA 4PSAA 4UJ3A 3SN6A 1OH7A 4RD6A 1OLOA 1CR4A 1OXSC 4LHXA 4JVMA 3R9WA 2N42A 4B33A 4OI1A 4ON9A 2PZFA 3AVYA 3DVLA 4PSVA 2XZLA 3BB4A 4JJKA 3A1VA 4AK9A 3CRQA 1CJMA 1R8SA 1TPZA 2LWIA 3AF3A 1AGPA 4PAQA 3QNUA 3ASZA 4FCWA 4LCBA 4CEIA 4I1OA 2BM1A 4DUGA 1NLYA 4A2PA 3P1JA 3MWLA 1UJ2A 3BB3A 3RS7A 1K5DA 1LW7A 3TQFA 2QAGC 1FX0B 1H8HD 1RRPA 2PCJA 3SYKA 3V00A 4IOKA 3Q8XB 1XBTA 1YQTA 4Q7MB 1CTQA 2W6IA 5FPKA 4MGKR 1TTTA 3EASA 1BKDR 2IHBA 3SNHA 5FL7A 5DH9A 3KUCA 2YC4C 3RS4A 2WICA 4HEJA 1LS6A 1NBMD 2WJGA 2DFNA 3TE6A 1XTIA 2DWQA 1E9RA 1HV8A 1K6MA 1UDWA 1NBME 1OH5A 2W00A 2OBMA 1XEWX 4KITB 4GDFA 4RKFA 2JASA 3KQNA 5E95A 3U7HB 2IA5A 4P33A 1Z47A 1E2EA 1DTSA 2R2AA 4M9XA 4WXRA 3HU3A 1DS6A 1NIPA 2BCJQ 3LLUA 3FHTA 1SKQA 3THYA 4Q7KA 1CJTC 3B9PA 2WJVA 2FV8A 4WZ6A 3GFOA 4ZCMA 1JAIA 2W2VA 5GVRA 3G82C 3W5JA 4EFLA 1N5LA 2ATXA 4PO8A 2ZI3A 3AVQA 1RYHA 2X1VA 2AFHE 2MSDB 4A0RA 1E32A 2Q9AA 2WJIA 4YC7A 5EQTA 3HU2A 1YRBA 2CJWA 1D2EA 3LNCA 4GFDA 4Z1MD 4F91B 3I1FA 3QG5A 3MWJA 2JLYA 1YJ5A 3AP1A 1XB2A 4Q7JB 4NE2A 4D25A 2KJQA 3BERA 3BJIC 4B3DA 4I1SA 1XCGB 1VG0B 4P4TA 1GM5A 1EWRA 4TMZA 1HH4A 3W8RA 1ESMA 1NF3A 3I3SR 3MUFA 3HWSA 2CCJA 1CP2A 1KMHB 2FSIA 4LBYA 3MFYA 4Z8YA 4HSEA 2Q6TA 4HLDA 5DYIA 3VKHA 1KDPA 4UXIA 2DB3A 2Z43A 4LJ5A 3WMEA 1G8YA 2A5JA 1DG1G 1Z5ZA 4HATA 4A0GA 1GRQA 2WOJA 4OI4A 3SHFA 2F1HA 1FUUA 1ZVQA 3A1SA 5FBLB 2REXB 2JGNA 2YYZA 1L4UA 4Q18A 1CF4A 4DDTA 3NBXX 3UWKA 3SFVA 2B21A 3QBVA 2WV9A 4HI0E 4A9AA 5G53C 1DOAA 2XTNA 5AK0A 5KPJA 1TAGA 1Q22A 2VF8A 2YNMA 3MCAA 4OHXA 3WY9A 1MRNA 1D2NA 4V0OA 2RGGA 4HUQB 5L3SB 4Q4AB 3O8CA 3U44B 3EPKA 2GK7A 3U60B 1XNJA 3F5FA 4PHFA 2GETA 1Q3HA 2W0SA 3LVRE 1EWQA 4PQRA 4QBIA 5G3YA 4KFRA 2QP3A 2CL0X 4BZPA 1N6IA 1FNNA 2OG2A 4MUBA 4B3GA 1DADA 4QBFA 5M04A 2FNAA 1HA3A 1XX6A 5KTYA 3HYTA 3VU9A 3WNDA 1QBKC 4Q66C 2QMUA 3N2EA 4NCKA 4DC9A 2VQSA 2PT5A 3KXKA 1J90A 1HTWA 2VHQA 3EWSA 3MGCA 3FMPB 1LV7A 1MOZA 8OHMA 4DEYA 1US8A 4HLCA 1NN1A 1WE2A 1AKYA 2HYDA 2O8CA 3DZ8A 5JSZA 4XOIA 4LJ6A 4GL2A 1R0ZA 4U5XA 5KSPA 4IVRA 2BMJA 1OV4A 2XJ9A 3TNFA 1FUKA 4UNRA 1ZD1A 2AK3A 5EJEA 1Z22A 5K8LA 2P5SA 2ZITA 2QUZA 4FMCB 3X1ZA 2D2FA 1JECA 2BEKA 3C5CA 1QHNA 2QMOA 1P2VA 1Z0IA 521PA 2R6DA 4LBZA 3TSWA 3BFKA 1P72A 3QPVA 5IF9A 1Z83A 3U61B 1AS3A 5HE8A 1OIWA 4HYYA 3GLFE 2ZUBA 2IXGA 5DN6A 1G8GA 2A3RA 2JJ8A 4O3MA 4JKYA 5DGXA 1BMFD 5JFGA 3THXA 1MO5A 4D80A 1GKYA 3VX4A 4OYHA 2IX3A 3GMTA 3OIVA 2CLDX 4JJZA 4BFTA 1DARA 1NN5A 5KU1A 1A7JA 1Y63A 1D9XA 2GJ9A 4V03A 1E0SA 5CB6A 5KPDA 4PTLA 1YU9A 3WHLA 5KNDA 4AKHA 4B76A 2DY1A 3CX6A 4HAYA 4DT1B 3R8FA 1BOFA 4TTPA 2W6ID 1CXZA 4Q9KA 4FI3C 4WVFA 2XXAA 3C14C 3AVVA 1ZNZA 2OCPA 3FKSA 2ZRJA 5FL7D 1G4AE 1UBEA 5BN3A 1A4RA 1G3UA 1OH6A 2EFEB 1C1YA 2B8WA 1TUEA 2J9RA 2ZJOA 4Q4HA 2F6RA 2XTMA 2XB2A 1COWD 3MJRA 3RRZA 4B75A 3I62A 1F2TA 1DAIA 2GCOA 3GEIA 3FPAA 4QFMA 2JLZA 2OSBA 2AK2A 3CBQA 3FB4A 3EC1A 4PFSA 1E2NA 2DCUA 3TJZA 4EPVA 2HDNB 1T3LA 1G7RA 3B60A 2H16A 3B6EA 2BHRA 1I4TD 4GMDA 4S35A 1RJ9B 3EZ7A 3IBYA 5D3MA 1FNMA 3M1IA 1SHZA 4QL3A 1F2UB 5EZ5A 3LD9A 2FF7A 4OQXA 3ND9A 4TT3A 4DB2A 2EQBA 1FTNA 1EESA 4PX9A 2RKOA 1GIAA 1KNXA 1T4GA 4QOSA 2GRJA 2ZYTX 1SXJD 5LB4A 5KNCA 3SBDA 4D4JA 4BFXA 4LJAA 1UEJA 1SXJE 4WZBE 1P3JA 1SGWA 4RFSB 2VP6A 3K0FB 4DCVA 2XZPA 1ZUNB 1J8MF 2H7VA 1E1QA 2GAOA 2PZGA 1T6NA 4JLOA 2O8BA 3CW2A 3RC8A 1VHTA 3A8TA 3TVDA 4ABYA 5DI9A 4BGDA 2G88A 4RFVA 3ADBA 3RDPA 2FFBA 5EE9A 1X8KA 1E79A 4P4SA 4R98A 3AVXA 1NN0A 3SI7A 1G64A 1FP6A 3BH0A 4A2QA 1DVRA 2W83A 2B6HA 2J46A 1W0JD 2O0KA 2PJZA 1SVLA 3DZDA 1GITA 1E94E 1ZU4A 4NZYA 3UKDA 2XNDD 2MMCA 5FBVB 2WSMA 3LLMA 2AKAB 2C96A 2QPOA 3OESA 2XGJA 2ANBA 2F3TA 2QPTA 3U4QB 1SKYE 2YV5A 1R7RA 1XMJA 1YZTA 1XJQA 4ASUA 1A1VA 4LHWA 4LV5B 1M74A 4NYJR 3KFVA 3AEZA 3ND8A 4Q1BA 2DWPA 4IHQA 2PMDA 3KKMA 1G5PA 2BBWA 3H1TA 2GEDA 4B2LA 4UNPA 4GSYA 3RRNA 4MRRA 3U5ZB 1F5NA 1TX4B 1UKZA 3AM1A 1JR3A 3MWKA 5FFMA 4Q1AA 4GOJA 2Q9CA 3QEJA 4TQUS 1WXQA 2RHDA 4MYUA 2QTVB 2NO9A 3A4NA 1OIXA 1G3IA 4B48A 2ONJA 1T8TA 3GCGA 1P9RA 1Z29A 1OFHA 2IF0A 3SR0A 4TYYA 2ONKA 1IN8A 4QJ4A 1GAJA 3HDTA 1T5LA 1KJZA 1EX7A 2QM7A 1ZP6A 2I3BA 3QKUA 4JYBA 1CULC 1HT2E 1D2MA 1G8FA 4I1VA 1EFRA 4IXNA 2WJYA 2X77A 3KXIA 5JS8A 5FOTA 2QAGB 3PEYA 1NVXQ 3EA0A 4AKIA 2HJGA 4TLEA 2B92A 1E2LA 1ZD8A 3GLHA 2GJ8A 2A30A 4U00A 3WHKA 3GJXC 1DE0A 4LYJA 3TVTA 2NO7A 4C2UA 4HB0A 2V6JA 3D3QA 3R7WA 4NCHA 3PITA 1IHUA 4DCTA 4OI2A 1TF5A 4TTQA 1E9FA 4URUR 3RVBA 1EG7A 3AVPA 3IQWA 3AVUA 1I2MA 1S9DA 4JVLA 3EPLA 3T5DA 2IS2A 2C77A 1QG4A 1KI8A 4ACBA 2GVZC 2QQEA 3ONWA 2P6UA 2A5DA 4IDQA 4V0KA 3PUXA 4H1VA 3T5GA 2IWHA 3LWNA 3X2SA 4XSHA 2PJRA 3KXLA 2BBTA 2FWRA 2VPPA 2FGKA 4L5BA 3BGWA 3NIBA 5JHHB 1BO6A 3ZJYA 2R44A 3SU8A 2V1UA 4HDQB 4L8GA 3TUIC 4EPRA 1OHHD 1ZC4A 2AD1A 1MRSA 2F9MA 4M1TA 2OXCA 2D4HA 3MLEA 1OYYA 2VIIA 5P21A 3FKSD 3GJ3A 3KB2A 4JLBA 3U3RA 1A5TA 4CEJB 2OV2A 3NC0C 2XOKD 2QTHA 1LF0A 3B85A 2RCNA 3L2OB 3VQTA 2C9YA 3QKSB 1KI9A 4DSNA 4DLWA 2PZEA 4IW3B 3EWAA 1KO4A 1YZKA 3AKYA 1E2DA 4DLYA 3TAUA 1U8ZA 4PC6A 2GXQA 1P2UA 2WIBA 2ZS7A 1OXUA 3P27A 4NTZA 2VHUA 2XB4A 4G5SA 1NI3A 2ORIA 4UXJA 1NVVQ 1E9EA 1L7VC 2GZDA 3JVUA 2ZRAA 1HE1C 1W46A 4XWKA 5JS7A 4CEIB 1R0YA 3GEHA 1JNYA 2WTUA 2V6IA 2ZAMA 4I1UA 5DO9A 1KDTA 4K8OA 1OPXA 1XJ0A 2JATA 1YR6A 2AX4A 2F55A 3T35A 1X1SA 1RC8A 4TSFA 4TT3D 3VKWA 2VP5A 2HLDA 3QE0A 2QE7A 1KI3A 3WBKA 2F3RA 4UQOA 2BVNA 1ZAKA 2IYWA 5JJIA 2B7CA 5CYPA 3GJ8A 3D31A 3FDIA 2HT1A 2AXNA 3VR6A 2ZTSA 3B8HA 2QP4A 3LDAA 5GVSA 3QXJA 3OEED 4OHVA 4LBWA 4JT4A 5B30A 2W58A 4CT5A 1UBCA 3ZH9B 1DAMA 5GJCA 3ZZUA 1U8AA 2XSZA 2CE7A 3Q85A 2P67A 4GPTA 4AYXA 1KZGB 3CR8A 4JKIA 4DEXA 1NSFA 4NMMA 2GJKA 2WBLC 3THYB 4KXFB 3JVVA 4KVAA 4ARZA 3CF6R 4NH0A 1ZMXA 4IJMA 3IEUA 4M53A 1I2DA 3CH4B 4YLGA 1CR0A 121PA 5KDLA 2G0NA 2SHKA 4A1FA 5IDVA 4BECA 2QI9C 1CRPA 2OESA 4JLKA 2GJAA 4KODA 4OJKA 3WNBA 3VMFA 3R9XA 1E69A 2W6JD 4ASUD 2ZRLA 2GVDC 3NHBA 4M9ZA 1TEVA 2QU8A 2CJWB 3HJNA 4TZ6A 1VPLA 1FL9A 3CF0A 4DBLC 1HQCA 1E96A 1KHTA 1KO1A 2WPDA 3KKNA 1JR3D 3P4XA 3UMFA 4B71A 4V02A 1E1RA 3QIAA 4LV8B 2C9OA 4TQAA 3KX2A 4A6XA 3A1TA 1JR3E 4BASA 3CPJB 2QRZA 2BOVA 1NJFA 1VMAA 2XX3A 2GCPA 1DG3A 3GJ6A 2Z0MA 3TR0A 2WMNB 5F98A 3NDPA 3SDZA 4Q5IA 4HAVA 3DEFA 3A37A 2ZS8A 4KBGA 1X86B 1E2MA 2IYUA 3AUXA 3N70A 3W8NA 3ZIAD 4BQSA 2XNSA 2ZUCA 1I4DD 2ODWA 1XMVA 3WRYC 3E5HA 3EPJA 1XTKA 5BN5A 2Q9BA 5KOYA 3NBFA 4LUCA 5TMPA 3IGFA 1N5IA 1U81A 5FTMA 4QNRA 2JAQA 3CIOA 4DRZA 3K53A 4GOXA 1KAOA 3ASYA 3GPLA 1XMIA 2IYVA 1XD8A 1W4BA 2YWEA 2IEYA 4LK2A 1JPNA 4CRWB 2WJJA 2IYYA 3PFIA 4PC1A 2CL7X 3K9NA 1EK0A 1MABA 1N0VC 2CLSA 1A82A 4KO8A 1CRQA 4TWZA 1W36C 1G4UR 2IL1A 1A2KC 2RB4A 3W5IA 4BFSA 4QJ3A 3JZMA 3GEEA 3T61A 5GJBA 4Q4JB 1Z0FA 1YZQA 2ZEJA 4UJ5A 2VP2A 5EE0A 2GKSA 4JYCA 1IY2A 2JCSA 1VG1A 3AP3A 1XPOA 4KFSA 3HPQA 1W4AA 1TF2A 2NPFA 2GK6A 1DAEA 2ZYVX 3VU9B 4RVCA 2HYIC 3HYRA 5CM9C 2UKDA 1UPTA 3X1WA 2OO7A 3DO6A 4RZXA 4BEJA 1XF9A 4EAQA 1US8B 4RD0A 5AJXA 2O8CB 5E7JA 5JSZB 3WRXC 2GCNA 2PLRA 4GI7A 5HKKD 4BE7B 4TLAA 2FU5C 1TL7C 2P65A 1DBSA 5C18A 2GZHA 5J4YA 2A2ZA 4TYNA 4PXAA 4FXPA 1NP6A 2JIZA 1HYQA 3CUEF 2BJWA 3WP0A 5JRZA 4BZXA 3RHFA 3KKPA 4A8JA 4D4MA 4F7WA 3QKRB 1XZQA 1D5CA 1E9DA 3GD7A 4AYWA 3P4YA 3WXMA 1VIAA 3SYNA 5JBQA 4OK6A 1KGDA 2V54A 1EFCA 3NEJA 3UG6A 1TNDA 1Q1QA 3LXXA 1ZYUA 5A5GA 1G9XA 2FEOA 5L8VA 1S8FA 2FGJA 5G3ZA 1CJKC 2ZR0A 4URWR 1WA5A 2QPAA 2CHVA 5C2JB 2IYLD 1SVWA 2C2HA 4XTCS 1Z63A 5AJZA 1II0A 1BYIA 2CCKA 1F6BA 4Q01A 4RZ3A 2HLDD 1IN7A 1GL9B 3OAAD 2QE7D 2ORVA 3LAWA 2XXAB 4MDFA 3VR4A 3VR3A 3QF4A 1Y3AA 3BFXA 1QF9A 5CJPA 1FFHA 1N0WA 2OCBA 1YR9A 3GLIE 2QNRA 1VECA 1Z6GA 4NDZA 5B57C 4LYFA 2NTYC 4Q4HB 1W36D 2HF9A 1F3OA 5FTLA 1VIYA 1TQDA 1XU4A 3Q5EA 5TXGA 2P6NA 4FCVA 3HU1A 4YXWD 5G40A 3Q3JB 4RSGA 5IRCD 2R6FA 5FBWB 3A6PC 4DLVA 3ZD7A 1F2TB 2GCOB 2O8DA 2XSZD 1PZNA 1KDOA 3I92A 2JJ1D 1V5WA 3LH5A 4Q00A 1NG9A 1MR3F 3CX8A 2DFLA 5IHPA 3LA6A 2YC2C 4PPNA 1XCMA 3KJEA 2PCLA 5JJLA 5D3MB 1KIMA 2JA1A 1G5TA 1P73A 1IY0A 2G77B 3Q7PA 1QHIA 5TB5A 4URVR 4JVSB 4N3NA 3WYGA 4IDOA 2GNOA 1OFUX 2QAJA 1W2HA 3H4MA 3OZXA 3OE7A 4QHTA 5AJYA 2ZI7A 3OFND 5KSZA 3I61A 4JVNA 4FMDB 4LV6A 2MSCB 4MA4A 4C30A 4MRNA 4ESVA 3AP2A 1AZSC 4XVRA 2ECKA 3D7MA 2J0QA 2Y8EA 2NG1A 3EIHA 3KJGA 3GJ5A 2ZM5A 1AN0A 4LYHA 2J7KA 2AN9A 4Q9LA 1G20E 4RD4A 5H70A 1S3SA 4A8JC 4EPTA 1R5BA 4I99A 5FOSA 3Q9LA 1VCOA 4NPHA 2Q0HA 3K1JA 5B58C 2QORA 3H84A 4LPSA 2MMGA
chains in the Genus database with same CATH superfamily
5ISMA 1OLSB 1PZHA 2VDWB 4B3JA 3NTXA 2J30A 3DDUA 3QQ5A 1TA0A 3GDOA 1Z62A 3OIYA 4ZAYA 3E15A 3ZNOA 5AI5A 3I6MA 3A27A 3WLPA 1JBKA 1SKBA 1C8VB 1TB4A 2LKCA 3KKZA 3MCVA 2HRCA 4IZHA 2NU7A 3PDUA 4XEHA 2QLLA 1FQWA 1YB2A 5JNSA 3LUJA 3B82A 5AK3A 4B0OA 5U1PA 4HDAA 1GA6A 2I4OA 5CK4A 2OY0A 1CRLA 2J3KA 4KQCA 4BLRA 2BIFA 1QTNA 2ZT7A 3QUQA 4KX5A 1S1CA 5CR9A 4DGQA 4YAKA 4QDOA 5FDFA 1UK8A 2Q27A 5COAA 1L8AA 1G21A 4K9OA 4P2BA 4XD7A 3U3JA 4P58A 5CXSA 5TSDA 3FGNA 5DWDA 3JQPA 4L0MA 4NKRA 4CIDA 2V0GA 1H6BA 1SB8A 2JA2A 4G5GA 2EW8A 2HWUA 4GP7A 4N6OA 3B38A 5TGTA 3C41J 3L0DA 2RAUA 5I7OA 4FE3A 2XQJA 3IAS1 3MJFA 4NBSA 2DFTA 2VJAA 1YAHA 3KQVA 1I51A 1RSZA 1MLDA 2C94A 1Z2CA 1IMOA 3DZCA 4RTNA 3A36A 1XZLA 4ATNA 1GFSA 4BJ1A 4NBKA 3AHJA 1FLAA 2V8BA 4PPFA 2WJAA 3NJ8A 3COVA 2P30A 4MUMA 3WNVA 5KYWA 2MJLA 2ROQA 2ODNA 4FYIA 3MJCA 4Q1CA 3VNRA 1P45A 5DASA 5DHAA 4KN5A 4JEMA 5CXUA 3FHCB 4XB6B 3DE6X 5L4LA 1Z5VA 4YAWA 4K9NA 1KZ4A 4GC9A 4KLZA 5H5JA 4KHPB 1NHWA 4BO9A 2MSEB 4H35A 4CTNA 4HBGA 4TS3A 4WT7A 3UJNA 1HWYA 5CIWA 3RYIA 5A3JA 3LUGA 4Z1OA 2IW1A 2CL5A 4HNQA 3UZUA 4G01B 4U7DA 1G17A 1PG5A 5J23A 4R5HA 1UDXA 1N4DA 3HR7A 5KYXB 1FP7A 2FDCA 3SJZA 1WR8A 4OJQA 3GUYA 4FQ7A 1X3SA 1XL0A 2LXNA 2VPIA 1C3OA 2YOFA 3U09A 5DFAA 4V38A 3FOAA 3FTCA 4R1PA 1OAKA 1RD4A 4RWZA 3AR8A 3UMRA 1ADCA 2C1XA 4D0LB 4D0NA 4FR2A 1RYFA 2NMVA 5E8JA 5LOVF 1F8UA 4XVUA 2EZTA 1M2FA 3AI3A 2RI1A 3QVOA 1KJNA 2GM3A 3KR9A 3MTAA 1LPBB 1TXGA 1JIIA 1Z33A 5JFOA 3L1IA 1CDZA 2VCYA 1EE9A 2Q28A 3JQ9A 3KBBA 4RA9B 4JXZA 2O2EA 5CM8B 5AUPB 3GY0A 3F3YA 4NJMB 4M8NE 3STVA 1JT9A 4I50F 1VL0A 2WWWA 3KJIA 4ZXFA 5HPYB 2Q1XA 5JFTA 2ZDHA 2Q3HA 2XUKA 3MGBA 4I55F 4DTCA 4DRXA 2ZJ5A 1PS8A 5FWXB 5AIBA 2O50A 3EC2A 1Y3HA 2XKJE 4WWHA 3GFBA 1XEFA 1CUAA 1Z15A 2IK8A 3ZY2A 1HYGA 2P2LA 4XVCA 3OPYB 2H17A 2PFKA 3ILYA 3DFFA 2I66A 3IA2A 1RBMA 3RSOA 4CW7A 4FFDA 2XCUA 2DUMA 4AZ0A 4FD3A 1DBVO 4NL4H 2YJ3A 3VSCA 4DUGD 2FH5B 3V2UA 4UMEA 1F8XA 4G9BA 1CS0A 3NFRA 3WA7A 4ARBA 1MGOA 3W5UA 4UBKA 1T9DA 5CIYA 4MINA 1V3QE 2WG0A 3F1KA 4IAOA 5EWJA 1DAHA 1OFTA 1GRVA 2RGEA 4U7PB 5E9WA 2JAUA 2O3SA 5KBYA 4YMVA 1ND5A 3I53A 1OROA 3EBLA 3EEIA 4H4EA 2D1FA 1JYFA 3FI0A 4QTZA 5KOHB 1KFJB 1N6NA 3C0KA 3VOAA 1WCV1 2FA9A 4M8IA 4WSOA 4LZPA 1V4VA 1JB9A 3ZHUA 1ZGBA 3NTOA 1P2BA 4JI0B 4PFKA 4BS9A 3CXUA 5DULA 1ZD9A 1OT5A 3C3EA 4ZEMA 3NWBA 3ZDDA 1YGPA 1VJRA 4FKZA 4R1UA 1E3MA 4MQMA 3BFJA 3K0CA 3B1YA 1U2SA 4KUEA 2GM9A 5C4GB 4IDCA 4PTYA 2BEJA 4XVQA 2HD4A 1WTAA 4Y2VA 1THMA 2H85A 2PX8A 1WKVA 1H6DA 1GN8A 3HYNA 1XEAA 3U7GA 3EA5A 3FX2A 4O08A 1GNQA 3L4BC 4HTFA 4RIFA 1IEWA 3FFBA 2M6SA 3F0TA 3T4EA 4BO3A 2AEJA 3GNQA 4AJHA 3QEOA 3MMPA 1EEHA 3GLIB 3WLQA 4GKKB 4IWNA 3GI1A 3NEPX 4OQZA 4OK3A 2WA1A 1XVLA 5ALEA 3SWWA 2CNNA 2RKWA 1QRUA 3KQWA 4EY6A 1Y8QA 1L5GB 2VNIA 3L84A 4WH0A 3KWJA 3NBZC 1NF9A 1FX1A 3OZUA 3X2FA 1CZHA 2REQA 5EHQA 7YASA 1Q1NA 4L4RA 4UQPA 4PF1A 3CQ9A 5A03A 5AM4A 4CKWB 1GVNB 2NN3C 3ZWQA 2AQ8A 4JDPA 1J2TA 2BONA 4RYDA 1X39A 1HO3A 4G5QA 5FPPA 2VJMB 4BKOA 1SEVA 4NYIR 1KDZA 3BHNA 3BSSA 2VAXA 2J85A 3EX7C 2A9PA 3OO1A 4YMWA 4EPWA 1C4KA 1MXHA 4GMKA 3OLCX 3ZK7A 5CNMA 5C0OE 2WHRA 4J3JA 4BMXA 4DCUA 1ZJWA 3AVWA 3ZCQA 5A6SB 1QU3A 1B2LA 4EA8A 3HPRA 3A2KA 1E9BA 3CO0S 5CT4A 2R1VB 3O82A 1L8XA 3GUUA 1R37A 1AY0A 3GIDA 2NUAB 4RVHA 1G38A 3LBFA 3SD7A 4CGYA 1K7SN 3LBIA 1AGXA 1N2EA 1P8JA 2RD2A 2FTKE 4IHJF 3ED5A 1LXCA 3S4YA 3GG9A 1C8BA 3FBTA 3JATA 3ENQA 1TK3A 2NO6A 1QDEA 4OGLA 3WIDA 2B20A 4TKVA 5A4MS 4EIWA 4RETA 2YMQA 2HIGA 2YXPX 3MSXA 1H65A 2MIIA 3O2NA 1FYEA 1JAHA 2A5YB 1UXGA 1AK1A 1D0IA 2QL7A 5LZ9A 3PFHA 4KV9A 1G5HA 1KVTA 4D4KA 4DB4A 1LRKA 5EPUA 4LJ8A 4O5OA 1IULA 1ZO8A 3B5JA 2G83A 3LE8A 2YNMD 3ZTTA 1SCUA 4UULA 2O06A 4MJLA 3IDQA 1E0JA 2C5AA 2RGCA 2X0KA 4MEJA 2RGYA 5AUQA 3ZI4A 2G3YA 3S7ZA 3M7IA 3AGPA 3SIXA 1KYIA 5AHOA 2Z5FA 3IV6A 1UPFA 1WD7A 3EGDA 4N12A 1AQ6A 5EP1A 1C1XA 4GECA 4HNVA 3AJAA 5LU8A 3F6SA 1L8LA 2J7PA 3HY4A 3EBOA 3G9QA 2CNWA 1EUDB 4JXJA 4I5GA 1GEGA 2V5AA 2WFLA 2BMFA 2I6TA 5HVNA 1OA1A 1JKFA 4S3MA 4R1TA 4Q03A 2QLMA 2VDJA 5HKLA 2QU7A 2R4TA 3P2IA 4ZDWA 5JT1A 3ODPA 4FT2A 4BPRA 2DHDA 3JY6A 3TVYA 1E1LA 2FZLA 3ENWA 4ZHSA 5T41A 3E23A 3LY5A 2BKXA 4RKYA 2W0MA 2O3QA 2Y2VA 2IZOA 3N5KA 1WDMA 2X1MA 3VU8A 5IM4A 2LIVA 3CSDA 1UDAA 1IZ8A 2JAWA 2MHCA 2Q8PA 2RGAA 3ESXA 3RHZA 3WE7A 2JI9A 5FBQB 4IHJA 3ADKA 1TADA 1H3FA 2PA3A 2X6QA 3DDNA 1KMNA 4FW8A 3RF6A 4LRQA 4INPA 1EJBA 4Z2YA 1VE7A 2CHGA 4DJDC 4GVLA 2R11A 3P0EA 5JD4A 2PU7A 4JUAA 2QQ5A 2YVAA 1UJMA 1MOQA 3D6TB 1ISSA 3IQXA 1MPTA 1FYFA 4PNPA 2D3WA 4CIVA 1VL2A 4S1NA 2GN8A 4U0JA 1QK3A 4KGDA 5FFFA 1XPRA 2X0NA 3QVMA 3W5AA 2OUIA 2PX4A 1Q57A 2AW5A 1M5TA 1E2QA 2DFDA 2GD2A 3KYCA 4NBWA 3SOPA 3DPSA 3SIRA 3SQOA 2RHOA 1Y3IA 1PFWA 3UGQA 4EHDA 4NHOA 5GADl 3FOFC 3RS5A 4G0YA 1Z34A 2XCSB 2H1OA 2NZXA 1KI6A 2WLSA 2FN9A 3AUAA 3GPCA 4TLDA 1Y7HA 4F5WA 1CVLA 1Z26A 4YAUA 4DV1B 1H1DA 4YIHA 2FRDC 2H4HA 3DBHB 2Y0EA 1JXMA 2XUDA 1KMCA 1R00A 1MO6A 2ZI9A 1V3UA 1CLUA 1PDOA 2FR8A 5B2EA 3NDJA 1PFUA 3KFLA 5CT6A 3TEMA 4JLNA 4AUEA 3ORHA 4AQDA 4JQZA 5CDUA 1KH3A 1EFLA 4URZR 4W1RA 1SBTA 2J4DA 1TDJA 3G5UA 3A58B 3TJRA 5JVDA 1FS6A 3BAFA 3VPXA 4P0TA 2VWPA 2LW7A 1DXQA 3A6HA 3IQEA 3VH4A 4QEDA 2ZVPX 1X80A 4A7PA 5B3AA 1AB5A 4TUYF 1CEYA 3DOIA 3R5XA 3N8DA 1QP8A 3LW7A 4R8MA 4FN5A 3C5WP 2AXQA 3DEHA 3WZ2A 1JZQA 4D9KA 5J40A 1W52X 2JFXA 1YH3A 4M1KA 3HR4A 1JEYA 3RWBA 1NN3A 4E3ZA 1EIWA 3KQUA 3O8QB 1NA5A 1Q3KA 3OURA 3RYCA 1XTUA 5IVDA 1U2RA 3N3AC 4US1R 4L7VA 4RTQA 1P0IA 1I2AA 3GXBA 3IESA 4LHSA 3UENA 1U3GA 3MA0A 1UBJS 3QF4B 3L41A 3EZ9A 3G6KA 1D4ZA 3S70A 1JFSA 2FN7A 5SZIA 1A5SB 1XPUA 1LEHA 3IPCA 1OH8A 1UPBA 3HO8A 5LQUA 1AO0A 5DYTA 1HRKA 1KK1A 3EFEA 2VHJA 3R7NA 2ZJZA 4CKEB 3QMPA 4YCBA 5LYJA 2G9NA 1OZFA 4JCOA 2NUTA 1P19A 1NC3A 2EX1A 2P3LA 2X5KO 4C4XA 3QEBZ 4FU0A 3ZZTA 3LQYA 1HE2A 4CT4B 4ZI7B 1ZQ9A 1U0NA 3ABQB 1GNPA 1LS1A 4NFHA 5TGDA 4DA6A 4F3YA 5IMBA 1YBMA 2DECA 2VSXA 1IDN1 3R3WA 3B5EA 1CJUC 4RC9A 5ICMA 1FP2A 2QX6A 2V7QA 3GGPA 2WJ3A 4PZPA 3QNMA 3SFZA 1NVMB 4LWPA 1Z28A 2IUYA 1SQ5A 1RW4A 5ICSA 1YHNA 3H4IA 4G5RA 4AUKA 4MHTA 3JWHA 5B1HA 1NRXA 1T3SA 4MLPA 4RV5A 5ARBA 2V58A 5EIXA 2FZ4A 4BX9A 4TGLA 4Q82A 5MF6A 3I2HA 5CHEA 2HJSA 2AX3A 5LOVB 3KQKA 2OGZA 1MN6A 3L06A 3Q11A 4V0SA 3SY8A 1BU8A 4N0DA 3AILA 4N5DA 1RWXA 1PEYA 3AFGA 2RH5A 2VYFA 2Q1WA 2ZSDA 2UYGA 2N1BA 2P4QA 4DY6A 1U5BA 4JD5A 4YDSA 1UC9A 2BFBB 4RQBA 5AQEA 5ESXA 2ZI5A 4ZOQI 1ESZA 3GLRA 2M98A 1IN6A 1V16A 1QB8A 4O4HB 4RD3A 4B9AA 5ARDA 4C3ZA 5IYZA 3PE4A 2B5WA 1TCAA 3ZH2A 1CDOA 3IR6A 1O9BA 4C0HA 2ZJBA 3X0DA 1SUAA 4N7RA 9MHTA 4F96A 2WTBA 3GP8A 1JHRA 2AOVA 1Y8CA 3IR5A 3F8TA 1N6KA 2W2LA 3RU3A 4LG1A 4L4UA 3EGVA 3C43A 2CE2X 3QFRA 4B6EA 3Q6MA 4DDKA 1AQJA 4G63A 4RDCA 1WBDA 4NARA 1DKLA 1H94A 4PZZA 2B78A 3WL3A 1L4GA 1IUNA 2Y77A 3KVNA 3F74A 2O8EB 4PFQA 2RGNC 1A9RA 1YFKA 3WO1A 5D2CA 2D7CA 4IDNA 2WVGA 4XDGA 3QENA 4JBXA 3KNZA 4NJEB 4YQZA 3KQMA 3LT0A 1F3LA 1L0BA 3ZJ5A 2VN8A 1NP7A 4DYHA 4X3OA 4KDRA 3HZOA 1H6AA 1SIBE 3CLTD 1BXRB 2BFEA 2BEVB 4AKEA 1CU1A 2BV3A 3DD5A 4R6WA 1DG9A 1Z08A 2B5VA 3NYWA 3QX9A 4FJ1A 1O58A 2QR2A 4I9NA 4K2AA 4J0FA 2BFFB 1GILA 2FY8A 1EFRD 4ENPA 1K6IA 1WB5A 4U7TB 2G63A 2XZTA 3OLZA 3SE7A 2RMKA 1D1SA 2IPNA 1Q92A 1Q7TA 2D1YA 2X5JO 1NOKA 1RABA 1Z6QA 2WKPA 3ASVA 3NONA 4YEDA 4MS3A 2AFHA 1XYGA 1GGKA 2R6JA 2VJBA 2UZIR 1YK0A 3HP7A 4PRYA 5TQJA 2Y27A 1KJYA 3HKCA 3Q10A 2GZSA 3UK2A 4CMIB 4EP1A 4EQ6A 4Q4CA 2JGKA 2D6FA 1JG6A 1GP2A 3BIWA 4G0ZA 4KAAA 4CT0A 3W4JA 4G24A 1T3HA 2NV2B 3CH5A 1QO7A 1FB5A 3HVJA 5JI2E 4IL5A 5K45A 4PAOA 2IS2A 3ADDA 5EP3A 2D4AA 3T94A 1WSAA 4DPMA 3URMA 4F6CA 3GLGA 1KHHA 5F1KA 3V8VA 2QPLA 3PQFA 4DLLA 4QGAA 1KJQA 5TJHA 4L08A 4DPLA 3U2QA 2H4JA 2PV0A 5CLQA 3CVUA 1RJEA 2BD0A 1ZI8A 2P9QA 2PGIA 1NR5A 2BZGA 1M1ZA 2RHWA 3INTA 3C5EA 4G5OA 5ICCA 2D5LA 2DWOA 4FYWA 4UM9D 1JI3A 4Y8VA 2R4UA 3RUFA 3P0IA 3L6UA 1Y8RB 2Q4DA 4ZRDA 4DLZA 2GWHA 2IH4A 1XRLA 2WIGA 3EZNA 1U80A 3T7RA 3ZHYA 2GJ4A 3H5VA 4UDYX 1U8EA 1UJ6A 4IIEA 3L8HA 3WBBA 1BXKA 1WHTA 2AFIE 1AT1A 1UMBB 3I01M 3WK9A 4HDOB 3NC1C 3T7AA 1GL7A 1SFRA 5BNTA 3Q9SA 2REOA 3QE4A 1I1HA 4QBKA 4TL6A 1LB1B 2HHHB 4R2XA 1MA0A 1ID8A 2OHFA 3TW4A 3N39C 5FTNA 4UUNA 3WIBA 2GJSA 3IDSA 2H8GA 4O0MA 5G4KB 2AZDA 4ITRC 5A5DA 2R68A 5JIBA 4JGGA 4KTVE 1AK9A 4QECA 4R2MA 5DGDA 2QBYB 2BTEA 2G7MC 1NM5C 3I6IA 4MQ4A 1S2OA 1XDWA 5J47A 2FZEA 2FMHA 4LZJA 5A0TA 2QSZA 4YJHB 4V0LA 1C4WA 1N2SA 3F6YA 3P19A 1ZSNA 3FSRA 2BMWA 3JD1A 4FGZA 4GG1A 3K05A 4KCGA 1SHUX 4HZIA 4WCVA 5DI3A 1A8QA 3TW0A 1PNTA 2WZCA 3I52A 1UP4A 4HLUA 3KPVA 4EHJA 2Q99A 1L4YA 2WIFA 5G0SA 3DMGA 2ERCA 1PLLA 2HMWA 2D5BA 2YHIB 5E6UB 1OX5A 1Z38A 3OM0A 4MVJI 4OLBA 3T9AA 3U4AA 1ZESA 1SG0A 1Y6RA 2AE2A 2VNKA 1Y4AE 3DEKA 3BICA 4JVOA 3E2IA 3LPAA 4PZEA 5T3UA 4N47A 2ZE5A 3LLSA 3RUEA 4L3VA 1X7HA 4IIHA 2CF6A 2WILA 3R6DA 1TE2A 4XGKA 4NYMQ 4Y2TA 3A3PA 2IDZA 5JXHA 2E3JA 5LQNA 1Q0HA 2UUOA 4M9QA 4JA0A 4TSFD 4HDKB 4WZAA 1Z16A 4PSCA 2J9ZB 3ZU3A 3DTTA 4KX3A 1O54A 3HBAA 4N8SA 3CO5A 1P9NA 1T0JB 4JSTA 4JMPA 1J9EA 4TWJA 3OQIA 3NKVA 1TLLA 5EWMB 2ZBGA 1KVUA 3RBXA 5J2TF 3LCCA 5L7YA 4MAFA 3ERCA 1JP7A 1DRJA 3QFFA 3LQKA 1OJLA 3VNAA 4ZRMA 2JIOA 4GOND 3IT2A 3HJBA 4D7AA 4E09A 1G4HA 4YRCA 4F4FA 4DWJA 2WHPB 3ZDEA 3Q40A 4V3BA 3S1AA 1K8RA 4Y98A 3OT5A 4IDPA 2YJNA 5E9JA 5A9TA 3S2UA 3ESZA 4H2DA 1CHNA 3JR7A 2CBXA 3RYFB 2FG7C 3CLUD 1NYRA 3IP5A 2J6HA 4K3VA 3REOA 5JZSA 1P62B 2JIPA 1OI7A 3B1VA 3KO8A 3RQSA 1R8YA 4GSKA 1SU4A 1ZRMA 2A0WA 1XTBA 1DLJA 2OHIA 3KSZO 4WK0B 4M54A 1JFFA 5AM0A 3UAYA 3RR2A 4NRDA 3WKCA 3H1BA 1MAHA 2O6HA 4GO1A 2X19A 2YINC 3K5PA 1BHJA 3VR0A 1E1YA 2ZCJA 3FR8A 5J63A 4DCCA 3MRTA 4OHRA 3ZZ0A 4OD0A 5B1IA 5DHTA 3HKEB 3O4VA 421PA 1U8YA 3RWMB 4I4LA 4K5QA 3I2YX 1ESNA 5HIAA 2JCBA 3FFAA 4KHZA 5BSMA 1E18A 3VR5D 1Z8NA 2G36A 1QVAA 3UW3A 4BL5A 4M0KA 1KSGA 4BFUA 5CDYA 1HT3A 1FFEA 4NY1A 1A4IA 5FAKA 1VYTA 5BYBA 4JLPA 3BXZA 3U9TA 2OZKA 3WLKX 3PSHA 1EVJA 4FJ2A 1WY5A 3DCIA 2VZ9A 4R7ZA 1CJSA 1IHOA 3MVEA 3VPSA 3P32A 2JFWA 3IJPA 3PR1A 1H2AS 2B4AA 4OHBA 4P3YA 1LBIA 1DZIA 3EMKA 4IV0A 2VZEA 2GK3A 4MK4A 3IJRA 1KMIY 2O48X 4MNTA 5BW6B 1MB0A 1GARA 4U2FA 1X1RA 2EWWA 2Y0DA 3H5OA 3OIUA 3X3HA 3NBQA 1J0AA 2PSHA 2WB4A 4CQJA 1GJRA 5CW1A 1FJ2A 4C6HA 1BHSA 2PKWA 3EZ2A 3ANTA 4HUTA 4MWEA 2PRSA 4P4SB 3BK2A 2QL5A 1NJGA 1TA4A 1U7HA 1XDBA 3S44A 1SN7A 2XHZA 1I4LD 4CM8A 4HXYA 4FFRA 2GB4A 4QGGA 3UGKA 5CLFA 4XB1A 4U5QA 5LD2C 1OFIA 4MIYA 3MPOA 2I4IA 5A5VA 4HWPA 4MUGA 4BNNA 5HGJA 1JQLB 1MDFA 1QMPA 2DR3A 4G0PA 4I9HA 4MS1B 4D45A 1MAWA 4X8OA 5LNK1 1FE8A 3OQ1A 4JK3A 1XC7A 3BXFA 1REQA 1KKLA 4R54A 1U3TA 3S3TA 1CIJA 3GUHA 3TSZA 4XUEA 1AA9A 1J1ZA 1DQPA 3GRVA 4MQFA 3BSWA 4FBMA 3LX5A 4TTVA 2ETVA 3H11B 3IA7A 5CUQA 4ZO7A 4HVLA 4N0EA 4RM2A 3WO0A 1SXJA 1USWA 1B6GA 1XOIA 1KU0A 3AUKA 5EY5B 2H29A 3RU9A 4FYVA 3ZDCA 4TTTS 2FEMA 3TXYA 4TWBA 4LTMA 4M99A 3MHPA 4X61A 3FYHA 1VA4A 3T52A 4D8WA 5BN4A 1OE0A 1I7DA 3NBKA 4Y2JA 3ZCUA 4TYWA 2W2XA 1IPHA 1YJQA 5ALIA 1Z6YA 5KEIA 3I04A 4RHYA 4JJEA 3EMVA 3GPLA 1T26A 4MQBA 4FOLA 2WYVA 3RKRA 3RO7A 3S68A 5BW5A 1TUGA 2R85A 1VYUA 1ZM4A 1K8XB 2VRCA 4MV9A 3TD2A 4DGSA 1D6JA 4MV7A 1T9GR 1GG5A 2FHPA 1V6AA 2ZE6A 5CH5A 5JS1A 3CH6A 3EGWA 4KWCA 3RB8A 1WUKS 1W0JA 2I67A 1KI4A 1HEIA 2FX5A 3AM4A 1SA0B 2L42A 3N8NA 2AFVA 4WNYA 4A92A 1NW8A 3ETCA 1GRRA 4Z4HA 3I8SA 4LZNA 1T8PA 2BFCA 2H9IA 1HORA 2JL1A 4MUAA 5LQJA 3PXXA 4Z7QB 2ZGVA 4MLCA 4NX2A 5KC9A 2ANCA 4C1BA 1VSVA 2GA8A 2O52A 1XWIA 4DSOA 1NQVA 4I36A 1LX7A 4FYMA 4PC3A 3SZUA 1QE0A 2BGNA 4V2IA 2PUJA 4EA6A 3HJHA 1P5JA 2H7CA 3ELYA 3HVRA 2VDMB 4UHHA 1I0IA 3HFGA 1T1RA 3THWB 3QJGA 4D1YA 2H52A 3NB0A 3BZBA 3E1SA 3C15C 1DBRA 2ZULA 4LXXA 2EFHB 3IAUA 3WQHA 1XALA 3ER9A 5HK8A 2ZROA 4TL9A 3RV4A 4CJXA 4Q7EA 4DQLA 3I1YA 4BQPA 4AFNA 2J32A 3CC8A 3M9XA 4M76B 3DTVA 3RRJA 4AUNA 3AR4A 4DIMA 4X1KA 1M34A 3Q9NA 1XV5A 3HU5A 3QRWA 1XD9A 4PG8A 2HJRA 3FCAA 3CLVA 2FP3A 4LHEA 2OCAA 2QLNA 2A0YA 2J3MA 4HLQB 4DLTA 4DDWA 2PE5A 2HR1A 3GNLA 3DM9B 2GCEA 2PZKA 1Q21A 4YGYA 3I73A 5F1OA 4C03A 2J4FA 1HDYA 4YMHA 1CK4A 2AJLI 4KXMA 2PL9A 2R9VA 4G9EA 4I2NA 5TMBA 3OD1A 3VR4D 3ZHRA 2BSXA 4QX6A 4FPXA 5FLKA 3LWDA 1RE0A 5T8KC 5AM2A 1BS9A 2NQTA 1H1TA 4CF7A 16PKA 1E3TA 4OB6A 1L4EA 4LXYA 4F3NA 1IN5A 1ODLA 3OPYI 3BRWA 2AUTA 3HXQA 1ZNQO 4MQEA 4PLFA 2EZ8A 4ZT2A 3MMXA 3U17A 4D4LA 2YDYA 4BBAA 2WWRA 3ZZ1A 3FFWA 5U9CA 5JDCC 1X94A 3BXPA 2XOXA 1RWMA 3OI7A 3RODA 3SLKA 1XI2A 1NC1A 2E4ZA 2ZJFA 4TV8F 4F9TA 2FCRA 2OO5C 3Q3GE 2ERXA 2ODEA 1ZM7A 3C74A 4YJFB 5AKEA 5B37A 2PTGA 4JBLA 4D0GA 4J3FA 5EUMA 5HF6A 2ZRCA 4B4DA 4BO6A 3EIEA 1XD2B 1U1EA 4FGJA 1BWPA 4RGQA 2QL6A 2ZQZA 3LYUA 3KT3A 5JLAA 1RRVA 4Q1FA 3PC8A 1PV4A 2DUUA 2BPOA 1LSOA 1W1WA 1X8JA 2M2IA 4N0MA 4V24A 5JSKA 4KAJA 3R2JA 4BB6A 3LIPA 1L7OA 3MFQA 1T2FA 3UB2A 3AF6A 4IILA 1J2YA 2O4CA 4NMWA 3SS8A 2ZTVA 3KK0A 2JJQA 3W9SA 1TCCA 3QBDA 4HAIA 1BG6A 2CUTA 4ND8A 1V71A 1YZNA 4HB3A 3VR6H 4QM7A 3LC2O 4K6KA 3ZCRA 3FOZA 3K1AB 6GPBA 3V46A 3OZWA 4H1HA 4PEVA 4ZCLA 2XXJA 5B2ZA 4M2LA 3DC2A 4YAEA 4KO2S 1QU2A 4L5AA 1ZOSA 2HHJA 3CUVA 5JS2A 3ACCA 5EP2A 5AI8A 3AF0A 1N78A 4DADA 3SVLA 5EKXA 5DM60 3A4TA 2A4KA 1XELA 2R8XA 2KI5A 3B6ZA 4R05A 4ZTBA 2AMVA 1UAAA 4QUJA 4L0QA 2CHQA 13PKA 1CNFA 2OV6A 3HP1A 1CUSA 1PUJA 4QFCA 1U5AA 1UXIA 4PBTA 2ZXEA 4UFNA 4Y1GA 4LOHA 3F7MA 3SQLA 1T34A 1W5BA 1ELOA 1PLKA 1YCDA 4W63A 5ALJA 4BP1A 4ZK2A 2I3ZA 2I33A 1EWTA 4YHBA 3O38A 2C31A 3R4VA 2BJVA 5JMTA 5DZSA 1YDMA 1JHUA 2CY0A 2IIPA 4AL4A 4BVKA 3PX7A 1V2GA 1ZOIA 2QM8A 1Z82A 3AEQA 4K81B 4TQ9A 3DDCA 5C8ZA 2CLHB 4HEA6 1UODA 3DMHA 3QI2A 1XRJA 3PRJA 4JYMA 1AUPA 2VP9A 1UCFA 3R24A 1PIWA 2E55A 5ESDA 5DF1A 5BQ5A 2QYTA 1G19A 2FRVA 3ABSB 3ANLA 2HF7A 2MOKA 2NQ2C 1GSIA 3FF4A 4LJ9A 4ZKEA 4F2GA 1SBYA 5FBZA 4BNDA 1Z0UA 3GT0A 4RLSA 3ECCA 4G2NA 3FDZA 4A8TA 3SBEA 4HQLA 5CFNA 1SK9A 4M7RA 5K0TA 4OUDB 4NCIA 1QDUA 2C84A 3OEEA 3WGJA 5J4VA 1WQ4A 3ZJVA 4W8HA 2IYAA 3AX6A 4YCJA 1RYBA 5BR4A 3E27A 1CY6A 3Q8WA 5DHUA 3BUSA 1RLMA 1CUYA 3N2KB 3FVVA 1DIBA 1YI8A 2HV8A 3ZS8A 5IJ0B 3OHMA 2AE1A 4LJ7A 3NG1A 1UC5B 4M7OA 4YAOA 3RNLA 2I7XA 4LVOA 1R0XA 4A23A 3TLMA 4NS1A 3QG1A 2X58A 2QRHA 4AECA 1U7WA 2ZANA 1RJFA 3NW9A 1N7IA 1DXOA 4OSPA 2A1UA 4TXJA 2XMZA 4R7TA 4LF9B 5FOUA 1XO1A 1DKQA 1OTYA 5EE5B 4OMFG 1IH8A 2J9FB 5GV8A 1UJ4A 4B73A 1BX0A 2P4SA 2PK3A 3ORYA 4BQRA 4I4TF 2OB2A 4AROA 1Z56C 3EIQA 3OJCA 4UMDA 1EGVB 3CUKA 3W2TA 4CCYA 5E6SA 4CEHA 2AWOA 1UT8A 2JCXA 3CVOA 5KJCA 1I0LA 3CUTA 1QFMA 4G1EB 3NALA 3KZMA 4OBEA 4HP8A 3CNLA 5TS3A 3WSVA 1A97A 3P2YA 4KC0A 4FK8A 1L4KA 2ORED 4H4CA 4HNTA 5T4EA 2HSEA 3NP7A 2HH9A 1Z6AA 3ADCA 1Z5UA 4J0JA 3SHQA 3LX6A 2IXTA 2WWYA 1N8SA 2IZ7A 5TVKA 1PL6A 4FDVA 3I2FA 4QPNA 5EPEA 5L3QB 1G16A 4ZICA 4TZ0A 2ECQA 3GCZA 1PTJC 1RKBA 1E9SA 2E5WA 3ILXA 1V95A 1QPGA 4WLVA 4F7DA 3P9CA 1E4EB 1I7LA 5L6LB 1J7KA 1S8OA 4NULA 4YRTA 1P3Y1 3VZDA 2HJVA 2OLJA 1XDSA 3FVRA 4ZTUB 1FLVA 5FX2A 2QI9F 4GZLA 1V1RB 3PQ3A 2FLKA 5DM4A 2F9LA 3INYA 5LBIA 1ONPA 2OV8A 3D6NB 4CIBA 3H9QA 4KNWA 1MHTA 1ULHA 4LISA 3L6DA 1HETA 1B0ZA 2VBCA 1MIOA 1ZGJA 1VE6A 2WOOA 3D9QX 1HEUA 1X7WA 1YBVA 4XFKA 1QYVA 3QUBA 2CJXA 5IT9A 4H60A 1L5MA 2HN9A 2PH3A 2W6OA 1E2IA 1HZZC 3H2GA 4WEQA 3BEDA 2W8BA 4CM5A 3O8OB 1SBQA 5FRDA 1UZUA 1N9ZA 2RIRA 1SRQA 3OJEA 5FUWA 2YHBA 5GOZA 1WCWA 1UXKA 1B8VA 3C8ZA 3G2KA 4QHSA 1FNDA 3TR6A 2IPMA 3LKBA 2LGJA 3DPIA 3F5DA 1VMDA 3GJTA 3IP3A 3KEFA 3LL7A 4NF2A 3QWHA 1K2VN 3UAGA 4RZ2A 4G5FA 2GT1A 2ZWOA 3UB3A 1X74A 7GPBA 5L4NA 3QOFA 3COZA 3D7RA 3AHIA 1I3OA 3HCFA 3E9MA 1PJ4A 3NNSA 1VLZA 5DP2A 4MCHA 1ST3A 2ZS9A 3JAWB 2H2AA 2QLFA 3U3OA 1CZNA 3BL5A 4CL8A 5CB4A 5JQGF 3BMNA 4FWTA 2J1LA 2HHCA 2KPOA 1JQJC 1RVV1 2DHQA 4ZFNA 4CV2A 3L04A 2BMEA 3FYUC 5K0GA 4G9GA 5JO0A 3BJMA 3E5RA 1RZVA 2PH1A 4L5JA 5F3DA 3I09A 3GNSA 2GN1A 3U13A 3WDLA 4BV9A 2EWVA 3H1PA 3T7SA 5IHXA 5LD2B 4ABTA 3B78A 2IIBA 3K8QA 1JBEA 3LX4A 3COSA 4IXMA 4DCNA 1JLSA 2VYVA 5C52B 3VHRA 3UCFA 4E1VA 2CWWA 3EZLA 1VDMA 4NQZA 4OIFA 1JA0A 3RFUA 4CU5A 5LMNB 5KNBD 2WG2A 3AY3A 4GSLA 4Q19A 2OXFA 4NOKA 4O2LA 4AMUA 3TXAA 2QKYA 3NDBB 1M7BA 1C14A 3P2MA 1P6QA 2C8VA 5F5LA 3USZA 3ZE6A 4E21A 1KR2A 3VC2A 1NZDA 2JJMA 6PFKA 4G65A 3NZEA 1EBUA 4TMWA 4EGJA 3M3PA 3CE6A 3GLFB 5IW8A 3WKDA 2HT6A 4RM3A 5FI0B 5JH7A 1R4ZA 2YWDA 4PYJA 4MCIA 4O3FA 3ZE2B 2PUCA 4RDXA 2VXBA 3T9EA 3PHJA 1T9KA 3GEDA 2Q6VA 4NS4A 5F3RA 1LNSA 4HYTA 2BR5A 2FX3A 1D7OA 1LF5A 4PLYA 2FQXA 2K2QB 3NFYA 5DBFA 4BZQA 2WI8A 4CFSA 4DAOA 5A9SB 2HSWA 4B7ZA 2CVOA 4P2GA 1VKOA 3O4HA 4KQ2A 2I4TA 3PNMA 2DWCA 3WNCA 3ZHCA 4EL5A 2NVOA 2OHHA 1MT0A 2AUMA 2EJUA 1CY8A 4CG2A 1KFBB 1RBQA 4CTOA 4M1YA 1RQXA 2FN4A 3TG2A 9LDTA 4ZCTA 1GGNA 2XMGA 1LK0A 1XSEA 4P35A 4LC1A 4S05A 2H5IA 3TTUA 5KTTA 3NHRA 2GN0A 2QRGA 3KT0A 4Q9JA 4AKSA 4V0ME 1U9IC 3PNYA 1X77A 4AG6A 3PICA 4HQ0A 1NKTA 2HXSA 1LVGA 2XADA 1ZICA 2PYDA 5GWXA 4IQFA 3DQZA 2PL1A 2ZIVB 4A2WA 2UXDB 1ZITA 3DMNA 3UBTA 4LQDA 4NG5A 4BFVA 4HK4A 1Y9DA 2W48A 4C0JA 4XUCA 3RNOA 2I4LA 4QXPA 1ZIOA 3UNXA 4ZDIA 2ETXA 4J16A 3TGPA 1PL7A 3VR2D 4N82A 4RK1A 5SZKB 4YRMA 3WGOA 4QOIA 1W0CA 2KM1A 3TLZA 3HSSA 2IU6A 1D1TA 3RS0A 1VYVA 3NH6A 1U94A 2I62A 5KUTA 1N77A 4JV5B 1AMOA 3FWYA 4WUVA 1V9SA 2WR8A 3IXMA 4NBRA 4UUBA 3TLKA 4W5WA 1P1BA 1NJ1A 3UH1A 4OGWA 1WUYA 1JLMA 3O91A 2JEOA 1VBNA 4JB8A 5EXSA 1IM2A 5DNYB 4BFWA 1RQRA 2R1ZA 1OJ7A 3REFA 5A1TA 3ESAA 4DQVA 1CY7A 2ASVA 4IJ6A 3OT1A 3TOVA 4L15A 4X7BA 4MDEA 3N0VA 3I9V6 2DBRA 4XIYA 5KOIA 3CKLA 1U1DA 4PG4A 3I9MA 1JSZA 4YJKA 1YF3A 3RS2A 4F5ZA 1G20A 3K0AB 3K72B 4NBLA 5AW6A 3E84A 2HLPA 3AJDA 1BKYA 3HKDA 3RT1A 3LRXA 1WMEA 2ZTMA 3AY0A 5D5PA 1CUBA 1PN3A 4QXOA 5D87A 5B53A 5K0NA 4BNJA 2E1RA 2RGBA 1JG1A 3AUSA 4B3TB 1P1CA 2Q3EA 1L7EA 1G9SA 5JWRA 3FHJA 3QUSA 3RUPA 4LOAA 2ZU0C 3U4QA 2YDXA 4YMGA 3MBIA 1E5XA 1T1SA 1B26A 3AINA 3KFXA 1A9SA 5KYWB 3A6ZA 4G1UC 1AS2A 3OEHD 1SK8A 2R8RA 1C80A 4RABA 4JB3A 4S24A 3E3OA 3TCXB 2UV8A 3PQ2A 2OCYC 2AG8A 3H6GA 4Q6WA 1YFZA 1SUPA 1GNVA 2FFHA 1S2MA 2OT3B 3A14A 1A8HA 2KE5A 2WYHA 5ALLA 4DHEA 1IQ0A 1N0IA 5E8RA 5CB0A 1UIMA 1UBKS 1MHPA 1ZH0A 1QC5B 2FUG1 4IHKA 4NMXB 1LKZA 3U9SA 2JIBA 2BM0A 1LVU