4CF6A

Crystal structure of the complex of the p187s variant of human nad(p) h:quinone oxidoreductase with cibacron blue at 2.7 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
b'RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLESQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Collapse of the Native Structure by a Single Amino Acid Exchange in Human Nad(P)H:Quinone Oxidoreductase (Nqo1).
pubmed doi rcsb
total genus 72
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cf6A00
4PTYA 3G5MA 2KLBA 1D04A 1TLLA 1CZHA 3OX2A 4U7HA 2V5VA 2A5LA 3OX1A 1BU5A 4S24A 1YDGA 1QBGA 1YOBA 3NHUA 2QX6A 3O73A 2M6SA 3F6SA 4FGJA 3TZBA 2OYSA 3ESXA 4BMPB 4YAWA 2F1OA 3GFSA 3NHPA 4H6PA 2V5UA 3F2VA 4PTZA 1WSBA 3N39C 3UXEA 3KEGA 2QX9A 4YAOA 5EA2A 2MOKA 2FZ5A 3N3BC 1RLIA 4QOEA 3QFCA 1I1OA 1AKUA 1OBOA 2BN4A 3W77A 4C14A 5LMCA 2HNBA 4ZVLA 5FA6A 3UXHA 2XOEA 2OHHA 3FNIA 3N3AC 2Z98A 5EMNA 2FOXA 4ESEA 1CZKA 2XODA 3NHJA 5JROA 4YAFA 3FW1A 4J8PA 5NULA 1J9GA 1FLAA 1JA0A 2X2OA 4LAFA 4LTNA 5BUCA 2QMZA 2Z9DA 4LTMA 3LCMA 3O2NA 2BF4A 5B3LA 3B6MA 1AKQA 1GG5A 4YALA 3KLBA 4C0XA 2Q9UA 5FUQA 3FJOA 3NHYA 3HLYA 3OJWA 3QE2A 3D7NA 4ZVKA 5F12A 1FLDA 4QOHA 3W78A 1DXOA 3F90A 3OWXA 1YCGA 4N9QA 5ULLA 3NFRA 2MTBA 5A4KA 3B6IA 2B3DA 3B6JA 5NLLA 1OBVA 5F51A 1FTGA 2GSWA 1SQSA 3B6KA 1F4PA 3QFRA 4QOFA 3S2YA 2QX4A 2OHIA 3LT5A 4GI5A 3FX2A 1DX9A 1C7FA 1NNI1 1ZX1A 4HEQA 3ES9A 4QOJA 1T5BA 4U7FA 4Y9RA 6NULA 1KBOA 3JSXA 3ZHOA 2BZSA 4DIKA 2MT9A 1H69A 2D5IA 2Z9BA 1XI2A 5FX2A 1QHEA 3KAQA 3NLLA 1AKTA 1X77A 4YQEA 3TE7A 2V9CA 3U7RA 3NHWA 1BVYF 1ZWLA 2QR2A 3OWHA 2RG1A 3NHSA 2BPOA 2WC1A 2HPVA 2W5UA 2FZVA 3KAPA 2Z9CA 1J8QA 1J9EA 3L9XA 4NULA 1B1CA 1CZUA 1QR2A 1XYYA 1ZWKA 3GFRA 1CZOA 2FLVA 3NHRA 4OXXA 1QRDA 5LJIA 3ESYA 5LBTA 4DILA 3HA2A 3OVMA 1JA1A 4NLLA 2X2PA 3NHLA 4QOGA 5B3KA 3OX3A 1FVXA 4H2DA 4FGKA 2ZKIA 2HNAA 5TGZA 4ZVMA 4Y7CA 2FDXA 1T0IA 1CZLA 1D4AA 4XDHA 1XT6A 2FAXA 3GAMA 4QODA 4CETA 1KBQA 1AG9A 3W79A 1FX1A 1H66A 2M6RA 4N82A 1AKWA 2AMJA 4DY4A 5LLDA 1AMOA 4BMOB 4HS4A 3RPEA 2N1MA 2R96A 5LVAA 2FCRA 3R6WA 2QX8A 3F6RA 1YRHA 2MWMA 2FX2A 1AHNA 1FUEA 4GQIA 4C76A 1AKRA 4YAUA 3SVLA 2Q62A 3P0RA 1AZLA 5LBUA 3W7AA 2ARKA 4PU0A 2QWXA 4LTDA 3L9WA 3K20A 1J9ZA 4R81A 4U7GA 3GFQA 2QMYA 3EDOA 4FX2A 4D02A 4Y9UA 1SG0A 1RTTA 3ESZA 5LJLA 1E5DA 1D03A 2R97A 4F8YA 1AKVA 1RLJA 1YKGA 3OJXA 1C7EA 3FVWA 5EAIA 2FVXA 4CF6A 1WSWA 3EYWA 3NHFA 1CZNA 1DXQA 4FGLA 4ICIA 1YCFA 4LA4A 4QOIA 3TEMA 4GR9A 1FLVA 5F4BA 3NHKA 4XDGA 1YCHA 4C0WA 3HR4A 1CZRA 4M0CA 1VMEA 2BMVA 3K1YA 3U7IA 1V4BA 1TIKA 1XYVA 2OHJA 2KQUA 4ZVNA 4N65A 1RCFA 1OFVA 1FLNA
chains in the Genus database with same CATH superfamily
1W2HA 1ENOA 2XYVA 4CKZA 5E1BA 2OV8A 5I5EA 1X86B 1Z5ZA 2AYXA 1TYCA 2FSFA 3BQ9A 3C41J 4R2KA 4AULA 4OI4A 1DSSG 3UTCA 5DWQA 1OXTA 5I7UA 1OKKD 2XHZA 3KE8A 4MCIA 4ENQA 1SUAA 1VPDA 1FYXA 3NJ8A 3DZCA 2WE7A 2DE0X 1K8QA 2WTAA 1ZJ5A 1N6RA 2ZZMA 5ADHA 4ZANA 2C4VA 3LQ4A 3LCJA 3CGWA 3GRUA 1VCIA 2Z08A 3E7PA 2H54A 4YONB 5HBRA 2XJ4A 2WYIA 3CY6A 4G4SO 1CJBA 4Y2GA 1EFPA 1OXVA 3U0VA 2C2GA 4MW5A 2IP4A 3QMWA 10MHA 3ZD6A 3VGPA 4QPPA 2FUEA 1MJNA 4RTKA 3HYRA 2BI4A 1NJ1A 2YVKA 1EH5A 5EVCA 4CN9A 4O8ZA 3LK7A 1KVTA 1Z8FA 3AJAA 3WLMA 2KE5A 3DOHA 1KDYA 3FB4A 1LVHA 4HAIA 3OKFA 3HUDA 4R5MA 1ZVQA 4BBZA 5CIYA 2J6CA 4BBPA 4L8VA 1OYWA 4JT9A 3L6BA 4X3CA 1GPLA 2FSPA 1C0EA 5IFLA 3HU3A 5CFRA 1LBHA 3AVWA 2Y92A 5C7LO 1ISPA 4IJWA 1U0SY 1BS9A 5FPKA 1TE2A 3DVRX 3E8SA 3ONDA 3CNNA 2D5IA 5IC5A 2X0KA 3G0CA 2Z9BA 4ZN6A 3ZZTA 2WTXA 4ROTA 2PBLA 4B33A 3NHWA 2YXLA 3T52A 3MAGA 4WK6A 3UJHA 1DXYA 4RPCA 2Z9CA 1P6QA 3F8TA 2IQIA 3VHQA 1IIRA 3EIXA 3P2JA 3IAUA 3L6DA 5GVSA 3L8GA 4M55A 4AY2A 2Q50A 4G9EA 2ZRQA 2O3JA 3VFDA 1VJTA 1FVXA 4QC2A 1C7QA 1XXHA 1L4KA 5CA0A 3UATA 3SSNA 2HRQA 1E64A 3EUEA 4D7AA 1LDGA 3RJMA 4D74A 4M1ZA 4XDYA 3M6IA 1AG9A 5K4AA 2PL1A 5DV9A 3KV1A 4R9SA 1U02A 1SKYE 2B1IA 1HV8A 2A0FA 3CNBA 1EUZA 1ZISA 4RJJA 5JNTA 3JQ7B 2ZR9A 3A27A 4FFSA 3K0AB 3NJRA 3KPVA 4IUCS 1K6JA 1U6KA 2ORWA 3BN3A 3H84A 4CW7A 2O7RA 4P3YA 4EH1A 1N5OX 3A1DA 3N2EA 2P5UA 2H0QA 1Y9EA 1E96A 2JLQA 3R0JA 2E6KA 2R7MA 4Q01A 4CG3A 4DA0A 5ECYA 5B5SA 4L51A 5DYYA 1O95A 4PXYA 2ZAGA 4X7RA 4EA6A 4FGLA 5FR2A 2VHYA 1JNYA 2R7KA 3OFJA 2XT9A 3ZD9A 1TU3A 2OWDA 3ON5A 1IUOA 2B36A 4ZT2A 2FXVA 3PUJA 4IJ5A 2XVAA 4HN9A 4QRHA 1A2QA 3J81A 2JJ1A 3ZGVA 2VNJA 4N5HX 1N6NA 4W5HA 4TLAA 2PZLA 1IB0A 4W1RA 3JQQA 2GK6A 1UJNA 2CNBA 2J4DA 4JI3B 3K35A 1DC3A 3IVCA 3BXZA 3D8BA 1Y4SA 2HO5A 1ZK3A 3A4VA 5DNAA 5BPFA 1IYZA 4W82A 2HCRA 5EXPA 2R0QC 1ORVA 3HO8A 3FTPA 1DTSA 1JXMA 1I4WA 2NO7A 2VJYA 2X6RA 3PGJA 1WW3A 5D8DA 4BO9A 1YB2A 1N2IA 1H8EA 2EBFX 5J2TA 4IDEA 4RY0A 3W34A 3D3EA 1JF8A 3HQ4O 3BAZA 1VSQA 4I66A 4AMBA 1HG0A 1XVLA 2I91A 4X85A 1NXPA 4YAFA 2JDIA 4PGAA 1RBQA 1RHJA 4I46A 2C31A 1JG3A 5FOQA 3R4VA 3AUXA 4BFVA 1KDPA 4XASA 4UVHA 1TK9A 2IITA 4MVXA 3V42A 1M2EA 4Z1OA 1L5YA 1MV8A 1Q1BA 3KRTA 3T7CA 2D4HA 4WBSA 3H6HA 3GNLA 4BMNA 4WZBE 2DRIA 3FHOA 5EJMA 4Z0PA 3VA7A 2WIJA 4QFMA 1CP3A 5HGXA 2JD2A 4LRTB 2IE0A 3GUVA 4UDOA 2J59A 3TR0A 4F5EA 1UQUA 2YWEA 5F4BA 4CMCA 1JU4A 4IGEA 1LLDA 1T8SA 2WTNA 2QM3A 2AN5A 4OJKA 4C7XA 4B4DA 4PNEA 1SVSA 3ANSA 3RJ5A 3WA6A 5TC4A 4AJKA 3PTAA 1QO0A 3V2UA 2XAAA 4YMHA 1I94B 1AGXA 3MXOA 3Q8WA 3G2HA 3VUEA 4DSUA 5MDHA 3UQYS 2GZRA 1J25A 2FI1A 4M60A 4DCVA 4F4FA 3EIOA 3AGPA 1E3TA 2ZZKA 2FGKA 1FFEA 1F17A 3WDSA 3LY7A 4Q66C 5TDHA 4JIMA 4MULA 5G4KA 1H8ED 3NYIA 5IAJA 3H2HA 4MAFA 2J32A 1WZCA 4QQNA 4NU5A 2GHQA 4TZ0A 2DF8A 4HWPA 5IRCD 3RT1A 1PFUA 1T2FA 3IYLW 5AM2A 2DSNA 2P65A 2QY9A 2HLDD 1XVUA 1GDDA 4PF1A 4DLSA 1AUQA 1E2QA 1GQRA 1DLIA 2C7GA 2BSAA 1DOZA 1XCPA 3I34X 4A2WA 4BRSA 2VDPB 5KYXB 4G89A 3KLMX 3DQZA 1Y3HA 1PG2A 1ZI8A 2MINB 2V7VA 5DGXA 4CNQA 4HQ0A 5LKRA 3IQXA 2ZIVB 4NK5A 3ZZ1A 3DKIA 3O9VA 4FKMA 4WOKA 5EIHA 6GPBA 1WD7A 1GG8A 4EGCB 2P78A 5DCUA 5AUQA 3JQRA 2WUFA 3C3CA 2R00C 5E8JA 2NZ2A 2ZYTX 3AKEA 1GGKA 5F7ZA 1Q0PA 1JMVA 2ZB8A 2C97A 1AA6A 4A2QA 4BWFB 2WUVA 1ZAKA 2ZDQA 3GAAA 1FYDA 1L7BA 2PLFA 5FFMA 3OQ6A 3WV4A 4US2R 4LVCA 2MSEB 2YC4C 3C3DA 1ZUD1 1UPUA 3K09C 1TKRA 2B30A 5HDQA 5BMVB 1XDBA 2IV7A 3TLCA 2DFTA 4UCFA 1F3OA 1K8ZB 1Y0BA 2GBPA 1H4SA 2LD4A 4QYMA 2D2IA 5DBFA 1MN6A 5FBZA 4D3SA 1J00A 1OZGA 3FUCA 4A7PA 1FYFA 5JAOA 4JBLA 4FLEA 4DLNA 3H6KA 4JC4A 1E6WA 1GZDA 3LHSA 5CVJA 5K45A 2HHHB 4G8DA 2O2YA 2HZBA 5IDYA 3DOIA 4C89A 1B6RA 3FPCA 5CRIA 1QHIA 3ZWKA 5KSOA 5IAEA 1RWQA 5DTMA 1UDWA 1UR5A 1V4VA 1YQQA 4NMLA 3UUFA 1DRKA 4K9NA 4WXMA 1E0DA 3HZZA 4MH0R 5DI3B 3I2KA 4TWBA 3FKJA 3DYIA 1ZRHA 5HCIA 5AR1A 3EMDA 5T4BA 4HWGA 4BVKA 5JNUA 4KGXA 3W2EA 1YB6A 3IP8A 4XVQA 2QIOA 3CA8A 2VP6A 2R8YA 1JKIA 2XQVA 3EVCA 4C0XA 1HZJA 1XF1A 1DB3A 2P7IA 3AUKA 5HJ7A 3WADA 5KU1A 3L77A 4U2KA 2QRJA 3RVDA 2V5AA 1ORIA 1WRBA 2HMAA 3IULA 5DNDA 2WIKA 2QYOA 4IDDA 3AM1A 3OLVA 1TUEA 5LIPA 3SE7A 1HXHA 4PQGA 2WKRA 1L7OA 4N0QA 3EA0A 5KYTA 1S2MA 4EVRA 1RACA 2Q29A 3KJHA 3KPJA 4JUFA 5FOTA 3CONA 1BXKA 4XUEA 3MOGA 4FE3A 4PR3A 3NAZA 1K1EA 1K6IA 3EGWA 4F4UA 4BLWA 4DANA 4WIAA 1XI2A 5IJ0B 2RG7A 4ASUD 2WTUA 1AGPA 3I5UA 5BWMA 1SWWA 1V16A 4XWWA 3MM4A 4NX2A 4G1VA 1RKBA 4QPDA 1I7NA 4LZAA 9GPBA 1K0UA 2ZTMA 5CBPA 5LBUA 3D5EA 5EYPB 1A9YA 1S2OA 1FRVA 5ILQA 5C4IA 2EAUA 4NLLA 2D2XA 3O3NB 3VU3A 5AIBA 1TD1A 3DTVA 3VH4A 3EPJA 4QOGA 3FLEA 3G9ZA 1O6GA 4JX9A 4CM7A 4ECAA 1SU7A 1VMKA 4H2DA 3F2IA 2E4UA 3ZCSA 2F43A 1E9RA 3IT2A 4LJ6A 6AT1A 4CFZA 2A59A 2QAGC 1RJFA 1QLWA 3NIWA 4NDAA 3TW0A 1N3IA 4R05A 2DY1A 3L49A 4S1TA 4XQ0A 3BM5A 4NCKA 1EE9A 1UP6A 2AW5A 2DR3A 2VTDA 4ZQIA 1NF3A 1PJ2A 1AK9A 4B3FX 4GP7A 4RC9A 1O9BA 2WMDA 1H22A 3FYUB 3ZXUB 3RBZA 4I1SA 5C1DA 3L9WA 1SZCA 2NTEA 1A9XB 3WFJA 1AF4A 4WZAA 4BVGA 1QRTA 3FPHA 1BQ3A 3K9CA 1NYQA 1QHYA 1XHLA 3ZK8A 3KBBA 3P9NA 4HDNA 4KUGA 2R97A 1QZTA 2F90A 5ALPA 4B3IA 1E3DA 5KAMA 2Y1DA 2YWGA 1ZNYA 1O5TA 2XBMA 3Q7QA 4BQRA 3DOCA 5EUQB 2V7XA 3WL6A 2PVCA 3ONEA 2EYUA 5HHTA 1E6EA 3GUCA 5JFGA 5ARBA 3RKRA 5DEIA 1OV4A 3D3QA 4G23A 1FPMA 1I01A 4JB3A 4L0QA 1HT0A 4Y6OA 3U3XA 5SY9A 3OTHA 4XUDA 4P31A 2JLSA 3C5VA 4YQZA 2I6GA 1AKNA 4AIIA 1IBKB 2UZ3A 1E79D 2UUCB 1B42A 1OTYA 2NXNA 2PUHA 5JSYA 3ZGNA 1JWLA 1JFRA 2DJ5A 2HWKA 1EWKA 4CLDA 4WVFA 3BTUA 2QAJA 3AYZB 4IHJB 1DMRA 3HBFA 1YHNA 4BBAA 3N39C 2VR1A 5J63A 1SOMA 3IMEA 1D2HA 4GPTA 3CH4B 1S96A 4L5BA 5KWIA 4FC6A 4M9RA 5F7JA 4XFKA 3EHEA 4UBMA 5A9SA 2J6IA 2WD7A 3DLTA 4G0UA 3ZI4A 2BOVA 1NVVQ 3FW1A 4FIDA 3W3AH 2DH5A 3FCSB 3ORRA 3RNLA 1K6XA 2QBYB 2CVZA 2G1PA 4ZOCA 2QZJA 3PTZA 3FTNA 3B82A 2PXAA 3GLUA 4O2BA 2DWOA 1AQUA 4PZUA 1FLDA 4ND5A 3GFVA 3R8CA 1RC0A 2XMQA 3DWIA 3HCOA 1AO0A 1YDMA 1JLKA 3VJLA 3TDNA 1AE1A 2AUNA 3QKSB 4WCFA 1NR7A 3GNSA 2WWIA 4WLNA 5E9QA 4CQLB 1B8NA 4N76A 5D6OA 4CR8A 4KXMA 5DHFA 3IIJA 5C1IA 5FTWA 3OZXA 3MQ4A 1FK8A 1VSVA 1Z5WA 3TCNA 1Z13A 4JITA 1F4VA 1YI0A 3MIIA 1UBOS 2R68A 3NT2A 4FBLA 2AKAB 2XT0A 3FYUC 1NOKA 1MV5A 3K4HA 2C3PA 3N70A 2H29A 1GKIA 2RI0A 2V7BA 1BSVA 3VAYA 1MO6A 2G9UA 1LLUA 2RI1A 4RSHA 1A4IA 4ZA2A 3E9EA 1KZ7B 3H8JA 1NRJB 3D2BA 4TMTA 3MTEA 2W5UA 3ZIDA 4B81A 2CN1A 3TX6A 3CIFA 2PCLA 3UGQA 3ZBQA 4IOLA 1FTSA 3F6BX 5CFQA 4KTVE 4GD3Q 3A3PA 1ZGJA 4Q4AA 4LXGA 4J16C 3QF4A 1NYTA 2YZ2A 3AUSA 3U4DA 5IF9A 3KU4A 3NBUA 3SBDA 4YH1A 3LP6A 1UINA 1I51A 1M8FA 5REQA 4MW2A 1Z35A 2VWQA 2IQ5A 3RYIA 2C2HA 4J03A 5CM9C 4LJ4A 1SELA 3SOPA 4KEAA 5ITVA 2WJVA 2X4GA 4JWKA 2IZZA 2J33A 3W7VA 2EL7A 4UULA 5JQGB 2FX2A 4DUGD 2AFVA 3BF7A 4WKBA 1XU4A 3NIGB 3HEBA 4LBZA 4TUYB 4LI3X 1JPUA 4I8IA 4MWGA 3GPBA 3RF7A 4QU5A 2LKCA 3T1VA 2WVAA 2OMKA 4DQDA 2WWFA 1DZ3A 4B46A 5CBPB 4RKRA 1TFRA 4XM2A 2RKOA 1E3JA 1QVWA 3G2PA 3CT6A 4JEMA 4X00A 2C5AA 1RZUA 4MGYR 4K26A 1FNSA 4MRMB 5EAIA 1O94D 3HM9A 3F3SA 4FPXA 4LWOA 4QJ5A 3OP4A 4WMLA 2VUIB 1DBIA 5HIAA 3WIEA 2XMCA 4OQYA 4BJ3A 3PHLA 3GJ0A 2WU4A 1X1BA 1XYVA 3PT5A 3UH1A 4B47A 3VO9A 1JIVA 4E3ZA 4BB9A 4JGGA 2GN1A 2ZBFA 1P2SA 5A5DA 1U8EA 2PD6A 2OKGA 5BOSA 4U6NA 2EJBA 4MDEA 5GINE 1KPGA 2PR2A 1PS0A 3CLUD 3IO3A 3L7YA 3PE3A 5U1PA 3VTZA 5K7SA 3OCUA 4UD2A 2QROA 1OE0A 3LWZA 2DFLA 4NMHA 3IJEB 3Q4GA 1Z4IA 3TH5A 2VYNA 3PC6A 1NLUA 1QIMA 2O0KA 3MUOA 4BWGA 5E4YA 5LQUA 2PLAA 1XRJA 3Q3VA 3KZKA 5IJ9A 1NOJA 2AI2A 3SYRA 3B9BA 5AOVA 3PHIA 2V6JA 4KBGA 3KYCA 4L0DA 5T64A 1JE1A 4AO6A 4BS9A 1BRTA 3C7TA 3PNQA 1P3DA 3L0IB 2QTZA 3IKJA 5SV2A 1GT91 1YK0A 4NECA 1ONOA 4TX1A 1EK0A 2YYYA 1TCBA 3VDXA 1W52X 4TKLA 1NDQA 5AVTA 1DRWA 4OMCA 1IUNA 2ZI5A 4IJUA 3KSBC 2CLKB 3KYBA 3EEIA 3V4FA 3DFZA 4ZHQB 2QP4A 3THWA 2O8VA 2JW5A 2BP7A 2FUCA 3ENZA 2A5JA 3OM8A 4N9QA 4Y1GA 2ZXEA 4HAOA 4XYMA 3R7WB 4CUZA 1BGVA 4F7DA 3EX7C 5P21A 4UUQA 5F3WB 1EUCB 2RH8A 1B1AA 4ML3A 1PQ4A 1V5EA 3V2HA 3JATA 3AINA 3WKAA 1WOMA 4EJFA 5F1OA 4OU4A 4EX7A 2CUNA 3IXMA 2GZHA 4DLRA 4EB6A 2CFTA 2YW9A 3AV3A 3PB3A 2PGOA 5IJXA 1S02A 3IAEA 2Q6LA 4EMTA 4ZARA 3FI0A 2JH3A 3JYHA 1DWUA 1VE7A 4AZ0A 2A6PA 1PBTA 1G66A 3HU2A 3KR0A 1KS2A 3MWDB 4HQNA 3ISTA 1TA9A 4JJZA 2UZ1A 5CIQA 1SU4A 2DU8A 1UKVY 4ZVSA 5HJ2A 3ZQUA 2O20A 1W581 1FIUA 5DF1A 1KQFA 1MH1A 3QVVA 1KO7A 4U3JA 3ZHRA 4KDCA 3WK4A 1ODLA 4P4LA 2WV9A 1V96A 1WVGA 3WDLA 3WJ2A 4HUTA 4HRAA 2AXPA 3EMVA 3DLHA 1TDJA 1C9JA 1HGXA 1SOWA 3INRA 4WKGA 5JH7B 3LA8A 3MA0A 3I23A 2PSFA 2WF6A 3PXDA 1Z7BA 3ASZA 1BMFA 2HQRA 3OOJA 1UFVA 2X5NA 4ND8A 4FFPA 2OCYC 4RVNA 1GL3A 3GJQA 3BMCA 4N3CA 1N2CA 4N5MA 3TTXA 1J70A 4ZQEA 4YX9A 1OJ7A 2J08A 2P2DA 3FPKA 4I1OA 3IEXA 1NJGA 4F5DA 3R76A 4E5SA 1DMSA 1NONA 3A6LA 3CBGA 4C7OB 4I5EA 1DFIA 1EK1A 1IULA 3M2TA 2GF9A 1YL6A 4RK5A 4EG6A 1O4VA 2ZUFA 5K8TA 2Y1GA 3K0CC 3HDYA 4G1CA 1FRQA 4XR4A 3M3DA 2XKJE 4QBKA 3R5XA 5A03A 3GUZA 1T29A 1DG9A 3K0CA 1KZ9A 3JVDA 3SJZA 1BAPA 4BO3A 4QDJA 2QPOA 3HJNA 3U6BA 5BSEA 1NHGA 1T1EA 2QF7A 2ZREA 3DMNA 4HSEA 2WEKA 2V03A 4XSGA 4F3TA 2PH3A 3PNMA 4MR9B 1VG8A 3BKXA 2QLNA 2BIFA 4K9QA 4MPPA 2Y4NA 2AEFA 3V8NA 4Z54A 1X2BA 3OBBA 1D0IA 2RBEA 1V3VA 3DOEA 4J1TA 2Z30A 1JR4A 1VL6A 2XGSA 2I1QA 2F3RA 1GTJ1 2GM3A 1ODIA 4BDTA 1ZIXA 3AVUA 2W6IA 4MTCA 2XNCA 3QM1A 4YRKA 1XDUA 2DB3A 4MYTA 1XZFA 3IQIX 2OPBA 1R6BX 2PX8A 3ZG6A 3VR6H 3C48A 1PGOA 3IC5A 3DMGA 4I5DA 1JJFA 1U8CB 2PKQP 2W2LA 2R6ZA 2UVQA 3GUUA 3T34A 2V7QD 2YYSA 3A11A 3OCZA 3F1LA 4XYLA 2H1WA 1KYTA 1EGAA 1KIMA 3NHZA 3OOHA 1VSUA 2FRXA 2HV8A 3MVEA 4ZDKA 5HWSA 2H65A 1NATA 1Y5IA 4IVNA 2VDUE 4NFYA 1XEWX 3N2LA 3C85A 2UXDB 5EE1A 3OQBA 1H05A 1G8HA 2UUBB 3ESQA 1IXRC 4OQFA 2HK6A 4P82A 5DMXA 4U7DA 4LOLA 1F6DA 2GTIA 4LBVA 2ZYIA 1SKYB 4UJ5A 3IDZA 5I47A 1MB4A 1QB7A 3JYPA 2C8LA 1DKOA 1J56A 5K99A 3CLRD 3LZDA 2BSQA 3IHWA 4DQLA 3R0ZA 2ZBPA 3UWPA 3AI7A 1LUAA 3HJCA 5FNVA 3S8MA 3CUWA 2BCJQ 1SUPA 1W5FA 1UXOA 4MX8A 3OPNA 1P73A 1U8UA 5AM5A 3T3DA 2WHXA 1GRQA 4LXYA 3CF4G 1YU6A 1XZHA 1JT9A 1SUDA 2GJ9A 3ZLUA 5BYAA 4ODIA 3A4NA 4YDSA 2F48A 4M49A 4L95C 5DYNA 3WB9A 3F73A 3LCVB 2WSBA 5ELMA 3GJ7A 3ETJA 2N47A 3H1PA 5ICSA 2GYVA 4TLBA 3KPUA 1O97D 3L9XA 1QMGA 1G41A 5MN4A 2DPGA 2PMCA 1MU0A 3A4TA 4IF6A 1T3ZA 3OOEA 3X1ZA 5J4VA 1R1DA 3STYA 3TIGA 2XB4A 4W9NA 3DLAA 4ZPXA 4CTJA 2Z83A 3HK2A 4G0NA 2WSIA 3MS4A 5C8XA 1GG9A 4XDZA 3MMZA 1LNQA 2VP3A 1XKXA 3M6MD 3ZGLA 2ZRMA 2KLHA 3PFBA 4WA8A 2I3GA 1AHHA 5CGQB 3VHLB 4N5LA 4RZUA 5FA5A 3RPEA 3N1UA 4UDYX 1KTVA 4WKNA 1X7ZB 1MC1A 2ZRIA 2YFKA 4QDOA 4BKMA 2RGRA 1CDZA 4E2FA 1GAJA 1YKFA 2XCIA 1VHLA 1YR1A 3C4QA 3KB1A 4ARZB 4DMRA 3FPGA 4GL4A 3R3SA 4MB2A 5JY1A 3GWZA 4CM4B 3KJFA 5BV1A 1VB3A 2X9VA 3AEUB 1E5DA 4X64B 3SDZA 4C7VA 1F7VA 4CEIA 1OXUA 1RT9A 3FVWA 2QRVA 1O0CA 1MXHA 1RWWA 5HTKA 1E9VA 1V8DA 2FFRA 3PZRA 1QC5B 3QA3E 4YRDA 4AG5A 5A02A 5JPDA 2ZI6A 1D2GA 5K03A 1Y5LA 4LMPA 5F1PA 2Z2JA 1C4WA 1JTEA 1ICEA 2BGMA 5HFJA 3PQ8A 4YCSA 1M8PA 4PEVA 3VPXA 1H8HD 1H9BA 1V2GA 2ZQ5A 4LSGA 2RKBA 2VJMB 4JLJA 2CMHA 2YHIB 1JECA 2R1UA 2BM8A 5LP6B 3BGOS 5GOTA 3WE7A 3BBLA 2P4HX 5EJ7A 1O95C 3VVCA 1YT5A 4TMZA 1RYYA 3WRXA 4ER7A 4UFPA 2J3QA 1ZD2P 3NEJA 5J2TF 5AK6A 1HI9A 2ZRDA 2HUNA 5ALNA 2OBLA 3DFIA 5CFMA 3RVPA 2GPNA 1DINA 3BULA 5A05A 4BV2A 1E98A 1BH6A 2AOTA 1KI6B 2V7QA 3I9OA 1UBJS 1KI3A 3QQPA 4UHBA 1SVUA 2GRJA 3S29A 4JJAA 3SKVA 2Y8EA 1YL7A 1QFXA 1YJXA 2Y6UA 4M9ZA 1XD2A 5ENDA 3OESA 5T4HA 3MBOA 2GX6A 2OC9A 2OAP1 3LVQE 1K2WA 5BNTA 5JZOA 1IEQA 2YTZA 3O8OB 2ODEA 2AJLI 5AJWA 1SOVA 2PSJA 3FGOA 4KMMA 5AM0A 2R8RA 4KODA 5EIOA 5CUQA 3V4RA 2Y3IA 1AV6A 2I1LA 3WRVA 1N2SA 2MSWA 121PA 5IC6A 3F9CA 4PW0A 4BOYA 1M0TA 4QXOA 2DKOA 2EYQA 5KWVA 1U2DC 2OCPA 3WLEA 5D3ZA 3MBKA 2BFEB 3DW1X 1RMQA 1SU6A 4P7BA 3B7GA 4WY2A 3ZGXA 2QN7A 3BMOB 3KQKA 3R5KA 3HE3A 1JB9A 3MLBA 3V00A 2R65A 3NLLA 4UHDA 1JDPA 1X8JA 2D5AA 4M1WA 1KEUA 2ZYRA 3IOCA 3VPBA 1DJOA 1Y1PA 4HEJA 3X2EA 4CEIB 3K09A 1E20A 1PNOA 1N2HA 1XKTA 4N1AA 3OT1A 4WN9B 1GILA 4M3NA 1FUKA 3LUDA 4DMKA 4DSNA 3KALA 5C8DA 2M6LA 4CL2A 4WH0A 4Y67A 5C1OA 2QZ9A 2WYHA 1NW9B 3RYCB 1OWLA 1U90A 2GF2A 2IHUA 3DBRA 3OSUA 4RVCA 1Y9JA 2HAEA 4UJ3A 3WLNA 1UWLA 4NPCA 2EV9A 2NSJA 1Z56C 3IR6A 4NU6A 2P2YA 4QODA 2WFLA 5DXAA 5H9VA 3CE9A 2EZ9A 1AUXA 2IUSA 4EJ6A 1FSGA 3DE1X 3PEEA 1T1RA 2V7PA 4UW9A 1ZRSA 1AY0A 5F98A 2C4KA 3LQKA 1M2OB 4N49A 3GP3A 2D74A 3NBKA 1DX4A 1F8XA 1MEJA 1SN7A 3DT6A 4K2AA 5ALMA 3WXBA 1GYPA 3CNHA 1KJNA 3VAZA 2OGUA 2O2GA 4UVEA 1S2DA 4I3GA 1Q7RA 2VCHA 5C2JB 4AX4A 3U61B 1TK2A 1EG7A 2JHAA 2JGAA 3IVMA 3ET4A 1PTJC 3NBZC 1C8LA 2FPPA 3AEQA 3GEEA 4ERXA 2JBWA 5JHHB 4GO1A 3VOBA 1YBMA 3TWOA 3KL4A 3PEUA 4Q7QA 3C3EA 4EG7A 2HA3A 2JCVA 4J1NA 3KVNA 1WMEA 2PT7A 5I3CA 3HWWA 3BCRA 1FB5A 4K9MA 5LM3A 3JQPA 4WEQA 1Q5PA 2AGVA 2CVHA 2WT9A 5TIIA 3AEXA 4RPLA 3V1YA 1UMDA 2QN1A 1JIUA 1WE2A 4KIUA 3CTMA 1RC8A 1GPNA 2JNWA 4Q3LA 4CR6A 2XDQB 4C0KA 1BU5A 2J85A 3MB5A 3PGMA 3LDAA 5YASA 2XUOA 5MHTA 5HKKD 3ZK7A 4WOPA 4G5HA 3HB5X 2Q6IA 1A77A 1HE8B 4LE0A 5CK4A 3UT5A 3MRSA 3W90A 1SXPA 3F2VA 4PTZA 3GGGA 3KEGA 1EI9A 1G291 3KOMA 3O7WA 4WXPA 1VL1A 5AESA 2VAVA 5MN5A 1TM4E 1JEYB 4X45A 5JEDA 5HJ5A 5EWLA 4EYGA 1CUIA 1QVVA 1X3SA 3H9CA 1OV6A 1YVEI 3GROA 3SJBA 3Q7SA 4TYNA 2XZTA 1U8XX 1TRHA 2TMYA 3OAAA 5F5LA 3O03A 1G4AE 4LAFA 3B51X 1ODFA 4OJTA 4YRCA 5M3BA 4EFDA 2H8GA 3FDZA 2CLCX 4ETIA 4Z1MD 2JCBA 1PUIA 1RVDA 2WUGA 3L6RA 3Q3EA 5FIUA 4G0WA 5A5EA 4G81A 4ZRDA 4C7BA 4UTXA 2IRWA 3UY4A 4OJNA 4JKOA 3KB2A 5KNBH 4KR2A 2JEOA 3BIFA 4ZYXA 1UOOA 4RA6A 1IY1A 3G5AA 1USIA 3SNHA 3VHRA 1NVTA 1KP2A 2NX2A 2B4AA 3C3MA 4G6ZA 2H1OA 1ORTA 4P58A 1BRMA 4DWWA 3RM3A 1VECA 1CVLA 2GSWA 1P2VA 2QXTA 3J7AC 5E38A 3UNXA 4X84A 2P6NA 4WFJA 4R0VA 2PJDA 3VSDA 1SUEA 4PG5A 1U8TA 4NFLA 2PV0A 4QAQA 2WJGA 3JSXA 3JWEA 3LZ6A 1D5WA 3PUZA 2XHEA 4M99A 1OUMA 4HFRA 2XUZA 3WWPA 5JSQA 4M0FA 3W8DA 5ENVA 5KNDD 4RHUA 1DHRA 1Y34E 1CQPA 1L7DA 3CINA 3ELUA 3GBSA 2WUDA 2D3WA 3H9JA 3QYAA 1WG8A 4L2IB 2DBYA 4NBRA 4NYIQ 4MW7A 1SCUA 4PYKA 4V0QA 4B6EA 1WBDA 4O4IA 2F9FA 4ZHSA 4PV7A 2KPOA 1FMJA 2W6MA 3KK0A 4LQCA 4OF4A 4PCLA 3PVCA 5CA0B 3U7JA 4B8YA 2VPTA 3E48A 3E4DA 4IDFA 1Z2DA 3R7WA 4DY6A 4YRAA 4ZAFA 3NRBA 1SB8A 2UZ0A 5EKXA 1NULA 2FR0A 1DPGA 1GRRA 3OPQA 4G41A 4MWCA 4ZHQA 5IJWA 5LU8A 4YJ2A 4F3RA 1FMFA 1Z4PX 3ZVMA 3TQOA 2GOYA 3RJTA 5KHLB 2WDZA 4QJ4A 1JDBB 4BLOA 5HQTA 4PLGA 3FPLA 2ID4A 2R96A 3QEOA 4ONEA 1ESNA 3DBHA 4ZALA 5AVXA 2ECKA 4DA6A 3B2EA 1T2DA 4BE7B 1BXGA 4GMDA 5D3MA 4RF2A 2J9XB 1WX1A 1QYIA 3LY9A 3ZDAA 4UE3S 3W4KA 4JB0A 1NXVA 3FDJA 3TG8A 5HILA 5JAUA 1JSZA 3THOA 4XWYA 3BWYA 4YPVA 1TCVA 3D3WA 3T5CA 2CDCA 1JHYA 4MI3A 3ZQKA 2OCGA 4QTYA 4XVUA 4ISBA 1SIBE 2CZGA 3OE7D 1CZNA 4QOSA 3E7WA 3MJVA 2BGLA 1E6LA 1KU0A 3NHKA 3X43A 3ZCRA 1N6IA 1EVJA 4LDZA 4BGDA 1LZLA 4PZZA 3HVRA 3VR6A 2RGAA 3GEBA 3HI4A 1NV9A 2Z9DA 4FI3F 1RWMA 2R2GA 2X58A 2JIPA 3G1TA 2Q41A 2FWIA 3LVFO 1LX7A 5FKJA 2BFFB 2Z6UA 2O6HA 4RQAA 2X0DA 3UHFA 3DAYA 4JEUA 1KDTA 4FGJA 3HJFA 4WESB 1G6KA 1N9KA 1X3LA 4OXYA 2A86A 1XZBA 2HSDA 2NO0A 4WPGA 2QE7A 2QV0A 1BD3A 2BHRA 4K87A 1UDBA 3FDFA 5E6UA 5TPWB 4C9BA 5BSVA 3GZ4A 3V8QA 3GLGA 2ZRPA 3K15A 1W19A 3PNLA 4BL5A 2C8JA 4R31A 4EECA 2O2XA 1SVIA 4Z7NB 1V7ZA 3CVUA 2FR8C 3H2YA 2W6JA 1XTZA 3NOVA 2GPWA 5CTJA 5DM70 1H94A 3P2YA 2GBGA 1LRKA 1XB2A 2IIVA 3R6TA 4YJHA 2X7XA 1FP1D 1UMBB 4ZT7A 2FEXA 1JI0A 3BIXA 4PO1A 5FL3A 2W48A 1N25A 2MMGA 3Q1KA 4IIDA 4WLFA 1U0BB 1PD1A 1VIMA 4BZZA 1I14A 3CCCA 4YT2A 5J1SB 1GTZA 3H5LA 3EB9A 5LNK6 2ZYGA 3ECCA 4RZXA 3REQA 4D9GA 4EGJA 3OO1A 3K70D 4C2BA 1M2GA 4RXTA 5JT1A 3HRIA 1BMTA 4TQ9A 4EHBA 3U4CA 3KVVA 3FF1A 3KB6A 4TV8B 4C2TA 1QFYA 2LUOA 2HF9A 4LJ9A 1P7VA 1XDDA 1JEDA 3H5OA 2M6KA 4R16A 3BDIA 4EKGA 4C4AA 2R11A 1JIJA 2D1QA 1NJ6A 1I1NA 1YS6A 4FUQA 1SNYA 3JYNA 1OC2A 2EXXA 2I2DA 4N0DA 3K0FB 1D6MA 4XCQA 4BATA 3OCJA 4YXFA 3EY9A 3LP8A 1SUCA 3BUSA 1ZYUA 3LWDA 3QKRA 1VM6A 4OJMX 1C29B 3M34A 4YJKA 4CCWA 4RTLA 5UKDA 5IUKC 5T8KC 1JEEA 1L5GB 1GPBA 3FYUA 2HBQA 1XXLA 4FOTA 5FUYA 1RNLA 4DV0B 2RIPA 4ZVMA 3GBVA 2ZYSA 2FW1A 5T8KA 3PL5A 3RV3A 4C4RA 3UB3A 3MAAC 3TBFA 2RJNA 3F8WA 5DYGA 5LYJA 2IX3A 2I76A 1EZ1A 3HKDB 3Q3JB 1EJ2A 2EOAA 3X2FA 3KTDA 3ZU5A 3CH7A 4YRMA 1VKHA 2WR8A 1C80A 1Z26A 3W6ZA 1VCMA 1U7UA 1KJJA 1U9IC 2VOJA 2ZR7A 4ZWNA 5CB6A 1NPDA 2BTQA 1HE4A 4B3TB 2AOVA 2PYDA 3K20A 4UBNA 1I24A 5BUQA 5I9TA 3I6YA 2NQTA 2PZMA 2G63A 4G36A 4GVXA 4O8CA 3UJ3X 4BVLA 2GFIA 3RVBA 4TLDA 3I3OA 4OYYA 5FQOA 2G5TA 1HDYA 4E6PA 5GJVC 2YV5A 3KUCA 3KXDA 5GP1A 2VTBB 5FFFA 3WG9A 2XBLA 4V2UA 1V39A 1UH5A 4GMHA 3U9TA 1XFAA 2A5FA 1DKQA 5L7TA 5AVWA 3T5PA 1CEYA 4BFXA 1XDWA 2CDNA 5A1TA 1RCTE 4B3JA 5C4MA 1D2CA 2AG6A 1GRCA 1FW6A 2EFHB 1QGED 4AZ3A 2D54A 1ZUWA 2H4WA 2HHLA 2QQEA 2WHPB 4UTVA 4Z4GA 4X8OA 1CNFA 1TLTA 2PUFA 3WO1A 4A8JC 1KAQA 5LD2C 1ZLYA 1DC8A 3NM5A 1OGIA 3PIIA 1LV8A 3L8DA 1Z45A 1T26A 3U7QA 2E82A 2E5FA 1VHWA 3ECAA 3BX1A 1JILA 1LBQA 5ALEA 4B82A 3EXFB 4ZOLF 4BMZA 5EJGA 5AHOA 5TF0A 1VMAA 2ZDHA 2WYVA 1BDBA 3VPFA 2CW5A 3JD1A 3OLWA 3PBKA 2DT5A 3SSAA 3VYUB 5JXGA 3W77A 3FOZA 1NE2A 3R9IA 4B4OA 2I99A 3GR6A 1XXHE 4BFCA 1RKVA 3ENWA 1KBZA 3W2FA 3RSHA 2OORA 3P9ZA 1HDOA 4RDCA 1CUGA 3V9PA 5ED4A 4AVYA 4PX9A 1Q91A 4D42A 4OHFA 4H7IA 2HK8A 3UK0A 1PCXA 1ETHA 3WKCA 2LW7A 4IFTA 1YK1A 3IP5A 2AEJA 1AQLA 3OF2A 1SCNE 1SD1A 4B7ZA 5ALFA 1RP1A 3ABZA 5D01A 1EX1A 4RVUA 5FI1B 2VRCD 3DDHA 2GILA 3DT9A 3RS3A 3WNBA 3EG9B 5CFZA 5F23A 1TA0A 3S99A 4ZOQI 1DEXA 1KMHB 1JJAA 3BFPA 4WESA 4PXAA 3T5BA 4HWSA 4U39A 3RCBA 3TQQA 1S01A 5AW0A 2J9FA 1NV8A 1IOZA 3AETB 3DUWA 2PBFA 5F1KA 3FKSA 1KH3A 2Q2VA 4GI5A 3SE0A 1OXXK 1RHKA 4AMZA 4R2MA 4KQXA 1K3TA 3IVXA 4IMPA 4NNOA 2HMYB 2VA8A 3C3BA 4ZREA 2D7DA 4G4IA 4X8LA 3E0XA 3HKEA 3O38A 3LC2O 3FOWA 1Z5UA 4C4TA 3UWKA 1F0YA 4IH4A 4OHUA 1EEXB 1SZPA 2WZDA 3L0CA 2EDCA 3WL8A 2B1JA 3L4BC 4NV3A 5EESA 2F7SA 1PNRA 1M6NA 4DMGA 4YDRA 4MRRA 1TKCA 4TKZA 5HUHA 4F3NA 4PHTA 1SHLA 5I7WA 5HMMA 2FSVC 2A9QA 3NJ4A 4J4HA 1MAWA 4P4NA 5M29A 3LJKA 4IGIA 2UDPA 3KELA 1ZH6A 1U3VA 3QWAA 5I9NA 2YASA 2REOA 2DULA 4ETNA 4YJHB 3I62A 1QHGA 2JARA 1XEFA 1GU1A 2HHJA 3GLRA 1O8CA 4M4SA 4RWZA 3CHYA 4HPXB 3KSUA 2HPZA 3A26A 2Q8PA 1EA5A 4QELA 3V33A 3F49S 3VNUA 1WCIB 1F12A 1TCCA 2IYNA 2OENG 2XB8A 3AHCA 2D7CA 1XTIA 4P53A 4URUR 4MUNA 4MS4B 4ENWA 2Q46A 3N9IA 4MMXB 5IHPA 3WGKA 4QTXA 1G8PA 1RWOA 4XLZA 4ER3A 1B4DA 4RGVA 4BJ1A 4F72A 3FKQA 3NWOA 3G5LA 4DMHA 3GFFA 3KOUA 3KOWA 3C5HA 4IQ0A 4TWJA 5E6UB 1SO8A 5MGBA 3ZI0A 3VISA 3HADA 4BCDA 4CG0A 1REQA 2G0AA 1YKGA 3OJXA 2FFAA 2FH5B 2I03A 4PZYA 3VPSA 1Z08A 2XCQA 3DAOA 3V1UA 2DPMA 4UTPA 2AFIA 1GU7A 4C0JA 2G71A 3LC0A 4C4ZA 4AS2A 2QNBA 3JALB 4M21A 3JR3A 2PSDA 1PVVA 3NCTA 3KNZA 3K8QA 1KWKA 1M6VB 4I9NA 3AOEA 5E0KB 5LDDC 9MHTA 2HSEA 3WIDA 4NE9A 2A5LA 3TD2A 4DSZA 2VRNA 1FSZA 4WAUA 2ODBA 3FYSA 5CYFA 2I78A 4DCTA 5FTLA 4PZDA 1J09A 2P6RA 1HM5A 3FLMA 3DHEA 1NW5A 3AEQB 2Y67A 2OT3B 4CGYA 1SC1A 1PZFA 2DPYA 3LL4A 1L4LA 4MP6A 2QTHA 1QV7A 2D4AA 4J0DA 4H3VA 4OX9B 2YR0A 2JDID 3HRHA 4FJ1A 1TT7A 5A9RA 4WTOA 3DZKA 4NG4A 3R7DA 1PLJA 3D0RA 5EN4A 5HOEA 2WNIA 4C5BA 4YCAA 2XWQA 2MINA 3QMPA 3R3XA 4BP9A 3A3KA 4DXAA 4TTTS 1K8XB 2ZLBA 4LECA 2BVNA 3LP5A 3CFYA 3DR3A 4RA9A 4XSVA 4EY8A 3EQZA 3LDGA 3PE6A 4HH0A 3KEQA 4BU0A 5JHGB 4DT1A 1OLXB 3L46A 1T5TA 1KJZA 3BCUA 4FYJA 4UU7A 4E7PA 1E77A 4YECA 1WTCA 1SCDA 4OJQA 1OB2A 4KXVA 2QX7A 1WETA 2HRZA 1UBHS 1IH8A 1Q1QA 1RPJA 4G8CA 4AJ1A 4X66B 4EQ6A 2PH1A 2NVBA 5CXXA 3N0TA 5E1OA 5F21A 3DVAA 1RFGE 4RTOA 1CDEA 1FP2A 1PSZA 3DE4X 3FUXA 3HR8A 3LQRA 3W4JA 3D8RA 1PG5A 2GPSA 1UF9A 3QPBA 4GMGA 5B12A 3ILXA 3LWBA 5H0IA 3Q6MA 1J0EA 4N8DA 2XB9A 4YACA 1IVYA 1P1FA 2IYTA 1HQCA 2WJJA 3TTSA 4OHOA 1NLFA 1N0WA 3I61A 1XWIA 3BGDA 1UC9A 3GJ4A 1JAXA 4W1SA 2P27A 1MRNA 2WC1A 3TLZA 2IUEA 2QTNA 3SPXA 4DOMA 4EHJA 4LFAB 4NS4A 1TMGE 2ZQYA 4A92A 4EKDA 3TL2A 4CFSA 3ZDFA 1HTTA 2W2KB 3HO1A 5KMGA 2XUKA 3SSMA 4KOAA 5J4YA 3ZHXA 5DH9A 1EFAA 2G6BA 3TBKA 2C2XA 1J39A 3VJMA 1VG9B 2FZKA 3LUKA 5EIWA 1ZH8A 4WACA 4GOLD 5B6JA 4P83A 2FX3A 1QZZA 1N6HA 2FTKE 2QPLA 1ULUA 1U3GA 5ETJA 5A06A 3R0XA 3RI3A 4GG1A 3HVHA 4G5QA 3ABIA 3WLFA 1UBUS 1R0YA 5GWXA 3NXKA 3ZKAA 3BD6A 5IS2A 1GL9B 1GV1A 2JJYA 1ZW6A 3GGOA 3PGVA 4FYIA 4BZWA 1NQTA 1UC5B 3RYCA 3I4FA 3QH4A 1T9DA 1XMIA 2BWJA 2I8CA 4U7GA 3H0EA 3RU3A 3U49A 4MGHA 1XAHA 2QMYA 3EDOA 3RFVA 3SCZA 5HFNA 3GLFE 4KREA 1JIQA 2ASEA 3EXEB 4C4PA 3QELB 2COKA 1D9ZA 3LGSA 4X3PA 2B34A 3FSJX 3SXUB 2I2WA 4GSYA 1TVEA 3MTQA 5IK2D 3SZMA 1GQYA 1ENYA 1MTOA 5K8IA 4GQAA 3PQ5A 5CP8A 4JXJA 1KVQA 2KMLA 3BFXA 4RZSA 1E5XA 2IYYA 5KOHB 1KARA 5JDIC 1DZIA 4UZFA 4U00A 1GSHA 1XLWA 3M5CA 3GLHA 2NUPA 2WUWE 3IPCA 4F8EA 1ABEA 2B8EA 3MQ2A 4KSYA 4PRZA 4P7FA 2I4IA 3VKWA 1JXAA 2BSXA 4IFBA 2FRVA 2QRZA 1P5ZB 1XMSA 2NT4A 4LWPA 1H85A 4YJ2F 1CRPA 5B57C 1MW8X 1L5HA 3WDKA 1SG9A 2AUTA 3BWMA 4ZAXA 5GONA 4KR3A 1ZGCA 2O8BA 3H9UA 1ZU5A 4IGKA 4AU1A 4E30A 2HX1A 3BB4A 2ZSBA 3EFBA 1FYWA 3FSEA 4LKOA 4F2GA 5D7BA 5CT9A 4X91A 2FPSA 1NVBA 1FEZA 4YLYA 2AZDA 1T43A 2GYWA 2IW3A 3O92A 5L4SA 3CKKA 1VE9A 1VHDA 4OHKA 4LNHA 3T5DA 3DVLA 4EJSB 1BH2A 1PNVA 2GAAA 4D9MA 5I7VA 4I6EA 2VHCA 3KVOA 4J3JA 5MN6A 3CX3A 4WERA 1BX3A 1D09A 3SZRA 1XAIA 3RUAA 1X9IA 2B2CA 1E7QA 5L6MB 1P75A 3OMXA 2DHRA 3P0EA 4L85A 4B6SA 4YAIA 1FW8A 3ER6A 2HPHA 3M4YA 4UD6A 3DKKA 5F12A 3A1SA 2G8NA 3GEDA 3SICE 4ZT5A 5DHSA 4EKIA 2D2VA 1ORRA 5JMPA 4ZYWA 2IPAB 1T25A 1XPRA 3VI3B 4PNHA 1Z8NA 4G26A 4OQZA 2HA4A 5DTQA 1PEYA 4A10A 2GD6A 2I3DA 7ABPA 1A88A 4TS1A 5K4GA 1LTKA 2CXSA 2CHUA 1CUSA 2HXGA 5BWBA 5K8VA 1NRXA 4J07A 3NO4A 3ZBUA 4PN3A 4D80A 5BURA 3IJ5A 2A0KA 3ISVA 2X0IA 4R7ZA 1Z6QA 8GPBA 3PVSA 1R5OA 4B6QA 4HWKA 4LJYA 3A1FA 4FYHA 2R6JA 1YZVA 5IJZA 1LLQA 3NYWA 3BXHA 2K4MA 4G5FA 3MB8A 3NNSA 1VJDA 5CHYA 2BI8A 2C9BA 4MO2A 1FUYB 2ZEJA 4AJLA 5KNCD 3WYFA 4DS3A 2B8NA 1M1UA 2WNHA 2Z09A 1HO3A 1E4YA 2VYVA 3HP4A 3LHIA 2VTVA 3PKJA 1Q21A 2HSZA 4HQLA 4KE8A 4NYJR 4RD3A 4WT7A 1OLSA 2KS6A 3V7YA 4ARZA 4EG5A 4LSMA 1AQYA 1D1QA 2XMRA 2Y9PB 1F38A 2R00A 5ED0A 4EUHA 5BN3A 2PKRA 1YULA 3LZCA 1SHUX 1E2BA 3ORFA 3M9XA 3L4KA 1X7ZA 1LRLA 5IYZB 4JENA 1JI3A 5JLAA 1P1CA 1PJSA 5FNVF 3FY4A 1OWMA 5CBKA 4XYGA 1UZNA 1YUMA 1KI2A 4G1EB 4GBGA 5AI5A 4YIKA 4F56A 4TV8F 5KSZA 1Y8RB 4RORA 2JD0A 3COSA 4NOJA 5JJLA 1A98A 2D00A 1VE3A 1TM1E 5CK5A 1RIIA 2F9LA 2OCKA 3DTTA 1F8FA 1G2PA 1MQ8B 3P0FA 2C5LA 2OK8A 2Q0XA 1TZ2A 2YJ6A 4A1OA 1YV9A 4BQOA 5L4LA 3GY0A 1B2RA 1YJQA 2FKNA 4H7JA 3U26A 4GPAA 4MYDA 1SVKA 4CKEA 2IU3A 1E69A 5CLLA 4LCEA 1DP4A 3V97A 1SCIA 4R41A 5I7AA 4PC1A 3RVLA 3T35A 3C3YA 3NBQA 4DBVO 1IBLB 1QS0B 2AIRA 3GLQA 3AESA 2XCTB 3LUBA 1OVGA 2NLOA 1M76A 4C30A 5LP6A 2YQ5A 2F2TA 2G1KA 3IQFA 4MWBA 3HR7A 4NCHA 4W9RA 2ZAIA 4A0SA 1VIYA 2C2ZA 2Q3BA 4UU0A 1JIXA 1GPH1 1AZWA 1M7GA 2OCBA 2YWFA 3CW8X 1T1SA 1XWFA 3TBHA 4LE1A 5DRYA 3LY8A 5AUPB 1R37A 5GQSA 1EJBA 1CERA 3PZBA 4LEIA 4QEKA 4FZVA 1RPZA 5IH7A 3ZW8A 4CKCA 1SCJA 1B2LA 3TIVA 8ADHA 1O9HA 3CKYA 3EXEA 4MW6A 4BJ6A 3ACBA 3I72A 4Z8YA 5HPYB 3NH6A 1Y3IA 2O3RA 2NU9B 3DTVD 4EVQA 3BL5A 3O83A 5D87A 4P1ZA 2BBTA 2SCUA 2I22A 4DADA 2DWPA 3AW9A 3KUUA 1ABFA 1DELA 4MA0A 4P3PA 2YN0A 5BQPA 1Q6YA 1CUJA 2VBCA 1N4AA 3U7EB 5BUSA 4IO0A 4XCVA 5TGTA 3RK0A 5K6RA 2XGOA 3ZY4A 3TMAA 2XWPA 3SYKA 3WOHA 1I2DA 1S7CA 2X7JA 4XB6B 2XGMA 1G9SA 3Q3IA 3L3BA 2QSYA 1HK7A 4RESA 2V4UA 5ICFA 3KEOA 1I1HA 4HWOA 4KDEA 4AS1A 2CGEA 3OWXA 5EZSA 1P2FA 4H1UA 2CBXA 4LZOA 4LHZA 5DN9A 5JZBA 1B0AA 1V2HE 5I4KA 3KV3O 3QIVA 5LZ4A 3TR5A 5CD1A 1J5EB 2Y1XA 1UZAA 1XRSB 4NFSA 3IPYA 2MCFA 1GTSA 1MC8A 1N0IA 5D5QA 5K6AA 1QF6A 3MWJA 2XQGA 1Z6TA 2CDRA 4BTVA 3RSZA 4RIFA 3OMWA 4YDQA 1P9RA 4DHWA 4QBHA 5J59A 3LXUX 4E3WA 4OI2A 4TM8A 4TL8A 1ZD5A 3V3KA 2ZJ5A 5I01A 4B3BA 5CFLA 1HEUA 2DUNA 2Z4RA 1GZ7A 1U0OC 1WUHS 1RWBA 3ED5A 1QZUA 4Q9DA 1NQ5A 3WMWA 5CB8A 3T9BA 2GCGA 5F64A 3IAM1 5T6MA 3D7LA 4K6CA 4PX2A 2HEIA 1ID1A 2P4UA 3VZPA 5TEWA 2EW8A 3EPKA 2XOKD 1I5EA 2O3TA 5KQGA 3K2IA 1T0IA 1ONNA 1VP3A 1WUKS 4M2LA 1L8XA 1SQ0A 3KAKA 2O4UX 2ACWA 4DPKA 4QGSA 2JI8A 3A36A 1NMSA 4KNWA 3ENKA 4RVSA 1KRWA 4JR1A 1ZC4A 3ONNA 2CYCA 4TL6A 4N47A 4CTMA 2G6TA 4HZIA 2P1RA 1C3JA 4MI9A 3RS0A 3USZA 1EFTA 4J4TA 1AUPA 4TKMA 2VLBA 1L5MA 2V1UA 1Z2NX 4F6RB 1GRVA 1W49A 3OEEA 2ZYDA 2PANA 4UXHA 1Z28A 1C9KA 3I8SA 3QEKA 1N78A 3RSFA 2XGGA 4FDAA 3A9VA 1E3WB 1T8WA 2VP5A 1XOIA 4MR7B 4CHGA 2QRPA 4OH7A 4XWGA 3CJRA 2NP6A 4ROSA 2HLDA 3CVVA 1J2JA 5BN5A 3H86A 4XLTA 2EBUA 3FFTA 5TEVA 1TIKA 1I6KA 2P41A 4N65A 5BVGA 1W36D 1M2KA 3MTIA 2FB9A 4UTOA 3MD0A 4CMKA 2H7VA 1OZ0A 3D2LA 2E89A 4Z0NA 5A5VA 1BMQA 1YR3A 3OX1A 1QOZA 3NONA 4DR2B 3H7IA 3AFOA 4E70A 3OZGA 3TAHA 2R1ZA 3O73A 1Z4LA 2WA1A 4NJMA 1SXJB 1FSFA 3PWSA 4GXRA 2Y6VA 5KYYA 2BP7B 1Y1TA 3O8OA 4OQMA 4BE9A 2EIHA 2WYWA 5IZCA 1KYVA 3AWIA 3PR3A 3RG8A 4ZJPA 3SS7X 2CXPA 1NYRA 4H3SA 4FFRA 1C5KA 1U0JA 4ZI3A 3JQEA 3R40A 5D00A 3ZCXA 2X23A 2WG1A 1X15A 3JZFA 1LPSA 3V8MA 3AUAA 4XAQA 2A0UA 5IPFA 1Y98A 4QRDA 1QIIA 8ATCA 1RE0A 1U2QA 3ROFA 3ZE8A 4G85A 5IUNC 3CS3A 4A8JB 2B4YA 3AHGA 3H1TA 3M5WA 4K6OA 2ORVA 4BECA 3I1FA 2EZTA 2GNPA 2Q9UA 3DHWC 3AJ8A 3K3PA 3IEIA 3OQIA 1GUDA 5CFNA 5ADWA 4L8FA 3ABQB 4I8DA 1F2TB 3KLNA 4CKXA 3BE5A 3LGAA 3JD4A 4BO1A 1IY8A 4F46A 4ZEWA 1J99A 2ES4A 2J67A 3E7DA 1NIJA 3HZHA 1IZ0A 1I7SB 1ZINA 3PKIA 1P7YA 1WSDA 4ZU6X 2O1WA 1YA8A 4ZFNA 4RPIA 3P4XA 2ZT7A 3ADDA 3UKDA 4KQWA 4L9SA 3F71A 4FBMA 2GVDC 1K7FB 1Q7EA 1MX1A 3MUFA 1R50A 2WF8A 4P84A 4X8HA 5FTJA 3ZPXA 2B2XA 2YN4A 1XTQA 1U5BB 1WMDA 2PU7A 2ET6A 1K86A 2O52A 3PC2A 3U4AA 3WQSB 5WRFA 3WLPA 1ZGHA 2HT1A 1XJ5A 2BHNA 2CCKA 4R3WA 5I4CA 4M1SA 1ULAA 4N6NA 1ZN9A 2DM6A 2P69A 3ZVKA 1RR6A 1GZ5A 3ESAA 2M32A 4C2UA 3PRHA 1ZRMA 4TM7A 2VSQA 5C46F 5K3AA 1SURA 4OFBA 1XTTA 2PS1A 2CCJA 4YI3A 1QGUB 1XAJA 4F45A 2J41A 2C95A 1G8AA 2GSDA 3DEYX 4H9GA 4XZ3A 2YWBA 5DP1A 2MR6A 3JD0A 4DCMA 2P79A 1QRAA 2XSZD 3EBPA 3Q9LA 4HGRA 1AU9A 2MYUA 4KVFA 4GNKA 5T6BA 5FB3A 1KE2A 5J23A 1JEAA 2JJ1D 1RYDA 2W8BB 1P4JA 3L0OA 3QPVA 4U2CA 3QLJA 1X42A 3RHTA 3AC0A 5AKLA 1UFOA 1JA9A 4JCOA 2XMPA 3JQCA 3MLAA 1A4XA 1T6NA 3HA3A 1EFUA 1Y1SA 2ACVA 4IIUA 4WLUA 1HDRA 3ADOA 2ZVQX 1HH4A 1CUUA 1H2BA 2AR9A 3HB7A 1KRXA 4DBLC 1Z0JA 3I5XA 4FE4A 1ZXBA 1QP4A 3G0GA 5JH7F 1M66A 4YUAA 3AF2A 4RKEA 3TEJA 2GHTA 3I2JA 3UA4A 4GC9A 4KYUA 4PPQA 4YPOA 1L5OA 1EVIA 2J3IA 4FE7A 5ALKA 5CA0F 3PXAA 4PZAA 2QAGB 4N3GA 4UHHA 1L7PA 2AK3A 4H31A 1XTUA 3SEFA 3AI3A 4V3BA 2FQ1A 2G4VA 3ZJ4A 1W88B 1KMIY 4D8YA 4B76A 2WW8A 3E9YA 4MRPA 3VHXA 1EHYA 4K9PA 3FMIA 5KYWB 5KOJA 1PYDA 2JHCA 4QGGA 1BGXT 3STWA 2V45A 1OGYA 4H3HB 1JFTA 2D2EA 1OIWA 3NX4A 1ZIOA 3O9ZA 1XK6A 4HWTA 4XYBA 2HU2A 1N7HA 1R66A 1RHQA 2QLMA 5DM60 3GH1A 4BMXA 3VR3A 4EYEA 5KC8A 2I66A 1CQIB 2QUBA 3OE1A 2ZUDA 5L95A 1WR8A 2B8WA 3CX6A 3H97A 3HXLA 4GAEA 3S1AA 4X6UA 4TRNA 4DIOA 1V37A 2WD7B 4KQ6A 5ECDA 4R6WA 3WYBA 3MMNA 1VYVA 2J4CA 2O6LA 3IDFA 1LBEA 2PWPA 1P62B 3O2JA 2JH8A 1TECE 1FF9A 4PFJA 4B79A 5LQJA 3QF4B 3AFGA 3QLUA 4NBWA 2HLHA 3KJQA 4U2DA 3WSWA 3CZRA 3ZNOA 4CR7A 2WWHA 1UPCA 5JSZA 4JXZA 1T9CA 5BSWA 4JR0A 5JWHA 3IMCA 4J0FA 5JOQA 1EKXA 2YYZA 4HAZA 5BSMA 4DLPA 1WDTA 2IS4A 4L57A 4XVRA 2EJWA 4JDPA 3IOEA 3HFSA 1D1TA 1YVUA 3I52A 3SFZA 4LZLA 3FE2A 4O5OA 5TPZA 4DREA 3IUBA 1UDAA 4WFKA 1RIFA 4EF4A 3ROQA 2OHXA 2PBZA 3DUFB 3LKVA 1T5DX 4MIYA 3F5MA 1J7JA 3ZZ0A 4PYNA 3H1FA 3A7EA 3AW8A 3PTLA 4RK7A 3WMRA 4D9KA 5J40A 2IHNA 4N7RA 1YL5A 1T24A 3P9PA 1PZGA 4IZHA 4XTCS 3UGJA 4ZGBA 1A8PA 3E9ZA 3GFRA 3QLTA 3UA3A 2DKNA 4E14A 2GN6A 1VJGA 5A71A 4CMHA 3LT2A 4MW1A 1JR3A 4LRSB 4RE5A 4UOQA 4BC0A 3P45A 5E2BA 2E0IA 1RXWA 2R8BA 2R7AA 3ZDDA 4O4LF 3PXBA 4NQRA 1D4AA 4BO7A 1ECJA 3DA8A 2P4QA 2VFAA 4BNIA 5HQ3A 3IKVA 3LX8A 4MS1A 1QKJA 3GQBA 3AFIA 3F6YA 3RUHA 2WJ3A 2OZKA 3D2AA 2J5RA 5FCDA 1KFKB 1BGWA 3C4JA 4NE7A 4EMUA 2NZYA 5CA1F 3NKLA 3SVLA 2FSVA 2RHTA 4KMSA 3I28A 4RCVA 3DAGA 3QWFA 1IG3A 4B9EA 3OIVA 4OQEA 2ISSD 4LGYA 1ST2A 5H3LA 4IRMA 3WX0A 4IDPA 2X0EA 3R77A 3CH5A 4NCBA 2WNSA 4RPHA 1GUAA 3BEOA 3QVJA 1K89A 1XD8A 2REQA 1D03A 5DVZA 4CFYA 4ENVA 3GYGA 3W5AA 2J0VA 2BKVA 1TJPB 4X1YA 3F3YA 1L1FA 4CF6A 2MSKA 2P2NA 1Y3FE 1CHDA 2CYAA 4ID3A 2KHZA 4L9AA 4EHDA 1MORA 4B6OA 4PQRA 1VP9A 2PTGA 3WO0A 4EG1A 2BUBA 2ZIXA 5EUBA 4ZAGA 2OEPA 2ZIWB 4DDMA 1M67A 3EZXA 2AC2A 4G2TA 1T10A 3RVMA 3MWEB 4UHEA 2HNKA 3RC7A 3WMXA 4ZO4A 4X61A 2OGSA 2ISCA 4YUWA 4ZK2A 3PA8A 1K5DA 1KQNA 4C43A 3FJ1A 3JATB 2UYCA 3U44B 1PSWA 1R88A 3GGCA 5FLKA 5ALYA 2A5YB 1VDMA 1YUNA 4TRRA 5B7PA 1TZMA 4LRXA 5FUVA 4OMUA 4ECEA 1KYIA 1EDOA 3I5MA 1E6MA 3QFCA 2QLBA 4DARA 3U4QB 2JFOA 1ACLA 4YYZA 1KTIA 3E4CA 5KNCA 3H3FA 1J4AA 1M5TA 1NUAA 2OXRA 4YK7A 5DI3A 3S7TA 2C1XA 1T2VA 2XNDA 2XV1A 3T9AA 4IV8A 3WGNA 1NG1A 1E2GA 2AX4A 3P9SA 5TNXA 6ABPA 3PNPA 2VYND 3I0MA 2CKDA 3KYIB 4XRGA 3L1UA 1NPTO 2NADA 3EEBA 1I1QB 3KS9A 4HKTA 1GGVA 4KWIA 5TQJA 3TF5A 2VZLA 3DEKA 4P4SB 5HTOA 2CLMB 1M74A 1QYXA 2WWTA 4OFWA 2AX3A 3F6CA 3EFOA 3KZXA 2BGKA 2ZB4A 3O8RA 2B3DA 5DDIP 1OAOA 1ILEA 2XCOA 4PLYA 4Q4LA 1RWKA 2ZIEA 4JL6A 3V4OA 3X2SA 5KQLA 3L7JA 1QXSA 2BI7A 1GAXA 1FU8A 2BKEA 1LSUA 1Q3KA 1X94A 4FOOA 4B32A 4DM7A 3CRVA 2BTOA 1CE8B 5JWRA 1WDWB 1E9AA 2E85A 2PRYA 2PS9A 5JAMA 4ZPJA 1JDUA 4DV5B 2AFIB 3AJ9A 4V0NA 3G8DA 4KJZA 3W9YA 5GAJA 3HCNA 3FR7A 4GSKA 4Y2YA 1MOQA 5IU6A 2JF0A 1THMA 2XUJA 3EXHB 4CL0A 5FBVB 2C7QA 3IR7A 6REQA 5AJXA 5BORA 1S9DA 2OO5A 2VUSA 3KM0A 3T1NA 2EFDB 1VJ5A 3LDFA 1DJPA 1MENA 4KCGA 5AH0A 5JQWA 4TV9F 2QMEA 3VKUA 3IVRA 1JA1A 2O2CA 3GAFA 5IT5A 1NBMA 4KL8S 2HNAA 1BFUA 4FIZA 4JLPA 3KZCA 3RVKA 4DZTA 2Q3JA 4UM9B 3UEOA 1A8SA 4N5IX 4HLUA 2W70A 4ZIRA 1ISFA 3O8QB 5CLQA 1BW9B 2DFNA 2QD5A 3BJMA 2YY5A 1SBTA 3F78A 1QIHA 3OLCX 3NASA 4E4RA 4ER5A 2FQYA 13PKA 3D6FA 4MS1B 2I4MA 1GZUA 2WD8A 1YZFA 2WFAA 3P2EA 5B4TA 2P8JA 3SQDA 2IIBA 1J20A 3WQHA 4J29A 2I4RA 5M34A 5JYCA 4XA8A 1S6YA 3KETA 1F2UB 3EVTA 2IWHA 4X20A 4X6XA 1C14A 1RZVA 3V7FA 4B45A 1LEHA 2QMHA 2UYGA 2VQ3A 1H1TA 2XTAA 3R23A 4PQYA 5I7RA 3L1JA 3NGXA 3IDOA 3ZHZA 1TOAA 4YN3A 2EGGA 1RTTA 2B69A 2BR3A 5ALDA 5FPSA 4YGYA 3SHFA 4ZJZA 5C5CA 1FSPA 4CKCB 1IK6A 2IIQA 2YMLA 3AQ4A 1N92A 5EIBC 1JQAA 1WCV1 3IMFA 1NBAA 3AHDA 3H1EA 3HVUA 2F4NA 2I6XA 3FTQA 3HR4A 4QDUA 4JC0A 5TQ2A 3KYJB 1WDKA 5IDQA 5M2QA 3IT3A 3RG2A 4JLMA 2A35A 5I9LA 3OZVA 4H7PA 1FU4A 2CL6X 1RYNA 2OCXA 2H5IA 3KZOA 3GUHA 4LYJA 3WGGA 5FEUA 4HB0A 4JMPA 3OFVA 1NBOA 1DCKA 1NP3A 3NB0A 1HNZB 3UFBA 4L8WB 2VG8A 5F7XA 1WVMA 2DHQA 1TZBA 2M6SA 2JFQA 3IBSA 3TZBA 4EUSA 4RHXA 3PJEA 4Q1VA 2GKSA 5FHQA 5SYMA 4LF9B 1XQ6A 3CVJA 4GOMD 3PYLA 4NPHA 1UXJA 3K70C 3L8HA 4PWYA 2I1VB 2OYCA 3DJFA 1TMKA 1R27A 1DAIA 2H4XA 4LV5B 1NPYA 2V55B 1C3OA 1COZA 4QNNA 1XJCA 4WJZA 5EXSA 3FNEA 3CZ4A 1GV0A 1VRWA 1Z5PA 4MA5A 2E2WA 3OIUA 3OUUA 4P0TA 4IV5A 4LTMA 1Z37A 3WQBA 1PL7A 3L05A 3TLMA 4IHAA 4LVUA 4BUZA 1MJGM 2NUAA 2FLKA 4QUKA 5JXHA 2Z5VA 3B9QA 2OOKA 4GM1A 2YZ7A 3Q7EA 4W4TA 1DAMA 3N8KA 3ZE0B 3I2IA 1DJNA 5FUQA 1D1SA 4AYWA 3BWVA 3M70A 4GHWA 4OYHA 1DOHA 3WYDA 4YV7A 1L8QA 1TGYA 4DQXA 4QXAA 3Q9NA 2Q1UA 1RHRA 4UC0A 5KWSA 4DJ5X 4ZC1A 1QAMA 1QP7A 4H27A 1Y7PA 1AUVA 4E5KA 2WM2A 4LPSA 1WXDA 3OCYA 1N0UA 3JAWB 1ID8A 4Y7DA 4JYAB 1RAIA 1YHZA 3MNFA 2MT9A 5CLGA 8LDHA 3A6DA 3PXXA 2AG1A 1I4EB 3VPCA 2H4FA 1BWSA 3JCZA 4ZEXA 5A7FA 1OI7A 2QTBA 2V0NA 3PICA 3C0KA 4RLSA 3V34A 2Z6AA 4KPFC 4KW7A 2QR5A 3H8VA 2YWHA 1XHFA 4P9NA 4MI6A 2YS6A 1VKRA 2ZP1A 1D2NA 1M72A 1S1CA 4HDNB 4WV3A 1J8QA 1J9EA 2JHPA 4HNRA 3TRDA 1ZWKA 1NSTA 4H35A 5CEEA 2OE2A 4WZAB 1ZJYA 3DV9A 3R3HA 3TW4A 1G4HA 1TC1A 3IOMA 2YDYA 2XUDA 2W6OA 3KEFA 3M1IA 3CLKA 3JQ7A 3JY6A 1DUIA 1OX4A 4RFSB 4W8OA 2YZMA 3I9LA 3VVMA 4DM3A 1V9CA 4BRUA 3VVLA 4IL5A 3N6VA 3P4YA 3RRMA 5SY4A 2QS9A 4GMXA 5KHOC 4GMFA 3UPDA 3JAKA 5C32A 1NW8A 2JIMA 2N1MA 1V3QE 3UPTA 2G04A 1SOAA 1TMYA 4KQFA 4ZICA 4PANA 3HUFA 1UKZA 4QO8A 2C00A 2Y0EA 3KQPA 3RSOA 2ARKA 4PU0A 4BFYA 5J2TB 4B34A 1W4AA 4IJ6A 1EFRA 4R81A 3S5JA 3KXPA 1P0IA 1YR6A 3LLUA 3SVTA 4F4JA 2JCGA 1L7XA 4KQGA 5EQDA 3JQAD 2CVOA 1L4NA 5H81A 5H68A 4Q7EA 4G3XA 5LIRA 1OI3A 1CG6A 1K6EA 1UUFA 3A1EA 3NAMA 4C4YA 3GLKA 4F91B 5JE8A 1YE8A 2FXIA 2VBFA 2IXBA 3DTNA 3GELA 2E49A 3I0NA 2XA2A 4GOJA 4KQEA 4N8EA 3K2QA 1Z06A 1T5SA 4URYR 1KMCA 1K06A 1YUBA 1Z2AA 3MPUA 4H7HA 1A0OA 2PEZA 3VYRB 1FXWA 1MABA 3CT4A 4FHEA 4K40A 3DHNA 1HT3A 2HA6A 1KXZA 2Y27A 4FEGA 4EFKA 1D04A 1R74A 1TLLA 2RK3A 4DZZA 2GWHA 2F55A 1Z0FA 4RZQA 1M1YA 1N6LA 5AQEA 4B7AA 4F6CA 4WN3A 1YU9A 4QO7A 5KTKA 3ETGA 4I9HA 3U3JA 3ZGOA 2ZANA 2JLCA 4YRPA 1EGQA 2OMEA 1SCQA 2R6GA 1JFVA 2YUIA 2FGJA 2MOKA 4I9UA 4J4BA 4LN1A 2DHEA 1P9LA 4CI0B 2ZE8A 5BWNA 3QEJA 4ANFA 1TYDE 4OV6B 2ASVA 4K6GA 1SU8A 2EWWA 2C7OA 2CKMA 2EF1A 1GADO 5CEJA 4F3KA 4FW8A 5H3HA 2IT1A 2ORYA 1B76A 3RRYA 3EJ6A 4BAUA 2Y68A 3P32A 1EJ0A 2A9FA 3S28A 4TGLA 3K0EA 4IG9A 4XFDA 1WEHA 1GNPA 3KFLA 3FBGA 2OHFA 2P0EA 1SXJC 3D7NA 4NIMA 4QPJC 1WCWA 4P08A 3KPYA 3SHTA 3U3RA 5F9FA 2JC3A 2MU1A 2NAFA 3COJA 1SXJA 3L6CA 3Q41A 2Y1EA 1F5NA 2XLBA 1ST3A 4YFYA 4Z2YA 4QOFA 4FSDA 4I2NA 4WNYA 3T1HB 4NAUA 1NUTA 1Q7GA 4JJ6A 2Z95A 1MB2A 4QOJA 1VI5A 4YMTA 4GGPA 1XE3A 1YC2A 2C0PA 5FNZA 3EVDA 1KF0A 3E18A 3ZXIA 4FFDA 1YI1A 3SAJA 1W5TA 3I9V1 4E2ZA 4GOOD 4EPRA 1NFQA 4YTEA 2D1FA 2GARA 2H85A 3O93A 4F85A 1GHTA 1V8FA 4JT8A 3SFTA 2BMFA 4JX8A 4DCCA 4F96A 2JB9A 1ULTA 4QXMA 3QX8A 4W1PA 2IEIA 1P60A 2AH5A 1KJWA 1NMYA 4OGGA 5I8ZA 5JCJD 1ZA1A 5IF3A 4EY7A 2HDWA 4IBOA 5K6AC 1AZTA 3QXSA 2P77A 1CRZA 4DLZA 1JKJB 2GPBA 3A6GA 3BE8A 4JLKA 5EIAA 3U60B 4XQ9A 1VPVA 5HF5A 1CS0B 3COYA 5AO9A 2DG2A 1V6AA 4KIGA 5JG7A 5KDOA 4IOJA 2WPNA 1Y3DE 4RJKA 4CETA 4J0GA 1QCZA 5A3JA 1OZFA 2GRAA 4K6KA 1SXQA 1J0BA 3EC7A 1KI1A 3EARA 2OBFA 4G1UC 4OKIA 1W0JD 2Z5LA 3L7OA 4RD6A 1ZQ1A 4CLOA 4YB8A 4AY4A 1TEHA 4BO8A 2FUNB 3P0RA 3JU3A 4J0IA 3FZNA 3CSSA 4RXUA 5A4JA 3L6OO 3DL4A 1BFKA 5EZQA 2Q3LA 3EZGA 4NMXB 5L3RA 3K4QA 2AOUA 3JWJA 2CLSA 4FYKA 2JLUA 2Z2YA 3FOCA 2VDNB 1QFMA 2RGGA 3GCZA 5DE3A 2BGWA 2Q3FA 1OI2A 3CRW1 3NDIA 1X0XA 1X1EA 2H48A 2XF8A 3HI6A 4PLHA 5SZIA 2H1VA 1R16A 1E99A 3PJRA 3JQAA 4R3NA 3EGXA 2QENA 4G0YA 5AMXA 4QOIA 3PQCA 4BFLA 4OHVA 1HUQA 4D0GA 3EW7A 3H5VA 3GN1A 3VC7A 1MHTA 2N75A 1T2AA 4G63A 1IAQA 4O4LB 1W5AA 4ZTBA 4ZVNA 1L0BA 3CPJB 1AX9A 4JHXA 1EK2A 3DC2A 5IXSA 1ZEJA 2G1JA 1H2ZA 3RRFA 3PQ2A 2V5VA 1GNQA 2H2WA 2P5YA 1M2FA 1I6WA 2FPKA 2ZRKA 4GECA 4DVJA 2W42A 3DEFA 4WW0A 1DEAA 1Y8CA 4K46A 1CIVA 4OHRA 4YROA 3T4UA 3HU1A 3I32A 4BMPB 1Z7WA 3A9CA 5KKAA 1O94A 3TJZA 1K9VF 2ZBQA 2HMUA 4PAMA 4GDMA 2IOYA 3TTTA 5KS2A 2O2ZA 1TJ4A 2QJTA 4I19A 2OXIA 3W6OA 2FF5A 2X5KO 2UYYA 2IZ1A 2XOEA 3BWEA 1DUSA 4UAVA 2C7PA 5EIEA 2H1FA 5HKLA 3LM8A 3OJLA 4DMMA 4TSFD 4X6YA 2QT1A 3GB9A 3L1VA 2I65A 3MTJA 4TT3D 4DC1A 5ICEA 1PV2A 1V71A 2ZBGA 1JEYA 2ECOA 4I4TF 3U3MA 4ND8B 4Y2QA 5K20A 2J0QA 2RJ3A 3DM9B 2HU5A 1Q0QA 1C3EA 2Y0BA 3ZKWA 1VXRA 3KO8A 3R6LA 1N9ZA 1R0KA 5CMLA 4XD2A 1FMLA 5ES3A 3M6FA 1O6BA 1SJ9A 1EXNA 2P75A 4JR2A 1KEWA 1HNNA 4LYFA 2QW8A 4P5DA 4B35A 4WNIA 1E1NA 1NBMD 4CDRA 1UMKA 1U99A 3AR2A 5CURA 4DZRA 2EW2A 1IDN1 5DSTA 5HK8A 4U3JB 5EKSA 1FDUA 2C9ZA 1FZTA 5CCBA 3ITKA 1Y9DA 4HXGA 4J43A 1QK5A 2UZ1B 4PLFA 4KR7A 2B7BA 4Y6QA 3GFGA 3BGSA 1VJ1A 4S2EA 3SMVA 4ZEOA 1TAHA 5B2ZA 4EHNA 3OKCA 2PX5A 2VSFA 1NMXA 3VVBA 4BNJA 3IVGA 2FPLA 1BWPA 4H17A 1LWOA 2NXCA 3GFPA 4ND3A 1FNCA 5BWLA 2Q2OA 1YR8A 1ZCJA 2ZJYA 3TFQA 1Y3CE 4DTCA 1WKCA 1P17A 3GDFA 1I2BA 1QQ7A 3IP1A 1KVUA 3A28A 5IT4A 2OVFA 2RGDA 4KX5A 1Y63A 2WJYA 1L1RA 1NQOA 1ZMRA 3ORQA 4RZIA 2W0SA 3DZHA 4LK2A 3IQGX 3QG1A 3GAMA 2FN7A 2HEGA 2NXEA 5FWXB 2AL7A 2PUVA 1C0LA 3ITNA 2FMHA 3WNCA 1BHQ1 1T5LA 4HS4A 5AYVA 3VPDA 3BC1A 3PFNA 4HDKA 4HNAB 3TDMA 3F6RA 1FZQA 2PHZA 1YRHA 2BF7A 4IG4A 1B8UA 3ANYB 2VHXA 4C76A 5ALHA 2NIPA 3FMFA 3RTBA 4Z7QB 3CLRC 1DC6A 3RQSA 2F17A 3PRJA 5AK5A 5H16A 4V0SA 3ZIUA 5GVRA 4IDQA 5JJBA 2GZSA 2XEDA 1I7QB 1I3KA 2PEYA 1QJCA 2Y1LA 3CZPA 3EIWA 4N4AA 4UBOA 4HYEA 1WEKA 5EPUA 2RAUA 3PDCA 1GVHA 4PICA 3T7TA 2ATCA 1CJUC 2ZSJA 5EHGA 2I7TA 1FP4A 1Y6QA 2WHQA 4EZEA 3IE2A 5C8YB 4DNFA 3IALA 4A91A 1W4ZA 4HB3A 3TEMA 4BWYA 1F8UA 1GKLA 3FCAA 2IYXA 3B1YA 3QV1A 4O4JB 5KX5F 3RYTC 1UP4A 4MQ4A 5FT9A 4KFTA 5AFSA 2OORC 3TE7A 2XKAA 3BTSA 5AJVB 4E4TA 1D07A 3W5SA 1DV2A 4PTYA 1FVFA 1JDBC 5CX1A 4HTFA 3LCUA 3OKAA 2BISA 1ORWA 5JPIA 4MRMA 1BEUB 3QV2A 5D1HA 3KQTA 4J7XA 2WMNB 5FOVA 4F1KA 3CRRA 1G2IA 4PRLA 1ZVMA 4JKIA 2UV8A 3ICVA 1AUOA 5EA2A 5F2KA 2AE1A 3MOSA 2JAQA 2LRHA 2B94A 1TZJA 4DA4A 3G89A 2IUTA 1P7PA 1PW5A 3I5YA 1PL0A 1U11A 1Q0TA 2CXNA 1GZHB 2OK7A 1G3UA 3PEWA 2BELA 3CN9A 1FFHA 2BD0A 2BHTA 2PWYA 4GYKA 4OMFG 4JLVA 4P93A 1JQ5A 3T12A 4PPGA 1PX2A 1DIRA 1XJ0A 3C15C 4X1IB 3RJZA 1V35A 4WLOA 3W78A 1T4CB 3M3PA 5FPHA 3DTYA 4AF7A 1SVOA 3PPWA 1G3RA 3E15A 1OIXA 1N33B 2YNMD 3DZBA 1NMZA 4P2GA 4TMWA 4BX3A 2WYUA 5KYUA 5L7YA 3W2GA 3BIJA 3QKRB 3A9TA 3FYHA 2VS1A 3X1DA 2NU6B 2QYSA 5L3QA 3ZJ5A 2C4HA 2C82A 4GLLA 2XZDA 2ZTLA 1E2HA 3CNEA 4M88A 4OUKX 3WL3A 3RVRA 3CZ5A 3LSYA 2J31A 1GCIA 3K1ZA 1P4HA 1EXMA 4G4JA 2DUUA 3F74A 4XOIA 1R9NA 4MQEA 1XDGA 3W4IA 2OHVA 3FG9A 2X5XA 5KSPA 3GPLA 4ND1A 5T3YA 2QGZA 5JBIA 3AEUA 1SPBS 3LUGA 3GRZA 4LHXA 1CR1A 5DLDA 5EWMA 5LLTA 4R8KA 3QFHA 4TTJA 1SK8A 3VNAA 3ZWOA 4MICA 1K3FA 3ETCA 3ITEA 3U4HA 2QVYX 3GPCA 2ZB2A 4ZGGA 4LZNA 4DLTA 1EM8B 4Z9YA 1ODKA 3I9NA 2PH5A 3SQLA 4LJAA 1R9GA 3WNDA 1SXIA 3HFRA 2PKWA 3TQRA 3ASYA 2JAPA 4JA0A 3WRYC 4U9IS 4YGXB 1SCAA 1U3WA 2OUKA 1GITA 2ZFUA 4XX0A 1ZGBA 3H83A 1V9SA 3WYCA 1W9HA 4HPJB 4UFOA 1KAHA 1NQUA 3M2PA 2PT9A 3T41A 1USUA 5KDLA 1DU4A 2LBPA 3CUEF 2E6UX 4M6WB 1RQPA 2JFBA 2JK0A 2ON6A 3E84A 3KFXA 4JBNA 4N7BA 3TTWA 4ATNA 4BX0A 2Q6OA 2FQXA 4X92A 4UPEA 2AN4A 3F1KA 3PEVA 3C8UA 4BAZA 3K72B 4KWHA 3T9EA 5LQSA 4NYMQ 1KI7A 2ZSDA 2C4TA 3GJ3A 4FGWA 4L16A 2VEOA 3UHJA 5KOJB 1AKVA 1JZQA 3QEMA 4M36A 3RYFA 3TECE 1N2GA 1OX6A 3QF7A 4UNQA 1N7GA 3RANA 3GEHA 1P45A 2IZ5A 4AJ2A 1L5WA 4WZAE 3GO4A 4IVQA 4Y6GB 3ND7A 3MWFA 3RVOA 1ZNZA 1T2CA 2DKFA 5J9FA 4C0WA 3BK2A 1NUPA 4MLCA 3ZGZA 1E0SA 1IC6A 1JXOA 2ZBRA 3RB8A 5ESRA 1DDOA 2OHJA 4UNRA 2KQUA 3ONFA 1IPHA 2H59A 4E11A 4US0R 1VPWA 1OAOC 2V9PA 4PVDA 5DM0A 3VNSA 3GVHA 5HG0A 3OBIA 5E6RA 1Z8DA 3CO0S 4PCAA 4LOIA 3HS3A 5DTRA 4B2IA 2AXQA 4KR0A 1GL7A 5AJUA 2UUPA 1NBEA 5TRTA 2OQVA 4BKQA 2QTAA 1US8A 4DHEA 2XCLA 3IESA 3UKJA 4G0QA 2NUAB 1Z07A 2RI6A 4AJOA 4JV5B 3SHWA 2QMOA 4YS6A 4JYPA 5KREA 3ICEA 3VNRA 1QORA 2IOFA 2OO5C 4F71A 1F7UA 1EIWA 2ZSEA 2WKSA 2BFAA 2QRLA 3NFYA 1UBLS 4QBIA 4B5LA 1BX1A 2EJVA 4CT0A 4PNPA 8ABPA 1C9EA 4D26A 1E3MA 2O8FB 1GGMA 2WOJA 4D9IA 4FFBB 3KTAA 3GRKA 3SYMA 3VU8A 5JY6A 3RHFA 3JR7A 1Y7LA 1QGUA 2PG3A 3FCEA 3H13A 3I53A 1DCFA 2FLWA 4F7WA 1DRJA 2ERYA 2JGRA 3K31A 3P4UA 3EJWA 5J47A 4F8JA 3H8WA 2CL5A 4NVRA 4KNVA 4PYJA 4HMOA 3K6SB