2HBQA

Crystal structure of wildtype human caspase-1 in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hbqA00
3R6GA 5LUBA 3PD0A 3DEIA 2AR9A 4NBNA 1I3OA 4HQRA 4QUJA 1SC4A 2H4WA 4ZVRA 4EHDA 3GJRA 4JQYA 2XYHA 5IAEA 3V3KA 5JFTA 2C2ZA 2Y0BA 1K88A 2QLJA 1JXQA 3V55A 2H5JA 2C2MA 4N7JA 3PCXA 1SC3A 2H4YA 2CDRA 1KMCA 4EHKA 4DCJA 3NKFA 4NOLA 4QUDA 4AW9A 1NMEA 3H11B 5IAJA 5IBRA 5IAGA 1IBCA 4JB8A 4QU5A 5H0IA 4JJEA 4FXOA 5IASA 2CNKA 3R5JA 3KJQA 2K7ZA 3R7NA 1RHKA 3RJMA 4PRYA 4N6GA 3GJQA 2FP3A 1NW9B 3R6LA 4JR1A 4EHHA 1K86A 3D6FA 2HBRA 1F9EA 3H11A 4N6OA 3IBFA 3PD1A 1RWNA 2CNOA 2H65A 3S8EA 4QUGA 1SC1A 4NOKA 5LU9A 4ZVQA 4IYRA 4EHFA 3R7SA 2DKOA 2NN3C 2Y1LA 2J30A 4FDLA 1RWWA 3UO8B 1QDUA 3UOAB 2QLFA 5IBCA 4I1PA 3DEKA 1NMSA 5IANA 2XZDA 4QTXA 5IBPA 1RHRA 5LU8A 3IBCA 4EJFA 4EHAA 1I4EB 3E4CA 3D6HA 3DEJA 4NBKA 4LSZA 4PS1A 3V4LA 1RWXA 2CNLA 4QU9A 4QTYA 1RHMA 3S70A 4D3YA 4N7MA 1QTNA 4FEAA 1RWPA 1RE1A 4D3XA 2C2KA 4JR2A 4ZVOA 3DEHA 4DCPA 4N6NA 3H13A 3BIJA 2H54A 3QNWA 4DCOA 3V4OA 1M72A 1SHJA 2CJYA 4QUHA 4ZVPA 2HBQA 3R7BA 3NS7A 2WDPA 3V6MA 2P2CA 3P45A 1CP3A 4JJ7A 4QU0A 3SIRA 3EDRA 3OD5A 5IAKA 2XYPA 5IC4A 4I1RA 4IEFB 4HVAA 2H51A 1RWMA 3ITNA 2H5IA 1GQFA 2J33A 1RWKA 2C2OA 3K7EA 4PS0A 1CVRA 2H48A 2J32A 4QULA 5I9TA 1ICEA 4EHNA 2XZTA 5I9BA 1I51A 1PYOA 2J31A 3EDQA 4AWAA 2HBZA 1GFWA 4NOMA 2FUNB 3D6MA 4QUIA 2HBYA 4AWBA 2QL5A 5IARA 4JR0A 1NMQA 3KJNA 4QUAA 5IC6A 4ZVSA 5K20A 2CNNA 1PAUA 3GJSA 2QL7A 4PRZA 4D3ZA 3R5KA 1RWOA 4QUBA 4M9RA 1I4OA 2XYGA 1RWVA 4QU8A 3KJFA 4FGUA 4EHLA 5LUAA 4QUEA 1RHUA 1BMQA 3H1PA 3V6LA 1SHLA 2QLBA 1QX3A 3NR2A 4ZVUA 2FQQA 2QL9A 4JJ8A 3SIPA 4N5DA 1F1JA 3P4UA 4ZVTA 3H0EA 4HQ0A 4NBLA 2CJXA 3GJTA 1RHJA 2C1EA 1RHQA 4JQZA 4NOJA 5IABA
chains in the Genus database with same CATH superfamily
5H80A 4W8HA 4YS6A 2P4SA 4ID9A 2PFSA 1DKPA 3QXXA 3TF5A 4KQFA 3SLGA 2HQSA 1GFSA 2WK1A 3O9VA 1G5TA 2DUJA 3FCAA 2GCIA 2G1UA 2IHKA 2AVDA 1S1CA 2E4AA 3BWVA 3DE0X 1CNMA 3EC1A 3HVKA 2H5JA 4GXQA 10MHA 2EWVA 4L6AA 4WLUA 4MW5A 3WRXC 2VWGA 5SY4A 4EZBA 5HWSA 3NEJA 1RLUA 2ZRJA 5K2MA 2H52A 4Y1EA 1EX6A 4D9BA 5KOIA 2H8KA 2RKBA 3LLCA 4JB8A 4A2CA 4EJSB 4PZUA 4Q4AA 1WCIA 2GT1A 3RC7A 2JIQA 2YVAA 1E4YA 2GETA 2ZXFA 4FD2A 3OFKA 4RKFA 1ZIOA 3C5CA 4KIWA 3OO0A 2VG8A 1WO8A 3BWCA 2JA1A 3RC3A 2CLKB 2BEWB 4K9RA 3D3WB 5G4KA 3RC1A 8ABPA 1XCPA 3NHYA 4TLLB 4NV3A 4E5KA 4EEXA 4OKSA 1F9EA 1O9GA 3RLFA 3OSUA 3T5AA 3ZWYA 2G6TA 4U39A 2O5CA 1E3MA 1U8EA 5AVQA 1BVRA 4ZHQB 1M6VB 2XJ9A 4TSFD 1EK5A 4X0EA 1CR1A 1DFHA 5A71A 2XUPA 2IWRA 4ERXA 4QVIA 1TK3A 3FTFA 2JZOA 3JALB 4IVRA 4BZQA 1KMMA 2OLKA 4C0SA 3A4IA 2AKYA 4BMNA 1REQB 3SZUA 3AM4A 3DV2A 2YKGA 2P2NA 5FPKA 1XMIA 1Y8QB 1X80B 3O3OB 3UC5A 1UZLA 4HF7A 2BJVA 5AHKA 1ECFA 4WUTA 1SBNE 3AOEA 4RL4A 1BWPA 1FNSA 2PXAA 2GAAA 3GRVA 4IIHA 4MR7A 4G5YA 2VFAA 3O73A 5E9AA 2XIQA 4IV0A 4MB0A 4U7TB 3T3DA 4A23A 3D6JA 4WY8A 1XHEA 4KIFA 4UM8B 3MHTA 3EDCA 5SZIA 3SC2B 3WLJA 3FHLA 1KEZA 2BMAA 4HDNA 3HM9A 2IQIA 2HI0A 3KLBA 4C78A 2Y71A 1DFGA 3KTAB 5I6DA 3D8NA 2XUOA 3DMRA 2RE8A 1J97A 1UKYA 1Z5GA 2ZWIA 4OYHA 4QTUB 1I94B 3GH3A 2JH3A 2QRZA 3HB5X 1K6MA 2W2MA 3NB0A 4AZWA 3Q7TA 4WOBA 4GT1A 3AEZA 5EWLB 1A2QA 4FUTA 3R6DA 2OLEA 2CCJA 1HLFA 4H7JA 1V8DA 2I9PA 4R2WA 5K9ZA 4I4TA 1O0CA 3K8ZA 4OGFA 1VZ2A 4OHPA 4M46A 1HZJA 4DAOA 3AIMA 4ARVA 5CITA 5K4AA 3ICCA 5BUCA 1A3CA 4E08A 3HJHA 3BK1A 3DXYA 2Z2ZA 2R97A 1UJ5A 2NX2A 1TTHA 4QPPA 2AWOA 5CA0F 3BDAA 1ABFA 2BKEA 3SQMA 4KLNA 1ZBQA 1KNQA 2Z04A 3N8DA 3RVQA 3K0KA 4QUBA 1YCFA 4L57A 2VAXA 2BTQA 4P0PB 4JLOA 1GKIA 1GN8A 4F7WA 1ID1A 2LZ0A 3QRWA 4JNCA 1WKBA 5REQB 1QE0A 4U9HS 1EUYA 2B1JA 2QIPA 3LDHA 4LRTB 2QTGA 4K8OA 2W93A 4O4LB 2Y1DA 3P96A 2GJSA 1W44A 1PX2A 3IAUA 4HN9A 2DTEA 5HK8A 5JJLA 1Z6GA 4PYIA 3RODA 5C7IO 4CM5A 2E4YA 2X76A 4EI2A 3VGPA 1S9DA 3WK8A 5AIAA 5B7GA 3NHLA 4HLDA 1GOTA 3HEAA 1F3LA 3CH5A 3MBIA 2ERXA 2FFRA 2IHYA 3A3OA 3CZCA 4L27A 2OM6A 3FNRA 4PGGA 5ALZA 1WBJB 2QLJA 3EB9A 1RRGA 3AU9A 4F9EA 4PNPA 2IQ5A 4V0ME 3ICVA 2V6MA 2FPGB 4ZZ3A 4PWYA 1RS0A 4EL0A 3RSHA 3IT1A 4WOJA 4EGSA 5JD5A 3VC7A 1YAJA 1X1TA 2CCKA 2ONCA 3K9WA 1PDOA 4M7WA 4PYLA 3DHNA 4NE9A 4GZMA 5CB4A 1RR6A 3TQIA 2XTNA 2NV2B 3OZXA 2N1MA 2N46A 1T0PA 2DR0A 5DDIP 4MKZA 1T6XA 1EK1A 1GYRA 3KOOA 4G65A 1LV8A 1U04A 3GUCA 4M7OA 1TF7A 4R7GA 2Q0XA 5IT4A 4UTNA 2H65A 3PJFA 4NOKA 2FZEA 3IQGX 3PNBA 3GJ4A 3KL2A 4M7PA 4QOEA 5G2OA 3SI7A 3U49A 5IM4A 1FS5A 2YFQA 3PI7A 4REOA 1YDFA 3MCTA 4RK4A 1V1MA 2X4GA 2FEKA 3F1LA 2P2ZA 1XRRA 1D2HA 1MB4A 4WFIA 5L4SA 5A2GA 1ECPA 1SHZA 1I5RA 4WNYA 1F6DA 5FJJA 4H6VA 1R27A 3LQ2A 3RUDA 5K8IA 1Q84A 3F6YA 4EPTA 1FSFA 4D0LB 2YQ4A 5CLIA 1PWYE 2YIJA 3DZJA 3KQSA 1OI4A 5KDLA 5GV8A 3BK2A 4ZJUA 4FLMA 1KRXA 1CQWA 1ORIA 5CVTA 3GELA 3Q9UA 3U0VA 5JJKA 3RYIA 3EW7A 2QRGA 4FP9A 1Z2DA 4HWTA 2RH9B 3RAPR 4B3DA 4D46A 4TZ0A 1L8LA 3B3JA 2Z8XA 2C0CA 3QNWA 3U61B 3ZWDA 4JKIA 2AJLI 4UCFA 1UPCA 2AEFA 4X92A 3C16C 4BJ1A 4TRNA 2FJ0A 1RYBA 2PRIA 1NR1A 4GLBA 4HEA1 4ZVPA 3U1VA 4B6SA 3I58A 1VA4A 2CLIB 4C0AC 1GZ6A 5IH3A 3MELA 3QPWA 5GJVC 1KDYA 4B3GA 1Z29A 2QOEA 1ZMBA 1CF2O 1DKOA 5K0GA 3LGSA 2XW6A 1VL5A 3U9SA 2JVJA 4Q1BA 1M8FA 5B1IA 3KETA 1F4VA 5FPHA 2Y6VA 1HA3A 1E7SA 2P4UA 3PDHA 3CKLA 3KJXA 4UEKA 2XUFA 5D5PA 2JJQA 2WP0A 4TWAA 4YIKA 1V48A 3TYXA 1TC2A 4OHKA 3RAEC 1DINA 1ZAKA 4H7HA 1R6UA 4J16A 3U1TA 2AKAB 1O0BA 3B52X 1U4NA 3BIWA 3K32A 3QEMB 4IJQA 2FVYA 3FI0A 3FNEA 2D54A 4WZAA 1NOKA 3QTBA 2BIFA 1GNTA 4ZREA 2VHYA 4AK9A 4R7ZA 3ZCVA 1MXHA 2IOFA 3R5SA 1XA3A 2V7TA 3P1JA 2Q3MA 3GEDA 3EPRA 4HNSA 4RKWA 2I2XB 2EKLA 3R8CA 3RVMA 4BZPA 5I7VA 5KMGB 4RD4A 2GD0A 2DTXA 3IPAA 4A8PA 5T41A 1G2OA 4LBYA 4B45A 1AKRA 4EQ6A 4GM1A 1L9XA 1E9SA 2R11A 3EFEA 4RJLA 3ASYA 3HPQA 5EHXA 2PH3A 3TX2A 2PKWA 1C7QA 1ULSA 3FMIA 5EZ6B 2GYYA 3B48A 1SOWA 3K3PA 3RVKA 2DFPA 1JJBA 1LK0A 2B1IA 3V97A 3C8MA 4DC9A 5IXJA 2Q50A 2XYQA 2GXUA 5JAPA 4LJLA 4MPRA 3EW9A 3BIXA 1P7PA 4M54A 4XTRA 1ZL2A 3PFHA 1M5UA 1UMCA 4RM3A 1TAHA 3TBHA 1GITA 1KYYA 3TI7A 5FV4A 5K0EA 3GLFA 3DKIA 1UKZA 3GPBA 3TSZA 2PUVA 3DMNA 1OI2A 3O2SB 2C95A 3K1JA 3FRJA 5EE3A 1Z0ZA 3K9CA 5A6SB 2AW5A 3ER6A 3WGOA 2XRYA 4U3JB 1W581 4JJKA 1C1YA 5IVKA 2VL7A 3EXIA 3VU8A 4RE6A 5EZYA 1PQ4A 4IQFA 1VE9A 3NUQA 5LA6F 4BJHB 4DWWA 2Y1LA 4XYGA 1QHHA 2Y67A 4DCUA 4LNUA 1IPHA 2Q1YA 3VSAA 5ERYA 5IANA 2DC1A 1WBBA 4RD6A 5G41A 1E7YA 3DJYA 2ZT7A 1KKMA 3MLEA 3NHPA 4Z7QB 2EV9A 4OBWA 4NBKA 3I5XA 4AO8A 2HDOA 3DMHA 1GUBA 2GBCA 1ZUHA 3DLIA 1T6YA 4NMWA 4KNVA 4J0IA 1T13A 1X9HA 5DO9A 3YASA 3AHJA 4L08A 5ALKA 5A02A 4ZVOA 3EWSA 2ROQA 3FHOA 4GYKA 1X6VA 3KQPA 2HJWA 2ZJ5A 3HZRA 1G55A 4Y18A 1VKHA 4P93A 5TQJA 3RGWS 3ADPA 3GRZA 2BFEB 2D1QA 2WG1A 1GRQA 4D0NA 4KGDA 2P2GA 2XH8A 3ZE1B 3VR4D 3CX4A 4H18A 3QEOA 3V7UA 1L5GB 5DNUA 3B5IA 5KYYA 4IFTA 1B3BA 5C32A 1JQDA 5M7EA 3I4LA 1I3NA 1VBFA 3AIIA 3P7MA 3DTYA 5DHQA 3TCKA 1ZH2A 4MLCA 1O6CA 4GPBA 4PG5A 2NAFA 3WYBA 5IN5A 4JI6B 1F6BA 1QS0B 1SQ0A 3FCEA 1KBQA 1TLTA 2NYUA 3HB0A 4MV1A 4KSBA 4TTJA 3UA4A 3DFKA 1I51A 4EG4A 3WL4A 1YJAA 2ETXA 4JUCA 4DLKA 3D6MA 5JD6A 5G0TA 4L78A 3DA8A 3LQKA 3STHA 3GLSA 3T9BA 2ZQYA 3H2GA 2QYHA 4QPJC 1EUDA 4JI7B 1T9KA 3SBEA 1TK9A 5KYXB 1ANKA 1Q0ZA 2NPOA 3DDHA 4DKXA 1ZVQA 2X8LA 1MGPA 1QQBA 3F46A 3NHMA 4LK2A 1EVQA 2ECOA 2XQGA 4GI5A 4YP0A 5C5CA 1KFEB 3AV0B 3OQJA 3DBRB 4S24A 2FUCA 3DMTA 4UQPA 5DMXA 3PHGA 1XZLA 6ADHA 1HYQA 1QTRA 3CZPA 2ZBPA 4BFSA 2BFNA 5IS2A 3TUIC 1X7YA 1YOVA 2VUUA 1YA6A 2QD1A 1JHDA 3DOEA 3KLNA 4TRMA 5ALLA 1GYPA 4GR4A 2F6RA 3FBTA 4FN4A 3U4GA 4AI6A 3PJGA 1KYXA 4O29A 3T15A 3VDNB 2IUTA 3PD0A 3TTYA 1H4SA 4YK7A 4BOYA 1I2MA 1L4HA 4HQRA 2YHSA 5KOJB 1NVDA 2FR8C 4PG6A 1KKLA 3L0IB 3DS8A 1DRWA 2X5XA 3NHUA 4RJ2A 1PP4A 4B3IA 4TMXA 3ZWOA 4WJZA 3OJFA 2O8EB 1MX9A 2NTNA 2PJDA 3HWSA 2J45A 2XBLA 5H9VA 2P7HA 2IHTA 2HMSA 2O8VA 3IKLA 3AX6A 3BWDD 3HCAA 4TKZA 1Z0AA 2IPLA 2NYRA 4CGZA 1FFBA 4KMRA 2WNSA 4AJ1A 3LIPA 1T2VA 3M3PA 2QJRA 3ZIDA 5K09A 2PR2A 1ODFA 1JEEA 4NBUA 3O8RA 5LBTA 3GNSA 3G8DA 2C9MA 3OWXA 4JVLA 3FJOA 1ULAA 1D4ZA 2XXAB 1WD7A 1TAUA 5C1PA 1UM9A 4YCBA 2NZYA 3RUHA 2A7XA 4LOHA 4GHWA 3U0BA 5HK9A 2Y4OA 1GPYA 4WK2B 2YJ4A 4LAFA 2D59A 3OZSA 4R40A 3BN3A 1NYRA 3HTXA 4ZD6A 1ND6A 1F0KA 2HSDA 2ACVA 3HJNA 1IB0A 3ZCSA 3O82A 4O08A 5L51A 1UT5A 1JDZA 3KD2A 1D4OA 5ALJA 2GRJA 1QH9A 3JRWA 3KQQA 1Q0QA 5JMOA 4DCNA 2WE7A 3ESAA 1B8UA 1KJNA 1JUDA 1P2GA 3CMMA 4HYTA 4PZ0A 4EYKA 3OLWA 1JU9A 3D6HA 3Q40A 1TPYA 4JL6A 4HHEA 2D00A 3QXHA 4KO1S 5FOXA 5G4LA 3ZLVA 1R4NB 1ZK0A 1V16A 4DLRA 4IIJF 4E4TA 1V2GA 3AEKB 4D9FA 2DRIA 2IYZA 3MLBA 5C8YB 2ZUTA 3QEJA 2IU0A 1BXGA 1LW7A 3OZTA 4L95C 4UUPA 1GEEA 1I0IA 5E6UA 5JY1A 1OLSB 1W1IA 2QYSA 4PWZA 2D0PB 5JSHA 3IXLA 2QZJA 3L0BA 2F90A 4Y2PA 5JMPA 3C74A 5BV1A 3HRKA 3D6NB 3LJKA 3VX4A 4ZQIA 5G0SA 3F96A 3W5VA 4XA8A 3EYWA 5HZHA 4C7VA 4C05A 2BE9A 2ZJBA 3P9RA 3SDSA 4FEEA 4WTOA 3HKDA 5TR9A 4B3CA 1Z7GA 2VTBA 1JHYA 1PS8A 4I36A 2QRVB 1TQ8A 3K0BA 1T1GA 2BFAA 3BMOB 4UUAA 4INJA 2I3DA 2HK6A 4I81A 1AHIA 1NYTA 2WZBA 4G4GA 4BFUA 4LG1A 5IYZB 3UV6A 2AN1A 1D6SA 1ZVKA 3O93A 4GX5A 4IHJF 2A92A 3ELDA 2B5VA 1Y8RA 4BNJA 2Q8QA 4CHTA 2OVBA 1WXHA 3ABQB 1P5FA 3TMAA 5HBGA 1LF0A 3VSCA 2HBYA 2FZWA 3TJRA 3ZCPA 1U8XX 3IE2A 1C7IA 1GZHB 3TVTA 4B87A 1COZA 2Z1NA 1PDWA 5J43A 4Q3AA 1JB9A 3F5DA 4URVR 2W6PA 4HPJB 4F38A 2HUNA 2Z58A 3HDVA 3RWOA 2O8DB 2PCJA 1M2WA 5AW1A 2IEDA 4MHTA 3O21A 1W25A 3WNDA 4CWAA 3PWTA 2OV3A 2XGSA 4HGZA 2C9DA 1R66A 2W22A 3HL0A 1F1JA 4DS3A 3D5TA 3E8MA 1DEOA 3IUPA 4L1KA 3QVSA 2HCRA 3UUGA 2WJWA 4QAJA 3ZWVA 1TM5E 5AVKA 1QH1A 5I4CA 4YHHB 2X3FA 2BCGY 1YZKA 3EZFA 4L4XA 3OF3A 4JN6B 3ITKA 4DY6A 5KNDD 3PDUA 3TG2A 4EPXA 1XLTC 2AE1A 4WKGA 1ONPA 2UZ1A 3KM0A 4C7OA 2G5PA 1M0WA 1XMJA 2NU9A 2Q6LA 1GADO 2QX8A 1URPA 3KZCA 4Y9UA 2I2CA 3SNHA 5AW6A 4KXVA 2GN6A 4AY3A 4UAUA 1JFLA 3B3GA 3CN7A 4KHZA 4PONA 3IAS1 1T4DA 3SDZA 4ILKA 5CT6A 4CIDA 1JPUA 3COPA 5KTOA 3N6VA 4KAJA 1J6UA 3PHBE 4OGWA 5D7NA 4FBMA 3ZCTA 1U99A 1WG8A 3KZOA 3V2UA 2N0SA 1ONBA 3EZ2A 5K45A 4NIMA 1C2YA 1LI4A 4PCVA 5IAAA 1PFKA 3DAOA 4ZQFA 3B85A 4EY3A 3IL2A 1K97A 3CB4A 5F1PA 5HKLA 2PV7A 1ADGA 2HMYB 5KBYA 4RTRA 1U3GA 2D5BA 3PPXA 2XT9A 2QG9A 3COYA 1IN7A 2EEZA 4UNRA 1GKKA 4ND7A 1EAYA 1L7DA 1FF9A 4OXXA 5CVDA 3H17A 1JLHA 3H6HA 4QREA 3RU9A 4IXWA 2IYUA 4EPRA 4G0YA 3L7MA 2C61A 2QW0X 2XNCA 2X58A 3ECCA 3M0EA 3M2PA 4J2HA 2P9HA 1WIWA 2EJVA 3TL3A 4YNBA 3RRJA 3PQ5A 5GY7A 3UCFA 4CBVA 3U31A 3DFMA 1P1BA 1DZ3A 1OW3B 1I6WA 3R09A 3EPHA 3WHKA 4F4IA 3RW9A 3OX3A 1V4NA 3TEFA 1M2VA 4NEQA 3F9IA 1BDMA 2QA5A 1JHXA 1J49A 1RJFA 4MW1A 5F5LA 4H7IA 1N0UA 4V0QA 3DYVA 3FBGA 5HF8A 4II7A 3FYCA 3PF9A 3SEQA 4Z4HA 3A6ZA 1E0JA 2HT6A 1HFKA 1KPHA 1EU1A 2MYNA 1PJ8A 3IB6A 1LTQA 4KUGA 4ARBA 4RTLA 1FFCA 1MOSA 2FFJA 2QD5A 1BXZA 3VR3A 1ONOA 1IG3A 4UXHA 2EKZA 3LT2A 5KX5A 3UWKA 3A6PC 4WLFA 5FWAA 4U0JA 1XQXA 1ESCA 4U8HA 3DXFA 3IUSA 1AKYA 3AQ4A 1ZA1A 3E7WA 2GHQA 3OX2A 3TKAA 2DT8A 5BMVF 1QDLB 4J91A 4JJ7A 2AGVA 2PFKA 2PO5A 5CNIA 2ODPA 4F2HA 4JXZA 2HO4A 2IEGA 3WBKA 3EFOA 3UT5B 1NG9A 4XUDA 3W7BA 1F2UA 1CUWA 3VPDA 3RM3A 2AHOA 3K7EA 2XZOA 2PX4A 2PZGA 3A0RB 1IBLB 5KVCA 3H5LA 1PR9A 1XXHE 2CL0X 4KR2A 4LTDA 1XIVA 4L15A 5G02A 2QQGA 3TMKA 3FA2A 3I52A 3QU2A 4EFNA 1KQFA 2EZ8A 4YDSA 2GM9A 5CG2A 5HOQA 2BEVB 1PUJA 2RH5A 1P18A 4NDNE 1EDEA 1WZNA 1CG6A 2X9GA 1HNXB 2TECE 5LLTA 2BEUA 1MJFA 3U7IA 1FX0A 1QCZA 1W76A 3A6LA 1BS2A 3H5NA 4HZUA 4C4YA 5HJEA 2CBZA 2WAYA 4QUEA 3SZRA 4CL0A 2JI7A 2PM8A 2H4ZA 4MYTA 4BRSA 1VL6A 1DQYA 1KQ3A 1Q2UA 2A9QA 3A2LA 1X8XA 3P8ZA 4IVPA 3E9DA 5U9CA 2BBSA 1G5HA 2A8YA 3NHAA 1DG3A 4R0MA 3ZOZA 4KQ1A 1F2VA 1MDBA 1OX4A 4DDWA 2J0SA 5EP3A 2F8LA 5AHWA 1TK2A 1NWHA 4W1QA 1LPMA 2FWMX 3K0SA 1V1JA 3FVRA 1O4VA 4DRYA 1KY4A 3I01M 2GBPA 2I5PO 4B3HA 2AUNA 1KO8A 4BN0A 2PKQP 2FPKA 1ECJA 4OTZA 3ZJ5A 4FHFA 2P9ZA 2NO5A 5EZQA 3COSA 3B5EA 621PA 1QF7A 1UDBA 5CFLA 2JGIA 3EGEA 1Z6PA 1Y7PA 5DX8A 5LCXA 5IH7A 3G5MA 3PFGA 3KE9A 5IM5A 1WX1A 1N4AA 4CF3A 1LSOA 4OIMA 2XRMA 3LNTA 5I7AA 1GIAA 2VJKA 3JPWA 3INYA 4V1CA 3EPLA 4AYXA 2WTEA 1LDMA 2JIRA 7AT1A 1JXMA 3LLSA 5HEKA 5T4HA 4A8JC 3ZDBA 1LJ8A 2ZFUA 5HM8A 3ZDCA 3VSBA 4I50B 5I4KA 4QXQA 4I46A 2R751 2LIPA 1K0FA 3FRIA 1DADA 2X0FA 1PJBA 1M1ZA 2QRNA 4P33A 5F1KA 4YP9A 4BMCA 1ZK1A 1O8CA 1X0VA 1AGRA 2B4AA 5JATA 1M2OB 5I45A 3ZJYA 4TMVA 4ZCTA 3W6NA 4OQZA 2JAPA 1RJ9A 2NO6A 4UPVA 3C3KA 3H9BA 4NC9A 1UFRA 4LBWA 5AHRA 2FB9A 2JEYA 3OJOA 1D0VA 3E5MA 3RFXA 3A14A 2HF9A 2ZRQA 5AHXA 5BN3A 5LQAA 2JCYA 1UUFA 1AQUA 3DV0A 1X7ZA 1KGDA 4ZGBA 2XTZA 4F1WA 3G0GA 1CKEA 3KG2A 5CVJA 4EG5A 1T0BA 4CV2A 3OF2A 1P3Y1 2VAMA 3JRNA 3NAQA 3OOYA 1HDEA 2MWMA 3FFXA 3QLJA 4D41A 3HK2A 2YN2A 1VKNA 5DN6D 1FQWA 3MT7A 5KHOC 2W0MA 3ELUA 3WOHA 2GQ0A 5AD1A 3BS4A 2JRLA 1T3ZA 2IXDA 1D1PA 3EF0A 3F5QA 3CNLA 3O7MA 3UJ3X 1KI6A 3TLYA 3FSGD 3D4OA 4QTZA 5HZGA 2GRUA 1NN0A 2J41A 4KKVA 4FC7A 3GFPA 3MD0A 4CFZA 3KWJA 5CYFA 3EAGA 3OOSA 2IDKA 3VQTA 4RZSA 1KAEA 1P4AA 1J9GA 3ORSA 2QV7A 4C6TB 2EHDA 1YVRA 1JFTA 5FUVA 1ZO8A 2YWEA 3G0BA 5TMEA 4QFMA 4BC0A 4P3XA 4CM6A 3WA6A 1S2NA 3DEYX 4RULA 1JPVA 4L9RA 1P9NA 4M99A 1DIAA 4I1RA 2ZUEA 2FZ4A 1DTSA 1HTBA 1SU4A 3H2JA 3CF4A 1E3SA 1V8OA 5AI0A 4EZIA 3FZEA 1JQKA 4GW3A 4E94A 5BWNA 3ET5A 4X20A 4UJ5A 4WIAA 4YV7A 5A3JA 3ZE2B 4DCSA 5LJIA 3Q41A 4V03A 3WFIA 2VNJA 3LKBA 1BEUB 2W90A 1UDAA 2J31A 2R87A 1HETA 5DBHX 3I9OA 2FVXA 2OGSA 1E2LA 1OLUA 2C8KA 3T35A 1B41A 2WPDA 4GZ6A 5IARA 1V5EA 4C30A 2IS2A 2IEBA 1TD1A 4PZEA 3CEJA 1XCGB 2JCSA 3KAQA 3BRCA 1RRCA 2Q62A 2D1TA 3MIZA 4Z9XA 1PW5A 2C8LA 3KOXA 2D7DA 2EIXA 1Z75A 2G77B 1KP9A 1YKSA 3LPLA 4WJKB 4EHLA 2C00A 2JIZD 2BFCB 1ZUNA 3E5RA 4UDOA 2OK7A 4PLFA 5EJ6A 1C41A 1U6IA 2IF0A 4US2R 4X63A 4Q4LA 1OFTA 2XV1A 4PYJA 3M6VA 1BGWA 5J2UF 2J3IA 3MUOA 3CLTC 4JC5A 2NWQA 2YRFA 3T9EA 4YBRA 2JHPA 3RH0A 4ZCLA 2HMTA 2ZEJA 4E5PA 3DHYA 3DGEC 3I53A 3BFPA 3OQIA 3M3HA 1T9AA 2J7KA 2PMKA 1UOPA 3L92A 2CFOA 4JSRA 3SJBA 2I6UA 4F5EA 2UZ3A 1FMLA 3SHTA 2C94A 1PV4A 4JC4A 2GK6A 3WXBA 1QZZA 1UC8A 1BIFA 2H1CA 3OPYB 3ZX4A 4AJPA 4DANA 1QRDA 2QVCA 1UXJA 4NAVA 4PBSA 1U90A 1PT8A 4C5CA 2VHEA 5IJXA 1A97A 2EIHA 3AFNA 4M0UA 1Q0RA 5COBA 3CCCA 1HM5A 1SCIA 5BUSA 1RBYA 3F4LA 3OZEA 4K6FA 1PWHA 1PR0A 2RKOA 4IXDA 4BMOB 3WL6A 5FPQA 1YUNA 2C7GA 5DLDA 4B80A 3VPHA 3DBVO 4HDSB 1VG0B 2JHGA 1ZUD1 3I9V1 1K86A 4L5CA 1KE2A 1QHGA 2QYOA 2XQVA 3DF7A 4TS9A 1YR9A 1VIAA 4IJUA 4BCCA 2BSAA 2B6NA 2JCBA 1JYSA 4NJMB 3WNVA 3AGQA 3KCNA 2ZZMA 1U98A 2Q5OA 4RKEA 2K7FA 1W6RA 2IOYA 4XX0B 3EN0A 1ULZA 1GAXA 3KEQA 2X4LA 4JK3A 4EWLA 4QDOA 3X1YA 1PG2A 5CFQA 3TDMA 4L2IA 4PQGA 4E33A 1C1HA 1DOAA 1JVNA 3EIXA 3HJGA 4PPQA 2NQ2C 3UWPA 1IQPA 4UPEA 4OU5A 1EE9A 3BREA 4F3YA 3S70A 2EX0A 1IEXA 5KCMA 5K0ZA 3L7YA 1NE7A 3NWPA 4B43A 2H4FA 2RIPA 5D3KA 3AQIA 3O8BA 5BQ3A 3IQEA 1RAEA 4IUDS 5EMLA 4CV3A 5BQXA 2GZAA 4RUKA 4KXNA 1A8UA 1CE8B 1DCTA 4KSYA 1MAHA 1VKOA 1Z12A 3QLUA 4NCXA 2HBQA 3BTSA 3ADOA 5BOSA 4DWOA 4YONB 2O7QA 4HAVA 3SMVA 2IBSA 2ILVA 3SJUA 3DT6A 3LOQA 1B1CA 1L4LA 1X14A 4UVDA 3HUDA 1O9HA 4NH4A 5AKZA 3TI9A 1RQ7A 2VHQA 1G5PA 2AEMA 2D5LA 1XEXB 4YJ3F 3GJ8A 2CMKA 1GR1A 3QELA 2H1OA 1KMQA 3MERA 4FKBA 1E2EA 1ITZA 4MLDA 5CDFA 4ITRC 5CFOA 5HKOA 5JDIA 1P5HA 4CNBA 3RSQA 4UHDA 1ICEA 1DWUA 4DLNA 1K92A 2VDVE 3GJYA 3IDQA 2P3OA 1D1QA 5CGZA 3KKQA 4G89A 4JKYA 2OQ2A 2HTEA 3ESQA 5C81A 4ZAZA 1EPUA 2BBTA 1BCRB 2D7JA 2Z57A 1K3UB 4IXMA 3RVPA 5JXIA 5KEIA 2C7QA 3G9QA 4H1HA 4J4TA 5ENVA 2WYHA 3ZLUA 2EZTA 2XVZA 5EQTA 3LC7O 3MT8A 2OMEA 2B8TA 2C7OA 2AJCA 3P2OA 2YW9A 1DARA 1NJ2A 3GGDA 2A5GA 5FEMA 3T4XA 3TQOA 4BS9A 4XLLA 4F4UA 1MEOA 1GRRA 2YZ7A 3NWOA 5HFJA 2V7PA 5BN5A 3GDGA 3ZH9B 2FEXA 4MNTA 1EDZA 3R3SA 4IUCS 5MHTA 5LZ5A 4GOXA 4JLKA 4NMMA 2G9QA 3P9PA 2Q1XA 4NQZA 1PD1A 1S6YA 4P2GA 1D9XA 1T9CA 4OJNA 3OOHA 2PNJA 3NGLA 5AXAA 4UHJA 5THXA 2J87A 5DBOA 4BVAA 2ZJ2A 2AMVA 4GE0A 2F3RA 3PB3A 4PINA 4YXWD 1FDTA 1BRTA 4OFWA 1ZESA 3LY8A 5CT5A 2PMWB 1O95C 3D2BA 3P2EA 4ZWNA 4YMLA 2EF1A 3NBKA 1QHYA 3WGQA 1CFZA 3R3WA 1GA4A 2GNAA 5B2ZA 1CBUA 1ZNYA 1XVTA 2R85A 3KVOA 4LF6B 1GAJA 1I14A 4GEKA 2R48A 1GPMA 2XE4A 3K9BA 3ZXSA 1MRZA 2VDNB 4D98A 1QPGA 2QTBA 3R3JA 1QONA 1FJXA 2C4NA 2J9XB 1ZSYA 1KYWA 4IVNA 3V2IA 1XT6A 4QFBA 2IEAA 5KTKA 4LOLA 3N7TA 1QK4A 2ZTMA 1Q16A 5BR1A 4P3KA 3VHXA 1ZM7A 4YAUA 3DW1X 1LDGA 4QODA 5J40A 4C88A 1XGKA 4JJGA 1JI3A 5AVWA 2LIVA 4YPVA 4TTAA 4W7HA 1JEQA 2P8SA 3IAHA 2EW1A 2JFOA 4KU4A 4PLGA 2WJ4A 4OXNA 2IXFA 2RHBA 2N1BA 4K81B 2C3MA 1V1RB 3Q3GE 3EDYA 3N2GB 2BMDA 3AUJB 7ABPA 4F3RA 1NW8A 1P2TA 2XVYA 2ZI4A 4MW6A 3USZA 3HXMA 4Q3BA 2D7CA 3K4PA 2ENUA 4FQ5A 1XQ9A 3JS5A 2JF0A 3UOGA 1HX7A 3EARA 1E1KA 4Q3OA 3RT9A 4H0NA 6YASA 4OP1A 3OY2A 3VNRA 4P53A 4KRXA 2B4TO 5EWMB 1Z6YA 2BKLA 4F4DA 4Y2TA 5EGNA 1FFXB 5LP6F 2ISSD 5HDQA 1GDHA 3IUJA 3NKVA 3NGMA 3WGTA 2GDJA 4P3NA 1ZLYA 4AROA 2PYDA 5CEJA 5AVSA 3MHPA 4G0UA 2AFVA 4II2A 2WFZA 4BKUA 1P2UA 4BBZA 2PZKA 1D8AA 1GXSB 2H16A 4TSFA 3SR4A 4GBJA 4QTTB 3RFFA 1CZRA 2X2FA 1NOIA 1UBFA 3CLTD 3HP1A 3PS9A 1ZPDA 4GMFA 2ZDHA 2ZSBA 4J1NA 2VJOA 2CB0A 3AKDA 4C0WA 4XIGS 1GFWA 1H2YA 1CWUA 5KQLA 4LJRA 2HCFA 1SPBS 1W6UA 5LSAA 4BBJA 5EKUA 2OO3A 4DM3A 1F5SA 1K8RA 2C20A 1FP1D 2Y27A 3BF8A 3IJRA 4ALMA 3AUTA 4BFWA 2QN2A 4P32A 2HC9A 3AHGA 5JVDF 1Y33E 3HCPA 4RVSA 5FUXA 2VNIA 3X1ZA 1DC7A 1H85A 1VFNA 2DR3A 2IE8A 3I2IA 4W9NA 3HY3A 3KALA 3LC2O 2O5VA 4ZO4A 3WVNA 4G5QA 1Z2PX 1ZK4A 2NXEA 2FFAA 3N8HA 5KQGA 3G6WA 3H1GA 1JDTA 4LOKA 5A6VA 2WSSA 4G8BA 2VJLA 1TU4A 4YMSA 4BTEA 4BV3A 3PGVA 5DNWA 1BG6A 2I1QA 4BJ5A 2X3YA 1LBSA 5DFAA 4S3MA 3AFMA 1N3LA 1RCTE 3C4JA 3RYHB 3WLLA 3A37A 4C4TA 2H59A 3VTKA 5L9AA 4DV7B 2Q9AA 1CJVC 2IU4A 2PMBA 3QKTA 1ABEA 2NUAB 2W2VA 4X1KA 2OY0A 3KAPA 1UDRA 1G16A 3UFXA 4CM8B 1LKZA 4B6GA 1JQ5A 4GOOD 4N4AA 1EM8B 1XZFA 3DO5A 1WXIA 3H11B 4ZCMA 2WIFA 1NJ5A 2W9XA 3NX4A 4AO7A 4JOSA 3UKJA 3VZBA 4JT9A 4CDGA 1NDHA 2YR0A 3GWZA 4MVJH 3NW9A 5E1MA 5AXBA 4EG8A 3K9FC 1N4DA 2A84A 3FOZA 3WWZA 4DCVA 3U80A 4QJ5A 3THOA 3H18A 3LVBA 4WCFB 2SKCA 5C46F 1OXXK 1U0SY 1FLVA 2P65A 2WTXA 3CO0S 3LUAA 3MOGA 3DW3X 3HUTA 1CD5A 1X7WB 2OPBA 3KVRA 5FX2A 1P2SA 1D03A 2IPNA 1V6SA 2IPAB 4TLEA 1TUEA 4V2UA 1PD0A 1TYBE 5IMBA 4RLQA 3QBVA 2VC2B 8ATCA 1ZXXA 1A72A 2P0EA 4MW2A 4UBKA 4OQXA 2Q4EA 4QYSA 4IIGA 3KIPA 4G5XA 3BFKA 3O1HB 1IULA 1CLUA 1Z7WA 3BFJA 4LGYA 2IUEA 1KEPA 1WVGA 3NBXX 5D3ZA 3WOVA 5IFLA 5A7HA 3VR5H 2G80A 1GUFA 2G71A 3DQQA 2I80A 1XPJA 4KQMA 4YRKA 1SB8A 3A2NA 2HHLA 1O9BA 1U2GA 2R6R1 1Y8ZA 1U7TA 1OU4A 3OTWA 1OREA 4X00A 4EJ6A 4E5UA 4DM7A 1DXYA 1CW2B 3PGJA 4WLOA 4IO0A 1NRXA 5FNVF 1A69A 4FYXA 3IAM1 5B57C 4X7BA 1ARZA 2BW0A 2Z0MA 5JYDA 2YWHA 5JTUA 1Q1AA 3ZD9A 1SCUA 4LRWA 1J70A 2WZCA 4PAMA 3WB2A 1TVKA 2XMBA 1B0AA 3VAYA 2A5YB 2IH4A 2YWJA 1ZW1A 3Q0TA 1AO3A 4O2AB 5EKDA 3LX5A 2AVNA 3W8RA 4EVIA 4YREA 4IHQA 1QU2A 4R8LA 3BHNA 2I62A 3HUFA 1XK6A 3UMRA 2GOYA 3A0UA 3D0KA 4BKRA 2HBZA 1FEZA 4QOHA 2Z83A 2P6OA 2HT1A 3AERA 4RVHA 4GL2A 1NR5A 2I55A 5CA0B 2FU5C 3NANA 3TQRA 1RZ3A 1OH7A 2P8JA 3GLHA 4KJZA 4PLCA 3GW8A 1GTRA 4HGNA 3SX4A 3DDOA 1NF2A 1TXGA 3W0LB 2GBLC 2A58A 4FGKA 1A8PA 1QGZA 3FTNA 5HQTA 3K2QA 2PU5A 3WWCA 3BYZA 2N75A 5EYPB 1DXOA 3VDQA 1ORRA 3EIQA 4B6QA 3IPCA 3KS9A 1GAQA 1XWWA 3WE7A 5IKMA 2H00A 4HRYA 4JJZA 4BB9A 1EB9A 3GMSA 1SUIA 2DWUA 1QR2A 3ECSA 3I5MA 5ESXA 5D6OA 1UK6A 4HVLA 4XWOA 4D9GA 2OXIA 2Z5LA 3QPDA 1EFUA 2BMEA 1DRUA 5LBUA 1JXOA 4Q00A 1UP4A 3FAZA 4TL8A 1VHDA 3LOPA 3UJ6A 3KR2A 1G291 1SCAA 1TVMA 4B7XA 2EG5A 2Q5QA 4NZOA 3C43A 4X61A 5CIWA 3JYPA 2CJPA 1Y1QA 4LDNA 4U1RA 2FQ1A 1PVVA 3CRMA 2ZBQA 3D0OA 4DSAA 5D2CA 1I6MA 1VRVA 3PFIA 1M74A 1OLXB 4O5OA 2XCSB 1TM4E 1SBYA 1U0OC 4QYTA 4EKDA 3H2YA 4A9AA 3K6KA 4RVOA 5DOZA 1OBFO 5ALXA 3G8YA 4YYZA 1DAHA 5CURA 4G5HA 1M54A 1J5EB 1JPJA 4JLVA 1DPGA 1JE0A 4NG4A 4O1MA 4A1OA 1W8DA 2V5UA 1NWCA 5SV2A 3CONA 2EKQA 3E4DA 1EXMA 1NRWA 2WUEA 4HC4A 2QQEA 2YRWA 1P81A 4YRAA 1WB9A 1FSPA 1FLAA 3KB2A 1WCXA 3QLVC 2ZRHA 3VC1A 3HKBB 3ESCA 5FLXA 1GNVA 1RKBA 6GPBA 4YP1A 3BTUA 2R62A 4ZV7A 3GDWA 4UFOA 2IV2X 3SS7X 4H0CA 2V74B 1SB9A 2FMKA 3T7TA 1JHUA 2G5GX 3LT0A 3C1TA 3PRYA 1EFPB 1U0TA 3HHEA 4FT2A 1NYLA 4UM9B 3HO1A 4U2FA 4OHFA 1QP0A 3LXMA 8OHMA 3N8GA 1LGYA 1ZOLA 1R4AA 3W8FA 3VR1A 2W0SA 3RC8A 4Q1DA 3R7LA 2NUTB 4MO9A 4WXMA 3ZWQA 4OFZA 1SIBE 5AW0A 1XK7A 3NHFA 5JEDA 1KJ8A 3FN4A 4TXMA 2O8FA 3DH0A 4QTYA 4L07A 4MULA 3LCJA 1X7HA 4BJ3A 4EA8A 4KBYA 3TJZA 5IKOA 2O3JA 3HN7A 4JR2A 4WY5A 1IM5A 4RXUA 5A3VA 3TVDA 2XA1A 4LF8B 2RAFA 5JCJA 4OMCA 3AFHA 3WWPA 2PNFA 5EESA 2VZ0A 5TPZD 3TDNA 1IATA 5IKEA 3T0IA 3UB4A 1DJPA 1DUSA 1OFVA 2DBQA 4INPA 4TZ6A 4XOUA 3PEUA 2JLSA 3EQ8A 1KFKB 4S2UA 2DB3A 3QKRB 3TBKA 2QROA 2BGRA 2VJNA 1B43A 2Y1GA 3U7QB 1K8XB 1IUNA 4JI0B 3F8SA 3G2KA 4NICA 2C92A 5ALIA 1W36D 2PUCA 1ZOOA 1DAEA 2WR8A 2VHWA 3RARA 1TIBA 4RL6A 3S27A 1TEVA 3F9RA 2A1IA 2XZTA 3DEFA 2X2PA 1V3UA 3Q5GA 1M0EA 2ZYSA 4IH9A 2EZ9A 2PGIA 1A9OA 2H4XA 3TD9A 4L0MA 4G0ZA 2C4KA 2R5FA 4WZBA 1G7TA 2OUIA 5EI5A 4NL4H 1VL8A 1QTQA 1K7EB 2Q3CA 3JQCA 3LBAA 1DRJA 3FR7A 4CIXA 1KQGA 4JJ8A 2WKQA 2YZNA 3OLQA 3QMMA 4HNAB 4NF2A 4ZVTA 4ZOLA 1W4RA 3UNXA 2XE8A 2JI9A 3B53X 5B3AA 1GO2A 2FUEA 4FNGA 4XDHA 1KJ9A 5FF9A 4AY5A 4QOGA 4KQIA 2CKMA 1TFUA 2IV7A 3RK0A 4KE6A 1NRIA 3TFWA 2H0AA 2J5KA 3S28A 1G0OA 5L3QA 1EQAA 1UFOA 3Q7QA 4XLZA 2AC2A 4MUMA 2LKCA 5FPSA 3FWNA 1BE8A 2OE2A 3ZHTA 2XNSA 4B82A 1WM1A 3VH4A 1HF3A 1T9DA 1VCOA 2C7VA 4P4UA 3L1IA 3SOPA 1OTXA 3OOWA 2Q1UA 3L8FA 1E6MA 3NQ41 3Q4GA 4D97A 1USUA 3CR8A 3I0ZA 1WW3A 5GZ1A 4UU7A 4ZYZA 5CCEA 4Q1EA 1CEEA 1OYWA 3DLAA 4QDZA 1FMTA 1ISSA 2R4UA 3NKLA 1WXGA 4IOJA 4K87A 1PT5A 5H0IA 4DSZA 4GX0A 2CDAA 1EWVA 3GFFA 3TZBA 3WLEA 5JJBA 2FPIA 4IILA 4X1YA 3SKXA 1H66A 3B1VA 5EGSA 2JGDA 3L4EA 3UA3A 3HYNA 3MRTA 3DBHB 4RETA 5AK5A 4DZRA 4ZJYA 1GKLA 3GP5A 3U6BA 3IB3A 4HPWA 3VBCA 1KI2A 4RD0A 4E32A 4LFAB 2BH9A 3HVIA 3I2HA 5KYUB 1RBQA 2NIPA 4E5VA 4HY3A 3LG2A 4YRTA 2VO1A 2TRSB 5B58T 4GVPA 2PT7A 3CJTA 3J81k 3H1AA 5EZSA 1AB6A 3W1EA 4G9GA 2CLOB 3QPVA 4UHBA 2YFYA 3OQPA 3I6IA 1XD2A 3Q15C 4O4JA 2GCGA 3L05A 1MT3A 4K88A 1W35A 2DJIA 3LYHA 1XQYA 4M89A 3WR5A 3ZWNA 2YRXA 3O8OA 3SQLA 1E4EA 3BJEA 2WU0A 1GA1A 1GQOA 2UDPA 1Z8DA 1NNSA 4B74A 3OZUA 3MS7A 4N76A 1E9CA 3AHEA 3DEAA 3EIHA 3RVNA 5KSZA 4R7TA 2FZGA 5LYJF 1VSQA 2V3CC 4JP2A 1SUCA 2PT6A 3C85A 3ZS9A 3E5NA 4J7AA 3WXMA 1I7NA 4P5EA 2ZYVX 3E9MA 1E7RA 4JP8A 5AKGA 3TPCA 3S81A 3LC0A 1JSXA 1L7BA 1YGYA 2VRNA 3QQ5A 4W9RA 2VRBA 1G1AA 3PVSA 2ZIGA 3EQZA 4M0EA 3MJCA 1T91A 5SYMA 1Z28A 3O9MA 1QNFA 4DRXA 3OLCX 3USES 2BMFA 2A3RA 1Q57A 5AKEA 4MDHA 3R6TA 5EJIA 3HDGA 5DNYB 1C0PA 2CFRA 2FWAA 3NZEA 3WGKA 1K9VF 3T7SA 3IP7A 3QBEA 1TI7A 4MWTA 1KH1A 3FPKA 4FZVA 2Q2QA 3DZHA 3E03A 2ZIVB 2I4MA 5EMKA 1ZGBA 3B7PA 1S2DA 1UK9A 3EGCA 3PE3A 3PUHA 1GVNB 2YZMA 5IC6A 1QMPA 5BQPA 3M6FA 5TF0A 3TGPA 2R6FA 1V47A 2PRYA 2E9SA 3GUHA 3Q9NA 3ILVA 1RKQA 3F2IA 1QYIA 1JR4A 1YOBA 2B1QA 3T06B 4XPIA 1FRZA 5K3BA 5B30A 5ADHA 4DREA 1P0FA 1AMNA 3KP1A 4OL9A 4EFLA 3LQRA 5A3SA 3Q9SA 4F92B 1XEFA 3U7JA 1JFFA 2ZZKA 2QTFA 3UWSA 1T0IA 4F1KA 2O1EA 3NAZA 1O97C 3A3KA 3AFGA 1TCVA 5DV9A 4BLWA 2X1LA 1Q7CA 4MYUA 4ZGWA 2AFIE 5CVCA 1AGYA 4H1UA 1RXUA 4TYPA 1PJLA 3EEIA 3UGJA 1H2WA 2GARA 4ND1A 3RFCA 1QYDA 2YV2A 3TEJA 2VDQB 4MPJA 5IC5A 3PLRA 4ZTUB 3LSTA 4NI5A 3V55A 1JR6A 2WYVA 3KJEA 1N33B 1O8BA 2DPLA 3K05A 3KZMA 3ES9A 4K9PA 1QOZA 3KPWA 5GZ6A 4HFJA 4DHEA 5JSQA 4V24A 2DM6A 5C34B 4U7PB 2D06A 1K6XA 2GVNA 1H93A 3NBFA 3VRHA 4C89A 1Q83A 3ND5A 3Q6NA 1V9LA 4MUIA 4ZN6A 2ONKA 3GXOA 4LPSA 5FLYA 1P77A 4BXOA 5I8PA 2EBWA 1J21A 3QVTA 2CLDX 3TB4A 5B4UA 1MAWA 1M6NA 3AR8A 2CWDA 4D5GA 4XWYA 2WJJA 2VQSA 2MSDB 1BDHA 4Q4AB 1KMHA 1WCIB 4R6XA 1JG1A 2F2TA 2FFHA 4B44A 5BRNA 2TMGA 5GQSA 4W5JA 4BO2A 3RRNA 5KNDA 1EDOA 2Q1SA 2YN0A 2PX3A 3IUQA 4B2LA 4JI4B 2QV0A 1NMSA 5G4KB 5E7MA 3JQ9C 1VJDA 1Y9DA 3ZK9A 2P75A 3W05A 4BMZA 4DDTA 2PGAA 4GLJA 3W6ZA 1CU1A 1E8MA 4R71A 3D3JA 2CL6X 4MI1A 5AQEA 4J3NA 1R6DA 2DFNA 2QSUA 4IICA 3ZGZA 1GGVA 5YASA 4YUVA 2L2QA 4KXFB 4QNNA 2DR2A 1ACJA 4CLRA 2HWYA 4JBYA 4DYDA 1AQJA 1HLPA 2AI3A 1XCMA 3TQFA 5DYGA 5BSUA 4I3FA 1ZISA 2VYQA 2YJ6A 2AUMA 4KYUA 1V8ZA 3EC7A 3R40A 2QWXA 4UUNA 1DKUA 3H13A 3K5IA 3QMWA 5MGNA 3OMLA 4AXXA 2IP1A 5F9FA 4AU1A 3HXOA 4RU1A 4LYHA 3GAFA 2ZBFA 1TKAA 1T5SA 3QXJA 3EAQA 1ESZA 4CIBA 1SCKA 4X62B 3AJ9A 5HCIA 4Y98A 2C2YA 2XWBF 3F5MA 2PDAA 1QWSA 1T36A 3EY4A 1UFKA 1V5GA 5DTQA 5LLDA 4QGBA 2KWIA 4HDNB 3HCBA 4N7RA 1GNSA 3ENKA 4UKDA 2QVYX 2PAFA 4NESA 3NTXA 4LZAA 3D2AA 1B8OA 2UU9B 2XGMA 3GGCA 3KKEA 3VA7A 3LFHA 1LLQA 2H6EA 4IR7A 4BC1A 1C7ZA 5BWLA 1SY7A 1ORHA 2BJHA 3TLAA 3MXTA 3DDNA 3CIOA 1LI5A 4CKWA 5HZKA 4I4TB 2OAEA 3ZVNA 4RLHA 4MQ5A 1Y1KE 1Z2NX 2YOGA 3ZEIA 4L4SA 3ZYCA 3KQMA 3AW8A 1SU6A 1KAMA 2AN5A 4Z4QA 1WP4A 2ZVDA 1GTMA 4FYPA 4KR0A 3ZHCA 4DA9A 1T1RA 3V80A 4AJJA 4Z53A 5HCNA 1VLHA 2I4IA 3KYJB 2R9VA 3PUXA 4P98A 1KJJA 5C1DA 2QF7A 2FY8A 3GNLA 4I55F 3SN6A 1XQ1A 1BVHA 5AM1A 1N7HA 4JB0A 4JJ6A 4ME6A 2ZUDA 1DIOB 1WUIS 3K0FB 1CUXA 3QKWA 4GMHA 2VRCD 1BEZA 2G6BA 2XNKA 3QEAZ 4TXLA 2R1UA 3PL5A 1CRLA 4BKOA 4E2WA 2OQVA 3DFIA 4M1KA 2XTMA 4KR3A 5BWMA 5ICFA 1XCLA 4PYRA 5EIWA 4NPAA 3RS4A 1V4VA 4N3CA 2R60A 4NDZA 1DLIA 2C2GA 3DWIA 1Y80A 2GTIA 3BPSA 4C2UA 3WYFA 3EJWA 4NU6A 3FKJA 3HDYA 4GMXA 4QBIA 4ER0A 3NHZA 4NEHB 3IQHX 3J7AC 2IT1A 4TMWA 4C6SA 3W8DA 4LJ9A 1YHYA 1L3BA 2JRCA 2FR8A 3OM1A 3QKUA 4IF4A 4KLCA 4NCJA 4YJGA 5CRIA 1MOQA 2W71A 1NNI1 1XROA 2CXTA 3NLLA 1WF3A 5JQGA 5BMOA 1N6RA 5LJLA 1LB1B 1MV8A 2J46A 2V7QD 1M6EX 1BO6A 2WVAA 3DZCA 3ZZ1A 1Y3IA 4DR6B 2HU7A 3FHJA 2DPHA 5LKRA 5HE8A 5KS2A 4DKJA 5HG0A 4AKSA 1IDN1 2FF5A 3GRPA 3W5CA 2IS1A 3PP8A 4G01B 2WWTA 1P19A 4QA9A 1Z5UA 1RYMA 2XQFA 4Y2YA 3TGLA 4JJAA 1FSSA 2EBHX 3FOWA 5CB4B 2JGLA 2C5HA 2CD7A 2IYEA 4GP7A 5K2OA 3B60A 3WIOA 1LWNA 2AXNA 3U4HA 1YU6A 2ATEA 4LYEA 4N49A 5FPTA 3OJCA 3V4VB 4IW3B 4LC9A 3AHIA 4BO9A 1UWVA 1B26A 2WAXA 2Y0EA 4A2WA 3EWAA 1ZEJA 2G8NA 1L8XA 3AB3A 1T9ZA 1TX4B 4OAQA 1DO0A 3GZTB 3MC1A 4ISBA 4J4BA 3TE6A 1V1MB 1CC1S 3VC3A 2AMJA 1UADA 2PH7A 3DTVB 4N7MA 5KINB 1A9XA 2IBTA 3O4IA 2F1KA 2PY6A 4UMDA 4FEAA 4CMJA 5BYAA 4UMEA 3EG9A 5JFGA 3W90A 1YR1A 4F45A 2HNKA 3GYGA 3AVYA 3KDPA 2ALJA 2C2HA 4MQFA 3ZW8A 9ATCA 3RU2A 3ZK7A 3DTNA 1JL3A 2HA3A 5DWDA 3SX0A 3HGMA 3NS7A 5C7LO 5JAMA 3V6MA 4ENSA 1E3LA 2O3SA 4CIVA 3GA7A 3U7RA 1YFKA 3A05A 5FCDA 1AHHA 3RVJA 5A4JA 3MUNA 1CY7A 4M37A 3URKA 1HDXA 3ULKA 1YA4A 2P7IA 4OYRA 2DPYA 3I6BA 1NY6A 1R4MA 4WACA 4OP3A 1P7WA 2I22A 1CLEA 3IS3A 4PANA 1O97D 4L7VA 5ITSA 1DMRA 1ZINA 2YXNA 4ZARA 3WYEA 3N70A 1FC0A 5DN6A 1NBIA 5HTKA 1TGYA 1NBMD 4B7ZA 1T4CA 2W42A 1WSWA 3B38A 4ALLA 3OFND 3GJSA 1X1BA 4K9QA 4QYMA 4JGIA 3H97A 3FSGA 4M9RA 4WH0A 3HYSA 1TB4A 3HU2A 2IHUA 1RZUA 4AAYA 4AP6A 2DGDA 5ELMA 1PNTA 4L4UA 3TOVA 1BE0A 1FS6A 1MQ8B 2PUBA 4GH5A 1QX3A 2GUGA 4LHWA 4YCCA 2QL9A 2BKAA 2WINI 3PVCA 2FMUA 3SJAA 1C7RA 5JXJA 3EULA 3INGA 4PPFA 5K0JA 2PS0A 3CHYA 3CUEF 3ESXA 2O2HA 2ZAYA 4ACAA 1XUOA 3FLEA 4MQEA 5HCUA 5HF6A 4WZAB 3Q8MA 4DRZA 5CFNA 1SK9A 1NF9A 2EJWA 3MQ4A 3BICA 4MRRA 1OQAA 1UKAA 3L7DA 2R00C 4WXPA 3H4IA 2OHHA 4OQMA 1QM5A 2RBKA 1TKRA 4L50A 1WXFA 4URUR 5HILA 5T57A 3C41J 3TLGB 1NF3A 4HX2A 3HVRA 1KARA 5KNLA 2G1KA 1P1KA 2C57A 3ZDFA 4LY3A 4PBRA 2R2AA 4TL7A 1D5WA 1E6LA 4R3WA 3ZGXA 2D0OB 2VKTA 4DUPA 4EQ6B 1RYNA 5JLJA 3PNOA 4U6QA 5DGTA 1MVNA 4IJVA 4GQAA 1PL0A 5SYAA 1XHFA 2XLCA 4MW4A 2HRZA 4YAWA 3TX6A 1KF0A 2YHIA 3DL4A 1T3TA 2NO9A 3I5YA 2WJAA 2Q45A 4MJ3A 1X1DA 2D2FA 2FJUA 2M32A 3ESRA 1R5BA 2OFOA 2JIZA 1PV2A 3BT7A 4XSVA 1OZFA 3CLHA 2WG0A 1YVPA 2A0YA 2I2FA 5PGMA 3MOIA 4EHHA 4NFHA 1E0KA 2ZRIA 1UMCB 4XM0A 2I2WA 1Q0SA 2Q3DA 5DU2A 4DNXA 4E70A 4IDEA 2OGUA 4H9GA 4JLWA 2BM8A 4MARA 4WUVA 4ZI7F 8AT1A 4CYMA 2QD2A 2Q0QA 4EUFA 2I4LA 1VMDA 2VAPA 1Z4NA 3C97A 3B3AA 2PL9A 4ROTA 4F72A 3EXIB 3X1KA 2A9KA 2W70A 4P4LA 1T4GA 2BOVA 3HCCA 3O1LA 1L8OA 4FI3F 3E81A 2EU8A 5EZYB 2P62A 2JATA 4LY0A 3VYTB 2MYPA 2WU8A 5ALQA 3GFOA 5E6RA 1QHHB 1U9CA 4E3ZA 3DO6A 4LNUB 2JAOA 4PGHA 4E46A 3D64A 4Z9AA 5ER9A 4PG4A 5GJWC 3Q0EA 4NV0A 2GPYA 2ZR7A 2X19A 2COKA 3D3KA 4LS3A 2J4CA 1GRVA 3SR3A 3TOZA 3UPDA 1L5NA 3UANA 3HP7A 5M04A 5CNKA 5FJIA 1GL7A 5D7BA 2BP7A 4CF4A 4Q7KA 4MGIR 3B1ZA 1O57A 3SQNA 2N47A 4MA0A 4WFKA 4N0PA 1WF6A 2CE2X 3N2LA 5AM3A 2ECQA 5DASA 2VK1A 4QOIA 4ZEMA 1TMOA 1BE6A 4L0QA 3V8MA 3OP4A 4OGKA 3BD6A 3GLRA 4BMDA 1U28A 1I4TD 5EMJA 1LDNA 1OHHD 1JXAA 1C1XA 4DR1B 1UPFA 2V9CA 2XAUA 4FSXA 2H2HA 2AMYA 2SKDA 1CJBA 1U7WA 3UGQA 4F60A 2BGJA 2RHJA 3AEQA 4N01A 3U17A 5KYYB 3HBLA 5AKYA 5D87A 1FNDA 2B83A 3QYAA 3RFVA 2FQXA 4H60A 1FP6A 3HKCB 4NABA 4C0XA 1A4UA 1MG0A 1RXYA 1PAUA 3V8BA 2ZB8A 2NPFA 2Q5EA 2K6GA 2V6GA 1I4OA 3SYNA 1V8PA 3B6IA 2ZSIA 3KJFA 4PX3A 1XRQA 4LBZA 3LFTA 1L6IA 3ZHUA 4DR2B 1NL3A 2C0PA 4JOCA 3TVYA 4AF6A 2UVQA 1EUDB 3PUVA 1HDYA 5DM1A 3G2PA 4HH3C 1ZD8A 3BKXA 2Q28A 1J99A 3WKCA 1IHYA 5JALA 1UOOA 3D7RA 4LISA 1QG2A 4UDNA 1YVEI 1NFRA 4J0DA 4JI2B 3FIUA 4WA8A 1QOQB 1T15A 2GM5A 3FVQA 1PYGA 2PX2A 4WGFA 1Y5NA 5FAKA 3TIGA 4EHDA 5B58C 5C52B 3DV9A 3UMCA 1FRNA 1GT6A 1X86B 3E23A 1YOVB 1M1XB 2EWMA 5JISA 1M6YA 1P74A 5A3QA 1PQWA 1E94E 5ITZA 4H31A 5JNWA 2B4KA 4OUDA 2JZCA 1AZTA 3LWNA 3OCJA 4HMOA 3NKFA 4PO9A 4URZR 1ZGCA 3WYAA 1RTTA 4TYNA 2XCTB 2P0AA 1NVUQ 1XJWA 3R3YA 3FW1A 4G84A 1XRSB 3C3EA 4S04A 1Z8NA 3JYOA 1T5IA 1EAMA 5CLJA 3H2IA 3N6RA 5E8RA 3ZY2A 4QQ8A 4FX2A 4X85A 5K05A 1CDEA 3MBKA 1AN0A 4NARA 4JA2A 3W7VA 4XB6B 3PUWA 1EEHA 1M83A 1Z6QA 4FCCA 1K1EA 2ZR9A 4G8CA 1RXEA 1YJ5A 1Z4MA 3AHCA 2SHKA 1DU4A 3I37X 3PC2A 4OX9B 1P60A 3DT9A 2J3HA 4DV4B 1DXHA 1I10A 1C9DB 3M9LA 4I2NA 1H2ZA 2WFAA 3DFFA 3PWZA 4L5YA 3WFJA 3QW2A 1UM9B 1WZEA 1HT0A 3N74A 3PC8C 4N9WA 4Q9IA 5K0TA 4GFDA 4IUYA 5TJHA 5C8VA 3P2MA 2QMQA 3IESA 2F59A 4YXWA 3M8KA 3VPXA 1EFTA 1Y63A 1GSOA 1RJDA 2XUAA 1KMNA 4MB6A 4RK5A 3VPCA 3WL5A 4PFKA 1X9GA 1ZA2A 3HY6A 2CMGA 4P86A 3UW3A 2PZLA 2RGBA 1SWWA 1SVLA 3GEGA 4F56A 4MA5A 2PK3A 2RHDA 1E18A 2YS7A 1RWPA 4OIFA 4HTAA 3RABA 1LPAB 2H1SA 1SELA 3G88A 2GM4A 2QTHA 2H54A 1XJ5A 1DKMA 4LWQA 4B7AA 1X8KA 1ZVVA 3MWFA 4L72A 1V16B 3CZ4A 3JYHA 4FYKA 4PZ9A 2YIVX 4S2EA 3GVHA 5A9SA 1EVYA 3ZJTA 5H82A 4GPAA 1N9GA 1JAXA 2C2WA 2NT3A 2QMEA 4ZO6A 5EJ8A 2GK3A 2Q2NA 4RY0A 1GQSA 3E1GA 3E22A 3H19A 2G63A 4HDCA 2JCGA 3NDBB 1RWMA 1O5TA 1YMVA 1D2NA 4M53A 3AESA 3FNBA 2WOJA 3SZMA 3PXEA 5A4IS 1EX7A 3NFYA 4IKPA 5TQ2A 1VJCA 1SHUX 2HF2A 1E3EA 4DY4A 3G89A 3I09A 3IP3A 1ZH8A 2VTBB 2D2IA 2HJ9A 2J3QA 4EDFA 1I5OA 2WYIA 1C1DA 1IHXA 2BM0A 1KZ6A 4FYVA 4Z4IA 3R5HA 1BWRA 4UMVA 3DYIA 3WSTA 4BWYA 2FEAA 1I3MA 3UYKA 1FTQA 2JW5A 3E9QA 3TRKA 3VR4H 1H9AA 3RE1A 4AD8A 1JBKA 1Q5PA 2P5YA 1Y8RB 3F49S 4M98A 5C1IA 4O1IA 3FHTA 1UDWA 1VPEA 2O23A 3DONA 4ARIA 4MKIA 3T61A 1GNLA 4MYRA 1K7FB 3R7FA 4QNMA 3D1VA 4EUSA 3M5DA 3UJNA 4Z3DA 4NS1A 2V6FA 5JPCA 5JUWA 4LMRA 1U7OA 1IH8A 3FLAA 2J0EA 3EH2A 3ANNA 4PTZA 4RE5A 4LWOA 2EYQA 2YMLA 4BQPA 4L4ZA 2PGJA 2XB4A 2VJMA 5JRJA 4KPUA 1S3IA 3KSUA 1VJRA 2YCBA 3AONB 3BH7A 1CCWA 3EXAA 4PLZA 1FYDA 2ISCA 2QPAA 1WDKA 3EZNA 5JNSA 2VZ8A 5IXYA 2C9BA 1XTSA 4CR7A 4GMGA 1IIBA 3PZRA 4J75A 1IAQA 4F8YA 4XQ9A 1HTWA 5ALSA 3IULA 1QH1B 3KQVA 4I8DA 3UBMA 4E7PA 4ETWA 1LBEA 4P7BA 5JAQA 4KQXA 3ZWCA 4KREA 3TSWA 1SC3A 2JKYA 3MS4A 1E58A 1FDUA 3LHDA 1W94A 3WFZA 2AOWA 2WWVD 1RM0A 4JV5B 2UZ1B 5FOTA 1PR3A 1GN9A 2R7KA 3LXRA 2A57A 5JZMA 4M1TA 1IK6A 1N0VC 2C1ZA 2X5JO 3D3QA 3IUBA 4C7OB 4X41A 2F4VB 2Z5FA 2XKAA 1L5SA 1RJWA 4LDPA 1R5JA 3KQYA 4LQCA 4C7MA 4G97A 4XYEA 4OQ4A 4D4KA 5B7QA 4UFNA 1GGMA 4OEHA 5J58A 2X7HA 2F3TA 1LLUA 4MB2A 1ZAYA 2FPUA 2LCFA 1UXIA 2QN7A 1QQ7A 4KZPA 2H11A 1AOXA 1NV8A 3HXKA 4HBZA 4KFUA 3ZWXA 4TS1A 5H5JA 1CUJA 2HQOA 4CG3A 3B3FA 1Z4IA 1RQXA 4R6WA 1NT2A 5JC1A 3C7DB 5EE0A 4ZKEA 2FV8A 3EIWA 3QWHA 2C5BA 4EJFA 1JILA 3FOBA 3QG1A 3AFIA 4Q3LA 2CF5A 3DKRA 1RXSA 1KI8A 2MT9A 1NBOA 4M9XA 4P4SB 5J2TA 4KVFA 4ZANA 4U02A 4BLRA 3FF4A 1JJVA 3MRXA 2M9MA 3FTCA 1E2QA 4NQRA 5LZ2A 4NXMB 4DLYA 3DWEX 2P9FA 4MRNA 5KTMA 1U9YA 1SJ9A 1C4WA 3MCWA 4R84A 4DGQA 1M2VB 1H65A 1XZBA 4G24A 5IPFA 5BT8A 4DLBA 2DHEA 4G4SO 4J94A 5CJPA 3GLQA 2HRBA 4FB4A 1B6GA 3IV6A 4BATA 4KRFA 5ERXA 1ZRMA 3OQMA 3U4QA 3BIOA 4NU8X 1XU9A 4C4SA 4F9TA 5JTTA 1H5NA 2XTAA 3BORA 4G1EB 5AKJA 5K1ZA 2L42A 5DKFA 3I9LA 1XP8A 4XVHA 4XKJA 1T2AA 2WV9A 1ZNXA 4PHTA 5LXTA 4WN9A 1N2GA 3BH0A 3QTLA 4PCAA 2OXTA 3UYLA 5KX5B 4N5IX 3TTWA 1MAAA 2JIOA 2V1XA 2YJZA 2EVWX 4KPGA 4ZIRA 4GGPA 1Q3HA 5JOQA 4P8RA 1DNPA 4HD8A 5AESA 3EFOB 3PVZA 3RB8A 3BTVA 1OFIA 1F2UB 5DGIA 4EGQA 2RB5A 3AVWA 5C51B 1DBIA 1NSFA 4KW7A 1K6JA 2Q27A 4NBVA 4DG9A 5K99A 1HKUA 1L2TA 4KO2S 4A73A 5TS2A 4HBGA 2BHSA 5LUAA 4HB2A 1AY0A 4EY4A 1U1GA 1OSNA 2PG3A 3VZPA 2QSYA 4OI0A 4GRDA 5HS6A 4HUTA 4RYLA 4BDTA 2F8MA 4B1FA 1P17A 3CM0A 1PNQA 3GL9A 1U3WA 3HV2A 4LYAA 1EQUA 2HQBA 3R2JA 8ADHA 1Y9ZA 4AECA 4HMPA 1EVLA 1GQQA 4IMRA 1BCSB 1FX0B 3IA7A 1CZHA 3DNMA 4HZUB 2IZ5A 4I1IA 3G13A 4PS1A 2E82A 5LUBA 3KV1A 1GZ5A 3DZIA 1J2RA 4AXBA 2UUBB 2AG1A 3IOCA 1PKEA 1UOQA 5AW5A 1TGVA 4FOPA 3ONDA 4TYWA 2R8RA 3PJEA 2JJ2D 3BWXA 1OX4B 2AFHA 3OPMA 1RQLA 1U3TA 1A50B 4UTZA 2PL1A 1G66A 2ERYA 4JMLA 3LYLA 4UHFA 4LBVA 3ZY4A 2EQ5A 2C31A 3AXTA 1BX1A 2BPOA 4QE3A 3TLKA 5LZ9A 3RRMA 5B7NA 5ANRB 2QTTA 3V2GA 1IBCA 5HMLA 3U3KA 4ARUA 1FJHA 1KDRA 2AI2A 1H22A 3E9RA 2AJ8A 4JQOA 1L7RA 1T5DX 3ME5A 5KNDH 1FFGA 1DVRA 1EVIA 2WF5A 3MGAA 1GWNA 1EBBA 2XD9A 4DWJA 2QP3A 3PNPA 2VTVA 4PXYA 5FNZA 4V1CB 3Q87B 1YQDA 1C4KA 1Y5RA 1NT4A 5FFFA 3PX2A 3WRYC 3W9SA 4KBGA 5AW7A 1NBEA 3L7BA 3K70C 4FU0A 4EO4A 1BH2A 2EKBA 4PN7A 4MZDA 1X94A 2QTAA 3K1ZA 3ELWA 4MP3A 1N6NA 4TVOA 4INOA 1NVVR 2XODA 2QM3A 1QGAA 3MTDA 3OZRA 4ND4A 3N7UA 2DKNA 1RJ9B 1HXHA 3LBYA 4R01A 3F73A 3ZKWA 2A86A 2MOKA 3K35A 2XCUA 1NX6A 4R3UC 1JN0A 3M9XA 4F5WA 3U3MA 5BN3B 3OLVA 3DV0B 3BX1A 2Q5IA 1RAAA 5IX8A 4YX9A 2PMFA 1ML3A 3F3MA 1C7JA 1DUIA 5HX7A 2BDUA 2QT9A 3DOCA 1XCBA 1RI3A 5JWHA 3SYRA 1WABA 2WIDA 2ZKLA 3F5SA 1K3TA 4JYMA 4C20A 2VQ6A 2R6GA 4PXSA 5JH7A 5E38A 3H0CA 2IHNA 1Q19A 1SHJA 5B1DA 4JI1B 3HFJA 3N39C 1AUXA 4JEMA 1KI6B 4UOZA 5JMWA 3QI7A 2HIMA 1Z33A 2OECA 1JIUA 3MXOA 4U9IS 1CR4A 1TUGA 4PU0A 1R2QA 1X3LA 1L7EA 2NTVA 1ZNZA 2X0JA 1LH0A 3NXSA 1R9NA 4W63A 5EHZA 1NXPA 1NPTO 5IKXA 4FB5A 3D0RA 2VSXA 4TV9F 1Q74A 4D5EA 5C8XA 3A6JA 2ZSAA 1D2RA 1ZWKA 3F7NA 4C7BA 4XOIA 2Z6VA 3EDQA 2H4JA 1NSTA 2RHRA 3DNPA 4HO1X 4QJ4A 1RRFA 4Y2XA 3CX8A 1UT8A 4QQKA 3CISA 2PXCA 3D7LA 4HYQA 1XTVA 2IOFK 3DQPA 4WLVA 2QPOA 4YCJA 1N36B 3AY7A 4X20B 4I1UA 3E18A 2J85A 4FMPA 1X2EA 5CUQA 1ZRNA 2YNMC 5ICSA 4AX8A 3JTMA 4RJKA 5I7SA 1DBQA 3SC4A 4X97A 2AC4A 1ZGHA 1OLUB 2QLBA 3SFZA 1DXQA 1HRKA 1L4FA 4RD3A 4RTQA 2PX8A 1CUUA 1NP6A 5TPZA 4PO3X 3U13A 3ZLBA 5A06A 4LJ7A 1B8VA 3WIVA 1ESNA 2XE7A 4KV7A 4R1QA 5LMZA 3T9CA 3R7DA 4J0FA 3ZBQA 4C7KA 1QKJA 1WCYA 5ALNA 3OIDA 5E3HA 1ZUNB 3PTZA 1H42A 1T3SA 2FDXA 4G0PA 2KB0A 4TT8A 1UCFA 4NBNA 4YRCA 1YK0A 5F5XA 3BA1A 5JSYA 1N8KA 1JP7A 3L1HA 4I1OA 2Q2VA 2OILA 4BB5A 3J80A 1UFVA 2ZJ1A 3G2QA 4JEIA 2PWZA 3Q3JB 4WKCA 5ALTA 3UAYA 4DIMA 5K0FA 1QO9A 1KFCB 3BIFA 3SF8A 3JQAA 2H1LA 4RF3A 4K28A 4OQYA 3NNSA 3OQIB 3MJ4A 4B4UA 3UG6A 3R7AA 3TR6A 4FR2A 3GRRA 2QMZA 5DLEA 1L4KA 1IK4A 1BMFD 3OT1A 3VYVA 4F97A 1APBA 1TAQA 4BAGA 1HDZA 4LTMA 4EPYA 4OHBA 2XUGA 1MO2A 3AL2A 3R0QA 4WCVA 3DE4X 1Z2OX 3U9TA 3VNSA 5L3SA 2V54A 2PX5A 4QG7A 4LE0A 4BNKA 4NJEA 3HSYA 2ZETA 1XAHA 5DE3A 3ROXA 3FYUC 3FPFA 5DXJA 3BOSA 4ZI2A 8LDHA 3S2SA 1U5CA 4JL8A 4TV8A 1ZSVA 5L3ZA 2F3QA 3UQZA 3EPKA 2QGNA 3H5WA 4C3ZA 2B94A 1UPUA 2QLFA 3CSUA 5A05A 1IPFA 4G6ZA 2W6ID 1J1ZA 2RHGB 2XZDA 2EGHA 1T8WA 1BU5A 4G0MA 4K26A 4B4OA 2PSJA 5F1YA 1TA0A 5A5DA 5MFZA 1D09A 4GC5A 1Y5LA 6NULA 4AX4A 4QG3A 2RHLA 4FZRA 1QQAA 4QHTA 5IYZF 2DETA 1XKLA 2ZYHA 3DOUA 4CKZA 1U1IA 2GR9A 1GU1A 2X8WA 2QSZA 1G4UR 3CRNA 1RYDA 3ETCA 4L2IB 4MWCA 2V7BA 4LPKA 4RTOA 3C2QA 5JSFA 5CA1A 1RI5A 1NXSA 5K0BA 4WOKA 1D2EA 1RLMA 3EEOA 3IUEA 2YYZA 1U4OA 3ANYB 3N2KA 5J4HA 5LQUA 3MWEA 2CK3D 4B6FA 1E3WA 1F2DA 1VGRA 1VSUA 2UVDA 2XUIA 4I66A 1ZCZA 5KJ6A 3LDFA 1JHQA 1JNXX 1WQ1R 3OFVA 4BCBA 1EWQA 2Q5FA 4L9AA 1WMSA 5GVRA 4Z1MD 1BMDA 4CKXA 4F2DA 1DAFA 4AJNA 4RFSA 2DBVO 1SQSA 3FTEA 4ESOA 3DMYA 1TL7C 1IFXA 4K5QA 4A15A 2BRUA 2VIIA 3SHVA 1A4XA 3G49A 4RV4A 4D26A 3L8HA 5FBHA 5ED4A 3E1KA 2Y66A 1XKXA 4FE4A 1POXA 2V0CA 4PSUA 1Y1PA 4Q7LA 1P2BA 1XN4A 7YASA 3AR7A 2A6PA 1WQ4A 3R7WA 2YYAA 3KEFA 4MGYR 4UEQA 1SEVA 3BSWA 3IMGA 4FBGA 2IGBA 3AVPA 4UUOA 3B6KA 1BC5A 4HATA 1HE5A 2FPRA 4J2OA 4CQMD 2OL4A 1P1CA 1SIOA 1UXGA 2CHFA 3V9AA 1HDGO 3ZG6A 2Y1CA 2ZPTX 5FR1A 3PNYA 4X94A 1FW6A 4P4NA 5KYGA 2OV6A 3OE1A 1MH9A 1E3DA 1KMIY 3OZCA 2PX6A 1O6ZA 3AUYA 2FPMA 3OJEA 4R68A 1W0CA 2JFXA 3IMFA 3OPQA 1D4FA 1ST2A 4R31A 4V0RA 1QFMA 1DEKA 2GBLA 2W6JA 1UBTS 2WWIA 3CB2A 4GIBA 5IT5A 1AJEA 3B9PA 1PFUA 2ZQZA 4CRWB 4IIDA 4HWGA 1ZHHA 2IEZA 1GJRA 1XTUA 5JZOA 5BN5B 3H5RA 2ZUSA 4GOMD 2WVGA 3U4DA 4BQSA 3CTMA 2CUZA 2Q4RA 3H05A 3D3NA 5ECDA 5ADWA 3EEYA 4HNTA 1Y1RA 4AMZA 3K70D 5B4TA 3HQ4O 1I2AA 4AW9A 4UNSA 3KQTA 4D92A 1L7XA 2P3SA 2FR1A 4E21A 2C4VA 1UJCA 2I6FA 2OHOA 2V7UA 3IPRA 2FI1A 2VPWA 4MUNA 4YMWA 2I8CA 2JZNA 1QXSA 1YDMA 4CQNA 4KOEC 3DPUA 5LM3A 4TKUA 1C9NA 1QFXA 3IMKA 4KO8A 4Y1FA 2Z56A 3IERA 1MO4A 1NVBA 2FYTA 2GCNA 4J1SA 5FOWA 1ACMA 1LSUA 2WYWA 3L8CA 1UMKA 1YI1A 2QDKA 3GDFA 3PITA 3QVGA 3BDVA 4KCGA 3FCSB 3TXYA 4ZYWA 5KNBA 1XV5A 4IYRA 4EY5A 3JVEA 1QIEA 3N1UA 3R20A 3PIDA 1L1QA 4FS3A 1YL7A 1HQDA 3CVYA 4BASA 2O2DA 1IHOA 4GYJA 1KAGA 4DNFA 5LU8A 4TTRA 3QLVA 3CLRC 2HX1A 1PGNA 3IDOA 1N2JA 3QU5A 4NFYA 4PX2A 5FOVA 1E5VA 2HK9A 3VHXB 2HPAA 2BFDA 4C4RA 1IDOA 1JEQB 4BRWA 3TPZA 3UM9A 1E1DA 2RHTA 3TLCA 2B3DA 1TF5A 3NONA 4QICA 1PK8A 3LT1A 3ZHVA 1UM8A 4K3VA 3CRVA 4A26A 1FUEA 3EDMA 3ANMA 4PO1A 5AJXA 4A0RA 2CXPA 4NTZA 4HRAA 4Q3EA 1O5IA 1YTUA 1BXRB 1KYTA 2B25A 4R5MA 3RS7A 5LL6P 1VCIA 4NY1A 3PGA1 3U19A 3BQ9A 3KR9A 4RIGA 1GV1A 2EJBA 2YNMD 3W78A 3T3NA 3DZGA 4ZHSA 3RYCA 3DG9A 4HXEB 3RSGA 1H1LA 4BMXA 3TQSA 2VT6A 2Z98A 4OHXA 5JJIA 4GWGA 4GC9A 1K7SN 3ZZNA 1YB7A 4ZEWA 1JHZA 1UZUA 3JYQA 1Z0UA 4RGVA 4E2XA 1MVLA 2IZ0A 3U3DA 1OXMA 4OGGA 2LUOA 4K0KB 3BFXA 3DVRX 4M1MA 3JPYA 1UEXC 4OHRA 1EGVB 1XN1A 2YC2C 4BNUA 2BUAA 3LNCA 1UH5A 5D51S 4ZDJA 5BP7A 3DL2A 1XZKA 3ZNQA 1OX5A 4A10A 3THWA 2P6PA 3F4KA 3H1PA 4D57A 5KOJA 3NR2A 3MRSA 5DI3A 4W8GA 3CUSA 1CQZA 1G3IA 4OK3A 1E89A 3DLHA 1MRNA 2RARA 2W6CX 4DCTA 2ODQA 4WZAE 4BHTA 3Q3EA 1GCUA 5EAIA 2B9VA 2CLCX 2HQ1A 3NOXA 1G5QA 1XRLA 3A04A 1E1LA 1GRNA 2F1RA 1Z5OA 2QRMA 3R6GA 3DEIA 2IIBA 3JQ8B 1XFDA 4BPRA 3K2IA 5B55A 3QXGA 3VPSA 1UDXA 3CNOA 4CDMA 2ZS9A 5T4EA 3ZWAA 2Q4BA 3FFWA 1AGPA 5ECGC 4ZHQF 3ONWA 3PFKA 2GSWA 2WIGA 1OXUA 1ODIA 1E79D 1A2BA 1HL3A 3OM8A 3TLJA 3WLNA 1M2JA 1MBZA 1JMVA 1PF7E 2YMMA 3A6EA 4LVOA 4IYJA 1VB5A 3RUCA 1SUDA 2DERA 3UJ8A 5FBKA 2EX1A 4B33A 4XWTA 1MC5A 5IJ9A 1YHNA 1VBKA 1GZ4A 2ZVQX 1QH8A 4TX1A 4PSCA 3UFXB 4HGRA 4RX1A 3W5IA 5ESDA 5I9LA 1HK7A 2KMLA 3AEYA 1M2NA 2COUA 1IZ9A 2ASVA 4MRSA 2V65A 1ILWA 3UMVA 4EI7A 3UBTA 2HBRA 2X3UA 2WJ6A 3GLFE 3KAJA 1YL5A 3IUMA 4K9DA 1S8AA 3FOAA 4LZPA 4Q15A 5TGDA 2IBMA 5DNVA 4IZ6A 3RF6A 4EKEA 1GRCA 3QX7A 1ADBA 1J1IA 2R4TA 1AK1A 2FUG6 3BFVA 2LP4Y 4FOTA 2O7SA 4PIPA 1RXVA 5B36A 3DO8A 4XIJA 4Z9YA 2H1IA 1OB5A 1EVZA 2BTOA 2EKDA 1DIHA 5H3HA 5D6NA 1FDRA 2C2XA 2OGZA 4OQEA 3VSEA 3W6PA 2UUAB 3FPBA 1J09A 2PA3A 2OGWA 4MROA 4N5HX 4ON9A 3RYFA 4NG5A 2A1UA 3W3ZB 3UV7A 2PPLA 5JI3E 1RE0A 1JQEA 3OEHD 2X0EA 3WK5A 4F2GA 1XF9A 2WVHA 2MCFA 4DLUA 2R8XA 1XMOB 1Z5PA 3ONFA 1IRXA 1S8NA 2V7QA 1JWAB 1X3SA 2I67A 3S6JA 1JIVA 3TZLA 3VM6A 4COOA 1PHRA 3LQ1A 3IDFA 3GPDG 4RH0A 1WW2A 3MAGA 1IXRC 2HLDD 2R84A 4B81A 1HI9A 4O4LF 3U7HB 1JLSA 3FR8A 2C2OA 2WWFA 4KPFC 3BMCA 1PEDA 4HAIA 1JU3A 4MQLA 2C04A 3LQ4A 3HG7A 3LY7A 4FYJA 1E7MA 4H35A 2JD0A 3O4RA 2W6MA 1BDJA 1SCUB 1T26A 4LW8A 2IPOA 4B3MB 3STWA 1U02A 2C2BA 2HRRA 1TVKB 3QI2A 1BOOA 2W8BA 3WISA 1U3CA 2GX6A 4FX5A 4ITUA 3M83A 4FMDB 4JY7A 4OOFA 2BHRA 2I2BA 1S3GA 2PWAA 2WMDA 1UBNA 2VYVD 4NCHA 1OMOA 2AF4C 5C0OE 3KQKA 4FSDA 3AERB 1VHWA 4GQBA 5T67A 3E35A 1AU9A 2EP8A 4G86A 1RAHA 3UAOA 2PTHA 2OCPA 3GLHB 3D8RA 1EXDA 4I1YA 3EVZA 3LCUA 2QZSA 2IU6A 4R05A 1JIKA 4Z86A 3VO9A 1IXYA 4DEYA 1A7JA 1C3VA 1YVUA 1H05A 1JHOA 2CNBA 3A2MA 3GZJA 4FGJA 4KH1A 3I9FA 5ESRA 4RMNA 1SUFA 4FYIA 3JSXA 1NJGA 2VEOA 4V0KA 1ZIDA 4OB6A 3LWZA 4HCJA 3PEFA 3EEQA 5IAEA 1HFWA 5TLSA 1WMDA 1THGA 1MQ9A 4S1WA 2FLWA 1GG9A 2BR5A 2RGGA 3AI1A 1EM6A 2RGYA 2C03A 4QBKA 4JI3B 4MIEA 2VI5A 4DUZB 1Y9JA 1NBMA 4WLEA 1Z07A 1USGA 2OBNA 3OFNA 1N5OX 3ETHA 1LRLA 2CMDA 4IBOA 1FYEA 2HWKA 4URYR 1H2FA 1IBRA 1O94D 4G2TA 1KTIA 1RVDA 5TV2A 3FLBA 4BNLA 1KFJB 1QVRA 4LY6A 4O25A 3T3EA 4H7EA 3ZHQA 3PIIA 3DP7A 3UB2A 2GN8A 5DBEX 1Q92A 4IIBA 1AUPA 5E0KB 3WO0A 2OP0A 4E5MA 1LA2A 1XMPA 4UBLA 2IP4A 1R0WA 2C5FA 3DDCA 1B0ZA 1EFRD 2D3WA 2AJBA 2NZWA 3PQEA 4CU5A 1Y4SA 1F8UA 7GPBA 1GPWB 3UHJA 3VZCA 2QMUA 3FDJA 5CM8B 5FB3A 4FDLA 4Y30A 2B78A 3QFCA 4DXAA 4EY7A 1I1HA 1JWBB 1LC3A 3BJMA 1M1NA 4IDCA 5A0FA 3V4FA 1W4AA 1IN8A 4QRHA 3X44A 1U7UA 3DZ8A 2XBMA 3QVOA 4J8PA 1RIFA 3P2YA 3SE0A 4TTQA 2QZZA 3UQYS 3M5WA 1J4AA 1P73A