2CDNA

Crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
b'PRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 186
sequence length 186
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cdnA00
4F7WA 1NSFA 3ICEA 4J0QA 3TK1A 5K8LA 3DZDA 2REXB 4JJZA 2FOLA 3TRFA 1ZVQA 2HV8A 3AGQA 5LB2A 3T34A 2W58A 3W90A 2C78A 4ZCIA 1OIVA 2F1HA 5LD2C 3BGWA 1R5OA 3TUZC 3RS7A 1D2NA 2VP0A 1T8TA 2E87A 2VP5A 3ZH9B 2WAXA 3CPEA 4GZMA 4OQNA 3BB1A 4XVQA 2QG6A 1XXHE 1G16A 2KB0A 1OXTA 4PO8A 2IL1A 2IS1A 4Q7LA 3GLGB 2GRJA 2C2HA 4OHYA 1IXSB 4DSTA 1G8PA 2ZUDA 1P73A 2QL6A 2ZETA 3TAHA 2ZJYA 3WXMA 4RZ2A 1S2MA 5JWRA 2AXNA 2ZR9A 2W2TA 4W5JA 1ESNA 1QZXA 4EPTA 3PR1A 4P32A 1EXMA 1C1YA 2VA8A 1QHGA 2RGNC 3T15A 1BYUA 4AK9A 3G0HA 1QRAA 2ZREA 1XMJA 2D74A 4AKIA 2OM2A 5HZHA 2XITA 3DM9B 2CHGA 3CR8A 5JRJA 3LX5A 1PLJA 2H16A 4AIIA 2ZRKA 2ZANA 4Q9IA 1J8YF 1FP7A 1QHHB 2FX3A 1N6RA 5M04A 4B74A 2NO7A 3MWKA 4NYJR 1E98A 2ORIA 3OAAD 4KHZA 3DMDA 2WJHA 4C0QC 4ZDIA 2FDCA 5CM9C 1GUAA 5JECA 1MKYA 4PQRA 5IDVA 1YR9A 1R0XA 2WWFA 3GLHE 5C18A 2FFBA 2D2FA 3DMNA 5TY0A 4CZ2A 5CJPA 3X1ZA 5FBWB 3RWMB 4BGDA 1N6NA 2WMOB 4PX9A 1DBSA 1KSFX 2YWFA 2EWWA 1KO8A 2ATVA 4JLMA 1HURA 3B1XA 2QMUA 2ZRMA 3Q7QA 1W5SA 3A1SA 4W5HA 3THWA 4OQLA 2PZFA 4OQXA 4Q1AA 4QKQA 1PVOA 4B3FX 4NH0A 1KMHA 2PX0A 1L4YA 4A0HA 4C0KA 1NN3A 1XCGB 1S3GA 3T1QA 1TQDA 1XTIA 4UNNA 5B64A 4Q19A 1XZQA 3P4YA 1JJVA 1UAAA 3KZ1E 2JAQA 3K1JA 4Q66C 1BMFA 1TF2A 3E1SA 2ZVQX 1Q1EA 1Z28A 2WPDD 1VCMA 1RC8A 4GBMA 2ANBA 3WBKA 2IYUA 3U7HB 1DADA 1O3YA 1WBBA 1JPJA 2QAJA 3A36A 1FMLA 4HZUA 4TLDA 2WV9A 3B78A 1KI6B 3FKSA 2Z4SA 5FUXA 3ZZUA 2ZQ5A 4UXHA 2AR7A 3AF1A 1YZTA 5EE1A 4LBWA 3DVLA 3HPRA 3LH5A 1GP2A 2VP4A 1UKYA 2JDIA 3GQBA 5BQ5A 4M21A 2QN6A 3I5XA 4OK3A 1GTVA 1G5TA 2XXAA 1SVLA 3FWYA 3H84A 3ZVRA 3QE0A 3UMRA 1JJ7A 1VIYA 1KY3A 3CPHA 2XZLA 3D31A 3LBIA 1GAJA 1P60A 4EAQA 4JBWA 3EC1A 3M0EA 4JKIA 3L0PA 2VRWA 4MRSA 4B3CA 121PA 3MLEA 2F1RA 2FGJA 4L4UA 2KSQA 1E79A 1U8ZA 4OI2A 3OEEA 1KZ7B 3RVBA 3R20A 2BMJA 4EUNA 1J7KA 2WSSD 1D2EA 4I4LA 5FBRB 2ZPTX 1ZD1A 4MUBA 2J1LA 4BPBA 3OE7D 4FXPA 2YC2C 2R65A 4XSHA 1W49A 3T12A 1HE1C 2JLUA 4AYWA 4TLBA 1GRNA 3VR2A 3GJ6A 3N5CA 1E2GA 1G9XA 2OCPA 2HDNB 2QU8A 3QG5A 2IF2A 1AA9A 1US8B 1PUJA 2A78A 2QA5A 2RCNA 3ZS9A 4BLSA 2IUUA 2IS6A 2A5JA 2FPLA 1TMKA 2H8KA 1LW7A 4Q1FA 4QBGB 3D8BA 5J4KA 2H18A 2R9VA 2ATXA 4JZKA 1MOZA 4PPGA 4EPXA 1N5JA 4OBEA 2C5LA 2WAYA 4GSYA 2N1BA 521PA 2VPPA 3Q8XB 1WB9A 2WKQA 2O8DA 2ZAMA 5L3QA 3ZS8A 4BEBA 5KSOA 3PVSA 4RFVA 4HAXA 4MGZR 3BAFA 4QXAA 4HB3A 4BLRA 3N2EA 1WBDA 2OESA 2GILA 5J4LA 4XD7D 4JT2A 2D06A 3UG6A 2R6FA 1R4AA 1IHUA 3RS5A 2GXAA 3A1WA 4YXWA 4B43A 3KL4A 4IDHA 4CGZA 3KJIA 5HR5A 1DOAA 2VSXA 4EJSA 5C1BA 1WQ1R 5CLLA 1AN0A 3VR3A 3A4LA 2IYZA 1P5ZB 1EFRA 1ZM7A 1VHLA 1YZNA 2JJ8A 3EA0A 1GL7A 4WXPA 5DIFA 4QJ3A 4MITA 5GJWC 4KVAA 1RW4A 1GRRA 1KK1A 4CEHB 3BIFA 3EPHA 1U8YA 4URZR 1NMZA 2PH1A 3L0SA 4UJ3A 3SI7A 1T8UA 1YR7A 1A2BA 3M6AA 2W00A 3OEHA 3I8XA 5JHHB 3R9XA 4Q1DA 1IN4A 4KFTA 5LDDC 1HYQA 1RRGA 2EFHB 4C0JA 4NL4H 4FMCB 4QM6A 1HY3A 3LD9A 4Q01A 1EFTA 3RS3A 2PL3A 2GBLC 5FPHA 3ETLA 4DLZA 3CNOA 5C4GB 3AUYA 3RLFA 2WWIA 1IXZA 4MDEA 3EPKA 4HLUA 2H17A 3FYHA 3ND9A 3U44B 3LY5A 4LHYA 3VR5A 2QT0A 2ANCA 2FH5B 3EWSA 1P9RA 5EE9A 2W6ID 2Z83A 4AG6A 1G64A 2DPXA 2ZRIA 1HA3A 1SHKA 2PMKA 5FTMA 1VTKA 1W4BA 4JLOA 1KI1A 2AX4A 3M4YA 2DHRA 2C96A 4P4SB 4DLWA 3U7FB 5DNYB 4Q1BA 1KO7A 2DR3A 3X1DA 2O8CA 3KFXA 4EDHA 3THXA 2RKOA 1EFHA 1XD9A 5E95A 2BBSA 1E0JA 2WM9B 1VCIA 4GRAA 3V4FA 3ZZ0A 1FTSA 3K9GA 1ZBDA 3NEJA 4FMDF 1SVKA 3L8YA 1KIMA 3BC1A 3LW7A 4GI7A 2JATA 3SU8A 2R44A 1KNQA 2I1VB 3A6PC 2O8EB 1MR3F 5DI3A 4A8JC 2C95A 4UXIA 1UKVY 5FUVA 2JEOA 4M2LA 5JJLA 4G01B 5P21A 1KOFA 2VP6A 1DEKA 2GJKA 5D3MB 5EQTA 2QSZA 3LFUA 4QNMA 1TTTA 3MSXA 3GEEA 3IO3A 2WWXA 4I81A 4BZQA 2HCBA 2ONJA 1YQTA 3U2QA 2QQEA 3WRYC 1R8SA 2DFKB 1A4RA 1TNDA 5BWMA 5SZIA 1Z2CA 4C2TA 5SZKB 3TJZA 1KO4A 1NKSA 1WDTA 4RZXA 4NCKA 3ADKA 4PSKA 3MG9A 1N5KA 3CR7A 4KSBA 4GOXA 5JSZA 1DAKA 4S2EA 1W4AA 2VYFA 3WYGA 4DSUA 5EJEA 1RRPA 2PLFA 3SFVA 1ZNWA 4D0GA 3QI2A 3TSOA 3GJ5A 1GRQA 4O0MA 5JI2E 3L43A 4LJ4A 4OJQA 4O25A 4TL9A 1OH6A 4LBVA 3B60A 4TMXA 3F3YA 1LNZA 3LWNA 2ZJOA 5FOXA 1Q3TA 4HAUA 1S9DA 1E2IA 1PUIA 2V4ZA 1R2QA 4HZIA 2NMVA 1AS0A 5AUQA 2X2FA 4B6EA 2FJUA 2W6JA 5CB8A 5JHGB 2IA5A 4PFSA 4G1UC 3AF3A 2KI5A 2ZRDA 4PXAA 2Q21A 1TQ6A 4YDHB 2OBMA 4Z8XA 1CJMA 1TU3A 3WHLA 2G0NA 1Z0JA 5JS7A 1BIFA 1OFIA 3QKUA 5FBVB 1VKJA 3ZLJA 4AKGA 1NMXA 2OE2A 1U2RA 1ZU5A 4US2R 3WNCA 3P20A 2QUZA 2XB4A 1UKEA 3CKLA 3VFDA 5JMTA 1VG1A 4MRNA 1W47A 1NSTA 3AF2A 1KI7A 4H9GA 2PT5A 1GL9B 2K5UA 1TQ4A 4EPVA 1OF1A 1KDTA 3EIHA 3W5IA 4Z54A 5LBIA 2ZVPX 1HUQA 1XF9A 3RRMA 2FWRA 1EESA 2FPMA 1V5WA 4N0DA 3N2IA 4AD8A 1D9XA 1TF7A 2CL7X 3GJ3A 2QAGA 4PHFA 4DC9A 1OFUX 5J4YA 3GJ4A 4P4UA 4B3GA 2OEPA 3HR8A 3AEZA 1OXUA 2C04A 4MGIR 3TBKA 4HDQB 1RKBA 2IYRA 5FBQB 3FHTA 1G3QA 1FTNA 1HT1E 1RIFA 3PEYA 1UEIA 2IYXA 1NIPA 3LQQA 1QVRA 3RABA 3GLIA 4TQAA 2VIIA 2JLSA 2ONKA 1TEVA 1SXJE 3AVQA 2BEKA 5SZJA 1ZM2A 4RJLA 4D0NA 2V1XA 1DAMA 2Q3FA 1RRCA 2C98A 6Q21A 3KJEA 2BKEA 2ZU0C 1T4GA 1CJUC 1MRSA 2KJQA 2WJGA 2JIZA 4JBYA 3R8CA 3FMIA 3KQHA 3I61A 1ZW6A 3AVXA 3NBZC 3Q9LA 4JMPA 1OKKD 4KI0A 1RPZA 1TF5A 4U5XA 1H8ED 2AFIE 1ZYUA 2L0XA 2ZAOA 2BOVA 4DLRA 3GLFB 1Z06A 2BMDA 2J7PD 2R6GA 4DUGD 2G9NA 1Q12A 8OHMA 3E70C 4KAXA 2ZI4A 1YRAA 2Z4RA 2IC5A 3U7EB 5HZKA 4MKGA 1JR3E 3SJBA 1II8B 1XDBA 3AVPA 3K9HA 5EUMA 4NYMQ 2ZE8A 2GCPA 1UBGA 5AUPB 1YR8A 3VMFA 1GNPA 2FMXA 2ODNA 1MO3A 2FFAA 2YWGA 5KNBA 3MFYA 1X3SA 2XTNA 1ETUA 4OI4A 3I72A 3LLUA 3TR5A 2FGKA 4QBFA 4ZDKA 3DKPA 3TSWA 2DY1A 2HF8A 2JA1A 3SR0A 1NBMA 2P3SA 421PA 2XZOA 1XEWX 2DFNA 3G82C 2WWWA 1B0UA 1G41A 1RYHA 2QMHA 2ZXUA 2AXPA 5DISB 4M9XA 2C03A 4Q9JA 3A4NA 2HEIA 4PAOA 1P2UA 3CRQA 2WKRA 4LYAA 3UMFA 1ODFA 2RGCA 4TMWA 4M4SA 4DIDA 4A6PA 1XPUA 3DL0A 2HLDA 1VCNA 1SVWA 2ZJ2A 3KDSE 4RD3A 4B48A 1GKUB 4MYHA 2A5GA 4MKFA 2LWIA 3FB4A 4B3XA 2OO7A 4ZDJA 1EGAA 2CCGA 4HI0E 2P2LA 5H8WA 3WRXC 1IY1A 5LPNA 2HXYA 2F1IA 1XTQA 3BBPA 4DRZA 3PUYA 3AVUA 4TQUS 2ZSDA 3THOA 2GDJA 3QXCA 4G0NA 4F4IA 1XMSA 4RZ3A 2H1LA 5FTLA 5KNDA 1GZSA 1W2HA 4OHZA 2V7QA 4O3MA 1HQYE 1T3SA 3PG5A 4HYYA 1JALA 1TAGA 5L3VA 2AN9A 3IIKA 1U0HC 2R62A 1CP2A 2EFDB 1NBME 1Z08A 4HUQB 5K8IA 2FPKA 3NH9A 4ABYA 2WIBA 3A8TA 2QE7D 1JBKA 2P5SA 2R6AA 3IPXA 4DHEA 1DVRA 4BFTA 2QGZA 2CNWD 3OIYA 3W8NA 1FX0B 3W3ZB 2V6IA 1W0JD 3CX8A 3LLMA 4B33A 1AK2A 4LV8B 2JJ2A 4LV6A 2B7BA 4MUAA 4CT5A 2XGJA 4JL5A 4KFSA 1M8PA 1CF4A 2P67A 1MABB 4JVNA 4DLYA 4FMCF 2BCJQ 1G18A 1PJRA 4D25A 5DN6D 3OIUA 4BZPA 3AP1A 4V0KA 2BMFA 5SZHB 5FTKA 1SQ5A 2HXSA 2IT1A 3EAQA 4JLJA 1XPOA 4CEIB 4OQFA 5KU1A 2Q9AA 2QT1A 1VMAA 2JGNA 3I92A 1NLYA 2VTKA 2QMEA 4LHZA 3GLGE 2Q9CA 3RYTC 5EXSA 1NG9A 1K5GA 2GEVA 1NN1A 1DPFA 1FPMA 2G6BA 2RAPA 3F0TA 1R5BA 3LO5A 2J0UB 4OHVA 2W2XA 4M9ZA 4NCIA 1G3RA 1V43A 2BJVA 3A1UA 1LFDB 2ZRJA 3C15C 2EYQA 5G53C 4NMMA 1CULC 4JT4A 4ZDWA 4BFZA 2OFOA 2FNAA 3B13B 4OQMA 3L0IB 4ZIRB 3KKPA 2OLKA 4EJSC 1ONBA 1W44A 2N46A 2CL0X 4PC2A 4QGAA 4JLPA 1UDXA 4BFXA 3HYTA 4DCTA 4LC0A 3R9WA 1JNYA 3SYNA 1CR0A 4IOLA 3VR1A 3SJAA 4TMKA 2XSZD 2N42A 4PQFA 4RD4A 2RGAA 2ORWA 2UKDA 1COWA 2R2AA 2PX3A 3V00A 3U5ZB 4OL0A 2BM1A 4LHXA 4C0AC 1XXHA 3BOSA 1ZM4A 3U3KA 3ZQ6A 1ZC4A 3QBVA 2D2EA 3CH5A 2O8FB 1KI6A 2BMEA 2DB3A 1W36C 3NHAA 2ZJAA 1RYFA 2XTZA 1Z29A 4LZZA 2QI9C 3AVWA 2FEMA 3EASA 5CYOA 2XJ9A 3MD0A 3T1VA 1E2EA 1GKIA 1Z0AA 3DO6A 3IIMA 4NHOA 1KSGA 5HPYB 3PEWA 2QRZA 2IHBA 2VQSA 4V02A 4GOKA 3NDPA 3SJCA 1X8KA 1VYVA 3AKEA 4JLKA 1VIAA 1XD2B 4TZ0A 1ZUIA 2RMKA 1SGWA 2AK2A 1QHXA 4WBSA 4DDVA 3MWJA 2WSMA 1UF9A 1ESMA 1ZM9A 5CK4A 4ERNA 5KOYA 1S3SA 5FOSA 2FG5A 5FPKA 1XNJA 4PC3A 3NIBA 1PLKA 4LDJA 4AY2A 1QDEA 4KLZA 2A2ZA 1VECA 4JLBA 3GLHA 4GDFA 4FCVA 4KYUA 4RY2A 3CX6A 4OJKA 3AKCA 3PENA 1L4UA 5G41A 1SVIA 3EPJA 3ZVLA 1EWQA 3NH6A 4X8HA 5B30A 4Q18A 1XWIA 2QENA 1UBEA 2J41A 3PFIA 3KQLA 1AIPA 4Q9LA 2D7DA 1YJ5A 1D8TA 2VHCA 4OHWA 2I4IA 2GHIA 1E6CA 2ZRPA 5FUWA 1Q1QA 1Z3IX 2V54A 2W2VA 4JLVA 2IS2A 5CM8B 1ZU4A 1F6BA 3HR7A 1N5IA 2QSYA 4IVRA 3SN6A 4C0HA 1KMQA 3TVDA 1G4AE 3K09C 3QXSA 3LRPA 1T0JB 2QBYB 1FUKA 2GVDC 3EXAA 2VF8A 3K0EA 1S8FA 1NNEA 5LB4A 3QKRA 4TT3A 4M9SA 4Z1MA 5DE3A 3TR0A 3OIVA 1HTWA 4QBIA 5E7JA 3T5DA 2ODBA 4DSOA 4HB0A 2VHQA 5EP1A 1KI2A 4MDFA 2ORVA 3OIWA 3LBHA 1R7RA 2ZROA 4LRWA 1NN5A 3REFA 3UWKA 5L3SA 1FMJA 1G19A 3ZQJA 4MYCA 3QUSA 1E1RA 4CEHA 3PEUA 1UKZA 4S35A 1ZIOA 1Q22A 2CEAA 1KO5A 1NJFA 3SYKA 1E94E 1P3JA 1OYYA 4QGFA 5FR1A 4CF7A 1SXJC 2ZJZA 3EZFA 1Q0UA 4TTRA 1G5PA 1NKTA 2GAOA 3NTUA 3QEJA 2KBEA 3D3QA 4F38A 1XU4A 4A8JB 2ODEA 4QHTA 1F2TA 4IVQA 1G291 4TZ6A 5KYKA 2HJGA 4UXJA 3H0KA 1G8HA 3CRRA 3GCGA 1FNMA 2NTYC 2EW1A 3H1TA 4JKYA 3TLXA 4DT1B 5AK0A 4HLDA 3U3OA 4ASUA 4XTRA 3TH5A 1LF0A 1Y3AA 3TQCA 3KKQA 4DBLC 3QJYA 3O8BA 5F9FA 5DHAA 2F43A 1K5DA 1EX6A 1JQLB 2GA8A 821PA 3HYRA 4KVGA 3VU9B 1FW6A 2DFLA 4LJ6A 4M22A 4KBFA 1N6IA 5CITA 3R7WB 3JVUA 4RD6A 4D4JA 3CRW1 1GWNA 3MAAC 5FTNA 2QAGC 1ZRHA 2GZDA 1FUUA 2W0MA 1GNRA 3LXXA 4QBHA 1NRJB 4Q9KA 2QTFA 4RFSB 2H7VA 3LBNA 4JIMA 2IW3A 1Y63A 2O8EA 1U98A 5DH9A 3TW4A 1BMFD 3B1WA 3BJIC 3PJRA 4URWR 4B34A 2PCJA 4ZO4A 4GFDA 4NZYA 5D3MA 2KBFA 4MRRA 2ERXA 3RS0A 4BEJA 2OAQ1 2PEZA 4HSEA 3GEHA 3NBXX 2IYYA 2DYKA 1SHZA 1W2GA 1XBTA 2CK3A 5HE9A 1XEXB 2P6NA 2PT7A 2ZS9A 3LXRA 4M1YA 1LTQA 2JDID 3SBDA 3AVVA 2OUKA 3SHWA 5FBLB 2XOKA 3MUFA 1LB1B 1XTSA 1F2UA 2P0EA 4M0LA 1UEJA 3RNLA 3IBGA 2IF0A 4YC7A 5A5GA 1AS2A 4M1WA 4FW9A 2QZ4A 1S0UA 1TEXA 3C16C 1HQCA 3PV0A 3H2YA 1XTRA 2MSEB 1E79D 5DYGA 1BH2A 4PHHA 5GVSA 2ZR0A 4US1R 2RHDA 2IYLD 4D80A 4EPWA 5JFGA 4FMBB 2IXFA 5EP2A 4IKEA 4ARZA 3HJNA 3EA5A 1MV5A 1I2DA 1OHHA 1YU9A 4NE2A 4PR0A 1AZTA 5KSZA 2YKGA 5JWOA 1NVXQ 2QORA 3B8HA 4TL7A 1K8RA 5KDOA 4HEJA 4JL8A 4Q4LA 4F93B 1U0JA 3ZJYA 2E1RA 2OBLA 2R6DA 4TLEA 5E3HA 2OCAA 3P27A 5BYKA 4JSYA 2AFHE 3TGPA 3K70D 3RRYA 1G8GA 3ASYA 1Z6YA 2CDNA 1E1QA 4BQSA 3VKGA 4W5WA 3LX8A 2FSIA 3ZIAA 4FN5A 3CRVA 2D3WA 1MH1A 2G1KA 3MRSA 2A5FA 3WMFA 3FOZA 2ZRBA 1YZUA 2JJ1A 4KYIB 2B8WA 3K9LA 1G8FA 3P4XA 4V0LA 4CEJA 4M1TA 4LJ9A 1UBCA 1ZP6A 4IDQA 4YMWA 5BN3A 1NY5A 2H5EA 3BH0A 4Q5IA 1GSIA 1TUEA 1T5IA 4YMSA 3NC1C 3SE0A 4DKXA 1KKLA 3OFNA 1JB1A 1E4YA 1Q21A 2V6JA 2JLWA 1Z0FA 2EQBA 1NN0A 2IEYA 1Z0IA 2CVFA 1T0HB 3K0FA 4YMUA 4AKHA 3HPQA 4YXWD 2OAP1 2QGNA 2ZSFA 1FFHA 1E2KA 4CIDA 1G3IA 4ZKEA 1S1CA 4D0LB 1NLFA 3BRWD 4PC6A 4HATA 5JJKA 1ZINA 1EFRD 5JWHA 4BLTA 2EVWX 2FZLA 1E0SA 3LV8A 1EK0A 5HKKA 2OHFA 2HJVA 4OK6A 4IEEA 4A2PA 4IOMA 1WP9A 4JSTA 1CJKC 5TVKA 3RWOA 3A1VA 4DCSA 5KDDA 3THWB 1N6KA 2ZE6A 3NKVA 3UWOA 2OV2A 3OEHD 3X2SA 4A0FA 1KMHB 4DWJA 4RKEA 1XMIA 2PZEA 1N0WA 2O8BA 5DI9A 4LJAA 4DSNA 4Q9HA 4ILEA 4FCTA 1DAHA 1KY2A 1W36D 1P2SA 5FL7A 1E2JA 2XJ4A 2BKUA 3S1AB 3WBJA 1Z63A 4Q4JA 4LJ7A 1J8MF 2GCOB 4JVLA 1WRBA 1LVGA 3GLFA 3W5JA 2C9OA 1CR1A 4GOJA 4G5SA 4BWYA 3IILA 2WOOA 1GILA 4M1MA 4L5BA 4PO9A 5EE3A 5L8VA 2ZRNA 4C2UA 2XNDA 1II8A 1YVDA 3BFKA 5UKDA 3DEFA 1MO6A 5EXXA 4E03A 3CO5A 3MGCA 3RSLA 4BLQA 3GLIE 1E69A 2B21A 2CHVA 1E9CA 2CLCX 2LKDA 2YOFA 5JRZA 221PA 3RDPA 2UZ3A 3AVYA 3BH7A 3W6PA 5FUYA 2IWHA 4NDZA 5KUTA 2H57A 1OV4A 3EZ7A 3RRZA 1G6OA 3Q5EA 3UANA 5CJ2A 4CRWB 4DLTA 3THYB 1Z8FA 2WWGA 5AR1A 2CJWB 1AS3A 5DSZA 3W6OA 3UK6A 3ZZTA 1BYIA 3EW9A 2NZ8A 4ZV4A 1SKYB 2GEUA 3QF4A 1Q3HA 1ZD8A 1LF5A 3K09A 3U3MA 4L16A 2CCKA 2Q6TA 3VR6A 3X1XA 3NDBB 2G1JA 2Q0HA 4TMTA 2GETA 2X2EA 4NPHA 1R0WA 4DJTA 1W0KA 1T3LA 4PTLA 1L7VC 2C77A 2J3EA 3L8ZA 4XJXA 3WMEA 1VG9B 4URVR 1P2VA 3TQFA 2FSHA 3GLFE 4PAMA 3IHWA 4TQ9A 1OT3A 1TPZA 1RE0A 4IDNA 4P0TA 1E2QA 3V4RA 1J90A 1PZNA 2EFEB 3IPYA 5ANRB 3W3AA 3L2OB 2QPAA 2YWEA 4BLPA 1JI0A 2O5VA 4UJ5A 4D4MA 3K70B 1KTVA 1A5TA 2G0TA 4Q02A 3M1IA 3B1YA 5JJIA 4LGMA 1W48A 1ZUNB 1KJYA 4IJMA 4OI1A 4PHTA 5TXGA 5J5CA 1OIXA 1SXJA 3P26A 3KB2A 1D9ZA 3FPAA 2BEJA 2IS4A 4KBGA 1E0KA 4HB4A 5ELXA 4LPKA 4XTCS 2CL6X 4G5OA 2FSGA 3LAWA 2YVUA 4DXAA 4DEYA 2D4HA 5JI3E 1DO0A 3I3SR 4O2LA 2O8DB 3DHWC 3B2EA 4DLSA 3AVOA 4TSFA 3R8FA 2CMKA 3O8CA 3BH6A 2C8VA 3NVAA 4Q4AA 2W6JD 1FX0A 2WWYA 1Q1BA 1IY0A 3ZVMA 1P9NA 1KO1A 3B6EA 3W8RA 4AYXA 4NCHA 3AQ4A 1UJ2A 1JR3A 4WZ6A 4EJSB 4RD1A 4AURA 3U7GA 1KNXA 1MABA 3EG5A 1Z6TA 1KK0A 3A58B 3FMFA 4BFVA 2I3BA 2V55B 3EZ9A 1ZC3A 2GK7A 2OZEA 4TMVA 4OK5A 1Z6AA 5AJXA 3TW8B 1IOZA 1LY1A 2IHYA 1F48A 4I1UA 5FH9A 2IWRA 1IN8A 1QHIA 1XPRA 1S1MA 4DEXA 1DAFA 5AJWA 2AD1A 2FN4A 1E3MA 2YWHA 2VHTA 3TKLA 2AHOA 4KJZA 3SS8A 4C9BA 4DDTA 3U6KA 3QOFA 3LQRA 5A0FA 2ERYA 2IBMA 4B71A 1YZGA 4N0EA 5JEDA 1Z0KA 2CXXA 4HLCA 1XD8A 2BBOA 4I99A 1NY6A 3C41J 4NKRA 4IEIA 2PCLA 2YYZA 2J0UA 1XEFA 5HCNA 721PA 4Q7MB 3U3RA 3SC3A 4NYIQ 3SJZA 1XRJA 1DAEA 2OBNA 3QKTA 3GMTA 3ECCA 5H1YA 1BS1A 1JPNA 4NCJA 3ICQB 4POAA 4EIWA 1R0YA 3UXMA 2MMCA 4HAVA 4IOJA 2F3TA 5IRCD 1MT0A 4ZPXA 3CNNA 3CF2A 4JVSB 1U99A 4URUR 1CBUA 1G17A 3C5CA 2IEZA 2AK3A 3EARA 2O8CB 3TAUA 3VNUA 3QKSB 2ZRAA 4CW7A 3AM1A 2O52A 4Q21A 2QP9X 4UNSA 4JLDA 2XX3A 5LD2B 2ASEA 2JIZD 2ZR7A 1XCMA 1R10A 4MQBA 3ADCA 2IUSA 4Q1EA 2REOA 4BECA 2WBLC 2AL7A 2A3RA 3FFAA 1T3HA 2PBRA 1TU4A 1DS6A 2QNRA 2MMGA 1IQPA 4G3XA 5JEEA 2Z0MA 1E2HA 4V03A 1KGDA 2IX3A 4OKSA 2OILA 5FI0B 4ACAA 1VG0B 4ON9A 1OYWA 1Z07A 1XJ0A 3I8SA 4V0NA 4WZBE 4Y0VA 2J7KA 2WWHA 2QTVB 1CR4A 4EFMA 1U9IA 2W0SA 4I1OA 5FR2A 4B2IA 4Y0AA 5DO9A 4PANA 4AI6A 5FOUA 2CHQA 3AUXA 3SBEA 5AWFC 1G21E 3K8YA 3EPLA 4PZLA 5TARA 1Q1ZA 2Y8EA 4PAQA 3REGA 1KDRA 1NBMD 1M7GA 4JLNA 5C4MA 1I4DD 4TYNA 2WOJA 1XP8A 3Q7PA 1FQKA 4XWAA 4HDOB 1P7CA 1OIWA 2NZJA 2J0VA 3CWQA 3GLGA 1I4TD 3ND8A 4QGHA 1OH5A 2HLDD 3B9QA 4A6XA 1VPLA 2IYVA 3UKDA 1JXOA 4KITB 5IK2A 2OFXA 1AKEA 1YZLA 1N25A 2Q9BA 4N1AA 2HUPA 3KUDA 4WIAA 4PHGA 1ZNZA 2E9SA 3Q85A 4K46A 1WA5A 4KODA 2WIAA 2VSFA 4WAUA 2P6UA 4DDWA 3UPUA 1OFHA 2RGXA 3K0CA 2HT6A 1F3OA 1II9A 1JAHA 4CVNA 4U02A 2IYQA 2V7QD 2D7CA 1QHHA 1NG1A 4ZCMA 3RHFA 1Z83A 2ZI6A 2ZYVX 1IN6A 3U60B 2ZJ8A 4QNRA 2NG1A 3VKHA 1KDOA 1QHYA 4NCNA 1SVOA 1F60A 3WY9A 2VO1A 4DCUA 1PLLA 3KUCA 4BZXA 1E9EA 1G3UA 3VNVA 4GP7A 1R8QA 1E9DA 3PUWA 1OW3B 1C9KA 3VQTA 4A2WA 2PJRA 2JASA 3KX2A 5KSYA 5JCPA 4LJ5A 4TL6A 2JJ2D 4A92A 1YZQA 3IKJA 4A9AA 1N3BA 4B2PA 4B44A 1W7AA 4GT1A 4M9QA 1ZD9A 1OXVA 5IT5A 1H8HA 3BK7A 2GZAA 5DYIA 3GLIB 2GESA 1W4RA 3QXJA 4BLOA 4YDSA 4XWKA 2B6HA 2DWQA 1DG1G 3AP3A 4X8MA 2GJSA 2C9YA 1M7BA 4DLUA 3KKMA 3TVTA 2YOHA 3K0AB 2PMDA 1WCV1 4DT1A 4LYHA 2YJTD 3OF5A 5CDFE 2G77B 3OZXA 2ZSAA 2P5TB 2VF7A 3I32A 1XCPA 2AWOA 4NYIR 4QC2A 3CONA 3W34A 3I62A 3KJGA 1Z6XA 5FI1B 4ITRC 3R7WA 3RS2A 3SNHA 1IJEA 1ZM3A 2NOAA 2A9KA 1CKEA 3KQKA 4R7ZA 1YR6A 3FE2A 3PUXA 3SQWA 1QHNA 4G5RA 4A4DA 3D6TB 3KB1A 4IDPA 4LOAA 4NYMR 2DBYA 1AM4D 3LVRE 2JLVA 1T9HA 3PIRA 5H68A 4A1FA 4TTQA 1FQJA 4ZI3A 2GJAA 1SVSA 3JZMA 1COWD 2ZI3A 4Q4HB 2OCBA 4UNRA 3CM0A 3OESA 2OXCA 2FEOA 1KJWA 3WYAA 3F8TA 4X8LA 5FL3A 2FA9A 2X19A 5L3RA 3KFVA 1G7TA 3AKDA 2VSOA 2FE4A 3QVUA 4O2RA 2GF0A 3VAAA 1E2LA 3LW8A 4CT4B 3WP1B 5E4FA 3RSOA 1ZJ6A 3GJ8A 1E9SA 2OT3B 5G3ZA 1UM8A 3DPUA 4MYUA 1LS6A 3ZD7A 4LHWA 2BBTA 3KTAB 1FL9A 1OSNA 2RGGA 5CYPA 5KPDA 2F6RA 1RJ9B 2IUTA 1G7SA 2R8RA 1X86B 3C5HA 4QRHA 4LY6A 5AUOB 2BWJA 1XJCA 1Z0DA 3PUVA 4QFMA 1AGRA 2X77A 3MJHA 5G40A 4EFLA 1NP6A 1ZIPA 3RRNA 1P72A 4B6FA 1US8A 3E5HA 3V9PA 4NP6A 3AB3A 3WNDA 2F9MA 4BUJA 1X8LA 3HP1A 3BORA 1UADA 3GPLA 1VHTA 3UG7A 5B57C 4GMXA 1NVWQ 2RGBA 2ZI5A 4DVGA 5KTYA 2JLXA 1M6NA 1OB5A 3EIEA 1M74A 1G5RA 3HDTA 3GP8A 2WICA 4HB2A 2YZ2A 1S96A 1ZAKA 3A4MA 3H86A 4WZAE 1KAGA 4XVRA 5EP3A 4CDGA 3FDIA 1U94A 3FMPB 3FFBA 1BO6A 2GNOA 4ZKDA 3OAAA 1BOFA 3IQXA 4RKFA 4A0GA 3QG1A 1G6HA 4C3ZA 4LK2A 3GFTA 2V1UA 2A30A 2ZI7A 2CLDX 4C4PA 1T5LA 1KSHA 4FWIB 4Q48A 3RS4A 3QEOA 1Z2AA 3KKNA 4K8OA 4A36A 2YV5A 3P32A 4RCZA 3B85A 2OFWA 2GXQA 3SDZA 4EQ6B 4XVUA 2IYSA 2J5XA 2CE2X 4TL8A 3CZPA 2Z5FA 2YINC 4E5UA 1YHNA 3NC0C 4AKEA 3GD7A 3AKYA 2MSDB 3HWSA 5C2JB 1MRNA 4PC7A 4WOPA 1KHTA 3BFVA 5J47A 2VHUA 4QM7A 4LJ8A 3KJHA 5EE0A 2B7CA 3IQWA 2F1JA 2YNMA 4V0OA 2J0QA 4TT3D 5F2EA 4Z1MD 3GJ0A 1NF3A 4PSAA 1CLUA 4YQFA 1KZGB 1AGPA 2ZYWX 1E2FA 3RAPR 1G7RA 2OSBA 4DLXA 4C0SA 5J4VA 3I5YA 1GL6A 3U44A 2J59A 1E2DA 1QG4A 3ZVNA 2BBWA 2WPDA 1S4QA 2XB2A 1J99A 2AD5A 1KK2A 1R0ZA 4GL2A 1E1RD 4LYFA 2NO6A 2OCYC 2C9CA 4P4SA 4XWOA 4WXRA 3U4QB 1DG3A 2WTUA 3IHLA 3QVVA 1G1MA 5AJZA 4IRUB 1N2CE 4B76A 1GDDA 4PZYA 4MKHA 1OH8A 4LSGA 1GVNB 4X8OA 1FZQA 3S1AA 3FHCB 4P3YA 5KO2A 2GCOA 4C0BA 1XTKA 1X8JA 1CEEA 4C0LA 1QBKC 1RRFA 4BFWA 3W6NA 4BE7B 1E9AA 1XXHB 3LA6A 5FFMA 4ASUD 3EWAA 3FGNA 4LPSA 2FU5C 4C7OB 1JEDA 3I73A 4D6PA 4EPRA 3BERA 3CIOA 4IOKA 4AYTA 5JCZA 2WSSA 4D4KA 5G3YA 1Z47A 4JYBA 3FKQA 2OLJA 1XX6A 4PPFA 2NQ2C 3H4MA 3QIAA 4N3NA 3PXGA 3FKSD 5GJVC 3OE7A 3BB3A 4Q7KA 1E2PA 1QHSA 3CF0A 1NI3A 1N6LA 3ZGXA 1OFTA 3THYA 4A15A 5B58C 1ZCAA 4DLVA 2CJWA 1GIAA 2J46A 1IN7A 3A37A 3ONWA 5AJVB 1GKYA 1OPXA 1KYIA 1CXZA 5EZ5A 1QG2A 2F55A 1XFAA 2ZS7A 1T91A 3TSZA 4B35A 1VYUA 1SULA 4NU0A 1ZCBA 3RANA 3OEED 1ANKA 2ZRGA 1UPTA 1M7HA 2QP3A 4F4CA 3NHBA 1Q44A 2GJ8A 2CK3D 2AKAB 4H1UA 5GJCA 1Z22A 4LWZA 1ZUHA 2HYDA 3TNFA 3GLHB 4YMTA 4TYWA 4FINA 1MO4A 3EZ2A 1E9FA 1WE2A 1WF3A 2XOKD 2BIFA 4Q1CA 2ZE5A 4CYMA 4GNKA 4XD7A 2BCGY 2GVZC 1LS1A 1NIJA 1FOEB 2ZS8A 1TADA 3EIQA 4M1OA 4AWXA 5EXTA 4BASA 4E09A 1U0LA 2GAAA 5JS8A 1NVUQ 3GFOA 4B3BA 5IHPA 1HT2E 2XAUA 1AZSC 2LCFA 3IGFA 5FOTA 4FCWA 4WA7A 3JVVA 4XOIA 4XSGA 3QENA 4IFBA 1IJFA 4IXMA 5BXQC 1U9IC 3SHFA 2OXRA 2PEYA 2ZE7A 4P4TA 4XIGS 4ESHA 2VL7A 1DO2A 4B32A 2AKYA 2NPFA 3ZD6A 5DHFA 2WVJA 2BC9A 4GZLA 4HAWA 1SKYE 2GJ9A 1OHHD 2UZIR 3BS4A 2FFQA 2NO1A 2AWNA 2WJYA 3X1YA 2XZPA 3AVTA 3NWJA 5D3QA 3VKWA 2ZRCA 2O0HA 3KQNA 4E22A 1DARA 3QPVA 2BV3A 5EE5B 4QHSA 3QKRB 4PPNA 2ZUBA 3SYLA 1CS4C 3SFZA 1EX7A 4PC1A 4B2LA 4BFYA 4MYTA 1E1QD 2A5YB 5E7MA 5EXPA 1S9HA 3SEAA 4KLNA 3ZIAD 2BVNA 1P61B 2PZGA 2RGEA 1T6NA 3NBYC 4ZI2A 5JZVA 1IAQA 2PLRA 2EYUA 2JJ1D 3NEYA 5EUQB 3IO5A 3WHKA 2BDTA 4GP6A 4KCGA 5L3SB 2W6IA 1CIPA 1J70A 1EFUA 2WZQA 1A7JA 1J2JA 4Q00A 4OYHA 3OFND 2HF9A 1DAGA 1A82A 2GEDA 3QF7A 2X8AA 3K0CC 1PV4A 1KDPA 3CRMA 3MWYW 1YE8A 3QNUA 4MA4A 1F2TB 2HCJB 4KFUA 4FD2A 4IVPA 4YMVA 1W1WA 3AF4A 4B47A 5JBQA 3VX3A 1E99A 1K6MA 3C8UA 2BJWA 1H65A 3X1WA 4A2QA 2CBZA 4BFSA 1TX4B 1FNNA 4JLAA 3NG1A 2NO0A 4QL3A 4RD0A 1N6OA 1X1RA 5CB6A 5HKKD 1NMYA 4TTPA 4FWTA 2F43B 2IXEA 4R2HA 3W9YA 2GXSA 4KFRA 5K8TA 2ZITA 4HZUB 3VHXA 3B7GA 2ZYTX 3QKSA 5KPJA 5IF9A 5KNCA 3PUZA 4TLCA 2ZIAA 2ZYUX 4D82A 3FMOB 4XH9B 2DWOA 3KXKA 1BKDR 3O47A 3CWZA 2XXAB 5FL7D 1WMSA 5BN4A 4TN1A 3U4QA 1KSJA 1D5CA 5CIQA 2WHXA 1TQ2A 3DOEA 1YZKA 4LUCA 2Z6VA 4LYJA 2ZJBA 1KI3A 1CRPA 4M1KA 1GM5A 2EWVA 5FPSA 4HUTA 4MRVA 3AP2A 2NO9A 4IDOA 2QEQA 2XNDD 4PZZA 2LKCA 3WMGA 3QBTA 3Q3JB 1A1VA 2VLIA 4RZUA 4M8NE 4BRWA 4MRPA 2IYTA 4OI0A 1Q20A 5FOWA 1OXXK 3R9IA 2VH5R 3D7MA 2RGNA 2B8TA 5TV2A 1W4CA 2ZUCA 1LV7A 5BW8A 2ODWA 3UATA 1F2UB 4TMZA 3IDQA 3CW2A 1VYTA 2W83A 3BWDD 1VG8A 2QM7A 3L0OA 3BFXA 3N70A 1N0UA 3CB4A 1CJVC 2CVHA 1TL7C 2SHKA 3IUYA 3QQ5A 3T5GA 2ECKA 2F9LA 4RVCA 1KK3A 1I2MA 4ACBA 4D2IA 5FPTA 4IHQA 3P1JA 3PEVA 3QPUA 2WMNB 1W0KD 3B1VA 3MJRA 4ARZB 1NVVQ 1KI9A 1F5NA 2FF7A 3HU2A 3CUEF 3K0SA 4HUQA 4PQYA 1E32A 1WXQA 4LBYA 3VTKA 1P9WA 5JLJA 1JECA 1IBRA 5HCIA 3HU1A 5L3QB 2CE7A 1SVMA 2ZRHA 4R98A 4TYQA 4G5GA 3C14C 4YONB 3BXZA 1D2MA 1E9RA 4LV5B 3MMPA 4DB4A 3IEVA 5DGXA 2QM8A 1NJGA 1N5LA 1Z5ZA 1RZ3A 1G3MA 3QY0A 3IEUA 3ZDQA 4M1SA 3I4LA 3K9NA 1AKYA 4A0RA 2VEDA 3T35A 3J81k 2QPTA 4UQOA 5KSPA 4V0MA 1GG2A 2WJVA 4B75A 3GJXC 1SXJD 2VHJA 3B82A 3T1OA 4CEJB 1DELA 1XJQA 4C30A 4EPYA 1II0A 1KI8A 2BHRA 1GNQA 1EWRA 4KU4A 4MGKR 4TWZA 4UNQA 4EKDA 5DLQC 1VCOA 1UBFA 3FTQA 4M53A 3UIEA 2CLSA 3NXSA 5FTJA 1AJEA 4CEIA 4HAYA 2JLQA 3O8DA 2G3YA 4TSFD 3T06B 3FVQA 1EFCA 4JS0A 4LC1A 4H1VA 5TMPA 4FI3C 1G7CA 2DCUA 3K0FB 3PITA 4PPQA 3KQUA 4MGYR 4DDUA 2QMOA 1W36B 2QY9A 3A1TA 4DCNA 2P6RA 4U00A 4NBSA 1OKKA 2G83A 4AG5A 1JR3D 1XMVA 4IW3B 2GTPA 1H8EA 2C99A 4JL6A 4LJYA 1KKMA 4RD2A 4OHXA 2GWHA 2J7PA 4DUGA 1CU1A 3MWLA 3SOPA 1X1SA 3GJ7A 5J40A 4U7DA 3PCRB 4R2IA 4ZIRA 1G8YA 1R6BX 2QTHA 1I4LD 3LDAA 2UVQA 4V0ME 2Q3MA 3CBQA 3T1TA 3CNLA 3K0AA 4KSCA 5BYJA 3AH8A 2V8OA 4QHYA 1Q57A 2IK8A 5A4JA 2O8BB 5F9HA 2KWIA 4Z8YA 2J87A 5AJYA 2JLRA 3THXB 1HV8A 4DIEA 2DWPA 1XB2A 3F5FA 2ZSBA 4W9MC 4Q4JB 3TE6A 4FIDA 2GZHA 2YHSA 2O8FA 1XZPA 2O0KA 1P75A 1W46A 4RCYA 1U81A 4QOSA 2QROA 5DI3B 1L2TA 3WYFA 4Q03A 5B2ZA 621PA 1Z6GA 2GK6A 3DZ8A 4K81B 4LBZA 3VX4A 5GJBA 3QXXA 4L9WA 3CLVA 2G88A 2B92A 2FZ4A 4US0R 4PO1A 2VBCA 1N6PA 1FP6A 1O87A 2F3RA 1UDWA 2EFCB 1D6JA 1P2TA 2ZRLA 3EC2A 2GXUA 4P33A 1OE0A 4KO8A 4Q4HA 4TYPA 5CLQA 5FPYA 3TIFA 2QQ0A 1OLOA 2XTMA 3G5UA 2WJIA 3E2IA 1EG7A 1G4UR 4QJ5A 4BRUA 2Q3HA 4I1SA 3U6BA 2ZM5A 1XD2A 4JBXA 1TUIA 2NGRA 2GKSA 4Q47A 1NLZA 2IYWA 3BD9A 3BB4A 3NBFA 1IXRC 5JSZB 1JR6A 2YOGA 3QF4B 1OXSC 3TUJC 4A82A 3WP0A 2CCJA 4HDCA 4Q7JB 3OHMA 1AQUA 3GFPA 3ASZA 1KAOA 2TMKA 3KTAA 1SZPA 2FSFA 1GFIA 5KHOC 5F98A 1RJ9A 2EU8A 2OG2A 3ADDA 3CZQA 1U90A 3I1FA 3T61A 4F4JA 3CPJB 2F7SA 1U8AA 4G5QA 3SZRA 1IM2A 5TDHA 4EFNA 4DZZA 3DOFA 3B1ZA 4B73A 3DDCA 3KXLA 1GOTA 3AV0B 4UKDA 4Z51A 1C4OA 1X6VA 4BFUA 1HEIA 4HLQB 4UNPA 2ZI9A 2QE7A 4DCVA 4L15A 4GMDA 2D62A 2MSCB 4IFEA 2CNWA 4NONA 1E0AA 3AF0A 1P6XA 2H92A 4DB2A 3SQXA 1DTSA 1W0JA 2ZRFA 1N6HA 1N0VC 3QXHA 2JLZA 4JYCA 5GADl 1SXJB 1HH4A 1NL3A 4GPTA 4LX0A 2ZTSA 2EFGA 2QPOA 2YC4C 2GBLA 4JVMA 4D81A 1E4VA 1NVVR 4HAZA 4QG7A 2XEXA 5E7IA 3DM5A 4KXFB 2QBYA 5DN6A 5CDFA 2RH5A 2O0JA 2FFHA 3B9PA 2WKPA 3AGPA 4NYJQ 2REBA 4II7A 1GITA 2P65A 3C7KA 5C46F 4P31A 3EZ6A 2R6CA 1IONA 5KDLA 5IK2D 3EX7C 4Q4AB 5J4HA 2JLYA 1IN5A 3JZAA 4QJ4A 3BE4A 1E2MA 1KI4A 4LCBA 1RVDA 4LHVA 4EQ6A 1W5TA 2V3CC 4W7SA 2DFTA 4F91B 2Z43A 4ZCLA 4R71A 1CTQA 1E9BA 3K70C 3IIJA 1R5NA 2BM0A 1IY2A 1HE8B 2QAGB 4NTZA 4D4LA 1ZMXA 4QGGA 3GEIA 2ZSEA 3L82B 1ZNXA 2HYIC 2I1QA 4PSVA 4WVFA 2QP4A 3HU3A 3PQCA 2HT1A 1JQJC 3RC8A 4LI0A 2GF9A 1L8QA 1JEEA 5EP4A 1JAIA 1G20E 4A8JA 1E96A 3Q5DA 3QPWA 1CR2A 1DE0A 1UFQA 5TB5A 1SKQA 1A2KC 2A7QA 2XSZA 2RHMA 1MO5A 2PJZA 4KV9A 4L8GA 2A5DA 2JCSA 4TYYA 1OB2A 2V9PA 1P4SA 2ZJ5A 2GCNA 2J45A 1VDZA 2RB4A 2ZEJA 2ZU6A 4TLAA 4F92B 4B3DA 4AC9A 3CF6R 5CIWA 3VU9A 3IBYA 1RFLA 3CH4B 1CJTC 3U3JA 1E2NA 5K8UA 3C4JA 3ADBA 1H8HD 3U61B 4MKIA 1OJLA 1XTJA 2J0SA 5GVRA 1KJZA 2NPIA 2QRNA 3CX7A 3LNCA 3ZYCA 3VR4A 1YRBA 4JJKA 4MH0R 2NIPA 1B23P 5HTKA 1OH7A 4R9UC 1M1YE 3RC3A 3TUIC 4L9SA 4RFSA 3MCAA 4URYR 2IXGA 2WJJA 5CK5A 5F3WB 5AUNB 3K53A 4URXR 3O8RA 3WNBA 1DAIA 5H70A 5HE8A 2FV8A 4IXNA 1QF9A 4ESVA 2KE5A 3KXIA 5BN5A 4C7OA 1P62B 3VHLB 3FHOA 2J9RA 4I1VA 1JXMA 3Q72A 5FOVA 2X1VA 1ELOA 2VP2A 4D26A 1QVAA 4FMDB 4RSGA 3B5JA 3KKOA 2XNSA 2RGDA 4HLUC 3TMKA 1XEXA 3UMSA 1CRQA 1M2OB 1ZNYA 5EZ6B 2VP9A 4YLGA 1YKSA 3LVQE 4E07A 1XEWY 3QSYA 4WW0A 1M34E 3DKVA 1AQYA
chains in the Genus database with same CATH superfamily
2J6CA 1GQQA 4ZVNA 1KOGA 4GUAA 4F7WA 2FCRA 4J0QA 3TK1A 2IVZA 4HJRA 5AVUA 5K8LA 1LGYA 1SHJA 2REXB 2VRBA 3BPSA 4G0OA 1XKQA 1KC3A 2FOLA 3N8IA 4X5OA 1FX1A 3AGQA 2NXJA 3WLEA 1I32A 1SXIA 2F1HA 4JBLA 4M99A 4MQ5A 5LD2C 1JPVA 1YI1A 2FMKA 3FR7A 4UU7A 3TUZC 1Y3FE 7REQA 1D2NA 5K2MA 2VP0A 1T8TA 2DLDA 2F00A 1GAEO 1BQ4A 2WAXA 3CW8X 1KH1A 2DBQA 2B1GA 3JQCA 3BB1A 5EXDA 2JFHA 3L8CA 4GI5A 1WDWB 4MS1B 3OCUA 5ESDA 2YDXA 3HE3A 4PO8A 3ZE2B 3ZCQA 2Y1OA 3AKZA 1D4AA 4CDNA 4CKBB 1YFLA 1BE6A 2C2HA 2ENUA 1T4CB 4Y1GA 4KPUB 3JQAB 1THGA 1YQQA 5AI6A 2R97A 4RUKA 1D1PA 4DARA 4DC1A 2H7XA 4M0MA 2BH9A 3IAM1 4ZAVA 3T7CA 2WFAA 4RIHA 1Y98A 1CG6A 1S2MA 2M9MA 4RZ2A 1PJ4A 2W2TA 3KR2A 1MX5A 2ZWAA 3IBTA 2ZTMA 3O1LA 3UWMA 3PR1A 1EZ4A 3UXHA 1C1YA 2QLMA 1ISHA 1O1YA 1QRAA 1FRFS 1XMJA 2ZCUA 1KBOA 2ZREA 3ABQB 3ANTA 3E9NA 4AN4A 1BMTA 2PUTA 3DM9B 1P0FA 3CR8A 4CT0A 1D2RA 3D0RA 1RI4A 4KX3A 3ONEA 4H18A 1SXPA 2P2DA 3O94A 1QHHB 3FA2A 4FLMA 5DJ5A 5AW8A 4WINA 2AG5A 2ID7A 2Z3ZA 3A04A 3CO0S 3I0MA 1EIWA 1HLPA 2FX2A 1NX9A 2X4GA 3MWKA 4PG6A 5DTEA 3ICPA 3M8KA 4L1KA 1PSZA 3DE5X 3HHPA 4A16A 4C0QC 3DMDA 1AHPA 4IQ0A 2PO5A 1GUAA 4U6NA 5CM9C 1E4EA 4AJIA 2CNBA 5JECA 1YR9A 2QI9F 3GLHE 1BZYA 2JGJA 2R5NA 3HA5A 1P2BA 3DEAA 2JI4A 2WIJA 3DMNA 5K05A 1GTL1 3NTLA 2X8BA 5FBWB 4H77A 1CQJA 2VH2A 1NQ5A 1SVUA 4HWOA 2K7ZA 4CU2A 4PX9A 4UU1A 2ZSHA 1DBSA 4GLOA 3WB1A 4N0MA 4QYWA 1FNSA 3M1LA 1JHAA 3B1XA 4E5KA 3HO8A 1C9MA 3U81A 1U1CA 3A1SA 1DUVG 3DVAB 4W5HA 5L51A 4OQLA 2IVFA 3THWA 3HDYA 2QTTA 2QVBA 3GB9A 5GAJA 4U7TB 5AJUA 1AY0A 4QKQA 1DJQA 1VJGA 1KMHA 4R6WA 2PX0A 4JUIA 1N9ZA 1EVKA 4MAAA 1N2HA 1MX9A 1MTZA 2I6TA 1TQDA 1MVNA 3MTAA 1E64A 4K8RB 1XTIA 4J0JA 4TX1A 4UNNA 4BHTA 3I01M 3A9VA 2JGMA 4C03A 1YRYE 3P4YA 4OHFA 5AK6A 1JJVA 5J2UF 1A9PA 3KZ1E 4KXYA 1V7ZA 3FHLA 1AZWA 1VJCA 1OA1A 1B0AA 1BMFA 3ENQA 2HBYA 4J6FA 4DCSA 4BQFA 3ZHZA 1X7DA 3IDFA 4JXKA 1S2OA 4GBMA 1T1GA 3VU1A 3HBAA 1WBBA 1O3YA 9MHTA 5GINE 3PNMA 5HRCA 1MIOB 2RHRA 5LLTA 5DASA 1P4RA 1P9LA 3UAWA 1RI3A 3LA8A 1QF7A 2HPHA 2C2KA 3ENNA 3AF1A 5KYUA 5EE1A 4LBWA 3WRXA 4R3WA 3EXG1 1GP2A 3WKEA 1H1DA 1UKYA 3HKBB 3GQBA 2QN6A 3ZY5A 1GTVA 2VDWA 1X38A 3FR8A 3H84A 4IXDA 3ENKA 5K4HA 4Z5XA 5KNDH 3KSAC 2P9TA 3CPHA 3G3EA 1PWXA 4ZJUA 4TUYF 4EBBA 3IE2A 2Y1EA 4KR9A 3ASVA 4ZT2A 4JBWA 1K6EA 3B52X 1WVMA 3M0EA 3AR7A 2G76A 2VRWA 4W7HA 1ZL2A 2C5SA 2DOKA 1LSUA 121PA 3E81A 3NAQA 4KQKA 2D2IA 4L4UA 3C7AA 3D8HA 3R5HA 1DWPA 4BQNA 2F3PA 3BZBA 3F74A 3N3AC 3R20A 4NEGA 4H7EA 4QUKA 4TPKA 3KVOA 5IDQA 2VTBB 3HKEA 2WSSD 1G1AA 1O94A 2NTJA 3EEFA 1T43A 4GZ3A 1APBA 1Y8QB 2ZPTX 2GZSA 1ZD1A 3R24A 4MUBA 2J1LA 4FE4A 4GVPA 4WBNB 4MMXB 3OE7D 4XSHA 3SQMA 1EB9A 1EJ6A 1W49A 1GSAA 2FW0A 3B6KA 4HEA1 4PU0A 5EJMA 2JLCA 4U63A 3UAZA 4TLBA 3WHPA 2ZIVB 4AYWA 1EUCB 1QLWA 1JR4A 4BP1A 1D7AA 3U19A 2R1ZA 2AOTB 3QX8A 1A69A 2HDNB 3GI1A 1LTHR 3K73O 3OWXA 2I55A 3GF4A 1RPNA 2E5LB 1AA9A 1EGMB 4R1UA 2P41A 1US8B 1VBMA 3G79A 2RCNA 3QVWA 3ZS9A 1ZUNA 4BLSA 1FBNA 4H6XA 3RUAA 4RZSA 1TMKA 4Q1FA 3MUNA 2JFZA 4F3RA 3K2BA 1J21A 5KJ6A 4C6TA 2H18A 2WPNA 1A7UA 3N59A 1Z9BA 2BFWA 4POOA 7GPBA 3CVVA 1CT9A 1U28A 1JU4A 1OWPA 3R41A 3WIOA 4DADA 4FONA 5THXA 1PQ4A 1V8DA 4Q6BA 3TE7A 2KW5A 1WB9A 2JLBA 1TYEB 3DV9A 3DLTA 3AHFA 1VMKA 2J9GA 5KSOA 3QFSA 3R1IA 2P79A 3EMVA 3N2EA 1P1HA 4BXOA 1GUZA 1VMDA 2FG6C 3MM4A 3WHIA 1YB6A 3PNVA 4HDKA 5J4LA 2XGOA 4LNUA 5F76A 1RHQA 3UG6A 5AVSA 2QMQA 1Q7CA 3OM8A 5AI0A 4B40A 5HWSA 4YXWA 3ZWBA 1DJNA 1QTIA 2H4JA 4B43A 1RHRA 2BEVB 1F6DA 2YUTA 2FSUA 3MT7A 5HR5A 2VSXA 2BR5A 3MUEA 1AN0A 3WWEA 4MP6A 3O83A 5C3MA 1FMFA 1J22A 2IYZA 2JJ8A 3AOEC 3EA0A 1YZNA 2XUKA 4WXPA 3U3XA 3F1KA 1ZGZA 3EUEA 4RXTA 4J9UE 4QYIB 5JXIA 5ALGA 5B1IA 1RW4A 1R6DA 3JQ8B 4ZT4A 1T1JA 3BWXA 1XDDA 3BIFA 4R1PA 1NR1A 3W04A 1LTKA 1KMCA 2PBLA 2PH1A 3BMOA 3SI7A 3RYCA 3DMRA 2PFSA 3EODA 5JHHB 1BW9A 1XZGA 3M6AA 3SF0A 1VSVA 3VOTA 1JU3A 3KQQA 2NAFA 5K0JA 4HBGA 1HYQA 1RRGA 1U6KA 3ZE7A 5LDDC 2TECE 2IHNA 4FMCB 4L7VA 3KPVA 4QM6A 1HY3A 1AXRA 1AHNA 3N07A 3GLQA 5ALDA 2PL3A 3BXPA 3TQSA 5FPHA 4BC0A 3RSHA 1VI2A 1U7XA 4DLZA 4MIEA 4P53A 1LVHA 3DOOA 3OCWA 2H3HA 4YRAA 1YDEA 1Z5PA 5KVAA 3BE6A 3KZMA 4MW7A 3U44B 4LHYA 3H87A 1LLFA 2IXBA 2J9FA 4XIFA 5DBIA 5CG2A 4AZVA 2PK3A 1SWWA 3IQIX 3DLAA 4HGPA 2W6ID 2PKRA 3C8HA 5E1DA 1G64A 3ECAA 5EE9A 2JG3A 1HA3A 4DWOA 4PAWA 1W4BA 1KI1A 1T24A 2AX4A 2HUNA 2C96A 3M4YA 4P4SB 4FSXA 5CP8A 1N2GA 2EKPA 2O4UX 2R11A 2W2OA 3IDOA 1EAMA 2DR3A 3KPJA 3MCUA 5AKKA 5BP7A 1S7GA 2BFFA 1NW6A 2FB9A 4GEKA 4K9DA 4BRZA 1O5TA 3DO8A 1FYWA 5K20A 1SCKA 2BBSA 4ZJZA 5LU9A 1E0JA 3AY7A 2WM9B 4GRAA 3V4FA 3SP1A 3T5TA 3ZZ0A 1M2VA 2YR0A 2CEKA 4B3IA 4CQJA 5F4ZA 4LK3A 3A1FA 2MTBA 4Z9FA 3VDRA 3DL2A 2P30A 3A6PC 1NSYA 1FFEA 5L95A 1C9JA 1BU8A 2PKQP 2R4TA 3QU9A 3RVDA 4CLDA 3LHFA 3KCNA 2FQYA 4X6LA 4Y1RA 4ZV7A 5JJLA 4CL2A 1YASA 2VP6A 3N86A 2Q2NA 5EQTA 3RBZA 2IEGA 1TTTA 1NUUA 2V7BA 5H9VA 1P7VA 2EP5A 1VGRA 3NBQA 2N1MA 3GJRA 4BZQA 5E8RA 2CJPA 4PYKA 4OL9A 1RXIA 5DGTA 4ZEXA 4Z7JA 3I09A 3O8LA 1HZZA 4ZV9A 3VOAA 3P9SA 4Z4QA 1TT7A 3UGTA 2DBZA 4L6CA 5AM3A 3SR3A 1J0AA 5KJFA 4U6SA 3MHTA 3SXUB 4DY4A 8MHTA 4ZQFA 3U5TA 3MCWA 4NCKA 4ZYXA 2G9VA 5TSDA 1DO8A 1HMYA 4KSBA 3HUUA 1Y7IA 1DAKA 3SKXA 1W4AA 1YHYA 1Y5LA 2VYFA 1PJ8A 2GM3A 1O96B 3DZBA 5FWYB 4E2FA 1SG0A 5EJEA 1ZNWA 5LA6B 4ANFA 1I2ZA 1UBTS 3SYMA 3S7TA 2AQIA 3QI2A 3HCAA 3BEOA 3GJ5A 2OKCA 2YWRA 3M70A 3OMXA 3LWZA 1OU0A 3LWBA 2QZZA 3L43A 4KPGA 4O25A 1JH9A 4TS9A 3IMCA 1MHTA 4IKPA 5HJ2A 3NRCA 3TAXA 3TNYA 3PX7A 4ND8A 3F3YA 1ZSYA 2R1VA 2UZAA 2BFMA 4MKXA 1Q3TA 1VIMA 1S9DA 1PUIA 1U1FA 1E8MA 2Y92A 2ZAIA 3EDQA 3IHKA 4FQ5A 4J29A 2RC6A 3FUVA 5ERYA 1GCAA 1OCEA 1XGKA 2YHIA 4WJLA 3W5BA 3RAEC 1VLQA 2NMVA 2OFFA 3DWEX 3QM1A 4EF6A 1G63A 4LQCA 3TGWA 4Q37A 3HFGA 1QV7A 2O2GA 2C8JA 4PXAA 2Q6LA 1F8GA 4YASA 1TT5B 5HDBB 3V4PB 2OBMA 3IP7A 1RXCA 3PE3A 4K6MA 4J07A 1Y6ZA 4HLNA 5DMXA 4P7GA 2BN4A 3QVXA 1U3UA 5I4KA 5KYXB 2VR1A 4M6WB 3CZMA 3L79A 1VIVA 1VKJA 5HGJA 4G0VA 1NMXA 3BCSA 2CDCA 2H48A 3C1TA 2Z3VA 5JMOA 3RRFA 1TAQA 2V4UA 3IUEA 1UKEA 1H4VB 2O3UA 1QIDA 2GLUA 3T0IA 4RK6A 1T5SA 4GAEA 4EY8A 1YNSA 2BFEA 3CVOA 1IEWA 5CXQA 1KI7A 2G4LA 5ERGB 3ANYB 5HIMA 3WVNA 1KZ1A 1GL9B 3H2ZA 4IF6A 1TQ4A 2AFIA 4OEHA 2AV6A 5D6NA 1KE1A 3IP6A 2PX4A 1Y1KE 1H9CA 4NOLA 4CTNA 4GHWA 3DD5A 4Z54A 3OIFA 2ZVPX 2HA6A 1PX2A 4KQ9A 3RFTA 3ZWQA 2JVJA 1OBOA 2FWRA 3RRMA 1WCYA 2PWPA 1G55A 1F8YA 2QOEA 2VZLA 3N0TA 1ZI6A 4N0DA 3HJBA 2CJYA 3N2IA 4MB2A 3UENA 3ZU5A 4XCVA 3H75A 4BEVA 5BYAA 2YRFA 1DKQA 4MUNA 1TF7A 2PMFA 4KIFA 3M9WA 3OJ0A 3GCZA 4KH1A 2QAGA 4P2GA 1OFUX 1PFYA 2Z95A 1G60A 1EK1A 1LI5A 2X3FA 3I2FA 1KC1A 4LWOA 2C04A 4MB6A 1L7DA 4B3GA 2PRYA 4HDQB 2IYRA 5ES4B 3PFGA 1HT1E 1RIFA 3VSAA 2YJ6A 4EO9A 1NIPA 4PZEA 3BF7A 1XELA 1Q0HA 4NU6A 2JVKA 2NXWA 1USUA 3D3WB 1NVTA 4XJVA 4WT7A 1UWLA 4RMHA 5SZJA 4CFYA 1ZM2A 4P4NA 4NMXB 1U3GA 1HM5A 2V1XA 1DAMA 5P8WA 1Q0TA 1B6RA 4H0CA 3KEQA 4WUVA 3IL2A 1LDNA 1CJUC 3HWRA 5K1ZA 3R8CA 3FMIA 3RIYA 1BTOA 4PN7A 1W59A 1FRQA 2HHHB 4MJ7A 3WWCA 4BNXA 4ZYZA 4JMPA 2ZCVA 3VH3A 1SIUA 1TF5A 3VDNB 2WU0A 5HFJA 1I2AA 1L1FA 1REQA 5GZ3A 4B7AA 1C14A 1TYDE 2YY5A 4DR6B 1QP4A 4MXDA 1LX6A 4B6SA 3CXRA 4UBKA 4YJKA 3JYQA 5HBGA 1Q12A 4CG1A 3LTNC 3C8DA 2FZCA 5DBEX 1I5OA 4KQEA 4CF6A 5HQ3A 5HZKA 4B3RB 3SJBA 3TD2A 1XDBA 1ZICA 2O3RA 3AVPA 1QTRA 1JHMA 1DCFA 3KE9A 1C0PA 1E3LA 5T57A 4NYMQ 3VHXB 3QBJA 1FMCA 4BNJA 2ZE8A 2GCPA 3LF2A 2PKEA 4UVIA 3SX2A 5AUPB 4TSRA 2XDAA 1AKNA 3V2HA 2VDVE 1X7GA 1QR2A 3VMFA 4QDKA 2ODNA 4QLOA 5KNBA 3EGIA 2J31A 2E4UA 3LYUA 4NDAA 2FUEA 2EJUA 4Q39A 3L8HA 3RUIA 5L4LA 4YP5A 4FDVA 1YRQA 5BN4B 1GZ3A 4FKMA 2UVPB 4ZDKA 2XTAA 2V9CA 3RRJA 1PNRA 3TSWA 2DY1A 2HF8A 2P3SA 4FZRA 421PA 2DFNA 2HHLA 1HFJA 3E53A 3PC8C 4KR7A 4RKQA 2WWWA 1B0UA 2QMHA 5J5VA 2ZXUA 4WBNF 2D1TA 2PANA 5TEWA 5JARA 4OFZA 1X9HA 2WG1A 1R6UA 3GAFA 2WJAA 3EQ7A 3JQBC 1MG5A 4TRJA 1GPYA 2XBLA 2XUIA 3F2VA 3ESXA 2PUGA 4JROA 1E2UA 2WUDA 4YROA 5LYJB 4LYAA 4CQLB 4D1YA 4G2TA 4WCFA 3VC2A 3BIWA 3IUBA 1C0LA 3E35A 4H3HB 2G8LA 2ISQA 2Y1CA 3DL0A 4D96A 1VCNA 2ZJ2A 4RD3A 4B48A 4EB3A 4EYEA 4MYHA 3BULA 1QV9A 4L74A 4N6OA 6YASA 3FB4A 2OO7A 4KBYA 2JGAA 1PV2A 2ATIA 4Y2VA 3R3YA 4F96A 4FT4A 3DD1A 2VNIA 3LPNA 3A6LA 1DFHA 3LOUA 3MJEA 3H1EA 2HXYA 4JUCA 2F1IA 1U8XX 4DPLA 4DRZA 2J9YB 4I2NA 2CNOA 3AVUA 4NBRA 4A8TA 1PL8A 1DIOB 2ZSDA 3GN2A 2FFJA 3QXCA 4J0CA 4RZ3A 4J7CA 3DDZX 3F5MA 1QH8B 3NDRA 5CAEB 1F0NA 2RB5A 4K5QA 4HYYA 3T3NA 1IIRA 1O9HA 1C0EA 5AOBA 4IMPA 4C22A 4F97A 1PT5A 4GX0A 5K3DA 2AN9A 3IIKA 1JSZA 4OP3A 3GGGA 3EPPA 1GTJ1 4RACA 1NBME 5TPZD 3S6JA 5C8YB 1I80A 2B1RA 3KJQA 3Q15C 2RJOA 1IC6A 1ZK1A 2V7GA 5H0IA 1H6BA 4H0NA 2XBUA 3A8TA 3IPXA 4ZRMA 3JQQA 5J1TB 2XUZA 3H4VA 1S4MA 2QGZA 1QX4A 4ECEA 3MT0A 3WKBA 1RNLA 3TCXB 3NNSA 2ZT5A 2BEWB 3LLMA 4B33A 4QQRA 4LV8B 4GKKB 5KBYA 2B7BA 1L9XA 3W9UA 4PIMA 3U7RA 1SBZA 1M1YA 2Q0SA 1M8PA 1CUXA 1PT6A 2P67A 1WP4A 2XRYA 2ZIUB 3AUJB 3AUUA 4JVNA 3YASA 2RHWA 4FMCF 5M2QA 2BCJQ 3A6ZA 3IB6A 3U4CA 1G18A 2IV7A 3VH1A 1FFDA 4KDEA 4NJEA 2R8PA 1AF4A 4EATA 4WH0A 2LD4A 1DJOA 2Q9AA 1KQGA 1EVYA 1TZKA 2JGNA 1L1EA 3O1IC 4G0WA 3I92A 3GRUA 2QMEA 4WERA 5FI5A 4CCYB 3GLGE 4F5EA 3RYTC 4JOQA 1GZDA 3IE1A 1DPFA 3SM9A 4QOEA 1ZK0A 2G6BA 4YUZA 1GPDG 4Y9TA 4DQKA 4DUYB 4CN8A 3ZDCA 4MW1A 4YRQA 3LO5A 1JAYA 4P3NA 1YONA 2EKLA 3O2SB 4M9ZA 4WZBB 4NC9A 2Z04A 2D0PB 2YMMA 3L6EA 5KB3A 1PWYE 4YIKA 1V43A 3C15C 4ZDWA 4ER6A 2C29D 4BFZA 4ZAFA 4CM8A 2P9GA 4JT4A 4MWCA 2VT3A 3TPCA 3ZXYA 3TLZA 4FDUA 2OFOA 1FXWF 2H1RA 5A3JA 1Z4IA 3GGPA 4R81A 5DPMA 1JHVA 1CUYA 1TDJA 1YULA 4UMDA 2F48A 4RGYA 4L78A 4LCEA 3QU2A 4X7BA 1K97A 3RF6A 4J4TA 4H7PA 1W44A 4QGAA 4YCAA 3SEQA 1R0SA 2JFPA 3R9WA 1E7SA 5G0UA 3P0IA 1JNYA 3SYNA 5BSEA 3JU3A 3HQ4O 2I29A 2IZOA 4IOLA 3VR1A 4DREA 4TMKA 3VAYA 5IANA 3EQ8A 3DULA 1J8FA 2VRNA 2ORWA 4MULA 4H16A 3W9SA 3FYUC 2R2AA 5CEJA 4AFNA 4RS4A 4RTKA 3HCFA 3I83A 4D9KA 4XYBA 2F8LA 2F8MA 4BVEA 2CFOA 3ZQ6A 1V8FA 1JFRA 4YREA 1G5HA 2OK8A 3IFSA 3L8DA 4LRQA 5LQCA 4MCIA 2O2ZA 5FNVF 1KI6A 2I4RA 3L5OA 4RVOA 5T6MA 5GV7A 1V7QA 2XKKA 4JI4B 5LJLA 1FDOA 3NUZA 4TKZA 1DWQA 2V59A 4GSLA 2QI9C 1QOZA 2FEMA 4LZZA 1Z16A 5CYOA 3MCVA 4LDZA 3V2UA 2XJ9A 4TXNA 5CGZA 1H9BA 2QY6A 1KBQA 4I4TB 4UTNA 2PTGA 1K2WA 2QS9A 2FVYA 3L7IA 4QJIA 4IPTA 4YJHA 1BX3A 3P2YA 3VR4D 5AM2A 2I6QA 4GDMA 4W1SA 5BSUA 2VS1A 4DAEA 1KSGA 5CVJA 2VQSA 4Y8VA 3C43A 5I4BA 5GY7A 5LA6F 1VHJA 3SJCA 4MR7A 1KQNA 2NYAA 1KY5A 3ZE0B 4U2KA 1IZZA 1W96A 3DMTC 4RIGA 2Y71A 1BS2A 1FY2A 2RMKA 1WU7A 1X0XA 3UMGA 3F8WA 4WBSA 4KQGA 4P0QB 3K15A 4O8ZA 2NUAA 13PKA 1W5EA 1ESMA 2X4IA 2YMPA 5FXMA 1N4DA 1YIOA 5TMEA 3A3PA 1XDWA 2Q3BA 3USCS 2A9FA 1EQ2A 5FWXA 3L6OO 5FPKA 3I42A 3NIBA 1XZIA 1MN6A 4CIWA 1C29B 1P5RA 4KLZA 2A2ZA 1VECA 3TF5A 4L73A 2GN6A 2QN2A 3ESBA 4P3XA 4D7AA 2OGUA 4RY2A 4OJKA 4O5OA 1MDFA 3P9NA 4R6XA 1TM5E 3PENA 2BONA 1A96A 1SU4A 3LCMA 3ZBQA 1QHEA 1EQAA 4MRMA 1P39A 5B30A 3K8QA 3RVJA 1QQAA 3GY0A 4TSKA 2WF7A 5JV5A 2B2XA 2DHCA 4XYLA 1GYPA 3NGMA 3PFIA 4R8VA 4Y6RA 1DBPA 3KQLA 1WXEA 4P3KA 4F9GA 5AW3A 4OHWA 3OPVA 2GK4A 4FS8A 4EMSA 3AR3A 3PGA1 3NEAA 3LBFA 3NM4A 3R76A 3DLBA 3H2IA 3PLAE 1ID8A 1ZLYA 2W2VA 2PXAA 1OZHA 4GNRA 3HYNA 3OMWA 4JU9A 3HR7A 1I3LA 3BJEA 3E3OA 3QUTA 1SC4A 1N5IA 3NGLA 4PLGA 2X5JO 3EZLA 4D3XA 2A33A 1YFJA 5IC6A 3IUMA 2HJWA 1KETA 4G8JA 2QBYB 4H59A 5IKEA 1FUKA 2GVDC 3EXAA 3L92A 4GZ6A 3K0EA 4RV9A 2C7PA 1MEJA 3RU3A 3RLIA 2J33A 4M9SA 4X20A 3UJ3X 4QBIA 4O2BA 5E7JA 4JB2A 3E9ZA 3VU8A 4PLYA 4UUAA 1DC3A 1N78A 1RHMA 4MQLA 3WOHA 3OPXA 3CR3C 4CUKA 1Z7BA 2HWXA 4YAJA 2FPIB 2XWQA 1KMNA 3VKUA 2VUHB 4MDFA 3IP3A 4N0PA 4EYQA 1K8QA 1CYEA 1U31A 2ZROA 3DBLA 1D8AA 3V7WA 5AVTA 2HIAA 3FYTA 5J2TB 1GVHA 3I9LA 2AHRA 3ZEAA 1CIVA 4CEHA 2YW9A 1EDEA 2E4VA 1YBVA 1ZIOA 3S8EA 2H29A 2AZDA 2CEAA 3G2IA 1O58A 3UJAA 4S12A 1P3JA 4R16A 4QGFA 5DM2A 1WF6A 5I4IA 5LP6F 4IR7A 2PGIA 4TTRA 1NKTA 2YY6A 2KBEA 4F38A 3O26A 4TKVB 2M6KA 1B6TA 4A8JB 2ODEA 4QHTA 4EKNB 3IXLA 1PV1A 3HGMA 1ENPA 4L9AA 4XGRA 4RJTA 1U2TA 2P2GA 1IAVA 4WE3A 3CRRA 5HVNA 4FFSA 4HQOA 2X0EA 3RVQA 3H1TA 4TTTS 4EW6A 2CLMB 4UAGA 1PEYA 2K2WA 2PUWA 4HLDA 5CLHA 2I34A 4XTRA 4DDHA 1YF3A 1VRCA 3TQCA 4ZZ1A 5FX2A 4CG2A 4EA8A 2FRDA 3QJYA 4FU0A 5AM0A 1F17A 4DJDC 4ISCA 2V0GA 5ALQA 3PTAA 4WASA 4XEUA 1M5RA 2XZTA 3IJ5A 3OUUA 2X6TA 3KO8A 3BXXA 4MVJP 2DFLA 2FPOA 2OY0A 1FW6A 1R8XA 3OY2A 4KBFA 3GHHA 5E9JA 5L40A 4UBJA 2DPHA 3S2SA 1EE9A 1GWNA 3W4KA 1NW7A 1TIKA 3E18A 3NOQA 5FTNA 2VTEA 1H0RA 3HKDB 4AO7A 2W0MA 3AU8A 3GRYA 4Q9KA 5JNSA 2VYVA 1B1AA 2H7VA 1SOUA 3HLYA 3LBNA 4JIMA 3VISA 3ZWAA 1B76A 2A9OA 3AXTA 5DH9A 3K6SA 4EMUA 4QSMA 1BMFD 1X7ZB 3BJIC 2CFRA 3G5TA 5IASA 4URWR 5BN5B 5KVCA 4WZAB 1Z5WA 4ZO4A 1EP9A 3MWDB 2KBFA 1NURA 2ERXA 3AEKA 3AR6A 2PGJA 3EF1A 1BMQA 4MRRA 4HSEA 3CU5A 3K1ZA 2AQKA 2P40A 3MOGA 4JB0A 4PLTA 3RTEA 1HSOA 1HDGO 3I5UA 3MMNA 1T4BA 2C00A 1YJCA 2XQFA 4MR9B 2CV1A 3B5EA 1KY4A 1LTQA 2VDJA 1RFGE 2HNAA 1TKAA 3FYSA 3OOSA 3UJ7A 4E4YA 1PKXA 2CMDA 3K9FC 1BCRB 3LXMA 2PX2A 5LZ5A 3AVVA 2XOKA 1K68A 3IP9A 3QTBA 1CJBA 1ZI9A 3AESB 1XTSA 3FPLA 4RMNA 4DQLA 4B3HA 5CFRA 3QGMA 3PQ3A 1UBMS 2EIXA 3IBGA 4A27A 4KREA 1TU0A 2OTCA 3E61A 2O1WA 1AS2A 1VB3A 3JXEA 4M1WA 4DM7A 3AWIA 3RC2A 3EXIA 1I4OA 3C16C 4DLBA 4EI9A 3UB3A 1ZJJA 1VCHA 2YL2A 4G1FA 3TOVA 3H2YA 1WXFA 1EX1A 3GC6A 4L51A 3FZNA 2HREA 3OZIA 4EPWA 3AWDA 4PLFA 4US1R 1HE5A 4FMBB 3OURA 5EP2A 3KV3O 5DHQA 3F5QA 1U1EA 2GN4A 3HJNA 1W2WB 2V7EA 3EA5A 1O94D 1GLNA 3IMGA 2FN3A 5COQA 4B8WA 4IILA 3JQPA 4LOJA 2QWXA 1QMGA 4YV2A 1K8RA 1NI4B 1WCIB 4KE7A 4ATNA 4Q4LA 4F93B 5ALHA 4OJTA 1D07A 3ZJYA 3FZQA 2OBLA 5K01A 4IJKA 5F21A 2DT5A 2OCAA 1YE5A 3CUWA 3AI3A 4F1KA 3CX4A 3C6KA 4OQYA 2WC1A 1RAHA 5CFMA 4MZXA 3FWHA 1C30A 3LX8A 1W29A 4I14A 4X92A 4EL0A 5CB4F 4FN5A 4X60A 5AKZA 1LQUA 1K06A 2D3WA 2G1KA 2GWRA 3CRVA 4G0QA 2O05A 3MRSA 2A5FA 1JEAA 1QFZA 1XAGA 3O1JC 3FOZA 2P3LA 2Y1KA 2VCHA 1G8FA 3K9LA 3P4XA 2QL5A 4DQXA 1F8XA 3BJRA 1GPAA 4LJ9A 3HGTA 4YMWA 2G9QA 3G2MA 4P84A 4F3YA 1NY5A 5DCLA 5BN3A 4ARUA 5A3RA 2H5EA 3V8QA 1A4UA 1RC0A 1KORA 2CNDA 1X19A 1T5IA 3GEGA 3H5NA 1VE5A 3ZU2A 3FYUA 2FFRA 3SE0A 1KKLA 3E0XA 1JB1A 3OQPA 2JLWA 5KVSA 2EQBA 2R7LA 1V9CA 4MLZA 4OJNA 2IEYA 4ROSA 5F33A 2GRAA 2VUUA 1CS0A 4IXWA 4FMPA 4AKHA 1VJDA 4YXWD 2IPNA 2QGNA 1FFHA 4YTEA 1DLJA 1XALA 1TVEA 4NBLA 3HCDA 3ZCPA 2O2JA 1GEEA 2SCUB 3IIIA 2X23A 2E3JA 5JBIA 2EVWX 4CF3A 5AW2A 3FCOA 3LV8A 1EK0A 2H6EA 4L7QA 3SSAA 3RJ9A 3AINA 3I9JA 4D42A 5C9ZA 2ORED 1AXGA 4OK6A 4R7TA 4F11A 2ERCA 4G56A 4IOMA 1I6MA 1OX6A 2IHZA 4HGQA 4HJXA 4N7BA 4BVLA 3DVQX 3EMDA 2C5EA 4G37A 5F1OA 1DUIA 3ZYZA 5K0CA 2OV2A 3N2KB 1K5PA 3JARA 2JA2A 3SC2B 3EVNA 1ESZA 3PT5A 3TEJA 2VDUE 1XMIA 3TQRA 4DWJA 2GEKA 1A9TA 1IPFA 1Z4QA 1B8OA 4UULA 2ALJA 2DG2A 2JAWA 4Q6WA 3ZY4A 1BX1A 3ME5A 1CZUA 4FCTA 2BE7A 1DAHA 3MAJA 2P35A 4KLRA 4UTXA 2XJ4A 3FPKA 2BKUA 4KW7A 1YBFA 3WBJA 4TS1A 3SX0A 3GEMA 3T7EA 5J2UA 3IPRA 2EKBA 3H65A 3R5TA 1LVGA 2I54A 1M0EA 1ZS9A 3DLIA 3V97A 2O59A 4G5SA 1WCWA 2W98A 1OLUA 3KE8A 4D3FA 4V1CB 4L5BA 4BTEA 4BB5A 4I4TF 2AMFA 3OCZA 4DYVA 4C2UA 4P4LA 1HDEA 1II8A 1YVDA 3WLNA 4J1NA 5UKDA 1CB7A 2NU8A 4PSCA 2GDZA 4ITUA 2OHOA 5GIPE 4OBWA 1MGOA 2AFHB 2DY0A 3NTXA 2CLCX 2YOFA 5BRAA 5JRZA 1U3CA 4PZDA 3GH1A 3CNHA 4L5CA 3VBEA 1DB3A 3RDPA 3BDAA 2VDRB 2PVSA 2P6OA 3AVYA 5FUYA 3DNMA 4OP2A 5M5BA 1SD5A 2IWHA 4W1PA 1HLGA 3EZ7A 3PXDA 1G6OA 3RRZA 2FZWA 3D6VA 2IGTA 2C8KA 2PSEA 3UICA 4DG5A 4PLVA 5AR1A 3W6OA 4XIIA 3WGHA 1Z75A 3JAMA 4QPZA 1EXNA 2CFSA 3QF4A 2ZWVA 2JCVA 1DMSA 4TUYA 3L7LA 1NQXA 1JJAA 1LF5A 2QQFA 1Z0UA 2TMYA 5DU2A 2CCKA 4JHXA 3KPUA 5ESWA 2A59A 3CH6A 2G1JA 4MA0A 4NZNA 2XDQB 2HSWA 4QJBA 4JJFA 4LHEA 4TMTA 1R37A 3V6LA 1IEQA 1JIXA 1XVVA 2X2EA 3N1UA 5MGBA 1W0KA 4B9AA 2XMZA 4PTLA 5FA5A 4DJ5X 1AGYA 2J3EA 2XECA 4XJXA 3CTMA 5K8CA 3ZOKA 3OOYA 3QHAA 1CUAA 1JDBB 1TIBA 4K9OA 4RZHA 3GLFE 3TDNA 4NG4A 4TQ9A 3B6MA 1RE0A 1JDUA 3WOVA 1FDSA 1E62A 5ANRB 1WUKS 3W3AA 4JC4A 2YWEA 1C4WA 1PS9A 3ICOA 2O5VA 1FQOA 2CSUA 4JJ6A 3ELDA 3GL9A 2G0TA 4UJ5A 1H2EA 5CTAA 3B1YA 5FHRA 3UT0A 3KOXA 1HYGA 5DB4A 1YMVA 1W48A 3TIIA 1PYOA 2A0YA 3TS1A 1TCVA 2G28A 3RFXA 5J3JA 3M4JA 4PHTA 1Y6FA 3JAWA 3LC1O 4RTMA 3P26A 3A7EA 3OC6A 1AUPA 1A9XB 2GTHA 2O8NA 4ZU6X 4KBGA 1E1YA 3KVRA 4CMIB 2PT9A 5ELXA 3AHHA 4HGNA 2YJ4A 4XTCS 1YIAA 4G5OA 3RSCA 2Q3EA 3NWEA 2D4HA 5JI3E 3I3SR 4O2LA 2O8DB 4NS4A 3DHWC 4EG5A 5DEOA 1QKIA 4TSFA 3U40A 3R8FA 2CF5A 2PUHA 1JSRA 1ULAA 2VJYA 1UM9B 3PJDA 3WICA 3BMCB 2C8VA 3KVYA 2W2KB 5KJCA 1FX0A 2PPLA 1XUOA 3KWFA 7ADHA 3I28A 5FO0A 1UT5A 4BNDA 1V16B 3KB6A 4YWHA 4AYXA 3GZNB 1JKIA 3E22A 1RP1A 1UJ2A 3M4NA 1SBTA 2FUG6 4DGQA 4EGAA 4RD1A 4HNUA 5IT0A 1KNXA 3DZJA 2EC5A 3RHTA 2XCIA 1FQWA 5A9TA 3FMFA 3ZE8A 3WGUA 1JQ3A 5C81A 5JXHA 2H5LA 2I3BA 1JEYB 2PGAA 2GK7A 3ZVKA 1JIUA 5C7LO 1Z6AA 3TW8B 2POQX 4JI7B 4I1UA 4L5YA 2IWRA 1IN8A 1QHIA 1XPRA 1YL5A 3MS7A 1K4MA 2RBGA 4BWVA 5AJWA 3VDQA 2RHOA 4AL4A 2HY7A 1OC2A 1Z8NA 2JFNA 2WIDA 1WPQA 3QOFA 3ZUPA 2VQEB 2LV8A 2GBFA 2X58A 5A0FA 2ERYA 2NU9A 3A4VA 4B71A 1YZGA 4CUZA 2Q27A 3EZYA 4E32A 5KYNA 4O1MA 3I9NA 4BTVA 1V2GA 4HLCA 1DWUA 1KJQA 3G2PA 3LRTA 2FI1A 4MS3A 4LGYA 1NY6A 5EGNA 3UK0A 4I46A 2PCLA 4IEIA 2YYZA 2GAJA 2ZK7A 2ZXEA 3PSAA 5D3KA 721PA 3P2MA 3HDGA 3I6IA 3L7OA 3NORA 5JMWA 1WV1A 2YWXA 4G25A 5JY1A 2NSHA 4RQAA 1VP3A 5H1YA 1ABEA 2XYQA 1JPNA 3ICQB 1C1DB 2WFLA 3EPRA 3LCVB 3UXMA 5DM60 2FMFA 5IRCD 3CNNA 5ALFA 3A3NA 3I34X 3KKZA 3TVYA 4DIBA 3C5CA 4YQZA 1WD7A 5FV7A 3ZWPA 2CXQA 4B80A 3T5AA 3O1HB 3EARA 3SM3A 3TAUA 4A3SA 1JTFA 2O8CB 1P45A 3AM1A 1N9GB 2FPUA 2HPAA 5D5QA 1WEHA 1L5HA 4JLDA 4D74A 1WHSB 4Z53A 2B61A 1V11B 2ASEA 3SQNA 2YY7A 1R10A 3BF8A 4MQBA 1Z3CA 2IUSA 4LSMA 1P1RA 3SZOA 3SVTA 3LGXA 4YK7A 3NPAA 1MHPA 2QNRA 4R1OA 2C61A 2Z0MA 1R50A 4LSWA 4ETNA 4YRPA 3ZWKA 4HVLA 1POXA 4CFZA 4V03A 1M2OA 3EXEB 1L0BA 2ZTVA 1J5XA 4W8HA 3TLEA 3I23A 1H3EA 3EE6A 1O97C 1OYWA 3O90A 1VLLA 1DU4A 4V0NA 4Y0VA 1J2RA 1T9GR 1VHDA 1V37A 2J7KA 4HDSA 5BORA 5ALYA 2QTVB 2O19A 1C1XA 2CWWA 1JG7A 5LLSA 2W0SA 3HCWA 5AKLA 5JAPA 2OBXA 3F3MA 1P5FA 3RJ5A 3PICA 4FHEA 3WB9A