4CF6A

Crystal structure of the complex of the p187s variant of human nad(p) h:quinone oxidoreductase with cibacron blue at 2.7 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLESQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Collapse of the Native Structure by a Single Amino Acid Exchange in Human Nad(P)H:Quinone Oxidoreductase (Nqo1).
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cf6A00
3UXHA 4ESEA 3N3AC 1CZNA 2Q62A 2V5UA 4S24A 1T5BA 5LJIA 4XDGA 3NHSA 1XT6A 3F6SA 2MWMA 5NLLA 1CZHA 1AMOA 3FNIA 1TIKA 3NHPA 3W77A 1CZLA 3OX2A 1FLVA 5BUCA 4BMOB 1D03A 2OHHA 4HEQA 4H6PA 3B6JA 3B6KA 2QX6A 3NHLA 3HR4A 1KBOA 3RPEA 2V9CA 1QR2A 4NLLA 4YQEA 3SVLA 4C14A 1RLIA 1YCFA 1AKTA 3G5MA 5LBUA 2A5LA 4ZVKA 2QMYA 1XYYA 3EDOA 4GI5A 3UXEA 3OJWA 4YALA 4PTZA 1E5DA 3HLYA 1FX1A 1T0IA 2HNAA 3NFRA 3U7IA 1DXQA 2QR2A 1D04A 1AKWA 1YCHA 3B6MA 4PU0A 4CETA 5B3LA 2FLVA 3NHFA 3OWXA 2W5UA 2QMZA 3OVMA 3K1YA 3S2YA 2QX9A 1AG9A 5ULLA 2Z98A 1BVYF 4XDHA 5FA6A 1FLNA 3ESYA 1X77A 1RTTA 3O2NA 1H66A 5A4KA 3TE7A 4U7GA 3F2VA 1TLLA 2FZVA 1H69A 5LBTA 3NHRA 3W79A 1WSWA 3EYWA 2BN4A 1OBVA 2OHJA 4U7FA 1QHEA 4GQIA 1YKGA 4ZVNA 2X2OA 4N65A 4PTYA 4QODA 2QWXA 4QOHA 1RLJA 1AZLA 2X2PA 2AMJA 3OX1A 3ESXA 4M0CA 3LT5A 1ZWKA 4QOIA 2ZKIA 4D02A 2RG1A 4CF6A 2D5IA 2FCRA 1QBGA 5LJLA 2ARKA 4C0WA 1DXOA 1ZWLA 5TGZA 4ICIA 1YRHA 4YAFA 2FX2A 2FAXA 5NULA 4NULA 3GAMA 1RCFA 2FDXA 3FVWA 4DIKA 4BMPB 1B1CA 1FLAA 1V4BA 1BU5A 1F4PA 3QFCA 2BF4A 3TZBA 4DILA 2QX8A 1C7FA 3KLBA 4LTNA 1YDGA 1KBQA 3OWHA 4N9QA 4QOJA 3NHKA 2OHIA 1WSBA 3KEGA 2MT9A 1VMEA 3FX2A 1AHNA 3W7AA 5LVAA 3QFRA 4FGJA 3FJOA 4J8PA 3NHUA 3LCMA 2R96A 5F12A 3ESZA 1FUEA 4FX2A 3TEMA 1GG5A 1QRDA 2N1MA 2F1OA 5EA2A 3W78A 3QE2A 4U7HA 3GFQA 3NHJA 2M6SA 1AKQA 5LMCA 3GFSA 3FW1A 3N3BC 4OXXA 3F6RA 3B6IA 1ZX1A 4FGKA 4QOEA 4QOGA 1J8QA 2OYSA 4FGLA 4DY4A 4Y9UA 2FVXA 4ZVMA 2GSWA 1AKUA 1FTGA 1FVXA 1CZOA 4Y9RA 2FOXA 4YAWA 5F4BA 2MOKA 3ES9A 2BPOA 5B3KA 3N39C 3KAPA 3K20A 3ZHOA 3OX3A 4R81A 2Z9BA 1J9ZA 2Z9CA 5LLDA 2Z9DA 2QX4A 4H2DA 3D7NA 3O73A 4Y7CA 4LTDA 3HA2A 4C0XA 3L9WA 1XYVA 1I1OA 1J9GA 1AKRA 2XODA 3KAQA 4LAFA 4C76A 2XOEA 4YAUA 2B3DA 3OJXA 2BMVA 4ZVLA 5F51A 4N82A 1D4AA 1NNI1 4LTMA 2FZ5A 3P0RA 1DX9A 2HNBA 5EMNA 4YAOA 5FUQA 1FLDA 1JA0A 3U7RA 2MTBA 3NHWA 3GFRA 5EAIA 4QOFA 2M6RA 4LA4A 3JSXA 5JROA 2HPVA 1AKVA 2WC1A 1XI2A 1JA1A 1YCGA 1YOBA 3NHYA 4F8YA 2KQUA 4GR9A 2BZSA 1OFVA 4HS4A 2R97A 1J9EA 2Q9UA 3NLLA 1CZRA 3R6WA 1SG0A 3L9XA 3F90A 1CZKA 2V5VA 1CZUA 1C7EA 5FX2A 1OBOA 6NULA 1SQSA 2KLBA
chains in the Genus database with same CATH superfamily
2JCXA 1AK9A 3HVJA 1R6BX 1CZNA 1P29A 2V5UA 2XIQA 3ABRB 1S7GA 3T7KA 2EXXA 2ACKA 4ZHQF 1PD0A 1ZOPA 5A9SA 5AK6A 2GXSA 1I5RA 5FOTA 1WPRA 3V2GA 5KYXA 3B51X 2B69A 1UBCA 2O59A 4OHOA 2O8BA 1BH2A 1F06A 3TJMA 4EX7A 1ZCZA 2GX6A 5F76A 3HYNA 4H3KB 2C4HA 4F3NA 1NNLA 1UJ4A 3NBXX 3NHPA 3OD1A 2A9VA 2G0NA 3PUKA 2Q4TA 3VDXA 4BVHA 1DOAA 1PJ4A 1SOVA 2HB6A 3BGVA 3BL5A 3P9PA 5CT9A 3TRJA 5I6DA 1FXWF 5HKLA 1O9GA 4F1KA 3T1TA 5BUCA 1O77A 3O4HA 3H5NA 3AGPA 4Y2VA 8ADHA 1KFBB 4TSKA 2QRKA 4H6XA 4JFAA 4QUKA 4CLOB 2UYHA 4O4JA 1NVTA 1E4OA 1TZMA 4HUQB 2QY6A 5BXQC 2O6HA 5JAHA 1WNTA 5FI1B 4ZN6A 4D42A 4Q12A 4HAXA 1G2PA 3S3TA 1JEYB 5AVKA 621PA 2AUTA 3NYRA 4B32A 4DSZA 3WG9A 3UW3A 1M75A 1GA6A 1NRXA 1EG7A 1GEGA 1SC1A 3A3YA 3AHGA 3DH0A 1XE3A 3L92A 4QRHA 1H5UA 1VDZA 1NR1A 3AUJB 3UZUA 3WGNA 5IVIA 3WP1B 1XRSB 2WAOA 1RLTA 3U09A 3OZ7A 1WB5A 2PZGA 4INAA 1EZ4A 1C9NA 4LV6A 1WEHA 3JQ8A 4R6XA 3FI0A 1JI3A 1U2DC 5IZ4A 2QTBA 1D2RA 4J0HA 2WSSD 3FDZA 1T4MA 5IWCA 1OH7A 2QRQA 3EBPA 2OMEA 4JUIA 1J0CA 2I7CA 3PQ3A 5GP1A 4BNYA 2Q3LA 4XSVA 2WY2D 3KWFA 4QO7A 4JGGA 3SQWA 3MAAC 4IDHA 1E9VA 1N2HA 4CCSA 5HK8A 3I28A 4H9GA 4RHCA 6CHYA 1WSAA 3WMWA 4ZT6A 1KZYC 3PE4A 1ZONA 3NCTA 4CIXA 4AJ9A 5AJZA 2ZR9A 4S05A 4BMYA 3R3HA 1Z12A 1E5DA 4WADA 3NDJA 4RNCA 2QVGA 3KKOA 5HSGA 3D5QA 3P0JA 4DCGA 3R0IA 3NKLA 3K9CA 4UNSA 5LYYA 5U1PA 1J49A 1US8B 2DQSA 3VMFA 1NXVA 4QG7A 5ALLA 4YUYA 3GDWA 5AKLA 3HHPA 4IHKA 1SFRA 2FFRA 5BOVA 3SR3A 1D04A 2PS9A 3JQDA 4KV7A 1YS4A 3E23A 4MRNA 4L50A 1AKWA 2OFPA 2AOVA 1LU9A 5LKAA 2OBYA 4Z7QB 1P60A 1GKIA 1XTPA 3EG9B 4IMPA 1AQYA 1SQ0A 4RETA 5HIIA 5JISA 3FTNA 3C1AA 1XWWA 4BX9A 2UXDB 3GNQA 3W8FA 3HY4A 5LDHA 3C74A 1XVUA 2GI4A 3NIGB 4YYEA 3HN7A 3MJSA 4WOPA 1I9CA 2YWDA 1TA4A 2K4MA 2R25B 4G0WA 3EXG2 4C7OB 1EP3B 2Y2UA 3P9RA 2MSWA 3LUGA 4ITVA 2X8JA 4UVGA 3RKRA 5JXGA 4M0DA 3B1KA 2JIZA 1W85A 1Y1QA 2RGUA 5I47A 1HE2A 2FLWA 4KV9A 2XWPA 4LECA 2SICE 4IYRA 4E2YA 1GKUB 3I6MA 5E1BA 4J4BA 1KMHB 2I4IA 2E21A 1RWMA 2HHHB 4J0CA 2GWRA 3R3VA 3BFVA 3GZNA 3CSUA 2HUPA 2Z4SA 3DMGA 3GD7A 3H4VA 4H16A 3RTDA 3T94A 4AP5A 4TTIA 3G89A 1EJ0A 3TQCA 1KSHA 5EINA 4BQOA 1U2SA 2HF2A 2FSGA 1ONBA 1O6GA 2OV1A 1DOHA 3JALB 3RJMA 3N2IA 2VJMA 1MJGM 1SZCA 2OBFA 5FT9A 1BRTA 2EW8A 3PPIA 1FEZA 5HRCA 1XD8A 1ZJ6A 1YT5A 4IIJB 4UUOA 4JT8A 3RK1A 4M1TA 3EZ9A 3WK7A 5EE5B 3CNNA 2BGUA 3AESA 3G1WA 3O2NA 2FZKA 4TQAA 1OH6A 3I01A 4MRSA 5FV7A 4JOBA 2W0MA 3GMTA 3KRTA 3UKOA 4OM7A 1CETA 1GLGA 2ZREA 4JT4A 4R9VA 1NFRA 1VHWA 4IEEA 5JS2A 5JC1A 2APJA 1T0JB 4Z3OA 1VJCA 5FEMA 3MTIA 4HSGA 3IDOA 1XTKA 2HI0A 1W93A 4UHKA 3EUAA 4W7IA 3NHAA 2QN2A 3VFDA 2GRJA 3WGYA 4XVQA 1YI0A 3AV3A 5IAGA 1F6DA 1L7VC 4CG1A 5C4IA 4FM9A 5BW4A 5BSRA 3F3MA 5C9ZA 1N34B 4AK9A 4BJ6A 1TO1E 4D74A 3L43A 3RAPR 1Z29A 1VLVA 2WQ6A 3G0OA 4O3FA 3HFRA 3RS7A 4FZ3A 2P7IA 4FFOA 3WBFA 1HYBA 2A0YA 2Z2JA 3URMA 3ZK8A 2QRHA 1SCBA 4O2BF 5K8TA 4YO7A 3T0IA 1M0SA 2ID7A 3KR2A 3NIDB 3T9DA 1KH2A 5BMVF 2XRZA 1X7WB 1L5WA 1Y3HA 4C07A 2PANA 3FFWA 2JAHA 5DX1A 1YV9A 2WSYB 3VO9A 1NUQA 3FOWA 4QGSA 4V2UA 5FTJA 4HLUA 3GVXA 4OBEA 1ORWA 2NU6B 2FG7C 4NYMR 2NO9A 5MGNA 1G8SA 2IVZA 1DXYA 4BPRA 4RBNA 1UAAA 1CF9A 4QOHA 5LZ8A 4E5NA 3N58A 3RVBA 3PNQA 4FTWA 3H1BA 4GD3Q 3ER8A 4B73A 2EC5A 3ESBA 3PSHA 3V97A 3GUYA 3RHFA 1JIQA 1FXSA 3CF0A 5JQWA 1GR0A 4Y2HA 2AVDA 3N05A 4P3XA 4YP7A 1ZWKA 1XA0A 2LIPA 4HLNA 3WY9A 2X5NA 4QU5A 2QR3A 2R6GA 1BVRA 4MUBA 2XKKA 2J0UB 3DO8A 5TV2A 4MQ6A 3V8PA 4DCNA 5BNWA 1SURA 4XDZA 2CHFA 4YPFA 2NQ8A 2NZUG 3BXOA 3LC7O 1ODIA 4RMNA 1NG9A 4KFSA 2RGDA 4RTRA 4M8LA 2ZJ4A 5L7YA 2XH8A 1PGJA 2BJHA 1QBGA 3IP9A 2AFHE 4M1KA 5ITVA 1A77A 1RXCA 1V7PC 1LPPA 4K87A 3VJKA 2I66A 3RK0A 5KYTA 3RWMB 3MZ0A 3BEOA 4UU7A 1DMRA 4S12A 3X1KA 2VHZA 3W5CA 5TVGA 2ODPA 1SZJG 1BMQA 5H16A 3OE1A 3C15C 4HUQA 5LQDA 3I4FA 2WK1A 3M5WA 3LLCA 2FWRA 5ED0A 5BP7A 3TGLA 3GDFA 3WAKA 2DPMA 1EU1A 1QH8B 1XZEA 4BLUA 1JEYA 5GGXA 4U2KA 5AUNB 1A8UA 1Q1EA 2OO7A 1JGTA 2HWKA 1U4SA 1YZKA 4O4IB 2DVMA 3OLWA 6Q21A 4FZ5A 1GRNA 3IP7A 4CKEB 1BE1A 4DDTA 1PZEA 3EVEA 3N6VA 2JJ1A 1A5TA 1NBMD 4TLMB 4UBMA 1B73A 2X1HA 5CLGA 4P98A 1IZ7A 1D0IA 1JAXA 2ZAGA 1EQAA 4M1YA 4UHCA 5IASA 3AUYA 5A7HA 2A4MA 4DJDC 1K5DA 4I0WB 3QQPA 4J0JA 1CEYA 4AP9A 3QLEA 1HY3A 2ZRBA 2VA8A 5L95A 1Q44A 2RGYA 1YB1A 2DBZA 2P3LA 3DSRA 3KO8A 4EW1A 3OTOB 3A05A 3R9XB 4DLAA 2NUAB 3GRUA 3WYNA 1KZHA 4XGQA 1KRHA 1Z74A 1DZIA 3QNMA 4JBXA 4U4AA 4TQ9A 4QEDA 4GMHA 4R54A 1MDFA 2IW1A 5F78A 5B2FA 3L4JA 2YNMA 2Y77A 1XEXB 3AERB 3FA2A 3K5IA 4TTJA 4YCJA 3T52A 2GA8A 3TOVA 5J4KA 5F98A 1JDJA 5CRIA 1YS7A 1CC1S 3QHQA 1US8A 2CXPA 3HKBB 2BEKA 2VDJA 4LXQA 2W42A 1BZYA 4QUGA 2P5YA 4ES6A 4JGIA 3B1VA 1V47A 2DTEA 5H83A 1TF7A 3M5CA 1E7YA 3C6KA 3PHJA 3ZWXA 5KTOA 2I6TA 3ZCUA 2R96A 3WKCA 1H0HA 3EG9A 5SYMA 3WK5A 5IUJC 5G0VA 5DOZA 3FNGA 2WQZA 3ZU2A 1I3OA 2AHOA 2R48A 3I34X 4CYMA 3OJCA 3C7DB 3FMOB 4R2HA 4WGFA 4EVSA 1EK6A 1PT6A 3TCKA 5HNKA 2VSNA 1OXVA 1CULC 4YFYA 2Q6OA 3SIWA 3N28A 4C7OA 1GCUA 2BI4A 2HFJA 2IF0A 3C14C 3CZCA 3HSSA 2V58A 4LYYA 2NU9B 2VSQA 3GJ7A 3KD2A 4KK3A 3KIPA 3ZHZA 3GP8A 2DWUA 2WTAA 2JLZA 2UYGA 1W581 1YR8A 1ACLA 1OBFO 1T36A 1DEHA 3R41A 1ESEA 1ZJZA 3DKRA 4J16A 4GWKA 4TS3A 4Q9NA 4B6SA 1KMHA 2NWQA 3DTNA 4F96A 4PLZA 5KQPA 4X45A 2JLUA 4YMLA 1HF3A 1JNXX 1KC3A 1S9DA 1G6Q1 2VXYA 1FSGA 2QORA 3DAHA 4PYNA 4GUAA 5HFNA 3O8NA 5BQPA 3RE1A 3F2IA 1H3FA 1YVEI 3JALA 4EHKA 4DV4B 2JKZA 3U60B 3B6EA 5AOCA 5I5GA 1V25A 4P58A 4TM8A 4IIJA 3Q12A 5JY1A 1R37A 1WUIS 2FMTA 1DGQA 1IH8A 4HLUC 1KYTA 2BGMA 3DBOB 4YCBA 2YIVX 4WEQA 3PD7A 2FVXA 5IXYA 1WIWA 3FPSA 3TW8B 1DIAA 2B34A 2XQJA 4FOOA 4TUYB 3TCXB 2X15A 1ODJA 4RVHA 4IDPA 4DE5A 1P77A 1YHZA 2FPRA 3FYDA 1ZGAA 3S2SA 2ZYTX 4GMKA 4R3WA 5F4BA 5K0ZA 2QPAA 1C8VB 4RVOA 1V37A 5CAEB 2BPOA 3F6BX 2WABA 2ALJA 4KRYA 3SEQA 2O19A 3B3FA 4B40A 3AQ4A 2GF0A 3N39C 1HX7A 3ZHCA 1YZYA 3BE4A 1NR7A 3SSNA 4FILA 1PWHA 3HVUA 4LOLA 4C6RA 1I33A 4XYBA 4FP9A 2DY1A 4HS9A 1BMTA 4LG1A 4BNMA 4NQZA 3AW8A 2MIIA 2LR0A 5CVUA 3T7IA 4BCCA 2G17A 1CNFA 1Z6TA 2J3MA 1N1DA 2A9OA 5F1PA 4L9WA 1X7WA 3ANTA 4XW2A 5LQKA 4C0XA 1JYSA 3DV0B 5AVVA 5CDFE 4R83A 5C1PA 4FJ1A 3N8NA 4GDMA 2QN6A 4QYXA 1A7KA 3F6PA 4D82A 3H7AA 2NU6A 4R68A 2LBPA 5HILA 3ZUPA 2QA5A 3JZFA 1W46A 4L02A 3KSRA 1ADBA 2GEJA 2QPOA 5L3SB 1MCZA 3QVOA 4OFWA 1OAKA 4R01A 1R4NB 2PX3A 1L3BA 4UVIA 4YT5A 4BEVA 1EI9A 1AY0A 2RG7A 2WWTA 4A0HA 5CMLA 2XTZA 4TMTA 1U6IA 1QVAA 5ALYA 1CQJB 4YX9A 2J9XB 3LXUX 4FPXA 2P1ZA 5AW1A 3BWCA 4MGYR 2HRZA 2QTLA 3IBGA 5AVYA 4UBNA 2WT8A 3VKUA 1D4AA 3W6NA 4E5DA 2QRLA 2BTEA 2VYND 2J0UA 2QXTA 4RPKA 4EDHA 2AUMA 1EB9A 4IX9A 1PNRA 3I5YA 3U48A 4MRAA 3X1XA 5ICMA 1T8SA 4OCZA 2O2EA 1GNVA 3O6VA 4L3OA 1Q14A 3E4CA 4YAOA 2WTUA 4QDKA 2VQ6A 4JMLA 3IAEA 3ROZA 2Z30A 3RNOA 3OE5A 4UMVA 2IJGX 1OGIA 2P9JA 4G89A 3F7TA 3SEFA 4MUIA 4EARA 3NIWA 3RRNA 4KG7A 1VJ5A 4BLQA 4RU1A 1AGXA 4WVLA 4DSUA 1FF9A 4YNBA 4E1VA 4CL2A 4GKAA 1YKFA 4PWYA 1K98A 4FHEA 4TMKA 2XZPA 1U0OC 3RRMA 1QH8A 2JH8A 1GTL1 2QN7A 3CUWA 5JROA 2FJ0A 2BF7A 2HPVA 1KC1A 1XI2A 4O4IA 4PVCA 1E3EA 2WSLA 3D1JA 4IQ0A 4CKEA 5LFAA 4NAHA 1Z8DA 3I58A 4PS1A 2F8MA 1G3UA 4EG8A 2V7GA 1QGDA 1DKMA 1OFVA 1M2VB 3PQ2A 3ZX5A 3W6PA 1E69A 4WK4B 1JG6A 1J0XO 2ZJ5A 5JCXA 2C94A 1NDUA 4OHFA 3EXFB 5GONB 4BNXA 1JIVA 3TW4A 1AXGA 4PG6A 1J9EA 1LV7A 3NVMB 4PN7A 1OFIA 1E98A 4LJ8A 2QP3A 1VKOA 2YZMA 5E1MA 2YVQA 2PAAA 4S1TA 3ZDYB 1WG8A 1G5RA 2XQGA 4OI2A 4Q7JB 4A23A 5JAZA 3R9XA 5KU7A 3TZQA 3N8DA 7MHTA 6LDHA 5INTA 2NUAA 4G85A 1CUWA 2IYRA 1I10A 2FPKA 2HQOA 2PMWB 3DNFA 4J16C 4OMCA 5FX2A 3DMFA 3KZCA 4QDZA 2PY6A 1OBOA 6NULA 2IYQA 1IQ0A 1XEXA 3AERA 2BWJA 5JTUA 3IERA 4U2CA 2WFZA 1D6MA 1ZNYA 1YJQA 1ND5A 2AQIA 2ZWAA 3MQ4A 1ZC3A 2OO5A 4GC9A 4WCFB 5A3SA 5FUMA 1LH0A 1UWLA 1GSHA 2J09A 2N46A 2C57A 2XUAA 3HKBA 3OCUA 4GPEA 5C34B 4IV0A 4B6PA 2V6IA 1QLJA 1YZHA 5JJKA 1KWGA 2JFWA 3QBVA 2VQ3A 4KTTE 3V48A 3MTEA 2JGDB 4IIXA 1U3TA 4GF5A 2L42A 4GI7A 2EBFX 3CH7A 3WA6A 3KZKA 1L1FA 2HR1A 2J33A 3PR1A 1Y5IA 3H11B 1VRVA 1BWQA 1Q7BA 1LFAA 1DE0A 4K28A 1OXTA 5AXBA 4N48A 4NDAA 5TGTA 3F9RA 3RRZA 3UAOA 3DCNA 4I36A 3IV9A 3JQQA 1T5TA 4N49A 1U5BB 2V7BA 1KY2A 3KXPA 4LF8B 1UL1X 1EK5A 3TTTA 1ORDA 3AVPA 3VYUB 2HT6A 2NU9A 3EPKA 2O3SA 4JYAB 1E9EA 3E3NA 1L7AA 1XTBA 2CVQA 3L7CA 2Z6VA 1FS4A 4OU5A 3NBUA 5EKDA 1X15A 4H6PA 4OBXA 4OIMA 3RDPA 4DFDA 2DH6A 1WOMA 1XXLA 4BS9A 3ASYA 1COZA 5AQEA 1AGYA 1BFKA 1Z07A 3HR4A 3VPGA 3TEFA 3IT2A 3ENZA 4O3MA 4KPYA 4FNMA 2YWJA 4RDCA 2SKCA 3FWNA 4KGXA 4MW2A 1CJTC 1TXGA 3DZCA 1E7SA 4L51A 3C6QA 4GMDA 4BO1A 2AN5A 3UPTA 1XNHA 1LJ8A 2VP9A 2YHIB 4FMCB 1BE8A 3ZGNA 2VPPA 3EXIB 1N1GA 2WOJA 1GLNA 2DE0X 4PM4A 3MJHA 2CN1A 3SC3A 1UBFA 1YONA 4TUYA 2DBVO 4WJKB 4Q9JA 4N5HX 4BEWA 4R71A 2FHSA 4R16A 2C2KA 3UJ9A 3HMQA 2M1XA 1CUVA 1E3JA 1PGOA 2D2FA 3G5MA 3HH8A 5FKJA 5AHXA 2XB4A 1N4DA 3BK7A 3HP4A 4B6EA 2QMEA 3Q87B 5BNTA 5CAEA 1HTWA 2QVXX 4F4JA 5ESDA 4E2WA 1QGYA 1E1CB 2QTGA 4QNRA 2RHDA 4H7PA 1XP8A 3BGDA 3ZY6A 2V6FA 1FPQA 2H1FA 1B8OA 4IIYA 4M9UA 2HNAA 3AIKA 2YJNA 3H1TA 4H7JA 2A84A 3V4PB 4AN1A 4D8XA 5F3RA 2R60A 3DM5A 1PK9A 2XF2A 3AR9A 1EVQA 1XAGA 1WOYA 4AD8A 1BJTA 2VN8A 1NONA 1W34A 2W83A 1U2ZA 2XQIA 3AR4A 1K8YB 4GP7A 4JK3A 4QYWA 2GHRA 2CF6A 3GYGA 2ATIA 2J48A 2ZSIA 3E58A 1SWWA 3DZIA 1YJAA 4BFWA 3DV0A 3MNFA 4L78A 3TH5A 2HA4A 2C8KA 3CLTD 4GSLA 3SBDA 3TLGA 1DEXA 2QLTA 5JJIA 1SC4A 3C24A 4U7WA 2C3UA 1JIIA 3VPDA 3ZWMA 2RCNA 2O8VA 4CF5A 1TFUA 4MWEA 2QW8A 3C3MA 3HB9A 2GBCA 5JSUA 1FJHA 1A5SB 1R4NA 2ZYSA 3BHNA 3UGQA 5ALJA 1E4YA 3S2YA 4C29A 5I7UA 2JG3A 5LQRA 1WS6A 1JMYA 1KFCB 2HUNA 1TJYA 5CX1B 4FB4A 3TG2A 4HOYA 1CQJA 4REOA 2J0SA 2E55A 3K4HA 2G8NA 1R5NA 1N5JA 3MHPA 3KKQA 3VHLB 4D0RA 5FA6A 1OB2A 1MLDA 2AZXA 3V00A 1U8UA 5FR1A 1VIYA 2A1TR 2O7RA 5IC6A 3V2UA 3PDCA 3KALA 4MV8A 4ZO4A 1ZN2A 3G6WA 3KZ1E 4JJ6A 1TUEA 3OEHA 2R6CA 3ORQA 2GPNA 1HDIA 1FVFA 2H0RA 3DBVO 4KFRA 3HBFA 2XB2A 2P4HX 3UWSA 2ENUA 3QYAA 4RLFA 1MA3A 1I1NA 2BHTA 4E30A 4M8NE 2HPAA 2DECA 2VZ0A 4S35A 1L5LA 4IINA 4HVLA 4RHXA 1N5MA 3QHAA 5CK4A 2OO5C 4YRDA 1QR6A 4QZVA 1CBUA 3OFNA 3T9AA 3FTEA 3KB6A 5DNCA 4U8HA 2ZBDA 3KCQA 1JKIA 1I0ZA 5CLQA 1JRLA 4X71A 3ZN2A 5C8ZA 4QGFA 5AHRA 5K0BA 5M04A 4C4OA 1VLMA 1FVOA 1NF9A 3E3OA 2QTNA 2WU8A 2CW5A 3KQVA 3UMFA 3JWIA 2YW2A 3AUXA 4Z7NB 5DNYB 2QG9A 4HAVA 2H52A 2QPLA 4W5JA 1M2VA 5F1KA 3ZQ6A 3R75A 4CR6A 1THZA 4KQ6A 1CUHA 3STVA 2R7NA 4MH0R 2H0QA 4L08A 3NC1C 3EXFA 5GONA 1ZJ5A 4ER0A 2OVBA 3DGFC 2IZZA 2R9VA 4OK5A 4EW2A 3DLTA 2XUGA 3LHDA 4TLCA 5B6JA 1C50A 1ODKA 4JXKA 1SBNE 2OFWA 3EIOA 4MYSA 3LT0A 4KYVA 1G3QA 3OOYA 1DB3A 5ALZA 3NONA 1DCTA 4MOWA 1AMUA 3ZY2A 1RM0A 5JOQA 1ZJJA 3MFYA 4G0OA 2FWBA 4AC9A 4MKFA 1T25A 3LT1A 5D3QA 1R6XA 5BYJA 4F1JA 1PJ3A 2H16A 4OFXA 4UTPA 1LSOA 4QHYA 3R8FA 1PX2A 1NQOA 1Y3CE 2EP7A 3UV3A 3NTRA 4PSAA 4ZI3A 4WCFA 3GC6A 4E14A 3CRMA 5CB4F 1UDBA 1QYRA 3M6AA 4G4SO 1AH2A 5AIAA 4ZPXA 2X6QA 4JX9A 2OAGA 2JGDA 3PBKA 4FR2A 5FQOA 1U0NA 2RKWA 4PHCA 3BBLA 3RRXA 4EI9A 2JL1A 3MILA 5EZYB 1M1NB 3H11A 2BFDB 3RFXA 1ZY2A 3S4YA 1U2PA 4Z4CA 4B83A 3DF9A 3PYMA 2ORIA 3BK2A 1ZK3A 2XYVA 1ZOIA 2PZAA 5AI4A 3CNQS 1U5BA 4M9CA 1KKLA 5ANRB 3EFBA 4LHXA 5ITZB 4INPA 2ARKA 3RIHA 1PU2A 3T4PA 4A15A 2WT4A 4R8KA 4NCIA 4ICIA 4KE9A 3TK1A 4DV3B 1T8PA 3EZ2A 4DS3A 3IB6A 2R0QC 3LH5A 4ZGGA 5AW2A 5KSYA 3CBGA 1G8MA 3KDSE 4Y1GA 3U0BA 3HLTA 1XNQB 4YREA 3OTWA 2IXDA 2E37A 4RSMA 2X4IA 3IDAA 4QAQA 4LOKA 3GP5A 2YFHA 1QKIA 2HRRA 4Q19A 4N8SA 3OEEA 5AI0A 3S2GA 1JWLA 3UBTA 4NS1A 1YB4A 2G0TA 4F0JA 1A88A 1YD7A 1UBSB 1A9ZA 2OG2A 5K1ZA 1I6LA 3E82A 2HEIA 1QGZA 2YHIA 2VH2A 5EMKA 3BFKA 1IN6A 2ZUSA 1MQAA 1Z17A 1F4PA 1EEHA 1HT2E 3EXIA 5BURA 4WW0A 2I4RA 3CUSA 3ASUA 4KWHA 4B6OA 4RQTA 5KWIA 2FHPA 2VT3A 2WTBA 1Z4IA 1SVIA 4MUNA 5T7BA 1XQ1A 1C7FA 3FYCA 4L2IB 1EUQA 3MCUA 3AONB 1W44A 3CZMA 4QDTA 2QMOA 3RU9A 3WNVA 1HDEA 1YDGA 4L5IA 4PRYA 1JHQA 3RVSA 4Z4QA 1PW5A 3QOWA 4H7IA 4EHJA 1E1CA 3EODA 1QVRA 3PIDA 2PO7A 3AM4A 1HMYA 3Q3EA 1PKEA 3NNSA 1G8JA 2D13A 2OHIA 3QUTA 1FMJA 1FQKA 5IDWA 4PLFA 3AI1A 1PJCA 3EHEA 3KL4A 4LZLA 1Q2UA 4MV5A 4BN5A 1INLA 1KHHA 3W5DA 4YLGA 3AP3A 4N3CA 4HRAA 3HRHA 1KVSA 3I37X 2Q6VA 2JCGA 4MUMA 2A7QA 4NYIR 4PC7A 1STOA 4O2AB 4QUJA 1E96A 4B3IA 5AK0A 1JDPA 4J8PA 5TT0A 1IM2A 1PUIA 4Z99A 1GAEO 4GC5A 5CIQA 1ZMBA 3I52A 3IVXA 5F12A 1A7AA 1T10A 5HM8A 3ESZA 4FX2A 1HYGA 1XPJA 3ZNPA 1RMTA 3AG6A 1G6OA 4MHOA 1ARZA 4QELA 2AOXA 1L8LA 3A1EA 3DPUA 1M72A 1UM8A 3DP7A 3HRKA 4NKRA 5DBOA 5F5XA 4EG0A 2HCFA 5C8YF 2KJQA 4JWTA 2F1OA 1ZA1A 1G0OA 3SJBA 4UTVA 2OD7A 3GJSA 3MRVA 3RWBA 2RI6A 1A50B 4YA6A 3KNZA 1V96A 4C0BA 3PNMA 1QMPA 1YDEA 5BQOA 3RTEA 4DV1B 5CX1A 4URXR 2XT0A 3QOXA 3B2EA 4FB5A 3BCSA 4EZEA 1T5HX 2RFLA 2VKTA 5TB5A 1YS2X 4OXXA 5YASA 5ES4B 2FKNA 1R9JA 3DB1A 4FCVA 5TVKA 3GF4A 3W9UA 5JAIA 3AJEA 4ZMRA 2AD5A 2H3EA 4B71A 3JVIA 2CZCA 3CCCA 2WICA 3AEKB 1X38A 3ELBA 1I1QB 1C3EA 2JZOA 1DLJA 1OX5A 3AKDA 4C5BA 4EW3A 1SCKA 2J1LA 4DDVA 1A4RA 2FWNA 2EKLA 5AJVB 2GJ8A 5DISB 4ZCLA 3BXEA 1WLYA 1RR6A 3A3OA 1DJNA 1A76A 1YE5A 1JAIA 1E79A 2LD4A 3BAZA 1C8BA 3FZQA 3BAFA 2JLBA 4XI9A 4B81A 1V48A 4R5MA 3EZ7A 4CEJB 5JZOA 1U0FA 3O8LA 4NX2A 3A2KA 1FDRA 3D4LA 4WCFC 2ZBRA 4J94A 4DBZA 1SK9A 3R7DA 1GRVA 1XZNA 2GZ1A 3BJEA 3EFEA 4A36A 2WF8A 1Z4MA 2COEA 3JQEA 4UEKA 2RHHA 2XUDA 2YIJA 2OGTA 4QUHA 3X3HA 3CH5A 4BNUA 3LO5A 1VI5A 4HL6A 3JCZA 1FRVA 1L7OA 1VE9A 1NFQA 1SZDA 2HCTA 2VDUE 1OQAA 4RK0A 2VHJA 5JCJA 5IM4F 1AUXA 2ON6A 3SG0A 2Z5LA 4N7BA 1WZCA 5FFMA 4ML3A 3F78A 3ST7A 3K96A 1QB8A 4Q9KA 3PNBA 2BP7B 1BXKA 3CUVA 4NOJA 4W63A 5DYIA 3ZR4B 4ZFNA 3H87A 1JP7A 4XGIA 4F2GA 3TRKA 1YVDA 3GUVA 4X3CA 1UT6A 1NWCA 2QD5A 2YZKA 3R3JA 3EZYA 4HDNB 2WT9A 4LHWA 4NFHA 3KAQA 1ZN9A 3MJRA 1JB1A 3D2LA 3SQNA 1B23P 4Q7KA 3NKFA 1FYEA 3IJ5A 4ZAYA 2AEMA 1MABB 2QQGA 3C5HA 3CFYA 3QP9A 4G2NA 1IN8A 1KO4A 3G68A 4J2HA 5D3KA 4DLZA 5IDXA 4LY0A 1G21B 1JEAA 1YA6A 2NO4A 2IC5A 3M6IA 1J0EA 1ZM9A 1YS9A 2PL9A 4I4CA 4LXXA 4FFMA 3OM1A 3BD8A 2QHXA 2YWGA 2IY7A 1XZ8A 2O2GA 4UEQA 2Q8NA 5CB8A 3ZTTA 3W6UA 1HNZB 1J0BA 3PHIA 4GRIA 1VHTA 1V26A 2DKOA 3VOAA 3MBKA 4HK4A 4JZKA 1Z6GA 1M1NA 3EMVA 3MFQA 2BFDA 5EZYA 4WFIA 3X0DA 3CPHA 4EFKA 1OH5A 2ONZA 4B4VA 5CW2A 1JJIA 3N8GA 3WIBA 2B8WA 2HNBA 2W0SA 5HCNA 4CV3A 1U3FA 4B3DA 5IK2D 1Z2DA 2ISSD 4GWGA 5GMOA 5HHTA 1YMQA 5ITZA 2ZM6B 1JPUA 1JU4A 4N0EA 4BTLA 1T3SA 2XVXA 3HO8A 4ZODA 4UBOA 5HS6A 2IZ6A 5SZIA 3WDMA 2BEWA 2D7JA 3MBOA 3O1HB 4JIMA 2MTBA 4XGNA 5D01A 3ZIAA 1BH6A 4KODA 1TCVA 1GUDA 5JHHB 3PI6A 2PUVA 1YE8A 1Q1AA 4LX0A 1SC9A 3NVDA 5JSFA 1CP2A 4UHJA 4IIHA 5AD1A 3ZJ4A 3RTAA 3H1EA 3TKAA 2RBKA 5BT9A 3P0HA 3K1JA 4WXYB 4P4NA 3MJTA 2VUSA 4ZO6A 3GPCA 1R1DA 1MVLA 2DFLA 4WKOA 5AMXA 1TUGA 1J2JA 3GT0A 3IUBA 3JVUA 1TTQB 1VYTA 1KZ4A 1XWFA 1N7JA 1UFQA 3UQZA 3W34A 4UOEA 4ENQA 3TRHA 4R1QA 2ECPA 2GEBA 2Q1WA 3BIJA 1XL1A 2O1WA 3GGJA 2IVFA 4NWIA 3X1JA 2ZKLA 1PQ4A 1K8QA 1SQGA 3AVOA 3O8QB 1IEQA 4JELA 3R6WA 1EDBA 2PMFA 1CUJA 1UM9B 2FA9A 1L2TA 2YRFA 3EHDA 3ILXA 2FWMX 4GSYA 1BW9B 4L2IA 2BFBB 5C4GB 2BFAA 4UTRA 5FBHA 5F2KA 2FEMA 2AOUB 2ZZKA 4NV0A 4IJ6A 2VSOA 2I29A 5LA6F 3ITDA 4FFPA 4ZRNA 1BU8A 3NEJA 4A8JC 2AJTA 1Z63A 1R9MA 4ZMBA 3E9RA 3GLFE 3LUKA 5IJAA 4CIDA 2GA9A 1ORRA 1NP7A 3UXHA 1RXWA 1QV9A 4CMJA 2Y1EA 2PWYA 1K8ZB 1ECGA 3MWYW 3X2FA 5IPFA 1I3CA 4AKSA 3JYOA 4HVTA 1T9DA 1E1RA 3EUWA 1HM5A 3FPGA 4IQFA 4O2AA 5BSGA 1PQPA 3F6SA 1OVGA 4RPLA 5F9MA 5DGTA 2G4CA 2MMCA 1YSCA 4GYJA 5JNVA 1LNZA 2RGAA 2WE7A 3UFBA 4ZV4A 2GNPA 5DWVA 5AKIA 1KVQA 4I4LA 1PRYA 2RAUA 2H59A 4BNGA 1J0AA 4BE9A 4YMVA 2NG1A 2IEBA 3ZZ0A 1DKOA 1QYCA 1QIFA 3D6JA 1CZLA 2GPAA 2MSKA 3OX2A 2F4VB 3CV3A 2IIQA 1TIBA 1MG5A 1RWOA 2GLXA 3X2SA 1CUFA 1W0JA 1Z5PA 1AT1A 3DJFA 1P9RA 2Q9CA 4J1SA 5EE1A 1RRFA 1ZHFA 2D3TA 5DK6A 4HNUA 1Z13A 2YC2C 1LF0A 3IP5A 3WHIA 3OF5A 4ZQGA 2BD0A 1YO6A 4L4RA 1RACA 3VVMA 3OOWA 2PIAA 2PSJA 3O26A 3RROA 3EMBA 3WL5A 3AHFA 1RRKA 1L5GB 4G97A 3PEYA 1T0BA 2GN2A 1ZEMA 2PLNA 3CX7A 4A6XA 4AZ3B 5BSFA 2ZTUA 3S2UA 5TMPA 2NVUB 3DP9A 2H1HA 5KPDA 4XVUA 4P36A 3AF0A 2XCOA 4GW3A 1C4KA 2V9CA 4KBFA 2SHKA 3AEKA 1H2ZA 2A0UA 5FO0A 4IZ6A 2JZCA 3IT1A 1XZBA 3L8YA 4YJHB 3RS5A 4XVCA 2NZVG 3GL9A 3IXQA 3FUWA 1WU7A 2I1WA 4A91A 4C14A 5IANA 3OCVA 5IRCD 3OLVA 1L9KA 5KTPA 2B7LA 1CIVA 2OCPA 3Q6NA 5AJXA 1N6OA 4YP1A 1P1FA 4XWKA 4PZPA 4IOKA 4U3JB 2RSLA 4X91A 4UQOA 1JHYA 2RKOA 1QVWA 4JLKA 4OL0A 4CEJA 4NNJA 2W6PA 3RRYA 2L18A 4I50F 4ZYTA 2IFTA 3K5PA 4IMRA 1NULA 4L5AA 3UJHA 5DN6A 2C58A 3OMLA 4D99A 1D2CA 2ZS9A 5HIMA 5LUAA 4E03A 2QYOA 3BN3A 2SKEA 4LV8B 4X20B 3OZWA 4B75A 4S1PA 1LBIA 3TL3A 1VE3A 3B7WA 4DANA 4PTZA 1PFVA 4FSDA 3WLQA 1KPGA 3HDJA 4CQMD 1SUFA 1P0QA 1G2IA 2O2IA 5H4GA 2BSQA 3AR3A 3L41A 4KQMA 3QFTA 1IVYA 3QJ5A 2IEIA 2OUKA 2YV1A 3JQPA 3IO3A 4WXRA 1ISRA 2P2NA 2QR2A 1Z75A 1IOWA 3TGWA 4LSMA 3AU9A 4A6PA 2BP7A 5I48A 4FMBB 3W3AD 1P5FA 1AB6A 4NJEB 2DR0A 4WWHA 1AQLA 4C7XA 1FMLA 2OZEA 4LWPA 2YYZA 4Z86A 4Q01A 3FR8A 2FG6C 3CMMA 1X3LA 2EP5A 4HDNA 3DZJA 2DX7A 3JYQA 4J0EA 4PU0A 4WLEA 4ETNA 2YV2A 1CHDA 1GPYA 2PZ8A 3AQIA 4CETA 2WFLB 4ZEXA 2P9EA 3N0XA 1MABA 1YL6A 1XP5A 5BQFA 5CFNA 1ZIDA 1EMDA 3NO4A 3Q1KA 2ECQA 4PNEA 4LVUA 1G21A 1GNRA 4TT8A 1GGJA 4JYZA 1N32B 2BM9A 2QX9A 2XE8A 4WGGA 2VO1A 3REQB 5CHEA 2P5SA 4R0VA 4F56A 4KDEA 1UEIA 1E3TA 2VHYA 4U39A 3BGIA 4ESHA 3ONNA 4H1HA 5C32A 1A1SA 1G5IA 4EP1A 4QFBA 1GO2A 1DIRA 1K63A 1I2CA 1U8CB 3GLRA 4C88A 1NRJB 3RB8A 5MN6A 4TYYA 1D2EA 1JFFB 1CERA 2VDWB 4YT8A 5K3EA 1KU0A 2EATA 3IAM1 3A4IA 1BS2A 1PLKA 2HSJA 3FSJX 3L6OO 4HCJA 1PHRA 2DSNA 3CXUA 1E66A 1C7QA 3TRFA 1TYZA 1C4WA 3QA3E 2WRZA 2ZE6A 1RABA 4Q1BA 3ORYA 2IZ7A 2Y6VA 1HDOA 3CX4A 3PQ4A 4UUMA 4UDXX 2D1TA 2XDWA 2ASVA 2DU8A 2C3PA 2QLNA 4FS8A 4GU5A 1DWOA 2PXAA 3OPQA 4FZRA 1SQ5A 5BORA 2AXNA 5JS1A 3KJHA 2AK2A 2HDOA 5F7ZA 2Q3JA 1V9CA 2WJAA 2KMLA 3KZVA 1X1QA 1TQ6A 3AI2A 1FSFA 4IXTA 4BEJA 4D97A 3PX2A 3LRPA 3O1LA 2G9NA 5JNWA 1HEIA 1QGAA 1Q15A 4PO8A 1DADA 4M1OA 3OY7A 1DC8A 1FFBA 2QZ4A 3I73A 3COWA 1JR3D 2VJDA 2IOYA 4FKZA 3MCWA 4IDAA 5FF9A 5AXAA 4D3YA 4DNQA 3JR3A 2QW1A 3GRAA 1ZH4A 3NORA 4A8HA 4QL3A 4HMOA 1OBVA 1PWXA 1BDJA 1L4BA 3Q6IA 3DE4X 2AMVA 4IDEA 3L49A 4NCAA 4DNOA 3Q8MA 1WLSA 4C3UA 3KCNA 3O8QA 2AF4C 4OKSA 3DWEX 5EWJB 2PUAA 2BRUA 1UM9A 4PG4A 2O8FB 2GXAA 1BW9A 5AP9A 2DWCA 4EFDA 1NY5A 3ORFA 2QP9X 5E9QA 2F8SA 2AOUA 3K6KA 3VR4A 4B6RA 2C2MA 4PTYA 4ARBA 2JKYA 4TMVA 4D92A 4YRIA 1YBHA 1WVMA 4O8CA 2JD0A 3H3XA 1E18A 1S6YA 2GOYA 4HY3A 3R5JA 3RS3A 2H17A 2FEWB 3OQPA 2CLHB 5I7SA 2IH4A 4HH4A 4RK7A 4JFRA 4FFBB 4NU6A 3NXKA 4MP8A 7AT1A 2GCOB 5DB4A 3TBFA 4A10A 5FOQA 5BUQA 3OF2A 1EUCB 4BFSA 4DAEA 4IGKA 1HE8B 3SS8A 4AICA 1IBSA 5CU7A 1IRXA 1XAHA 3K4PA 5CH8A 1K0FA 1QS0B 1XZLA 3OQOA 4GGMX 3CT4A 1WXDA 2ZKIA 3VKGA 3LWNA 2RG1A 1CY6A 3MLAA 1E7WA 1WU8A 3ELWA 4FW9A 2EDCA 3I3OA 7MDHA 1SHUX 2FPSA 3AI7A 1K9VF 1NRWA 1ZU4A 2QQ0A 4CFZA 4JI0B 3I45A 1I7PA 4BZXA 3DBHA 1HEYA 2XNJA 2VG8A 2NOAA 2RGRA 2VNSA 2EF1A 4QFMA 4JY7A 1AGNA 4KJXA 4EQZA 4EUFA 3O8CA 2YIMA 3U1BA 5CPBA 2XNSA 5C31A 5CVCA 2CLFB 4XJTA 1FFDA 2PKRA 3ML1A 5H9VA 4ZDKA 5ICSA 2IUEA 3WGTA 4AMGA 1X1CA 1PBTA 4CJXA 4QUDA 2NP6A 4GEGA 4MV3A 1DUVG 5SYAA 5IFLA 2X1MA 3OWOA 1Z6AA 1PBNA 5AW7A 3DMNA 4A82A 2PV7A 2J3DA 3WAJA 5EJMA 2OORA 2RE8A 4D8TA 4AZ3A 1V45E 2NVUA 1DEOA 1FP6A 1N2ZA 2FDXA 2UYQA 5I9SA 4BWGA 2FF5A 4ZANA 4BFUA 2VKQA 3DOFA 1JE0A 3DVQX 3QUSA 3MYRA 4NHEA 4JI4B 4KXNA 2DPHA 3R40A 2VPYA 1KWKA 4YJHA 1V4BA 4YRAA 1EXWA 1PR1A 3OU2A 3IAS1 2UVPB 2FJPA 4I2VA 3U19A 4HNSA 1LPOA 2IDKA 1H1TA 4O2RA 4U3JA 2G70A 1YCDA 3KOXA 4AX4A 1YRYE 3QPUA 1MD9A 1E6LA 2JVJA 5KDDA 2A5FA 2FSVA 1PQYA 4LTNA 3WNZA 1RXEA 5FTKA 5A3JA 3QPAA 1R3DA 1VGVA 2I87A 3DCIA 4HB4A 4IXWA 5DTQA 4KWCA 5J2TB 3CKLA 3NANA 4X20A 3CLSC 3ZGVA 5AVWA 3H9EO 2EWWA 3GXBA 1RAGA 1RRMA 3OQJA 1KORA 4E0BA 2FK8A 5HKKA 2A86A 4MI1A 1G21E 4M76B 4X1OA 4C6TA 5JS8A 4NJOA 3FFTA 2KPOA 4KQFA 2X2FA 4J2TA 5H59A 2I2DA 4BHTA 4BP8A 1DCKA 1ZI6A 3BCUA 2UZAA 4KK4A 4UCWA 1GGNA 4P32A 5AM3A 4M0LA 5P21A 1U0LA 2BUAA 3ZDAA 2MYPA 1ZSYA 4ZZ1A 2BAGA 2GEKA 3OZUA 1KIFA 2HZ7A 3P96A 2Q4BA 3EC1A 2K2QB 2W11A 1D3AA 4NJEA 1FDVA 5ECWA 1JT9A 4L57A 3GN2A 1OVMA 3D3WB 4BJHB 4D9EA 2H1IA 2P41A 2HA2A 4GVLA 2IA5A 2J3KA 2ZUCA 3U4CA 3UK7A 1I3KA 4D25A 4RENA 4G1BA 2WFLA 1L6IA 3LSYA 3PQDA 4UKDA 2JCBA 2IPAB 1AQJA 4O33A 2X0EA 1K6MA 2VRCD 1T26A 4H7DA 3REQA 1LX6A 4G1MB 2JBAB 1TPZA 4MEAA 1J42A 4F6RA 3I2GA 3LPMA 1PR4A 2OV4A 4JDUA 4BN0A 2HDHA 3K0HA 3RAFC 4LHVA 1Y4DE 3TSYA 4MW5A 2WTXA 1HNWB 1JFFA 2IT1A 2VDWA 2VF7A 3B6IA 3CH4B 3FHOA 4OQEA 5DNEA 4QXRA 5CFZA 4G37A 4H59A 4RIFA 2BRUC 2O7SA 2CSUA 2V74B 1Y1LA 5D8DA 5BYBA 2IW3A 4ZQEA 5H81A 3SVZA 4JJ7A 5P8WA 4M22A 3ME5A 1HDYA 1EWYA 1QC5B 1SUBA 2CNWD 2SBTA 1MB4A 3ASZA 3I0ZA 5A0VA 4HPXB 2XZOA 1WMEA 2FPOA 3GPIA 3MGBA 4G5XA 5CJJA 4AFNA 2G77B 5BSEA 1Q19A 4M53A 4ZIRB 1C7IA 1B6RA 3HXLA 2RH4A 3KHSA 4Y9RA 4DSOA 3ZXIA 1Q84A 4UM9B 4TL9A 1CP3A 2I2CA 5SZKB 1IHXA 3CPEA 1UINA 3LGAA 1Y5NA 1SVKA 3RYTC 1W6RA 2OP1A 2GB4A 3K35A 5FH9A 2PGLA 3KBOA 1XDDA 5IX8A 5LP1A 1U04A 3FPLA 1MJNA 1Y6QA 3MIZA 1E7MA 4RV9A 4B7CA 5KNDD 2DFVA 3C3PA 5M7EA 4ABYA 3A28A 5TXGA 3SJZA 5JO0A 4XIFA 1J22A 3WWDA 1Q22A 1O9HA 1J9ZA 2B94A 2NTEA 2Z9CA 3K16A 2IWHA 5EFOA 5BSKA 2R8OA 1VLZA 2W98A 4IGIA 3PHGA 3D6HA 1TL7C 1E8NA 3SHQA 3K0EA 3I39X 4I5GA 5EWJA 1L7XA 1DC5A 4WVFA 3DAOA 2GDZA 1R4ZA 3HA2A 3BTUA 2O8FA 1PGQA 1O6BA 2QSZA 2IPOA 2CXXA 1EFDN 2QD1A 1WBBA 4KRFA 1IAQA 1VSVA 4ZPJA 3ABSB 2ZRMA 4I5IA 4TWAA 4BJ1A 4MV1A 1CY0A 4KPEC 1DX4A 1IEVA 2B3DA 3KE8A 2HHCA 4HEA6 5CLLA 5A3VA 3FSGA 1EP1B 2PZEA 1NUHA 2OORC 5AI8A 2RHBA 4RJTA 3WIOA 4XJSA 5EZQA 4FFBA 2XCIA 3D7SA 3KR1A 3PSAA 1DARA 2GCOA 5I3CA 3DBRB 4R6WA 4YQZA 2X6RA 4XE5A 1AHHA 1NNSA 2OK8A 1EUCA 1RRPA 1SXJD 4OXNA 1FNSA 2JIOA 2XE6A 1M2WA 4I5EA 4KJZA 4GX2A 4NICA 3KHKA 1QS0A 3FN4A 4U1RA 2H29A 3WB0A 1QYVA 3SEZA 3WGLA 3ESQA 3ZJUA 3GMSA 4DIFA 4BNLA 1FZQA 2ETXA 1PWEA 2CLSA 2ZRNA 4FHDA 4H0FA 4Z3DA 3AF5A 2W6CX 4KAJA 2OXIA 2D74A 3O0TA 1BN7A 2FSVC 1KTVA 3M6XA 1H4QA 3PJGA 2AUNA 2RK3A 3V2HA 3AZPA 1QDLB 3KSBC 1ECFA 3NASA 2GRAA 4C0LA 2Z2ZA 2DLCX 3CG0A 1KK3A 2YDYA 1XLUA 5LNK1 1HFWA 2C07A 2PJZA 3BSSA 3HBMA 4QNMA 3U7RA 1CYDA 3WVNA 1SGWA 1B16A 4KL8S 4QTTB 4DLPA 3HKEB 2JDID 2WU3A 3A1DA 4EPWA 3ABIA 4G5YA 3H4MA 3L7JA 2OOSA 5EUQB 3UA3A 4BV8A 4DVGA 3L1KA 4XCQA 1T6BY 2IYLD 3FAZA 4RD1A 3UGTA 2I91A 3FY4A 1YR1A 3NHYA 1GU0A 1OXUA 4G07A 1CUZA 4F04A 1TAHA 1XIVA 4DR5B 4E6EA 4TN5A 2IELA 3L4BA 3V8QA 2VQSA 3K8QA 3D64A 2RD2A 3DFZA 1E1YA 1GVNB 2NYUA 1T3TA 3A6GA 3IDQA 1XJ5A 1ZQ9A 1RE1A 3FKQA 4DIUA 3H2IA 4N3NA 3NIFB 5K9ZA 3T7CA 2UVPA 5DHPA 1DJLA 2N9UA 2FRVA 4RY2A 4YBRA 5KVQA 3IFSA 3MS7A 2GN0A 1IL0A 1AVTA 1Z4QA 1K9SA 3KR0A 3L9XA 5I8WA 3GEEA 1KR2A 2QRZA 4HEHA 5CVJA 1C1YA 2EZ9A 3DMHA 1Z4JA 4E12A 1WE2A 2P2CA 5ALOA 5HGXA 4A2QA 5J2TA 1NXPA 1WB6A 3A4NA 1FRFS 4HVAA 1I01A 4HB2A 3ZXYA 3CWZA 2HDNB 4I8IA 1P2DA 1G5FA 4RD6A 4JLVA 4MI6A 2ZS8A 1KDRA 2JVKA 5EMHA 2JLXA 4D79A 5AUQA 1M9NA 3D3EA 5KNCD 2BMJA 1LCIA 3TECE 3IOMA 1DINA 4KSBA 1ENYA 4HAZA 1T5OA 1O08A 3G0CA 4ZXPA 1E0JA 3RWOA 5EIAA 1XDZA 1FU4A 5COAA 4LVOA 5K0NA 5F9HA 1ZKDA 2OV6A 2ZI4A 5EP3A 1DIBA 3C8ZA 2XNDA 4NTZA 3BBPA 1TZBA 3D3WA 4E2FA 1WUYA 4M89A 3W5BA 3G9TA 3WTCA 3BWYA 3H8SA 4HQLA 4K6FA 1WAMA 3BG5A 2ZPAA 3PUYA 3A4LA 1T0UA 2Y6UA 5LKRA 2QTZA 3AEQB 1KR5A 3F97A 1ZH8A 4BMOB 3N8HA 3TOXA 2ACVA 3T7AA 1OR8A 2XOKD 3V7NA 2BMFA 1EK1A 3AM5A 5HF6A 2R4QA 2FQXA 2Z2YA 2J9ZB 2RAVA 3HBJA 2CFOA 2JBAA 4OK3A 3CLRD 1QG2A 1HQYE 1LSSA 3RFUA 4QEKA 3H9GA 3VH1A 1U9IA 3D8HA 1V7ZA 3MB8A 1Y4AE 1YZTA 4FUQA 2JAWA 4INOA 4IXDA 1QO7A 2QTWB 3C97A 4DLBA 4F6LA 4NBLA 3P2EA 1UFOA 4CM6A 3P97A 3I2JA 4DARA 3ERCA 1HLGA 1SCIA 4IHAA 1M2JA 4IX1A 2YICA 4GKBA 3V34A 2QUBA 4O02B 3EVBA 2CXQA 4UULA 4WERA 1Z2AA 1ZXXA 1YA4A 3I6YA 1FOEB 3INYA 3W5HA 5CD9A 2FXVA 2A88A 4OQDA 1QC5A 4FFLA 2JBWA 2PG3A 4IIEA 3ZNNA 2G09A 2OSVA 3BGWA 1B42A 1MXFA 2OHOA 1ZK1A 1LSUA 1SG6A 3E9CA 3IO5A 3JATB 3JTEA 5DHTA 4EDFA 4ZIRA 5LU8A 3G6KA 3KOMA 1LRJA 4B46A 4W5NA 3KLOA 3DMTA 4GO1A 1XNJA 4LI3X 5PGMA 3M6WA 2C5SA 4NH0A 1QB7A 5JNRA 2QMYA 3EYAA 4O4JF 1BO6A 1XYYA 3E15A 2IOQA 4EY4A 4ND7A 4C7KA 3EDOA 3AL0C 1NW3A 2OL4A 4AWAA 1F60A 2AN1A 3KOWA 3EXHB 5KREA 4O1MA 1JQJC 1GSAA 5DSTA 6AT1A 1GLVA 3I0NA 3SC2B 5KTSA 3NUGA 4DLXA 5B1EA 4ZYYA 1UBKS 2W6JA 4KE6A 5G0TA 2J3QA 1UEJA 1VG9B 1P9OA 4UDNA 2ZM5A 3ZHXA 3FXAA 2GLUA 4FGSA 1ZN7A 2H4FA 2PJDA 4DCUA 4TWZA 4YBZA 2OUIA 4G1EB 3P1JA 4MV6A 1VHDA 2OCYC 2F00A 2QDXA 2ZPUA 3D8TA 5EWLB 4ZCIA 3PCXA 4Y6SA 2VTBB 2JFVA 4XYLA 4QVIA 1FUKA 4CN8A 1T1SA 1Y9ZA 1JBQA 1ECCA 3WV5A 1U1GA 1B26A 3HI6A 1N25A 3FB4A 3MINB 4GPIB 4WLOA 2Z0MA 4BNIA 5DGCA 3KJFA 1TMYA 3I9V1 1VMIA 1H9CA 2Z09A 1RM5A 4TGLA 3AP1A 3OPMA 3EEQA 1EGMB 4P80A 5K7SA 4TX1A 3VNUA 1JG2A 2GZSA 5DI3B 2Q2QA 1EK0A 1XAJA 3C4VA 4HAUA 4KR9A 1EVEA 3OVMA 1BKYA 1PF7E 1Y6JA 3EZXA 1NMSA 1HE4A 5D7BA 2XT6A 3OOJA 4PG5A 4HHEA 2II6A 3L4BC 1X87A 1MOPA 2ZYAA 1L8AA 3DBRA 4CW7A 5C46F 3L8HA 1Z28A 2X9NA 2YW9A 2XUHA 3L8DA 3HP1A 2IBSA 1Z82A 1X80B 3ZZ1A 4AJIA 3VO8A 3SLGA 3CGGA 4Z3KA 1VPVA 1Z4OA 2F3RA 4GOJA 4Y98A 3A4VA 1S1CA 4GZ6A 2BR5A 3WBBA 7ADHA 2P9BA 1KPHA 1KJYA 4O4LB 2GCGA 2ZAMA 3T54A 4MUKA 3AH8A 4CI9A 1XZAA 4QDXA 1M2FA 3PQ8A 3P2OA 1JEQB 1XRJA 2QXUA 4PY2A 3N87A 4TM7A 2XMGA 4RXUA 1LQTA 4OHZA 2NZ2A 2AN9A 4G4SP 3V4OA 4D3DA 4D4IA 3ADOA 3ZE9A 1UZAA 3WHKA 3C39A 3E1GA 3HKEA 2J6IA 4B7UA 2UVDA 3HXOA 4L73A 4BNJA 1O0BA 2PUFA 3FNRA 3DAYA 5DHRA 2BGKA 5CFPA 1L5QA 1FS6A 2C5FA 3CR7A 1L4LA 3TMAA 5LBTA 4TWJA 1T9HA 4WY5A 1JR6A 5FUWA 2P8JA 3H99A 3PDUA 4KUHA 1Z0SA 1LDGA 1YVRA 2FX5A 3BIFA 3D6FA 3KX2A 4J49A 1CRZA 2GGSA 4K9MA 3DVSX 4X1KB 3ZBUA 4D45A 3H6KA 3HYCA 4B4UA 5THQA 1RYBA 4DIDA 1R4MB 4IWYA 4LXIA 1ORIA 5JCPA 1XDUA 1K3FA 2YVUA 2FTKE 3EIWA 5KYNA 1OTYA 3QW2A 1NJ2A 2GEVA 5G3YA 1CUIA 5HJ2A 2W4IA 3CWQA 3RABA 3AKZA 3I6QA 4PAWA 4KLNA 3BRSA 4GWLA 1E92A 4U2BA 2J4FA 4OSPA 2HF8A 1YXMA 2VYVA 1Z45A 3JQCA 1U9IC 2JPDA 2RGBA 3PC6A 5FLKA 4AS3A 3HVRA 3ITEA 4KYUA 1UADA 2OAQ1 5LQNA 2HMWA 3ET5A 2PH1A 2ZI5A 1V16B 5KTTA 1TK9A 3HA7A 2BM0A 3HP7A 1TKRA 1FSSA 2I2FA 4QQFA 5FYDA 4GR4A 2M98A 1E2FA 5F9FA 1R5BA 4IKOA 4ITRC 2VH5R 2W6ZA 3U7EB 3PNSA 4J7CA 4EVRA 3D4BA 1DT3A 3OZBA 1HDGO 3T5MA 1TB4A 1OX4A 2C78A 3K2IA 2L17A 1TX4B 2ID4A 2JASA 3T3IA 2CUKA 5MFZA 3TIGA 5JCZA 5JLJA 4GL2A 3ZTWA 3QX7A 5AOAA 5AUPB 3DMTC 3QKSB 1KF0A 5ESWA 4DUZB 1UOEA 4ZI5A 1VLHA 3AEQA 4GYKA 4PGFA 4P84A 4QUAA 1E99A 3IAHA 4U6NA 1QRRA 2A9KA 3N59A 5TGZA 3AW9A 3A9WA 1GARA 1SEVA 4HNTA 1G7TA 1Y4SA 2RJNA 1DWUA 4KQIA 5CT6A 3WFZA 4MTCA 4B3JA 4GKKB 3UG7A 3OICA 5JT1A 2WFAA 3VR6A 2D2VA 2IHKA 5EIOA 1ZRSA 1U9YA 5KVVA 1PEAA 4R8LA 3FFXA 4EAAA 1M34B 1GNLA 3HVKA 4J07A 4KKVA 2ZYUX 4QECA 1Q2XA 4AMZA 2QT1A 5KKNB 2JC3A 1Q7RA 3BSWA 4UAUA 3G79A 3KXDA 2XI4A 4BMPB 4MIKA 1IHDA 3GZTB 1RADA 2A94A 2I8CA 1K5HA 4QQKA 4DABA 2OM2A 3A1SA 4JI6B 1Z8NA 3ZS8A 4D0LB 3TI9A 4G5OA 1K3TA 5BN1A 5K8CA 4G26A 5DTEA 2I78A 3K30A 2JIRA 3WL4A 3L4SO 4RC9A 3AF1A 2ZWMA 1W2GA 3JATA 4B87A 4J03A 4JR1A 1VL1A 1ZBQA 2JFXA 2XTNA 1CY2A 4C7JA 2OGZA 5H1YA 4Q00A 2B2XA 4YWJA 4HC4A 2H4XA 4KQEA 2HU8A 4GP6A 1Z9BA 1SK8A 1TGVA 4MV0A 4C7MA 3HL0A 4HPJB 2ZU6A 4G6ZA 2C5AA 3EXHA 4RHUA 4FEGA 4LJRA 2VRNA 4PLVA 3BEDA 1DAKA 2R6R1 3TTWA 4PFKA 4NK4A 1NJ1A 4IVPA 1WSBA 2IF2A 2O5CA 2V1XA 3VPBA 1K7SN 1FBNA 3IT0A 1YZUA 1G8HA 3O9VA 4GUDA 1IDOA 3TIXB 4P3NA 3EOAI 1BRMA 1FYVA 3C1UA 3H1AA 3P9ZA 4RELA 1L5HB 3H9QA 3HNPA 4FR0A 4TTVA 5EWLA 3RHTA 4EYOA 1W0KA 2BGRA 2VTBA 4GFDA 2PGXA 3BORA 5CIWA 5TPZD 3DDNA 3AY0A 3VISA 2DFTA 4KQ2A 5L3ZA 3W0LB 3DAGA 1F0YA 1Z6XA 1PT7A 1I3MA 1VMDA 2IXTA 3MINA 4L16A 4BO2A 3ZWBA 1P0IA 3PXCX 3WC4A 1WUJS 4J1TC 1LGYA 1QRDA 1X8KA 3CX3A 2X5OA 3AJ8A 5HE8A 3ZLUA 3DNMA 3SDBA 4ETMA 1BMFA 1ZVMA 1T1JA 2VNKA 2Z3WA 3IRUA 4HZGA 1W48A 1SELA 1X7DA 2AH5A 3L01A 1CG6A 4JKIA 4LNUB 5DI3A 5FBZA 1K5GA 2JH3A 4U7HA 5F1YA 3LC1O 4JV5B 1JDUA 3COYA 1I80A 2UUAB 3R7AA 1RE0A 3PJRA 1Q20A 3JPYA 2KI5A 3CNBA 3MGKA 4XM1A 4E13A 1FMTA 1MC4A 2PUJA 2ZIWB 4GBED 4HTAA 6GPBA 1V11B 3UJCA 1RFGE 2WKRA 4JJIA 3JQ6A 4AWXA 1LEHA 1E63A 1HZJA 3CM0A 4MW7A 1X80A 1QE5A 4AF6A 2A58A 3DMPA 4YGXB 4FFSA 4V03A 1GV0A 3KJEA 1XRQA 1IM8A 3D8NA 4BQPA 1N3BA 1T8WA 2B5VA 4FGKA 4MVJG 1WBDA 4D5EA 1GAQA 2I6QA 5REQB 3WLJA 4C4ZA 1ODLA 4NQRA 4WJZA 3COZA 4O4LA 1R6UA 2Z1NA 3OPYB 3J81A 2NO7A 3FVVA 1JTFA 1TM1E 1W4ZA 1XZGA 4KO8A 1OPRA 1JEQA 1Z18A 9GPBA 4IDQA 1KOLA 1T5DX 4E88A 4JDPA 1GU1A 4CMBA 4DGQA 5JW6A 1P75A 5ENZA 3DJYA 1XTUA 4EENA 1N5RA 2O05A 2R6AA 3U9LA 5TF4A 1GUBA 2X8LA 2ZJBA 3NWBA 4TRMA 2G40A 2EFJA 2W93A 1VDMA 3IMKA 4ACAA 1A82A 2DUMA 4MGZR 3TTUA 4I1RA 1CUGA 1X2EA 3QNUA 3FDFA 2QD3A 3K20A 4GDFA 2X5JO 5BWBA 1DXHA 3NP9A 3U61B 1J1UA 1QIMA 2YUIA 1NW8A 4GRDA 4X1KA 3GEGA 1GL7A 3W1VA 3BMOB 4YAJA 4C4TA 4EJSB 5KMGB 5LLDA 5GJBA 1ZDMA 2Q6KA 2Y1FA 3OBIA 1S2IA 2AG5A 1DO8A 4XPIB 1R9GA 4N12A 2QX4A 4KUGA 1WMDA 2J8ZA 1VPEA 1R4MA 2ODQA 4ILEA 4PLPA 2VDVE 3O73A 3TEJA 1ZIOA 4IIJF 3FF4A 4EYSA 4II3A 3D2CA 3FOEC 2PFGA 4F3YA 2C82A 1ESNA 2O50A 3ILYA 3NJ8A 1P2BA 1LBQA 1JWAB 1YAJA 1UK6A 4AKEA 3VX3A 3CEHA 4LAFA 1TZCA 2HX1A 3OCWA 3PEFA 4PLCA 4UOQA 3QTTA 2W71A 3Q9LA 4OXRA 4Y1RB 4NYJQ 4QGGA 4QLAA 4B09A 5EE9A 1V16A 1R6DA 1JSXA 2FR1A 2C2XA 1LPNA 2ZWPA 5K09A 2DPYA 4W1RA 1D4FA 1XZPA 1P80A 1HI9A 1F6BA 1QK5A 3KLMX 5FPSA 4NCJA 2RHMA 2HXYA 3UH0A 1D6JA 1V3VA 1F2TB 2OCXA 3V4ZA 3BT7A 1PVDA 2IX9A 2QN8A 1YI1A 2EZUA 3THSA 4CM1A 2QRVB 4XUGB 3UM9A 3OIGA 1SBTA 2H65A 4D41A 4HD8A 4V0RA 3N6XA 4CGYA 4JBHA 4HATA 1DQPA 3LA6A 2WI8A 2WM9B 3PHCA 2AJ8A 2FZ5A 1TK2A 2JJ2D 3CEAA 4UPDA 1G7RA 2B21A 3SHOA 1JJAA 2ET6A 3DDCA 1KETA 5JLAA 1EUYA 1OCEA 2I9PA 3QKSA 4CUJA 1MJHA 1P1RA 1TTHA 2GASA 3PNKA 1CEQA 5JO9A 4ZEMA 1NVEA 4EYEA 4JBNA 4M1ZA 4BKMA 5I45A 5T3YA 3EXHC 2PGNA 4OVKA 4ER7A 1YZVA 3UKDA 2IYZA 4BJ3A 2VYFA 8OHMA 3T61A 2D59A 3JQFA 3NHWA 1BXGB 1PR6A 3UTDA 2QL9A 1TLTA 4F4CA 3BREA 2YXPX 3AJDA 2I6UA 1O95A 1VG1A 3LUHA 5J3JA 3GJ0A 1M34A 2I67A 4ZEWA 3UWKA 3GLGB 1BX3A 2QV0A 5GAJA 5L4LA 1GKYA 3JARB 4PZ9A 4DLWA 4NBTA 1FDUA 5ALSA 1VJ0A 2P65A 4JASB 2X14A 4LWZA 5HR5A 1PJZA 4ON9A 4L0MA 2YV3A 3I04M 2PTHA 3UWMA 4KNYA 3JQBA 4TXJA 2ZI6A 1UPUA 1LVGA 2CMHA 2ZYVX 1XQYA 3HLKA 2RHRA 2PMEA 3ZU3A 3IR6A 3NEPX 2JGKA 1KQNA 1RLOA 2HLDD 3I1FA 4N40A 4GKJB 5C80A 3WL3A 3IVCA 1VE7A 3DTTA 3IPYA 1ZUWA 4ROTA 1R50A 4OAPA 5D6NA 3GLTA 3GARA 1M6EX 1DQYA 1LDYA 1KS9A 1FFYA 5J4YA 1T5IA 1NOJA 4YDSA 4HTFB 1CE8B 2CUZA 2VIIA 4E5VA 2B0CA 3Q88A 1ZRHA 3ADBA 1FUUA 3TZKA 1JLSA 4IR7A 3W6OA 1BVHA 4G0QA 2OHFA 3MWFA 3PPVA 3QA9A 4HG2A 4O4IF 5EZ5A 4TT3A 3BXFA 1KE2A 4C0AC 2EARA 4HPWA 2A1IA 3R74A 1JFSA 4UM5A 4XARA 1L5HA 2IYVA 1J23A 3HGQA 1UMBB 4FUTA 1V3UA 4HYEA 5K0LA 1CZHA 3QJYA 4V0SA 4TXHA 4FQ8A 1LWOA 3IVGA 4I1YA 2NQTA 3Q2OA 3UGJA 1QH1B 3OTQA 4LJSA 1I0LA 3WL6A 5GIPE 1GCOA 2ZJ3A 2EGUA 5DCYA 4K9NA 4MQMA 4IDCA 3RC1A 2CL6X 4YP0A 3DE3X 5IMSA 1NLMA 1ECJA 3N0WA 4LNUA 3K9WA 4F5EA 4LJ6A 5CCEA 2Y68A 4L8FA 2Q8QA 3EEOA 3ITNA 1VSQA 2UUBB 4LYJA 1USUA 4B31A 2FW9A 1JDTA 4Y0NA 1UH5A 2Z8YM 3KVVA 4PSDA 1EB8A 1G5PA 1S3GA 3EVAA 3I09A 3KOOA 4MB6A 3TQIA 3GPDG 1SUCA 3C3WA 5JJBA 1B6TA 1RIFA 2HA3A 3M8KA 3TXAA 1V11A 3B6KA 5DTIA 3SYMA 2ILVA 4JJAA 3VKFA 5HOEA 3A6FA 3TGPA 1OA0A 3BZWA 4L7VA 2J5QA 1VLLA 2AKAB 3HM2A 3SZ3A 3LBIA 3L7MA 4MVJA 2ZYWX 5E6RA 5REQA 1UK8A 1CEEA 1GPUA 4EECA 4MINA 2AN3A 1KJJA 3OPYA 2C04A 2R8RA 4AJ4A 1SUDA 4N5LA 4BQRA 3QOFA 2Q29A 3BFPA 1ABEA 3NM4A 5KBYA 1NATA 4CCAA 1WSDA 3FUCA 4Q4HA 4K0KB 3DLPX 4GSKA 2CFSA 3MS4A 3TO5A 2BGIA 1F0KA 1KPIA 2SCUB 3EA0A 3A14A 3EK2A 3IBFA 4MDYA 5J5VA 1YF3A 1GTVA 5C7OO 4UAVA 1FJXA 2UUPA 1B93A 2C97A 1UJCA 2P7HA 1JHMA 3AC0A 1AKNA 4ADSG 1JJFA 3PFGA 4S2EA 5G40A 4ER6A 2VHXA 4XLLA 2Z95A 2VTDA 1XZCA 3DEZA 1WD5A 4AYTA 4PQRA 4D44A 1U1CA 4QXQA 2X41A 2WNIA 1RCTE 5KMGA 3BMOA 3SKXA 4EJSA 5KSZA 3CZQA 2PNFA 2RMKA 3CSDA 4GI3A 1L4EA 2B4AA 3HUEA 5FCDA 1L5VA 1DQRA 3L5OA 4XPIA 4C5AA 3UV6A 1Y8RB 4KQHA 1IZ0A 3OURA 2J3JA 4LRYA 4EKGA 3DXXA 2F1IA 3NWJA 4NEQA 3QE9Y 1YJ5A 3OP4A 4Q4JB 1NIJA 4W8HA 3NMUF 1NZFA 3L8FA 3K9BA 1CIJA 4COOA 1EM6A 1QP0A 2NTVA 4TUYF 1IHPA 3BFJA 1W2HA 3BICA 3ZIDA 2XNKA 2F8LA 3E3LA 3JQFC 2WLTA 2CHQA 1JHPA 3QWHA 2BMAA 4FKMA 3A1UA 4Y1RA 1Z08A 3TUIC 4L1KA 5B3LA 2JVIA 1O95C 1P1BA 2VP0A 1NVVQ 2ZIUB 1Y82A 1C3XA 2P77A 3Q8WA 2ODAA 2AW5A 1QZZA 3ND6A 1PFQA 4LFBB 4JUBA 2GK4A 2XMZA 4V24A 5IDYA 3RC8A 2OV2A 2XAUA 2J6HA 1N7GA 1TQ2A 3PPWA 3PUJA 3WOVA 3FOAA 5M3BA 1F2TA 5DLEA 5A1JA 3C98A 2QRVA 5BXYA 2IIBA 4FHGA 4NCNA 1N92A 2RHCA 4YAGA 4R8SA 1M34E 1XMSA 2BMWA 2CEAA 5FPQA 3KVOA 1HXHA 2ZSDA 3AMVA 4UZFA 1LDBA 3F67A 3TNYA 2GHIA 3WLOA 4URHA 3P8ZA 1UMKA 4M1QA 1MG0A 4LZWA 5L45A 2RB4A 3OLYA 1BDBA 4AJNA 4BLTA 2RHTA 1XTRA 3S2EA 2REOA 1H66A 3M6LA 4G63A 5BYKA 5DNVA 1ZP6A 1S4QA 3DDZX 4KX3A 4N6NA 3TE7A 5C5EA 3B1ZA 3KU1A 3I1YA 4MB2A 1TQHA 4YI3A 3WRVA 3F3SA 3R2JA 4OLFA 1BXGA 5DK4A 3AF6A 4EMTA 3A1FA 3HXMA 5CFMA 3HTXA 4H7HA 5I9NA 2PAFA 1C3JA 2VLBA 2ZOSA 2OLJA 4QXAA 1UPBA 1N2JA 3GLGA 3JARA 4Q7LA 1YZLA 1YQEA 2WPDD 4KLAA 3NDBB 1NI4B 3AG5A 1JW9B 1N9KA 4QA9A 4AJJA 4RY0A 1IZ9A 1SEPA 5KC9A 3OM0A 2FOLA 2G5TA 4KO1S 3W79A 5HZGA 2YV5A 3TOSA 4E22A 1V6SA 2Z3VA 2YJ5A 4G67A 4MHSA 2FI1A 3C3DA 4ASUA 2UV8A 2CYBA 1VBFA 4CM5A 5H02A 1P81A 5SY4A 1OH8A 3R24A 2OAEA 2ZI9A 4LY9A 4EG6A 1WMSA 2R8ZA 3NHMA 1GNQA 1LQUA 1MJFA 4K88A 3OFVA 4HJXA 2BONA 3IV7A 2ATVA 2P0YA 3K9GA 3SX0A 5GIOE 1G5QA 5DW3A 3LHSA 2HWUA 1W47A 1P7ZA 2M9MA 3VOBA 4BQSA 1XNRB 3OZFA 1LPSA 1ZUD1 2ZZNA 3O1JC 2M6KA 1DRWA 1A8HA 4HTFA 1BROA 1CE8A 3S29A 2Z6UA 1EVYA 4C21A 2KX7A 3H83A 4XWYA 4ARZB 5DW0A 1ZSVA 4EHNA 2V0GA 1N7IA 3R6GA 5KYYB 3GVPA 1XALA 4G1FA 2YZ2A 1AGPA 1M5TA 5FUYA 1X8XA 4TLBA 5JASA 3EULA 3UHAA 3E4DA 2VAMA 4OIFA 5LNK6 2Z6QA 3MRXA 1TO6A 2BDTA 4Y6LA 3ANXA 1EP2B 3GBSA 3NTXA 3PLNA 4NZZA 1EWRA 1UMBA 2IWRA 3MTGA 3U31A 4URFA 4FHFA 4M4SA 5GONF 1H8HD 3IAAA 3LTEA 1KZ6A 1QH1A 2O7QA 1ZMRA 3UC5A 2VPZA 4KP7A 4P33A 4D02A 1MEJA 3WLMA 4DXDA 1HOTA 1E0SA 2WIFA 4GM1A 4NG5A 4FMDB 4BMVA 2WSIA 2ZAIA 4RE5A 2QU7A 4YJ3A 2OQ2A 4X93A 3NQ41 1ZGZA 4H35A 2WF7A 1XVAA 1SCAA 1JECA 1W0CA 1KI2A 5F3WB 3TM4A 2X4DA 3QXJA 1RKQA 1YRWA 4YJ2B 3ER6A 3KQTA 2FAXA 2G36A 3ZI4A 1B3RA 4M49A 2JFPA 1E9CA 3C3JA 3IP6A 3ZY4A 2PS0A 4EJSC 2P9QA 4JJZA 1L8OA 3GLKA 3L7KA 3HJBA 2FPXA 4KXWA 1M54A 1FW8A 4LQLA 1WXWA 4IMJB 1BDMA 1HV8A 4RTNA 1ML4A 1K68A 3KJZA 4BRWA 4FJ0A 4DTIA 3Q7RA 1UKYA 5J23A 2P6PA 1JEJA 1FLAA 2IHZA 2H5LA 3MRTA 2HQSA 4L5BA 3K3PA 2X58A 4TTAA 3K9NA 3M89A 3SBEA 3WKDA 4HI0E 3VM6A 3L7YA 2OWEA 1S2NA 3NAMA 2H11A 3EDYA 1UIMA 1ZGCA 3FFBA 4PZZA 1V4NA 1HL7A 1E9AA 3KB8A 3KFVA 3QUAA 4UBJA 4E5PA 1UDRA 2YY7A 2ZXEA 3IUQA 4RKFA 2SCUA 5AHOA 7ABPA 2HO5A 3AXTA 3WYEA 4ZEOA 1AN9A 5M29A 1J90A 3OZRA 3VGPA 3RADC 3L02A 2IZ0A 3LMKA 3OLZA 2I3ZA 1GQRA 1XDSA 2FN3A 3PFBA 3R9IA 2VUUA 2EF0A 1SBQA 2IODA 3FCAA 3JAKB 1N2IA 1X70A 2C98A 4Z4GA 5KJEA 5BV8A 2G71A 2LVBA 2QVZX 3CLUC 4YI5A 4TKUB 3S6JA 4TL6A 1J0DA 2H85A 4UNQA 4UTNA 2HU2A 2P68A 4GXRA 5T67A 2I3AA 4HYYA 3VC2A 2DB3A 4CT4B 4KN6A 3AXSA 1E1NA 4IO1A 3HE3A 2O8DA 4DCVA 4FGJA 4KAFA 1Y8RA 1EBBA 2ODNA 1SOUA 1W5SA 4HLQB 3VHRA 4Z1MD 1TRHA 3T5DA 2ODTX 4OP3A 4Q4JA 1Y3IA 4LDQA 4N03A 3WZMA 3C16C 3PTZA 1KOGA 1DTWB 4WEOA 4XD7D 1M7BA 4LHZA 4D46A 3E1KA 3LX8A 4PZEA 1ULTA 1CLEA 4HYQA 1S0UA 3OF3A 3RUDA 4IV8A 4LXUA 3B3QA 3KM0A 5CVVA 3LDFA 1M6HA 1UOQA 2R44A 3BRWD 3ZCVA 1FQOA 1QORA 1UEXC 2BUBA 3B36A 4GX1A 1VCHA 3O92A 1O5OA 1KI9A 1Y5LA 3IUYA 4ZV7A 4BWYA 4BDSA 1GA1A 2I6SA 1V8DA 1EX9A 4D9GA 3SN6A 1AKQA 1MIOB 3QG1A 2YXNA 3LV8A 4J7XA 3ZXUB 5AVJA 5JQGB 4NMWA 1E64A 1N5OX 3DLCA 3U13A 3V5NA 1U80A 3WXBA 1VYUA 5I4KA 5KQGA 4U2FA 1KIAA 3T3MB 4EYQA 3GLGE 1QDEA 2FMFA 3NWPA 3S2FA 2PK3A 4H7FA 5TX7A 3HU2A 4B35A 3NVKI 2DETA 3C5EA 2IYUA 1AMNA 1ADFA 3LI2A 5LB4A 1SKMA 2A92A 1FRZA 1TK3A 3I9FA 4ZYVA 4ATNA 3EVZA 4YUAA 4LGYA 5HQJA 1NJ8A 3DWIA 4EIWA 1KO7A 1N4AA 3JVDA 3ABQB 3FHCB 1Q21A 3PT9A 1W8IA 2HKIA 1N57A 1SG9A 1YIDA 3AFMA 5KPJA 2WB4A 1PYOA 3OQ1A 3HJTA 4BFXA 5E0KB 3I64A 4J0KA 4NZYA 2YL2A 4WESB 5TRTA 4BLWA 4I46A 4MS1B 3FMPB 4JSTA 2ZSUA 2G9RA 3L1HA 3JVEA 4JB3A 4O6VA 3UK1A 3H18A 2CLMB 1B76A 3D7MA 1B00A 1DNPA 1FX0B 2CL5A 2JH9A 3QH4A 4GKVA 2NVBA 1NI4A 4HRYA 1QJ4A 4NMXB 5SICE 3I9V6 3W5IA 1VPDA 1WTAA 1WZNA 1YMUA 2MU1A 4O0LA 4YCAA 1W25A 3VR5H 2UU9B 3FKSD 3SM3A 2ZE5A 2I6XA 3R7LA 1YU6A 2EP8A 2HBZA 4BFZA 4D1YA 1H2FA 2GBGA 3GFVA 1TO2E 4EPVA 3JRXA 1M8GA 2Z4TA 1PR9A 1IJEA 2IU4A 1LD3A 1R8XA 2QIOA 1WO8A 2UZ3A 4EZIA 4ZZIA 1K4YA 4RJIA 4MQFB 3BTSA 1RWQA 3HN6A 1GQOA 2ZRPA 5TQVA 4CUKA 1B8PA 1Z3CA 1O3YA 1U7TA 3IXMA 5ED4A 4ISCA 4MARA 4HADA 1FB5A 3EGOA 2HC9A 4J0DA 3BVPA 1XROA 2XODA 4UNRA 4Q1FA 2DBYA 1AN0A 4C76A 1ZI9A 1V3TA 3K70D 1JPNA 2VJAA 3ZLTA 2NMVA 5T64A 4Y7DA 4ARZA 1JFVA 4AZTA 2WUDA 5KWEA 1TU4A 3ONVA 3JAWB 1DP4A 2XCQA 4IIUA 5KYYA 1WKVA 1JL3A 1JHZA 3HV0A 4G09A 1NLZA 1WVIA 4RJLA 1YDHA 4FN5A 4YRKA 4Z53A 2WM3A 4BO6A 3D59A 3D81A 3TW0A 1RKBA 4OF4A 3DOOA 2X7XA 2XBLA 3W4KA 3H5OA 1NURA 2E4YA 5IDVA 1ZI8A 4H4EA 5E4TA 4IIDA 1EGQA 3ZDZB 3S7ZA 4BUJA 1FTSA 1QO0D 3EPJA 2WHYA 5IBRA 5IHPA 4HQ0A 2V55B 2VP6A 3QGMA 4L8GA 2H0AA 1YQGA 4QOSA 2YXEA 3K0AB 5DWQA 1ENZA 1P2GA 1XJWA 1UJ5A 3FTQA 5DM0A 4IUDS 3L8EA 2JARA 3AYXB 3IMGA 4ME6A 5FUQA 4DIOA 2MSEB 3RUCA 4RHFA 3G59A 2JJMA 1QPZA 1EZ1A 2JI6A 4YJ2A 4Z51A 1HTTA 1KMCA 1MR3F 3GJXC 4HAOA 2GK7A 1XCBA 4HQKA 3HB4X 4MVJH 4XVRA 5GZ6A 3RHZA 1WDTA 4B79A 4NENB 4EUSA 1K6EA 4G9GA 4UE6A 3TTYA 4PX3A 4ZYZA 4RYDA 5IFKA 2C7PA 2WC1A 3TCNA 2OHXA 4D0NA 4F46A 1PVVA 4DGSA 1QRAA 3ZU4A 5B36A 4IQ8A 5EJ8A 1CDOA 1TAQA 3FPHA 1ZD5A 4DBVO 1PDWA 3RQSA 1QQAA 4GX0A 3ELUA 3NUZA 2NYRA 1VYHA 3GFFA 2AF3C 5EZYF 3R3SA 4QUIA 3PA6A 1SUWA 5L51A 1A8IA 3VTAA 4LJ5A 1VOTA 3TXXA 2V5AA 3V4LA 3NP7A 2FSSA 3FGZA 3CUTA 3B70A 3OHSX 1GTG1 5DPMA 1E32A 1O57A 1Y1TA 3B2QA 2VSYA 3PA8A 5EHIA 4EJ6A 2V9ZA 4EHBA 3D0OA 3IQXA 3PJEA 2JLQA 3HZOA 1OKKD 1ZJWA 4ARVA 1OB5A 3DL2A 2QN9A 2PX4A 4L6AA 2ZDGA 1J8FA 1OROA 2AE2A 2ZSHA 1Q7GA 3C3XA 3SIPA 2W6IA 4P0PB 3EF1A 1PJQA 2G1AA 1G16A 3JAKA 1C7EA 4KFTA 4Y2RA 3ESAA 3Q9SA 4LYAA 3G8CA 4TKUA 2KLBA 1BX1A 3L7BA 5F4ZA 4IJMA 1WUHS 3OCZA 3U9TA 4ESEA 3GLIB 2ZRGA 1T9CA 1TEHA 3V1TC 1YBFA 5BUZA 1YR3A 2HF7A 1B8NA 3L8MA 4I9FA 3FM9A 2C5HA 2C88A 3IPLA 4XH9B 4XQGA 6ADHA 1YAHA 2GARA 3A6JA 3NRJA 4P4SB 3VPHA 2COUA 4YH1A 1XN1A 3K9QO 1IBKB 2F1KA 1DTWA 3BM5A 1OXBB 1DDGA 5CHYA 3NH9A 5FUXA 4DRZA 3S1SA 4ZKDA 3GRYA 3K9HA 4DREA 1TIKA 5AKJA 4TYNA 4D2IA 2BGNA 2H7CA 1LNSA 1ZJYA 4RZXA 3AUKA 2H1VA 1YZ3A 4KB5A 4KZKA 4RIEA 3W1WA 1A8QA 4OEHA 3A6KA 2I76A 3FVTA 1LLQA 1ZINA 3CA8A 2R00A 3RSSA 3ZU6A 1TUIA 2VI5A 1E2KA 2QTHA 3G2NA 3ANYB 1USKA 2OZPA 4JZYA 1DVRA 2CVPA 2JGNA 5J5AA 1BXRB 2YN2A 3KC2A