2CDNA

Crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
PRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 186
sequence length 186
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cdnA00
3QXCA 4QBGB 2O8FA 1F6BA 1E0SA 3Q8XB 1R4AA 1SHKA 3H84A 5CIWA 3R7WB 3U2QA 5L8VA 1JJ7A 3SHWA 2FPKA 3LXXA 1SXJB 5FBVB 4RCYA 5F98A 1TF2A 2BEKA 1JBKA 2NIPA 3C8UA 4RD6A 1YR7A 2A78A 4HZUB 1CEEA 3Q7QA 3A1VA 3DOFA 1UM8A 2QP9X 5BYKA 5B64A 2GJSA 4PAMA 4DLVA 1C9KA 3KTAB 1YR6A 1Q3HA 4MRSA 1G8YA 1Z6YA 3H4MA 4L9WA 2YWFA 2G1JA 2OBNA 5FOTA 1E2GA 4V02A 1UBCA 1T0HB 3IPYA 4NZYA 3QJYA 4MGKR 5GJCA 1BO6A 1ZM9A 3G82C 1ZCAA 3IGFA 3UPUA 4DEXA 4LBYA 2KSQA 3LQQA 4JLMA 3OIYA 1NLFA 5JHHB 1KI8A 4MRRA 1CTQA 2WMOB 1RYFA 1D2EA 3K70D 2H57A 2P67A 5DH9A 4JBYA 1N6IA 2GDJA 2OT3B 4BFZA 2AD1A 2C77A 4DCUA 4ACAA 3L8YA 3P26A 3A1UA 4HB0A 1Z83A 1KSGA 1A2KC 4HB2A 3DEFA 4ARZB 2BHRA 1ZUNB 3FHOA 4TL7A 4YMUA 4UJ3A 1KK0A 4CT4B 4HAUA 3IEUA 2R6DA 1IY2A 3QI2A 3AVWA 4HDQB 3HJNA 4KYIB 1GVNB 3BXZA 4HUTA 1DOAA 3SS8A 1NRJB 2W2XA 2R6CA 4KLZA 1OB5A 2RGNC 3DDCA 4HSEA 3VFDA 2QPOA 4US1R 5IK2D 2QP3A 3GLFA 1TF5A 2XAUA 3BH0A 3EZ9A 1S9DA 1HQCA 4IDOA 4MRVA 4L8GA 3V9PA 3NBXX 2J59A 3LDAA 1Y3AA 1UFQA 4Q4JA 4NCNA 5L3VA 3EPLA 1XD2A 3UKDA 3R9WA 2ZJZA 2O8EB 2JLWA 1AGRA 2FU5C 1Z5ZA 4ILEA 4TYWA 4CEIA 3TR0A 4BUJA 3GLFE 2IYZA 4HB4A 2HT6A 2ANCA 5L3QA 3GEIA 1OJLA 2J9RA 3SJZA 2JLUA 1KK2A 1W49A 1OXXK 1EFRD 3X1ZA 5CB8A 2OXRA 3IIJA 1HE1C 4AKEA 3EC1A 4M4SA 3CF0A 4CW7A 1UAAA 5SZHB 2WKPA 4MYCA 3VNUA 2V7QA 4MGYR 1XXHA 4Q47A 3A4LA 4LI0A 4B3GA 3SJBA 4NYMR 3IIKA 1KKMA 1RZ3A 4OHWA 5H8WA 1AS0A 1XBTA 4US0R 3EX7C 5JJLA 1UEIA 2V9PA 1KI6B 1NSTA 2OFWA 3QXJA 4D6PA 2J3EA 3QSYA 1OIWA 1FQKA 3D6TB 3K09A 2GAAA 2DHRA 2QTVB 4GZMA 1XXHE 4HYYA 1O87A 2Q3HA 2J0QA 4GPTA 2C5LA 2CNWD 4AC9A 1DE0A 2PLFA 2V6JA 1EX6A 1VCNA 3BERA 3QPVA 2P2LA 4EPRA 4WW0A 4MKFA 3U7FB 2LCFA 2O8DB 3JVUA 2GZHA 1U98A 3LAWA 3C7KA 2PCJA 5IHPA 4PFSA 4A2PA 1LY1A 4XJXA 4X8MA 4OYHA 2Q3MA 2GJAA 1DPFA 2VP9A 4XD7A 3CRVA 3SFZA 1N5LA 1WXQA 3FMOB 4CEHB 1KY3A 4ZI2A 1BIFA 3TW4A 1DVRA 4JVNA 1E2DA 1UDWA 3L82B 2OLKA 1JB1A 4TL8A 1G21E 2ZR7A 3P27A 1Z0AA 2WWHA 4D0NA 4II7A 1GKUB 1T5LA 3EZ2A 1RVDA 1VHTA 1Z06A 2BMJA 2OESA 4B3BA 4D0LB 2D74A 2AFIE 4ITRC 1E99A 2VP2A 3ADCA 4P4SA 1L4YA 1GUAA 2J7PA 5HCIA 3WP0A 2J7KA 3PG5A 2KI5A 3PUVA 2XNSA 4QBHA 1CULC 1KNQA 2WKRA 3LH5A 4FCWA 4NCJA 3LA6A 4FD2A 2QPAA 1FUKA 1AA9A 1QHYA 3CRW1 3CX8A 2IS1A 3NC0C 3PJRA 1HT2E 3RS5A 4A8JC 3AUXA 4RJLA 2XGJA 3MCAA 1P2SA 1SVMA 2AD5A 4CYMA 5JSZB 1M7HA 3W3AA 2H5EA 4LJ8A 2C96A 2ZRHA 1ZM7A 4FINA 3W5JA 2JCSA 1XJ0A 2NTYC 1X86B 2ZS8A 2ODNA 1IN4A 1QHIA 4LV5B 3FPAA 4PQRA 4Z51A 3FE2A 1J8MF 3TMKA 3THOA 2IUTA 1XTIA 3IDQA 1NI3A 3KXLA 5GJWC 4Y0AA 2N42A 4JL6A 1G3IA 3VNVA 2C2HA 1HQYE 3K0CC 3K53A 1GL9B 1XPUA 3DKPA 4Z8YA 3ZIAD 4GSYA 1F60A 3CPEA 3BIFA 4JLNA 4TZ0A 5AUNB 5JRJA 1TMKA 1IN6A 1UKZA 2J0SA 2WM9B 4DC9A 1EWRA 3KZ1E 4DKXA 2XXAB 3GLHB 2ZRDA 3CIOA 4WOPA 3ICEA 4BLQA 3U60B 4N1AA 4BZXA 4CRWB 3CNLA 2FH5B 4BFYA 2R62A 1DAMA 5FBQB 3MFYA 1GNQA 5TVKA 1CJMA 1EFCA 1R5OA 1XEFA 1ODFA 3DZDA 3EZ7A 4GT1A 1US8B 2LKCA 4PC1A 3RHFA 4F91B 4Q7JB 4URVR 3KQKA 3MGCA 4TWZA 4Y0VA 2PL3A 1E9AA 3AP1A 5DYIA 1ZP6A 2OFOA 1D6JA 2DCUA 4LGMA 3B9PA 5JCZA 1CP2A 2XTMA 2X2EA 1XEWY 3N2IA 4JKYA 1N3BA 1P60A 3BOSA 4DIEA 5FPSA 4A0HA 2FGJA 1LFDB 2CDNA 5LB2A 3R8CA 2VF8A 4Z8XA 2PJZA 2AX4A 5E7MA 4QM7A 1FOEB 1X1SA 4RKFA 4MKIA 3RS4A 4D4JA 1NIPA 1E1RA 4PC2A 4RFSB 2DFKB 3CRMA 2IYXA 3QY0A 4JLPA 4PC3A 2ERXA 3AEZA 3WMEA 4LSGA 2VHQA 4YMTA 5FBRB 4W7SA 1TL7C 1SXJD 2ZR0A 5FI1B 3B60A 2DB3A 1Q20A 1G8FA 4IFBA 2ZETA 4JYBA 1PZNA 5CYPA 1LS6A 4NU0A 3SQWA 3FDIA 4RD1A 1VYTA 3FKSA 3I4LA 3QG5A 4JLJA 1OH6A 1II0A 2IYQA 2VYFA 2DFTA 3W3ZB 3TUIC 1XF9A 4M1MA 4X8OA 2CNWA 1TQDA 4EPTA 3CF2A 3KX2A 4M21A 4RZ2A 3K9GA 3TAUA 2MSCB 3EARA 5JZVA 1KZGB 4G5GA 2VQSA 2G88A 3U3MA 1Q0UA 4WIAA 3SJCA 3Q3JB 5EZ6B 4ABYA 2Q9AA 5L3SA 2BV3A 3GLGA 4B2LA 2PT7A 3ASZA 1IJEA 4M1TA 1W4CA 5DHFA 3DPUA 4IEIA 4Q1FA 4QRHA 4G5QA 3VQTA 3AF1A 2VSFA 2WWWA 4LDJA 1A7JA 3R9IA 3T35A 2Q9CA 3CNOA 3WXMA 2ANBA 3AKEA 3K70C 2DBYA 2KWIA 2ZJYA 3EWAA 3GLGE 1HT1E 4OI1A 3MG9A 2N46A 6Q21A 1MH1A 3KKMA 2QTFA 3HR7A 4OKSA 1OFUX 5FTMA 2REBA 2OLJA 4MH0R 1CJKC 4HAZA 2I3BA 3SOPA 3VKWA 4DRZA 3QBTA 1DEKA 2QMEA 2REXB 3RRMA 1DAHA 1LNZA 4G0NA 4R98A 4D26A 4DLSA 5KSPA 4PQYA 1C4OA 1NJGA 4YC7A 3GP8A 3I1FA 2PMDA 2C9OA 2BM0A 4ZI3A 1JALA 1DELA 1DO2A 1VG0B 3GCGA 1D2NA 2ORIA 2V3CC 1P4SA 4YMVA 5BXQC 1T0JB 1ONBA 4RD2A 5CIQA 3NDBB 4JJKA 1S2MA 1T6NA 3AF2A 3E70C 5AJZA 1S4QA 1TADA 2FSGA 1X8JA 3KXIA 3I62A 3BB1A 3PXGA 2OO7A 1RIFA 4Q9HA 3FB4A 4OHVA 4M9SA 1F2UA 2V1UA 2VL7A 3I3SR 2EFHB 5D3MB 4PPQA 4OQLA 3AB3A 4JZKA 4CEJB 5EZ5A 1A4RA 3U61B 4NH0A 4IOJA 4AWXA 3NC1C 4E5UA 2QTHA 2J0UB 1DARA 3HYRA 4KAXA 3UATA 4ASUA 4C0QC 2VP5A 4DVGA 1WB9A 4JLBA 3TIFA 2EU8A 1S1MA 3K9HA 2BCGY 3K0FA 2F6RA 3ADDA 2Q3FA 1FMJA 4IXNA 2VSXA 1T5IA 5FOUA 2ONJA 4A92A 1E2JA 5B30A 4Q1AA 1WBBA 2GZDA 1PUJA 3TSOA 2Z0MA 4HLDA 5J4LA 1GNRA 2G83A 4N3NA 4K81B 4A1FA 3FTQA 3O8DA 3QE0A 3T61A 2G3YA 1XMSA 4B2IA 2XZLA 3W34A 1OB2A 4EAQA 2ZE6A 4TN1A 5HKKA 5JS8A 2GZAA 1P6XA 3N5CA 4URXR 1Q44A 2OCYC 1UKVY 4LPKA 2C98A 5EE3A 4BFTA 2Z6VA 4HDCA 4Q7KA 1OKKA 2P6NA 4WZAE 1N25A 4WA7A 2JIZD 2YYZA 4GMXA 3IQXA 2VP6A 2JJ2D 2RMKA 1QHSA 2IEZA 3KFXA 1RRFA 4C0BA 2DWOA 4HUQB 4RD4A 2QT1A 1WP9A 1U8ZA 1WF3A 4G5SA 2A5GA 1M6NA 3PQCA 4PO1A 3VKHA 4HZUA 4PZYA 3FOZA 5KNBA 3ADKA 4KBFA 1ZNXA 4TMKA 5AUPB 4DT1B 3KTAA 3M0EA 2RB4A 3IO3A 4QXAA 2JLQA 1ZVQA 4PC6A 4TL9A 5EE5B 4QM6A 1VCIA 2JLVA 4KLNA 3CR8A 5C4GB 2JLSA 5H1YA 2X1VA 4XTCS 3UG6A 2JDIA 4BE7B 2WWXA 3X1YA 2QQEA 2ZSEA 4RY2A 1Q1BA 1E2NA 3EPHA 1F48A 1N2CE 1WMSA 3R20A 1E0KA 1NN0A 5KDLA 1O3YA 2ZSDA 1FTNA 2GF0A 2WJYA 1FQJA 1F2TA 1KI1A 4Q9LA 3AM1A 5FTNA 1KO4A 2D7CA 3VU9B 4LJ5A 4R71A 3SQXA 2OCPA 5KOYA 4LCBA 3TGPA 3KKOA 2GJ9A 1TUIA 5HPYB 4ARZA 3AVTA 2GESA 4B3DA 1VDZA 1GAJA 1J2JA 4M1WA 3EA0A 1AGPA 3UMFA 1H65A 2ZAOA 4EJSB 1T3LA 2QSYA 2GCNA 1L2TA 4LWZA 3REGA 3QENA 3RS0A 3GLGB 4OI2A 4UXJA 2REOA 4AYTA 1JEDA 3A8TA 2BCJQ 3PENA 3AH8A 1OH8A 2XEXA 2JEOA 4GMDA 3TQFA 2ZRMA 1BH2A 1G5RA 1KJZA 1XPRA 3AF3A 2ZJ5A 3P1JA 1CXZA 1LF0A 5AJYA 4C0AC 5C46F 2IS6A 3KB1A 1Z0IA 1E4VA 3V00A 4HB3A 2IHYA 3O47A 2W6JA 2QMOA 2F7SA 1ZC4A 1P5ZB 5LD2C 3JZMA 1U9IA 1YZLA 1KJWA 2WJJA 2IYUA 1KSHA 2VHJA 1N5KA 1A5TA 2O8EA 2R6GA 5C1BA 4DCTA 3NEYA 4OI4A 2DWPA 1N6RA 3DM5A 3SI7A 1R0YA 2IEYA 3U7EB 1NMZA 2ERYA 2IL1A 3ECCA 4Q4AA 1YVDA 2GJKA 1JNYA 4U00A 3B1ZA 1N6OA 5BN5A 3B85A 5DGXA 4JT2A 1TQ2A 4GRAA 4NYIQ 4BEBA 2CBZA 2XJ4A 4DLZA 5TARA 1E4YA 3U5ZB 4B76A 3GFTA 3MRSA 5KNDA 1X6VA 5FOWA 1W4BA 2WICA 3NEJA 1IBRA 1Z8FA 2IW3A 2GVZC 1VIAA 3QKUA 5BW8A 5L3RA 4W5WA 2BEJA 4IHQA 4URYR 1E9RA 3SU8A 1KI6A 1ESNA 5AUQA 1WQ1R 4M1SA 5TXGA 2ZRCA 3WRYC 3D8BA 2DPXA 3MJRA 1SXJC 3WHKA 3AUYA 2B8WA 1NLZA 2D2FA 4V0LA 4ZDKA 1OH5A 1NNEA 4UNQA 2WVJA 4BFUA 1DG3A 3I8XA 3UIEA 4AY2A 1E2MA 5CITA 2FFQA 2V7QD 1GL6A 3CRQA 3GEHA 3J81k 4QBIA 3TVDA 3WNBA 4ZCIA 2IBMA 2FFBA 4JMPA 2C9CA 2WIAA 4OK6A 1KO8A 1TF7A 3CBQA 4FWTA 1W36B 2FF7A 2O8DA 4MRNA 5E4FA 3RWMB 4I1SA 2IXFA 4X8HA 1SHZA 1YJ5A 1Z6XA 4Q4HB 3TR5A 2PEYA 3DZ8A 2ORWA 2GCPA 2ZI7A 2ZTSA 3B13B 3C41J 4JL5A 1ANKA 3FFBA 2HYDA 3B2EA 2QBYB 3RRZA 2YOHA 2AWNA 1UF9A 1YZUA 4CEHA 121PA 5KDOA 3AP3A 3FKQA 3ND9A 1I4DD 5FPTA 3U3OA 3U6KA 3N2EA 2ZJBA 5K8LA 4KFSA 3LLMA 4K46A 4HI0E 4AK9A 1R0ZA 4B3CA 3QVUA 4OJKA 5G40A 3CZPA 2VTKA 1CKEA 4JJZA 4WZBE 5TV2A 3E2IA 3QXSA 2E9SA 1UPTA 2ORVA 3ZVLA 4MYUA 2ZI6A 1GRNA 2EFDB 2VHCA 4DBLC 1LV7A 1GTVA 5KPJA 3B5JA 2N1BA 4PZZA 2ZROA 3M4YA 5HR5A 4XD7D 2GXAA 1IN7A 4TQ9A 4C7OB 2PX0A 2NO1A 4PR0A 3U44B 1NVWQ 3LRPA 1OSNA 3VAAA 4RSGA 4H1UA 4Q21A 2IWHA 4LYJA 4A9AA 2B92A 4L16A 4ZPXA 2FFHA 5JSZA 3MAAC 4JVSB 4PHFA 3EZFA 1JR3D 1U9IC 1MRSA 4QHSA 1RYHA 4F4IA 2R44A 3I32A 4K8OA 4Q9JA 4DSOA 4HAYA 3KQHA 2ZRAA 3DKVA 1ZCBA 4MUBA 1G5TA 2J7PD 2RGEA 2F9LA 1Q12A 1V5WA 1E1QA 2PX3A 3LWNA 1F3OA 2QM8A 1SVOA 4XIGS 3PR1A 4LV6A 4KSBA 4F4CA 3BS4A 1KI7A 2QMUA 1R5NA 3GJ0A 4ERNA 1GNPA 1ZBDA 3NHBA 3AVVA 5KHOC 4HLUC 3BH7A 5J4YA 3QKTA 1KO5A 5JCPA 4XWOA 3FGNA 4LHWA 2QAGB 3I73A 4LJ6A 1F2TB 5FBWB 2A5DA 4IW3B 4LZZA 1RRCA 2AHOA 5EP2A 2XTZA 1IY0A 3LBNA 3X2SA 5F3WB 2XXAA 3GLHA 1XWIA 1T4GA 3TW8B 1U90A 1PJRA 4KCGA 2LWIA 4PHGA 2YV5A 1OYYA 2AKAB 4JL8A 4Z54A 5KYKA 1US8A 1XZPA 4G1UC 3ZVMA 2XZPA 5C4MA 2GK6A 3TUJC 1MO3A 1OIXA 3QVVA 1OHHD 1GM5A 1BS1A 1X1RA 3SNHA 4HLQB 4DLWA 2GJ8A 3P20A 1MO5A 3GLHE 5FPYA 3EC2A 3LX8A 3LNCA 3QPUA 4JLAA 4B33A 2ZE7A 4Q00A 4Q03A 2IYTA 4TTQA 1UEJA 2CMKA 2HCJB 2ZYVX 2HDNB 2JAQA 3EWSA 4RFSA 1JEEA 3K8YA 4A0GA 4AURA 1Z22A 2QU8A 3LX5A 4M9QA 1AQYA 3ICQB 2WOJA 3DMDA 5FUWA 2P5SA 2D06A 3KUDA 1W2HA 4Q4AB 1W0JA 3UXMA 2O5VA 4G01B 1IXRC 2B7CA 4E09A 1AIPA 4BFXA 3GMTA 2CHQA 3U3JA 2AKYA 3RAPR 2BMDA 1PVOA 4RFVA 1NY5A 1WBDA 1E1RD 4MITA 4OL0A 2FDCA 3NHAA 4M9XA 4TL6A 2JLXA 1T3HA 3MWKA 1NIJA 3BD9A 3VMFA 2K5UA 2IK8A 3MWLA 1XP8A 2RAPA 4PO8A 1QG4A 3IEVA 3B1WA 1KDTA 3X1DA 3FKSD 1TU4A 2C9YA 5FI0B 3CUEF 2P6UA 2IYLD 3W8NA 3TAHA 1D8TA 3G5UA 4PPFA 5P21A 1U2RA 2ONKA 1AS2A 4DLXA 3BB4A 4NYIR 3SYLA 4F92B 3WRXC 4O25A 3TVTA 5BYJA 4BFWA 1NMYA 4LBWA 4G5OA 2FZ4A 3SYNA 2GILA 3QOFA 3FYHA 3Q9LA 4P33A 2ZJ8A 1E9EA 2HF9A 1E2LA 5IF9A 5JWRA 2F43B 2AN9A 2A9KA 2WAXA 1SVWA 4A0FA 3L0PA 2EVWX 2IT1A 2QN6A 4BZPA 1R5BA 4P4UA 1ZM2A 3A58B 1E2IA 5FL3A 3RS3A 2ZAMA 2QRZA 4C2TA 4LPSA 1DAKA 2VA8A 3GJ8A 3DL0A 5J5CA 3R8FA 3SZRA 4NBSA 2PZFA 5LBIA 5BQ5A 3LO5A 4C4PA 2KBEA 1LS1A 3EA5A 1JR3A 3NBFA 2FEOA 4KXFB 1C1YA 5K8IA 1AKYA 2Y8EA 2WWGA 1JXMA 2SHKA 4D0GA 3QG1A 1Z0FA 4WXRA 2V1XA 4GOKA 3OEED 1GL7A 5D3MA 1OFHA 4LC1A 3I8SA 4NMMA 4WAUA 1KO7A 2KJQA 1TAGA 3ZS9A 4CEJA 2EW1A 2J0UA 1GOTA 2D7DA 3HP1A 4IDNA 2CL6X 3JZAA 3AV0B 3VX4A 1P72A 4S2EA 5JRZA 1JR3E 1MV5A 1AK2A 1CS4C 2A5FA 1E9FA 1NSFA 2YOFA 2IUUA 1QHHA 2WJVA 2O52A 4E22A 1EK0A 5FUYA 4B48A 1ZRHA 3A6PC 3OIUA 2BDTA 2ZRJA 1VYVA 2VRWA 3SN6A 2NO6A 4DCVA 1I4LD 3F8TA 1P7CA 2A30A 1N6NA 3ZDQA 4V0MA 4XVUA 3TSWA 3T5DA 3K1JA 3U7GA 1R6BX 2ZJ2A 3EG5A 1H8HA 4R7ZA 4M22A 3CKLA 2BC9A 2RKOA 4ASUD 1IOZA 1IY1A 2KB0A 4LJAA 4RCZA 1KY2A 1WE2A 1OHHA 2V4ZA 1NBMD 1ZUHA 3EZ6A 3H0KA 1P61B 5KSZA 4NKRA 2UVQA 2YINC 4V0ME 4CVNA 4LBZA 2BMFA 1T91A 3AGPA 2WHXA 2FFAA 3UMSA 4TT3A 3ETLA 3T5GA 3U6BA 4DDWA 3SC3A 2W58A 1JXOA 4FWIB 2Z4RA 3B1XA 2XSZA 3WYGA 3KL4A 1OV4A 2Z4SA 4HUQA 4MKGA 3TJZA 3K09C 3TH5A 2JJ8A 4DSNA 1HEIA 1MRNA 4NP6A 3Q72A 3LBIA 1E96A 3PUXA 3RRYA 3SYKA 2BMEA 2CVHA 2JASA 3AQ4A 1QDEA 4ZDJA 4TLBA 2IXGA 1IAQA 5HKKD 1FW6A 2B6HA 2EYUA 3BE4A 4S35A 1QVRA 3IO5A 4TMXA 2IF2A 1NJFA 4DT1A 1ESMA 3OEHA 2ZJAA 3OE7A 1GSIA 1OKKD 3GD7A 2IX3A 1TX4B 5ELXA 3I5XA 4GDFA 1Z0KA 1R8QA 1DO0A 1GP2A 2JLZA 4PHHA 4W9MC 4EIWA 2DFLA 1OXSC 4O2RA 4OK3A 4ZIRB 3JVVA 4OHZA 2QENA 5EP1A 2EWWA 3ZYCA 5KSOA 5JBQA 1RRGA 1W1WA 1NF3A 4FCVA 4TMWA 2HYIC 1Q21A 4M53A 3VU9A 1Z6TA 2O0KA 3BC1A 4LRWA 3QEJA 2GHIA 1HY3A 2IHBA 3X1WA 4ACBA 2VSOA 3HPRA 3CR7A 3AVXA 2VIIA 3ZVRA 5FL7A 2Q21A 2VP0A 2AWOA 2NO7A 4A8JB 4DCNA 1JJVA 4HAVA 1WCV1 5HTKA 1P2VA 4EJSA 1AZSC 2JDID 2QPTA 2ZU0C 1EWQA 1GITA 4DIDA 2OBMA 4M1KA 2AR7A 4EPXA 4WZ6A 2PEZA 1W0KD 4W5JA 5G3YA 3V4FA 2R6FA 4EFNA 4FW9A 1IHUA 3AF4A 1FL9A 1IXZA 2XITA 1Q1EA 3N70A 4V0KA 4A82A 4BWYA 1M8PA 1A82A 1JECA 4Q4LA 2QMHA 2WOOA 4DLRA 2FWRA 1G8GA 3FWYA 1XJCA 3Q7PA 4UXHA 3CW2A 2OE2A 3M6AA 1KK3A 3QBVA 4P4TA 1G9XA 3GFPA 2BJVA 2XZOA 4C0KA 3MWJA 1RPZA 3CPHA 1IN5A 1G4AE 2XTNA 4QGHA 3WMGA 2ECKA 4CT5A 2CEAA 2OV2A 1N5JA 2B8TA 2NQ2C 1N0WA 5DIFA 3OEEA 4TLEA 2G0TA 1KSJA 2F1HA 1XCPA 2ZRKA 1E32A 4PQFA 4TYPA 4XOIA 1FNNA 1RW4A 2G9NA 4RVCA 4XWAA 2W6JD 4Q7MB 1J99A 2WWIA 4KITB 1II9A 2A2ZA 2QSZA 5DHAA 1CBUA 4B73A 1Z6GA 3QF4B 3BORA 4P31A 4UJ5A 4TLAA 2OCAA 4XVRA 5J4KA 4EFMA 2CE2X 2V6IA 2ZRPA 3KJHA 4OHXA 3PEWA 2P6RA 3IHWA 5EXPA 1GFIA 2Q6TA 5JJIA 2QM7A 1GWNA 3BAFA 2XOKA 3MMPA 1YU9A 421PA 1Q1ZA 4TLCA 1R0WA 2MSDB 1KAGA 1JQLB 1NY6A 4KI0A 4ZKDA 1N6HA 1G1MA 4JSYA 4M0LA 2J87A 3T15A 2R2AA 1D5CA 3GFOA 4XSHA 3QXHA 4KYUA 1BKDR 2G77B 4R2HA 1XTKA 4I1VA 3O8RA 1NBMA 1OIVA 5G3ZA 1QHHB 1KI2A 2GVDC 4Q4HA 3TLXA 1X8KA 3UG7A 3TRFA 1DAFA 2ZI5A 3K9NA 3A4NA 4HDOB 2EYQA 4PANA 4TQAA 5FUXA 3AVUA 1P73A 5JI3E 2QY9A 2QBYA 2X77A 3U3KA 4D4LA 2JLYA 1TQ6A 2R65A 2FNAA 3VHLB 2NZ8A 3GJ7A 2W0SA 3I61A 2XJ9A 3QEOA 2ZYUX 2R8RA 2GCOB 2B21A 4IVRA 3NWJA 5DE3A 1NBME 4Q19A 3R9XA 1W5SA 1M7BA 1WRBA 2FPMA 1S9HA 2IYSA 5CLLA 2AK3A 5JMTA 3C16C 3WBKA 4TTPA 2FSIA 2OUKA 3IQWA 3K70B 1G8HA 2I1VB 2HEIA 1UBGA 3PEUA 2AK2A 4P32A 2QZ4A 2JATA 3H86A 1S3SA 3WNCA 2PT5A 2ZIAA 4C7OA 3PUZA 1OT3A 4GFDA 1G20E 4C3ZA 4IKEA 5FR2A 3SR0A 3U44A 4EKDA 4C2UA 1ZNYA 5FOVA 1IM2A 1XCMA 1VG1A 1XU4A 3OESA 5C2JB 4IOLA 4LHZA 2O0JA 4ZKEA 2IS2A 5E7JA 3TE6A 4YQFA 3RYTC 4QFMA 5HZKA 1KO1A 4Q7LA 1G3RA 2HLDA 4MQBA 5FFMA 4GOXA 4A36A 4DB4A 3RC8A 2QORA 1YRAA 3L8ZA 4C0JA 1YQTA 2RGDA 2WIBA 5KNCA 4ZCLA 4BRUA 4C30A 4I99A 1UJ2A 2BBTA 2CJWB 1R7RA 4QJ3A 3EW9A 2P3SA 3RVBA 2RGXA 4HATA 2NPIA 3LVQE 5G41A 2ASEA 5F9FA 3KUCA 3G0HA 1DAEA 2C78A 2GXSA 3CLVA 3KKNA 2VEDA 2RGGA 3CO5A 3KQLA 1W0KA 3EPJA 5LB4A 2ZXUA 5J4VA 2HJVA 4LHVA 2QAGA 5TMPA 3AVYA 2ATXA 3B82A 1ZUIA 5EE0A 4DHEA 1CRPA 2J41A 1JI0A 1XB2A 3LW7A 1K5DA 3SEAA 4KBGA 1E1QD 1E79A 3BFXA 5KSYA 4I4LA 3B8HA 1G18A 721PA 4D4KA 4URUR 2FX3A 3UK6A 2ZSFA 2CVFA 1FMLA 1ZIOA 1SULA 3U7HB 1ZM3A 2FZLA 4XSGA 1CU1A 2PZGA 1N5IA 4MUAA 4CIDA 5FBLB 4EPWA 1FTSA 2WWFA 4M2LA 2FN4A 1G64A 4OHYA 1G4UR 4BEJA 1KOFA 2P5TB 2PBRA 3SJAA 4LJ9A 2FE4A 4ESHA 3AGQA 2EWVA 1IXSB 1OXUA 4OQNA 2OCBA 4FMDB 1CIPA 1CJUC 2WPDA 3DO6A 3U4QA 3ZD7A 1S8FA 1KYIA 3PEVA 1IN8A 2WSMA 3W8RA 3P4YA 3WYAA 2RHDA 3DMNA 3K9LA 1UBFA 2UZIR 2XNDA 2H17A 3C14C 4AKGA 4BZQA 1EGAA 4B35A 2H92A 2NG1A 3DHWC 3F3YA 4MGIR 1PLLA 2GEVA 1CR2A 1E94E 4NTZA 2CE7A 2C95A 1MKYA 3IHLA 4UNSA 1CRQA 3I5YA 1HURA 1FX0B 2Z83A 4D25A 2YNMA 1E0JA 1E2KA 4PSKA 1SKYE 2D62A 1HTWA 2A5YB 4DLTA 2WBLC 3NBZC 4L5BA 4RD0A 1RC8A 1E69A 1AJEA 1S0UA 3T12A 3RABA 1DS6A 1PV4A 2XX3A 3B1VA 3LXRA 5CYOA 1ZNWA 4ZDIA 2OZEA 3HPQA 1GDDA 4AKHA 5H68A 1YZTA 1ZYUA 5FOSA 3TK1A 4BASA 4U5XA 5FTLA 4IFEA 4JLOA 2VBCA 4JLVA 3LLUA 4MKHA 3LW8A 3T1TA 1T8UA 3T34A 3ONWA 1QZXA 2WJHA 2OM2A 2AXNA 4AIIA 1W0JD 1W5TA 4JLKA 3RDPA 4BECA 2VHUA 3A4MA 3KFVA 4PSVA 1G17A 1N0UA 2GXUA 4F93B 2FOLA 1SVIA 4Q1DA 2HJGA 4M9ZA 3NIBA 1U0LA 5ANRB 1B0UA 1GIAA 4TYQA 2FEMA 5GVSA 1E9DA 1E9SA 3ZVNA 3MWYW 3SBDA 1EESA 3AVPA 2OAP1 4O0MA 2F43A 2C8VA 2A3RA 3OAAA 3C5HA 3AVOA 4FN5A 4A4DA 1TU3A 2D2EA 4B32A 1X8LA 3RLFA 5FTKA 3HWSA 1DAIA 4N0EA 1P3JA 1EX7A 1KIMA 4B2PA 2QP4A 4ZDWA 4DZZA 1JR6A 3NH9A 3HU2A 1NN3A 1IQPA 1MABB 2IA5A 5F9HA 4TSFD 1A2BA 4UQOA 5HE9A 1G6OA 2PCLA 2ZRBA 3EAQA 4DEYA 4LYAA 3FHTA 5EJEA 5AWFC 1CJVC 3VR4A 3BJIC 5LD2B 2ZUCA 2GRJA 2WAYA 2IS4A 5IDVA 1XNJA 1E2QA 1M2OB 3KJGA 1FPMA 3TKLA 3FHCB 2GKSA 2IC5A 4KVAA 2OHFA 4B3FX 3CRRA 5DI3B 3FMPB 3ND8A 2ZE8A 2QRNA 1E2PA 1XMIA 2ZJOA 2EFCB 2FSHA 1KAOA 4LJ7A 4KO8A 4NL4H 5JEEA 1SQ5A 1Z0JA 2WWYA 4O3MA 3QIAA 2FMXA 3IIMA 3S1AB 2TMKA 3LVRE 1KTVA 4WXPA 2IWRA 4ON9A 4QGGA 2IF0A 1G8PA 1RJ9B 4ZCMA 3B1YA 4YDHB 2WJIA 2WMNB 4QG7A 4J0QA 3THWB 1VKJA 1X3SA 2YWHA 5KUTA 2OBLA 3CNNA 4TQUS 1OYWA 1BYIA 3VR2A 1P75A 2H8KA 5K8TA 2BOVA 3K0AB 1K8RA 3BB3A 3WNDA 3L0OA 3A1TA 1EG7A 1G5PA 2BM1A 3D7MA 4LBVA 5CK4A 4FMBB 3NBYC 3UWOA 4BFSA 3RC3A 5KTYA 4Q1CA 1D9XA 4JT4A 4L15A 1E3MA 1BYUA 3IUYA 4PC7A 1HV8A 4DJTA 2OAQ1 3LQRA 4M1YA 4MDFA 3KDSE 1K6MA 5CM9C 1XZQA 1NVXQ 4DWJA 4G3XA 1SKQA 4PZLA 1L7VC 4V03A 5AK0A 1KMHA 1Z47A 4LHYA 2QNRA 2W6ID 2CCJA 4C0LA 3HDTA 2W2VA 3PV0A 1NVVQ 2OILA 4F4JA 4DB2A 2O8CB 2EQBA 2Z5FA 3RWOA 4AYXA 4LV8B 1H8HD 2GK7A 2RH5A 2JA1A 2CK3D 4IDPA 2QGZA 4QJ5A 2NPFA 4LJ4A 1QRAA 1W44A 1IJFA 3CM0A 5HCNA 2QL6A 3HU1A 5KO2A 3EIEA 3RANA 5GJVC 821PA 3PITA 1JAHA 4NCHA 1II8B 4TT3D 4Q1BA 1RKBA 3U4QB 3THXA 3KKPA 4LYFA 1OLOA 5J47A 1T3SA 4UKDA 1NLYA 1LTQA 2XSZD 3AKDA 4ZIRA 1YZQA 4V0NA 5DO9A 5AJVB 1SKYB 5B57C 1Z3IX 3SBEA 2F1JA 4P0TA 3X1XA 3EIQA 3ZD6A 4Q48A 2D3WA 1U99A 1J70A 3TNFA 4EFLA 2NOAA 3O8CA 3THYB 3I92A 2F55A 1XMJA 1Y63A 2J45A 4ESVA 4M8NE 3GJXC 3T1OA 4DSUA 4EQ6B 3OEHD 3OE7D 1E6CA 2J46A 2GA8A 3E5HA 4JVLA 5IT5A 4B6EA 3AKYA 4A8JA 1EFTA 1WDTA 2GTPA 4BLOA 1ZJ6A 4QL3A 1CR1A 2Q0HA 1MO6A 5EUQB 5CJ2A 2BKUA 1CJTC 4FIDA 5J40A 1VTKA 1YE8A 2ZANA 1OFTA 3AKCA 2E1RA 1YZKA 2F3TA 4XWKA 1XX6A 1ZINA 2RGAA 2NO0A 3QKRB 1OXVA 2E87A 4QOSA 4D2IA 2XB4A 3GLIB 2VH5R 3CZQA 4BLRA 3K0CA 1ZD1A 5FPKA 3BRWD 1HUQA 3L2OB 4GNKA 2FPLA 5FL7D 3M1IA 2CLCX 4Q18A 4L9SA 1Q3TA 2ZREA 1MOZA 2CLDX 3CH5A 3Q5DA 2BBWA 2HF8A 2JJ1A 4IDQA 4TSFA 4R9UC 1W4AA 2QUZA 5DSZA 1R10A 4AYWA 1KK1A 4NCKA 1VCMA 3DVLA 1ZM4A 3HU3A 3PVSA 1G7RA 1OE0A 5AJXA 5TY0A 2OEPA 2O0HA 2WV9A 4MYHA 3BWDD 4RZXA 3W6NA 2QROA 4DCSA 621PA 1VG8A 4FMDF 1CR4A 1XTRA 5LDDC 1OFIA 1PLJA 5UKDA 1KI3A 4QBFA 3LFUA 4YXWA 2ZM5A 221PA 1XTQA 2OXCA 2ODBA 3CWQA 4O2LA 3WMFA 3OF5A 1UBEA 4LYHA 5J4HA 2GBLA 2ZRIA 3QF4A 4Q5IA 1R2QA 4YDSA 4PTLA 1U8AA 4RZ3A 5KPDA 1G7CA 5TDHA 1NG1A 3FMFA 2JGNA 3EIHA 2ODEA 1ZMXA 5E95A 5TB5A 1VECA 3QQ5A 4KODA 1CLUA 2HCBA 2JLRA 4QHYA 1JPJA 3CB4A 3VKGA 4Q1EA 5IRCD 4B44A 3C5CA 2QI9C 4B6FA 4IXMA 4BQSA 3SE0A 3B7GA 2W83A 4YONB 5CJPA 1YZGA 1GG2A 3ADBA 2ZS9A 4JSTA 4MYTA 1G16A 1XEXB 4H9GA 4MGZR 1AM4D 5AJWA 1W47A 2ZVQX 1AN0A 1FNMA 2VO1A 1TEXA 3B9QA 3I72A 3Q85A 3QKSB 5KU1A 3NDPA 4IDHA 5CLQA 1ZD9A 4OBEA 4P3YA 4GOJA 4Q66C 4BFVA 2XOKD 3BFVA 2W6IA 4KSCA 5EP3A 2BVNA 3LD9A 2C04A 1SVKA 1JQJC 1P62B 1VHLA 4UNRA 1YR9A 1XDBA 2V54A 3WP1B 1TNDA 2CXXA 2GCOA 2NGRA 3KQUA 2O8FB 2EFGA 4DUGD 3MD0A 2CK3A 3GEEA 1TPZA 2P0EA 4DLUA 2D4HA 1JPNA 1W48A 4TMTA 1ZD8A 1W36D 2X2FA 1Z2AA 2GEDA 4U7DA 1MR3F 3PCRB 1OPXA 2ZQ5A 4NPHA 4AI6A 1DTSA 1XMVA 1E2EA 3QXXA 1U8YA 4NDZA 4W5HA 2AFHE 5DNYB 4WVFA 4HLCA 1KMHB 4KJZA 3GQBA 2QEQA 1YRBA 2FGKA 1XCGB 2QGNA 3GJ3A 1MO4A 2HXYA 2HV8A 5G53C 1FUUA 4I1OA 1SVSA 2OG2A 4IOMA 4YMSA 1G3QA 1VG9B 4LY6A 1ELOA 3RRNA 2O8BA 3WY9A 4ZO4A 2GETA 5IK2A 4JYCA 3NVAA 4BLSA 1N6KA 5HZHA 2F1RA 2AL7A 4FMCB 4JKIA 3TBKA 2CJWA 2W00A 1G3UA 2QAJA 4HAXA 3IKJA 1NL3A 4QNMA 3ZQJA 5JFGA 1GRRA 2QE7D 2WSSD 3CPJB 1COWD 3THXB 1KDPA 4NONA 3WYFA 3CH4B 5EQTA 2QA5A 1KZ7B 4PAOA 1ZNZA 4IVQA 5KDDA 1KJYA 1J7KA 1DG1G 2HLDD 4E07A 3V4RA 2IXEA 2UZ3A 4LOAA 1DBSA 1XPOA 3T06B 1ETUA 4URZR 1NVVR 4TMVA 3PUWA 5DI9A 4D80A 2GBLC 1YZNA 5SZKB 2ZS7A 3W9YA 2RHMA 4DSTA 1G7SA 3GLFB 3HYTA 1EFRA 3BH6A 5B2ZA 1U94A 3LBHA 4OQXA 1GRQA 1TEVA 3LY5A 4N0DA 2I4IA 2GF9A 1XD8A 2H7VA 3EXAA 3L0IB 1E98A 4BGDA 4CGZA 1P9RA 4QGFA 4D81A 4Q4JB 3KB2A 4EPYA 1XD2B 3H1TA 4IRUB 2ZI3A 4QHTA 4X8LA 2ZSAA 2ZITA 3CONA 4NCIA 5EE9A 3VHXA 4UNNA 1XTSA 4B43A 2ZE5A 3UMRA 2F3RA 4CEIB 1J8YF 1K5GA 4PX9A 4UXIA 2CCKA 1D2MA 1G3MA 2ZYTX 1H8ED 4IJMA 5L3QB 4HAWA 5JHGB 1M34E 1VYUA 3W5IA 1S3GA 1AZTA 2WTUA 1KI4A 5JLJA 2NZJA 5FOXA 2CL7X 3KJEA 1E79D 1RFLA 2WZQA 4B34A 4HEJA 3ZZ0A 2ODWA 2BWJA 4E03A 2QQ0A 1A1VA 1TUEA 1Z08A 3RSOA 1OW3B 1XXHB 1M1YE 3B78A 1T9HA 1Z28A 2KBFA 2R9VA 1NKSA 1TQ4A 3MSXA 3SFVA 2ZR9A 5EXXA 1KGDA 3ZLJA 3AVQA 4TYYA 1G7TA 1QHGA 4F38A 5HE8A 4JBXA 1VMAA 1QVAA 1LVGA 4IEEA 1T8TA 5SZIA 4QKQA 5FTJA 1E2HA 1NKTA 4A0RA 1Z6AA 3UWKA 5JECA 3VR6A 1FX0A 1S96A 2GWHA 2IYRA 4OK5A 2WPDD 4C0SA 5JWOA 2F9MA 4Q02A 2YC4C 2YKGA 2BJWA 4EDHA 1SVLA 2G6BA 4GP6A 5FUVA 1YKSA 1IONA 4PSAA 4OQFA 2W0MA 3DM9B 1WA5A 5C18A 2YJTD 4Z1MD 4NYJQ 2V55B 1RRPA 2BBSA 2XNDD 1SZPA 5H70A 3OFND 3EASA 1E0AA 1U81A 2DYKA 4PPGA 3ZZUA 1E9CA 1KDOA 1E9BA 1CF4A 5BWMA 1OH7A 2MSEB 2VLIA 1NN1A 4CDGA 3MJHA 2RGBA 2F1IA 4KVGA 1I2DA 2VP4A 3KJIA 2NO9A 1EFUA 1Q1QA 5EP4A 1OXTA 3A36A 3SHFA 1R8SA 2J0VA 5M04A 4DUGA 3TUZC 4CZ2A 4TLDA 2EFEB 3NG1A 4G5RA 4B74A 1NN5A 2PLRA 2IYYA 3VTKA 2AXPA 2ZRGA 3WHLA 4OQMA 3MLEA 3C15C 4P4SB 4TZ6A 1UDXA 2PJRA 4I81A 1FFHA 3RS7A 4LUCA 3UANA 1N6PA 4BRWA 5EUMA 1V43A 1QHNA 3LV8A 3P4XA 4I1UA 1DADA 4PPNA 5BN4A 3ZIAA 2FA9A 2HXSA 4A2QA 1FP6A 5AUOB 3U3RA 3OIWA 3OIVA 1VIYA 3QPWA 1MABA 3OHMA 4MRPA 1FZQA 1W46A 2CLSA 4AD8A 4EJSC 4F7WA 3TQCA 2HUPA 1P9NA 4MA4A 3DOEA 2ZEJA 4DLYA 2VHTA 3OAAD 4GI7A 3PEYA 2QE7A 2WSSA 4XH9B 2RCNA 5DN6D 1COWA 2OSBA 2ZI4A 5DI3A 2CCGA 2ZI9A 4YMWA 1G291 3FVQA 1NVUQ 4KU4A 2PH1A 3ZGXA 3AF0A 5SZJA 2OFXA 1E2FA 3PFIA 1Q22A 5JS7A 2J1LA 2ZUBA 4B3XA 2O8BB 2J5XA 3S1AA 1N0VC 3QNUA 2GAOA 1VPLA 4JS0A 2UKDA 3OZXA 1HH4A 1HE8B 1PLKA 1RJ9A 1UKYA 2FV8A 3VX3A 5A4JA 3WBJA 2Q9BA 3THWA 2YWGA 2ZRNA 2A7QA 3VR1A 4POAA 4M1OA 1LF5A 3W6PA 3K0SA 4EUNA 3R7WA 1G41A 1PUIA 1I4TD 1BOFA 3K0AA 4V0OA 2ZSBA 5A0FA 1XRJA 3ZJYA 1UKEA 1ZAKA 1SXJA 4LC0A 4DDUA 4URWR 1BMFD 4KHZA 3L43A 2WKQA 4NHOA 2G1KA 3K0EA 3MUFA 1P9WA 1TTTA 4MDEA 4WBSA 2DR3A 1XEWX 1EXMA 4R2IA 1KKLA 3AP2A 1H8EA 1KHTA 2BBOA 2ZYWX 3BBPA 4QNRA 5JEDA 4QC2A 2Z43A 1Z0DA 3T1VA 1GZSA 2QG6A 4LX0A 3GJ6A 4QGAA 4U02A 3F0TA 1KSFX 4JLDA 8OHMA 4A6PA 4GP7A 1DAGA 2CL0X 1U0JA 4KFRA 3NXSA 1KMQA 3IILA 1SXJE 1Z2CA 5CB6A 1GKIA 2O8CA 4HZIA 4Q01A 5FPHA 1XFAA 1GILA 3GJ4A 3ASYA 3FMIA 1G6HA 2X8AA 2ZUDA 5EE1A 1UADA 1ZU5A 2NMVA 4CF7A 1EFHA 2H1LA 4LHXA 4UNPA 1W2GA 4DDTA 1Z63A 5GADl 3B6EA 3D31A 3L0SA 1KI9A 5DISB 3FFAA 4PAQA 1W36C 5DYGA 4AG5A 5K8UA 4A15A 2BKEA 3QUSA 2PMKA 1N6LA 1II8A 4TYNA 4L4UA 3H2YA 4AKIA 5CDFA 2VPPA 2IYWA 4A6XA 5CM8B 1QBKC 3KKQA 2H16A 3F5FA 4KV9A 1M74A 2XB2A 5CK5A 2FG5A 4JIMA 1XD9A 2DFNA 4Z1MA 5L3SB 3A1WA 4FCTA 2CHGA 4RZUA 1ZC3A 2V8OA 4TMZA 3THYA 4NE2A 3OFNA 5E3HA 3P32A 3CX6A 4KFTA 4RKEA 2DWQA 2VF7A 2YOGA 5D3QA 1J90A 4EQ6A 5B58C 1F5NA 1D9ZA 3IBGA 4FMCF 4PHTA 4QJ4A 3RSLA 4BLPA 5CDFE 3GPLA 4GL2A 4NYMQ 1S1CA 1VCOA 3W6OA 1AQUA 5JI2E 4OI0A 2G0NA 3C4JA 2MMGA 3BGWA 4IOKA 4IVPA 5BN3A 3D3QA 5EXTA 3GJ5A 1W7AA 2I1QA 1FP7A 4GBMA 1P2TA 2YVUA 3NKVA 3KQNA 2YWEA 2LKDA 1ZW6A 1AKEA 3BFKA 1NMXA 2PZEA 1Q57A 1W4RA 3O8BA 4D4MA 1QHXA 4XTRA 5DLQC 3QKRA 3VR5A 2R6AA 3ZQ6A 4A2WA 4C0HA 1MT0A 4BLTA 3GLIA 3A37A 3IPXA 3NTUA 3ZS8A 1HA3A 2QT0A 2C03A 5E7IA 521PA 1KNXA 4HLUA 3TSZA 2YZ2A 1NG9A 2DY1A 1QG2A 4JVMA 1L8QA 1AS3A 1KDRA 2RGCA 1U0HC 4US2R 1GKYA 1QF9A 3A1SA 2IUSA 2ZRFA 4GZLA 3T1QA 2HT1A 1ZIPA 1XJQA 2B7BA 3GLIE 2P65A 1R0XA 2ATVA 4FI3C 5GJBA 1YHNA 2YHSA 2ZVPX 3ZZTA 1CR0A 1G19A 2ZRLA 3Q5EA 1F2UB 2ZPTX 5JJKA 4NYJR 4B75A 1Z07A 4LK2A 2GXQA 2QAGC 2H18A 4OJQA 5DN6A 4YLGA 4ZV4A 3ZH9B 4XVQA 4PO9A 1XTJA 5LPNA 2RGNA 2A5JA 5AR1A 4DDVA 2GNOA 3E1SA 3BK7A 3PIRA 3SDZA 3PUYA 2JJ1D 1LB1B 3K0FB 5EXSA 3NH6A 2X19A 5FR1A 5GVRA 5JWHA 3HR8A 4Q9KA 1OF1A 1LW7A 4FXPA 2FJUA 4AG6A 4DXAA 4BPBA 4B71A 2BIFA 2C99A 4RD3A 4JBWA 2JIZA 4KFUA 3CF6R 5A5GA 1NP6A 2JJ2A 2FSFA 1L4UA 2CHVA 1P2UA 2YC2C 1Z29A 3IBYA 4YXWD 3EPKA 4D82A 1XEXA 1BMFA 2GEUA 4H1VA 2W2TA 2MMCA 3CX7A 1JAIA 2ZU6A 3W90A 4Q9IA 1RE0A 3KXKA 4PXAA 3QKSA 1M7GA 3QF7A 4B47A 3CWZA 3RNLA 1YR8A 1I2MA 3REFA 2IYVA 2WJGA 1SGWA 2KE5A 5F2EA 2L0XA 4TTRA 3RS2A 4C9BA 4EPVA 5FH9A 1ZU4A 1HYQA 3VR3A 4LJYA 1B23P
chains in the Genus database with same CATH superfamily
4QBGB 2Q4RA 2E4AA 1TJ4A 2G4VA 4Z49A 3QFTA 4OX9Y 1T10A 4JNKA 4C43A 3R7WB 3Q6IA 3F74A 3H84A 3W1EA 4QXRA 3BJZA 1QGAA 3IT3A 4C3UA 4NCAA 4PYIA 1UC5B 5ETJA 3FVRA 3LXXA 3L4JA 3AHIA 3JWEA 2P0YA 1TF2A 4RCYA 3UAGA 3G9TA 4UU0A 2G76A 3I1JA 1P1HA 5BOVA 1BW9A 3ORRA 3V2IA 5GOZA 3Q7QA 1X9IA 3EGIA 1E3EA 1IWBB 1NUAA 3C3AA 1K0UA 3GYBA 3DFFA 5B64A 1U2GA 2GJSA 1P18A 2PA0A 1QTRA 4PAMA 2C7GA 1LPMA 3WL3A 3ZCQA 3KTAB 3EEOA 4TKUB 2EJUA 3PA6A 3HYLA 4FDUA 4R2KA 3H4MA 4AY4A 5ITZB 1ILEA 2B78A 2G1JA 1FS5A 2CMHA 2OBNA 1XV5A 2OV3A 4Y3UA 1L8OA 4EB6A 2OBFA 2XMBA 5HOQA 1VGRA 4MYDA 2HSJA 5EFZA 4J1SA 1T0HB 2XVXA 1TA9A 3KYJB 4UCXA 5E1DA 2PNJA 1MPTA 1P5FA 1U2ZA 1MQ9A 1L5GB 2BFEB 3DDHA 3W9UA 3ZDEA 1RYNA 2DT5A 2R5NA 3NDRA 3IGFA 3FZNA 4LBYA 4JLMA 1WDWB 3DLBA 4KR6A 1WCWA 3OIYA 2ZIXA 2QLTA 4C01A 5JHHB 1K3UB 1CTQA 2BFPA 4Z9AA 4ZP1A 2OT3B 1RBQA 2C3MA 2WQZA 2B0JA 4Z7NB 2D5IA 2NZXA 1OVGA 5CU7A 2PUDA 1A2KC 3UOGA 2WJAA 4IJWA 3RU2A 4L2IB 1GAQA 4FOSA 4BKMA 5CFPA 3M9LA 3IEUA 4AS2A 4H3SA 2R6DA 1Z7BA 1RYMA 3AEQA 2Q5CA 3FIUA 4HUTA 1U6IA 2Q2NA 2W2XA 3AEKB 2GYWA 3MS2A 2FSUA 3TMAA 1FSFA 2JFOA 2W8BA 3KAQA 4I8XA 4BTVA 3H7IA 5BY2A 1UBKS 3QEMB 1QR6A 1ZIDA 5AIAA 1E5TA 2AB0A 2PK3A 3O90A 2X0IA 2DWUA 2YVQA 3OJEA 1TF5A 3OHPA 2ZBFA 1HYBA 4TUYA 3VDQA 3CLUD 4BTEA 2R68A 4ZCRA 2FP3A 1UFVA 3CLTD 5EJ6A 1U28A 1LRJA 4XSVA 4CL8A 2F1OA 1TA0A 2ZIEA 5IDXA 1D4ZA 2C2BA 3C3PA 4NCNA 1DKUA 3EPLA 3K16A 5ULLA 3R9WA 4BMSA 1BEEA 2W2KB 1AHHA 2O6LA 2ZJZA 1OFUA 5J2UA 1I3MA 1A88A 3B1KA 4MW6A 2JLWA 4GRIA 4TYWA 2ZUUA 3F7OA 3P9XA 3V1LA 1IHDA 3NUZA 2HNBA 2ANCA 3IJ5A 2G5GX 2Q3DA 4CWAA 2OMKA 2D6FA 5EPUA 3ZZ1A 3GEIA 1OJLA 2CBGA 2J9RA 2XT0A 2ZIFA 4XZ3A 3RROA 3SJZA 5MHTA 1EXDA 1H3NA 4IKOA 3TM4A 5HNKA 3FGPA 5EN4A 3VBCA 1C9JA 1D4AA 3X1ZA 5CB8A 5FWNA 2EDCA 4DG9A 4ZAYA 4QODA 4AKEA 3N8IA 5C1IA 4KVFA 3UM9A 3H6KA 4TOIA 4I9UA 1WHTB 3GJZA 4MYCA 3VNUA 2V7QA 4H7KA 4JDPA 4BJ1A 4QUEA 1XWFA 1Y48E 1LPBB 2OM6A 3AUFA 2RGUA 4DR7B 2JFPA 5H8WA 2FMTA 4L5YA 1RRVA 1YJ8A 2GCGA 4ZYLA 3EX7C 4EVRA 2HOQA 5AHOA 4D6PA 2ZTUA 3QSYA 3CNHA 1MEOA 1OIWA 3DFZA 4GM0A 3FFXA 1A27A 1Q0SA 5J59A 3ZY2A 1SA0B 4EQZA 2JIQA 4QD3A 1UH5A 3MRXA 2QTVB 2DHRA 2Y92A 4GZMA 1PYOA 2OL4A 1NJ2A 4CHTA 2NU6B 1O87A 3D43A 4JH0A 4R84A 3SQNA 2J0QA 2C88A 1Q11A 2C5LA 4M76B 1YDGA 4AC9A 3UWMA 1BHO1 1DBVO 1IK4A 1QJ4A 2CJXA 3WIDA 3ZHUA 1O5IA 1OTYA 1EX6A 1IWOA 3QPVA 2I67A 4BCDA 3ABQB 1D4OA 4DNXA 1RZRD 1T24A 2DUMA 3WLPA 3MCTA 4DREA 3KOZA 2LCFA 3HEBA 4BN0A 1Z4LA 4KR2A 2O8DB 4YB8A 5E9JA 1ECFA 1PE0A 3NHMA 3UJDA 5IHPA 3OCWA 4HQKA 1SIOA 1YIOA 4A2PA 5LOVA 2WY2D 5KREA 4XJXA 3L7YA 3PUJA 4IXWA 3K6SA 1W5FA 1MC1A 1ADJA 3CRVA 3G2OA 5TPZA 3AFIA 1ZJJA 1GSAA 1N5LA 3I28A 2DFVA 4NR0A 4AXXA 4QREA 4ZGWA 1KY3A 2WKWA 1BIFA 4RK4A 1GT6A 1DVRA 1OX4A 3X1JA 2ZYGA 1ULHA 3L82B 1Z6ZA 3PNVA 4TL8A 3OD1A 1PUXA 1DCMA 2FWAA 1KJQA 3LOPA 4D0NA 4BIIA 3MJVA 2Q8PA 3FROA 3HKCA 3MAJA 5A1TA 3EZ2A 1CUVA 1VHTA 3DBHA 2Y0EA 1Y1PA 4BO1A 2ZZMA 1ZJ5A 3DOCA 4ITRC 4W5TA 4RF3A 1WETA 4W5NA 4IJUA 1L7RA 3CHYA 1GUAA 3EIUA 1L4EA 4HXGA 2J7KA 5H83A 3CNEA 3S2IA 1AQIA 2FZKA 2VSYA 4B17A 2IHJA 4GE3A 4QBTA 2XNSA 1AN9A 4KE7A 3NM5A 3K1AB 4FCWA 3TL3A 4D3DA 4BKUA 1JVBA 2XMGA 5CNIA 3RFVA 4FD2A 3ST7A 3K5IA 4LF6B 3E35A 2AJCA 1QHYA 1AA9A 2QPAA 1ULTA 3CRW1 4JU9A 4AZWA 3PJRA 1HT2E 2VYVA 1AKNA 5MGNA 1DBQA 1VJ1A 1P2SA 1MG5A 2EF1A 1M7HA 1HETA 1H05A 3B9BA 3HYNA 4MTLA 1P17A 2OFPA 4RHFA 2D59A 3DE1X 4GF5A 4W9NA 5T6BA 1P7VA 2C96A 4GKBA 1ZM7A 1Q1NA 4YMIA 4BEVA 1MOQA 5A0VA 4ECEA 2E4ZA 1XJ0A 3GLVA 3ZTYA 1JWLA 2FEAA 3JW8A 2PUAA 2D8AA 3IULA 3K1YA 4GDMA 3FPAA 4PQRA 3U17A 4PYJA 5K0CA 4L9AA 4B09A 2IUTA 1DWQA 1LWOA 1KEVA 1QH8A 3BF7A 4MMXB 3WGNA 4D5EA 2JH9A 2R87A 1NI3A 4BQQA 2PGLA 2M6SA 2Z9CA 1G3IA 1HQYE 1O6BA 3K1ZA 4FZ3A 3UAYA 4PVDA 4IJVA 5CPBA 3DEAA 3WBBA 5IVIA 3KL2A 1OWPA 2LZ0A 4ZREA 4QVGA 3RUIA 2CF6A 2WF8A 3LNTA 1I0IA 1UWVA 2QX4A 2Z30A 5F2KA 3LJKA 5DLEA 1RNLA 3CLRC 4KPUB 1UC8A 1UKZA 2J0SA 3M5CA 4ZZ3A 4O2BF 2C2OA 4DC9A 1KXJA 3JWIA 4DKXA 1SELA 1QQ7A 4ZT7A 1PT7A 5C8XA 1V11B 1YI0A 2EL7A 3U60B 3ICEA 3M34A 4N1AA 4AJLA 4BZXA 4EB8A 1YVRA 4CTJA 2FH5B 3OU7A 3TECE 4PTZA 2NZWA 1LDYA 2R62A 3KVRA 2OCIA 3C6KA 3EF0A 5FBQB 4KIGA 1XEFA 3FRIA 3RHFA 3EZ7A 1E58A 3OM9A 4F5ZA 1SBZA 5ABPA 2OXFA 3BL6A 1Y4UA 1VHQA 2HPVA 3MGCA 4TWZA 4XQCA 4URVR 3KQKA 4DA9A 1VI5A 1SUEA 1ZP6A 1SB8A 3GRAA 3I6IA 1A9TA 3L8MA 4LGMA 3B9PA 4MMZB 2XTMA 4IVNA 5DNUA 1O95C 4WXHA 2ILVA 1EDOA 3OM8A 3ZLBA 3NIFB 4JKYA 3H9CA 1OWOA 3SZMA 1E63A 1V8PA 2Q6IA 3NKLA 5LVAA 1BKSB 5EGSA 4H7DA 4AX8A 3HVIA 5ALRA 3N7AA 5LB2A 4ZAVA 2VF8A 4Z8XA 2PJZA 2PUWA 3RYHA 1H66A 1Z2OX 4R1UA 4DQDA 3AEUA 4QM7A 1LU9A 2SCUA 3IVMA 4QQ8A 4D56A 1LA2A 1Z4MA 1M0WA 3FDZB 2H4FA 4FGLA 3RS4A 4D4JA 5U9CA 2PXCA 2WZDA 4LDZA 4NBTA 4RFSB 4ZEMA 3QY0A 2VK4A 2VHQA 5FBRB 3S4YA 2A4KA 1Q20A 3B48A 1XA0A 2YRXA 2ZOSA 3DKKA 2G06A 3OE5A 4IFBA 4LOJA 3VUFA 3SEFA 1PZNA 1QZUA 3FI0A 1JDJA 4HEA1 5DULA 2GAIA 4GP9A 3VPAA 4CR7A 4OKNA 4RD1A 1JTVA 2PT6A 3F78A 4FQ8A 5FJJA 5PNTA 3Q88A 4CIVA 5C1DA 1A2QA 5FWXB 1GARA 2FPIA 2H4WA 3FKSA 3AG6A 5C81A 5IZCA 5JZSA 3C39A 2QUIA 3K0KA 1II0A 2IYQA 2VYFA 4CMGA 3D6NB 1OA0A 1T8PA 1CUYA 3CZ4A 5KYYB 2VHWA 4C4AA 5LQCA 2W42A 3RM3A 1K4YA 1VE1A 4M21A 4RZ2A 4X6XA 1KZGB 3TCXB 1IQRA 2A1TR 3D2CA 4ZV7A 3S29A 3CISA 3U7QA 3G2QA 3O94A 4QEDA 4DQUA 1H9CA 3VNRA 5BQXA 5EWLA 2A5LA 2BFFA 4OV6B 4ZN6A 4D9HA 3SKYA 1ZK4A 2PKEA 2WU3A 2Y4OA 1V9SA 2Y76A 2ZT5A 3ASZA 4TZTA 4ZC1A 1TM5E 3QFFA 3KUUA 1OLSA 3SCZA 1V47A 1X9GA 4QRHA 5JNWA 2VSFA 3VPHA 3R9IA 2Q9CA 2YS6A 3U7IA 1ZDMA 2XDQA 3CNOA 3AM5A 3LUPA 2YX1A 5EKDA 4YREA 1KOLA 3AKEA 5C1OA 2DBYA 6LDHA 4PONA 1BXRB 2KWIA 2XCQA 4PRKA 3WWEA 4BBJA 1WXXA 1L0BA 1Y1TA 1EFAA 3PWZA 1GXSB 3DVRX 1HEYA 5F3DA 1IVYA 4GWKA 1MH1A 3R0QA 2VJCA 2CXTA 3CURA 4LYEA 5JATA 2EGGA 2H59A 5FTMA 4MYSA 1M1ZA 5IBCA 3U5TA 1X42A 2OLJA 4MH0R 2OCKA 1ZI9A 3HN6A 4HAZA 5CA1F 2I3BA 3SOPA 3VKWA 4CEJA 3CV3A 2REXB 4L0QA 3ND5A 4JT9A 4D26A 2PPLA 3OUTA 4Y6RA 3D3KA 3EVZA 5T4EA 1DELA 1LC3A 1HZZA 2ZJ0A 4XYLA 2V3CC 1FNCA 1KORA 5L6LB 3Q6NA 1WR8A 4ZVTA 4EI7A 1T0JB 3X2FA 3OZUA 1ONBA 4KK4A 2VR1A 3NDBB 3L1HA 1T6NA 3DNFA 1OAAA 4BNVA 1R3DA 1DIGA 3HHPA 4KXWA 2MCFA 1QIKA 2NSJA 3I62A 5LA6F 4NMLA 2OO7A 3DWFA 1A4XA 4GU5A 3UY4A 1TJYA 3T7EA 1DIBA 1VA4A 4M1ZA 4JR0A 4M9SA 2VJMA 2V1UA 4FE4A 2VL7A 4TTAA 3K92A 1TZKA 4NK5A 5D3MB 1DEOA 4OQLA 2PSJA 4DQ0A 3WLFA 2CN1A 4UVEA 3U61B 5I8WA 2QTHA 4PICA 2J0UB 3M81A 2BGTA 3N3BC 3QRWA 2G9UA 1C4KA 3HYRA 1P1IA 2F3SA 3UATA 4C0QC 5L6MB 1WB9A 5EAIA 5JQGA 1S6YA 2VC2B 4HWKA 3S81A 1H23A 1Y9AA 1X7GA 5I8PA 3AG5A 3AY7A 2JGDA 1U5CA 1H85A 4BBPA 1QYVA 4UULA 2Q4OA 3ADDA 2ZBRA 1FMJA 3V4LA 3ESDA 2ONJA 1BN7A 4A92A 1MOPA 5K0JA 4LZAA 4Q1AA 1WBBA 3ZWAA 1F6DA 4WXMA 3W79A 2BEUA 2P11A 2Z0MA 1J2EA 2ZB4A 4MUGA 2XRZA 3RVDA 1J7JA 3TX2A 1QPGA 1L4GA 3KM0A 3UFXA 4MUNA 5AK5A 3ZE6A 5LUBA 4JEIA 2QJWA 4FYYA 4HS4A 2C4UA 1XMSA 2G3YA 3WGJA 2BTQB 1CQJA 3UMJA 1XE3A 3M6WA 2SKDA 2C29D 5PGMA 2ZE6A 4EAQA 3KOWA 5HKKA 2GZAA 1VMDA 1N2OA 2QVLA 1O94A 4DWOA 1QCZA 3D6HA 1HC7A 1O9HA 1YR3A 1TB4A 1QO0A 3BXGA 4HDCA 2PUVA 1O8CA 4Q7KA 2V5UA 3A3YA 3D8SA 1JXAA 3ICVA 4YGXB 2D4AA 1N25A 3L4EA 3LKDA 4HFRA 5D6NA 4YP1A 3NCHA 2BGNA 2Q1YA 5CAEA 3LCCA 4GMXA 3L0ZA 4UDYX 3UHFA 3ILXA 2JJ2D 1O8BA 4Y9DA 4NEHB 4H3VA 2DWOA 4A0SA 4BC0A 4OQYA 4KQIA 1U7DA 2VPTA 2R96A 4D9CA 5C9ZA 4D9JA 5JISA 3L1IA 1U8ZA 1WMDA 3VVBA 3DZFA 1ISGA 2NU8A 2A5GA 1GTMA 5BW4A 4H4EA 2AI3A 3PQCA 3WDMA 2WIDA 3DV0B 1SCNE 4MV8A 1RACA 4MQUA 4PZYA 1N2CA 3VYTB 3FOZA 3H04A 4LS3A 2FDRA 4W7HA 5CCBA 2IEIA 1ZNXA 3BFPA 3TBHA 2YASA 2H2AA 5IN4A 3LX6A 4DT1B 2LNDA 4TQGA 3M0EA 2RB4A 1QRDA 4ZV9A 1SWWA 1RAEA 2FUKA 4P2GA 1BMQA 2JHFA 3NZEA 2YN2A 5HQJA 3ROPA 1Z35A 2B4YA 2FK8A 3ECAA 2UXCB 1U8FO 3AEUB 1BXKA 4XTCS 5H5JA 3GT4A 4BE7B 2WWXA 3ZGYA 3C7DB 1RWXA 5LC1A 5DHUA 3EPHA 1N2CE 3R20A 1NN0A 1BFUA 2ZIVB 7YASA 3SGLA 3ADPA 3ZE2B 1IPHA 1O3YA 1FTNA 3KSRA 1N34B 2PFGA 1FQJA 1T1JA 5A5VA 1KI1A 4FYXA 2CJPA 3PICA 4R71A 4RL4A 3VDMA 3WGUA 4R16A 3OPNA 4OB6A 1LCIA 3PQ4A 4N39A 2QNIA 2ZCJA 3W5UA 1CEQA 4UW9A 4LRUA 2GJ9A 5L7TA 4X62B 3ET5A 4C14A 3AVTA 4B3DA 1VDZA 3QXGA 2R6R1 4K6OA 1AC5A 1CY1A 4H18A 3O03A 4PX3A 1H65A 3ZJ4A 3FTEA 3DFUA 1X7YA 1Z18A 1M8GA 2OA0A 2AOTA 5AHXA 4B9AA 1VBNA 5EWMB 4R8KA 3UJPA 2GFIA 3PDHA 2BFDB 2BCJQ 2C2XA 2JKZA 2QXTA 1QP4A 5DHSA 1SRQA 2H2GA 1O5TA 3AF3A 5KJ6A 2EKPA 2G71A 4WLEA 5G2OA 4A03A 3KB1A 3NAGA 4IL5A 3M7IA 4IIGA 4KUHA 5BSKA 1E4VA 2IYPA 3V00A 3VISA 3O47A 1EFKA 1PJ2A 2GRUA 4A10A 2QMOA 3LU1A 1AV7A 1I7NA 4C1NA 4WINA 3IT0A 4MB2A 3OT5A 1JDTA 1XC7A 2RKBA 4G24A 2IYUA 1KSHA 3VKFA 2VHJA 2Y71A 1A5TA 3H17A 2O8EA 1QGZA 3WISA 2DWPA 3DNMA 4QNNA 5DGCA 4BCCA 2MJLA 3U7EB 1R0YA 4E31A 5A4FS 4AQ7A 3TLKA 2ERYA 1C29B 3ECCA 2ORED 1UPXA 3C1TA 3E7PA 1N6OA 5BN5A 3B85A 1JKJB 2SKCA 4K26A 2XJ4A 2WI8A 4DLZA 1GDTA 5TARA 4PLYA 1E4YA 1YQUA 3ZXXA 2AJBA 3DBRA 4RTMA 2G1PA 3N2LA 5A04A 3SSNA 4R3WA 3RVRA 1E89A 1MZVA 2FSPA 2WTXA 1P4JA 2WICA 3QEAZ 3P0IA 3IR6A 1B6GA 1H3FA 2P1ZA 2VUUA 2W2MA 3KWFA 4NBLA 3QKUA 4MHOA 1EJ2A 1K7CA 3EYWA 3REQA 5BW8A 5K6RA 1QTQA 1RE1A 4DA4A 4QRIA 2ZUFA 1VL6A 3ITKA 4YS6A 4LMBA 5T3YA 3SHOA 4BVKA 3D8BA 1YRQA 3WHKA 1P45A 3A4VA 3AUYA 3MD9A 1ZD5A 2D2FA 1B16A 2VJMB 2BGKA 4ETMA 4UNQA 2WVJA 4BFUA 1HNZB 1DAOA 4IWXA 3PFHA 4CI9A 3IUSA 1KZ9A 5B2FA 2FSVA 3WB0A 2EP8A 4DIKA 1T43A 3TNJA 4ER0A 2XH8A 4MIEA 3IAM1 3OWOA 2O2HA 4F6CA 2PMBA 4QBIA 4ZCIA 3WNBA 3PWSA 2FFBA 3QUBA 1XZMA 1QIGA 1J0DA 1WPGA 2EJVA 1KO8A 2ZBQA 3K05A 4OK6A 1E18A 2FF7A 3N28A 5E4FA 4X7PA 1VJCA 1XMXA 4ROTA 4WZBA 1IM5A 3ROZA 3KLOA 3KRTA 3ZN2A 3DZ8A 2IKSA 2ORWA 2ZTSA 2P9HA 3QE2A 4L8WB 5JNVA 1YULA 1K3FA 3B2EA 3AHJA 4B4OA 5KS2A 4AP9A 4KK3A 4WRRA 2D1QA 4D3XA 1YZUA 2XUHA 3N0RA 3AO0B 4MV7A 5KDOA 4Z3DA 3AP3A 3L8CA 4OXKA 1OC4A 1I4DD 1SUPA 3NOOA 5FPTA 5J63A 2NUTA 1NX6A 1R4MB 1XLWA 1ZHFA 2CXSA 3IMEA 3N2EA 3NONA 5K8LA 4INPA 5LKRA 2C00A 1YB5A 4HI0E 4AK9A 1W6RA 4B3CA 2W2QA 4OJKA 4RH1A 4QPNA 4WZBE 4JJZA 5G40A 3KZOA 2E9SA 2ORVA 1EDZA 4Z7QB 1S8AA 2ZI6A 1QQBA 1J2RA 3SX4A 4G1EB 1YDHA 4D0RA 1WULS 2EFDB 3DD5A 4DBLC 1Y4DE 4J9VA 5KPJA 2N1BA 4KPGA 4CTNA 4PZZA 4HNAB 4RZSA 4UMFA 3T7JA 3BRSA 4U7FA 1IN7A 2OG1A 4O2AA 4TQ9A 5GPBA 5AKKA 2G1UA 2NO1A 3AHFA 3TRKA 2VZ8A 3LRPA 3R3HA 1JYSA 5DXFA 5ERXA 3CA8A 2ZB7A 1RXSA 3PX2A 3URKA 3R7AA 1TYCA 2VCYA 1LBSA 2QW1A 1CV2A 3PFFA 1DKRA 3FNBA 4I5IA 2ZUSA 4WLUA 2IWHA 2FFHA 2VDUE 4NEGA 4ZT5A 5JSZA 4M6WB 3ZPXA 4JVSB 3SS9X 2P30A 1KC1A 3PLNA 4TWAA 2VDMB 1FC0A 1KEEB 2DQZA 4BMYA 3K6KA 5HDQA 4BTLA 5A0TA 1ZQ9A 4BB0A 1KVSA 5HBRA 2QN8A 1N4AA 1JDPA 1ZCBA 4BNLA 2ADOA 2WNSA 3C3CA 2J7PD 3E3LA 4FILA 3HY4A 3SLGA 4E12A 4R1LA 3DG9A 1H1LB 5IKOA 1F3OA 2QM8A 4JI3B 1H4QA 2RGRA 3K32A 1R27A 1H6AA 2WZCA 1IHOA 1SU4A 4K3UA 4LV6A 4KSBA 1NHGA 2ZT6A 2Q6KA 1D1QA 1KYTA 3BS4A 4QPCA 1KQPA 5DHTA 2QMUA 4YUYA 3PRKE 1GNPA 1FNDA 3D7NA 2HU7A 3NHBA 4XR9A 3NTRA 5KHOC 5L9AA 5J4YA 1KO5A 5AOBA 4TKVA 3U4CA 1G6Q1 3UICA 3W3AD 2QLLA 4TMYA 1BRMA 3R0XA 4LJ6A 4MB0A 5FBWB 2VTVA 1YTUA 2EEPA 4QYSA 4M60A 1ZUD1 1RLOA 4HT3B 3HRIA 1IY0A 2SICE 3N0VA 4RHXA 2XXAA 5ITWA 1IBKB 3G79A 4F5WA 1M0TA 3UMGA 2FUEA 1PJRA 2CLMB 2LWIA 2PHZA 4J0HA 3ZJ5A 4YASA 4YX9A 5KYKA 5FLXA 1XZPA 3ZVMA 2XZPA 3VKVA 5DOZA 4P4NA 3TUJC 5LQDA 4OXXA 1FFEA 4C4YA 1YQGA 2MTBA 1V1JA 2Z8YM 4OUDA 1GM5A 1JDVA 4HDAA 5HM6A 2J4CA 1GQQA 3L7DA 3MPOA 3R3YA 4ZVSA 3LTNC 2GJ8A 1I51A 3R5SA 4ZQIA 5E1BA 1X14A 3LX8A 1T0PA 3QHPA 4Q3EA 1ABEA 1H1DA 2ZE7A 4HEA6 4KN8A 2YV4A 1SK9A 1JWAB 3LG2A 4KE9A 3EZYA 3LS2A 1ZMTA 2ICAA 4CM9A 5LLTA 4PZDA 3PL5A 1J56A 3NUGA 4CTOA 2H4ZA 1JEEA 1X9HA 4DSZA 3K8YA 4A0GA 1Z22A 4O4HF 5TQ0A 1W5EA 2NNWB 3EOBI 4M9QA 1ZG3A 3MWEB 4KLCA 2IVZA 2VDWA 4FX5A 3DMDA 2AG5A 3UV7A 1V7QA 4F9TA 1KH3A 2BGJA 5L4NA 3L5KA 1W2HA 3DW1X 2OUIA 4J0IA 1LBIA 1CE8B 1IPFA 1EB8A 4G4JA 1IXRC 1MO2A 1JIUA 1NF8A 3I6MA 3KEMA 1AIPA 3P9IA 3ONEA 2VVTA 4R1SA 4YJFB 3EC7A 5K4AA 3NHWA 3HWWA 5DBFA 3RAPR 3PRYA 2QX8A 4M0MA 1SNYA 1HFWA 1TO2E 1UBTS 3V8VA 1H22A 2I4OA 5KIAA 2G04A 3ILHA 4O3FA 4AM8A 5CLIA 1WBDA 3DO5A 4OL0A 2H4YA 4R83A 4WKGA 3A2MA 4M9XA 4AF6A 1RLUA 3IP5A 1E60A 4F96A 1MJGM 5JXGA 3E05A 3ZIUA 4MAMA 1UIRA 2D5BA 3JZDA 3H5NA 2IK8A 4G5YA 4J76A 1E1KA 4LJRA 2RAPA 4O33A 4PO8A 4JI0B 3GD5A 4EGSA 2XUGA 3B1WA 3Q8KA 4MVJA 1KDTA 3X1DA 2PZJA 3EOZA 3ETDA 3LT5A 2HL6A 4QDUA 1YOVB 4KRXA 5FI0B 3VU3A 2DGDA 4DQXA 3CUEF 3JWGA 3PK0A 2WTAA 1U2GC 4GE0A 3TAHA 3SLRA 5P21A 3TJMA 3W6UA 3W8NA 4DLXA 4ZK6A 1CWUA 3RQIA 3KYCB 2CFSA 2JK1A 2VOJA 4E2WA 2V8BA 1BQEA 1K4MA 1O5OA 1T4DA 3HNPA 1NMYA 4BFWA 1VGVA 1XAJA 3SYNA 3U3DA 1ORVA 5HHTA 4YV0A 5BUSA 1HDYA 4MVJE 3TL2A 1RM4A 2IU4A 3TCNA 1E9EA 1DNPA 1PFYA 2HF9A 2SNIE 3HJUA 4V24A 4BN4A 5JWRA 4D1YA 1JT9A 4LVCA 5E8JA 2QD3A 3L7AA 1SVWA 3G8AA 3VKUA 3A58B 4OJNA 1E2IA 3SXJA 4YJ2B 3RS3A 2I78A 1B76A 2QRZA 1UPAA 4P92A 3FUWA 4WLFA 5CDUA 5IKPA 4B7XA 3K6JA 4G8BA 1DAKA 2UVPA 4KRYA 3GJ8A 4JQZA 4LQDA 4C7VA 4O0LA 3GU3A 3GDFA 1SC6A 4RDCA 4HNTA 2C4HA 1M5RA 3VSBA 2FN3A 3RVNA 2JGMA 4C4PA 1V39A 1Z15A 3NBFA 1E64A 5A71A 1PFUA 3GT0A 1AKYA 2Y8EA 1LDEA 2QOEA 3V1TC 1Q1GA 3ZX4A 1CQWA 5K3OA 1Z0FA 4FDVA 2WG2A 2V1XA 3FYUB 1DRKA 1RD4A 2R1TB 4UVGA 1LNSA 5EHGA 4EA6A 3JQAA 1RYEA 3H9QA 2JGKA 1M76A 3BILA 3LUJA 1JR4A 1QSGA 1FMCA 3ETCA 1GOTA 1H2AS 3JRNA 3AV0B 2RJNA 4B3SB 5CFZA 3ZDAA 4N7RA 4JELA 5AM3A 3UENA 1G0NA 3VX4A 1U2PA 3CPSA 4UTNA 2B94A 1U28C 4DA8A 1EUYA 1U1CA 2RJOA 1E9FA 2W6OA 2YOFA 1Q92A 4MQFA 3E22B 4I4NA 3O2JA 2O52A 1V5GA 3N59A 4E22A 1BS9A 1EK0A 4BNWA 5DBEX 1VSVA 4O08A 4BNGA 1JHOA 5IM5A 5K0NA 2BDTA 2ZRJA 2VRWA 3KPYA 4TZKA 3T3MB 1SUIA 1I4LD 4CR6A 3NHZA 1AT1A 3PFGA 2QS9A 1LPSA 4GPD1 4MICA 2P41A 3GT7A 5HFNA 3SP1A 3RYIA 2Z09A 2Q0SA 4FFRA 3EGEA 3K8OE 4FSXA 4N7JA 4ZZ2A 3T5DA 3K1JA 1NXQA 6ADHA 4C6RA 1F6WA 2QV0A 3KZVA 1PDOA 4ASUD 4DVJA 1YUNA 3G59A 3ZHZA 4IMRA 3MJFA 4PM4A 5IVHA 2AUMA 3PXDA 1AURA 1K9VF 4PZEA 2BH9A 4B3MB 1XCOA 2ZFUA 4PLVA 2D0DA 5I9SA 4GPEA 4D02A 5KSZA 2EG5A 4NKRA 2UVQA 3CWCA 2YINC 4J16A 3V4OA 4EUHA 1FYWA 2WHXA 4F9FA 5BP7A 4TT3A 1N7JA 4ENUA 2H1IA 4EG0A 2IYOA 4DDWA 3CVWA 1WOYA 1Z6PA 4CQLA 2IPOA 4I4CA 2Z4RA 1LC0A 4H1HA 1V3UA 3U4AA 4HUQA 2J08A 4MKGA 4WN9A 3E3AA 3TJZA 1ORTA 1C8KA 3ASVA 1HEIA 3IMGA 5TIIA 4PU0A 4B6PA 4NP6A 3Q72A 4B46A 3PUXA 4JC5A 3D2BA 4GR4A 1TYZA 2P4QA 3EFEA 1J00A 2QZSA 2WT9A 4G8CA 2HWUA 4LVNA 1IAQA 4IV8A 4TLBA 3WK5A 3UW1A 2O8NA 4CMHA 1FW6A 1YDEA 3BE4A 4UTOA 4EEZA 4CCWA 4GMGA 1REQB 3KZMA 1J0EA 3OE7A 1GSIA 3TIGA 2BR5A 3GD7A 4RADA 2IX3A 4CXMA 1AUXA 5B7QA 1WZIA 2UYCA 1Q7BA 2QTCA 2DUWA 4D9EA 4QGBA 3EUEA 2DFLA 1OXSC 4OK3A 4I2VA 3GRRA 3JVVA 3USZA 2VAMA 3R3VA 1N3LA 1VXOA 1ZXBA 2B5VA 4HDNA 2J6IA 1FJXA 4ZOEA 4E6EA 5GIPE 2ACVA 3ZYCA 1EKXA 2VDOB 4ZT6A 4YCSA 2PIAA 2P9GA 1QLWA 1Q21A 5DBGA 1KMNA 4LQCA 3T9AA 4S1PA 3NHUA 4CCYA 1VJ0A 2XF2A 1CDEA 2XB9A 1HY3A 4FGUA 1ZCZA 1JEYA 3L04A 2VSOA 3PZBA 3AVXA 4EYSA 2WD7B 4O4JA 5FL7A 4KZPA 3ZVRA 1ZW1A 3NQ41 3RC7A 4DKJA 3AK4A 3BYZA 2PX4A 2N3ZA 2OOKA 3R3WA 1GCOA 1QYCA 3OPYA 4CMIB 2JDID 3MOIA 2JGJA 3SAJA 4DIDA 4KWIA 3QBJA 1ESCA 1UMKA 2I6GA 4LAFA 4EPXA 4WZ6A 4BKPA 1DG9A 1JU3A 2PEZA 3ENZA 1UC4B 2WFMA 1LV8A 5G3YA 2R6FA 2DFDA 3V4FA 4W5RA 2PPVA 2QTNA 2VT7A 3GPDG 2VTEA 3NIGB 2PXXA 4IIJB 1Q1EA 4V0KA 5GIOE 2VHYA 2YBEA 2BZGA 2ZSUA 1CSEE 4UUMA 3AB8A 3OQIA 1Y5NA 1T2FA 4W9NC 3A05A 3VJLA 5IABA 4O29A 3D8HA 3DLAA 4TS9A 3C3BA 1EFDN 4JFAA 4L0DA 5EJMA 2R7NA 2IJGX 3GOQA 5JDIA 1KK3A 3HYCA 5DDIP 4QTYA 2B2NA 1JLLA 4ZU3A 3UJAA 1TCAA 3C5VA 2BJVA 1RI4A 4PAWA 4HDMB 1FVHA 5K6TA 4A23A 2X2OA 1JFFB 2VBFA 3ANTA 3KUKA 3PCXA 4BE4A 2Q6OA 2XTNA 3TE7A 1S4MA 1X7WB 1C30B 3D6MA 3LFHA 4I2NA 1C1XB 1HKHA 3V3KA 3HRKA 4S3MA 1ZO8A 3BPSA 4XPIB 5DCLA 5CPFA 3U13A 2F8TA 1N0WA 1Z2PX 2J3IA 1CJSA 1B0AA 3IAUA 4IAOA 3SPXA 4NFYA 4TLEA 2G0TA 1UBJS 1UK9A 1YGPA 3B2NA 5LNK6 4J7AA 4E2XA 3F7TA 4XOIA 1PIWA 1PT6A 4TYPA 1RW4A 1U5BA 3IP9A 3ELUA 4REQB 3UK1A 4P36A 3A3KA 1PFVA 1YONA 2QYOA 1GG8A 3AYZB 3H5LA 4GLJA 4XYEA 1ZCJA 3AUUA 1OV6A 2FKAA 3SIXA 3FUUA 4EO9A 5H9WA 2A2ZA 3JQ8B 2QSZA 4LSWA 4B73A 1GPLA 1ESEA 4P31A 5L4LA 1KQFA 3WYDA 3K5WA 3HFJA 1RQ2A 4XVRA 1EWVA 3E9MA 3IAM6 3M83A 1ZOIA 2CE2X 1W6UA 4KB5A 4B8WA 3PEWA 1I13A 3BK2A 4KJXA 1BJKA 3IHWA 5EXPA 3RFUA 1OBOA 2Q6TA 5JJIA 2QM7A 4DV6B 2HO4A 4QUIA 1P39A 4BLUA 2Y1GA 4RANA 4L4RA 4TLCA 5JCJA 1NY6A 4KI0A 4KG7A 1P6QA 4WGGA 3DHVA 4ZKDA 4M0LA 1G1MA 4F06A 3NNDA 4U63A 5KNDD 1ZOSA 1D5CA 1VXRA 3GFOA 3QXHA 3FYCA 2PUHA 5KOHA 1Y5RA 2G77B 1VRCA 2M1XA 2HJ9A 3DZGA 4KEAA 2C42A 2Q46A 3EDOA 4N4AA 1NBMA 1X7HA 5EIOA 2ETVA 3WL7A 2H00A 4NJMA 4Q4HA 5JS6A 4G0PA 7MHTA 2ODAA 3NATA 2BI7A 4RPCA 3ANNA 4TQAA 4CLDA 2EYQA 4PANA 1KP9A 2X9NA 2QY9A 5JI3E 2NP7A 2AMYA 2FFJA 1S2NA 3IC5A 1RMYA 1VB5A 3GPBA 3IT1A 4RIEA 4BV3A 4AN4A 3E8MA 2MSKA 1EEXB 4D4LA 2POQX 5AKLA 1TQ6A 3O92A 2BEVA 4UUQA 1RHQA 5JD3A 3SYTA 2XWBF 3ZCUA 3N2KB 4LXTA 1DCKA 3I61A 2HA3A 5IZCC 2ZYUX 4OM8A 4KQXA 4QDKA 2B21A 5I51A 1N8NA 1R12A 2ZCUA 1NBME 2CFOA 3NWJA 4FC6A 1KFEB 1W5SA 2PZKA 3EQ8A 4KO3S 1UKBA 4FDAA 1PG2A 4AF8A 3IAHA 2X9LA 4D9MA 1E4EB 2GLXA 1JIJA 4E0BA 5BQ3A 5HW0A 3DMTA 3OTWA 3CUUA 1RJWA 4E2FA 4MXDA 1O2DA 1TD1A 5JXIA 4BO2A 2P7HA 1GLNA 2PV0A 3I34X 4OQDA 2AK2A 3WBFA 3H86A 1S3SA 1IHYA 4Q3BA 1OX6A 2NSYA 3PUZA 1OT3A 3UJHA 2BMAA 4DAOA 1G20E 3D7LA 3RTEA 1E61A 1F20A 1Y5MA 3GQBB 2DHQA 1ZNYA 5FOVA 1XU4A 1YB2A 1BE6A 3VH2A 4GHWA 3OESA 3F7MA 3JATB 5KTKA 2HBQA 1NULA 3N8GA 4NOLA 4LY9A 4LHZA 3UA4A 4TWJA 5U4XA 1N1EA 3TE6A 4YQFA 3NYIA 4QFMA 1ZK3A 4EG8A 5HZKA 4MQBA 4QXMA 4KH0A 1UFOA 1X1BA 2IOYA 5FFMA 3ZR4B 4DB4A 4A36A 4JV5B 3RC8A 2QORA 1V5EA 3JWHA 5EZQA 3FH0A 1VA5A 4C0JA 3OMLA 4LF9B 3PDIA 1HF3A 3N2GB 4UU7A 5KTOA 2AE1A 2OC9A 3JZIA 2O4UX 2QL9A 4ZVNA 3R7NA 4E5YA 3LXMA 1XVTA 4BVEA 1JZQA 2VT6A 3WWPA 5ILGA 4XJTA 5JLAA 4KUGA 5K3FB 4B84A 4YT8A 2VRCD 3PHLA 5J1SB 3RC1A 1A5ZA 2H9YA 1PVDA 3EDMA 4TYMA 3PE3A 3GUUA 1G1AA 3KWJA 5GONF 5G41A 1PZFA 3LUBA 1UJBA 5F9FA 5B7NA 4J43A 1HZZC 1BS2A 2QLBA 1DAEA 3R5FA 4BVAA 3DKRA 1KS2A 1U0TA 2I22A 3CO5A 1BVYF 1W0KA 2HQRA 4FXOA 4OP3A 4DV7B 2ZXUA 3A6JA 4LHVA 1JDBC 4D99A 4ZAFA 3AF6A