2CDNA

Crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
PRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ADENYLATE KINASE
publication title The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 67
structure length 186
sequence length 186
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cdnA00
2VPPA 3SS8A 3U3OA 2WSSD 4ASUA 2RAPA 2DFLA 1GAJA 2VSXA 1JR3A 4AK9A 1R10A 4D2IA 2HXYA 1E1QA 1KIMA 2ZUBA 2JCSA 2IXGA 1KSFX 5K8TA 3TRFA 2CBZA 4V0KA 2H18A 4URUR 3ZH9B 5KPDA 1QG4A 1N6NA 1TF2A 2OCBA 4Q01A 3UXMA 3VFDA 4K8OA 3U4QB 4HB2A 3LX8A 3BOSA 5EXXA 4LJYA 1IQPA 2F9MA 4RKEA 3U4QA 4M1KA 4R2IA 3SHFA 3NBXX 3VNVA 2F1RA 1SZPA 4A2WA 3PIRA 3THYB 2BBWA 2O0JA 5EE3A 2IS2A 1R8QA 1HURA 3THYA 1J90A 3QF4B 1P2VA 2GJSA 2W0MA 1W2GA 4B75A 1CR1A 1YR8A 5AJWA 3T06B 2ZAOA 1T8TA 4QOSA 4IEEA 4M1SA 3QF4A 5EE9A 4N3NA 4HLQB 1P60A 2G88A 5E7MA 3WXMA 4ACBA 4Q03A 4B32A 1D9ZA 2QZ4A 2V7QA 4KFSA 4BLOA 4B3CA 2WMNB 4K46A 3BAFA 5F9FA 1II0A 1NL3A 2H1LA 3MWLA 5FPYA 1JPNA 1W0JD 3KL4A 1EK0A 4HB3A 2QU8A 4BLQA 4DLUA 1RPZA 1E2EA 2KWIA 2VP0A 1UAAA 3RRMA 1F60A 3TVTA 2OESA 4WIAA 2O0KA 1HQCA 1G41A 4PSVA 2CHQA 5C1BA 3IEUA 4JL5A 3PXGA 1E94E 4B48A 1AGRA 4DSUA 4OI4A 1H8ED 3CF0A 3G5UA 3NEJA 1FX0A 3X2SA 1ZUHA 5KDLA 4BASA 3OHMA 5FBQB 4GL2A 4IKEA 1W4CA 5JHGB 4MDEA 3PFIA 4LCBA 3HPQA 2FZ4A 2J87A 4OQNA 4URZR 6Q21A 1XXHB 4PPGA 2QE7D 4TQAA 4Q47A 2BCGY 5JWHA 4RD3A 5CJ2A 3C14C 3ZVMA 1XXHA 2PCJA 4JLVA 3B9PA 3VKWA 3X1WA 2VH5R 1G8FA 3FHOA 2QRNA 3K9HA 2ZJYA 3K9NA 2BJWA 2FFBA 2YNMA 2ZI9A 1G19A 5G53C 5TARA 2OUKA 2EYQA 3OEHD 1UEJA 4I81A 1COWD 2WJHA 3WYAA 1FW6A 1CTQA 3EARA 1L8QA 1KI1A 3AGPA 1DAEA 1A2BA 1NBMA 1Z3IX 4OQMA 4DIEA 5DGXA 2YWGA 1RIFA 5JS8A 3Q9LA 4TZ6A 1I4LD 3GJ8A 5G40A 1UADA 3NVAA 4WZBE 3C5CA 4R9UC 1U0JA 1IAQA 2Q9BA 4Q00A 4QGHA 1HE1C 1M7GA 1XPRA 3CPEA 1QHNA 2IUTA 3PUXA 3RSLA 3G0HA 3ZS8A 4TT3D 4F38A 2FPMA 4KVAA 3SEAA 4MYCA 1S96A 1GOTA 1DPFA 1OH7A 1IY1A 1HE8B 4FMCB 1Q57A 3QXJA 4NYJQ 4QHSA 2BC9A 3B1VA 5FBVB 3CPHA 2WICA 3AUYA 3UKDA 5EZ5A 4I1VA 2XTNA 2V9PA 2YZ2A 1Q22A 1WBBA 1NIJA 2RHMA 4QKQA 1K5DA 3I72A 2CLSA 2VP9A 2ZSFA 3O8BA 1UDWA 4TMXA 3OAAA 1VECA 4QGFA 1CJVC 1I4DD 5DSZA 1ZD8A 2W83A 4MGYR 2VF8A 2HT6A 1DEKA 3CRQA 4BEBA 1D9XA 4LJ4A 3BWDD 4XTCS 2CMKA 2IEZA 5F9HA 4X8OA 2WTUA 1ZYUA 3C16C 1WDTA 3CF2A 1Q1QA 3AVVA 2ZRDA 4AWXA 3TVDA 2HCJB 4LJ8A 2A9KA 1EXMA 4PO9A 2HF8A 3T5GA 1Z22A 3WNCA 3A6PC 1Q12A 2YVUA 2FOLA 3T1TA 5KDOA 2PZGA 1AS2A 4JSYA 4A15A 4TL6A 2VP5A 1VDZA 4DUGD 2GZDA 5KU1A 1KK1A 4FCTA 1RC8A 1P4SA 4HUTA 4IOJA 2AD5A 3QPUA 1SGWA 1ZMXA 2P5SA 3DL0A 5J40A 2P0EA 2GK7A 1Q0UA 2Q3HA 4RJLA 1J99A 5JMTA 1N3BA 3P4XA 2IBMA 1MH1A 1FTSA 2BM1A 3GEEA 3GLGE 1RRCA 4ESVA 2C2HA 4CW7A 3Q8XB 5ELXA 5AK0A 1TUIA 1R0YA 3T15A 4LYFA 4V0ME 2ZYUX 3TUIC 4XVQA 4LBYA 3FB4A 3IO3A 2F1JA 1NY6A 2ZE7A 2AXPA 5L3VA 4LOAA 3ZJYA 3AQ4A 1KY2A 1DELA 4Q9KA 1BKDR 5DN6A 4U5XA 3VR4A 1J2JA 3EZFA 5BW8A 2BOVA 1YQTA 4Q7MB 1UJ2A 2B7CA 4L8GA 3X1DA 1GTVA 3FKSD 1U99A 1W1WA 2QP9X 3MCAA 4JKYA 4NONA 4UXJA 3UG7A 4WW0A 4PC3A 2NMVA 1ZU5A 2KE5A 1FNNA 1E96A 3T12A 2J9RA 5JSZB 5FL7A 4MGZR 3B9QA 1U8YA 1JQJC 4FMDF 2IS6A 4GOXA 4DDTA 3SNHA 2ODBA 2ZSAA 5JSZA 1TEXA 2ZYWX 3KFVA 1XPOA 4RD0A 5FOXA 2IW3A 1LFDB 3EZ2A 1CJKC 1BH2A 2CCJA 3SJZA 4FMBB 1LW7A 1T0HB 2WWHA 4PQFA 3TNFA 3W90A 3T35A 4BQSA 4EFMA 2ZITA 2XOKD 1N5JA 3LO5A 1KSGA 3IDQA 3EPLA 2YWHA 1MV5A 1YZGA 3U61B 3H4MA 4F93B 4N1AA 1MKYA 1GL6A 1Z07A 1VCNA 2ZRJA 4X8MA 2GK6A 4JYCA 1A2KC 4NMMA 3LBNA 3B85A 5KSPA 3W6PA 1VPLA 2BMFA 5JFGA 3IEVA 5HZKA 2J5XA 4PQRA 2EVWX 2ZE8A 3W5IA 2YINC 3TW8B 5L3QB 1NSTA 5DYIA 4C30A 2ZE6A 1RZ3A 4H9GA 2VHCA 3U5ZB 3F5FA 5L3QA 4J0QA 3K70B 3L0IB 4MYUA 1BMFA 1NMZA 3UMFA 1XU4A 3CRRA 2JIZD 2RGXA 1GNPA 5FI0B 1E3MA 3KKQA 1FQJA 1JBKA 1NNEA 3OESA 2WSMA 4EPTA 4DBLC 1DS6A 3MGCA 5G3ZA 2J0VA 1MOZA 1FP7A 3Q7QA 3ZQJA 1CR4A 3AUXA 1G291 3C5HA 4YMSA 4DWJA 2CE2X 1OHHA 2IC5A 4A6PA 5BXQC 2PLFA 3VKHA 3SJAA 3TW4A 5KOYA 3QJYA 5EP4A 4IFEA 4CVNA 1OSNA 5FPKA 1T3LA 2FGJA 2PX3A 3PEUA 4ZO4A 3WNDA 1JR3E 1S2MA 4A8JC 3CM0A 3U2QA 3CB4A 3QXSA 2WJJA 1BYIA 2ZRNA 2VRWA 1G1MA 1Z0AA 1UKZA 2F43B 2CL6X 1GUAA 3K0EA 1PLKA 1TX4B 3D8BA 4BZXA 2QI9C 4PC7A 1KOFA 1ZC4A 1XMJA 2F43A 1US8B 4M22A 5TDHA 2PJZA 4HZUB 2PL3A 1KO8A 2J7KA 2WVJA 5SZKB 3TUZC 4Q66C 3EPJA 1US8A 4HLDA 3QG1A 1E79A 2ATXA 2ECKA 3I8SA 2OAP1 3CWQA 2VYFA 4HZUA 4YDSA 1C1YA 5DI9A 1U90A 2MMCA 4H1UA 2D2EA 1N5LA 2FFAA 4D0NA 4QG7A 4BLSA 2D7DA 4HLUC 2W2XA 1WQ1R 3UIEA 4Y0AA 2WHXA 4JVNA 3L43A 2NO6A 2O8FB 3B1YA 4BLTA 4D4LA 4QC2A 2XX3A 1GITA 2GJKA 4QM7A 4M1OA 4HDCA 2O8FA 2Z4SA 4DCTA 3KXKA 2ZIAA 3TLXA 2C9YA 2C77A 3QVUA 3I73A 4RKFA 5TB5A 4PZLA 3KQHA 2I1VB 2NTYC 4CIDA 1VG0B 3MD0A 1E9RA 4IXMA 2UZ3A 5FR2A 3IUYA 1OKKD 2D06A 3M0EA 4A0RA 4XD7A 4NYMR 3MLEA 3LXRA 4RD1A 2MSDB 4JMPA 3ZDQA 2GCNA 2QN6A 1G20E 1T0JB 3RDPA 3QI2A 3WNBA 1YE8A 4D6PA 1ZUNB 3L0PA 2DCUA 4E03A 3SJBA 1OPXA 1OIVA 2AD1A 1E2IA 2ZYTX 4JBWA 1XD9A 4XWOA 1KJYA 5CM8B 1XBTA 2BBSA 3LXXA 1OB5A 3GJ5A 2QPTA 1LF5A 2AXNA 2AFIE 4D82A 3IIKA 2ZU0C 1TQ4A 4B3DA 2OLKA 4NCIA 1N5IA 1IY0A 4KCGA 2WWYA 1UKEA 4LV6A 1E2QA 4IOKA 1XFAA 4Q9IA 1N6OA 3HR7A 4M2LA 1F2TB 3M1IA 4KLZA 4Q4LA 4EIWA 3S1AB 1GDDA 3EC1A 3LQRA 2V1XA 4KAXA 1IONA 1NBME 1YRBA 4UNQA 1F2TA 5DISB 4LHWA 3S1AA 5LD2B 3BB4A 4FIDA 4OHWA 2W00A 5LBIA 1YZQA 2QY9A 4TZ0A 2GXQA 2N42A 2ZVPX 2WPDD 4JVLA 1EX7A 3QEOA 3DHWC 5E4FA 2YOHA 5TMPA 1II9A 3RHFA 1XTKA 2J0UB 2VSFA 4GP6A 1H8HA 2A5DA 4JLMA 4Z8XA 1D2MA 4BE7B 2J0UA 1W36B 2W58A 1E1RD 3ADCA 1EGAA 1DADA 1DAHA 1E2MA 2XB2A 1KMHA 4QBHA 4MYHA 3SQXA 3TGPA 4WZAE 1EFCA 1W36C 3B1ZA 5J5CA 2J45A 1AA9A 5AWFC 4BRWA 3E70C 2XZOA 3LH5A 4GPTA 1CBUA 3OFNA 3QY0A 2ZJ5A 2R6CA 2J46A 2RGNC 2ZRKA 1HV8A 1E2KA 3N5CA 3RYTC 1SXJB 1C4OA 4C2UA 3EIQA 4GRAA 1W5TA 2QA5A 2IXEA 2YWFA 3I8XA 1SXJA 2O0HA 3QKRB 1JAIA 4D81A 1O87A 1DTSA 2J1LA 1E9BA 3DOFA 4C0KA 4TN1A 2QAGB 1SVMA 3QKRA 1EWQA 4CEHB 2VHTA 2DHRA 3K0AB 2CK3A 2QAGA 2WKRA 2ZSDA 3K1JA 2BEJA 1E2PA 1L7VC 2D7CA 1ZM4A 4CEHA 4DB2A 3CKLA 3K0AA 1G17A 1JQLB 3O8CA 2O8EB 2JJ8A 2QBYB 1MRNA 2QQ0A 5FOSA 2C98A 1U81A 1TU3A 1AJEA 2C04A 2WOJA 3C15C 3FMOB 3DM5A 1NN5A 2O8EA 4AYTA 2QBYA 1LNZA 4AURA 4E22A 2ZROA 1XTRA 4EPVA 2HT1A 3ZD6A 1A82A 4TLBA 1YZKA 3U6KA 1R0ZA 1RRGA 2FSHA 5F3WB 1YR9A 2WJIA 5KNBA 1E9FA 1NF3A 2IS4A 4MYTA 2YOFA 3ZLJA 3CX8A 3EIEA 1E4YA 4A6XA 1PUIA 4KODA 1IN6A 4M1YA 5CK4A 5GJBA 2HYDA 3HU1A 3QIAA 4WOPA 4DT1B 4LV8B 3K09C 2P2LA 1A1VA 3MJRA 2ZRAA 4PO1A 5GJVC 3QG5A 1AQYA 3MAAC 4DT1A 2ZRCA 2CHVA 4M9XA 4Q7JB 3GLGB 5HCIA 1ZNZA 4ZDWA 1NN0A 1GM5A 3DMNA 1ZIOA 3CNLA 3SU8A 1F6BA 2I1QA 2HJGA 3GLGA 3IIJA 1G7CA 1VCMA 3TH5A 2IEYA 1I4TD 2GWHA 1XJ0A 1ZAKA 3GMTA 2HXSA 2R44A 5FPHA 3SHWA 1E2LA 1XRJA 3PITA 4NKRA 4JKIA 5BYJA 3VX3A 5DHFA 3OEED 2B6HA 2DFNA 1IN8A 3AV0B 4KSBA 2ZR7A 1Z6XA 2Z43A 2IHYA 2Q6TA 3HU3A 4JT2A 3ADKA 4OQLA 3MFYA 2Z0MA 4KLNA 4JLKA 3MMPA 4Q1CA 2A5FA 4CYMA 1VG1A 1A7JA 3DVLA 4QL3A 1OFUX 3AH8A 3QXCA 1PLJA 2UZIR 1NI3A 2A5YB 4HAZA 3WP0A 3FOZA 1Q1EA 1G21E 3WBKA 1TTTA 4TSFA 1JEDA 1UF9A 1KYIA 1M2OB 1GFIA 2BBOA 2HLDD 2IA5A 2PMKA 3CH5A 3TAUA 4TTQA 4DLXA 5KO2A 5JEEA 2K5UA 1NN3A 2PCLA 2Z5FA 3SQWA 3IHLA 2VTKA 5FBWB 4AYWA 2C5LA 1G5TA 2FFQA 3AF0A 3ICQB 1DG3A 5F98A 3GJ4A 2F3TA 3QPWA 4ZV4A 4QXAA 4IXNA 3VNUA 5EE1A 1DAFA 1L4YA 2ZSEA 2AKAB 2VSOA 4UNNA 1AN0A 2IYZA 4AYXA 1AS3A 1WCV1 2XNSA 4V0NA 4ZIRB 5KNCA 4O2RA 2W6ID 4KFTA 4AG6A 3B6EA 1Z2AA 3DOEA 5AR1A 2ONKA 3X1ZA 2OBLA 4KBFA 4RD2A 2F6RA 4UJ5A 1MO6A 4ZIRA 1G5RA 3AF1A 3DM9B 4ZI2A 4ACAA 3BXZA 1VHLA 2JDID 3PQCA 5D3MB 4RZUA 4MKIA 2R6FA 1G5PA 1M74A 2RGGA 5D3MA 1JEEA 5AUNB 2OXCA 1IM2A 4HEJA 1IN5A 1G64A 3A4NA 3BH7A 4A9AA 4QBGB 5CK5A 2VBCA 2XSZD 3LVRE 4UJ3A 4LGMA 3NEYA 1S4QA 4IOMA 1G4UR 1WF3A 2OCYC 4RZ3A 3BBPA 1XCPA 2ORWA 3RRZA 1KDOA 1DAGA 4NL4H 3GFOA 3ADDA 5EZ6B 4G1UC 2YYZA 4ZCIA 2C03A 2C9CA 2WSSA 2FZLA 3H2YA 1AK2A 2ZI5A 3KZ1E 1N0VC 1R5NA 1GSIA 2DBYA 2QGNA 1G3QA 4OQXA 3NC0C 2J7PD 1NP6A 4NCHA 1GL9B 3CR8A 3IO5A 1BS1A 3K8YA 4MH0R 5FUYA 1XTQA 5JJIA 3N2EA 4DLVA 2GILA 2KBEA 2Q21A 4QNRA 5FTJA 3IGFA 1U98A 4NPHA 3JVVA 3A1VA 3KJHA 4TQ9A 3CR7A 3FTQA 1AKEA 2PZFA 4PXAA 2KI5A 1YR7A 3QKUA 4LWZA 1GIAA 3GFTA 4URWR 5IK2A 2SHKA 4YXWA 4ASUD 3L8ZA 2IWRA 4MRVA 3VQTA 1VTKA 3IPXA 1U0HC 3OIWA 1OXVA 2V6IA 1JR3D 2ZRMA 2Q3MA 3P4YA 1TEVA 2ZE5A 4KFUA 1E98A 3P27A 3EWSA 1OH8A 3SYNA 3WRYC 5LDDC 3R8FA 4JBXA 3RNLA 5HPYB 3QEJA 4L4UA 2OAQ1 2WMOB 4TL9A 4NCKA 2EFDB 5FUWA 5LB4A 2RGEA 5HKKA 4D4MA 3VR6A 3AKCA 3VR5A 4KBGA 1ZNYA 4MGIR 4O2LA 2IF0A 3SN6A 4AKIA 3IQXA 1I2DA 1VG9B 1KNQA 2J0SA 3SBEA 4GT1A 4DCNA 2A2ZA 2FMXA 4RZ2A 3FDIA 1QHYA 1RRPA 3QNUA 3A4LA 4POAA 1FX0B 3AP3A 2PZEA 1H8EA 1N5KA 1X6VA 2ZRPA 4M1MA 3RS2A 2FSFA 4HAXA 4BZQA 4B35A 5GVSA 1RYHA 1Z06A 4DRZA 1KMQA 1QHHB 3L8YA 1UFQA 3VR1A 2VP2A 1GRRA 2KJQA 1QHHA 1RRFA 2ANBA 3EW9A 3RS7A 4FD2A 2EYUA 1JJ7A 2ZRHA 5EE0A 2X2FA 3L0SA 2JJ1A 4CEJB 2A7QA 3T61A 4TYWA 1EWRA 1X1RA 1WB9A 2IS1A 3EX7C 3BB1A 3KQKA 3LY5A 3K0CA 4DLWA 2AL7A 4CEJA 2IYQA 4OQFA 1NMXA 5JZVA 3NKVA 3OE7D 3K0CC 1P5ZB 2JASA 4B44A 3ASZA 1SKYB 4CRWB 2IUUA 3A1WA 4MRNA 3HPRA 3ASYA 2PJRA 3OEHA 3CZPA 1T3SA 2PH1A 3RLFA 5JEDA 1P3JA 5BQ5A 5HE8A 2W0SA 3RC3A 1K8RA 3D7MA 2J3EA 4HB0A 3TSOA 2D62A 2N1BA 2C99A 3AGQA 3ZD7A 2GEVA 3A37A 4BLPA 4DLTA 1TU4A 3GJ3A 4B2IA 1CRPA 2RCNA 3QVVA 1NJGA 1XCMA 2O8DB 4LV5B 3KJGA 3WY9A 1BIFA 3KUDA 4DLRA 2CCKA 2O8DA 4OK6A 1T8UA 3MUFA 1NJFA 3BORA 2GVZC 5C4GB 4AIIA 3J81k 2O8BB 4B74A 2C78A 4BFWA 3NBZC 1CR0A 4KFRA 2A5JA 4JYBA 2G83A 4Q19A 4W5WA 1SVOA 4CF7A 1CEEA 2O8BA 1SXJE 5FUVA 1NBMD 2HDNB 3GP8A 1P9WA 4B43A 1U8AA 5HE9A 2BEKA 3THWB 1IN4A 4FMCF 2ODNA 1XNJA 1W4BA 1JXOA 1NLYA 1SVIA 3TSWA 3THWA 4F7WA 4W7SA 3FKQA 4Z1MA 3DEFA 3THXB 2A78A 3SR0A 5SZHB 1T3HA 3RWMB 3GJ6A 4DDUA 4DJTA 4B3FX 5FTMA 3THXA 5FTNA 4LPSA 4MUAA 1GL7A 2X77A 4P0TA 3U7EB 4KYUA 3W3AA 4B76A 4YC7A 4IDNA 3LNCA 4NCNA 4DCUA 1NVVR 1KDTA 5EP2A 2NQ2C 1F2UB 3L0OA 1G16A 4DUGA 4JJKA 3W8NA 4PSKA 3OAAD 4W5JA 3R9IA 3C7KA 1F2UA 2G6BA 2D74A 3TKLA 5FUXA 3I1FA 3RSOA 4A92A 3D6TB 3GQBA 3B82A 3NHBA 3VHXA 1AM4D 2BJVA 3MG9A 1KI4A 1DOAA 3SYLA 2OFXA 4FW9A 2JATA 4LHXA 4C0QC 4GNKA 2C95A 3FVQA 3VX4A 3I3SR 1XMIA 4BFSA 2BKUA 5AJXA 1VCOA 2R6AA 1G3RA 3BC1A 4OHXA 2ONJA 2EFEB 2VF7A 2C96A 2NO1A 5J4YA 1FUKA 2AX4A 3SOPA 3EA0A 5EUQB 4LRWA 4P31A 4PC2A 2IYWA 1VYUA 2ZI3A 3AVTA 2GKSA 3NG1A 4FN5A 1G6HA 4HLCA 4C0SA 1NLFA 2GF9A 2QP3A 1JNYA 4IJMA 3HYRA 2REBA 2WWGA 1KKLA 2QENA 1HY3A 4JIMA 2YOGA 4KHZA 4LHVA 4ZDKA 3T5DA 2IF2A 3DZ8A 1R8SA 2ZRIA 4II7A 5KUTA 1HEIA 4GBMA 1QVAA 4UNRA 3WHLA 2CXXA 1YHNA 4MDFA 4DEYA 3T1QA 3I5XA 2GBLA 4G5RA 2YHSA 2D2FA 2ORVA 5IDVA 4DSNA 1ZM7A 4JLAA 3BB3A 3IIMA 3BE4A 5JCPA 4O25A 4BFYA 2E9SA 1WE2A 4S2EA 2VQSA 3CO5A 4L9SA 1E9EA 3MJHA 1ZCAA 2OCPA 5FL7D 3UPUA 3A1TA 1JAHA 4NHOA 4CZ2A 2A30A 1MO3A 2GA8A 1VIAA 3EZ9A 4A2QA 4QRHA 1SHKA 1W49A 4RVCA 4GOJA 5IF9A 5KSYA 2VA8A 3LLMA 4U00A 3GPLA 2OBNA 2EQBA 3B8HA 1S9DA 2AK3A 1J7KA 1PZNA 1U0LA 3F3YA 4OL0A 4DSTA 1CIPA 2JIZA 1CRQA 3CX6A 1HTWA 2C8VA 2ANCA 4L9WA 2GESA 5J4KA 4OHVA 3K70C 4PANA 5EXTA 1G7RA 5FBRB 3PG5A 4PC6A 3RC8A 1IOZA 1OFTA 4Y0VA 1F3OA 2BMJA 4Q48A 4ZKEA 1IXRC 1A5TA 4HI0E 1S3GA 3BS4A 1ZUIA 2JLRA 1MABB 2AWOA 3CW2A 1BMFD 3W8RA 2FDCA 5K8IA 3K70D 1SVWA 1JPJA 4NYIR 5CYPA 1MABA 2YJTD 4PR0A 4Q1AA 3WBJA 1SQ5A 2WKQA 3C41J 1CS4C 4PPQA 5LB2A 4I1OA 3ZVNA 2XJ9A 4LHZA 4K81B 1KTVA 2FX3A 3M6AA 3U7GA 2H5EA 1NVXQ 1T5IA 4C3ZA 5CYOA 3GFPA 4TTPA 4UNSA 4G3XA 2WZQA 5E95A 4XWAA 1M34E 1ZIPA 1XEXB 2XTZA 3B5JA 3D3QA 3EASA 2F55A 3P1JA 5SZIA 2QTFA 1XEXA 3D31A 3SJCA 2ZQ5A 3AVWA 4A0FA 1B0UA 4LYAA 2J0QA 2JJ2A 3W6NA 1XEWX 2V55B 2ZI6A 2JEOA 4LJAA 5BN3A 4DXAA 3LW7A 1QHIA 2OSBA 2ZTSA 4NP6A 4HB4A 1Q44A 1FOEB 4QGAA 5EE5B 3B2EA 2BHRA 3EZ7A 4C9BA 1LF0A 4Q5IA 5GVRA 5DHAA 2QMEA 3VU9B 3TR0A 3CUEF 5A5GA 1G6OA 4YDHB 1E79D 2QAJA 2XITA 1WXQA 3H1TA 4OHZA 4DLZA 3VU9A 4IDPA 5C46F 4JL6A 2ATVA 1GP2A 1OKKA 1KO5A 4YMVA 5SZJA 2QMOA 1J70A 1VYVA 4GMDA 2A5GA 3TQCA 4MKHA 3OIYA 1Z63A 1YZTA 2YKGA 2IYRA 2PEZA 2QTVB 4M53A 1EFUA 2J59A 2IK8A 4PC1A 1E2GA 1S0UA 4NE2A 5FOWA 4P4SB 1F5NA 3KXLA 1KI7A 5J4HA 3UWKA 3ZVRA 4P4SA 4LBVA 4XTRA 3TUJC 3I62A 1S8FA 2X2EA 3OF5A 3Q3JB 4PPNA 1KZ7B 4KXFB 4XD7D 1CJTC 2O8CB 4LDJA 1N6HA 4EJSB 2HV8A 2QL6A 4V0OA 2OFOA 3ECCA 3LAWA 3WMGA 5A4JA 4D0GA 2O8CA 1SKYE 1VYTA 4OJQA 4EJSA 2BVNA 4YMUA 4ERNA 3CNOA 5G3YA 2IYUA 2GXUA 4QFMA 5EXPA 2F7SA 1XDBA 2CLDX 3ETLA 1QHXA 1XWIA 1CKEA 4URVR 2Z6VA 1ZNWA 1CXZA 2DY1A 4XH9B 3P32A 2RMKA 5ANRB 2LWIA 2WPDA 1WA5A 5JS7A 1XB2A 3KX2A 1OH6A 2ZUDA 4G01B 2GJ9A 1LS6A 4OI0A 1LVGA 4NYMQ 1AIPA 1PV4A 1W48A 5LD2C 4IEIA 2B92A 2ZU6A 5BYKA 4FWTA 1Z2CA 5GADl 4LJ9A 3IBYA 1KMHB 4BFXA 1E1RA 1XD2B 3V4FA 1Z47A 4KVGA 2FEMA 3JZAA 1UKVY 1FUUA 5HTKA 1E2DA 4PAQA 1ETUA 1XD2A 4YLGA 4EDHA 1U9IA 1OW3B 3KQNA 1HQYE 3RABA 1D5CA 1DBSA 3ZIAA 3EAQA 3PUZA 4OKSA 3NXSA 1SVLA 1IHUA 1NKTA 3E2IA 4W9MC 1IJFA 2AR7A 1MRSA 3CRVA 1RE0A 4NU0A 2DB3A 1X86B 3RS0A 4M9ZA 3U3MA 1H8HD 1XTSA 4FWIB 3F8TA 4TMZA 2FEOA 2G77B 2XNDD 2YC4C 4KYIB 5HZHA 4M1TA 4LX0A 4XJXA 1E32A 3Q72A 3WRXC 3VTKA 4C0JA 1W36D 1HA3A 1W0KA 1SXJC 1OYYA 3IQWA 4LK2A 2F3RA 2MSEB 3DKVA 2BWJA 2GRJA 2FU5C 4TMWA 4JLPA 2QT0A 2WWWA 3NDPA 5JCZA 1FP6A 2ZPTX 1E2FA 1KAGA 1Z6YA 3RS4A 2QAGC 5DNYB 3GEHA 2HCBA 3OFND 2ZS7A 3BH6A 5FR1A 1Z6TA 3T1VA 4EPWA 2HUPA 4JZKA 3HR8A 1K5GA 3A8TA 4LY6A 1T4GA 2GAOA 1JB1A 1KK2A 1ONBA 2IUSA 1KJWA 1W7AA 5EP3A 1CF4A 4US0R 5KPJA 1P9RA 2BCJQ 2GEUA 3JVUA 1II8B 1TADA 2OZEA 1EFRA 4FINA 5DO9A 4ARZB 1II8A 2BMDA 3VR3A 5CB6A 4OHYA 1XEWY 5DH9A 4ARZA 1T9HA 1DG1G 3ZYCA 4PHHA 4DCSA 2REOA 1N6IA 1R0XA 1XX6A 1EX6A 4LC0A 2NPIA 1ZD9A 2OT3B 2RHDA 2WOOA 4IDOA 4OK3A 3AKYA 3CWZA 1KK0A 2ZS9A 2VO1A 4B3GA 1P9NA 1R0WA 3A1SA 2Q9CA 3F0TA 3SE0A 5B30A 4DHEA 2CNWA 2ERXA 4NZYA 4A0GA 3EWAA 1KKMA 4LBZA 2EFHB 1NN1A 4NH0A 2G0NA 3I4LA 3LBHA 1SVKA 1P2UA 5JI3E 3FE2A 3OEEA 4HDQB 4CDGA 4AKGA 3A36A 1PLLA 2BDTA 2CL7X 1D8TA 2PT5A 1W2HA 3LV8A 3BD9A 3ZGXA 1N0WA 2WJVA 3EPHA 3GLHB 4JL8A 3I92A 1W46A 3HU2A 4WZ6A 3GLHA 1KO1A 1AGPA 5EXSA 2QSZA 1UEIA 1YU9A 3EA5A 1G7TA 4GZLA 1KZGB 4IVPA 2QUZA 3WP1B 1GRNA 5JWRA 3AP2A 1HT1E 3BK7A 3NIBA 4WXRA 5B57C 3RRNA 2GXAA 1OFIA 2OFWA 3O47A 1OV4A 4ITRC 1ODFA 4BEJA 2QMHA 1DO2A 4Q1EA 3VAAA 1Q3TA 1YKSA 4DCVA 4L15A 3W5JA 3AVOA 3QQ5A 4C4PA 3U7FB 1R5BA 4PZYA 3TQFA 1G18A 5HR5A 2BM0A 1D2EA 3NWJA 4OYHA 3X1YA 2ZJAA 3TK1A 4DVGA 1DE0A 4BGDA 2FH5B 4CT5A 2WM9B 1HYQA 4C0AC 4IVRA 2W6IA 3A1UA 4HUQB 3RWOA 4DLSA 3A4MA 2HF9A 1ELOA 2ZREA 2E87A 1E99A 4HUQA 4D4KA 1XF9A 2R6DA 3K0FB 1PVOA 2P65A 1XMSA 3RAPR 5H8WA 1M7BA 2WAYA 3LA6A 3E1SA 5FPTA 4D26A 1AKYA 2OG2A 2XXAB 3K0FA 5UKDA 2GEDA 3I5YA 2B7BA 2ZI4A 1PUJA 4YMWA 3H0KA 2IYYA 4F4JA 2XXAA 2GHIA 3QUSA 4TYPA 4HAWA 2R65A 1IBRA 2XJ4A 2CLCX 1Z28A 2ZJZA 1GILA 2DYKA 2XSZA 4FI3C 3K53A 2FSGA 4QJ5A 3CH4B 4LJ6A 3ZZTA 5TVKA 4PHGA 3NTUA 4A2PA 1EESA 3TAHA 1AS0A 3HJNA 3RRYA 3GLIB 5JJLA 1E2HA 2AHOA 121PA 2G0TA 3HWSA 4G5QA 1KNXA 3CF6R 1E0AA 3IKJA 1RVDA 2P6NA 1KI6B 3AEZA 3GLIA 2JLSA 4MA4A 3U6BA 1P7CA 3LBIA 3LX5A 3K0SA 2W6JD 2WWXA 1FMLA 1KI6A 1V43A 3V4RA 2OLJA 4LI0A 3KKMA 5AUOB 4MKFA 3BIFA 4IVQA 2DWQA 4PSAA 2ZANA 2ZR0A 1P73A 4HZIA 2ZRGA 5C2JB 4EUNA 5JRJA 5CIQA 2ZM5A 4G5SA 1KAOA 1OIWA 4TYQA 2D4HA 2PEYA 2FGKA 3W9YA 3WHKA 5KHOC 1I2MA 5B58C 4KI0A 5CJPA 3CLVA 4M8NE 1M6NA 2IYTA 3FYHA 3GCGA 3FHCB 1LS1A 5H1YA 4O3MA 4ZCLA 4M0LA 3SFZA 2FA9A 2R8RA 2QM7A 2NO7A 1OE0A 1JECA 1UBCA 2P5TB 3EZ6A 1OXXK 4M1WA 1BO6A 4QBFA 1M8PA 4LC1A 2XAUA 1E1QD 3LQQA 4QJ3A 2ZETA 4I99A 3R8CA 4AC9A 2GXSA 2W2TA 3KFXA 1OH5A 4QHYA 2GCOB 5GJCA 4PZZA 2ZRFA 5P21A 1X3SA 2Q3FA 3LLUA 3NHAA 4TMTA 5L3RA 5B64A 4JJZA 4PAOA 2ASEA 2GCOA 1W0JA 2OHFA 3LDAA 1G7SA 2QT1A 3CIOA 3VKGA 4YMTA 1W4RA 3UMSA 4X8HA 1SHZA 4YXWD 5IK2D 2GTPA 4LUCA 1OXSC 4U7DA 1N6PA 4V03A 5EP1A 4LBWA 3PVSA 3PUVA 2H16A 3TSZA 2NG1A 1EFTA 2JLQA 2IYXA 5DE3A 3QSYA 1GRQA 4JVSB 1NVUQ 1X8LA 2QMUA 1KJZA 4PFSA 5FOTA 1FNMA 2XTMA 1WBDA 3BFVA 1OXUA 2V7QD 1NG1A 1AZSC 1HT2E 2Z4RA 4BUJA 4PHTA 3SZRA 5HKKD 1TAGA 1OYWA 3R20A 5CITA 4MRSA 2PX0A 4HAUA 4LHYA 1E6CA 3BGWA 3CX7A 1FL9A 2QE7A 4IDQA 4M21A 1ZM3A 4PX9A 2V1UA 1UKYA 4Q1DA 2BBTA 4Q9HA 1KDPA 4DC9A 3OE7A 4KO8A 5IRCD 5FH9A 5CIWA 4C0BA 1GNRA 1X1SA 4JBYA 3B13B 3PEVA 5JRZA 2EU8A 2DFKB 5FBLB 1KY3A 1UBEA 2NO9A 2VL7A 4QNMA 3WMEA 1R7RA 4NYJR 4TTRA 1R2QA 5C4MA 1COWA 4LPKA 3CZQA 4BRUA 5L3SB 1CULC 2JGNA 2JJ1D 2QTHA 5TY0A 3LRPA 1OXTA 5L3SA 1UDXA 1UPTA 4OJKA 4LSGA 1NIPA 4Z54A 3OIVA 3KJIA 4B3BA 2RGAA 2ODEA 3Q7PA 2IXFA 2Q0HA 1Z5ZA 3FMFA 4RY2A 5CLQA 3OIUA 3QBVA 4A4DA 4B71A 4HDOB 2IX3A 3ND9A 2IYVA 2EWWA 4ZDJA 4DDWA 4TT3A 2OCAA 1W47A 3RANA 1XPUA 3SYKA 421PA 4XWKA 3PENA 4HSEA 4NCJA 3SDZA 2H7VA 2B8WA 3ZQ6A 5D3QA 1QZXA 4Q4HB 1GVNB 3ZZ0A 1KSHA 4Q4HA 4ZI3A 1M7HA 2QG6A 2FWRA 4Q4AB 3ZZUA 4UXIA 3UG6A 3UMRA 4URYR 1CP2A 2JLVA 3H86A 4WAUA 4A36A 1EG7A 1FTNA 4Q4AA 3B1WA 1DAIA 1VG8A 4RFVA 3THOA 521PA 1GKYA 4ZPXA 5CDFA 1ZM9A 1ZJ6A 2OILA 1BYUA 1Y3AA 2EW1A 3TBKA 3EC2A 1FFHA 1Z8FA 1ZP6A 4QJ4A 1JI0A 3RVBA 3WYFA 1QVRA 1Z6AA 2ZXUA 3AP1A 4X8LA 2ERYA 2XB4A 3SC3A 1Y63A 5EJEA 1OLOA 1UBFA 2CVFA 4NBSA 4G5GA 5HCNA 3AVYA 4QHTA 1TPZA 2IT1A 2ZRBA 4I4LA 1P62B 4LYHA 1W5SA 1TQ2A 2FF7A 2V54A 1FMJA 2ZAMA 2E1RA 3DZDA 2HJVA 1Z0IA 2WWFA 2AK2A 3U7HB 2ZJ8A 4IDHA 2WJYA 3AVXA 1LY1A 4MKGA 4L16A 4W5HA 5L8VA 3DDCA 3E5HA 4ABYA 3C8UA 2QORA 4JLOA 4RFSB 3U3KA 5DIFA 1TL7C 4Z1MD 1TMKA 3LD9A 5FTKA 2JLYA 4RFSA 1E0SA 1QRAA 3GJ0A 1ZRHA 3OZXA 4P4UA 3TE6A 1ZVQA 2FV8A 1ZNXA 3AB3A 4QM6A 2Y8EA 1K6MA 4US2R 3GLFB 4MRRA 4XOIA 2QNRA 1N6KA 2JA1A 4C0LA 3GLFA 1P75A 2VHUA 4R7ZA 1GWNA 4Q02A 3IHWA 1CJMA 4E07A 2GAAA 2V8OA 1RFLA 3KB1A 1G9XA 4GZMA 5A0FA 2AFHE 2FFHA 5KTYA 2DR3A 1W4AA 3GEIA 3IBGA 3PV0A 2BMEA 3HYTA 1OT3A 2L0XA 4AY2A 3FKSA 1G8YA 3MSXA 4PAMA 3GLHE 3JZMA 2PT7A 4PPFA 3AF3A 4RD4A 3CRW1 1NMYA 3SBDA 2WWIA 4XSHA 1QG2A 1S1MA 2EFCB 2RGCA 4KSCA 1QBKC 5LPNA 4BFVA 1E9DA 1NY5A 2ZRLA 3DMDA 5J47A 1M1YE 5EQTA 2OE2A 1OJLA 3W3ZB 2NZJA 1Z0KA 3LWNA 1KI2A 1NVVQ 1T91A 3LVQE 5DN6D 1D6JA 2R62A 4A82A 4FCWA 5FL3A 3FWYA 3CNNA 1SKQA 3EXAA 2XOKA 5JBQA 4FMDB 1AQUA 4N0EA 3W34A 2GBLC 4NTZA 2CDNA 2YWEA 1Z0DA 2CVHA 2OO7A 4OI2A 2CJWB 1FPMA 2Z83A 1A4RA 4C7OB 1NLZA 2JLXA 1KI9A 1G8PA 1P61B 1G3IA 2CJWA 3FFAA 3L82B 2LKCA 3U44B 4C7OA 2F1HA 4DDVA 4Q4JB 4G5OA 4PQYA 2ZUCA 2F1IA 4DB4A 3KUCA 1TQDA 3U44A 1IXSB 1TF7A 2GVDC 4Q4JA 4XIGS 4B6FA 3KB2A 3K9GA 3KDSE 2VP6A 1ESMA 4TYYA 2IL1A 4CEIB 1TQ6A 4MQBA 1ZC3A 5M04A 1F48A 2XEXA 4HAYA 4MRPA 5IT5A 5KDDA 1E0KA 2N46A 4CEIA 5FPSA 4OBEA 2P3SA 2PLRA 2AWNA 1ZBDA 4WBSA 3A58B 2GDJA 1DARA 3B78A 4YQFA 5DI3B 1N2CE 5FFMA 3MWJA 4BFZA 1ZU4A 3Q5DA 3NBFA 5DI3A 3GLIE 2DFTA 1G3UA 1JJVA 4TMKA 5FOVA 1X8KA 3R7WB 3VMFA 2NO0A 5KSZA 2BIFA 1Z83A 4B2PA 4I1SA 2QRZA 3SFVA 2EFGA 3R7WA 2FSIA 1EFHA 2WAXA 1KI3A 2WBLC 3LFUA 4UKDA 1XZPA 2AKYA 1DVRA 4NDZA 3CONA 4EFLA 3NH6A 4Q1BA 1ANKA 1Z6GA 1KO7A 2ZJOA 1OHHD 4M4SA 1XD8A 4A8JB 4B33A 2JLUA 5JLJA 2H17A 3I32A 4QGGA 3EIHA 4I1UA 4ESHA 3TMKA 2V3CC 2RGBA 1KGDA 4U02A 4BPBA 4A8JA 2J41A 4CT4B 3G82C 1DAMA 5JJKA 2MSCB 3QBTA 1JR6A 4Q1FA 2QEQA 3T1OA 1N6RA 1WMSA 4RSGA 4TLCA 1RKBA 1U8ZA 4IRUB 4DKXA 1YJ5A 1DO0A 1P6XA 3B60A 1OIXA 1YZLA 1E69A 1RYFA 3KKOA 3AF2A 2UKDA 5EUMA 1YZNA 2B8TA 4FXPA 1NG9A 3ZS9A 2QGZA 3R9XA 2GJ8A 1E4VA 4R2HA 3B1XA 2GNOA 4GFDA 3KJEA 2NPFA 3U3JA 1VHTA 4ILEA 4D80A 1IN7A 2NOAA 4IHQA 4EAQA 1RW4A 2XZPA 1XCGB 5DYGA 3TR5A 4TL8A 3O8RA 2OV2A 2H57A 1G4AE 5JHHB 2UVQA 2JAQA 4HLUA 2XGJA 3FFBA 1MO5A 5E3HA 1E9SA 4YONB 2JJ2D 1P2SA 1Q20A 4JSTA 2XZLA 4TLEA 2RH5A 3KKPA 2VP4A 4D0LB 3UWOA 1S3SA 3Q5EA 1ESNA 1D2NA 4NYIQ 3RS5A 1GZSA 1L4UA 3W6OA 1WRBA 5F2EA 3N70A 2FE4A 4F4IA 1O3YA 1GKUB 4RCYA 4Z51A 4OK5A 2GCPA 3LW8A 4WVFA 5TXGA 1Z0JA 1L2TA 4GOKA 2FJUA 4L5BA 4TL7A 4C2TA 2CCGA 1YRAA 2B21A 1Q3HA 1S9HA 2LCFA 4D4JA 2G1JA 4WXPA 2IYLD 4Q21A 3UATA 1YR6A 2HEIA 3K9LA 4URXR 2YV5A 1Q1BA 1LV7A 4R71A 2ZR9A 3CBQA 3NDBB 4XVUA 5K8LA 4TLAA 4QBIA 3V9PA 3REGA 1TNDA 3AF4A 3AKDA 2NGRA 3QXXA 4P32A 3VR2A 4LJ5A 1WP9A 2DPXA 1H65A 2PMDA 4HATA 4P33A 1J8YF 2V6JA 5TV2A 3KQUA 3L2OB 2ZJBA 4IFBA 4ZKDA 3WMFA 4EJSC 3QXHA 1E9CA 2CHGA 1IY2A 3AVPA 4LYJA 4Q9LA 4A0HA 4DSOA 3AM1A 2GJAA 3V00A 3B7GA 3TJZA 4KU4A 1GKIA 5IHPA 1JXMA 4Z8YA 1RJ9B 1XXHE 2O5VA 4V02A 3BJIC 3QOFA 3NC1C 1VIYA 5CM9C 4EPRA 1RJ9A 1ZW6A 3CRMA 4S35A 2ORIA 4JLDA 1CU1A 2WV9A 1T6NA 1U2RA 3MRSA 5E7JA 1HH4A 5B2ZA 1DAKA 2ZI7A 1B23P 4TWZA 2GZAA 1IJEA 1GNQA 3FMPB 4Q9JA 1G8HA 2OBMA 2CL0X 2RB4A 4OI1A 1R4AA 3X1XA 1CLUA 2WKPA 3U3RA 2D3WA 1MT0A 3VHLB 4B3XA 3KKNA 4BECA 5BN4A 4TYNA 3QENA 3PUWA 4B6EA 3MWYW 1U9IC 1E9AA 2PBRA 3I61A 1QF9A 2A3RA 2LKDA 4IOLA 4AI6A 3BRWD 3MWKA 4B34A 5KNDA 2G9NA 3C4JA 2GETA 3Q85A 5CDFE 3KQLA 4O0MA 4RCZA 2REXB 3KTAB 1UBGA 1HUQA 5C18A 1XP8A 2XNDA 3PEYA 3BERA 1AZTA 1KDRA 1XTJA 2KBFA 3KTAA 1KSJA 3HDTA 4C0HA 4KJZA 4TLDA 3AVUA 1X8JA 2FNAA 3IILA 4JLJA 4B73A 4KITB 1OFHA 4F91B 1XJCA 5AJVB 5BN5A 2RGNA 2ZSBA 4LJ7A 4BZPA 4DZZA 5BWMA 3SI7A 2ZEJA 2H92A 1S1CA 3ZIAD 2VIIA 5H70A 4BFTA 4AKEA 2QM8A 5JI2E 2VHJA 4M9SA 3FHTA 3T34A 4HAVA 1R6BX 1J8MF 1VMAA 1Z29A 2MMGA 3PCRB 621PA 1T5LA 4E5UA 1SXJD 4BFUA 1CR2A 1BOFA 4R98A 2BKEA 2F9LA 2WIAA 1IXZA 1VKJA 1W0KD 4XVRA 4UNPA 5H68A 4RZXA 2H8KA 4DLYA 2I4IA 2RKOA 3UK6A 2CK3D 5GJWC 4ZDIA 1KK3A 3P26A 2RGDA 3GLFE 1FQKA 2FPLA 2KB0A 2GZHA 1XJQA 4MITA 1ZINA 4LZZA 3QKSB 2GF0A 721PA 1MR3F 5KSOA 1SVSA 2FN4A 1PJRA 4P3YA 2HYIC 2NZ8A 5FOUA 2X8AA 3QKSA 1QDEA 4PHFA 1QHSA 4B47A 4JLBA 3DPUA 5G41A 2YC2C 4PTLA 1OB2A 4N0DA 3DKPA 5CLLA 2OEPA 4KV9A 3BFXA 3KXIA 3U60B 3PR1A 1N6LA 4GSYA 221PA 1EFRD 2KSQA 2ZJ2A 3M4YA 4M9QA 2P67A 5K8UA 3K09A 1QHGA 3RS3A 4B2LA 4A1FA 4FCVA 3ND8A 4ON9A 2AN9A 5J4LA 2QPAA 5FI1B 1KHTA 1TUEA 3EG5A 4Q7LA 4E09A 1ZM2A 3AKEA 4JVMA 1Z08A 2P6UA 1JALA 1TF5A 2IHBA 3QE0A 3P20A 3ADBA 4AG5A 4ZCMA 1N25A 2CNWD 1E2NA 1OF1A 2IWHA 4DIDA 4V0MA 2DWPA 1UM8A 2HLDA 1R5OA 2QP4A 4HYYA 2G3YA 2C9OA 4V0LA 1YZUA 2O52A 2R6GA 2EWVA 1NVWQ 2OM2A 2W2VA 2JLWA 4UXHA 3IPYA 4G0NA 4D25A 2VEDA 4MGKR 3R9WA 2R9VA 1CJUC 1Q21A 1XZQA 2CEAA 1G8GA 2VHQA 1C9KA 1NRJB 3EPKA 2NIPA 1NSFA 2ZS8A 1Q1ZA 5AUQA 3PEWA 4UQOA 4GMXA 4TQUS 2P6RA 2R2AA 4TSFD 4P4TA 5CB8A 3WYGA 4EKDA 2QSYA 4EFNA 2TMKA 4JS0A 1E2JA 3GJ7A 1KO4A 3BFKA 3GJXC 3NH9A 4GI7A 1NKSA 1SULA 1MO4A 5DLQC 1W44A 2V4ZA 3AVQA 4RD6A 1LB1B 3CPJB 1P2TA 2JDIA 2WIBA 3HP1A 4DEXA 1XMVA 4GDFA 1G3MA 4JLNA 2X1VA 4TMVA 2VLIA 4WA7A 4MUBA 3NBYC 4F92B 1N0UA 1V5WA 2DWOA 4AD8A 4GP7A 5AJZA 2FPKA 5JWOA 1FZQA 3FMIA 4IW3B 2QQEA 4BLRA 4H1VA 8OHMA 5J4VA 1P72A 2ODWA 4F4CA 2JLZA 4PO8A 3H84A 2WJGA 3PUYA 4EQ6B 3GD7A 4XSGA 4EPYA 4BWYA 5JECA 4EQ6A 2I3BA 2OXRA 2ZVQX 3PJRA 2QPOA 3O8DA 4AKHA 2W6JA 1KI8A 1GG2A 3N2IA 5FTLA 1E0JA 4Q7KA 1LTQA 3TIFA 2J7PA 4Q18A 821PA 4US1R 5AJYA 4JT4A 3BH0A 2FG5A 1XTIA 1U94A 3QF7A 3FPAA 2IYSA 2Q9AA 2CE7A 1ZCBA 2X19A 1VCIA 1XEFA 2G1KA 3REFA 3UANA 1Z0FA 3ZVLA 1ZD1A 3QPVA 4CGZA 4EPXA 5KYKA 2ZYVX 1YVDA 3DO6A 2BV3A 3FGNA 2QROA 3ONWA 5E7IA 5AUPB 3ICEA 3QKTA
chains in the Genus database with same CATH superfamily
2VPPA 3SS8A 2DKFA 1C8KA 2WSSD 4UCXA 3KBBA 3ZCQA 1YMQA 4DWVA 1SY7A 4IDFA 1GAJA 3P0IA 2PSHA 3T7IA 3DEYX 1WPGA 4OHFA 3W5DA 1Z4KA 2HXYA 2ZUBA 3UHPA 2PHZA 2JCSA 5JANA 1ZRNA 1Z7GA 3L1VA 3RF7A 3GF4A 2YJ5A 4KXNA 2HMTA 1TM3E 2HQOA 4V0KA 1U1EA 3THSA 1IOLA 1TF2A 4RF3A 1WB5A 3UXMA 1A97A 3F1LA 3TMYA 4MW2A 5ALSA 3CX4A 4BLUA 5IEJA 1Z73A 3LF2A 4JQSA 4B6RA 2AYXA 4LJYA 5IG2A 3U4QA 3F6RA 1KP2A 3G59A 4YTEA 4XD2A 4P81A 4E5YA 4JYAB 3VNVA 3ECAA 3KQPA 1FP2A 1K3UB 3THYB 1E92A 4W82A 5F1KA 4BNZA 4C05A 2IS2A 5COBA 5DT2A 5C5DA 3QF4B 1YR8A 1NV9A 2FP4B 2IHZA 2FUCA 2ZAOA 4OXXA 4IEEA 4DMGA 4R4JA 4X65B 3UWSA 4GIBA 3DMTC 4KQWA 5H82A 3RGWS 1D9ZA 1WETA 4NFHA 4RVHA 3KWFA 3NORA 4WN3A 5FPYA 1JPNA 1UPUA 1TM4E 1V45E 2QL7A 3SS7X 1RPZA 4BCBA 2B9VA 2KWIA 3WADA 3VC2A 4RTNA 4ONEA 1YCHA 1BN7A 1HQCA 2E55A 2O0KA 2YXPX 1OU0A 1X3LA 3HP4A 5C1BA 3PF8A 2YJZA 4JL5A 5ICCA 2JCGA 3HN7A 3PXGA 1ACJA 3JQGA 3WB2A 5LZ2A 2PLAA 2Q2OA 5FV7A 3FSJX 4AP5A 1K08A 2YBDA 3U4CA 5C8YB 1C1DA 4LJLA 4HF7A 4E12A 3G5UA 3NEJA 4J43A 5IH3A 1FX0A 3X2SA 3BMQA 4C7JA 1ZUHA 2GM3A 1X39A 2GARA 3I9FA 3M2TA 4LOLA 4V1CA 5JFTA 5DBEX 1CR6A 2PUEA 1LTKA 3U7QB 1W4CA 2B69A 2Y3IA 5JAIA 4C43A 3PFIA 4DR4B 5CT5A 1WZ2A 4RVOA 2J87A 4OQNA 1UBSB 2VJMB 1X77A 5EHZA 1L7MA 1TJ4A 4H77A 4E7OA 1ZA1A 1SU7A 3OJWA 5IMSA 3TOZA 2ZRQA 1IBKB 3NETA 4CV1A 2AOXA 3QY9A 3E8MA 3EQ8A 1EE9A 2PCJA 4JLVA 1JKXA 5EZYB 1MUUA 1JV2B 4D9HA 2AFIA 4G2TA 1TVEA 1YQDA 3EEQA 3FHOA 1JG7A 1YJ8A 3AWIA 3L8FA 3K9NA 4ZV9A 2Q6LA 2QR3A 3BMOB 4EY8A 2FFBA 4FFRA 2YNMA 3KZCA 5G53C 1KZ9A 2WKWA 1R1DA 2VRNA 3ND5A 5GP1A 4IEFB 4NXMB 1V2GA 3JPYA 3JQAB 1A71A 3DHVA 4JI0B 3DTTA 3VOBA 2OR3A 1FFYA 3OFVA 1P7WA 2H8GA 2NX2A 2ECOA 1ATZA 3CVVA 1RIFA 3A6FA 4HRYA 4OLFA 5JSFA 2IVFA 2OVBA 4GPBA 4K03A 1N3IA 4F4HA 3JWHA 1C8LA 2PZMA 4J03A 2H7YA 1WOYA 1E89A 1M7GA 4M7OA 3CPEA 2Q1TA 1QHNA 2X1MA 2W48A 4NU5A 4Q3BA 3S2IA 2AA3A 3RSLA 1DC5A 3I2GA 2IEGA 4ALKA 4DA4A 2ZB8A 5H81A 3ABIA 3LQFA 4FLMA 1O9GA 1S96A 1V47A 1DPFA 3OT1A 1JU3A 1HE8B 3NEAA 2FPGA 4FK8A 4FMCB 4IICA 5AYVA 4CE6A 2Q1XA 1Q57A 2O2IA 1WUKS 4LAFA 3B1VA 3HLTA 4X5OA 1GO2A 3QU9A 1G42A 3AIMA 1XG5A 2UXCB 3H6HA 4JNCA 3V7WA 1VRVA 2V9PA 2XTNA 1SBCA 3TLGA 2IEDA 1Y8QB 1WBBA 1N1DA 4JQOA 5AJTA 4IWYA 5ALUA 3WHIA 1XTZA 3IVAA 4PLGA 4Y2TA 2O1EA 5DFAA 2I4LA 1NVAA 3I72A 4JI1B 4BO9A 1ST3A 2R6R1 1ISFA 2ZSFA 3FTEA 3ANNA 4D9KA 3Q3HA 2C8KA 2C57A 4RK5A 3ESXA 1HDEA 3OAAA 1VECA 4TMXA 5JPDA 1GKLA 2XYRA 2AMVA 2BFMA 1ZD8A 4AZ0B 4EMSA 2GZ3A 4Q16A 1VA5A 4DSZA 2CDRA 3H6KA 3JYQA 5KREA 1YA6A 1Z5WA 3JAWA 3BWDD 3T4XA 1JW9B 3AI1A 1JG6A 4DJJA 5F2KA 2MWMA 2WTUA 1G5IA 2VPWA 1XR3A 3C16C 1B1CA 1YJBA 2P41A 2XRMA 4GMGA 3ZHXA 1Q1QA 3LLSA 9ABPA 8ADHA 1U2SA 4IJKA 2R3SA 3TNJA 4N7RA 2IITA 5E9AA 4YBZA 3T5GA 2WVHA 2YFHA 4DIOA 1BVRA 1J9EA 2WFMA 1WV0A 3BL8A 4PS1A 1T25A 2W2KA 5ADWA 3A6PC 4PX5A 4WD3A 1E2UA 1GV0A 2PZGA 2EG9A 3GFVA 5G1NA 4J75A 3D3EA 1KK1A 3HUEA 4IIXA 3ASVA 3QPUA 1B00A 3QOYA 1SGWA 1YIAA 2X8WA 4D74A 1A1SA 2P0EA 2GK7A 4EJ2A 3GOQA 3WLSA 2MYUA 3P4XA 3QP9A 4FQ8A 5K2MA 4GKAA 2AOTB 4J29A 2BM1A 3GLGE 5DXJA 4CW7A 1VOTA 4RVUA 4B6PA 3LIIA 2R1ZA 3T15A 4LYFA 3GRUA 5I4BA 2YRFA 4KAJA 2QRJA 5K2OA 3DDZX 4IYJA 3IO3A 2F1JA 2R00C 3AHIA 4H3HB 4U7FA 4RY8A 2NP7A 2XOXA 1FRFS 2FZVA 2ZE7A 1VRWA 3OX4A 1USUA 2HWUA 1KY2A 1MIOB 1QH9A 4QJIA 1Y9JA 4U5XA 1U8UA 4C89A 3O3CA 2EP5A 1NZFA 2NT4A 3G0IA 4FC7A 4EHHA 4N0MA 3RK1A 2B7CA 4GZ3A 2H1WA 3UAVA 2H4WA 1M8GA 1E18A 3ROTA 2QW1A 1O2DA 4YT8A 4MW9A 2H52A 1L5GB 3VZDA 4AJNA 3HJUA 3L40A 3N39C 2Z2IA 2NUTA 3VGJA 5FWXB 2YIJA 3OU6A 4AG6A 1U8YA 3LCRA 3HCBA 3D59A 4XW2A 4YP1A 2ODBA 2IODA 4RHYA 3SNHA 1TEXA 2AB0A 2ZYWX 3KFVA 5IF3A 3OQNA 4RD0A 4QEDA 1LFDB 5HA5A 1CJKC 1RWWA 3QJ5A 3QBJA 4GWLA 3JARB 4IL5A 4M37A 4TKVA 1T0HB 2ZSKA 3W90A 4G56A 2XOKD 3STXA 1YULA 1N5JA 3LO5A 3DGEC 2HSZA 2C7GA 2WMDA 2YWHA 3C85A 1H85A 2E3JA 4HXYA 4N4AA 3MUNA 4ZZIA 2VYND 2Q3LA 1GL6A 3KQSA 2ZRJA 4X8MA 4E5VA 4N01A 3LBNA 3B85A 3LQYA 4OHOA 3AILA 4S1TA 2BZ0A 4TRJA 5EIFA 5KSPA 4EQZA 1TU0A 2PPLA 3LP6A 5LFAA 2J5XA 4QDZA 5C4IA 1OD6A 4O4IB 4CI9A 4CT0A 1LBEA 4KRGA 4M1ZA 3D6MA 2SCUB 4Z9AA 2DUMA 1C4WA 1E64A 1SEPA 5DYIA 1RTKA 4N5LA 4C30A 1RZ3A 4H7FA 4GEKA 4FVTA 3EMVA 4KMMA 4GKVA 2VDMB 4J0QA 4PSDA 3IP6A 4KFCA 1G5HA 3L0IB 3LG2A 4GWKA 2VAWA 5GONF 5I5GA 1KS2A 3CKYA 4ZC8A 1DTWB 1NMZA 2IHUA 1W0CA 1FJ2A 4KQIA 3CRRA 3N2YA 1RXWA 3HB9A 1MX5A 4G8CA 1E3MA 4KX5A 5ERYA 5FA8A 1JBKA 4QU9A 3OESA 3FSGD 1DS6A 1ZN7A 3P9ZA 3MGCA 2IKQA 4LWPA 2NADA 3ENQA 3ZQJA 3WA6A 3AUXA 3C5HA 4HNVA 4PNZA 1P45A 3L8EA 5SYMA 3DVRX 5BXQC 1PR6A 4DPMA 4F2WA 5LQNA 3GFSA 4P54A 5EP4A 3ENWA 4R1SA 3LUPA 3OF3A 4IFEA 1JDBB 3L92A 2I7TA 2J67A 1XAJA 4YMGA 1T3LA 1N8SA 2CBXA 3ZE0B 3EXEB 2OC9A 1TZMA 1Q0ZA 5F7OA 3CM0A 4IO0A 3R9XB 3U2QA 3D81A 4I1PA 2WJJA 1BYIA 2ZRNA 2VRWA 3IRUA 1G1MA 1L8XA 2C88A 3HA3A 2D2IA 2GASA 1GUAA 3K0EA 4Q0MA 3B38A 3LY8A 1ZVVA 4CMCA 1ZIXA 1KOFA 1ZC4A 1XMJA 3OF2A 5IKEA 3K6SA 1ZR4A 1T9AA 4KLCA 3BTUA 2PL3A 2QJRA 3QKWA 2J7KA 3LOPA 5SZKB 1R8YA 5B4UA 1X1TA 3IP3A 2FN7A 3ZDYB 3D3JA 2E21A 2ATXA 3DZKA 3PICA 2ECKA 3LQ4A 5FADA 5KTRA 5E2IA 1U90A 1TCAA 3FYUB 2D2EA 1L8AA 2IP1A 1N5LA 1R37A 3FFWA 4D0NA 3RRJA 3UAWA 4BJ5A 4BLSA 1EIWA 4LVUA 2D7DA 1C41A 1EI9A 4HLUC 2W2XA 5IZ4A 1WZIA 2CLOB 3DCJA 3DOCA 1L5QA 4CIVA 3LKZA 1FZTA 1ZKMA 1DIRA 1P91A 4J9VA 4GM1A 4BLTA 3NWOA 3DQPA 2FUG6 1AT1A 1SBNE 1YONA 5A3VA 2O8FA 2JHGA 3SZ3A 1KP9A 1V7CA 1RBYA 2H2AA 1FDRA 1V4NA 2G40A 2I6XA 3JRXA 4FDVA 2K2QB 1TRHA 3I73A 4W8HA 5HFAA 1DCTA 3AM5A 3AG5A 7REQA 1JFFB 4CM8A 1VG0B 3MD0A 1ZO8A 3EODA 2ZT6A 2Y93A 3FPCA 1XSEA 3BWVA 2W8ZA 1GRVA 1YJQA 2WMYA 3V33A 3M0EA 4A1OA 4HSGA 3FOFC 4XD7A 3D1JA 3FUWA 1NMSA 1U0OC 4EMTA 1NUPA 2YDXA 2J4DA 3B6ZA 2OD7A 3KYDB 3MUEA 2MSDB 5DZSA 3PDWA 4M0MA 3ZDQA 2WIDA 2PUAA 1ZSNA 2GCNA 2ZTLA 3PC4A 4RIHA 3V4SA 1P80A 1T0JB 4OXRA 2HRZA 3RDPA 2BFPA 1E4EB 1L5ZA 1NOJA 3C5EA 4QFBA 3RRBA 1XK6A 3RAJA 1UPBA 5CB4F 4ZYVA 2MSWA 3ON5A 5HGXA 4IIJF 4NMHA 2DCUA 1Q0RA 4E03A 3AHHA 2Y1KA 2A1IA 3OM8A 4J0KA 4Y2RA 1ZUNA 1MOPA 1E2IA 3WSVA 4CCSA 2MSKA 2ZYTX 3GPIA 2W71A 1XDDA 1KJYA 4PRZA 1N8TA 4Q15A 1XBTA 2BBSA 5CLGA 2A0XA 2IELA 4Y6OA 3GJ5A 4TS3A 3AUJB 5AJUA 2BONA 2H5IA 4G07A 2PFKA 3TLEA 2AFIE 5HZGA 4R31A 1UM9B 4UFNA 3WLMA 2OLKA 3T5CA 3IEIA 3PQEA 1V3TA 1EQUA 2Y1FA 3UV3A 1UKEA 3DEIA 3DW1X 2PUJA 3PJFA 1XFAA 1UMCB 4ZO7A 4ZAZA 3CEMA 3J7AC 1LBQA 2HSWA 4D9BA 1GCOA 3OO1A 1N6OA 2XXJA 3GP5A 3HR7A 4AZ3B 1QH1B 3E9RA 3T5MA 4M2LA 4RO0A 3R5TA 1VGVA 4KLZA 1BXZA 4QA9A 3EC1A 4YCJA 4KAXA 1YRBA 4HZGA 3Q6IA 1P1CA 3K2IA 1LBHA 4UNQA 2NQTA 1F2TA 2BFEA 5DISB 5LN1A 3GLTA 2GBFA 2C07A 3BB4A 4MR9A 4ARCA 3AY0A 4FIDA 4MV9A 1JJAA 1UWKA 5A4KA 3KSBC 1KOJA 4KIUA 1NC3A 1YZQA 3OIDA 4G89A 4QBKA 3WGLA 3E27A 1GSAA 4TLMB 4BGUA 1XZBA 3FUTA 1II9A 2LRHA 3SZOA 3B53X 1RAEA 1R0CA 4ML3A 2QYOA 4YAOA 2EKQA 2GWRA 4GOND 4RWZA 2VQDA 1UC5B 2RARA 3I9V1 1E7QA 1XLWA 1GPLA 3ZWCA 2FPPB 4AY6A 1YASA 1H4QA 5F5XA 4IH1A 3WRVA 2PWYA 5KKAA 2RI1A 1VL2A 1H5UA 1RWXA 6ABPA 4RESA 5ER9A 4EHKA 3DEHA 5FORA 4GO1A 3B1ZA 4IJQA 3TEJA 2JLCA 2J45A 5AWFC 4BRWA 2GFIA 2AV6A 3UCXA 1GPMA 2PS1A 1I1HA 4FN4A 3LH5A 2XZOA 3ROQA 1YL5A 3QY0A 1DBPA 4PFQA 2ZJ5A 2R6CA 5DGIA 1BDBA 1W96A 5JD4A 1S3FA 1XJ5A 3VDQA 4MI3A 1C4OA 3ADOA 3ER9A 2VK4A 5CYFA 4I19A 1E3WB 3WRXA 1RRMA 1SQSA 2IXEA 1NOKA 1SXJA 2OTCA 2W9XA 1O57A 1R8JA 2WD8A 3FF1A 1P5RA 1JDTA 4G5XA 3WE7A 1IBLB 1HRDA 3CNHA 3DOFA 4ARBA 3QKIA 2XCLA 3RTBA 5KJFA 2Y9PB 4CEHB 4DHWA 2VHTA 3KHKA 2W2PA 4NX2A 3TLZA 3K1JA 3PZBA 1JHUA 2C2GA 4PYOA 2BDUA 9MHTA 5LMUB 2D7CA 4PLTA 3CVJA 4CKXA 4DB2A 3L7JA 1PUXA 3K0AA 1JQLB 2ZZKA 1R6AA 3O8CA 5FOSA 1DBVO 1U81A 4W6ZA 1AJEA 3CTMA 4RAOA 2M32A 1LJLA 3JVEA 1QO9A 3N05A 4AYTA 2ZWPA 3HUDA 4PXSA 1LNZA 3RW9A 1FY2A 2C4TA 4HDSB 4MW1A 1N32B 2ZROA 5BW5A 3PXBA 4IJ5A 2FQQA 4BBJA 2HT1A 1ESCA 1A82A 3GNQA 1TVMA 3OZEA 3U6KA 4P5PA 3JYOA 2VG8A 1GUDA 3B2QA 4MVJI 5KNBA 1E9FA 1VBNA 1ODLA 4LGYA 1XO1A 5J63A 1ZWLA 2YOFA 3AR8A 1DRUA 1MGPA 3EIEA 3HJTA 3HP7A 3GCZA 1ITZA 1CFJA 1E4YA 1WKBA 1JDJA 1IN6A 3KSDO 5JE8A 2HYDA 3HU1A 3OHPA 3KKLA 3VR3D 4AJ1A 3OFKA 2A5LA 3VVMA 3H11B 2AMLA 3BT7A 4AZWA 2VTBB 4D0LB 2XWJI 2ZRCA 2CHVA 4Q7JB 4HTFB 4XYBA 3GLGB 1P0QA 1BQ4A 3D3WA 4EHDA 1NN0A 4KV7A 2PMEA 1ZIOA 3CNLA 2RAVA 3A3PA 2ZIXA 4HTAA 4I46A 4BATA 1SIUA 1CE8B 3I6IA 3HABA 1UZNA 3HBNA 4ND3A 4B87A 1N5MA 1I4TD 1V6SA 1F9AA 2GWHA 2HXSA 3ITDA 4QARA 3BKXA 1N9ZA 1ZK1A 2P91A 1M73E 3FCYA 4JKIA 5D5PA 4BWGA 3KD3A 4OBXA 2NZYA 5JBNA 1J1IA 3C4VA 3R7BA 2ONZA 3BQ9A 4GBJA 4ZGWA 1MNAA 2EL9A 4JT2A 3ADKA 2ZT7A 4MS1A 4KLNA 4UVDA 1ZICA 4Q1CA 4ENPA 2CFSA 2A5FA 4FGWA 4CYMA 1FDOA 1VG1A 1A7JA 2X9GA 3UB3A 3VR5H 3VDMA 4RMJA 4X93A 1N4DA 1TTPB 5AIAA 2C58A 5A0TA 3PTZA 2CEKA 3O7MA 3KT8A 4H7PA 4V39A 3N74A 4BY9E 3WP0A 1GAWA 1Q1EA 4RZIA 2PKCA 1JEDA 4YT5A 2HLDD 4OU4A 2PKQP 1L3BA 3LT0A 1NQWA 3KE9A 3H5VA 3WBFA 1NN3A 3RFTA 3SQWA 4CFYA 3PWSA 1UOPA 3H0EA 1RACA 4LYGA 4BLWA 5JS2A 4HT3B 3EDCA 2CLFB 3G9XA 1RZRD 2UZAA 1KC1A 3KAKA 3ZW9A 3H2ZA 3PNMA 5J2UB 4JI8B 1E3IA 3E15A 3ENZA 3R0XA 4FFNA 4B2YA 4NBRA 3QYFA 1UINA 4M9RA 1B8PA 1DG3A 3ICQB 1OTXA 1XKXA 5HRCA 2F3TA 1GR0A 3QLEA 4QXAA 4BCDA 2BP7B 1ZVJA 2TECE 4LHEA 5EE1A 3VNUA 3DE7X 1L4YA 4ZIRB 2NYRA 4ESOA 3PX3A 3C24A 5JXWA 2I33A 4J8PA 2FWAA 1UDRA 1AN0A 4O4JB 4TGLA 1H0KA 2HRRA 1PT6A 3DVAB 4QAQA 4XQ0A 4CL2A 1AS3A 1AUPA 1CUSA 1GRCA 2XNSA 2X9LA 3K20A 2XB9A 3QNMA 4J91A 4KFTA 4O2RA 4NNJA 4QOJA 4Z4IA 2ONKA 5COAA 5TQ0A 1CRWG 5ALJA 2VH1A 1TW3A 4FE3A 4RPCA 3DM9B 3FH0A 2XB8A 3VUEA 4ACAA 1VHLA 9LDBA 3TW6A 3DJFA 4AMZA 4LCJA 1MP0A 3RHSA 1CP3A 4PRYA 3O5AA 4PX3A 4ZODA 5IJWA 3T5PA 3OQOA 2PKYX 3JD0A 3MOGA 3VNAA 3AR5A 4PGHA 1L4FA 3MILA 4HWOA 4HEJA 1IM2A 2C00A 1IN5A 1G64A 2PS3A 2VHWA 3TX6A 4K9QA 1LK5A 2NV6A 4QBGB 2Z3ZA 2WF8A 2N3ZA 4IZIA 4JEUA 3SJ7A 2X6QA 3STVA 2V03A 3EZNA 4LGMA 2Z56A 3NEYA 3WIOA 2C7PA 1Y1KE 1EE2A 1VM6A 3OQHA 3DZBA 3P4UA 4P7FA 1LZLA 1X94A 1QUFA 1XCPA 2ZQZA 4KXMA 3OKAA 4QTTB 3W77A 4NL4H 4HPWA 3GFOA 5CA1F 3K2EA 4GZ6A 4DA7A 4HDNA 4DC1A 3ADDA 1H3EA 1ORIA 3VZRA 2WJ4A 2WSSA 3H2YA 3Q0TA 4E6PA 4YRKA 5BR4A 4MQEA 1YC2A 2ZI5A 4XDZA 2JI7A 1J9GA 1N0VC 2QGNA 4OHMA 3ORSA 3NC0C 2ICAA 1NP6A 1LW6E 2ST1A 1GL9B 4KXWA 3KXDA 3K8YA 3NRCA 1QU3A 5FUYA 4HDMA 4HNRA 1E2BA 1OVGA 3N2EA 4DLVA 3DMHA 4J76A 2Q21A 3N3AC 2F4VB 1J00A 5FTJA 3V8PA 2CVOA 2XOEA 4PYQA 5DYWA 3JVVA 3KJHA 2UUCB 4DMLA 4UFOA 1RKVA 2PZFA 4PXAA 4E7PA 2V7GA 1N2ZA 4L8VA 2ZYAA 5CD9A 4FR5A 4LWZA 5JXGA 1GPUA 3I04M 4UASA 2BKXA 3DFIA 2SHKA 3L8ZA 3P9YA 4MRVA 2C2YA 1UBOS 3QEKA 2D00A 1FUIA 1U0HC 1OXVA 3IPXA 4WBNF 2V9ZA 1IJBA 1JR3D 4DLBA 4MQ5A 5BRNA 4DV3B 1WVMA 3CF4G 1CX9B 5E3JA 5HKAA 4KIFA 3RUPA 2J9YB 1E98A 5LXTA 1QLHA 1RCTE 5BVHB 2AZXA 1A4UA 3MRTA 4WZZA 1S8AA 4DJ5X 2XRFA 2HD4A 1V5GA 4JBXA 1DWUA 4N8DA 3NYIA 2OAQ1 3NKFA 1QOZA 2EFDB 5FUWA 3E3LA 4ZJPA 4LVOA 3IXQA 4XCVA 4BQQA 1LLUA 1APBA 1KHHA 3A3NA 4ZAXA 3LC0A 1VG9B 5DW0A 4GX1A 2H48A 4K9KA 4X1YB 1XXLA 3HO8A 3SICE 3UT6A 5AW4A 1AH2A 3B9RA 4B09A 1XT6A 1I6MA 3QNUA 4ZALA 2BTEA 1CDDA 1FX0B 3AP3A 3BMQB 3KD2A 5EJ4A 4FYIA 3RS2A 4OLBA 1PR0A 4HAXA 3PVZA 5GVSA 1P17A 1R6UA 1YB5A 2VDPB 4G4GA 4DRZA 1QHHB 2OCIA 3L8YA 1IXKA 1DKLA 1Z5UA 1UFQA 2WA2A 1MAAA 3B7PA 4ZVLA 5KWIA 2V7VA 1C7JA 4ID9A 2JI8A 3MIIA 4IQ0A 3U4GA 2QMYA 3VPXA 1SVNA 5ADVA 1T1EA 3EW9A 1Q2XA 3CHYA 3QGMA 1MA0A 1YJAA 4FD2A 1NVTA 1JHMA 3DLCA 1SC3A 2X2FA 3L0SA 4XWGA 5EE0A 2JJ1A 3SG0A 3ZIUA 5D85A 4RWEA 4KQEA 4CEJB 1EWRA 1N3LA 4L1KA 3RKSA 1WB9A 3KQKA 3MZ0A 1AKUA 1RP1A 3LY5A 1N7HA 1Y8AA 2J4CA 2AL7A 1QFMA 1ZUD1 3PDHA 3R0ZA 4MINA 4O2AB 5EWJB 3AEUA 3T95A 3BE6A 1FRZA 3NKVA 2JIRA 1PL8A 2WAAA 4B44A 1BFUA 4XUCA 2IUUA 3S2EA 4MRNA 2UV8A 3ICPA 2VQ6A 5HDBB 1DINA 1SBZA 2X22A 4JH0A 1OGIA 1XDUA 3ASYA 2FEWB 3EJ6A 1FS5A 3GIDA 2F8TA 2PH1A 5JEDA 2CFTA 3U1BA 5JH7F 2BGMA 1ZZEA 3LLCA 3RC3A 2RHHA 3ZYZA 2FVXA 3C43A 5HMMA 3LF1A 1T8YA 4A8PA 4Q3NA 2N1BA 5YASA 3I5UA 5F35A 4BOYA 3AGQA 1D2GA 3OQIB 1ZONA 1QYXA 2EF1A 3A37A 3RJMA 2I6QA 3OJ0A 3QX3A 1CV2A 3DLTA 4IX1A 1Y7TA 4UTRA 5KU7A 3PDJA 2O8DB 3KYIB 2V96A 3PHJA 2X6RA 1VIDA 1BIFA 3LKBA 2C5SA 3HSYA 5JATA 1M2VA 3G0GA 3SLGA 1VLLA 5E2AA 1T3GA 3W4KA 1FMCA 3ZY5A 3KU4A 4IQ4A 2JIPA 3ZKAA 3J81k 4BNNA 3DF7A 2P69A 4CF7A 2G83A 1P77A 2B61A 4L76A 4OUDA 4P2BA 5CCEA 3E7XA 1SXJE 3AW9A 5FUVA 4WZAA 1NBMD 2IYOA 1QV6A 4AULA 1Z4QA 3E82A 3AFOA 3G0OA 3RO7A 4B43A 3KUXA 3VOTA 1AGXA 5FFFA 3WK7A 1AGYA 3JX9A 3HC7A 2BEKA 1PP4A 1QJ4A 1SA0B 2OV1A 3D6FA 4LSZA 3H9BA 1ZRMA 3HACA 1JYEA 1IN4A 1O5IA 1CIJA 3RBZA 5IN5A 5C7OO 1A4XA 1NLYA 1UBMS 3A6DA 3S27A 3Q8LA 3D3NA 2HQRA 1BJTA 1O96A 3FKQA 5HJ7A 4LG1A 4QTZA 4Z1MA 2NVUA 1X7WA 4GOOD 1E61A 3IPRA 5FIUA 4JUFA 3QPAA 3RVLA 1T3HA 3SR0A 2HA3A 3MW8A 1T1SA 2KW5A 3QWIA 5TRTA 3L0YA 3BF8A 3I01A 5FTNA 1V26A 2X77A 4JP8A 2I7CA 1I0ZA 2BTQA 1WB6A 4YC7A 2HSGA 2CWDA 3PLNA 4HQKA 5DSTA 4QQ8A 1QM5A 3PRHA 4PPYA 5L6LB 3LNCA 3MHTA 5B1YA 1CZRA 1YQXA 1KH2A 3DMRA 1NVVR 4DCUA 2PKEA 2XGMA 5EP2A 1F2UB 4RV4A 3TR6A 1QTNA 1TEHA 4JJKA 2DPHA 4PSKA 3W8NA 2GN8A 1HDYA 1Y80A 3EF1A 3KU1A 3VVBA 3C7KA 4BNWA 2G6BA 3WSWA 2WZBA 3R5XA 1NE2A 3VHXB 1RQPA 1C50A 1KQPA 3QW4B 1PVVA 4ZEMA 2AN3A 2JGAA 1T2UA 1TK9A 3JYLA 3D6TB 2W8BA 4K28A 4QYIB 3NHBA 1AM4D 3N7TA 3CT6A 3R75A 3OOHA 1N8KA 5AKIA 3SYLA 3WLAA 1Z8NA 3S44A 5CG2A 1P5JA 4C0QC 4G5YA 1J33A 3EQ6A 3OQ1A 2YUTA 4ZCQA 1NWCA 1RYZA 2C95A 4WACA 1ND6A 5H4HA 1OLUB 1TK2A 2C2MA 1RHRA 3F97A 4KJXA 1VCOA 5LZ9A 4MCHA 2R6AA 2X8BA 1LI4A 2Y0PA 1G3RA 3KHTA 4B7XA 4BQFA 4E1BA 2ACKA 2JJYA 2EFEB 3BGVA 3WZMA 5C1PA 4YJHA 3DOHA 3ZGYA 2I4MA 2JPDA 1TZ2A 3ZK7A 1JKIA 4UEOA 5INTA 1H2BA 2ZG6A 4AO6A 4IV5A 3NHLA 3OECA 5DCUA 2A3NA 1VYUA 4EEKA 3AVTA 2GKSA 3NG1A 4FCCA 5AK5A 1CS0B 1G6HA 3NASA 2NUTB 4C0SA 4PVCA 2PR2A 1RLTA 2EAUA 4M8KA 1BOOA 3TFWA 1UQTA 2QP3A 4KAAA 1CUUA 1JNYA 4IJMA 1RWVA 1AK9A 2REBA 2WWGA 3HYRA 4JXKA 2H29A 2H4XA 1ZH4A 3C5VA 1CJCA 1ZD5A 2YOGA 4JIMA 4LHVA 3UO8B 4TZTA 4ZDKA 2IF2A 3R23A 1OX4A 1R8SA 2ZRIA 4GBMA 3WYEA 4HGPA 4MV0A 2PD6A 1QFXA 4M0PA 2CXXA 1SOUA 3KEOA 3LGSA 4HFMA 4Z0PA 1XZHA 2Y92A 3T1QA 4G5RA 4P82A 4DRYA 4DV4B 4XR9A 2HA2A 1GGNA 3IQIX 3WGGA 1PGQA 5FT9A 1ISMA 5DEOA 1P4RA 2VYNA 3BB3A 3BWMA 3IODA 4O25A 4W63A 4EK9A 2A9VA 1BWRA 1MAUA 3CO5A 3OPXA 3SKVA 5KMGA 2PUDA 5DP1A 4Z4EA 4ER0A 3UPUA 4MIYA 5FL7D 3A1TA 1JAHA 1BU5A 1X7YB 4NHOA 3SC2A 2VAPA 2A30A 3NHYA 4IS3A 3RS9A 2HU5A 3C4QA 3EZ9A 3ESZA 1KF0A 3LU1A 4A2QA 1PT9A 2C5HA 1QX4A 4QRHA 5IF9A 1O4WA 2R5WA 5KSYA 2VA8A 3LLMA 3I6BA 2OQVA 2J5RA 2X40A 1ZFNA 1U3VA 4BJ3A 3UJCA 4BNGA 3BG5A 2DETA 1I4EB 1JE1A 4J1NA 4CCWA 4F5ZA 1J7KA 1LNSA 2DSNA 4JYMA 1CRQA 3SCZA 3CX6A 1IOVA 1G55A 4OHBA 3PJDA 4RZQA 4TZKA 4AW9A 4UZSA 2ANCA 3ZWOA 1JS1X 4DCMA 4OHVA 5J23A 5IFKA 3WKBA 1XOIA 2R8XA 5KVVA 1KRXA 1G7RA 3AESA 3PG5A 5FBRB 4ZOLA 5BUQA 2YWRA 4IIYA 3CA8A 1GPJA 1A2QA 4FYHA 2RK3A 1ZK2A 5GONA 2WP8J 4N5MA 1YUBA 2O23A 5THKA 1WMAA 4HI0E 5DBIA 5FWYB 3FZEA 4RAQA 3S40A 3LL4A 4NG4A 5BUCA 2W42A 3MPOA 5REQA 5JJBA 5JISA 1OTYA 3FLBA 2H1OA 3GRRA 3N6RA 3CW2A 1BMFD 3EBPA 3W8RA 2O07A 3GGJA 4NYIR 4R7TA 5CYPA 2YJTD 2O3TA 4PR0A 4YP9A 4UAJA 2XJ9A 1A50B 4KQ2A 4MTLA 4K81B 2RG7A 1QIIA 3REOA 1BQ3A 5CHYA 1AKTA 1NXXA 4YCCA 1FFCA 1V71A 2H31A 4RDCA 4IIFA 5IARA 3V7YA 4JT9A 1NVXQ 3K6SB 4CIXA 4Z7JA 5KQLA 3GFPA 4GMKA 5AMXA 3PHCA 2WZQA 3ZGZA 4DM3A 5I47A 2AOUA 2VOEA 2XTZA 2FEXA 1ZJWA 4G63A 3SPXA 2BGTA 1W88B 3EASA 3F6SA 5KVAA 2MINA 5KKCA 2F55A 3P1JA 3LRTA 4QUJA 3RHTA 1E1YA 1I9GA 5ECGC 5EHNA 3LGXA 3F8SA 4LOHA 4A8HA 2PT6A 2ZQ5A 4AAYA 4TWIA 1YFJA 3CEJA 1B0UA 1DCKA 3BQMB 2J0QA 1NBOA 1XEWX 1C81A 2V55B 5DLEA 4GRDA 1W73A 3N8NA 4YQYA 1HE2A 2IU6A 4E5PA 3TKAA 2NU9A 3VAYA 2ZTSA 5HEKA 2II6A 2O2CA 4J2OA 4X0EA 4O2BF 4L0MA 2ACWA 3EXIA 4ND5A 1FOEB 3T3HA 3NUZA 3B2EA 4QDOA 5ICFA 3CRNA 4IIVA 4WV3A 4ZQCB 5ALNA 2H2FA 5AVJA 5AXAA 2JAOA 2H11A 4S24A 4EX7A 1XVLA 1OLSA 1MAVA 5I7UA 1B14A 1I4OA 2QMEA 1TMYA 4MICA 4JJIA 2XCOA 1E79D 3H1TA 2EW8A 1CZUA 4LSWA 4WT7A 3RVOA 4AWBA 2GEJA 2ZAGA 4IDPA 1T10A 4JL6A 3EXG2 4UVEA 4ZVNA 5B53A 3KOWA 5IPFA 2EZTA 3PDIA 4FYXA 1J70A 2AJCA 3NI2A 3HA2A 2O3SA 1VYVA 3S55A 1TLFA 3D2LA 1D6SA 3B89A 3TQCA 2IGBA 5FNVF 3FCXA 1X19A 4MV5A 2ZZNA 1O8BA 3W79A 1S5PA 2M6KA 4D4IA 1VPEA 2IYRA 2P9BA 3C3AA 3JWEA 3Q3CA 3INRA 3L0BA 2IIBA 1EFUA 3TTWA 4BXOA 2JGIA 2YN4A 4R81A 3VJMA 2I6FA 4ZQBA 2AE1A 2OKGA 3PR3A 5J3JA 3RAGA 3HH8A 1JEQA 1DV2A 1XU9A 3VZCA 4NBNA 4OIMA 3QX9A 1ADGA 1XMOB 3AJRA 4LBVA 3SR3A 3DE6X 3EFBA 4CQLA 2I9PA 3WIBA 1QZTA 3Q3JB 2ATIA 1KZ7B 1Y98A 3GC6A 3I6MA 3IV9A 2YHUA 1BQEA 1UP4A 1SKUA 1XP5A 5KTSA 1UWCA 3T0GA 2HV8A 1QS0A 1E3EA 4HS4A 1E1NA 2Z2XA 2O8CA 1CIVA 8LDHA 1NXSA 2BVNA 3MBIA 4EJSA 1GT91 4M46A 3G3EA 4FWTA 3GEMA 2G04A 1VFNA 2GXUA 3X1KA 2ZJ1A 1HF3A 5JNSA 2CFIA 2CLDX 1U3UA 3ETLA 3EY9A 4MR8A 5I4CA 1QC5B 1T9KA 3OP1A 4TKUB 4UM8B 5ICMA 4IFIA 3O8OB 5IAKA 3UGQA 3DBVO 2DY1A 4BKUA 2OGSA 5AW2A 4FOSA 3EEOA 1OI7A 2GD1O 3ETHA 4KWIA 1MOSA 4ZWNA 1IHOA 4LNAA 2YY7A 2C4VA 1D4AA 3JQFC 3L8GA 3V3TA 4B7AA 3KX2A 4E5NA 2R1VA 1OH6A 3MTGA 2H5JA 5G4KB 1L6IA 3LQ2A 3SEQA 2RGUA 1ZK0A 4UPEA 1PV4A 5KI6A 1SWWA 2I3DA 3CSUA 2P0AA 3CH6A 1G0NA 3ED5A 1Z2CA 3L02A 1SOAA 4H7HA 1K5HA 4LQCA 5GADl 2GB4A 1XD2B 3M6WA 2IX9A 4PZAA 2VBIA 2FEMA 5JNWA 4I6JA 2FPIA 5DK4A 1WW8A 4CM4A 3F7TA 4N7MA 3UXHA 1ETUA 4EDHA 1DKPA 4FS3A 7ADHA 3ZX4A 1OW3B 2ZBRA 4MV1A 2I1LA 2FZGA 1ZCFA 4NOJA 1O6FA 3DB1A 4DBZA 1DBSA 3W1WA 3EAQA 4S0ZA 1JH9A 1XZ8A 3N7UA 1BRTA 3A06A 1ZD2P 3D0QA 1QVZA 3A1EA 1SVLA 1IHUA 2A1UB 3E2IA 2M2IA 3OOWA 4W9MC 2AR7A 3U49A 3OCYA 1FJXA 4IZHA 2L19A 4BMDA 1UPCA 4KK4A 4PIMA 2MCFA 1H8HD 1PR1A 2VAVA 3F8TA 2G77B 3BJEA 1U9ZA 3GBPA 3GPDG 1DBQA 3RROA 1ABBA 5EMLA 3YASA 1UJBA 3FWNA 4FSHA 3R7SA 3TDKA 5JARA 5G0UA 2ZQYA 4KNVA 4C0JA 1W0KA 3IQWA 2EHJA 4YYEA 1B0ZA 3D2BA 2BWJA 2DF8A 2FU5C 2GRJA 1XKLA 3KVOA 1Y7IA 3R6DA 4TWJA 4WXHA 1CZKA 1Z38A 1IC6A 4JLPA 4A6EA 1FP6A 2ZPTX 1KAGA 1PJQA 1Z6YA 2VWHA 4N6GA 3RS4A 5AW7A 2Q46A 3HVUA 1YUMA 2F67A 4UU8A 4RUKA 3TLBA 3I5AA 3DVSX 1Z6TA 2Z2JA 1E6EA 2FUNB 4JZKA 4EUHA 5CFOA 1K5GA 5JVDF 1TKCA 3A8TA 1T4GA 4AN4A 2H00A 3ES9A 3KTDA 1A27A 2IUSA 1Q16A