2HBQA

Crystal structure of wildtype human caspase-1 in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hbqA00
3H11A 3H0EA 4N6GA 4EHAA 1RWPA 4PRYA 1NW9B 2C2OA 2H4YA 1I4EB 3UOAB 4AWBA 2XYHA 4QULA 1RWNA 4NOMA 1PYOA 2CNLA 4PS1A 3R7BA 1SHJA 2HBRA 4QU9A 3PCXA 5LUBA 1IBCA 4ZVSA 1SC3A 3H1PA 2WDPA 4IEFB 1RWXA 4N5DA 4N6OA 1NMSA 3KJQA 3BIJA 5IAJA 5I9TA 2AR9A 3GJSA 2C2ZA 3V55A 4EHFA 4QUGA 4QU0A 4JJ8A 1M72A 4QU8A 1RWMA 4NOKA 2C2MA 2CNKA 2HBQA 3D6HA 3R5KA 4JQYA 4NBNA 3KJFA 2HBYA 4HQ0A 3D6FA 4ZVPA 5IBPA 2QL9A 3EDQA 1RWVA 5H0IA 5IAGA 1CP3A 4EHDA 3NS7A 3IBCA 4EHHA 1K86A 4LSZA 1QDUA 4N7MA 5IBRA 1RWWA 4NOJA 3K7EA 2CJXA 2P2CA 3R5JA 5I9BA 1ICEA 3NR2A 3P4UA 1RHMA 2XZTA 2CNOA 3GJTA 4QUHA 1RE1A 3V3KA 5JFTA 4QTYA 4JR1A 2H5IA 4HQRA 2FUNB 1RWOA 2FP3A 4NBKA 4QUEA 3DEHA 4N6NA 4NOLA 3R7SA 2QL5A 3QNWA 3S8EA 3V6LA 4D3ZA 4EHNA 4FXOA 4JR0A 1NMQA 1SHLA 2C2KA 1K88A 1PAUA 2J30A 3SIPA 5IC6A 1RHQA 3UO8B 3OD5A 2H65A 2CDRA 1I51A 3P45A 4FEAA 3RJMA 3V6MA 1GQFA 2QL7A 4NBLA 4ZVUA 5K20A 2QLFA 2H5JA 4FGUA 5IC4A 1I4OA 2H51A 4DCJA 1GFWA 2K7ZA 1KMCA 3V4LA 2Y0BA 2QLBA 1QX3A 3GJQA 4ZVOA 4HVAA 4EHKA 1RHKA 3DEJA 3DEKA 1QTNA 5IBCA 2H4WA 2H48A 3PD1A 4M9RA 4QUIA 4N7JA 4DCOA 5IARA 4PS0A 4JR2A 5IASA 2CJYA 5LUAA 4FDLA 1SC4A 3ITNA 4D3YA 1F9EA 1RHRA 2XYGA 1RWKA 4JQZA 2CNNA 3R6GA 3V4OA 4QUBA 2H54A 4QUDA 2J32A 3DEIA 4PRZA 4QU5A 1BMQA 3R7NA 3E4CA 3IBFA 4QTXA 4ZVTA 4AW9A 4EHLA 3PD0A 4IYRA 3R6LA 5LU8A 1RHJA 2XYPA 3H13A 4ZVRA 2QLJA 5IAEA 2DKOA 2J31A 1SC1A 4I1RA 3EDRA 5LU9A 3D6MA 2J33A 4JJ7A 3KJNA 4I1PA 2FQQA 1CVRA 4DCPA 3S70A 1JXQA 5IAKA 3SIRA 5IANA 3H11B 4EJFA 2Y1LA 1RHUA 2NN3C 2HBZA 2XZDA 4QUAA 4AWAA 3NKFA 2C1EA 4D3XA 1I3OA 3GJRA 4JB8A 4JJEA 5IABA 1F1JA 1NMEA 4ZVQA 4QUJA
chains in the Genus database with same CATH superfamily
4AECA 1Q1NA 1YBAA 4H35A 3VSDA 3AVTA 1DT5A 2JFGA 4QE3A 3ADPA 4AK9A 2NUAB 1XMQB 1K3TA 1D2AA 4FZJA 1CY8A 3C5WP 3PUXA 4UDYX 4XQCA 5C0OE 3ETNA 5EHQA 4D9GA 4INJA 1X7YB 1HYBA 4NG4A 4W5OA 1V6AA 4N5HX 2XD9A 3DLTA 4L4ZA 2YV4A 4QLAA 5BQOA 1XO1A 4RQBA 4CKXA 2ES4A 4BO6A 5FF9A 4PYMA 4OI1A 1MB4A 2P2DA 2QTVB 3T3MB 3H1PA 4CL3A 4K1LA 3M6UA 3MLBA 1PFUA 2EHJA 2GRUA 5I9TA 1JVSA 2W2LA 2ZDHA 3SS8A 1EFDN 3CRW1 1JH8A 4ZCPA 4YMTA 3FKQA 2HR1A 4DA9A 3R5KA 3VPFA 1ZUHA 3KB2A 2WQ7A 1L3BA 2IPAB 3GVIA 3FB1A 3NATA 1I6KA 2IXBA 3EIUA 3HA2A 2YIDA 4PQFA 1K86A 4HUJA 4UQOA 5LC1A 1CRWG 5KWJA 2XMCA 3C5CA 4X0EA 1L6RA 4ZVKA 3GEDA 2YKGA 4EI9A 4ENSA 3R9XA 3OWXA 1VCMA 4Q3AA 2RC5A 3LV8A 3I2FA 3REQA 4OXQA 2J07A 1V11A 2VDJA 3CIOA 1OYWA 1UEJA 2BELA 3GRPA 5THKA 3ZHBA 5ADWA 4S04A 1HDEA 2NUTA 5D1NA 1OAKA 2QN1A 3G2QA 2YR0A 1UFRA 3AYZB 1F6DA 1YQGA 3BFPA 2XYVA 1RYFA 4TRRA 1BROA 1X1TA 3RIGA 1CXZA 3ABSB 2EJCA 2WFZA 3JRWA 3ZY2A 4JGBA 2LZ0A 5H83A 1U3CA 2G36A 2DRIA 1GPBA 2UZ3A 2FWMX 1MC5A 3CUEF 1IL0A 2BRUC 2Q8PA 2CF6A 1VHQA 2DPYA 3C6BA 1L4MA 3BA6A 3N7TA 4Q4HB 5CGQB 2JFOA 4UUMA 3GJ8A 3E2IA 3H6GA 3NCTA 3WMFA 3AJAA 3FG9A 3B3QA 4BX3A 1DRJA 4MUNA 3JU3A 2H1VA 2HA4A 1DTEA 2IYNA 3PEEA 1YB1A 2A1IA 1BE6A 3JWGA 3OM0A 1OFUA 1RMYA 3N58A 4NKRA 4E2YA 1QYCA 2IYWA 2PFSA 1DAFA 2BHTA 2WVJA 5EKSA 2VPZA 1NVGA 4KDEA 2C99A 5BSUA 2QMEA 3VNUA 2X5KO 5AW8A 2DERA 1G5RA 5F2EA 4R4JA 5LLDA 1Y9ZA 1SC4A 1RZ3A 1OU4A 2GUGA 2R87A 1TJ5A 3K1YA 4IJWA 5TQJA 2P0AA 4WSOA 2PZLA 5ALYA 3V00A 3WBFA 1VGQA 3GEGA 1FTWA 1HNXB 2FUG1 2FOIA 1GJRA 3IBFA 3SLGA 3P26A 1E9VA 2ZJZA 2DFLA 2YVQA 5LU8A 2DUUA 3U0BA 1JXOA 1PVVA 4J94A 3N8HA 2ACKA 4V3BA 5L3QA 3MHTA 5HRCA 4DYDA 2NT4A 1EUDA 1YRHA 4JJ7A 5C4IA 5JR3A 1H8HA 3KJNA 3A4LA 1PR5A 4X94A 3OLZA 2W83A 3B6KA 3Q2IA 3E0QA 1S6YA 1U6JA 2EP5A 2C3MA 4JLOA 2ZBRA 2QT1A 2DXIA 1OAAA 2Q5JA 3JQ8B 3KAPA 4GI2A 1J8YF 4KVFA 4MW0A 4PLPA 4L76A 5E1BA 3TVDA 3VX4A 4LDQA 4MUYA 4X60A 4JLUA 4ED9A 5MF6A 3Q3VA 3ZW8A 2X4DA 2OG2A 5TMBA 1HRDA 2XDYA 3GUUA 4YMHA 4QXQA 1RWPA 5FV7A 4IQGA 4V39A 4WBSA 5KNDD 1NQ5A 4JBHA 5GJWC 4B82A 4BNWA 4MKGA 5EFOA 4P80A 4J3JA 3LL4A 4BNYA 1ZP6A 1YDHA 3NHWA 4Q9JA 3VTKA 2Y92A 1NXOA 1C4WA 2AMLA 4HWTA 5T64A 3VYWA 4BQPA 4HLQB 1DBRA 3UBTA 4CZ2A 1POWA 3Q9NA 5H8WA 1C2YA 2HYDA 4V0ME 2J6CA 1KO7A 1QQ5A 2AOTA 1BU5A 2X1MA 5DP1A 4Z0TA 3TCXB 3U3MA 1K9SA 4I6GA 1UFVA 2AHRA 2X76A 4M36A 1PT9A 2PRIA 4JXKA 5ELMA 3EXHC 4HGOA 3A4TA 2E87A 1SCAA 2YQ5A 3MFQA 4J49A 4GOKA 3ENWA 4JT8A 4TMTA 3UC9A 4GMGA 5F2NA 1KSHA 3R44A 4BFVA 4NAVA 2HIMA 3HB9A 5JATA 4QOHA 4ZAWA 4YRPA 3U48A 1LDGA 2LTAA 2PKCA 3PUJA 4NBSA 3K31A 4V0QA 5AW3A 1EWTA 1DEKA 3KXIA 4I81A 4Y6SA 1P1CA 1XTPA 2OBFA 2V5VA 3HM9A 2VNJA 4D81A 2ZTUA 2FF7A 3DF7A 3EXHB 1Q1ZA 4Q7LA 1VLMA 3RS3A 4NZOA 5HA5A 1I5EA 3V4SA 1FRQA 3GPDG 4RPLA 4ES6A 4PLYA 1X1CA 2F3SA 5A7FA 2G4LA 3NC0C 1A8IA 4TKLA 5EWLA 1IMOA 2QGNA 2RHDA 2FW1A 4TV8A 3C3KA 1M1ZA 1M33A 3KHSA 4WESB 5IJ9A 2BKLA 1QBKC 4F9TA 2YZ7A 1GGVA 5K3AA 1YCFA 2JGFA 2JPDA 1KFCB 5B12A 1ZVMA 1WKBA 1RABA 2JGMA 1QOQB 5DCWA 5ER6A 4G86A 3H9CA 2HSZA 1ULAA 4IHQA 3U3DA 1M34A 1K7FB 2XEXA 1KAGA 2WHYA 4H77A 4LY0A 5DTEA 4BJHB 1N32B 4R8RA 1QIIA 2HCFA 2L19A 4IH1A 2RDMA 3M6AA 5JYDA 3BM5A 1R5NA 2CHQA 1KVUA 1MGPA 2HF7A 2QTAA 5AXBA 3U3XA 3RNOA 3AF6A 4MV6A 4B0PA 2D4HA 5H3LA 3BZUA 1OGJA 4M1SA 3IUQA 2R7NA 2ZB8A 1HE8B 2EX1A 5ENZA 2VF7A 4QDTA 4F4FA 3FCSB 4DV5B 5B58T 3MXOA 2G9QA 4PN3A 1QMPA 3C8MA 3CA8A 3M9LA 3TI7A 2C0PA 2ZYVX 3K0KA 5B7NA 3T3EA 3F3KA 1TA9A 3FF1A 1GCIA 2FMXA 1RAIA 4XSGA 1YDWA 1Y5RA 2G5PA 1UC5B 4HWSA 3A36A 1BVYF 5AVRA 1DAKA 4II2A 4L2IB 4Q18A 2ZSJA 3KX2A 3UAOA 2OQIA 4G8JA 1T3GA 5AJVB 3BXEA 2YJ3A 3MJDA 1DL5A 1NZDA 4KTVE 2RKOA 1Y9DA 2HSGA 3B53X 3LA6A 5GM2A 3GV0A 4FWTA 1QBGA 4G0ZA 3R74A 5FR1A 3S1AB 1EI9A 4GF5A 4A9AA 2YJZA 3KUXA 5AKEA 1JLSA 2EC5A 3GUYA 4BO3A 4DREA 1Q7EA 1SG9A 3QNMA 4Q1BA 2ZJ5A 5EUCA 1HLFA 1PZEA 1AK9A 1E9SA 2VEDA 4MPPA 3NC4A 2VDQB 2QU8A 4RQAA 1HURA 3JASB 1FXWF 2J46A 2PLWA 4WDQA 5BNFA 4RTRA 2D6FA 1C0EA 1LPSA 4MB2A 4MVJF 1L7PA 1NMEA 4PLVA 3EEYA 3NBKA 1W7AA 1AGPA 3GPCA 1DJPA 3D6TB 1KZ9A 4WE3A 4RPGA 1CBUA 1Z7BA 4XEHA 5DM70 1K27A 3K4HA 3N2KA 4EX7A 4IDEA 3L18A 3QWBA 3DGFC 4NOMA 4TYMA 5EP2A 4YT8A 1AMOA 1XEWY 5BW8A 2WWFA 3CINA 4L16A 3UIEA 3IAEA 5F2OA 2NTYC 1I4DD 2VQ3A 3QMWA 4N54A 1J2JA 3S3TA 5J2TB 4OL0A 1Q0LA 4Y0VA 2JARA 4TLDA 2XVAA 3NAGA 3AEYA 1WKVA 3OQJA 1KYZA 1ZITA 4DEYA 3W5DA 3BE4A 3DKPA 3V55A 1IMJA 2PIAA 3IRVA 3M3DA 5DNEA 4GSYA 3WGJA 3BB3A 1QR2A 4ZN6A 3UYLA 2HQBA 4HEJA 2H1IA 1MVNA 2OBYA 3IQWA 2AN4A 2PZKA 4M8SA 2XMRA 3LSTA 1E2LA 1UEXC 4MWEA 3ZZTA 4C76A 1TAQA 2ZIXB 4DM4A 2EL9A 1XWIA 3PXAA 1O7JA 4GPBA 3RE1A 4R8VA 5IVDA 3OSZA 4D92A 1JR6A 4QNRA 4YMIA 4YV7A 5JNSA 3NU1A 4ZU1X 4L8WB 2Z2IA 2RGEA 2PZ8A 1F8FA 2RGNC 2VXOA 3SEAA 1RBQA 3O8RA 1M2VA 1WQ1R 3Q8MA 1JHMA 3KXPA 1EBBA 3IMFA 3BFJA 1FTSA 1H2XA 2PO5A 2VJYA 1GHTA 1RYYA 3C7DB 3CHYA 3GD5A 3BX1A 4FOPA 1DQYA 5HMMA 2G4VA 4OH1A 5LYYA 3UJNA 5HCIA 4FXOA 5KAMA 1K5GA 2VOJA 4HY3A 2WHQA 4BBAA 2QVYX 3THSA 2AA3A 4EKDA 1VG1A 4J7CA 6AT1A 5L4SA 1K97A 2I2FA 5DYWA 3EXFB 3U3KA 2OCBA 3OEED 3AR3A 5EWJB 4B3GA 1QZUA 2H31A 1NMXA 4OMFG 4Q9HA 1FBNA 1XDWA 2XLBA 1J0XO 3JVEA 1Y1KE 1MX1A 3Q11A 3QVKA 1FMLA 2VJNA 3HU3A 5KTNA 4F4UA 1P1BA 3L8YA 2CL6X 2REQA 4JBYA 2H1HA 3BXOA 1DI0A 3QKRB 1JQJC 5DIFA 5AJUA 4IO0A 2H59A 1MH1A 1IOLA 3HN2A 2XE4A 1UJBA 2FFBA 2J1LA 3DZDA 4ABTA 1VKZA 1SQFA 2VPQA 3SJZA 3UMGA 4BNTA 1KJWA 5L3SB 3CR3C 3F7MA 4JWKA 3EFHA 3QWFA 1IB0A 1MQ8B 2A5LA 2L17A 2VHXA 1LJUA 1PHPA 1HEUA 4DLAA 1O89A 3RFFA 1LNZA 2NZJA 2D3TA 3BVPA 7YASA 2IH5A 2ZIFA 3LUPA 2WAYA 1Z47A 2OHFA 3CRZA 4NCJA 5FCDA 4DSZA 5AVJA 1KWGA 3CCBA 1M7GA 2AL7A 2DKFA 3I8XA 1IZ0A 2DKOA 3SOPA 3ZU5A 1OQAA 1GYQA 3OHSX 1T2CA 3QVUA 4RHFA 4YJKA 2DH6A 2A0FA 3WAKA 4BNVA 3RAGA 4P3XA 2PZAA 1CZHA 1XDDA 1A95A 1HE4A 2VP6A 1AV7A 1G7RA 1GAWA 3HBFA 5F7ZA 3UFXB 4BIMA 3QITA 4NYJR 4QJIA 3ZR4B 1O6BA 2X3YA 3P2YA 4LHVA 3FSEA 5DYIA 4RA6A 1HDZA 3WLEA 5IZCA 2ZRMA 4J29A 4YJ3F 4EBFA 2HT6A 4OMDA 1YUBA 3HPRA 3FMVA 1Z8DA 3LS2A 2JAOA 2OORC 5IFLA 2A9KA 2BEVB 1K06A 2DX7A 3LVQE 3PI6A 1W46A 5DM2A 3EZGA 3NHZA 2CFOA 2XYHA 2O8CB 1I2CA 5ENDA 1Y63A 3PWZA 2ZWPA 1ZH6A 2DHRA 1KI3A 2FE4A 3I1FA 2HBRA 5GZ3A 1CS0A 3RANA 4IRUB 1ZI6A 2B6NA 3KR0A 3T5AA 4QRDA 1H3NA 1H2YA 4CMBA 4C1BA 4AKEA 2HHAA 2VPIA 1Q1GA 2GAFA 3EGDA 3HC7A 5ALOA 4X85A 4EO4A 1KEKA 2QE6A 2IPXA 2OGUA 3DV0B 1V1RA 1FFHA 1VB5A 2GN6A 2OQ2A 2CD7A 2G5TA 3AVQA 2G0AA 4ZOAA 4GUAA 1E0SA 1ZX1A 4XLZA 2XKAA 1YR6A 2I91A 5K03A 1IRIA 3PNYA 4BFSA 2OKCA 4ZOLA 4ARSA 3X2FA 3I6MA 1GKYA 3DCNA 1Y42X 3OECA 3E2MA 5TS3A 2PYZA 2R7KA 3G9QA 4HH4A 3VNAA 3KC2A 1DIGA 4O4IB 2YWGA 2RH9B 4C5AA 4EF5A 1JIXA 2E82A 2XA1A 1LU9A 1P1KA 3F67A 2DWUA 3L77A 3CNQS 3FDJA 4GC5A 4Y7CA 3IPRA 3TG2A 1N33B 2R8PA 3WB9A 3BFXA 2BT4A 2FMTA 3EG9B 4NCAA 4C88A 2JI7A 2Q07A 2EIXA 3K9HA 3OY7A 2R7MA 2EEZA 1LPNA 2HPVA 2ZROA 4AG6A 1OZGA 2B1QA 2RIPA 1Z5VA 1L5SA 3CZ9A 3WGKA 3KSAC 3AG5A 2FK8A 1Q1AA 3PHBE 3I45A 4P4LA 3RJMA 5ALZA 3QG1A 3DR3A 5EIXA 4PZDA 3DEFA 5DB4A 4LGVA 3G02A 2E7ZA 3PKZA 1QS0A 5G0VA 4RCYA 1U2SA 1S01A 1T5BA 1J42A 4PGMA 1RJGA 4D0RA 1A9TA 4OU5A 4QFDA 5H80A 1COWD 1Y82A 2PR2A 1JSRA 2V4ZA 4J9UE 5CEJA 4QAJA 5EJIA 4ZDJA 4M1TA 1T2DA 2O9JA 2H48A 3IULA 5DMHA 1SVNA 1S3IA 4I8IA 1I30A 1G41A 2ZJ1A 2EERA 4O8CA 1MIHA 5LZ5A 5KSOA 1M1YA 4G1UC 2JCXA 4OKSA 3PNMA 2H92A 3I9FA 5JZ9A 3CF6R 3NM5A 1VL0A 4M1MA 5C9ZA 5IWCA 2JIZA 1T4CA 2WYUA 3P2MA 4IV0A 2C82A 3L49A 2FPMA 4UAJA 5GTDA 5DPMA 5JS1A 3TOSA 3I34X 3LE8A 4CL2A 5ITZB 1U0GA 4CV2A 1MRZA 2NXJA 3M49A 3FMPB 3UWOA 1A8HA 4X8MA 3OQIB 4XOIA 5D6OA 4GQBA 5DTIA 3ZZMA 4CQJA 2X1HA 1NT4A 4OQ4A 3U4GA 2QTZA 3H2HA 4FMDB 2C96A 2XTNA 5IAEA 3JQFA 4E08A 4E5VA 2JJ1A 5BUQA 3BHMA 1QAOA 4CNBA 3NYIA 3VUFA 2XRMA 4MR9B 1N6IA 2P5SA 4QASA 1AF7A 2XGSA 4JU9A 1LVGA 3TUJC 1NUPA 4N18A 4XRRA 3RRYA 3HKDA 4M0LA 3DAOA 2JVKA 3ECSA 3VQTA 1O58A 2AK3A 4C78A 2BI4A 2JFXA 3LUJA 4AKHA 4JS0A 4G0YA 4QYSA 5K0BA 2TMKA 3LI2A 1M2NA 3C6ZA 2DT8A 4D3XA 1FFXB 1MC4A 4OK3A 4IPTA 3HSSA 4U3JA 1HNZB 1RXUA 4BPBA 4JI7B 2HRQA 4C3VA 1ZC3A 2CLHB 3NHYA 4JVLA 1GSOA 3S7TA 1Y8QA 3VFDA 1L6IA 1FVHA 1P1HA 3FGOA 4HX2A 5AK4A 5TQ0A 4KUEA 4DVGA 4LF6B 3FNHA 2IHJA 3B6JA 4MQ5A 1QIHA 2PM8A 4NNPA 4FEEA 1UKVY 2WG1A 3P96A 1P5JA 4M83A 4CKCB 2GD1O 1SRRA 1L8OA 1L4HA 2OXFA 1CJSA 2PVSA 4L7VA 2AFIA 3UJBA 4LSGA 5FNZA 2HADA 3PEWA 1JDJA 1U5BB 1B76A 3ACBA 2DY1A 3L7JA 4O63O 4R7TA 5DHQA 2IX3A 3NDJA 3PI7A 3QU2A 4M7OA 4P93A 1UWLA 3ABZA 4I5FA 3GEMA 2B78A 3I4LA 5HOEA 4MDEA 1ETUA 1UBFA 3C7CB 1XD2B 3PIIA 4J03A 2PU5A 1E5QA 4LZLA 3L0DA 2CYCA 4B5LA 3HN6A 1LS6A 1C8KA 2AXEA 3KR2A 4ME6A 4R9NA 5J4LA 3IL2A 2XWJI 1H22A 2F1HA 2FEXA 4RCVA 2YNMD 1S3SA 3IUEA 1EGVB 3EFEA 3QF4A 4N01A 3P97A 4CDNA 2G0NA 3SBXA 1EZZA 4XW2A 4CRWB 1EK1A 1OU0A 3ZQUA 1SVIA 5LXTF 1WV1A 1YJCA 4BZWA 1EP1B 5SYMA 5ES4B 4LPSA 4ZYVA 4LOLA 4WKCA 1X7DA 3F5DA 2GVNA 1K88A 4E21A 3DEAA 4CM3A 3WK4A 5B7PA 3WQQA 2ZREA 2JBAA 2VF5X 5K45A 2XGMA 4M7WA 3P27A 2GXSA 2GZSA 3HB5X 3OURA 4GOXA 1QF9A 1BYUA 3KQHA 1BCRA 3ME5A 4EO9A 2G17A 4FYVA 1T36A 2OLKA 3U9LA 2VZ9A 3MHPA 4L3OA 4ZHSA 5KX5F 3PLRA 5D2CA 2R85A 1BWPA 3F8WA 2HZBA 1E2PA 5JLAA 2I67A 3ONWA 5LJIA 3GAZA 3RC7A 1H05A 3EUAA 3PK0A 1D2CA 1R37A 2COKA 4O0MA 3WYGA 5JZVA 4TZ6A 4I50A 1KPIA 1L4FA 1PRYA 1RC1A 3IBTA 3LIIA 4MV0A 3X2SA 1V1MA 2WF6A 2QDXA 2JCGA 3EBPA 3P94A 4Q1DA 4AJ9A 2XQFA 1YQWA 4AJPA 2O8EA 3M1LA 1EAMA 3LBYA 3GLFE 2HTFA 5G1OA 1LNQA 2IBTA 1E1LA 4QEKA 4A0QA 1PFYA 3KOZA 3GXBA 3DP7A 1BMDA 3AUYA 3L4SO 5DFAA 5MN4A 1J49A 3FPJA 2PLFA 4EPWA 2A84A 2YV3A 3AFHA 3N76A 5ITWA 3RYCB 2O5VA 3ACDA 2RAFA 1IONA 3EVTA 3UAZA 3TQFA 1X70A 5BN5A 4D25A 4KBYA 1OLOA 3BREA 3BK7A 1MA0A 1V4NA 1KAMA 4WXHA 1SCUB 3ZHXA 1W0JD 4URVR 5FR2A 3H1FA 2ZJ7A 1EFVB 5JCOA 3SI7A 2PBZA 2XY4A 3JTEA 3O83A 1RHUA 3CPEA 4MZDA 1QVRA 3RSOA 2M6SA 3ANTA 5AHKA 4I4TF 4CM5A 1KAHA 2C31A 3EEOA 3L8ZA 2OPBA 3BFKA 3O94A 2QY9A 2RFLA 1DEXA 1PWZA 2RJNA 3T1TA 2B2XA 1N6NA 1WB6A 5AKGA 3PC7A 1PL0A 2GF0A 3W5SA 5HBGA 3TX6A 4MQ6A 1Y7PA 1MQ9A 4JUCA 2LGJA 3QQPA 1KY5A 2NO4A 2YASA 1DRVA 2Q5QA 4HMQA 5F64A 4EG4A 3FYDA 1M8PA 3IUSA 4K9PA 2ZJFA 4I8DA 4B31A 2ZRQA 5LMNB 5JU6A 1OVGA 4NSNA 1PDVA 3ZU3A 1D9XA 3KOOA 4L5CA 2ZE6A 3CVJA 1J8QA 1HT3A 1R6DA 1KDRA 3BJMA 1E7WA 1YA4A 1BZYA 2G77B 4P7GA 3KQTA 2A9QA 4Q03A 4H31A 1DARA 2GMWA 1OXVA 2OBMA 3A04A 1Z8HA 1HPLA 1FB5A 4M89A 2C5AA 1Y0BA 1Y8AA 3D4LA 4GL2A 3N53A 4Z3KA 4ZICA 1ARZA 4I0WB 3WHKA 3GN2A 4EGCB 1YZKA 5U9CA 4X1OA 1AQ6A 3FRHA 4IIBA 4PTZA 2C9DA 2WJVA 1SQ6A 4QD3A 3UT5B 3OCYA 4KXUA 1J8DA 1H5QA 4E5YA 4M8NE 3RUEA 5CDUA 2IHKA 1G8MA 1II8B 1EGHA 1T5TA 5EUBA 4BKMA 3IBGA 2UVPA 4JHLA 1E89A 4C06A 4AJKA 4WX2B 2BUBA 2PV7A 4JY7A 4OGWA 1E9AA 1Y4DE 4XPIB 1FNDA 1Z8NA 4HX9A 4LISA 4A2QA 4NDZA 1M76A 5EA2A 4V0NA 1NQXA 3D7KA 1F6WA 3GLHA 4EW3A 2N42A 4BRZA 2D1SA 1UKBA 3BMQA 3QLUC 2QMZA 5DMXA 1BCSB 1FMJA 1ZN2A 5IXYA 3W6OA 2QVZX 3C7AA 4PC2A 1U9YA 4WN3A 3B7WA 5EIOA 1TPYA 3EWSA 1V3QE 3Q1KA 4QUIA 5ITVA 1XKXA 2LBPA 1NXQA 1SBCA 1DWQA 4L7QA 3PXUA 3AVOA 2I3GA 3DUWA 3G2HA 1EJ6A 3JPWA 2AD5A 2OZLB 1XTSA 3L41A 5DXJA 2BFEA 3LWNA 1ESDA 1G5TA 4O2AA 5PGMA 5KHAA 4J0DA 1S9DA 3P2OA 3FMFA 4DM3A 2EFJA 3TIIA 4EGFA 1WG8A 2YXPX 5TIIA 1E9EA 5AVZA 5AM3A 2FLKA 2VJLA 3I6ZA 1VJ0A 3M5DA 5JQGF 2Z6UA 4DTIA 1L5KA 5GGXA 2C4WA 4DM7A 4ZGBA 1L5HB 1VP3A 1XHLA 1NE2A 1PDOA 3AEKA 3B9RA 4MOWA 2IWRA 1RSZA 4CF7A 3HFGA 3FZYA 3EIEA 1HDYA 3EFBA 2OLEA 4I1PA 2IXFA 4DF3A 1PG2A 2XNDA 3UMSA 4ZDKA 3EX7C 3NWPA 2Q3DA 3U4MA 1XQYA 1BO6A 3K2BA 4IDDA 4U9UA 2ZIAA 2AX3A 3WL3A 1OXUA 4Y1FA 1GOTA 1NNLA 3P9RA 4MULA 4QUAA 4B79A 2GERA 4G37A 3VVLA 4P3YA 3NUZA 4CHTA 2ZUUA 4LRUA 1TQ6A 4Y0AA 1GAQA 1JLLB 4B6SA 1EP3B 2GD2A 3OEWA 2FZLA 5CBPB 4GYJA 3T4PA 1OSNA 2C5LA 3MCVA 4HAXA 3LXMA 1J1IA 1PNQA 4C4AA 3AHCA 4LQLA 3F9RA 3E3LA 3OQVA 2W0SA 5TF4A 2REBA 4F5ZA 4MW2A 5HZMA 3PSAA 3PGXA 2VBFA 1Z6ZA 4XGIA 4QXAA 1KK1A 4Y2UA 1DTWB 5K3FA 3BULA 4CKZA 3E7XA 1NBOA 1TK2A 3GRFA 1Z13A 5KJ6A 5JHGB 4MR8B 4B43A 2R8BA 2D54A 4NRDA 2IKSA 2PCLA 5F9HA 1HE2A 3H19A 1E9DA 3UCEA 4B6PA 4BLTA 1GPKA 1PW7A 1FC0A 2UZ0A 3Q7RA 4G0NA 1ZUNB 2Y2UA 4WEQA 5EWMB 3OD1A 3WBKA 2F8SA 4AU1A 1KEEB 2CYAA 2GFHA 4EJMA 1AM4D 1O54A 4MS3A 2YJNA 1DAGA 1MHPA 4M6WA 5JARA 3PEVA 3VYRB 5FL7D 1A5AB 4EZIA 5AVWA 1SCJA 3DCYA 1ACJA 3SNKA 3K7EA 4TMWA 1CQIA 2GDZA 1YI0A 1ZU5A 3ZDRA 3IKMB 3IV9A 3ANLA 3EXIA 1NBAA 1N2CA 4OA8A 1OC2A 4Q7JB 5ECGC 3ROKA 4S12A 3PTAA 3B7PA 4MKXA 3VR4H 5CCBA 1ZJ6A 2ZITA 3ZJUA 4A6PA 1KMHA 4DRYA 3T15A 1HFEL 2ZUBA 4JLAA 2Q5OA 3STHA 3LG2A 3LUGA 4EYQA 2BI8A 5FX2A 3DFFA 1QE3A 1JHOA 3STUA 3FSGA 5I4IA 1P6XA 2PL1A 4E6PA 4JASB 5I8WA 4WESA 4OLAA 5AVYA 5ABPA 4C5BA 5K6AA 3P0RA 4UMDA 5CIQA 5K09A 3HI4A 2E4VA 4FVTA 3M1AA 5AICA 3FTFA 5CFOA 4KQKA 2FMHA 3HL0A 4TLCA 3SYRA 2QZZA 2R2GA 2WP8J 4AY4A 2OFWA 1Q0RA 1SD2A 4M9ZA 1PO7A 2PO7A 1IEXA 2CBGA 1C30B 2AG6A 4IGFA 4REMA 2ZJ2A 4EHKA 1WCXA 3IQEA 3GEHA 4D9BA 2F1RA 5JPIA 4ZCTA 1S0UA 1W48A 2CEAA 1WULS 4JLJA 3WLQA 2JIRA 2I8AA 1VOTA 2HUPA 3RS7A 4Q01A 3W5BA 2ONJA 5HKKA 1QPBA 2OXCA 2ZS9A 3G2PA 3GJ0A 5EE3A 1YZGA 3H1BA 2NXEA 1BGVA 1VECA 4NF2A 1Y7LA 1JNYA 4NMLA 4MCIA 4RZIA 3VSEA 4HS4A 2HF8A 2YX1A 4LRQA 2LE0A 3O4JA 5DM60 1RCFA 2PX5A 3W8NA 2CCJA 4LXIA 3AH8A 1ULBA 4OHUA 4ROTA 3VC7A 4EDFA 3E18A 3KFVA 4FFBB 3GELA 3EVEA 9LDTA 3UK0A 5FOSA 3DMHA 1AUQA 2PSJA 121PA 3K09A 4OP3A 1LD3A 5GIPE 5AXAA 3FM9A 4NJEB 5L3RA 3T94A 1AGYA 1Y8ZA 2WWHA 1PWYE 4TM8A 2CZGA 1ST2A 1UBGA 4XWWA 2WNHA 1E2QA 2QN2A 3H5NA 3N2EA 5GJBA 2X1LA 3QIVA 3GLUA 1Z37A 2RKWA 3H97A 2XNSA 4F5YA 4C4XA 4PQRA 4XVUA 5IKMA 3R8XA 3WGYA 3LY7A 5EXDA 2CK3A 1E1NA 1ML3A 4HNSA 4D99A 1PS8A 1SBZA 2ZRFA 4H4EA 1PEDA 1T35A 3IEXA 3M83A 3K2QA 3W77A 1EP2B 4IICA 3N8DA 2JFZA 2ZI4A 3WLTA 4LX8A 1MEEA 1TK9A 3OOSA 3W2FA 4IDAA 1OAOC 1TM1E 3OZ7A 3E1GA 4PXYA 1PFVA 4WXRA 3TSCA 5IVHA 4KKVA 2GHTA 3TRDA 1GA1A 5LUBA 1R7RA 4FGWA 1FP4A 4DIOA 2FKAA 4URYR 4O25A 4GBJA 4PX2A 4ARCA 4GPD1 3FVTA 2HWXA 3VHXB 4ASUA 4TLAA 2JDIA 3TZEA 1X80A 5HGXA 3PL1A 1RWMA 4L5BA 3U44A 1QPZA 3PX7A 3ST7A 5J2TA 4EB8A 3KB1A 5BSTA 5HVNA 1KIFA 1THZA 2HK9A 4EWLA 1CEXA 3E6AA 4X9XA 4ZA2A 1SC6A 2Q6VA 4PG4A 4A03A 2XJ4A 4KKXB 1ZJJA 2V3CC 1VKHA 4HZIA 2NGRA 3B52X 1E0AA 1T1EA 2H7YA 3FW1A 3KD2A 3R77A 5AJWA 2ZW9A 5TQ2B 3GO4A 4W8OA 1IC6A 4YV0A 3R5JA 4CFYA 3FCAA 5F4BA 2A4MA 1WDLA 2IKQA 4PCVA 2AEFA 4MWCA 4TL8A 5ERYA 2FZWA 3HVIA 1XQ6A 4NV1A 2ISQA 3EA0A 4RENA 5AKKA 3AM1A 2Q0HA 1K92A 1ZIYA 2KBFA 3HV0A 4BN4A 2X8BA 3AONB 1K7XB 3GK3A 3LVBA 3LGAA 3HFRA 3GL9A 3ZY5A 5LQAA 4CT5A 3R7DA 3LKBA 3R7SA 5C35A 2FXIA 4NV0A 2XMPA 5MGBA 1RJWA 4L75A 1L4EA 3FOAA 4IAOA 3ZE0B 1W5EA 3VHLB 3K6SB 3E1KA 2EWMA 3NV7A 1NDHA 4Q93A 3V6MA 4UTZA 1GQFA 1WOMA 1JEQA 1JT9A 2PN1A 5GGYA 2O7VA 4QOIA 3ML1A 4E07A 3WLPA 3IO5A 2XB9A 3FSJX 2XUHA 1HF3A 1X94A 3KQUA 4YAOA 3GY0A 4BZQA 5JECA 1D1PA 4FIDA 3ETGA 4NMMA 3RRXA 3G8CA 2BHLA 2FPXA 5AVQA 1AN0A 4LQ4A 1ZIPA 4Q16A 5DGCA 4UAGA 2XCUA 3FSRA 4EENA 4FKMA 3R3YA 3NBFA 3H2BA 3RABA 1DUSA 3E5HA 3L40A 4YRDA 4C4PA 3O8QA 1M8JA 5HFNA 2O23A 4BTEA 4RTPA 3ZJTA 4O4HF 4PHHA 5CHYA 1SZCA 2CDAA 2EDAA 4U4AA 5AKHA 4XGQA 4D43A 2DPGA 2JZOA 3SDBA 4KN9S 3RTBA 1MFPA 1SZPA 4LBVA 4GBED 4AJHA 4CGYA 1E66A 2WHXA 1XZKA 5GV7A 3RV4A 3OZVA 4W6ZA 2V7XA 2VRNA 7MHTA 3BWDD 4GL4A 5BXYA 1K2WA 1ZGJA 4V0OA 1HOXA 5L3SA 2LD4A 1NVAA 4KWEA 2NAFA 4EYGA 1F4VA 3GRAA 4DLBA 3TLZA 1J22A 4S24A 2PR7A 1LDNA 5I9IA 1X13A 1EEHA 4XIYA 1C7FA 2P1ZA 4PG7A 3RKRA 1E6CA 1AG9A 2GVZC 3BMOB 4NFSA 1LDMA 2C29D 3UPUA 3R7WB 4YRFA 5EJEA 1ZK4A 1R12A 3Q7PA 4A8JA 2P6UA 4GWKA 2WYHA 4DQXA 1ZOIA 1QYVA 3GYBA 2PUEA 1WSDA 5BMVA 4FHDA 3UFXA 3IQGX 5CB0A 3CB4A 1EHIA 4M21A 2B2NA 2ZB4A 3E0XA 2ZJ4A 1H85A 1Q2UA 1GU7A 3D3JA 3ZI0A 2WKWA 4AY6A 1L5LA 4FTWA 1OWNA 3U62A 1CT9A 3BH0A 3DJFA 4OU4A 1ND6A 3SQXA 4TV8F 2FEWB 2GRJA 1R88A 2P69A 2RGAA 2WD9A 3BB4A 1G291 4GM4A 3T61A 1HDGO 3GFBA 1LK7A 2OV4A 1VIAA 4WMLA 3STYA 3A06A 3KTFA 4WEOA 221PA 4C07A 2AW5A 2ACVA 2P4QA 4W5TA 1ZK2A 3D3EA 3GGCA 2JANA 3PLNA 1H65A 1J23A 3TLAA 3JYNA 4Q7KA 2EWVA 1U1GA 2YUTA 1VYHA 2BFFB 1J8VA 3JARB 1C9DB 4G4GA 4G4IA 2XHEA 1B1AA 4XTRA 4BQRA 5BY2A 1UOQA 3GJYA 4IILA 3OZIA 4MRSA 4OUDB 2PUBA 4EA6A 2WYIA 4XDHA 4QEDA 4GECA 2RHBA 3BORA 5JDIC 1E1DA 4LXQA 1Y6ZA 3OLQA 4MMZB 1M6EX 5EHIA 1BXZA 3KKZA 5H02A 3SZ3A 5B6IA 8GPBA 5JASA 4Z7OB 1IHPA 3P9QA 5CLQA 4DCNA 1FW6A 1L4BA 1L9XA 4DQKA 4A16A 4OFZA 1W2GA 2CL0X 2NUBA 4O4IA 4ZYTA 3GT7A 3E82A 2CV0A 1X39A 1B14A 1OYYA 2NG1A 3BTVA 4FS8A 4HDNB 4LRTB 5DH9A 4E2FA 2GZAA 3JZAA 3KU1A 2JLAA 3ESYA 2J9FA 2YN2A 4KMOA 4QG7A 4UNRA 1ODSA 2WJ4A 4WZAB 1CU1A 3FOZA 4YHHB 1L5GB 4AXXA 3ZIAD 4B0OA 3WIBA 1UAYA 3R0IA 1CZNA 1USKA 4PFSA 2IEGA 1EA5A 5EJ2A 5BW6B 4BKQA 2JAXA 3GJ6A 3SQNA 2QNBA 1C7QA 1XEAA 2ZKIA 2ZBEA 4DV4B 3LFHA 1NVWQ 1X9IA 4HVAA 4PSAA 3DEJA 3KBBA 4Y6GB 3J80A 1C0KA 4HMOA 3HXMA 4JVSB 5H9VA 5LQCA 1OROA 2W2NA 1UJCA 2XMBA 4TLMB 2PTGA 2B5VA 1P77A 3UJHA 4ZI7F 2Q6IA 3IE2A 1JR3A 1UADA 1ZMTA 4JUBA 3IS3A 1VGRA 2F00A 2Y99A 4UULA 5BWMA 3ASUA 3ZZ1A 4TQUS 4RMHA 1V3UA 1SWWA 3GZNA 4ZAZA 3TE6A 2PY6A 2ZUTA 1MX9A 2VXYA 2WKSA 1A5SB 2EOAA 3ZWXA 2YC4C 4MRNA 4C0AC 5JTUA 3MIIA 4E03A 1KDVA 4JXJA 4JHXA 4YAKA 2JI6A 1AQNA 4UCWA 4M98A 1T1JA 4QYIB 2VI5A 4CJXA 5GONA 4M0DA 3EIXA 2X86A 4Q9DA 3GX1A 2NWQA 2C4VA 4TXLA 2HCTA 2FTKE 4ALKA 1GNRA 1EG2A 1ZSVA 1Y48E 1Y9JA 1L1EA 3O3CA 5TF0A 5ALVA 3W8EA 5BNTA 5IS2A 3HYRA 4PBRA 4EI2A 3J7AC 1C1HA 1BDIA 1U1DA 1HQCA 4IP0A 4NBTA 1NBME 1CUXA 3PG5A 5FA5A 5DKFA 3SQDA 3DYBA 1O4WA 2RB5A 4IJKA 4HXEB 2PV0A 3B1YA 5BSEA 5I4CA 1ZJ4A 4WFIA 1A9XA 3UMYA 4JH0A 4WNAB 1K7YA 1T0JB 3WMWA 3EDYA 1RC8A 4Q9AA 4X6XA 4E13A 4NDAA 3THXA 1TC1A 3BDIA 5HSGA 5C51B 4LMAA 4Z0NA 5J9FA 2YW2A 2BTQB 4DBLC 3TLGA 4EA9A 2ZT7A 1FFXA 4AJIA 5BV0A 1ODIA 2PSFA 2FN7A 4UHDA 3LCCA 5AIBA 2UUCB 5AW4A 2I80A 2QXTA 2ZSHA 3QYJA 4FMCF 2OHGA 5HRUA 2O8DB 1E5XA 3TD6A 3HZOA 3HZZA 2AR9A 1KO5A 4MVJH 4YECA 1I5RA 5DNAA 2MHCA 3K0AA 4X66B 4PF1A 5HE8A 2XQJA 4N39A 1JS1X 2B4KA 2OHOA 3NIGB 3T7CA 4IQ0A 4C7BA 5I3ZA 1RYBA 1RVDA 4W9NC 4NMWA 4IGAA 3KQKA 3KQQA 3JATB 3B51X 4GRIA 5AI9A 1XCPA 5HS6A 2A35A 4O4JA 4JXZA 3QX8A 4DBZA 3OEYA 3WQBA 3TQRA 2C5GA 3IODA 3ZWMA 5LDHA 1FP1D 2WNIA 3UANA 4BU0A 1NFRA 2ZDQA 5FJJA 3WK9A 1JX6A 4P92A 2NLOA 4EVSA 1NX6A 1SKQA 3V33A 2QRVA 2MTBA 1E5VA 2ALJA 4LOHA 4ZT4A 1EM6A 1PJBA 4U6NA 4AJ1A 2AGVA 3W2TA 3OUUA 5KYXA 4GSLA 1YZ3A 2P3SA 2VIIA 3G8AA 1G3MA 1PTJA 4ZT2A 2OSBA 2XDQB 4HQKA 4G56A 4Q7QA 1R6BX 1L5ZA 5BOSB 2D5CA 1C1XA 3B6ZA 1QG4A 4FWIB 4KO1S 3JAMA 2R1VA 4Q9NA 3A28A 3W8FA 1ZGAA 2GLXA 4R69A 4WINA 2QJRA 1BE1A 3W3AD 1DXYA 1RAGA 4BLSA 4MUIA 3SKVA 2NU6B 4D4JA 3HS3A 4DXHA 5HDQA 3VO1A 2Z2YA 4DFDA 2A5FA 1RLUA 4BMZA 4GP9A 4DCOA 1TW3A 4LI3X 1UCFA 2RG1A 3IQZA 3J81k 2HPHA 3USZA 3U0VA 2CFIA 1JAHA 2IDMA 4ITUA 3Q5GA 3T9FA 2EARA 2AWNA 5AI8A 1LZKA 3NGMA 4YY3B 3IUPA 1AX9A 1S2OA 4IEEA 3T5GA 1E61A 2YMPA 3RNLA 4FINA 4AUMA 2EGHA 1WSBA 2VH1A 4F12A 3ASYA 3AVXA 4ZTUB 2JB9A 4AY2A 2YWRA 2PA3A 4X8LA 1ADGA 3DTTA 3R20A 4MCAA 3EK2A 4G5QA 4PWZA 1RYDA 2AD1A 3OCJA 3VR2A 1HFKA 1RI5A 3L82B 1F2TA 5GIOE 4ZCIA 1T4GA 1P2TA 1C3OA 3B2QA 2OVFA 1SB8A 3EDRA 3Q0EA 5IK2A 1FZTA 2QYSA 1JBEA 2Z09A 3IKJA 4KZKA 2NTNA 2BKAA 4HD8A 3VSAA 2O3QA 1JAZA 3KNZA 5IYZA 4KP7A 4RS3A 2FDCA 2OGZA 3OY2A 2ZXFA 1QR6A 2LKDA 3MUOA 5BURA 3NOXA 4QFCA 2ZIEA 2SCUB 2VJCA 5BSWA 6ABPA 1G9SA 1OUMA 4KQXA 5IM4F 1CR4A 4RKEA 1Q7RA 3ORYA 4FS3A 5FEUA 4MS4B 3SJUA 3HDTA 3VTAA 1OXBB 1TKRA 4HFRA 4XVQA 3V8BA 4UQPA 3WXMA 2ZYSA 1WXFA 4DCSA 3DBIA 4DLKA 2PXCA 2Q3LA 1ZL0A 4LYAA 3A1VA 1IZ9A 4KH0A 5IUJC 1DPFA 1Y6RA 1THGA 3E4DA 3B1JA 3QXJA 2NX2A 4CI9A 2Y1FA 1G21E 3MF4A 2IH2A 4O4LF 1WX1A 1QZTA 2YDXA 1DKOA 3CUYA 4GMXA 4Q19A 4Y2JA 4DOMA 3VSCA 3OOYA 5T8KA 2O8FA 2QLMA 2HCJB 5IJWA 1UMDB 1F48A 1QHFA 3E9EA 2OGWA 1P60A 4HTFB 4BXOB 1ZDMA 3W6UA 1N92A 4MEBA 2PMKA 2ZKLA 1KRHA 4X7RA 3ZHOA 4NH4A 4QJBA 3HADA 1FVFA 2AJCA 1W2HA 4AG3A 4B83A 4L9SA 4DLWA 1J20A 4K5QA 4C29A 2FW0A 1V6CA 2WAMA 4LWQA 5ICGA 3GLIB 3C3CA 1F2UA 1TLFA 3KZ1E 4PAOA 4S0ZA 2WQ6A 1XA4A 2EJUA 4B7ZA 1WUIS 1NRWA 4IFBA 1P7CA 3B78A 4GUDA 1Y1SA 1WDMA 4HDQB 3VDXA 3CZCA 3TDKA 1C2TA 1MDBA 2P79A 4FHCA 3WQSB 3AHHA 1QQ6A 4Q00A 1E8DA 3FJYA 1EH5A 3ZWPA 4FQ5A 3MBIA 4WH0A 2Z30A 2W70A 1P17A 1UBNA 3C2QA 4IVNA 3ER6A 4D4HA 1DMRA 2HY7A 3UT5A 1SHLA 4MVJP 4RC9A 1G18A 1HG1A 2EG9A 1KVRA 3OVMA 1Z4LA 5HPYB 1ZD8A 2ZXUA 4CVNA 3PT5A 1RU3A 1X1EA 3BGOS 1CWUA 1LW7A 3IR5A 1II8A 4ER6A 1U8TA 2VHUA 4W63A 1VZ2A 1SBTA 3V42A 5KSZA 4KPYA 1RQNA 2W6MA 1Q2XA 4RIIA 2O19A 1ESEA 2WYOA 4AN0A 4DSAA 1IPHA 1U04A 2AXPA 5CJPA 1PNTA 4ZGGA 5FWNA 4XPIA 4EI7A 1QGAA 1QCDA 1AXGA 3DE3X 3MQ4A 2H2WA 1ECGA 4JUAA 4D3SA 1XD9A 1KYXA 2DWPA 1O6CA 2Q7OE 5ILOA 4OHYA 4QX6A 5K4GA 3ORRA 3EY9A 1P9OA 3W2EA 4BV3A 1F9EA 1V95A 4W6QA 2G9ZA 3V3TA 4YREA 2WWTA 2D0OB 3A6FA 2J7PA 1IJEA 3CLHA 2C57A 4YFYA 4X93A 1HQKA 5CLHA 1V96A 5E0OA 1TQDA 2NADA 3JW8A 5HBRA 2B7LA 2X1VA 4KMRA 1N7GA 4NYMR 1F51E 5EKUA 3UICA 5B2FA 1D7AA 2B4YA 4OATA 4Z2AA 5J4VA 1K6JA 2UUPA 2GCGA 2VK1A 2NTJA 2O54A 5ALEA 3K9FC 2BVNA 3F4BA 2IPOA 5FP0A 1JVBA 3HV2A 2ZWAA 2HRRA 4DCPA 2JAWA 5CB4F 2G9NA 2Q5LA 1QV7A 3I12A 3PP8A 1B42A 3WB1A 4INPA 4B4WA 2FZ5A 2ZIUB 2AZTA 4TQGA 2Y2VA 3DONA 3JALB 4IVPA 4QFBA 4B6EA 5L8VA 3U1BA 3AF0A 5A5FA 1DQZA 5IDWA 2C1EA 4YCNA 1CUYA 1T8RA 4G97A 1JAXA 4TLEA 1E7SA 2IQIA 3SSAA 4R1PA 4LRYA 1TXGA 2JAPA 4RVDA 3EYWA 1RYMA 1QDLB 2PL3A 1RXWA 1CLUA 2Q50A 1OHHD 3MOSA 4WFQA 3QMPA 3COJA 4KDCA 3NVKI 2Q1TA 1JSZA 4BE4A 3DEZA 2DYKA 1J24A 1PR4A 2Z4TA 3LZDA 3OX1A 3VU1A 3ZS8A 5HX7A 4BECA 3P0FA 3B6MA 2PSHA 3WIVA 1RKBA 1S4MA 2AFRA 5K0SA 2G82A 3V34A 4MVWA 4UHEA 5JEDA 4HXGA 3BILA 2ZDGA 1VG8A 3QE0A 1Z0IA 4FOTA 4PHCA 3WWCA 3CG4A 3PJGA 1IVNA 4FBGA 4CCYA 1NYLA 2ZVJA 4C6RA 5ICFA 4WTOA 4U7DA 2YZMA 5CH8A 2Z1DA 4K6OA 4DWOA 3TZQA 4B87A 4KI0A 3SR3A 3UXMA 2WBLC 2H08A 1ZUNA 4RM3A 5ALNA 5K4AA 3V7YA 3WDKA 2VEOA 1YOVB 1KEEA 3JQAB 3NHUA 3CKYA 1AHIA 2P2SA 2VUUA 4J76A 3WOVA 2QMYA 3UBMA 4ALMA 2JLVA 3I9JA 3IERA 4XTCS 1FRNA 4UE6A 4CV1A 3LQFA 5CBPA 4XQ9A 3PNKA 1LFDB 3G5AA 1TJPB 1PT5A 3DC7A 1NVUQ 4F9GA 5C5CA 1ZUIA 3LQYA 4UREA 4WCFA 4WZBE 1SKUA 4R16A 2ERCA 3R5SA 1E9CA 3HRIA 4GX5A 2JI8A 2PUDA 1M5RA 4URZR 1FEZA 2HA7A 1DBVO 2P2ZA 3KKPA 5B37A 2VZLA 1UBUS 2I4TA 4HPJB 4L22A 3JS5A 3UV6A 2GYWA 3R09A 4JBWA 1MR3F 4MRAA 1AZTA 4RV9A 1I4OA 3FWNA 4BNDA 5A0VA 4L27A 4WKOA 3FRJA 3GLVA 2ZIGA 3AF5A 4E51A 3D8RA 2OO5A 3HBJA 3ESZA 2Q4DA 1TRKA 2Z4SA 3DVQX 4P54A 3O3MB 3T0FA 1QV9A 4JJ6A 3WGUA 3FHLA 4GMFA 4DDTA 2X9QA 1VYTA 3OQOA 2R96A 4G09A 3RGGA 1FPQA 4UU7A 3EZ7A 2UYQA 1FRZA 2JATA 1UPBA 1X7WB 3BSSA 3ETHA 3NWJA 4TXNA 4XUGB 4BLVA 5IVKA 4RY0A 5KINB 1XVVA 3QE9Y 1A9YA 4TTSA 2IHUA 5H68A 5DE3A 3ZW9A 3DUFA 4PPYA 1NUAA 3T7AA 1W0KD 5JMWA 4P4SA 4RTQA 3R5HA 3J81A 1XMOB 4WLFA 1YQQA 3M6FA 5AKYA 3SM9A 4LJAA 1A9RA 2ZWVA 3NHFA 3G2LA 4R0NA 4K40A 4YRRA 3GRYA 2V6JA 3PFIA 3R6TA 2RBKA 1VLLA 1DAMA 4LZNA 2P3LA 3C1TA 5AI6A 4WLEA 2V4UA 2QPAA 5J63A 3SSOA 5AM2A 1V7PC 1Z39A 2AFHA 2CKDA 2CYBA 3SHFA 4PZZA 4RO0A 3SZGA 2JFWA 2B4TO 3H8SA 3TQCA 4OYRA 2DTXA 5B2ZA 3A10A 1R0WA 2EL7A 1IZZA 2JZCA 4J16C 1LRLA 1R6UA 1YSCA 1N9GA 4J07A 3HA3A 4NTZA 4C01A 3D6AA 1PL7A 1IWPB 1GRRA 2P0EA 4EJSA 4MI6A 1VXRA 2I29A 1Q0SA 2VQ6A 3H75A 4MPDA 2O7QA 3AWDA 2VRCD 3FIUA 1V2GA 2QG6A 1B43A 1D07A 3FFXA 3F6BX 4FD2A 3QVGA 2CLMB 1XLTC 1ISSA 1ENYA 1JN0A 1QVWA 1T8PA 3JD3A 5FEMA 2QQ0A 1I94B 1OXXK 1YE3A 4G5GA 4WJLA 1ESNA 4RIFA 1FUUA 2WDPA 2R00C 3K3PA 4GOMD 4CL8A 4JJIA 3KOMA 2GN4A 4RKWA 5EJ8A 3CEAA 3H3FA 4LN1A 4UQLA 5JI3E 2PLNA 2R5FA 2IEAA 1G5FA 1SBIA 1YAHA 1P4RA 2II6A 4KQ2A 5E7JA 5K8LA 3A1FA 1N7IA 3S4YA 1JSXA 3S55A 4DLRA 1XIVA 5B30A 3I1JA 4ISCA 5L95A 3RYFB 3HO6A 4REQA 4YRKA 1K6XA 3HO8A 1QGZA 4BKUA 3N87A 2GSWA 2BWJA 1P5ZB 3P4UA 1CG6A 2P2YA 4LHXA 1B6SA 4Q4DA 2KB0A 2XZTA 4X54A 5FWYB 3IHWA 5B1SA 5JMPA 3TCNA 4EGAA 3BAZA 3ILHA 4FYHA 4LSWA 3TL2A 4XSHA 4US1R 4DR6B 5BR1A 1VE5A 2RH8A 4B7XA 3PDIB 3FWYA 3AGQA 2M1XA 4UVGA 2BMFA 3LNCA 2QRQA 3BH7A 3MTAA 4W5QA 2C8LA 2A78A 2FN4A 4ZT3A 4D57A 2X77A 4DPMA 4CMEC 2JJYA 2TYSB 5C53B 4C43A 1ZCFA 2NW6A 4U2DA 5AUQA 3K5HA 4I55A 4QNNA 5A4IS 1ZEJA 2ZJ6A 3OIVA 3TJMA 1RIFA 1B6RA 3B1VA 3G0BA 1IY0A 2CLIB 3MT0A 4HBZA 3C87A 5F12A 4EHIA 4DDUA 4HLNA 1UEIA 1HV8A 3D5TA 4CQMA 1LGYA 4X61A 2BMEA 3EB9A 4MQUA 3ZU6A 4AZSA 4CN9A 4XWAA 3CLTC 1DNPA 3C3DA 2EAUA 4POOA 2GPNA 1JWLA 3ROPA 3WDSA 1RADA 1BJRE 3FR7A 2EFDB 4N49A 2VNAA 2ANBA 4FKBA 1R5OA 4FMBB 4DV2B 3B8HA 2REOA 3OTGA 3S27A 1KI6A 5JSQA 1GTZA 2FPUA 3U4CA 3NOVA 3VR6A 3IT3A 1J5PA 2GJKA 1KEUA 3C1OA 3GLGA 1EE9A 2LNDA 4LMRA 4OBEA 1XAHA 3C6XA 2OCXA 1AZSC 5HYVA 3MLAA 1YF3A 5M34A 2QIPA 3A7EA 3DLIA 1DJMA 2ZRBA 3FTPA 5IANA 2NO1A 3EAFA 3KQOA 1W581 2GJ4A 1R15A 2JH3A 3EEFA 4X1IB 1Z12A 3H1GA 3K6RA 4PZ9A 1G55A 3DLBA 3KV1A 3IB3A 1GD1O 3RT1A 3OETA 1GG2A 1P1JA 3PXEA 2O7SA 4Z1OA 4IIVA 4YJ2A 2YRWA 1EXDA 2QP9X 4Y2VA 3T12A 3OPYA 2XMSA 4HH3C 1WDKA 3S2GA 3LCJA 2BGKA 4KLCA 4DY6A 4XRGA 3OTHA 1R00A 3FF4A 4A26A 1JHVA 3NHPA 5IW8A 5JCPA 2ZATA 1BA3A 2GI4A 2W6CX 1FDIA 2QTMA 2X4IA 3S1SA 3O1JC 1EFRA 2W6JA 1C8LA 3AESA 2XGJA 2ZZNA 3KQSA 5CG1A 1FU7A 1Z6GA 2FPSA 5FLKA 2IELA 3F6CA 3IIKA 3AFMA 1T9ZA 3ZZ0A 1XDUA 3JQPA 2QRUA 2SBTA 4QOJA 4TWAA 2VJPA 4RWZA 2IS2A 1JA0A 1E4EA 3H1TA 1ISIA 2R5NA 1H23A 1MU0A 4N5DA 1KHTA 3MWLA 5CTAA 4OUKX 1U3DA 5BORA 4DUGA 1SMKA 1T0IA 5H3CA 1T24A 4FFDA 3G0CA 1OB2A 4J1NA 2CNKA 1A4IA 1WDWB 3IP7A 1EHYA 3ZGZA 1CQJA 3WJ7A 4BQEA 3U7QB 2AFVA 1W5AA 3DWFA 2WNSA 4GPEA 4RAQA 1CQWA 4P53A 2X42A 1X8KA 2YFYA 3GGPA 3K9NA 4PINA 2B92A 1ID8A 3DZIA 3WGVA 2OG1A 1B0ZA 1IHXA 4CEIB 1MTOA 1NI3A 1SUDA 2F90A 2VKQA 1JJFA 1M2FA 1YIAA 3GJ5A 3N75A 2JFYA 2GZ2A 4NECA 5I8ZA 2VWGA 3R7FA 4CFSA 4KFCA 1XZ8A 3CKMA 3MRTA 3SC6A 3LO5A 1YS2X 1I1QB 5AM4A 3IEPA 4OLJA 4B3FX 4F6RB 3HJUA 5KIAA 4F4IA 3IPLA 2FSPA 3K30A 3QX7A 4NU0A 1F9AA 4RVOA 1KZ6A 2B36A 3PXBA 1QWSA 1JT2A 1E2KA 3FHCB 5AKJA 4D9KA 1TE2A 2RH4A 5D7NA 4QICA 1EQUA 1CR6A 1FSGA 2QQ5A 3ROGA 3IKTA 3OQ1A 3RYHB 1AKQA 2P9FA 2WIGA 2OCLA 4OQLA 4FX2A 1ISMA 3R1IA 3W8DA 3B89A 3FI0A 2IHYA 3N86A 3P5SA 3PRYA 5KAPA 3IR6A 3AJEA 2XE8A 1SCIA 1ZESA 3MZ0A 4Z3DA 1C7EA 2BMWA 2GPSA 4Q4AA 4RA9A 3D7LA 2V45A 4WY2A 5K0EA 2F8MA 2ZYUX 1FFCA 1XRSB 1ZAKA 2X6TA 3JYOA 3Q15C 4OD0A 4HSGA 3JQ7A 1PP4A 4CM1A 2X3UA 4OM7A 3WDMA 4LTMA 3K9CA 2XTMA 3K0EA 4HB0A 3S7ZA 2HDHA 2D0PB 2BMAA 1J9EA 4NVRA 1THMA 5KTOA 1FTYA 3DE5X 1RWKA 3MC1A 2I6SA 3T3IA 3FETA 3WY9A 4F72A 4A5OA 1GPNA 5A62A 3W2HA 2JLXA 2FUCA 2IY8A 2XMDA 1GTG1 3PXDA 5AK5A 3R0VA 5I5GA 1OX5A 4HK4A 4LCEA 2ANCA 4WFKA 5AW5A 3IEKA 2ID7A 4UCQA 5CFNA 4Q3EA 3IT1A 2GH1A 4ZT5A 1TD9A 1K6IA 4QSMA 1Z4QA 1XG5A 1C7IA 2EX0A 3A11A 1HT2E 3AR8A 4BB6A 1XCGB 3JSAA 5KNDA 1W2WB 3OKCA 3BQNB 4I1RA 4OJKA 1P33A 8MHTA 4ZJPA 3CRQA 4QO8A 1Y7HA 1SXGA 4RVSA 1UBCA 2XUOA 3K15A 1XZCA 4F8EA 4XUEA 1T9AA 1UMBB 4DDWA 1RPTA 5EHNA 2V6IA 1KGDA 3F47A 4QXMA 4QYIA 1JG1A 5J2TF 3GJRA 4BB9A 3U19A 4Y9UA 3PQFA 3MD9A 3CW8X 4TVKA 721PA 3TMYA 1BXGB 4LHSA 4DSNA 1IN8A 3FDFA 1TYAE 2IZ6A 2YWEA 4QULA 4P3PA 2FXVA 3VOAA 1ECBA 4YJGA 5CDSA 1W29A 1N3YA 2H06A 3ITEA 3N3AC 4OQPA 4LS3A 4Z7NB 4HYYA 2ZUVA 1IVSA 3ORSA 4E4RA 4R8SA 1G17A 1ISJA 4YCCA 3MJVA 4DLNA 3O03A 4WNAA 3G79A 4PQGA 3K2IA 2JS7A 1ATZA 4G8BA 4NESA 3IAAA 1NSFA 4YP5A 2NU8B 5HKLA 3ZIDA 3MEQA 2I99A 4JD5A 1QKKA 3GBPA 5EMMA 3DR5A 2VHEA 4P3NA 1ESCA 5F9FA 1R4MB 2B1IA 1Z2PX 3QMMA 2C2MA 3D43A 3MJSA 4II7A 3DCJA 3W8RA 1B16A 2ZVQX 3NGLA 3HXOA 2O8DA 2XTJA 4NP6A 5FBZA 1JIIA 4HATA 3AI2A 3SZRA 3D0KA 1FU4A 1Z3IX 1QDUA 2ABWA 3OZUA 4O29A 3V48A 1N6LA 4EYSA 2VDVE 3P8ZA 2O48X 5K6TA 1L5QA 2I3AA 4JC4A 2XOEA 2BIFA 1KP2A 5THQA 2IIQA 2XE7A 4ETMA 1BN6A 1M2KA 1SHZA 1YDMA 1Z0AA 1SOUA 2RJOA 3JZMA 4LQDA 4OQNA 3GFTA 2R4QA 3JATA 5FBRB 1ZVVA 1ZL2A 3CCCA 4KK3A 1X7ZA 4LY9A 5AW9A 3DWGA 2C84A 4RAOA 5MFPA 4YMVA 1XPOA 1RRKA 3M81A 4WK4B 1Y3HA 1XUOA 3EZXA 4FDUA 1LSUA 3I2IA 1A82A 2J30A 4ZRMA 1ABFA 4LNUA 5ALWA 1HKUA 3T9EA 4U0JA 4PNHA 4JOCA 3THRA 3CNHA 1GITA 5LZ4A 1UKCA 3WK7A 3LIPA 5U4XA 4EVQA 5LYJA 1T2NA 3I6YA 5C3MA 4JGGA 4PPFA 1X87A 1RFLA 2VJDA 4Z0PA 3CE9A 2JI9A 4QO7A 3HKCB 4ER5A 4C0LA 3MGAA 1U7TA 3EF3A 3FE2A 4I5DA 2L0XA 2ODTX 1MAUA 2F59A 2O5CA 1BS2A 2CJYA 1TCCA 3AV0B 1ZOPA 1GNTA 1XTIA 2D0IA 1Z0KA 4LJ5A 4PLCA 4KRGA 4DR1B 5GM1A 1Z26A 1M2GA 3ADKA 2HIAA 3QOWA 1RYNA 3JD2A 3FPHA 3L7OA 4KEAA 4NNJA 4QUDA 5A6SB 3WZMA 1DBWA 2F9LA 4U7HA 4L57A 4AP5A 1PDWA 5B4UA 2CUZA 3DP9A 4B3BA 2FMFA 4CW7A 3LPLA 2YYAA 1WOYA 4AX4A 2FPPB 2XKKA 2BJWA 2D7DA 2EW8A 1QXSA 1U8EA 2IC5A 2ZUCA 3FKJA 3PPXA 4DIDA 4DWVA 3OKFA 3IT0A 3AW8A 4WECA 1OC4A 2OKGA 2Q1YA 3H2YA 4G0UA 1DCFA 1PQUA 2FW9A 5EINA 3EVNA 4MCHA 2JHFA 3QLEA 4WUVA 1WUHS 1N2IA 4P83A 4PWYA 3K6JA 3X0DA 1U7ZA 2WHPA 1RBMA 2B82A 2YBEA 4AS3A 4QQFA 5JE8A 5KZMB 3WLJA 4NS4A 2XNHA 2DB3A 1K3FA 4YPFA 2CSXA 4BNGA 1F5SA 1G8GA 3PUKA 3CKKA 4CETA 1DLIA 2CXQA 2A0XA 1GGEA 3A9VA 2BISA 2SKCA 5JWOA 4O3MA 4IJ5A 2SCUA 1IDN1 7AT1A 2XUFA 2NZ8A 2CVHA 2QQGA 3HKEA 5J4KA 3FD8A 4RY8A 1DO2A 1JKMA 1WABA 1U4SA 1BSVA 1UZAA 3G3EA 4JL8A 1L5FA 3WIDA 3AVYA 4CMIA 3EIHA 4DR5B 3RYIB 1UKAA 3SC2B 4N6OA 4O4IF 5T4EA 2AQIA 1WMBA 4ZDWA 2ZM5A 4KSBA 4QUGA 4DYHA 4JA0A 4JYCA 4ANFA 3PXCX 2NP7A 3QEJA 1D1QA 3R3XA 4FYWA 4D4MA 5JNLA 2A3RA 3N8NA 4TMXA 3FPLA 5B1EA 3CUKA 5E38A 1CP3A 3MNFA 4PYOA 3SXUB 3SSNA 2P5UA 2BFCA 3IMCA 5C4GB 1T3HA 4RL4A 1PQWA 4HUQB 2EDCA 4D41A 4DJEC 5AUOB 1L0BA 3GDHA 4ZOCA 3RSQA 5KWIA 3A32A 1NLYA 3OA0A 1AS0A 1XZLA 2NSLA 2OXEA 4NPHA 4Q47A 1C80A 1J21A 3GEIA 3OICA 3QEMA 4N3CA 5PNTA 4DIEA 3O9VA 1AGXA 4TS9A 3KSUA 1R4NB 3QWIA 4X20A 2AMVA 1XNQB 2VL7A 3F2VA 5CLIA 2WC1A 3M4YA 5KOHB 4GI7A 4LVNA 5HQJA 4E3ZA 1NIJA 1QCCA 2WDZA 4Z7JA 2V9PA 2VHCA 4I3GA 1QORA 1FVOA 4BEVA 5CW1A 4DV1B 1NONA 1YJAA 2VLIA 1XC7A 1YHYA 4BO5A 4I9GA 4CIDA 4ARUA 1D04A 3RS0A 4Z54A 3PYXA 1RJ9B 2CLSA 5KTTA 4B4DA 2NP6A 2O8BA 2Q0QA 1L1QA 3QPWA 4J8PA 1P7VA 1IEVA 5AT1A 4QT4A 2OVBA 1SUEA 3DXFA 2PZGA 3KTAA 3K20A 1LSOA 1KQGA 3IQFA 4MUJA 5JAIA 2J9GA 2GK7A 2Q46A 3H8JA 1E3EA 1S1CA 4LDZA 4LV8B 4Z4HA 4FMDF 4KB5A 3AVPA 1MV8A 3L7AA 2M6LA 4D8YA 3ITNA 2PZMA 3B48A 4KVZA 3FYUC 4YACA 4ZTZB 2FMUA 3M6LA 3NHMA 2CCGA 2JF0A 3QU9A 1DJNA 4CE6A 2OXRA 4S2UA 2PS9A 2VSNA 4ZHQB 1K4MA 1CR2A 5DI9A 3ZDAA 1U28C 2I5PO 4CM7A 1R8YA 2BBTA 3W5AA 4OAPA 4EPYA 1WCIB 4F3RA 1N36B 2C42A 3A1CA 5F52A 2V3WA 1U4NA 3L9WA 2GBLC 3OPNA 4WA8A 5E7MA 3ZD8A 4E5UA 5TMPA 1Q50A 2WOJA 3GFRA 4PC1A 4F4CA 4XDGA 1D0SA 2WUEA 3NJ8A 3WRVA 4AUKA 4X1KB 1XRLA 1JKJA 2HM7A 5HR5A 3FCXA 2OBNA 3LDHA 3PS9A 2IUTA 3OO0A 4GI5A 3U37A 4I9FA 4DC9A 2QT0A 3VO8A 2H4FA 3OI7A 4OQZA 1VYVA 1AUOA 1AK1A 1G8SA 1P75A 4BWVA 2AKEA 4PICA 1O9HA 3ILYA 4FKZA 4QATA 4RS4A 5HG0A 3ZBQA 3D8UA 2PUGA 4QDJA 3EULA 4O4JF 1VG9B 5CA1A 5H4GA 3NBAA 2R79A 5BYAA 3G6WA 3KVVA 2IZ7A 5FH9A 5DT9A 5E6UA 4LFCB 3IP1A 4G0PA 2VH2A 3VC1A 1LUAA 3AIIA 2G0TA 3OX4A 1VE3A 5FJIA 5TX7A 1SBYA 5T6MA 4MYRA 5M5BA 1ZXLA 1OBHA 2GO7A 4Z9BA 1RVV1 3AB8A 1BEZA 2OFOA 3B8EA 3A26A 5ALUA 5BV8A 2IW3A 1VSTA 3OZWA 2IY9A 1LC3A 3TZHA 3THYB 1U0OC 2BRUA 4RVHA 4ZAXA 1ENPA 5A02A 2D3WA 1ZK3A 2V7BA 3UPDA 4YUZA 4MVJE 4Q9IA 4JODA 5FUXA 1OV4A 3HA5A 3JV7A 3NALA 4WBNA 1TA4A 2JD1A 2FNAA 3LBNA 4U5XA 4KR6A 4MYDA 3RTEA 1ZRNA 3Q12A 1MP0A 4B8YA 4Q3OA 4EY7A 2VQSA 1NA5A 2C3OA 2VSQA 4BYGA 5J47A 1XV5A 2YCLA 2YHBA 2RD2A 4KNVA 1QGED 1FU8A 1YOVA 1XE3A 2PGOA 3G17A 4HQRA 2NVUB 2ZCJA 2HHJA 2FUNB 1ZXXA 1TU4A 3EW7A 3QTLA 1COWA 3C4QA 4N0MA 3ZDYB 2P78A 1Q0HA 5HF9A 1VL2A 1MA3A 1JHDA 3BJEA 1SXJC 4LJRA 1SD5A 1QK5A 4NFYA 1HGXA 1BE0A 1SFRA 2RH5A 2XUZA 1KDPA 3CXRA 3P20A 1QHHA 3U7HB 3SHOA 1BVUA 4C6TA 1KMIY 2QMUA 4DKXA 1CZRA 1IAVA 1FS4A 5TGZA 3K1ZA 1A9QA 4MUKA 3DE0X 4LJ9A 4NCXA 2YVUA 3O7WA 4NMXB 1BD3A 1EYZA 3ZWKA 3ZWWA 1EDEA 2Y27A 2WICA 3N3BC 3OMXA 4MEJA 4B80A 4V1CA 1OFUX 3CM0A 4GRDA 3DGEC 2E18A 4TWRA 3MSXA 4KSYA 3IOMA 2RSLA 1QIMA 1ZONA 1JILA 4QOGA 3JY6A 4G2NA 1GV0A 4FDVA 1EXVA 1AGRA 5ILGA 4IQ4A 2UZAA 3V1TC 4AZ3B 4AMBA 4QBKA 3DL0A 2P6MA 4QA9A 1UZNA 1LWNA 2ODPA 1UP6A 2NU9B 1HDRA 3ZXIA 3HDVA 3QW4B 5D1HA 2XBMA 4BMCA 2GKOA 1KAQA 2QSYA 3AI7A 3DLCA 1X38A 1KY3A 3TJZA 1E1CA 1ZCBA 3L46A 4RNDB 1YB4A 2HQSA 5HF6A 4JXXA 3K0FB 4B48A 4RVCA 4LTDA 3QVVA 3ZK7A 4CM4B 3EMBA 1QH0A 2A5YB 2IT1A 1JPVA 1NN1A 3IKVA 5CPFA 5HP4A 2GBPA 4I19A 3WSTA 3EVFA 5FO1A 1ZBDA 2IIBA 5E0KB 5FTWA 1UDBA 3QUBA 1EUZA 4WW0A 5FWAA 5ER9A 3FLAA 5DLEA 5BT8A 4M1EA 1DEHA 3P7MA 4TTAA 4NU8X 1EWKA 4PXSA 1HZJA 3RW9A 4CKEA 1UIMA 2QVXX 2KLHA 3I5XA 2R7AA 2NO5A 2ZAOA 1SIOA 1U0NA 4HBGA 2W98A 1QRRA 2QKYA 1Q7BA 2B37A 2EW2A 2PQ6A 2J0VA 3OQ6A 2EG5A 1AURA 1BIFA 2ETXA 2GNPA 2C9MA 3IDSA 4FW8A 2WAOA 2NTEA 2CVZA 4KXVA 4AVYA 3VH4A 5AHXA 1JU4A 4IBOA 2ZAIA 4TV9A 1OH7A 2FSIA 4I66A 1BMFD 2AQHA 5IP5A 3L7BA 4RGYA 2IYLD 3AKEA 3OFSA 4BJ1A 2YNMA 3TQTA 4Q4JB 3AF2A 3VKGA 2YL2A 3ND5A 4BEWA 3L4EA 1IQUA 2KS6A 2RAPA 5JC1A 3QVSA 1T9KA 2QXUA 4JT2A 4CEHA 2O07A 1FUIA 5DBHX 1MB0A 4E11A 5ELLA 3LLCA 4XD7A 2GZRA 3B70A 1RWVA 4YV1A 5KNBA 2I2BA 1GAJA 3B85A 3F3YA 3CR7A 1Z6QA 4DSTA 5TJ9A 4CKWB 2OY0A 4MGYR 1AQJA 2XXAB 5EZ5A 3G9TA 5DN6D 4V0MA 1R3UA 1D6SA 2Q27A 4CDRA 1XMJA 2HRZA 4O08A 3O3NB 3NTLA 3TLBA 3DB1A 4UTXA 4MWOA 1MCZA 2D62A 1HEYA 3BCRA 1F2VA 1T15A 4MV8A 3DD5A 4BKRA 1JZSA 1IBMB 1PX2A 4HNQA 2VHTA 2VPPA 5C8ZA 5FLXA 1G7TA 2OD9A 1WY5A 1LLUA 3CTPA 3T3DA 1PAUA 3TZLA 4YLYA 2VDLB 5AI0A 4ILEA 4Y2YA 3WR5A 3S29A 3FCOA 5ULLA 5FPSA 4IUCS 5K99A 4D3DA 2A86A 2PXHA 2QLFA 1QFSA 4MQFB 1BX3A 1IG0A 3PDIA 4IQFA 4MMYB 1VI2A 4DA8A 2VTVA 2O7RA 4ZKDA 3M70A 5CYGA 3GIDA 3HU5A 3L8MA 2DFKB 4CMGA 1XQ1A 4H0NA 1J2UA 4GKJB 3I2GA 2OPHA 4ESEA 1C81A 3FDZA 4EARA 1M74A 4AF7A 1NFFA 3PD1A 4EZEA 4WACA 1I2DA 1G0OA 1CRLA 2X14A 2O0HA 5E4FA 3DXXA 4ND3A 4IX9A 4K9MA 1R0LA 1JU3A 3I9V6 5HIKA 3L79A 2A0YA 2CLOB 2GLTA 2O2DA 2XTZA 4H7HA 3RIYA 3TD2A 1S96A 2EIHA 5J1SB 1TC2A 3M5CA 5K3DA 3LECA 3RYTC 2YWFA 4B2PA 2FYTA 1ZD4A 2AI1A 4AQ7A 4ADSG 1S5PA 4ZVTA 3ZOKA 4PX5A 2FWBA 3ZVMA 2XRYA 1R0RE 3AHIA 5CVDA 2VAVA 2CLFB 1JLKA 2VJBA 3C3XA 2AEEA 5A5GA 3CW2A 2Z8YM 5CGZA 4KXMA 4YJ3B 3BF8A 4PEVA 4ARAA 4XQ0A 3DYIA 4ROSA 4YUYA 1B93A 5A0FA 2ZZMA 1Z4JA 3LLUA 4XZ3A 4FHZA 3CLVA 2WV9A 5THXA 4HNAB 4CGZA 2GEKA 3U4AA 5LP1A 4RKQA 3GJ7A 2GCOB 1CRQA 2OHJA 1EGMB 1ECFA 4F1JA 2JJMA 4JJEA 1NHWA 3F1KA 1K98A 3DDUA 1NI5A 3LQ2A 4NIMA 3O4VA 4PZPA 4BU1A 4E2XA 4EHAA 2QW1A 4NCIA 1X2BA 5SZKB 5K8UA 2BR5A 1JDTA 1QH1A 3I5MA 4LHYA 2EWWA 3ONDA 1XSEA 2DWCA 4TKVA 1A8SA 1Q16A 3CW9A 1CDEA 3GUZA 1G3QA 4CQLA 5I7RA 4RZ2A 1HFJA 4MV9A 2ZM6B 1QFYA 1WMDA 5A4KA 1QHYA 1I1NA 2PS0A 5FTLA 3CRMA 5DK6A 4B09A 4MYHA 1UDCA 4QTZA 4JC5A 4OHVA 2YXEA 4ZEWA 2HAEA 1RRVA 1G4HA 4RH0A 3WYBA 3EA4A 3JRNA 3HBMA 4AJ2A 5M04A 1A9PA 2ISCA 2H2FA 1LRJA 4MI9A 2F55A 5F35A 3HO1A 2O3TA 4YUXA 1KU6A 3CURA 1Q19A 3JQ9C 4D9EA 5LQKA 3A4MA 5DLPA 2GVDC 4NATA 2I7VA 2FDRA 1QFMA 2ODQA 3QJYA 4FYPA 2QT9A 1ZGGA 2J4FA 1U2PA 4IDCA 4HVTA 4PLTA 5FOXA 1D3AA 5T57A 4OGKA 4KWTA 4JQSA 4M4SA 1WEHA 3C45A 4C3OB 2XODA 5JSHA 1SKBA 1GGMA 3WRYA 3DAPA 1SULA 3EA5A 5GOTA 1BHO1 5DGXA 3EXEB 5EZ6B 3RWMB 1DIHA 4WA7A 4Z8XA 4D9NA 3VAYA 3KAKA 1WVGA 3TIXB 2C2GA 1CIVA 2XOKD 3FY4A 4KSCA 2FKNA 3NI2A 3PE3A 4YLGA 4G8DA 2CC2A 1E4YA 1UM9A 1FDSA 4G5XA 5CUQA 4XWOA 4QM6A 4N5LA 5SZIA 3GMIA 2C20A 4ZVUA 4FCCA 4GQAA 5KOJB 4MA5A 3GNTA 2UYCA 2FP4B 3H3JA 4HKTA 4ZQHA 1GFWA 1Y5LA 3TTVA 3UB3A 2V6GA 3T3NA 3WLSA 5IJZA 4H1UA 4PTLA 5DI3A 3VNBA 5B58C 3AJDA 4RFVA 3UCFA 1VMIA 5EXTA 3TS1A 3ZH2A 1D1TA 5DNWA 1M6YA 1XU4A 4RL6A 1H9AA 4V0RA 4EUSA 1ZA1A 9GPBA 4NDNE 3IIEA 2NZWA 3A6EA 5K8CA 3T7DA 3C3WA 3EYAA 2JFVA 4E0BA 2FFHA 3W6PA 3PRJA 4N41A 3KDSE 4HF7A 2CNNA 4FCVA 3I3OA 4JOSA 3Q6MA 1BW9A 1R9NA 4LRXA 1DBSA 1LPPA 3FVVA 4Q7EA 4YVFA 4B2IA 5B36A 1WPQA 4KITB 3HNPA 4JLMA 1GCGA 4UPDA 4P4GA 4PZCA 2XB2A 2B1JA 5DP2A 5CFQA 4AW9A 3HR8A 5MN6A 3PT9A 2VKTA 3I0MA 5LKAA 2RJ3A 2H4XA 1VLZA 2P2NA 1RM5A 2LKCA 3TTYA 3I73A 3ID6C 4GMHA 4RJLA 1P72A 1PJ3A 1H2AS 1T6BY 2NPIA 3T7RA 4MV5A 4QJ3A 3P9NA 3V97A 5KOIA 1OBCA 1TL7C 2FW6A 4GSKA 2FSUA 1XHEA 5G0SA 3NH6A 3R9KA 3DNPA 3R8CA 4IIGA 4DYVA 3HWX1 3O4IA 3DLHA 3TH5A 4NXMB 2OLJA 2VAPA 3TNLA 3IJEB 4ZZ3A 4KLNA 2N3ZA 4Z6KA 3AINA 4PAMA 4R2WA 3K1AA 4LJYA 2QUAA 5CLLA 5JS6A 1I7SB 1YZUA 1XJCA 5B1IA 2IHVA 3SDSA 2ZR0A 3KWLA 1UMBA 1NC3A 2R1UA 3NP9A 6REQB 1DFGA 3QEOA 4GYKA 3E61A 1AA9A 2PXXA 5E4TA 2QN6A 2JRCA 1SA0A 3LCRA 5FL7A 5FIUA 1FDUA 1NP6A 3RVPA 4E7OA 2PWBA 4KR2A 2P9GA 2DCMA 4NL4H 4ZFNA 3MGKA 3C16C 5F1YA 4BP3A 1IIBA 2ADFA 2GQ0A 4G5RA 5LQMA 2Q6OA 2IWHA 1HDOA 4GVXA 3CRNA 1DP4A 3HQ4O 3SC4A 2EXXA 5MN5A 1OZ0A 1IY9A 3LYAA 2XUAA 2P77A 4X6LA 3EGXA 3AX6A 3GP5A 3I8OA 1B4DA 1Z25A 4MEAA 4U9HS 5BVHA 4GEGA 5KHOC 4EDHA 13PKA 2NU8A 3C1UA 4LZOA 3VZSA 2G4CA 4UHJA 5AQ1A 2X40A 5JYBA 2OE2A 1KMQA 1M9NA 2QZ9A 4LZPA 2H07A 1Z29A 4R2IA 3H86A 4YJFB 2HRBA 5LXTB 1ONOA 1XWFA 5SY6A 1RWWA 2QW0X 1A5BB 1CW2B 4S35A 1H3FA 3QU7A 4HDOB 1EINA 3G1TA 4JP8A 4R7GA 2H57A 3QHPA 2WYWA 1DC4A 2Z58A 2C4TA 3I32A 7ABPA 3ZD9A 4FFOA 2YWDA 2Z83A 4GH5A 3FWPA 4TS3A 2B4QA 1OOEA 2QJOA 4DC1A 1WPRA 3X1ZA 1KH1A 3ENQA 1SXJD 3NIFB 5CVVA 2BFBA 3H5RA 3UWMA 5H7XA 1P44A 4L5AA 4A82A 3VZPA 4LOIA 1EK2A 4H6PA 4A6EA 2HDWA 1YZTA 2ZB2A 1UBHS 3PUWA 3IAS1 1VPDA 3BL5A 4ND4A 1QC5A 1UL1X 4TWZA 3RPEA 1TJNA 1RCUA 2AG1A 1RRMA 3WYCA 2I9KA 2ECPA 5ED4A 1NC1A 2CB0A 2DFTA 3ZEAA 1ENOA 3Q2KA 1ECLA 4BP1A 3TLEA 5L6LB 1RM0A 1Z7YA 2AJTA 1GILA 4GLFA 1R10A 1BDJA 1LBTA 2YWJA 3DVLA 1K75A 2VXCA 4R1UA 3IOBA 5GJVC 4DDVA 3I61A 3AVWA 2W90A 1TTTA 4LY3A 3QJGA 5G40A 5BWOA 3ZCSA 3HB4X 1MNQA 3SK0A 5JVDA 5JY6A 3LTNC 3QLTA 1LK5A 1KJ8A 2XJ9A 5T4BA 2WM2A 3E3OA 4HO1X 3DTVA 1S8NA 4TN5A 3DAGA 3HCRA 2PE5A 2QLTA 2B5OA 4OQMA 5DTJA 5EIAA 2PUFA 4TSFA 2X8AA 2DBVO 2ODNA 3UUWA 3ISTA 1JHAA 4MVJD 4YJ2F 5AHWA 1JHUA 2QDKA 3DFIA 3RTGA 5LQRA 1FQKA 2AI3A 2ACEA 2JH9A 3D1LA 1Z62A 1E3JA 2XE6A 3QUQA 3F73A 5HQ3B 4AM8A 3C3JA 4DWWA 5JZOA 4UBJA 5CFPA 4G1CA 1SURA 1L7VC 2R6ZA 2BSAA 2VCEA 2FHPA 2XD4A 2ZRLA 5FHRA 1GFIA 3VU9B 3PFGA 3WGNA 4BQQA 4EPXA 4YIHA 3T8YA 1GRNA 4B8ZA 5DV9A 2FFQA 3EFOA 4FDAA 2DWQA 1A9SA 3MWKA 2BDEA 3NDRA 2V98A 4H6XA 3U4QA 4PQEA 1M2EA 1NN3A 1ZM7A 2R5WA 3CH6A 4MITA 2DZDA 1T2UA 5DT2A 3RBZA 3TYXA 1ZXBA 1D2RA 1Y9EA 2H3EA 3PR2B 4HAWA 4QPNA 1E9FA 3TXYA 4B3IA 3K5PA 2QAGC 3RDPA 2K7FA 1IXYA 3DCIA 4OLHA 3ZVNA 5REQA 1U9ZA 4HZUA 4OHFA 2UZ4A 3LAWA 4J6EA 4UDNA 3KM0A 2P9JA 3V8MA 2CLEB 4F8YA 4YAGA 3FCYA 1Y34E 2ENWA 4G1FA 3L1KA 4HNHA 2DFDA 1NW9B 2OUIA 3IOYA 1PR0A 3O38A 4B7AA 3BEOA 1RRPA 1KARA 2QAGB 3BTSA 1XKTA 1BN7A 1W4ZA 3EZLA 4PVDA 1P91A 1QZ3A 1VLVA 1P3Y1 1JB1A 3A6GA 4IMPA 4M8KA 4PO3X 3KG2A 1A0OA 3GLQA 2UYOA 3AIKA 3C3MA 3UGQA 1Z5NA 4BATA 1CCWA 3UKJA 3U6BA 2XT6A 1O94C 3RT7A 4NEHB 4X1YA 5FWDA 3PC6A 5UKDA 3RSZA 4KFUA 1ZMOA 1E3WA 4CF3A 5K0ZA 2WU3A 4GYWA 4Z49A 3A25A 4H6VA 4PSCA 3EJWA 3C0KA 4AN1A 2PH1A 2N1MA 2QD4A 4JQYA 5KYYA 5KYGA 1WKCA 1KERA 3KR1A 4BVHA 4MB6A 4D8UA 2GPTA 1V9CA 4WOKA 2QMOA 4V2UA 3RKUA 3L7KA 3O7MA 3PX2A 3I1IA 3JZIA 2O1EA 4QXOA 1EIWA 1WHTA 1CUHA 1GZ5A 2VH5R 1AC5A 1NVFA 5E3JA 2B25A 3L8HA 4GPTA 1TCBA 5BMOA 4MRMA 5I9SA 1CB0A 1N1DA 2HU7A 1DG1G 3ICOA 1JQDA 4QXRA 4ML3A 3HLKA 3MCUA 4RYLA 4ZI5A 2JIOA 4ISBA 1R5JA 5TJHA 4DRXB 2X22A 3IUMA 1OTXA 1DRKA