2CDNA

Crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
PRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords ADENYLATE KINASE
total genus 67
structure length 186
sequence length 186
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cdnA00
4FD2A 3Q9LA 3MWLA 2GRJA 4HZIA 4ASUD 1CJMA 4KI0A 4IFEA 2GA8A 2NO0A 4PHGA 2FSIA 2R62A 2OBLA 3L8YA 4MH0R 4R7ZA 2P2LA 1D2MA 3QF4A 3UWOA 5TMPA 3MLEA 1N6IA 1CXZA 3D31A 3VKGA 3TAUA 2NIPA 3ZGXA 4PO8A 2ZRJA 1YR7A 4KVGA 4IDPA 2J5XA 1TF5A 3TQCA 4V02A 1VG9B 1AK2A 4Q18A 2QSYA 4I1OA 4JIMA 5AR1A 1DARA 3PCRB 1W0KA 4A2WA 2XNDA 4A8JB 1W1WA 3IQWA 3N2IA 2VP6A 3GJ6A 1G7CA 2ZYUX 1FQJA 3AF3A 4DDVA 4JLBA 1ZRHA 5GJVC 5JSZA 1E1QD 1DAGA 2E9SA 5TV2A 1QDEA 1NI3A 4P4SB 1KJWA 2G6BA 3LRPA 3W3AA 2R8RA 4G5SA 4UNPA 1FP6A 2QGNA 2VEDA 2FZLA 1XU4A 2QU8A 3U6KA 3OEHA 4AKEA 4L5BA 1GNQA 3W8RA 1JAHA 2D2FA 2W00A 1GL7A 4BRWA 5LBIA 4A0HA 4B74A 3UATA 2ZR7A 1QBKC 3WMGA 2G1KA 3TNFA 4TN1A 4DZZA 3U44A 4Q7JB 3ADBA 2XNSA 2QP4A 3SBDA 721PA 3SC3A 4BFUA 1D5CA 4B48A 3U4QA 1KJZA 3RRMA 1E2EA 1IY2A 4URYR 1B0UA 2CHQA 4DSNA 4LJ9A 5KYKA 1IM2A 5ANRB 2RGEA 4NYJR 5C1BA 1VPLA 2Z4RA 3KKNA 3AGQA 5L3RA 5L3QA 4M1SA 1W36D 5CYOA 1NVUQ 1Z6TA 4HYYA 3FMFA 3LO5A 1WB9A 1BS1A 3K70C 2JLSA 1ZINA 1UAAA 2ERYA 4Q4HB 3VR3A 1RRGA 3THWA 1N5IA 4E22A 4PSAA 1W2HA 3THYA 1Z6GA 3QXSA 4A6PA 1AZSC 4C4PA 5HCNA 1S2MA 3IEVA 4KFTA 4XWOA 2ANBA 1JJVA 2OLJA 2ZRDA 2H5EA 4EPXA 1RYHA 1OH8A 3IHLA 1HQCA 4P4TA 3I73A 4NYIQ 4JLPA 1XJCA 3IO3A 1HE8B 3PIRA 1D2EA 1S3GA 1ZP6A 4TWZA 1G7RA 1ZM2A 2JDIA 5AUNB 1G8HA 1HTWA 1Q21A 2AWOA 4GZMA 4TSFA 4PFSA 3QF7A 1HEIA 5D3MB 4B3CA 3CWZA 1OKKA 4XVRA 4AG6A 3ZVRA 4C7OA 3KQHA 1W5SA 2W2TA 3LLMA 4PPQA 3SYLA 3L0OA 3VNUA 3QG1A 1GIAA 2ZRFA 4NCNA 2ZYTX 1ZYUA 4Z8YA 4ZKDA 4KV9A 4OK3A 4QBGB 4RY2A 4XWKA 1P5ZB 4QG7A 5EE1A 2IYLD 4JLMA 1IN5A 1NLZA 3W8NA 2ZJAA 3WP1B 2JLRA 1Z2AA 2V7QD 1GTVA 2C9CA 4MKIA 3X1WA 4HAZA 2ODBA 5J4VA 3QXXA 3VR2A 4BLSA 3MD0A 1UKYA 2J59A 1W44A 4LC0A 1ZUHA 2DHRA 1NG1A 2YYZA 4GRAA 4PX9A 1R5BA 4BLPA 1BYIA 1UEIA 3DZ8A 2J7PD 1ZUIA 3M4YA 2WOJA 4Q7MB 4B6FA 1G3MA 1R4AA 4Q19A 4AI6A 5KOYA 4H1UA 2EFHB 2OFWA 5AJZA 3WMEA 1DO0A 4TL9A 4E09A 121PA 2C9YA 4HLQB 2BMJA 2EFDB 4N0EA 4Q4AB 3V00A 4JZKA 3CKLA 2WAXA 4UNSA 1IONA 5DE3A 5E7JA 2Q21A 3UKDA 4EPWA 1IN7A 4S35A 1NN1A 3OEED 2DWPA 4B3FX 2IYUA 1TU3A 4F4IA 2QENA 1ANKA 4LC1A 3A6PC 4LV8B 3NTUA 2V6JA 3EASA 1XD8A 2IYWA 2I4IA 1NMYA 3AP3A 3VKWA 3GJ8A 4IOLA 2GJ9A 5FBWB 1LB1B 2IF2A 2QTHA 3NHBA 2YOFA 3QSYA 2QORA 4KFSA 4OI1A 2QAJA 1SVLA 3WBKA 2XTMA 4IOKA 3IPYA 2IUUA 1S1MA 4BLTA 1HA3A 4PQRA 4DRZA 5AJVB 2QM8A 2F1RA 2PJZA 3BJIC 3B8HA 2XJ9A 4NH0A 3VR4A 1FNMA 2FA9A 1JBKA 1TQDA 2CJWB 4DJTA 3ZDQA 2O8EB 3EW9A 1GVNB 4R9UC 3A1TA 2F7SA 1XMIA 3HWSA 3VNVA 3AQ4A 2RB4A 2R6CA 1IN4A 2ZI9A 5HCIA 5D3QA 3ZLJA 2Q6TA 2CEAA 4HDCA 3OIYA 4AC9A 1VCIA 3IPXA 2TMKA 4I1UA 4TTQA 1U9IC 1Z47A 1H8HA 5FL3A 2PBRA 1R0WA 3QKSB 5F3WB 1E9AA 1DE0A 5DO9A 1OHHA 5AUQA 2B7CA 2I1QA 5EE9A 3OIUA 3EIQA 2XOKD 3N70A 1DAEA 5JWOA 2GXSA 1ESMA 3TVDA 1ZM4A 4C0QC 2YZ2A 1E2DA 4M8NE 1JI0A 4QGHA 3QXCA 3REFA 1FUKA 4H1VA 4M0LA 4AY2A 3T34A 4PZYA 2G77B 3K9LA 5CDFA 1XBTA 1QG4A 3OHMA 1XRJA 2R44A 2HV8A 4AYWA 2ZRMA 5LB2A 5DGXA 2DFLA 4GBMA 2ZSEA 4QHTA 3Q85A 1XEWY 4FWTA 2ZSBA 1E0SA 2GJKA 2VSOA 3CF6R 4KBGA 1DAIA 3RS5A 4QJ3A 3TLXA 4MKHA 2L0XA 1W2GA 2GAOA 4LYAA 1OE0A 1R2QA 1YR9A 3QEJA 1Q57A 2ZRLA 4V03A 1CLUA 2ZIAA 1UF9A 3AVYA 3E5HA 3KL4A 2Z4SA 1R10A 1KMHB 5SZKB 1GZSA 3VU9B 1N0UA 4EAQA 1OJLA 3OFNA 2RKOA 2JLWA 3CPJB 4PHFA 3B1VA 4JLOA 4NMMA 621PA 1LFDB 3CF2A 1YZTA 1Q22A 4BUJA 4JBYA 2H7VA 1Q3TA 4EFMA 5P21A 2PCLA 4RFSA 4XH9B 4LBYA 5C46F 5FPHA 2ZRCA 3U6BA 2VHUA 4C30A 3PUWA 1P60A 4L8GA 2ZJ2A 3F8TA 3WYFA 1RVDA 3VU9A 5G40A 1XEXB 4D2IA 2FV8A 2GXQA 2GEVA 2XGJA 4A92A 4TMXA 5J40A 4ACBA 4PO9A 1SQ5A 4OI4A 1G9XA 1E9SA 3I72A 5HZKA 2IEYA 4QBIA 1CBUA 4MITA 3OAAA 5H8WA 3P27A 3TKLA 5GJBA 1HURA 3FKQA 2H1LA 5EZ6B 3EA0A 3O8CA 4B76A 3CX8A 2VF7A 1U81A 4NYIR 4HAYA 2YKGA 2QPTA 2WAYA 1AZTA 1VHTA 4QGAA 3I92A 4Q1AA 2ZI4A 4NYMR 3PQCA 2IBMA 2RGBA 5JS8A 2EWWA 1FZQA 1OSNA 4IVQA 5DI9A 1Q1BA 2Z6VA 2WTUA 2YINC 1RYFA 1T5LA 1B23P 4YMTA 1E2IA 3UK6A 2FGKA 1E0KA 3SQXA 4MGYR 2GNOA 4W9MC 4Q1FA 4IXNA 1E69A 1WCV1 1SKYB 3EZ9A 5EXPA 4D81A 2Q0HA 3KQNA 1XTKA 3CM0A 1UBFA 3OIVA 2QMOA 3SN6A 1KO5A 3BC1A 2F1JA 1N2CE 1UBGA 2FH5B 2QGZA 4LBWA 3SEAA 1XPUA 3SJAA 5B2ZA 2GZDA 5KPDA 2BKUA 5EP2A 1KMQA 1NY5A 1T3SA 1KY2A 5IK2A 4K46A 4TQAA 2H8KA 1Z08A 1AIPA 3ETLA 1JPJA 3D6TB 3TAHA 2ZQ5A 2XZOA 3K0SA 2BM0A 3GPLA 2JEOA 2QA5A 2ZJOA 3NG1A 3SFZA 3AVPA 3NH6A 3IQXA 3QKRB 3OAAD 2G83A 2EYUA 3SQWA 3KKOA 4N1AA 1XTRA 3AF2A 1Q44A 1P9RA 1T0HB 3NDBB 1E98A 5K8TA 3ZVLA 4Z8XA 2VLIA 1X1RA 2Q9BA 4LYFA 4KHZA 5FL7D 3AVOA 4V0KA 3LVQE 1G7SA 1NF3A 3GCGA 2X8AA 2QT1A 2H57A 5JMTA 3GEIA 3F0TA 2VO1A 1KSJA 4A8JC 1E0AA 4OHYA 2RAPA 3LW8A 1I2DA 1A5TA 4DIEA 3K09A 3QNUA 1NG9A 4GNKA 3N5CA 4MQBA 1N6KA 4FCVA 4IEIA 1NN5A 5GADl 1XPRA 3U2QA 1N6LA 1NJFA 2GEUA 1ZC3A 2QRZA 3OFND 3IEUA 1WBBA 1F6BA 4POAA 2ATXA 5L3SB 3U3OA 5CJ2A 1COWD 3PUVA 3K70B 1IJEA 2HXYA 1CP2A 1UKEA 3ADKA 4M1TA 3GLGA 2RGCA 4BFTA 2XAUA 1N5LA 2FNAA 4JBXA 2CLCX 2DWQA 3IHWA 4MYCA 3U7EB 3BS4A 1X3SA 1E2KA 3QBVA 1PUJA 3BORA 2X19A 5E4FA 4PC3A 1YR6A 5BXQC 1GFIA 1E2PA 4LJ6A 3H0KA 4AYTA 3PENA 4PHTA 1QHIA 5L3SA 2OFOA 2J0SA 3MMPA 4OL0A 1VCNA 1D2NA 3RS0A 1VG8A 1R5NA 2NO1A 3JVVA 5TB5A 1KO1A 3NDPA 2GJAA 2IL1A 2IYZA 4AKIA 1CULC 2ONJA 2ZRAA 4IOJA 3SOPA 3LBNA 3NWJA 1QHHA 1OB5A 3LD9A 4OI0A 1TEXA 3H2YA 5KO2A 3ASYA 1SXJA 4G01B 3CZPA 5GVSA 3ZZTA 1ODFA 2GVZC 4BZPA 1NBME 2J7KA 2WICA 3SYKA 2ZVPX 1RIFA 1H8HD 4W5HA 5TVKA 1FX0B 2W58A 2IT1A 5CM8B 2IUSA 1TF7A 2V3CC 3WMFA 1XJ0A 4RKEA 3TIFA 1UKZA 2NO7A 2W0MA 1S0UA 4US0R 3W34A 1G20E 2ZJZA 4Z1MD 2DFKB 4DLWA 5JCPA 5HE8A 1KI1A 1NLFA 4US2R 3DKPA 3DZDA 3SJCA 2VPPA 5FOVA 1E99A 3WXMA 3BFXA 1P2TA 1XXHE 1G8YA 4OBEA 1X8LA 1EESA 2AD1A 4XD7A 1VMAA 1ZU5A 2EWVA 3MSXA 2QI9C 3HU1A 3VR5A 4FMDF 2P65A 4PC2A 3B78A 3GP8A 5TDHA 3I5XA 3GEHA 1SVOA 1G64A 4F91B 5A4JA 3T1QA 3EXAA 4CEIA 1E2MA 1GILA 2G0TA 1NKTA 3K0AA 3B60A 1WDTA 4NPHA 4TL7A 1X86B 2DWOA 4KITB 2AFIE 1ONBA 1ZCAA 4D25A 2ATVA 2VYFA 3OEEA 3SR0A 2QQEA 4F7WA 3PV0A 2ZS8A 4B2IA 1G41A 1OIVA 4LJ7A 3FFAA 4MDEA 2GCOA 1SKYE 1Q1QA 2O8EA 2HDNB 3NBFA 5IHPA 1YE8A 4DHEA 4QGFA 4JLKA 4DLRA 1HT2E 1M7HA 2ZXUA 4AKGA 3U60B 1U8ZA 2F55A 3AVVA 4PR0A 1G8GA 3KB1A 4RD6A 1FMJA 2REXB 3EZFA 3GJXC 1GSIA 1P9WA 2XSZA 2OCPA 1YZUA 4IHQA 1KK3A 4IDHA 3EA5A 4PPNA 1BH2A 2V7QA 5EP3A 2A9KA 1RC8A 2ZRGA 1I2MA 4I1SA 2VHQA 4GMXA 5H68A 4EPRA 2ZI3A 1G18A 4MDFA 2P0EA 2J46A 3ZZUA 1PV4A 1HY3A 1W4CA 3GFPA 3VMFA 2FPLA 4Z54A 3CNLA 4RD0A 2HUPA 4OKSA 1J7KA 3AKDA 5KDLA 3IKJA 1OKKD 1V5WA 4NCHA 1VYTA 5E95A 4GT1A 4M1KA 1G7TA 2QAGB 1MABB 1MH1A 4TSFD 2O8BA 5JHGB 2NG1A 2KWIA 5FTMA 2OBNA 1OFTA 1LS1A 2ZAOA 3TBKA 1FFHA 2OZEA 1AQYA 4M1OA 3RS2A 1FTSA 4ILEA 2I1VB 4I99A 3L2OB 2JDID 5FR1A 5FR2A 4R98A 3X1DA 1KZ7B 2OV2A 2F9MA 2GETA 4JYBA 1S3SA 1U8AA 2ZEJA 1K5GA 2ZRIA 4FN5A 4M1YA 1II8A 2UVQA 1YJ5A 2VHCA 4Q9KA 1CS4C 4IEEA 4WOPA 4Q00A 4YMSA 4NCIA 5AJYA 4IXMA 4TYPA 4C2TA 1E6CA 3RRNA 2ZUBA 3EPJA 1G5PA 3KFXA 1CR2A 2ODNA 3R9IA 2CLSA 4C0LA 3EG5A 2PLFA 2FFAA 5EP4A 1P62B 2BMDA 2C04A 4N3NA 2PZFA 2WJVA 3ZD7A 3GFOA 4M4SA 4UJ5A 4D82A 5ELXA 5F9HA 1KO8A 2AHOA 1IBRA 4IVRA 3MJHA 3GJ4A 2HF8A 3K53A 3CF0A 3L8ZA 2ZUCA 5DISB 3WYGA 4B35A 4P31A 2VBCA 4URZR 3T61A 2RGGA 2ZAMA 3O8BA 3LV8A 4Q1BA 3W6PA 1NIJA 1DVRA 2REOA 3TMKA 2D2EA 4LPSA 1N25A 2FX3A 4ZDJA 3BB1A 4ZV4A 4F93B 4DUGA 1O87A 4B34A 3VR1A 1DAFA 4MRSA 2PZGA 2HLDD 3TRFA 3R9WA 1SULA 3I4LA 4W5JA 1HYQA 2A2ZA 3PG5A 5SZJA 3E1SA 5IF9A 4KLZA 2HCJB 5H70A 4TT3A 4OK5A 3RABA 1E1QA 4CZ2A 4CW7A 5FPKA 2GF0A 3QUSA 2PEYA 3MRSA 1C4OA 3OZXA 1Z63A 2IF0A 1X8JA 1U94A 3W9YA 2B7BA 1VTKA 5BWMA 1XZPA 1E1RA 1S96A 3BWDD 4M9XA 4A6XA 4ZIRA 3G82C 2QP9X 4X8LA 5DN6A 1F60A 4UQOA 4C7OB 1EWQA 1KI8A 4V0MA 4DLUA 2W6JA 2IA5A 3KXKA 4DDWA 2ZJBA 4G5OA 5AJXA 3A1WA 2PH1A 4A0FA 1NMXA 2PCJA 1GWNA 2C96A 4RCYA 1EXMA 2RGXA 1Z6XA 3CIOA 4D4KA 5JJIA 1NMZA 3AH8A 2BKEA 2QEQA 1E2HA 1UBCA 4LPKA 4PSKA 2WM9B 4ASUA 5EE5B 3IDQA 3K0EA 2IEZA 4RD1A 1UPTA 1Z0AA 3C14C 2KE5A 2O8DB 2QMHA 4A15A 3W5IA 1N6OA 2G88A 2OAQ1 3WNCA 3X1XA 6Q21A 3U7GA 2JJ2A 2KSQA 2JLVA 1FNNA 1ZNZA 3GLFE 3X1YA 5J4LA 4ITRC 2R6GA 1G6HA 1HV8A 2H18A 1RRPA 1R8QA 3GFTA 4W5WA 3Q7QA 2BC9A 2DFNA 2IS4A 4GMDA 4A0RA 1IY0A 3AVQA 4JLJA 3AVUA 3DO6A 1NKSA 1RJ9B 4DSUA 3HPQA 1OFUX 3SBEA 5KPJA 1EK0A 3HYRA 4B3XA 3TGPA 3CW2A 4MYTA 5BQ5A 1ZMXA 2VH5R 3KJHA 5GVRA 1VHLA 4FIDA 4EKDA 4GFDA 5KSZA 3FOZA 3BBPA 3UIEA 3GJ5A 3FYHA 2CVFA 4FW9A 1OH6A 2QPOA 1IXZA 1P6XA 3RRYA 1XWIA 4Q1DA 2ZSFA 1ZBDA 2F1IA 1CJKC 4NDZA 2ZRPA 4IFBA 4MUBA 2HYIC 2N1BA 4DCTA 821PA 1E9BA 1TUEA 1XB2A 4Q01A 2ORVA 3VX4A 3FPAA 4JLNA 4B71A 4WXRA 2IX3A 2X1VA 1H65A 2PX3A 1JQLB 2UKDA 1CRPA 3B9PA 2FWRA 3WNDA 5KNCA 4ZCMA 4GI7A 1IHUA 3PEVA 3TUJC 3K70D 3ICEA 2RGDA 2BEKA 4JVSB 1H8ED 1JEDA 3R8FA 2BMFA 1GM5A 3B9QA 2ZREA 2P5TB 2WJYA 3BFKA 3BFVA 4GP6A 2Z43A 3A58B 2WPDA 1XF9A 4JYCA 2FU5C 4OJKA 1W4BA 2F3RA 3K0FB 3WHKA 2QTFA 4FWIB 2RGNC 3P20A 4JJZA 1SKQA 3MUFA 4BQSA 5M04A 4WVFA 1DAHA 2WIBA 5JWRA 1D6JA 4LZZA 1QHHB 1VECA 1U98A 1ZJ6A 1M8PA 3Q5EA 3B5JA 1NSTA 1AA9A 1I4LD 1OFHA 2AFHE 4WA7A 2OFXA 1SXJE 2W83A 3TH5A 5JRJA 3H86A 3K0FA 1ZD8A 2WBLC 5JRZA 4IW3B 4RFVA 4WXPA 5DNYB 5AUPB 4S2EA 2YV5A 3MGCA 5HPYB 1EFHA 1F5NA 4E03A 3K0CA 2C9OA 4PQYA 4ON9A 3PFIA 3NC1C 4UNRA 1A1VA 3W3ZB 3TUZC 3LBIA 2HEIA 3PUXA 4IKEA 2WIAA 3WYAA 1KSFX 1VKJA 2C95A 4D4LA 1AQUA 1XJQA 2HF9A 5KNBA 1LTQA 3LWNA 2B6HA 2GESA 2GILA 3V4FA 1BOFA 1GAJA 1IAQA 4PSVA 3PVSA 2ODWA 1HUQA 2Q9AA 4IDOA 4AWXA 5KTYA 1XCPA 3T15A 1RZ3A 2KI5A 1KDOA 2BM1A 4EQ6B 3P26A 2UZIR 5DYGA 1JNYA 2D7DA 221PA 4RZXA 3GLGE 1KKMA 4RKFA 1PLLA 2GDJA 2OE2A 2ZETA 3W90A 3RC8A 5FOSA 1UBEA 5EE3A 3B13B 2J9RA 2WVJA 3CUEF 3ASZA 3LQQA 4PHHA 4QRHA 1IQPA 5EQTA 4AYXA 1JXMA 2QN6A 1Q3HA 3VHXA 4LGMA 3UMSA 3K09C 1G291 5F98A 1XD9A 1RFLA 4IOMA 3CNOA 2JJ8A 1DG3A 4AK9A 3TUIC 2A5DA 4DLXA 2C77A 4LV6A 3HU2A 1JR3E 2VSFA 3GEEA 5AUOB 3LX5A 4C0KA 2WWHA 3A4MA 4XIGS 5FH9A 5FFMA 3GD7A 3JZAA 1ZM7A 4GOKA 4KO8A 4W7SA 4X8MA 1II9A 1G5TA 3FMIA 3AGPA 3ZYCA 1E9EA 3PR1A 3RS3A 4EJSA 2WV9A 1K6MA 2B21A 4M53A 4NCJA 3A37A 3ZVNA 2ZYWX 4P32A 4V0LA 1E79D 3CB4A 5JECA 1CRQA 3EC1A 3KJIA 4N0DA 1NY6A 1E3MA 4IDNA 4Q9JA 3WNBA 3HDTA 3KQKA 1E2LA 2QROA 2Q3FA 2XITA 2J0UA 4QM6A 3CRRA 5KDOA 1WA5A 4MKFA 1HE1C 1W4AA 4A2QA 2V1XA 5BYJA 1PVOA 1YQTA 3PEUA 5A0FA 4D6PA 1CU1A 3K0CC 5B57C 1G17A 2BBSA 2BOVA 3RAPR 1XTQA 3RNLA 4RD4A 4TMWA 2IWHA 3MWJA 3WHLA 1FW6A 1NN0A 1XDBA 3KUDA 2OCAA 3Q5DA 3FMPB 4HI0E 4TMTA 5SZHB 2GBLC 3UG6A 5C2JB 4HDOB 4GP7A 4CEHB 1JR6A 1YRAA 1RRCA 3P4XA 3P1JA 1CJTC 3U4QB 2UZ3A 4TLCA 1NVXQ 2FEOA 4LYJA 5GJWC 4O2LA 2DPXA 1CF4A 2EFGA 5CLQA 2IHYA 1KYIA 2PL3A 2O8BB 2IS2A 3CO5A 4LCBA 4PXAA 3NC0C 5CIWA 1UEJA 1Z0DA 2ZSAA 1GKIA 2J0UB 1QHNA 1YR8A 4UXHA 4BLRA 4URUR 2VA8A 3LFUA 4B2PA 1ZC4A 4Q4LA 3UMRA 2F43A 1ZNWA 3K9HA 5HKKA 4OHZA 1EX7A 3FWYA 3A4LA 2VL7A 1CR1A 3UPUA 4OQLA 3LW7A 4LRWA 2ONKA 4MYUA 3AF1A 2XEXA 1D9ZA 4LI0A 4G1UC 1W46A 3QBTA 3S1AA 3SJBA 1JR3D 2EU8A 2QL6A 1TPZA 3B2EA 2QE7D 3ZD6A 5EXSA 2P6NA 1R0XA 1TX4B 1TL7C 2A7QA 2OCYC 4A0GA 4MYHA 2Q3HA 2QY9A 2A5FA 2OUKA 3U3JA 2O52A 3BB4A 2O8DA 3B1XA 5JI2E 1MO5A 3D3QA 1US8A 4HZUA 4QNMA 2EFEB 3RDPA 1E2NA 1Z83A 1IXSB 4LJYA 2X2EA 4A4DA 5JS7A 4ZDKA 1AKEA 1CEEA 3O8RA 4QL3A 2YC2C 2C78A 1SVWA 2O8CA 4G5QA 4X8HA 2O0KA 2ZANA 1MV5A 2OXRA 3FMOB 3D8BA 1W0JA 2CL6X 1XZQA 1QVAA 4BFXA 4XVUA 4F4JA 2YOHA 5B64A 1G8PA 4IJMA 2OLKA 4HAVA 4KXFB 1XXHA 1G21E 4ZI3A 5KDDA 2ZS7A 4PPGA 4UNNA 1UDWA 4Q7KA 1Z6AA 4I4LA 421PA 5HKKD 1GP2A 3FHTA 4DXAA 2XZPA 3QE0A 4EFNA 3ND8A 4XTCS 1E96A 2ZJ8A 3QPWA 1SGWA 1J70A 1KO4A 3D7MA 4JSYA 2JLXA 2C8VA 2BBTA 5AK0A 3NHAA 2XTNA 3AF0A 4PAOA 1HQYE 1BYUA 5FOWA 1UKVY 2FJUA 2GVDC 1S9HA 3GMTA 4Q9IA 1MOZA 2IUTA 1TU4A 2P6RA 1TQ2A 2B8TA 1NSFA 4QGGA 4KODA 1YZNA 4ARZA 3DM5A 1DADA 4BECA 4IDQA 2NTYC 4J0QA 4I1VA 3KJEA 3AP1A 2CL7X 3EIHA 4BLOA 2ZRHA 1XD2A 1W36B 1QHXA 1RKBA 4TYWA 1QZXA 2KB0A 1AGPA 1EFTA 2F6RA 1AN0A 4LJ5A 3RSLA 2G0NA 4ESHA 2ZM5A 4GSYA 4YMUA 3FKSA 2YWHA 3KKQA 4LWZA 5D3MA 3LY5A 1CJUC 2ZVQX 4RZ3A 1ZAKA 1A7JA 1K5DA 1KO7A 2IYSA 4L9SA 3NIBA 1SVSA 4DIDA 2YHSA 5DI3A 2PT7A 2ZE8A 1OXXK 2WWFA 4GOXA 3B1YA 1WF3A 3MCAA 1MO4A 2H17A 3AUYA 1QHYA 3SE0A 2SHKA 2FDCA 1KNXA 5FPSA 1G4AE 4NL4H 3RS4A 1Q0UA 1WRBA 2OILA 2QT0A 2VQSA 4OYHA 4BFSA 5EJEA 2B8WA 1ZCBA 1DBSA 1NLYA 4BFVA 1OFIA 1UM8A 2FPMA 3GJ3A 1ELOA 2ZTSA 1RJ9A 3QKUA 2BBOA 2R65A 4TMVA 4DWJA 4U7DA 1BKDR 4FCTA 3FHCB 3W6OA 2GCOB 1E9FA 4LYHA 4EUNA 2WWYA 1A4RA 3BOSA 3EAQA 4D4MA 4LJAA 2ZI5A 3CPHA 4US1R 2GBLA 1OW3B 2AL7A 4GPTA 1MKYA 4Q21A 3VX3A 3DVLA 1SXJB 3IGFA 1F2TB 1WMSA 2H16A 1X6VA 3A4NA 1EFRD 3CX6A 1U0HC 5K8UA 1N0WA 4XWAA 2IWRA 2YWEA 2XJ4A 5EXTA 3TR0A 5FTJA 2JIZD 2C99A 2GXUA 1YZLA 4BLQA 3THXA 2QAGC 2D4HA 2ZI7A 2WJIA 4DCNA 2ZE5A 1DO2A 3K8YA 4HUQB 2QM7A 1KDTA 2HT6A 4KSBA 2K5UA 3T12A 2JLYA 3FVQA 5DYIA 4ZKEA 4OHVA 1KSGA 4ZPXA 2PEZA 4MKGA 4CIDA 2WSSD 4A82A 2FSGA 3GLIE 3NEJA 2W6IA 1U90A 2FE4A 4MRNA 4EJSC 2Q3MA 5DHFA 5FUWA 4B73A 3SYNA 2D3WA 2NMVA 1SVIA 2NO9A 2XXAA 1DELA 2XB4A 3QQ5A 4F4CA 1CTQA 3THWB 1KSHA 2R9VA 3LX8A 4RCZA 1LVGA 4KBFA 1A82A 1IN8A 4DLSA 5L3QB 3NBYC 1TMKA 3OE7A 2EQBA 1T5IA 4B43A 2GZAA 2F9LA 3MWYW 1F48A 1T91A 3LLUA 1VCOA 2CCKA 1LY1A 3U3RA 5L8VA 4XTRA 1W47A 3ICQB 5CK4A 1GOTA 1G8FA 3R7WB 4YXWD 2JJ1A 1GDDA 2WJJA 4M9SA 4HUTA 3HR8A 3M6AA 3EIEA 5KNDA 1F2UA 3A1UA 1Q12A 3VKHA 3C5HA 1ZVQA 1E32A 4OI2A 1YZKA 4Q4JA 1KK0A 2ZRBA 4X8OA 4B44A 4CDGA 1RE0A 2X2FA 5FBLB 1Y63A 4BEJA 2OEPA 3O8DA 3C41J 1TTTA 1R7RA 3P4YA 1XX6A 3VHLB 1LF5A 3K1JA 3SZRA 3TJZA 4A36A 1M6NA 2LCFA 3A36A 2CK3A 4HAUA 4BEBA 1OLOA 3U7HB 2D62A 1DOAA 2IS6A 3DMDA 3W5JA 1J8MF 1G1MA 2XTZA 4A9AA 1CR4A 3ND9A 4DCSA 2CDNA 4PC7A 3BIFA 4OQXA 3SDZA 4PPFA 4TZ6A 1GKUB 1OIXA 4JVLA 5JJLA 2W2VA 2N46A 3LXXA 5DI3B 3REGA 3RWMB 4EPVA 2BBWA 4JBWA 1TF2A 1RRFA 3RRZA 1F2UB 1JECA 1Y3AA 4MA4A 4GL2A 1V43A 4Y0VA 5KU1A 4EPYA 2CMKA 2DBYA 2VP5A 1QHSA 4Q4JB 1CJVC 3BXZA 4H9GA 1IXRC 4JLDA 2VHTA 4LDJA 4R2IA 5K8LA 3GJ0A 3AVTA 4LJ4A 1XTSA 1PJRA 4C0SA 4XVQA 2JJ2D 5C18A 2WMOB 1FOEB 3N2EA 1EFUA 4HLDA 1E9DA 4DKXA 4BE7B 4HB4A 4PZLA 1HH4A 1C1YA 2FFBA 4L4UA 2O5VA 5KUTA 1J2JA 3H84A 5UKDA 4DVGA 2WWIA 3M1IA 1BIFA 4BZXA 4JL6A 2ZPTX 2B92A 1ZW6A 2YWFA 3GLIA 1F2TA 3PUZA 4OHWA 3FB4A 2QMUA 1XXHB 4D0LB 3DOEA 4NZYA 2O8FA 2R2AA 4C0BA 2P6UA 3EPKA 1NBMA 2CL0X 2NOAA 2VIIA 2C03A 4PZZA 4HAWA 3UANA 5FUXA 2W6JD 2A5JA 3THXB 4PTLA 3MG9A 4MGZR 1TUIA 2ERXA 1SZPA 3I32A 3SNHA 5HR5A 4BFZA 1KIMA 5DN6D 2P3SA 2CLDX 4ERNA 5JCZA 3BH6A 3QKTA 5C4MA 4LSGA 2AX4A 1OV4A 1E1RD 3Q72A 4M21A 4TL8A 1ZM3A 3JZMA 5TY0A 2X77A 2HXSA 1NVVQ 3KXLA 3THOA 4CEIB 2OO7A 3TVTA 3K0AB 2AXNA 4TMKA 4MGKR 4LBVA 1ZU4A 3S1AB 3U3MA 4B3DA 1E4VA 3P32A 3QPVA 1QRAA 2YWGA 3GLHA 3TSOA 3EX7C 3KX2A 4TT3D 1CKEA 2JLQA 3AKYA 2Z0MA 4BFYA 4BPBA 2ASEA 2JCSA 2O8FB 2W0SA 4KSCA 3CLVA 4M1MA 2HLDA 1IY1A 2MMGA 4FMCB 4FXPA 2WWXA 2JA1A 4DUGD 3L43A 2I3BA 3EC2A 2CNWD 4CVNA 3F3YA 1AS0A 1XTJA 5FUVA 4E07A 5J4KA 4B33A 1P4SA 3B1ZA 4U5XA 1R6BX 5CM9C 3ZIAA 2IYXA 2QNRA 1IN6A 3IUYA 4JMPA 4P0TA 4R2HA 1P61B 5EUMA 4WBSA 3KKMA 4URVR 1OF1A 1U0LA 3LQRA 2CCGA 3A1SA 5JFGA 4HAXA 3ZZ0A 4A1FA 3THYB 3LH5A 2N42A 4DSTA 4KVAA 3T35A 4B47A 4F92B 1JPNA 5LPNA 2QG6A 3GLHB 4YDSA 5G3YA 1ZIOA 3KJGA 4B2LA 3ZJYA 2MSCB 4I81A 2FFQA 3EWAA 3WY9A 3KQLA 2XX3A 5HTKA 4KJZA 4AIIA 1OT3A 5K8IA 3I61A 3U7FB 2AN9A 4ZCIA 3VTKA 4C3ZA 2CE2X 1T8TA 2E87A 521PA 3C8UA 1ZIPA 3NBZC 1NIPA 1FL9A 1IJFA 2QPAA 1SVKA 1UJ2A 1GNRA 4C0HA 5LD2B 2JASA 2ANCA 1KI2A 4FMDB 3V4RA 1AJEA 3C4JA 3KXIA 2IXEA 2ZR0A 1GKYA 2ZSDA 3PEYA 2JGNA 3KTAA 2DY1A 2NZJA 2REBA 3EPLA 4NP6A 1XMSA 1AKYA 4ZI2A 4C2UA 3CRMA 2OG2A 4JVMA 3LAWA 3ZIAD 3RWOA 2IW3A 4D0GA 1Z06A 3I8XA 1N6HA 1LW7A 4WZBE 1GNPA 3IILA 2CNWA 5B58C 4UXIA 1E0JA 1L4YA 4LHYA 4C0JA 4EQ6A 1T9HA 4TTPA 4D0NA 4CEJB 2WKPA 3BD9A 1VYVA 1NN3A 1Z3IX 4Q02A 2XSZD 3QVVA 1ZNXA 3QKSA 4LX0A 3C7KA 5GJCA 5J4YA 3RSOA 4DEYA 1MT0A 2PT5A 2BV3A 1EG7A 4P4SA 1YU9A 5C4GB 1JXOA 3TW8B 1OXVA 1PLKA 2FN4A 1RPZA 2A5GA 2GF9A 3I5YA 4PC1A 2A3RA 1P2SA 1WQ1R 3QENA 2RCNA 1OIWA 3AM1A 2FZ4A 4JL8A 2NO6A 2J41A 1JAIA 1J8YF 2O0JA 3KKPA 3EZ2A 3GJ7A 5FBVB 4CEJA 5FBRB 4DLYA 1GL9B 3RS7A 2NZ8A 2CVHA 3QPUA 3J81k 2BVNA 1FP7A 1IOZA 2YOGA 2RHMA 4MRRA 1NVWQ 1Z0FA 4DT1A 1XPOA 2GEDA 2VTKA 5EE0A 3BH7A 1OYYA 1LV7A 3SHFA 4XSGA 5DLQC 3CZQA 1OPXA 2Q9CA 3VQTA 8OHMA 1O3YA 1OXTA 5HE9A 4EJSB 4Y0AA 2ZR9A 1NBMD 4WAUA 5KSYA 2GTPA 3C15C 2MMCA 1KDRA 2BJWA 2ODEA 5JZVA 1GG2A 4XD7D 3BERA 3QY0A 1T6NA 1M1YE 4QOSA 1KZGB 2PMDA 2V1UA 3PXGA 2ZI6A 5JJKA 3M0EA 2IHBA 1YZGA 4ZDIA 2FSHA 2AXPA 1N5JA 4LHVA 4HLUC 3SS8A 3U3KA 4EIWA 4DEXA 2R6AA 4Z1MA 3F5FA 3G5UA 1EFCA 3H1TA 5IRCD 4HLUA 2JLUA 2BJVA 4R71A 4LOAA 4TMZA 2NPIA 3EZ7A 2OESA 2HJGA 2DB3A 3X1ZA 3Q8XB 1XEFA 3RYTC 1XEXA 3MAAC 3T06B 3UMFA 4NKRA 3G0HA 1S9DA 2ZE6A 3C16C 1EX6A 3KDSE 2A78A 3DDCA 1KDPA 2FFHA 1KGDA 1T3LA 4HEJA 5CB8A 1GRNA 1SXJD 2P5SA 2CBZA 4OQMA 5G41A 3TW4A 4G5GA 4KYIB 4RZUA 5IDVA 2ZITA 3ZQJA 4XSHA 4CEHA 1N6RA 4C9BA 3ZS9A 1UADA 3CONA 2J87A 5E7MA 2ZUDA 2HT1A 4DDTA 2BWJA 2WWWA 1G5RA 1ZM9A 4JS0A 1NNEA 1XNJA 2F43B 2KJQA 1T8UA 1U9IA 5CYPA 3RC3A 3I62A 1AS2A 4QHSA 2D7CA 2NGRA 2AKYA 4RD3A 4CT4B 3OF5A 4TL6A 2CK3D 2IXGA 4JKYA 3BAFA 1ZD9A 4KAXA 4B32A 2FG5A 2FEMA 2QAGA 2GXAA 4Q7LA 2XZLA 1YVDA 4DLZA 1KK2A 1Z0JA 2IYYA 1KMHA 4RJLA 2IYQA 1N0VC 1DEKA 4IRUB 4EPTA 2QRNA 4NHOA 3LDAA 2WZQA 3TQFA 3QIAA 1FQKA 3BGWA 2ZS9A 2PMKA 4QKQA 3ADCA 1COWA 1KTVA 1TAGA 2Y8EA 2YNMA 2Z5FA 3QOFA 5JEEA 2EVWX 4ABYA 4GDFA 4HB2A 1OH7A 3L0IB 4FCWA 1N6PA 1W49A 3L0SA 2O8CB 2JJ1D 3DPUA 4PQFA 4YXWA 4G3XA 3PJRA 3HU3A 4JKIA 5FPYA 3FDIA 5JLJA 1US8B 4D4JA 3QEOA 3CR8A 4GOJA 1S1CA 4QBFA 4G5RA 2WKQA 3TSWA 3OE7D 5J4HA 4PAMA 3TE6A 1KI4A 5CLLA 3QI2A 5FL7A 2CCJA 2ZYVX 2AKAB 2ZE7A 4QJ5A 4O2RA 4M9ZA 4RVCA 4BGDA 3ZH9B 2GJSA 3DM9B 2W6ID 3UWKA 4Q4HA 2OT3B 3ZQ6A 2CJWA 3B82A 2WSSA 3BRWD 1OH5A 1K8RA 5FTNA 4V0NA 5EXXA 4URWR 1U0JA 4MRVA 2MSEB 3I3SR 5EZ5A 1E2QA 3HYTA 1E9RA 2V4ZA 3HJNA 4Q9LA 2GCNA 3WRYC 4LY6A 2FMXA 4HLCA 4MRPA 1QVRA 2ORIA 5IK2D 3ONWA 2WJGA 4LK2A 1XFAA 2NQ2C 2QTVB 3UG7A 3CNNA 3GLIB 1KAGA 5LB4A 2CHVA 3QJYA 2R6DA 3IIJA 3AVWA 2EFCB 3GLFA 2JIZA 2YJTD 2RH5A 4TYYA 4AG5A 2QQ0A 4YC7A 4OK6A 5JWHA 3AEZA 1EFRA 1TADA 1YHNA 2V9PA 1CR0A 2WSMA 4QFMA 4QXAA 3T5GA 2ZU0C 4RD2A 1R8SA 2XXAB 3K9NA 5TARA 1G19A 4M9QA 1E2FA 4CYMA 1LF0A 3U5ZB 1M7GA 4DBLC 5DH9A 1J99A 1X8KA 5BYKA 3ADDA 1P3JA 1P75A 1U99A 3GLFB 1N6NA 2BIFA 2LKCA 3W6NA 4DB2A 3X2SA 4D80A 1LNZA 4JT2A 4YMWA 5G53C 4YDHB 3IBGA 5FPTA 1VYUA 3QKRA 1M74A 3NH9A 1AGRA 3BH0A 4M1WA 4UNQA 2AWNA 3LVRE 1Q20A 2JAQA 3SJZA 3QXJA 4YQFA 1EWRA 4HB3A 4TLAA 5JI3E 5HZHA 2IS1A 1XMVA 4OHXA 1DTSA 2WMNB 3E2IA 2F1HA 4HDQB 4D26A 5J5CA 1SHKA 3T1OA 1I4DD 5BN4A 4IVPA 3MJRA 5EUQB 4NONA 5F9FA 3QVUA 1E9CA 4KU4A 4XJXA 1T4GA 1XCMA 3TSZA 1DPFA 5JBQA 1Z0IA 2OM2A 4M22A 2GJ8A 1DAKA 3KUCA 2IYVA 3WP0A 4QC2A 1E2GA 1M7BA 4LV5B 5CB6A 4KFRA 1JJ7A 1MABA 3FKSD 1Z22A 4FINA 5DIFA 1ESNA 4Q03A 5A5GA 5FTKA 1KI6A 3MFYA 3QF4B 2GZHA 4DLTA 4FMCF 2DCUA 2R6FA 3OIWA 1R0ZA 2D74A 2WKRA 1VCMA 2MSDB 3VFDA 1R0YA 5FBQB 5CJPA 2GK7A 2VP4A 4NTZA 1L2TA 1OXUA 2J0QA 2AD5A 3CR7A 4PANA 1E94E 2GAAA 1KOFA 1YZQA 4QBHA 4P33A 1MR3F 1OXSC 2Z83A 1TQ4A 3CRQA 3R7WA 2RGAA 3PITA 2AK3A 2HYDA 2CE7A 1RW4A 4NE2A 2GCPA 2W2XA 3WBJA 2RGNA 1ZUNB 4WZ6A 3DEFA 4HUQA 4TYQA 4BRUA 2A30A 4Z51A 1OYWA 1W5TA 1A2BA 1MO6A 2EW1A 1L4UA 2G3YA 3C5CA 4HB0A 3DHWC 5KHOC 1YKSA 3T1TA 3K9GA 3B7GA 2QBYA 5LDDC 3A1VA 3Q7PA 4HSEA 4KCGA 3HP1A 5JSZB 3LXRA 1G6OA 1ZNYA 1JEEA 3CH4B 5KSPA 3AB3A 1SXJC 2ZROA 4QJ4A 3U44B 2KBEA 4K8OA 4Q9HA 3BE4A 1L8QA 4O25A 2JLZA 5H1YA 1W0JD 4L9WA 1Z5ZA 5FI1B 2XOKA 3CRVA 4E5UA 4ZDWA 4LBZA 1S4QA 3RVBA 3NKVA 3SFVA 4NYMQ 1GRQA 1OHHD 2ORWA 4JSTA 2NPFA 2OAP1 2FF7A 1L7VC 1Z6YA 4DDUA 5IT5A 2KBFA 3PEWA 5G3ZA 5FOXA 2G9NA 1NP6A 3IBYA 2QBYB 4ZIRB 1FPMA 4JLAA 1KI7A 4TLDA 2FSFA 5FTLA 2VRWA 4II7A 2J1LA 2VF8A 2C98A 2VSXA 2IYTA 2QE7A 4LHXA 4TQ9A 1JR3A 5F2EA 2FPKA 2DR3A 3FFBA 3IIMA 1LS6A 1XEWX 2IK8A 4DC9A 5JHHB 2V55B 1QG2A 4A2PA 3R9XA 5TXGA 2WWGA 3A8TA 1KY3A 5JEDA 2GKSA 3AUXA 4OQNA 4B3BA 1DAMA 2CXXA 5CDFE 3ECCA 5E3HA 2ECKA 1A2KC 2V6IA 5BN5A 4UXJA 1JQJC 3E70C 1S8FA 1T3HA 3GQBA 1KJYA 2GHIA 4O0MA 4BZQA 2VP2A 2HCBA 5CITA 4YONB 1VIYA 4K81B 2WOOA 4EDHA 2PJRA 3EPHA 4TZ0A 4DCUA 2FGJA 1FMLA 4A8JA 1XMJA 3H4MA 1Q1ZA 2J45A 1FUUA 4O3MA 4AURA 3LA6A 1Z2CA 4WZAE 3EWSA 1C9KA 1PZNA 1WE2A 2OXCA 4P4UA 5AJWA 1SHZA 3T1VA 1M2OB 1I4TD 3GLHE 4L15A 1VDZA 3SU8A 1XP8A 3DOFA 3QG5A 1UDXA 3RANA 5BN3A 1J90A 4B6EA 4QM7A 1X1SA 2BCJQ 4QNRA 1YRBA 2BDTA 3NVAA 4TLBA 2J7PA 2JATA 2OSBA 2ZJ5A 1XD2B 1KAOA 1MO3A 2ZJYA 4LHZA 3KB2A 3R8CA 4KYUA 2QUZA 3NEYA 3QXHA 2YVUA 3LBHA 2WHXA 3TK1A 1QF9A 3NBXX 1VG1A 1E79A 4URXR 2OHFA 1KNQA 3CPEA 4Q66C 5SZIA 4V0ME 3EARA 2QP3A 5CK5A 5J47A 1P2VA 2ZRKA 4BFWA 4WIAA 5CIQA 1TQ6A 4FI3C 1F3OA 3V9PA 1GITA 4KLNA 2DYKA 3AF4A 5KSOA 3L82B 3TR5A 1JB1A 2BMEA 4OJQA 5LD2C 4U02A 1E4YA 3NXSA 1W4RA 4M2LA 4B75A 3JVUA 1P7CA 4CGZA 4HZUB 4RFSB 3DL0A 1QHGA 3L0PA 2VHJA 2V8OA 4Q1EA 3SI7A 1NVVR 4Q47A 4ZCLA 5FOTA 3IIKA 2LWIA 3Q3JB 2QSZA 1Z28A 3ZS8A 2AR7A 2V54A 4TYNA 2HJVA 1W36C 5DHAA 1G3IA 4PO1A 1XCGB 1U8YA 2P67A 4Q5IA 1GUAA 4C0AC 3I1FA 3AV0B 2GK6A 2FOLA 5EP1A 1OB2A 2IXFA 2D06A 5BW8A 4PC6A 1ETUA 3B6EA 2BEJA 2CHGA 3AVXA 2H92A 1KHTA 4G0NA 1PLJA 4Q48A 4CT5A 3PUYA 1U2RA 2E1RA 2WJHA 4NU0A 4UJ3A 1ZD1A 4ZO4A 2C5LA 2VP9A 3OESA 4P3YA 2VP0A 4LUCA 4RSGA 1Z0KA 2PX0A 2RMKA 4V0OA 3FTQA 3BB3A 1G4UR 1MRSA 4MUAA 1N5KA 3UXMA 1P9NA 4NCKA 4PAQA 4AD8A 3AKCA 3VR6A 1G3UA 4B3GA 2AK2A 3KTAB 4YLGA 2IYRA 1E2JA 1N3BA 1VIAA 4Q4AA 3RHFA 4JLVA 4DLVA 4LHWA 3MWKA 4LJ8A 1Z07A 2GWHA 3CBQA 2BHRA 3LNCA 3GLGB 5DSZA 3OEHD 2A5YB 2QZ4A 4BWYA 3KFVA 1FX0A 2J3EA 4JVNA 3B1WA 2G1JA 3BK7A 2XB2A 2RHDA 1Q1EA 3KQUA 2PLRA 1NJGA 1M34E 3RLFA 3EZ6A 5AWFC 2OCBA 2XNDD 4OQFA 1NL3A 2OBMA 4JL5A 1W0KD 5FI0B 3FGNA 5L3VA 3IO5A 2WPDD 1DG1G 4AKHA 4CRWB 1D8TA 1W48A 1SVMA 1DS6A 1T0JB 1PUIA 4HATA 1P72A 3B85A 1AS3A 5E7IA 1H8EA 4CF7A 4ESVA 4KFUA 3SHWA 4JJKA 4UKDA 3ZVMA 3U61B 4F38A 3FHOA 1KK1A 1VG0B 2PZEA 4QHYA 4U00A 1TEVA 2O0HA 4NYJQ 1CIPA 3DKVA 3HPRA 3CRW1 3I8SA 3CWQA 1HT1E 4GZLA 4BASA 1JALA 4XOIA 2C2HA 3AKEA 4DT1B 2QMEA 3VAAA 3R20A 1GL6A 1KI3A 4WW0A 1MRNA 3CH5A 2DFTA 4DB4A 5FUYA 1II8B 4ACAA 1XTIA 4JT4A 1WXQA 4YMVA 2BCGY 4TLEA 2ZU6A 4Q1CA 3HR7A 1FTNA 1P73A 2LKDA 1BMFD 4ARZB 1Z29A 3WRXC 1W7AA 1TNDA 4FMBB 2EYQA 4RZ2A 1EGAA 3T5DA 3CX7A 4DSOA 2J0VA 1UFQA 1G3RA 1BMFA 3DMNA 4MGIR 3FE2A 2IC5A 2ZRNA 5B30A 3O47A 4NBSA 1II0A 1G16A 3AP2A 4DCVA 1GRRA 4TTRA 1G3QA 1KKLA 5FOUA 1R5OA 2F3TA 1Z8FA 1WP9A 4TQUS 1NRJB 1AM4D 1D9XA 1P2UA 1KI6B 2YC4C 1KI9A 3KZ1E 4EFLA 1WBDA 4L16A 1BO6A
chains in the Genus database with same CATH superfamily
3BMXA 3WXBA 1TQ8A 2H4ZA 1AMUA 1GQSA 4YRKA 1K6JA 2GRJA 3G2KA 4QOEA 2M2IA 2R8YA 3ZXUB 4YRZA 3HDJA 2BF4A 5HUJA 3K5HA 2BM9A 1GA4A 1RAIA 2FSIA 1CQZA 2R62A 3IBTA 1L5SA 5KWSA 4HEA6 2PPLA 4R7ZA 4PO3X 2OOSA 2PIAA 3KFLA 1D2MA 3L8FA 2VYVD 3Q2IA 3QXGA 2QLLA 1Z7BA 3D31A 3EXFA 4MR8B 3FPKA 1L7EA 1YXMA 1HWYA 2H54A 2ZUUA 3CV3A 3D0QA 1YR7A 1X39A 4KVGA 4TWAA 4DMCA 1ZD3A 1RRKA 1TJ3A 4IIXA 4NABA 3QUCA 1NNSA 4I14A 5CYGA 4IH1A 1MIOB 3ZTWA 3FSEA 4WK2B 1F1BA 1JJAA 3NDJA 4F4HA 1PWXA 3WGJA 4GHWA 4ZCPA 1RAHA 3SPXA 5CXSA 2QSYA 4FC7A 5JH7A 1DARA 2PWAA 2XVZA 3MJFA 3FGZA 1C3VA 3PCRB 5CURA 5AIAA 2JHPA 2V58A 1EMDA 3DTVA 3RNOA 4DGSA 3V97A 2ZSKA 1VSQA 5JSZA 4PLHA 3UTCA 3IEMA 2GBFA 4HYQA 4A23A 1EBUA 2E9SA 4CDNA 3WV5A 1WW8A 1Q7GA 1XCOA 4G5SA 3W3AA 5DGDA 1DX4A 1JQDA 4NJOA 4DA0A 1FP6A 4CTOA 1Q15A 2QU8A 3WLLA 1WU8A 3WBBA 2C7QA 4KIJA 5G0WA 3KDPA 1GNQA 5F7OA 2HF7A 4HVTA 1WY7A 4LYEA 4YLEA 2C61A 2DTDA 1R6DA 4ZO8A 1DKPA 2NU9B 4BO3A 3AJDA 1Y8QB 5F76A 3ZN2A 4RY8A 1SQSA 4A0HA 4OX9Y 2PBLA 2PIDA 4JENA 4P98A 3ZHYA 5T4EA 4TTTS 1CYDA 1XHLA 4QPNA 4X1YA 1AGNA 1Z5NA 2DWCA 1PJSA 5HJ5A 4YIHA 3U4QA 4WEOA 1PWZA 3OOJA 1VSVA 1IBSA 3G2JA 5FADA 3RRMA 5C5EA 5KIAA 2G70A 3FZQA 4CN9A 3K94A 4L0CA 4J91A 3SVTA 2P9FA 4IDBA 1RADA 5BSTA 2XYVA 5K09A 3CVVA 3EGDB 2Z4RA 3TNYA 5L3RA 5L3QA 4M1SA 1MB9A 2M32A 3EWNA 1BH6A 4WZAB 1Z6TA 4HYYA 3AOEA 3FMFA 4X64B 1W36D 5EWMA 3LO5A 2X0KA 2YJGA 1BS1A 4FFDA 5FYQA 2WHQA 1NZFA 3HMKA 3QSGA 1L8AA 2RGUA 4FX2A 3IHKA 4JX8A 4ABYA 3THWA 1PDOA 2J07A 2CGEA 1ZGCA 4U8HA 1I3MA 5ALPA 3TBFA 4A6PA 1Y82A 5HCNA 3JQQA 5JLAA 2FUCA 1JJVA 2YASA 3ZBQA 3JD3A 2JEYA 4IL5A 1QFXA 1EE1A 4FFOA 4PFQA 1QWOA 4YJKA 3UJDA 3V4VB 3D6UA 4C0WA 3KSAC 4AZVA 2UUCB 3L41A 2AI1A 1NDHA 1TM5E 2G67A 3RC1A 3IO3A 2C3UA 2O05A 3FDZB 2WHPB 2JDIA 2QN8A 3D0OA 3D3KA 3EGCA 4FWBA 3RT1A 3RFFA 4AJ4A 1DQRA 1DG9A 2QN2A 3CUWA 4WDRA 1HTWA 4U2GA 3O2SB 4TKVB 2FR8A 4LRSB 5AUNB 2INGX 3N6RA 2BI7A 2GVNA 3O8OB 1UBMS 3PUKA 3LWDA 3SXPA 1ZGHA 4RH0A 1HEIA 2MHCA 4WXHA 3CWZA 2RAFA 1Y0BA 4O4JB 1IU9A 3LU1A 1MDFA 1QH1B 5A5FA 5I7RA 3STXA 1C0PA 3KQHA 3LLMA 1ZRNA 4O02B 1I5RA 1EINA 5JV5A 5DPMA 1GIAA 4E70A 5K8CA 4NCNA 3FNBA 1L4GA 5EZYB 1ZYUA 4ZKDA 2XBLA 4KV9A 4RY2A 4IJVA 2QLBA 2IYLD 4JLMA 5HQ3B 1N75A 4YRBA 1B00A 3UWDA 1E7SA 3X1WA 5FULA 3RT9A 1J8DA 2DE0X 5EHNA 4BNIA 2ODBA 4WGFA 1UKYA 2EL9A 1W44A 3G0OA 3C74A 1AV7A 1NG1A 2DHRA 2YYZA 4B81A 4CM9D 1BYIA 3DZ8A 1RACA 1K2VN 4X6LA 3EQ8A 4Q7MB 4JBNA 4LVNA 4B6FA 1R4AA 5BVGA 3AW8A 4MS3B 1YJQA 2QZ9A 3GUZA 3MQFA 2EFHB 2OFWA 4H1UA 2MINA 5AJZA 2PGAA 3TOCA 3C3DA 3I39X 4ODIA 3WMEA 4HLQB 3N28A 2RB5A 4JZKA 2VDNB 1UDBA 2Y1LA 2Q21A 2WY2D 3UKDA 4AO6A 1IN7A 4D4GA 2XOXA 3ORHA 3R3SA 4HRYA 4XYBA 4FB4A 2A58A 3KS9A 3RBXA 4YDQA 4F4IA 2QENA 3ORFA 2C9BA 1ANKA 4KN8A 3FGOA 2A0WA 4MK4A 4LV8B 5AM3A 3DE6X 3H16A 3UT5B 4IZIA 2J31A 4C7KA 1XD8A 2HRBA 1D03A 2HAEA 3AP3A 3GJ8A 1BWRA 1KMNA 1UCFA 3WQBA 1LB1B 2IF2A 2QTHA 4YECA 2G7ZA 4HMOA 4IIJF 3QSYA 3NQ41 2C31A 5J2UF 1PJLA 1FA9A 2OAGA 3HGMA 1V11B 5IYZF 4PQRA 5AJVB 4QTXA 5LOVB 1N2IA 2PFGA 3KG2A 2SCUA 3L8CA 3OHPA 4Q1VA 3VR4A 5KMGB 2KLHA 3SY8A 5K8LA 1YJAA 1VBKA 4L02A 2FA9A 2OBXA 2O8EB 3VNVA 4H6XA 1BWPA 2HJRA 1XMIA 7MDHA 3E7FA 2BYTA 2RB4A 2QM0A 1U2QA 1IN4A 2ZI9A 5K0SA 2CN1A 5D3QA 2X4DA 1YBVA 2Q6TA 3L6BA 3KPVA 4D3FA 3ZLJA 1JHRA 3E2MA 1I32A 2OORC 1NW9B 5H81A 3UJ6A 1L7BA 4ZU1X 4Z0HO 5AJTA 3E84A 1XSEA 1X13A 2PHZA 2PX8A 5BWLA 1ZSVA 4G1EB 3AR6A 2WFAA 5H7XA 2AN1A 4WUTA 4M37A 2XCSB 2CNNA 4RO0A 4BVFA 2HNKA 4BMXA 2I1QA 3OZWA 4BX9A 2VTEA 3IBSA 3UB2A 3EIQA 1WEKA 2JVJA 5LYYA 5AVYA 4PFKA 5KVQA 1L8XA 1GPAA 4DGQA 2YZ2A 1PFWA 1Y4UA 3LC7O 4IHJF 4QGHA 1CS0B 3QXCA 4FYVA 1AY0A 1O9HA 2X58A 3OM1A 4JN6B 4PGMA 2FVYA 2R5FA 2VN8A 3BG5A 3K9LA 1DTWA 4EB0A 4E31A 3QWIA 3OHMA 2DFVA 3G8AA 2R44A 2HV8A 3CKKA 1HNXB 4DLKA 3I12A 4RHFA 4MB2A 1E6MA 3RYHA 2O59A 2VJYA 2ZSEA 4TSKA 5IXJA 4C4SA 3K30A 4E0BA 3Q7TA 3CF6R 4D4IA 4AYXA 1B8PA 2O2SA 4TGLA 2CF5A 4K03A 3TLXA 4MKHA 16PKA 2L0XA 2GAOA 4G65A 3MTIA 5A9RA 1NYRA 4R5HA 1J22A 2HMYB 3N7AA 4ND2A 5DASA 1YR9A 3FYDA 2Y0CA 4NEHB 1WO8A 1T5BA 1XJWA 4O1HA 3IOCA 1TXGA 4CUKA 3E5HA 2Z4SA 4O2BA 2XMDA 1KMHB 4LMBA 4IIJB 3RWBA 5BWBA 2W42A 1TT5A 4BOYA 1AOXA 3OFNA 4R6WA 4RA6A 4HVAA 5F77A 2OD2A 1KE1A 4EL5A 3RAEC 4PHFA 4EFKA 1FSZA 3CH7A 3OPYA 4NMMA 4RORA 3RAGA 1DX9A 1Q22A 1IY9A 1UK7A 3DFIA 4Q7QA 2PSJA 3ILVA 4EFMA 1MXFA 3TPZA 5FXMA 1J0AA 1GPJA 1K63A 1AZLA 1Y8RB 3GDHA 5HQTA 1DV1A 4OLBA 5FPHA 1OAAA 3NUQA 4NSNA 5B55A 4V1CB 1JG3A 1FSFA 1DKMA 2V03A 3PUWA 4C30A 3VDNB 4N5LA 4CIBA 4QJIA 4RPJA 3K0HA 3CBGA 4HOYA 2QZJA 4WQMA 5G40A 1JHDA 1XEXB 1PNTA 3PX3A 4QWMA 2H6EA 3ESBA 1T35A 1XAHA 1QM5A 3O9VA 1ZWKA 1H2HA 4J2HA 4LVUA 2XGJA 3IELA 1KEKA 4TMXA 5J40A 4ACBA 3PD7A 4E2WA 1SQ5A 3L0BA 2G40A 3TEJA 4JY7A 1C8BA 1CBUA 3OAAA 2IYAA 3P27A 3Q87B 1GD1O 4KMMA 3FKQA 5EZ6B 3EA0A 3T3IA 3MYRA 1D1SA 5J2UA 1U81A 1NBEA 1YAJA 2A1UA 4CUJA 2IIVA 1Q0HA 2W2LD 3H2JA 4FNOA 1B8NA 1EXWA 1QGZA 1R16A 5H4GA 3CQ9A 1DCFA 1QTRA 3I1JA 3PHJA 4Z4CA 4ARIA 2CDBA 4Q1AA 3PQCA 2RGBA 3BKXA 3FNEA 5JXHA 4IGFA 3UJCA 3DZJA 3ZZNA 5CLIA 3GH3A 5IXYA 2YINC 1IIRA 1U7XA 4JYPA 2ZDGA 3SZUA 1D1PA 1T5LA 1QVVA 3JR3A 2FPPA 1XZ8A 4GKVA 3UVEA 1ULBA 2UYGA 2POQX 3KWJA 4YX9A 3A4VA 1GZ7A 4W9MC 3IEPA 1F4VA 3D2CA 1PT9A 2EERA 1VE9A 2R5WA 3HRIA 4KH1A 1QE0A 3T9BA 4D81A 1PL8A 5DXAA 3KPWA 3TOSA 2DRIA 3CM0A 3NO4A 1ZJWA 1E1YA 1KRWA 1KH1A 3OIVA 3HH8A 2YL2A 3ACBA 3BKWA 3OKCA 3SZGA 2DKFA 4CMCA 1P39A 2HSWA 2XUDA 3DF9A 2VNJA 3QM1A 4UTZA 4EG8A 2FH5B 1ORDA 3IP7A 3PT5A 3W77A 1YOVB 3LZ6A 5C1OA 3SJAA 3T9EA 4MAAA 1B41A 2V6BA 3MJSA 5EP2A 2VXOA 1KY2A 4ICIA 2A4MA 3DBHB 3G2HA 4QSMA 3ZTTA 1Z08A 1Y7HA 3ETLA 1JPJA 2W2LA 3FNRA 5FV4A 2C4VA 4ZT4A 3GPLA 2PAAA 2PX2A 2QA5A 2H4YA 1NI4B 3BSSA 2RJNA 5JQWA 2C29D 2FSUA 3QFFA 4MCAA 4LQLA 1EBFA 2G83A 3OTWA 4Q37A 1S8AA 3SQWA 3LT5A 4R1NA 4N1AA 5E3IA 3RIGA 1G38A 1P9RA 2PLAA 1XG5A 3UO8B 4MUEA 1P18A 1V1RA 3L7OA 3ZVLA 3ZU5A 2MSLA 1QORA 2GFHA 3R5KA 1V1MB 2VLIA 3OMXA 4NDAA 2Q9BA 1RWWA 4AJ1A 4C21A 1JEAA 5K99A 1RRVA 3LVQE 4XGKA 5B37A 1NF3A 2LZ0A 3W0LB 6NULA 3NYQA 3KWMA 3JYPA 3R3XA 5JMTA 2SKCA 1IULA 4RNCA 3VVLA 1X1BA 2VO1A 4MR7B 3AUKA 4CR7A 1ISPA 5BUZA 4MPRA 4B8WA 1GO2A 3LW8A 4NFYA 4DIEA 2YTZA 3WK6A 3QVMA 4MQBA 4FCVA 3T3GA 4YK7A 1VBMA 4H31A 5ICGA 1ZC3A 2FWMX 1WBBA 4EGCB 3FOAA 2Z3VA 4S24A 1F6BA 4POAA 2X41A 2AUTA 5TIIA 3TJMA 2Q62A 1ZN9A 3K70B 5CJ2A 5ALDA 4PVDA 2HBRA 2IUEA 2FK7A 1CP2A 1ES9A 3ADKA 4M1TA 4BKOA 4C89A 3GLGA 3ZXIA 4LRTB 4BFTA 5LP1A 3ZYZA 3OQMA 5ES3A 4E1VA 3O21A 2GS9A 3O2QB 5FHRA 1FB5A 1VL5A 1WCYA 2PXHA 3DDWA 3IALA 3JARA 1C9DB 3KUUA 3UK7A 3IHWA 2WK1A 4PYRA 4Z0PA 1FMTA 1P44A 4CPDA 4JI0B 3LY8A 4KDEA 3QNWA 4Q3BA 4TVKA 2X19A 5BXQC 1ENZA 1F8YA 3WRYA 1E2PA 3C7DB 1SU7A 5GONA 1KQOA 1UDCA 1B16A 2D5AA 3TZCA 4RABA 2NU8A 1D2NA 2NADA 1JDBC 2DJ5A 2NV6A 2WHYA 2XUIA 2XUKA 3COZA 3PNPA 4IHAA 3L93A 4WECA 5IJAA 1F3LA 2OENG 1KO1A 3NDPA 4ID9A 5LP6F 2IL1A 5MN5A 4ZQGA 4CMBA 4U7TB 3V1TC 4IOJA 3GU3A 4IGAA 4N8SA 4YCMA 2P35A 3PTZA 3L7LA 3N6VA 3I09A 3OX2A 4P0QB 1RWNA 2ACKA 3VZRA 3V4PB 2XECA 3N0VA 1CUSA 3ASYA 2IPXA 2GSWA 4WXEA 3DMTC 3ZZTA 2QUIA 3QE9Y 2B7LA 1O6ZA 2GVZC 3DDHA 2P1ZA 3KALA 1M1UA 2WICA 2NXEA 2ZVPX 2YHAA 3FUVA 1FX0B 1MRZA 2IT1A 4F06A 3WMFA 3ZJ4A 5F1PA 1CUAA 1UKZA 2AQHA 2NO7A 3E8SA 2D1FA 4PSCA 1NVEA 3CZ4A 3DFFA 4Z4EA 1U2DA 5JE8A 1WUYA 5LDHA 1X77A 3KEOA 3UMJA 1S2NA 3UJAA 3IEIA 6PFKA 2NTJA 2DFKB 4AJNA 3MBOA 2VDWA 5HE8A 4KE7A 2J0EA 3ESAA 1YDHA 3JQBA 4BDSA 2I6SA 3U3XA 1YTUA 2JARA 5EMJA 3VR4D 2ZIUB 1E99A 1SEPA 2JBWA 3UWPA 3WXMA 1XXHE 4YT8A 2IE8A 1EESA 1GFWA 1G63A 2AD1A 1Q19A 1CJBA 4JCCA 3IFSA 1VMAA 3RUIA 1ZU5A 3T9CA 4RK5A 2QI9C 1NAIA 1ADYA 2P65A 3BMQA 1YJCA 2ODQA 3AJEA 4PC2A 2QJRA 3GNLA 3H9GA 5ESWA 3IMGA 1QG0A 5B1IA 2HJ9A 4JUIA 4D46A 1L5VA 2MR5A 2GTIA 2SECE 4HADA 1R6XA 2I5PO 5BNIA 5EHIA 1ISSA 4JXZA 1PL7A 3EXAA 5HOQA 2HSZA 2GZMA 5DSTA 5FDFA 2G0TA 1NKTA 4B3RB 3L5OA 3G8DA 4PIMA 5C7IO 3JYQA 1X86B 2XMPA 2BFCB 1JE0A 3QFTA 4RHTA 2BGTA 1ZCAA 1AUPA 1O54A 1EVQA 3LKZA 3UJBA 3SR0A 3OEEA 2XMSA 3ZDYB 1JHPA 1BS9A 1XVUA 1G41A 1DHRA 1JTVA 3FFAA 4UMVA 4B17A 6ADHA 1GPWB 4KO4S 4NMLA 4MDEA 2B69A 1SKYE 1Q1QA 4MV4A 4CM3A 5CLJA 1BVYF 3K2IA 3NBFA 4D4JA 4LZLA 2IZZA 3L7NA 4DLRA 5JMWA 1OBCA 4KXLA 4BATA 3G8BA 1CY6A 2A9JA 4IIUA 4A7PA 3H6HA 1I5OA 2VBIA 4AKGA 4ZTZB 3AVVA 2ODAA 2X8WA 3DF7A 2R5NA 1FTWA 1GSIA 2L17A 1P9WA 1VHJA 4F3CA 2OCPA 1YZUA 2L82A 2LTAA 1O0SA 4PPNA 1SU4A 4GECA 3GT4A 3ZCXA 1MVOA 1E7MA 2AJDA 2AQIA 2ZRGA 1I2MA 3C6QA 4TV9F 4GMXA 4KAAA 1T2EA 2ZI3A 3IPRA 4DJEC 3K71B 4UATA 2FUKA 1IC6A 4U3JB 3PGJA 5IC4A 1Z12A 3NBUA 4DMGA 4OHOA 3CSDA 5I6DA 2ZUSA 2J46A 4R69A 3ZZUA 4EMUA 1N8SA 2Z08A 3WMXA 3LIPA 1ILEA 3P0HA 3EYAA 1J8QA 2XUPA 3ETNA 3FWPA 3KKEA 3TDNA 3VNAA 1XRPA 2C9DA 4HPWA 1PHRA 1WAMA 4EBBA 5CLHA 1GUZA 1PTKA 5IBRA 5TGTA 1V5WA 1F2VA 1D4ZA 5JEEA 4BBPA 4M1KA 1AUVA 4W63A 2WM3A 1MABB 1S2LA 2OGWA 4J0EA 1QKKA 2GD0A 3HB9A 4OMFG 2ON6A 4FYIA 2O8BA 5A1TA 4UEWA 4LTNA 1S7GA 2E37A 2YIMA 2ZT8A 4L07A 1FTSA 2XYGA 3RS2A 4K9DA 3A7DA 3L2OB 4PYIA 3PNLA 4L8WB 5FR2A 1JRLA 5EFOA 3S8MA 4GO1A 3N0WA 4E2YA 3LCMA 3CJRA 1S3SA 2ZEJA 4N7MA 1II8A 1C80A 4IF4A 2I2XB 1RZVA 2RBGA 4WOPA 4YMSA 4NCIA 5L51A 4IXMA 4MUFA 4PGFA 4ZC8A 3UCFA 3ZGYA 1AQJA 5LMNB 4C2TA 5JD6A 1TAQA 2JBAA 2BJHA 3AT1A 4FDUA 2ZUBA 5HK9A 3TM5A 1NXVA 3TOXA 2G08A 1DKOA 3VPAA 1JILA 3MN1A 1WUJS 3R9IA 4C0LA 5K05A 1SWWA 3O31A 3WDSA 5ADVA 1K8XB 1Y4AE 1A8SA 4DWVA 1H4SA 2JJYA 4N3NA 1UP7A 2WJVA 5DVZA 1R4MB 2IV3A 2IYFA 2YMPA 4NU6A 3L18A 5F9HA 1KO8A 3B89A 1AD2A 3IAS1 3IDOA 3MT8A 1RLOA 3DLAA 3DUWA 2DG2A 5CYFA 1GZVA 3O0DA 2HF8A 3K53A 3QQPA 2J4DA 1EP9A 4B35A 4ONEA 1T9ZA 1YJBA 1PR4A 3P7MA 1QMGA 2BGNA 4KKVA 3ZHXA 3GUYA 4WKCA 2HA7A 1FBTA 1P0PA 4Q1BA 3M83A 1TD1A 2GARA 2I3ZA 1CF9A 1WHTA 2QTVA 3DMGA 2REOA 1ECJA 1PZMA 3VOTA 2EGGA 3BB1A 3IP3A 2QJTA 3TEFA 5I5EA 4BO7A 1CQIB 2OQVA 3VR1A 1OZHA 1DAFA 1PJTA 3S2ZA 2RHGB 2PZGA 1PBTA 4RPGA 5GV8A 4P3PA 3ST7A 1F0YA 4BFCA 1E3SA 4KGZA 1P6UA 1SULA 2XHZA 3GLVA 4A3SA 1IBKB 3HRHA 5EWLB 1HYQA 3G9TA 5IF9A 1TA9A 2G72A 2DUJA 2AZ4A 5C34B 5H70A 2ZQYA 3KQSA 4TT3A 8GPBA 1L7PA 1R8XA 4BQFA 1FDSA 3ZGOA 3PU6A 4CW7A 5LNK1 4EELA 1CIVA 3VTAA 3QUSA 2PEYA 3MRSA 4KPGA 4Q4DA 5E9QA 3R5HA 3SXUB 2IF0A 4A8TA 5LLTA 1JDUA 2NUPB 3GDFA 1Z63A 4JBLA 1U94A 4BTVA 5A4DA 1VTKA 2H1SA 1GG5A 5BWMA 1S96A 3R24A 3TDKA 1HDCA 3PJEA 2Q5OA 3G82C 4YO8A 5K4GA 1RAAA 5LQCA 2QP9X 3CN7A 1B0AA 4X8LA 4G6ZA 4N54A 4EP1A 4KUHA 5HILA 1PWYE 2NP7A 1Q84A 4DC1A 3HJUA 1T8SA 3U4IA 4FEAA 4NV1A 4IXDA 4G0MA 3VVBA 1XKTA 4DABA 4G5OA 1P1FA 2FLWA 3R1IA 3A1WA 3C97A 1QV7A 2P0AA 1YB5A 3FLAA 4O4JA 1QYIA 2Q2OA 2VJAA 3RUFA 2I4LA 2D5BA 3HN2A 2HREA 4RCYA 1DEOA 4HDRA 1ORTA 2E4YA 5JDCA 3LUGA 3W1WA 2RJOA 2BKEA 1JFFB 2W2PA 3NHUA 3EXHC 4A1OA 2J3IA 4EHFA 2R8ZA 3I6BA 4WT7A 3AJ8A 1U5AA 1XVVA 1LC3A 2WP8J 3B5EA 1T13A 4KZKA 1ADJA 4P4LA 1AZWA 1QVZA 1X1TA 2ZWMA 1UPTA 4QICA 4ZYTA 1UJBA 1O8CA 3BX1A 3C14C 3TW0A 3QFHA 1Z18A 3SYRA 4OXXA 3EZLA 3W5IA 5IC6A 4E46A 5DMXA 3E3OA 4MCIA 1DDGA 1M72A 3MB8A 4ZGWA 4OSOA 2HSGA 1FNNA 1SY7A 1ZNZA 5FNVA 2H1IA 3BE6A 5FOQA 1FBNA 2IU6A 2QTGA 2A9PA 3NHRA 1ISFA 4X0EA 4BV2A 4MJ3A 1DCTA 1APBA 4GMDA 3S3TA 1BA2A 3F6BX 2PWBA 4K1LA 4U7FA 3CLSD 4TKMA 1RJ9B 5JD3A 5BR8B 3JV7A 2IOHA 1OFUX 5KPJA 3R2JA 2IIBA 4YQEA 3MTQA 1HYBA 7REQB 1E61A 4YVFA 4B3XA 1R88A 3UK1A 3WC4A 1VHLA 4FIDA 2C5FA 3LBAA 7YASA 1H9AA 4IDAA 3UZUA 3EMVA 3GJ5A 4JU9A 4CR8A 1FVHA 4FW9A 2QPOA 3ZW8A 2X5NA 3OWHA 1U04A 1R0LA 3NXKA 3WGMA 1JDBB 1XRLA 4R81A 4YQYA 4H3HB 5BSRA 4TOIA 3GGPA 2ZRPA 3AUFA 4BLWA 4IFBA 2HYIC 3ITNA 821PA 5LMCA 4A8PA 2QSJA 2WB2A 3GUVA 3FPAA 5CT9A 2X86A 1DCKA 3I30X 4WXRA 1ABEA 1H65A 4N5NA 4QZVA 3ITEA 3WNDA 5EKXA 4EF5A 4CKCB 3TUJC 2ZSHA 5AW2A 2RGDA 3QH4A 2DZDA 1V3UA 1WULS 3RFXA 3R8FA 3EZYA 2EFYA 4X54A 2BMFA 1GM5A 3B9QA 3BFKA 1E6LA 2WJYA 3BFVA 3EQ9A 4WHMA 2Z43A 1JXAA 2WPDA 2H0RA 13PKA 3E2PA 3QWAA 4YRGA 2ZOSA 2GCGA 4MAFA 3DD5A 1NQUA 5KOJB 5TQJA 1M34A 1VP3A 3H7AA 3AO0B 4L5CA 5KNDD 1UM9A 1PR5A 3T3HA 2AOVA 5DNUA 3DZKA 1X92A 4HPXB 4JJZA 3B9RA 3MUFA 2XA2A 4WVFA 2WIBA 2GD6A 4HH1A 1FFYA 1J00A 3B1FA 1U28A 4RYDA 3V2IA 3HKEA 2W8ZA 1M8PA 2VF2A 3LGAA 3RV4A 1GPH1 2XIQA 1C3EA 4IS2A 3TQRA 4DR7B 3QFSA 3GEBA 2H2IA 3I5UA 4G63A 2AFHE 1CHDA 2RH8A 1XALA 2JA2A 1B6GA 5JRJA 1MAAA 3JATB 1ZD8A 2WBLC 2XOEA 1KJQA 3OZBA 3PFGA 4N9QA 5JRZA 1UM9B 3PPYA 4WXPA 2R7KA 5H0IA 3WL8A 4P3NA 4QATA 2H65A 1ACLA 3MGCA 3SIRA 4DCOA 3MTBA 1PNRA 4HNAA 3L01A 4N4AA 1ZK1A 4LISA 4WBNA 1A1VA 4ON9A 4UNRA 9ABPA 3KKLA 3OQ6A 1QIJA 3W3ZB 2ZTLA 2AZDA 3GFFA 1JFVA 2HLHA 2C95A 1FYWA 4WJZA 4AMZA 1P80A 2BRUA 5LXTA 2Z58A 3BHNA 2PX5A 4G5YA 4W9NC 4OHBA 1GKKA 3SZOA 5EWJB 3LUFA 4F60A 3LM8A 2ZBFA 4PSVA 1Q7BA 3PVSA 3LJKA 2VDUE 4IDOA 1HUQA 2Q9AA 2QRQA 3DC2A 4JOQA 1T1SA 1XCPA 1XNRB 3TXAA 3SLGA 2BFDA 2CV0A 4XYMA 2BM1A 2J9YB 3P26A 4BEVA 1DBQA 2W8BA 2WTBA 2FQ1A 4D79A 1YCGA 5TRTA 2JHGA 3P0JA 5H16A 3P0EA 4ZEMA 221PA 3AESA 2HA0A 3K2EA 1PLLA 3R77A 2C7BA 2OE2A 2GHTA 4Y2PA 4I6JA 3HXOA 1EDZA 1C7EA 1UBEA 2TS1A 2V0NA 3II6X 2CFOA 2EJTA 3EDQA 3ONEA 2P2GA 4LZWA 1HE4A 3LQQA 5CVUA 4O1IA 1X38A 3CHYA 4XQCA 5HDQA 3H5NA 4UFOA 4JBIA 1U0GA 4MXDA 4Z0NA 2ID9A 2QN6A 1Q3HA 2A14A 1VRWA 3ORSA 5C1IA 3TE7A 4LGMA 4H7HA 4RIHA 3DHNA 1JIVA 2RK3A 3O7MA 3RRFA 2PT6A 4Z99A 3GDWA 3WVNA 4F04A 3NONA 1E1LA 4PR3A 3AW9A 3CF4G 2HMAA 3VYUB 4EO4A 5F98A 1NVMB 1DT3A 3WWPA 2FKAA 1SCUB 4YUAA 2VR1A 5CXQA 1L9KA 1N7IA 3UFXB 1ONOA 2LUOA 4XIYA 1WUHS 1MGOA 1IHOA 4WX2B 2ECPA 3SMVA 1U2GC 3LX5A 4C0KA 1A9ZA 3GD7A 3JZAA 4CI9A 4FLEA 2X0DA 4E94A 4X8MA 5L7YA 5AK5A 3HKBA 1PYOA 1L4HA 2CXOA 4FPXA 4J43A 1GFZA 4HD8A 3RIEA 4O8CA 4WJKB 1YVPA 1K6MA 1BN7A 2OFFA 2IY8A 3ETJA 1QCCA 4P32A 4V0LA 1E79D 5JECA 1PR2A 4PLZA 2TMGA 4MA5A 4P9NA 3RU7A 4AXXA 2BH2A 3THRA 2CXPA 1OC2A 4N0DA 1NY6A 2XD9A 4ZI7B 4Q9JA 2Y68A 1POXA 3P0FA 4X65B 2BTEA 2WTNA 2QROA 4J1TA 3CRRA 1QIFA 1OQAA 3AHDA 5DULA 2WMDA 2VT7A 1QV6A 4GMFA 5BUQA 1W4AA 2F3SA 1KR5A 2ZWOA 3IPAA 1CQIA 5BYJA 4KVZA 3S29A 4B80A 1UKAA 5AHXA 1VKZA 1NX6A 4RSHA 4E5PA 2BOVA 3RAPR 1H05A 3BMCA 4H35A 2C8JA 2Y3IA 3ACDA 5I48A 4RD4A 1RLTA 3JAWA 4G1VA 5CEEA 2IWHA 1JQBA 1Y3CE 1C50A 3MWJA 4E4YA 4YAKA 1W85A 3AEUB 2OCAA 5BO5A 1SKUA 3UG6A 1SR8A 1S2DA 3OLZA 3LHIA 1G2OA 1AKWA 1GGHA 1YBHA 3A2MA 2BHLA 3QK7A 1K9VF 1RRCA 1CJTC 1U3UA 4TLCA 3VZSA 2FEOA 3E1KA 1Q0SA 1QIIA 4FHEA 4K7JA 2EFGA 2O7NA 2LD4A 2IHYA 5BPHA 2BELA 2PL3A 3RGGA 2O8BB 2CJYA 4LCBA 2FYTA 3JWEA 2IS2A 2CB9A 4LDPA 2W2KB 5L6LB 5AW5A 2J0UB 1QHNA 2FMIA 5HJEA 2VAMA 2OHOA 3EGEA 1U80A 4MVJM 4XM2A 2AJCA 1RWVA 3SKXA 4ECAA 4PZEA 3UMRA 2BM8A 3O92A 2YUTA 1DINA 3FWYA 3A4LA 4ZICA 1F5SA 5IUNC 4OQLA 4MIKA 2PNJA 3RD5A 4CKYA 4LRWA 3GR6A 3QVLA 1M2HA 4PVCA 2A86A 4G1MB 3IVCA 2DUMA 1B6RA 1TPZA 4N65A 1B2LA 2QE7D 4JP2A 4N3BA 3IURA 5EXSA 1YFJA 1R0XA 2A7QA 1HRDA 3G7UA 2IKQA 2QY9A 3KQTA 3U3JA 5C8DA 1PFKA 3C8HA 1JIKA 2O8DA 1GZ4A 2D00A 4M49A 1GG8A 3D3QA 2IYEA 2B94A 2EFEB 5IDYA 5D86A 5JS7A 2XLCA 4A4DA 4DBVO 3A0RB 2YC2C 3JQ7B 2C78A 3CE9A 4EB8A 2PR7A 2QVCA 4L6IA 4QD3A 3I2GA 2O0KA 5IEJA 3RJMA 4ZRDA 3FMOB 4NQZA 5ALLA 5CCXA 1RYDA 5JSKA 4BFXA 5DHQA 1PVDA 4Z2YA 1TIPA 1KJ9A 4BFLA 4IJMA 4RVGA 2OLKA 1XQXA 3DLPX 1NLMA 1JW9B 1KFCB 5KDDA 3RIHA 2F62A 2ZS7A 3PYLA 3UHPA 1OLXB 1UDWA 2II6A 3NNNA 4MWCA 4Q7KA 4LHSA 1EXVA 3HGQA 1YB2A 2WWTA 421PA 1GP2A 1JLSA 5BV7A 3PQ6A 2NU8B 2PRJA 2PMFA 3QMPA 2IVFA 5CD9A 5MGNA 1ULSA 4XTCS 2ZJ8A 3QPWA 3IB3A 3OTOB 2XTJA 3OVMA 3KIPA 2JLXA 1YBAA 2BBTA 4TS1A 2HGZA 2W11A 5AK0A 4DM4A 1BYUA 5KWJA 2FJUA 3PI6A 5JJBA 4YGXB 4M9CA 3LOPA 2X8BA 2PKWA 4EKNB 3Q1KA 2Z6AA 1NSFA 3ND6A 4QGGA 3VO1A 4BNVA 4YR7A 1OVGA 1PKEA 1ZZGA 1YZNA 1J2EA 2HGSA 2WSYB 3M2PA 4G2NA 4JOSA 4OVKA 1EU1A 3DM5A 4QQ8A 2GB4A 4LJLA 3RRBA 2B5WA 2Z3ZA 2X0EA 1DKLA 4IDQA 4MUJA 3LF1A 2GT1A 4ZQCB 3WO1A 3FH0A 5JAQA 2Z2XA 4DCPA 3KJEA 3ESDA 3AP1A 3HI6A 4LF4B 1RKVA 3SVLA 2ZRHA 4ZQIA 3AFMA 5JFOA 5JSZB 1QHXA 2KB0A 3A9VA 5BQFA 4RIFA 2ZM5A 4ESHA 1VJ1A 2QSUA 3BL8A 3W8EA 1D7AA 4X91A 3D4PA 5ITZA 3IQZA 1USWA 1FY2A 1GY8A 4FOPA 1U2ZA 3ZDBA 2EW2A 3U40A 4KDRA 1AQLA 2X22A 3IOMA 5TGZA 5IJZA 2B1RA 1Y7PA 3V48A 1IOVA 1KO7A 3V34A 2HNAA 3R6TA 3V2HA 3NIBA 2HRCA 4OBBA 4DWWA 1TGYA 1QAMA 2E82A 1PQWA 1XI2A 2PT7A 2WWFA 2ZE8A 1ECCA 1U0EA 1WF3A 3EEFA 3MCAA 1MO4A 2CZCA 4GOXA 1J0CA 1SOVA 1KAEA 1YCDA 5JS2A 4OQYA 1XXLA 3AUYA 3SE0A 3WGHA 2YZ7A 2SHKA 2FDCA 1P0IA 2CY0A 2YJ5A 4Y18A 1KNXA 1BHQ1 2Q29A 1XZKA 3QELA 3RSSA 1Q0UA 1WRBA 1KQGA 2OILA 4WZBB 4OYHA 4BFSA 2IZ7A 5EJEA 4CNBA 3AM3A 4MVXA 3UHJA 4E2ZA 5BNTA 1UPXA 1UM8A 2FPMA 3A3PA 3GJ3A 4IDDA 1HNZB 3F5SA 4L8LA 1Y3BE 4DV6B 3QKUA 3MB5A 2R65A 4IR7A 4DWJA 2X4LA 1V48A 3BWMA 4U7DA 1IEVA 2IU0A 4OA5A 4PYKA 4MKRA 5E4JA 4EUNA 2VCYA 2WWYA 2ZZKA 4RZIA 5IBQA 4G85A 4D4MA 3L7BA 1USIA 1Y5IA 4GPAA 2RK4A 3CPHA 4PZUA 1OW3B 5E8JA 3ROXA 3WYEA 3V1KA 4Q21A 3W2GA 1SXJB 3OT5A 5ICSA 1BNCA 5EZSA 4BLUA 2H16A 3LGXA 2QGFA 1EFRD 3STHA 4CL8A 5TVGA 2G4CA 1HF3A 3PB3A 4NOMA 2YWEA 3SOZA 1H6CA 4F3NA 1THGA 4ZAVA 5ALWA 1RJWA 1A96A 2GXUA 2JIZD 1WSAA 3THXA 4XI9A 5JIBA 3O1JC 2ET6A 1P1BA 3AU8A 5HS6A 3CA8A 1GTSA 3BZBA 3QOWA 3BICA 4HUQB 2FJ0A 2QM7A 4CL2A 2D0IA 3AERA 3T12A 3NHKA 2JLYA 2OD7A 1GUDA 3FVQA 4JJGA 5KTSA 3R3HA 3R40A 4H08A 3OCXA 4OHVA 2QTAA 2PEZA 3GZTB 1KSGA 4C7BA 4RDCA 2WSSD 1NFRA 1Z4OA 4W7IA 5LLSA 4MQLA 2FSGA 3C3KA 5CAEB 4A82A 5HF6A 3I23A 4PS1A 4WBXC 1GPLA 4F5DA 3GLIE 5ALUA 4XM0A 4CLDA 2FE4A 4QO7A 4RKQA 1VFNA 2Q3MA 2YN2A 3L5KA 5DHFA 5GZ6A 1NI4A 3GZ4A 3PNOA 4JJAA 2FN9A 1SVIA 4R3NA 5K6RA 2NMVA 1C81A 2Q45A 4F4CA 1CTQA 1KSHA 2R9VA 5BR1A 4GYKA 4RCZA 4KBFA 3WK7A 1A82A 4DLSA 4DNOA 1TMKA 3HL4A 3IOYA 5KZMB 1PK7A 3MOIA 5HTOA 2LGJA 2F9LA 1SPBS 3LLUA 5H80A 4GWGA 4L75A 4MKXA 5L8VA 4L3OA 1HBJA 4MIEA 3R7WB 3DVSX 1XELA 4WE3A 2UYOA 3H11B 4NAVA 2JJ1A 3K9WA 5JDIC 1QQTA 2QD5A 1MFZA 3ER8A 5G2OA 1Q74A 5J2TA 2ZVDA 3M6AA 1QZTA 4B6SA 3VKHA 3UW3A 3VAYA 4JJFA 4INJA 4FHDA 4OI2A 4Q4JA 4E5VA 7ABPA 2Q4RA 1FNSA 2XNJA 2OCGA 3G17A 5A4IS 3RBVA 5CT8A 5DV9A 4BEJA 1HLFA 2VSYA 4D3XA 4R2MA 1G21B 3VPGA 4MVJA