4UHKA

Crystal structure of the receiver domain of cpxr from e. coli (phosphorylated)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
130
structure length
129
Chain Sequence
b'NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQKLAAALEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Structural Coupling between Autokinase and Phosphotransferase Reactions in a Bacterial Histidine Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 45
structure length 129
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhkA00
1Z17A 1LJUA 1P6QA 1NXPA 3Q41A 2WB4A 3JTEA 5ABPA 3JVDA 1ZY2A 4RXTA 1JFSA 2P9HA 3TD9A 3MMNA 2GX6A 4B09A 4RK0A 1C4WA 2KYRA 2FW0A 4LE1A 4PYRA 1YS7A 5B3JC 3LKBA 4OLBA 1BVHA 3IPCA 4G97A 2PE5A 1QP7A 1EFAA 1C0EA 1ZN2A 3CRNA 1S8NA 4JOQA 4KREA 2L17A 2AYXA 3LKVA 3IP9A 3O2QB 4KV7A 1U04A 5GOTA 3P9YA 1EWVA 1BA2A 1DC7A 1DBQA 2FEWB 2JCGA 4WZZA 4Q6WA 1QPZA 4MQEA 1YMVA 1OXBB 3G85A 3GA5A 3HV2A 5JNRA 4OLAA 4MS3B 2L19A 1NXVA 4JA2A 1ABEA 3CG0A 4L85A 4EYQA 2NZVG 1NXXA 4IGAA 4UHJA 4MLCA 1NY5A 4PZ0A 5KQMA 2ID7A 3ILHA 8ABPA 3O75A 3HDVA 1ZAYA 2FN8A 4YGXB 3W9SA 4DN6A 1XHFA 2DRIA 1Z2EA 1YVUA 1PHRA 3L6UA 4NICA 3UUGA 5KWSA 3FMVA 4EYKA 3O1HB 4MR9A 4Z4CA 2PLNA 1DCFA 4IMIB 4HNQA 4MR8B 3E3MA 3Q7TA 3QEMB 2B4AA 3VNAA 3MIZA 3I45A 3JS5A 2MYUA 1BDHA 1FSPA 4YR7A 1JX6A 1PEAA 1DBPA 3FFXA 3O74A 3R0JA 2QVCA 1FFWA 2O20A 4Z4IA 5IBQA 3EQ2A 2HQBA 3RVKA 1RZRA 3EODA 2FVYA 1JLKA 3HS3A 5EWJA 3FDFA 5BRAA 5FWYA 2FQXA 2LPMA 5KC8A 4FB4A 1APBA 4MS1A 1QMPA 2MSWA 4RKRA 1ZHHA 3G1WA 2A9QA 1EHCA 1FFGA 3N0XA 2HSGA 4F06A 1JL3A 4TLMB 4JASB 4LX8A 4EYOA 3Q9SA 3T95A 2VUIB 1TMYA 4Z4EA 3LUHA 1GCAA 2QVGA 3ROTA 3DLHA 4MLDA 6ABPA 4O5AA 3KLOA 4YWHA 4EYGA 2MSLA 3LUFA 4EY3A 4W5RA 3H5TA 1I3CA 3H6GA 3QELB 4RY8A 4WXMA 5KI6A 4MS4B 3OM0A 4XARA 5IUKC 3RVRA 4WWHA 1YTUA 4EUKA 5IEBA 4GNRA 3RVPA 1M5UA 2QV0A 1D1QA 3A10A 5IC5A 4F12A 4F11A 4W5TA 4KNYA 2CD7A 4RXUA 1KRWA 3OLXA 4ETMA 1Z2DA 3EDCA 4RV5A 4EGSA 2MSKA 4Q6BA 5T3YA 1RZRD 2I6FA 4XLTA 4G0ZA 2LIVA 2IKSA 4RK6A 2IOYA 1QO0A 2IDMA 4Z9BA 3BILA 3RVMA 1BDIA 7ABPA 1PNTA 2PUDA 2PMCA 3D02A 3KCNA 3OMWA 3QLTA 4QYMA 1NXTA 4ETNA 3KTOA 1QNLA 1DBWA 3EAFA 3H5OA 4RK7A 1USIA 3H5LA 4O1HA 1TJYA 2R48A 4ETIA 3TX6A 2PUBA 4QICA 3MQ4A 2PUGA 4G0QA 4D74A 1SRRA 3CFYA 4NCBA 1FQWA 1VKRA 4LE0A 4MS3A 4KZKA 4RK1A 2QW1A 4RU1A 1JYFA 4QPJC 2FMHA 2MYNA 3OLVA 1DRKA 3D8UA 5F64A 3CG4A 2VK2A 3JPYA 4S05A 2FMIA 1ZGGA 2TMYA 2XDYA 3GRCA 4WXEA 3OQNA 3I09A 2M1ZA 2GI4A 3DGFC 4MR8A 4KPYA 2NT4A 1XHEA 3QEMA 2ZAYA 1QO0D 2FMKA 4ML3A 1P2FA 4IILA 2PUAA 3N0RA 4QYWA 5TQ0B 2FLWA 1Z16A 1JBEA 1ZGZA 4ZPJA 2QSJA 3RVLA 3TB6A 3H1FA 5CNIA 4E7PA 1LK0A 1E6MA 2E4ZA 4P98A 4TLLB 5FWXA 1W9HA 2JRLA 4EVRA 3C97A 3N53A 4RK5A 4LDZA 3LUDA 1GUBA 4EVSA 2PUCA 3O21A 3HZHA 3NHMA 1NXSA 2IPAB 4G0MA 3RH0A 2RJNA 2WJAA 4YCSA 1H9CA 3CZ5A 4KQCA 3A0UA 3OMXA 3HXMA 4LDAA 1ISSA 2R47A 3S99A 4Q7EA 3CS3A 4Z4GA 4YLEA 5GQSA 1JF8A 1QKKA 5EWLB 1QQBA 3Q7RA 2JVJA 2E4UA 2FLKA 2MYPA 5TQ2A 2CHEA 4XASA 3H1GA 3N75A 3OLYA 5TPWB 2YHBA 4JB0A 1DCKA 3O1IC 4Z9AA 4RZSA 3IP5A 1NXWA 1JYEA 2PAFA 3BREA 3C3KA 3KG2A 1PEYA 2ID9A 4W5NA 3I5AA 2L2QA 3RVSA 4RWEA 2WMYA 4MRMB 4MQFB 3N0WA 3RVJA 5JNUA 1USGA 3I42A 3LUGA 1GCGA 4MR7A 2A9PA 3IPAA 1DG9A 4XXHA 1D1PA 4LE2A 2HJ9A 3HK2A 5EWMA 1ZITA 5DCLA 3BBLA 1VPWA 3QX9A 3OLWA 1Z13A 4F3TA 1RNLA 1GLGA 3E61A 3HDGA 4FE4A 1LBIA 1NXOA 5JS2A 3KS9A 1LJLA 4N47A 4W5QA 4OG2A 1E6KA 3RVQA 2NZUG 3JVIA 1CYEA 1Z15A 1MAVA 1Z18A 1BDJA 1KRXA 1M5TA 3JY6A 2F8SA 3FFWA 3H75A 4E7OA 3DBIA 2HQOA 4PICA 4O1IA 4EVQA 3LMKA 3QLUA 2AYZA 3T6KA 3O2SB 1ISRA 1P6UA 2JB9A 2E4XA 3T38A 1EAYA 2H3HA 2CWDA 4MQEB 2H0AA 5FBKA 4G0XA 5I4CA 1A04A 4N0QA 3HO1A 2PJUA 3UK0A 3LFTA 4IF4A 3A0RB 4Z99A 3OO0A 1U8TA 3GT7A 1ZESA 3CKMA 1QP0A 3LTEA 3QLVA 5TQ0A 2R4QA 5T7BA 1CHNA 4YRZA 1ZVVA 4MR9B 1J56A 5DLEA 5FBHA 4F8JA 1JFVA 3RQIA 2HQRA 3B2NA 4HNSA 4KK4A 1YIOA 3SY8A 3EULA 4OATA 2F8TA 1EWTA 4RY9A 2J48A 2R25B 4H3HB 6CHYA 3MYYA 4RY0A 1ZH2A 4DADA 1B00A 3IP6A 4MYRA 5CNJA 4N76A 4RS3A 4WUTA 1U2QA 1USKA 5EWJB 4N0PA 1GUDA 2A9OA 1A2OA 1T34A 3HM9A 2JBAB 1YMUA 5EWLA 1ZDMA 4RXMA 3BRSA 2B1JA 3ROFA 2BGGA 1RPJA 5TQJA 1SXHA 1F4VA 1A0OA 1JDPA 5CNKA 4UHKA 3TO5A 5TPWA 3F7NA 4RK4A 3K9CA 1FFSA 3CU5A 3C3WA 1TLFA 2GWRA 3M9XA 5DGCA 3SAJA 4RKQA 3HUUA 5JNTA 1MB0A 3RVNA 3HSYA 3MA0A 9ABPA 1U2PA 4KQ9A 1PNRA 4JAVC 3A3KA 1Y1LA 4G86A 5C5EA 4MPTA 2PKXA 3TMYA 1M2EA 3ILYA 4TMYA 5E3JA 3HVRA 4OBBA 2E4YA 5D2CA 5TPZA 1L5YA 1F51E 2IPLA 3KYJB 3N8IA 2WY2D 5IX8A 4KVFA 1KMIY 1JHZA 1JDNA 1DC8A 2PL1A 3NNDA 4MAAA 2FEPA 2PUEA 3DZDA 3KJXA 4CBVA 1DJMA 2WWVD 1VLZA 1E6LA 5BQ3A 1NTRA 3QX8A 2LUOA 1CEYA 1DRJA 3LUCA 4MGEA 4NV3A 2VYCA 3M6MD 3T8YA 2JVKA 3UKJA 2WJWA 2FKAA 1MVOA 3FGZA 2E4WA 4Y9TA 5DKFA 3SNKA 3QELA 4DQDA 2FN9A 5BR1A 3KKEA 4MS4A 3EQZA 4G0YA 2NT3A 4ZYLA 2Q5CA 4YS6A 4S04A 3GV0A 1OXKB 3CZCA 5IUNC 2FQWA 3MM4A 3CHYA 3IP7A 2FSPA 2N9UA 2A9RA 4G0PA 3M9WA 4D6YA 3LUJA 5IULC 4Z4HA 5HKOA 1PUXA 3H1EA 3QEKA 5B3JA 1SXIA 5TPZD 2OQRA 3F73A 4XAQA 3F6CA 5CNMA 3DGEC 1SD5A 2RJOA 5KQGA 1Z12A 1AB5A 3NNNA 3O1JC 3QLUC 5HSGA 2QR3A 4JP1A 4NQRA 3K4HA 1AB6A 3EJWA 3H5VA 4G0OA 5JNVA 3FFTA 1M2FA 5ED4A 1Z25A 4LZLA 4OTZA 2VUHB 1JWLA 2NUBA 5HM6A 2YHAA 3C6QA 1DCMA 3KYIB 1JFTA 1YK1A 1D5WA 4RDCA 3CNBA 2MYTA 1RXIA 3EGCA 2LP4Y 3LUAA 3OLZA 3OM1A 3CLKA 2QZJA 3SG0A 1WETA 3OQOA 1ABFA 4HNRA 4YO7A 5DTEA 5FWXB 1TM2A 3QLVC 2FXIA 2FMFA 3NNSA 5JNSA 2RGYA 4PE5B 5BRJA 3HJFA 2GBPA 3MF4A 2JBAA 2P4UA 5TE9A 4W5OA 4GPAA 3KHTA 3URMA 5JS1A 1RXEA 4Z4FA 3GL9A 2V0NA 4KFCA 4Z0NA 4XFKA 3RVOA 1URPA 3H5IA 2QXYA 3H5WA 3Q7SA 4M88A 2CHFA 1D4ZA 3NBMA 1IIBA 2X7XA 2IPMA 2JK1A 1SXGA 3GYBA 2FEKA 3IDOA 4PEVA 4L4UA 1MIHA 1P8AA 1NATA 3SQNA 2E4VA 4WT7A 5TQ2B 1W25A 5JNWA 4N41A 4KMRA 4LRQA 2HPHA 1D2AA 3VNBA 1UDRA 2LBPA 2M98A 1VRVA 5KQPA 2WRZA 1YS6A 4FE7A 3Q15C 5KQLA 3QK7A 1KGSA 5CHYA 2OENG 4JB2A 5PNTA 1QQAA 1K68A 4ZMSA 2IPNA 2PUFA 1EWKA 1TVMA 3L49A 4KK3A 1MB3A 3BRQA 4IMJB 3KLNA 3GWGA 3KSMA 4H60A 1DZ3A 1XWWA 2ZWMA 1R8JA 1ZH4A 4P1ZA 3LOPA 2L18A 3NHZA 3HCWA 3HUTA 3O2JA 4MR7B 4TN5A 5FWYB 5C5CA 4YV7A 3H6HA 2W42A 5KC9A 3GBVA 4MS1B 4N03A 5EWMB 3GBPA 3JPWA 1L5ZA 5HQJA 1U0SY 1DP4A 3C3MA 3N6VA 2JVIA 2IYNA 4D6XA 3OO1A 2FTKE 1Z26A 3HEBA 2QU7A 4H3KB 4RSMA 4NCAA 4KRFA 1BAPA 4HYEA 3DLBA 4YP9A 3F6PA 1LBHA 3LUKA 1JH9A 1E2BA 1QP4A 2GKGA 5IEJA 4IRXA 2FQYA 1HEYA 4MRMA 2PL9A 4MQFA 3SM9A 3CTPA 3OQMA 1YK0A 4ZMRA 1K66A 2RDMA 5IUJC 4ZJPA
chains in the Genus database with same CATH superfamily
2YVKA 1R66A 2AXNA 2DE0X 3KR0A 3RYIA 2AOUB 2H1FA 4IO1A 4R0NA 2R0QC 1S8AA 1WMAA 3ZEIA 3EGOA 5HFJA 3FNEA 4KH1A 1IPHA 1E3QA 3MMSA 5B57C 1JFSA 2ZVJA 3U3JA 4O4JF 4CKXA 2IYTA 5F3RA 1BO6A 4IVRA 2K7ZA 5CB4B 2W8ZA 3QMWA 4MUKA 3C16C 3WGUA 4MYSA 1M34A 1GKYA 3QWFA 2OSBA 1ZVJA 2PY6A 3CM0A 1NYRA 3HDJA 4QXRA 2HU7A 3F6BX 3NKFA 2XUKA 3KZNA 4LSMA 3F2VA 5CU7A 4AWBA 1EFAA 2E5WA 3V4OA 2D0IA 1Y6GA 1XK6A 3S8EA 3LKVA 4JEIA 3ZWBA 2BRUC 3R0ZA 5TLSA 2ZB7A 1JTVA 1UKVY 3WSTA 2EEZA 2OGWA 4GYYA 1RRVA 1EJ0A 2HRCA 2FZCA 4J7AA 1IHPA 1RQXA 2PD3A 3G85A 1HDEA 1ZEMA 1AHNA 2CDAA 2IKQA 1SMKA 2L19A 3AHJA 3C7AA 3IIMA 4FZ5A 4GP7A 4PFSA 4X64B 4CHTA 2QG4A 4ALKA 1FC0A 1JQJC 2CMHA 2XZPA 3PXUA 10MHA 3BZBA 1Y89A 1Q11A 1IUNA 3DA8A 4QU5A 3HHPA 4QU9A 4AJHA 2BFMA 4LTNA 5A4AA 2RBEA 5CCDA 1E5XA 3TAHA 1GSOA 1PHRA 1RYNA 5A06A 5K6AA 3L8GA 2ZUBA 1S01A 2VF4X 2ZSHA 2OZEA 4YJ3B 4D8XA 4DIBA 4QT4A 3WGKA 1C2YA 2P3QA 1A8PA 3CBGA 2D3TA 4JL6A 1NF3A 3G02A 5JH7A 4I7EA 2Z2ZA 2V7UA 1F20A 5IBCA 3VX3A 4AJOA 2O8CB 1PVDA 2OY0A 1G66A 2X19A 4TKVB 1ISMA 3W2EA 4AG6A 4DMHA 1WW3A 1DBPA 1WY5A 3KUXA 2JD2A 5AHRA 3A2NA 4EJ6A 1H69A 5AVQA 4U5XA 5I9NA 3GLIB 4DR6B 4GM0A 1Q95A 1DG3A 1HNWB 1DNPA 1CQJB 3JALB 2A0UA 3TQQA 3TKYA 3L0IB 5CBPA 3K09C 1ZK0A 2BSAA 1OD6A 3FUCA 1U3UA 2OC4A 3PG5A 4CUZA 5ALLA 4F2PA 5MDHA 1LD3A 1YHZA 2QY6A 3H9JA 4U7FA 4MS1A 2V74B 2C9DA 3DZKA 4WJLA 2C8LA 5AVVA 3UOWA 1Z5UA 4I99A 2HSGA 2B6NA 4WA7A 3KHKA 3DV2A 3S2SA 1ZOLA 1H2BA 4BXOB 3T95A 3ZVKA 4EDHA 3OJFA 1GR1A 3DCNA 3C43A 3PC6A 1THZA 3R0QA 4RH0A 1G7SA 1JAXA 2VIIA 2O1SA 1LPNA 3DXFA 4URUR 1JLRA 3LUFA 5E9WA 2CUKA 4DLPA 1RXSA 1V41E 1ONBA 1VOTA 1WIWA 3CX8A 2W2XA 2X0EA 2JJ2A 4RDHA 5FH9A 2R6JA 4GEKA 5KAPA 1YL7A 1TK9A 1YVDA 1JFFA 4KNYA 1KJZA 2DQKA 2CD7A 2HGZA 4GGPA 3D2CA 5B37A 4ZZ2A 1G3MA 2O5RA 2FRDC 4LX0A 3UEOA 4IFEA 3RWBA 1V26A 2B83A 5GZ6A 1C9MA 4CL8A 5DFAA 4YX9A 3MC1A 3IJPA 1R0WA 5FX2A 2NP7A 4IDOA 1ZD2P 4JLDA 5KSYA 1PZHA 1P62B 1R00A 2E87A 3OTQA 4Q18A 1UWKA 5F1PA 4O3MA 4DEYA 1O5TA 4E2FA 1VJRA 2X8AA 2G9NA 4KR7A 2ID4A 2RH8A 3F7TA 3KCNA 3HTXA 5EEGA 1SUDA 1IN6A 3H5OA 1VXRA 3HBLA 4IDEA 3TINA 3DLIA 1FDOA 2R48A 5IVKA 4QDOA 1Z5WA 2X3YA 4HD8A 4D74A 1ZP6A 1AH2A 3KVRA 1GQFA 1M1YB 3GN2A 4LE0A 2Z9BA 3VR4A 3FVTA 3Q2OA 4KWIA 4FW9A 2WG0A 3TQRA 3QTTA 4Z0HO 3EWNA 4FIZA 2AFIA 3FTNA 1Y1KE 1IE3A 2P6OA 2W6MA 2PGXA 2HEGA 4IEFB 5JJIA 1L7RA 4RM2A 4ALIA 2FMIA 5ILOA 4A8HA 1ZGGA 1XSEA 5E1MA 1PEKE 1NWCA 2ZSDA 3SHFA 3R3ZA 4DSTA 4BUCA 4ND8B 3TLKA 1ND5A 4NJOA 3JSXA 3H3FA 2Q1YA 2G04A 2NT4A 1ZLYA 4FFPA 2IXDA 2XEDA 1WV1A 1TX4B 4PPFA 3P2JA 3THRA 1S2DA 3BF8A 2PUAA 2IHJA 4TYYA 3BD6A 5JYDA 3FTQA 3GJ4A 3K30A 2X2EA 1VSQA 3PLNA 2IYVA 4MXDA 5D84A 3HFRA 1T4CB 2JRLA 4TUYF 4ZCSA 2UU9B 4GL4A 4B6SA 3VJKA 2J7PA 4EJFA 3U1BA 1XZIA 1ARZA 1WUTA 1VYUA 3C97A 2BFAA 2C29D 3S1LA 4B32A 4JP3A 2ZJYA 4DHWA 3VKVA 1OB2A 1A8QA 3L02A 2AZXA 1RTTA 2PSEA 3F90A 4R7TA 5FUYA 1Y5LA 2ZTUA 3FCCA 3HXMA 1A2BA 2CBZA 3LX4A 4FGWA 5E2BA 4DJAA 3UMYA 3CS3A 1LJ8A 3CIFA 3NHLA 3RSOA 4MIEA 1FOEB 4IPTA 1N8KA 1M66A 3IHLA 4IGFA 3V8MA 3N2GA 3TEFA 4X1IB 1X3SA 2HEIA 4FGKA 4QGHA 2HLDD 2YJTD 4HNHA 1VCHA 5AJHA 3BC1A 3QU7A 2VYND 4HUJA 1AGNA 1SUIA 3FOWA 2IBSA 1YI1A 1BDBA 1FFAA 1KGDA 1ES9A 5IBPA 3W1EA 1KU6A 3FYDA 4UXIA 3S2EA 2Q07A 4QDKA 5EXDA 1V2GA 2AD1A 3FM9A 3PEFA 5MFPA 4KPUA 3C3KA 3KHSA 4E1BA 2Z2YA 5CCEA 3HUEA 4B6RA 3TSZA 4W5NA 3P4UA 3AO0B 2ODWA 1K2VN 3T1QA 4MVCA 3K1YA 1DRWA 2HRDA 3N0WA 5DTQA 3ZU6A 4MUXA 3TSCA 4CKBB 4DM4A 5LPNA 5FRDA 1KBOA 1WE2A 3SXUB 1DUVG 1ULHA 3ZNPA 4LE2A 4LQ4A 2DWPA 2YXLA 1RD4A 5D85A 1E3WB 2VVTA 3VYVA 4F46A 5KYYA 4EHIA 4JJIA 2CBXA 3SPXA 4EH1A 2VTBB 1WB4A 3K94A 4PHTA 4UPDA 2DWUA 2ZS8A 3UXMA 4JI4B 5BYKA 3LKDA 1M2HA 3SEFA 4F6RA 3JQCA 3FIUA 4PFKA 4CUJA 1JNXX 1IQRA 1ZI6A 2YW2A 4EHJA 3JWEA 2V1UA 4FFBB 4AB1A 5ADVA 3D3WA 1TKBA 4LGYA 3L43A 2O2GA 1FS5A 3CXUA 2GARA 4PICA 3CLUC 2DH6A 4BFTA 2AYZA 4UDOA 5KMGA 4HVLA 3AYXB 2C7OA 3WAGA 4BX3A 4JXJA 2CNWD 1OKKA 2FP4B 2I80A 3C5EA 3TOXA 4D3YA 4D4IA 2GM4A 3PV0A 2V6IA 4GECA 4OI4A 3AU9A 5I4CA 1SELA 4YQFA 3RCBA 5JVDF 4AFNA 3AR4A 4W63A 3CW9A 3UUWA 2R97A 4D0RA 2Y2UA 2PSFA 4BFUA 1XYVA 2QD2A 3AH8A 3GT7A 2GEJA 1WX1A 5LU8A 3IODA 5CPFA 2VPYA 3TXAA 3AY3A 1E2FA 3G7UA 1Z83A 4HNAA 5K6RA 4CEJA 2O48X 2IJGX 4QXAA 1CF2O 4DV1B 2Y8EA 3W90A 5DVZA 4NU0A 1XMVA 3L3BA 1YIOA 3SY8A 3LLSA 2PJDA 3EULA 3G9ZA 3TZCA 2C7QA 4ICIA 2R25B 3I34X 3HVKA 4QGBA 2G06A 3GRPA 1Z38A 4BNKA 4DADA 2FSVC 3RSQA 3KPWA 4XGKA 4G85A 1HSOA 3ED5A 4YALA 3ZKWB 1A88A 4RDXA 5CNJA 5EHGA 4TMZA 4X6YA 3S1AB 2X7HA 1CK4A 4KXQA 3W5SA 4G0UA 1QAOA 2YHIA 3GLKA 4IJ5A 3LY5A 3G2LA 1UZNA 3Q9UA 2A9OA 3UOAB 2BI8A 5A7HA 4IM7A 1G64A 3B85A 2GYUA 5KU1A 2HCBA 2H4WA 2HF7A 2RK4A 5I6DA 2JHCA 4ZAFA 2YCLA 4BX0A 5CDGA 1KKUA 1A8HA 3FOBA 1KNQA 3HXPA 4BVHA 3QKSB 2QD5A 2IODA 3L04A 3WLIA 1XVAA 3C98A 3ITEA 1GWNA 4U5QA 3A31A 4P84A 1T25A 4UUBA 3RD5A 2XDQA 1TKAA 4PBRA 4DXHA 4F5EA 3NONA 2GUWA 4RKQA 4QQRA 1ESMA 3HUUA 1T0JB 2OD7A 5LUBA 1JIXA 3JYOA 1MB0A 5U4QA 3HSYA 4L0QA 2R00C 4FR0A 4BFZA 5JCOC 3GJ6A 5CTAA 2QT0A 2CYCA 5H1YA 4G09A 4UOQA 3CT4A 1W4BA 4ZOEA 3CVVA 1UIMA 4QJIA 3GGDA 3AETB 3G23A 4MARA 3QXXA 2HZBA 3ADKA 4RO0A 5CT6A 1FSFA 2QAGA 4TYWA 1JKFA 2WWGA 1JG3A 1TD9A 1VLLA 3MG9A 1KZYC 1RYDA 3G5AA 3SSAA 5K05A 1L6RA 4FN5A 2VEDA 3QXHA 1N6NA 1VLZA 1XZCA 1NRJB 2ZIGA 2YS6A 4K5QA 3QX8A 5GJCA 3I2KA 5TMDA 4LWQA 4WCFA 1L7VC 2J46A 4WZAB 4FN4A 4AM8A 3ELBA 4JVNA 4QLAA 3EZXA 3R9XA 1NF2A 2H1HA 3W2IA 1M67A 3HEAA 3AEZA 4BP9A 3EUFA 1W0KA 3KKEA 5G1PA 2ERYA 4DQKA 3PCXA 4RPGA 3WV5A 4RELA 1Z6AA 3NALA 1NUQA 1XLTA 3LA8A 4X5OA 4ZOQI 1W85B 1Y7PA 1I36A 3ELWA 1DJPA 5BVHB 1NLZA 5EGNA 1FTQA 5KYKA 5KTTA 1GCUA 2NIPA 1IJBA 4JJFA 3I6YA 3GRRA 1AMUA 4ND7A 2WQ7A 5ALOA 2B0JA 1F3OA 3AB7A 4HH3C 4W5JA 5DYNA 5DI3A 1N75A 1O6GA 1K4KA 1MAHA 3TR6A 4FJ1A 5K3DA 2PMKA 3O03A 2C95A 2O8EA 3DEHA 4FFOA 2O19A 2AD5A 3F67A 2AJTA 2WG2A 4YRNA 1NOJA 1T15A 1SOVA 4HQOA 1NFRA 2XYHA 3FTFA 4IS2A 2OAGA 2DFNA 1BFKA 1P2BA 2HIAA 4JGIA 4JL8A 4WNCA 2BMVA 2IY8A 4LBWA 4I14A 5I3CA 3WMXA 2VYVD 4XB6B 3SC2B 3MTAA 4X1OA 4RLQA 5IS2A 3B13B 1K86A 2ODPA 3C70A 1YNSA 3PYXA 4RANA 4E30A 2RKBA 2BBTA 3NQ41 3NNSA 4E5MA 1T13A 2AC7A 2QYTA 4FZRA 5JNSA 4L8GA 4LNHA 1A9TA 2GBPA 2VJYA 5B6PA 5ITZB 4HWRA 4ZALA 2IUUA 4TWJA 1MP0A 3EVFA 3KKQA 4Z4FA 1SA0B 1PKEA 1HR0B 2GBGA 3L7LA 5B30A 3EPPA 3NTLA 1I5EA 3TDNA 2PA3A 3D4IA 3RVOA 5CT5A 4N8EA 4Q7LA 5ALZA 1SHZA 3KJZA 4MP8A 5D1HA 2WNHA 4J07A 4M8SA 3VGPA 3D4NA 4YCNA 3K0BA 3K16A 4HWOA 1P91A 1G8KA 1SXGA 3E2IA 2FEKA 1QGOA 4K6CA 2Z5FA 2OQVA 3JR7A 2PHZA 1LDBA 1V45E 1W25A 3K09A 1Y4SA 1W5EA 3RI3A 2MDTA 4LCBA 3W6UA 3UKDA 4ZIRB 1H66A 1UDRA 1BYUA 2LBPA 3KQYA 4H27A 4IDNA 2QMYA 4KN8A 2XGOA 2I9KA 2GPJA 1YS6A 1IOLA 4ZK2A 4HFNA 3WP0A 2EJTA 1JKJB 1PWEA 2C9CA 2CUTA 2QM3A 3BMCA 4QTTB 4UZFA 3GEHA 2IPNA 2P2GA 1DCTA 1CQXA 2I33A 1O08A 2ZJ7A 2ZKIA 1L4YA 4AW9A 3W4IA 1NLMA 2AUMA 421PA 4M89A 3AHFA 4NJEA 4ZU6X 3UTCA 1G2OA 4OKSA 2BFFA 2MR6A 2PBLA 1AGXA 4RHXA 5CHEA 3AU8A 3NHZA 2L18A 2WZDA 2QKYA 1VSBA 2VH5R 3PUHA 2FW6A 2PT5A 4I9FA 3V4LA 4PQRA 4B4WA 4PLVA 2ZOSA 1EGHA 1DC3A 1MJ5A 2VJDA 1RACA 2NAFA 4HBGA 3W5JA 4E6PA 1V8OA 3RIMA 1HRDA 2NZ8A 2XXJA 4DR1B 4I50F 4IYRA 5CA1A 2QUJA 2XNHA 1LS1A 3S55A 1Z06A 3E9NA 3JYPA 1DJQA 1PDOA 1Z26A 1Y5IA 1CUUA 3G2JA 4FKZA 3GCZA 4TQ9A 3A8TA 1TMOA 3D0KA 2I34A 1CRQA 2F67A 5HFAA 4CQMA 1P2DA 2YWCA 3D8TA 4AD8A 4CIXA 4CV3A 1EXVA 2CCKA 2W71A 2K87A 1NVMB 3IGFA 4R5HA 3VTFA 4E07A 1AKYA 1N0IA 2W98A 2WAXA 4WN9B 1IM5A 2IF0A 5G41A 2RDMA 4G8CA 1YS9A 2HA2A 4L08A 5KYUB 1KK2A 4RJTA 5SV2A 4BNLA 4F6CA 4DTCA 2IVZA 3MCUA 3ZLVA 2VF8A 3STYA 5J5VA 5CVDA 4GZLA 1VGRA 2GXUA 3W9YA 1PK9A 3YASA 4DA6A 5BVGA 4GFDA 1FP6A 1JJFA 3I0ZA 5AW1A 5I7RA 4K9MA 1SWWA 1RPAA 1V5IA 4GZ5A 1YS7A 3LKBA 3GH1A 5FPTA 2R84A 4Z8XA 2FZLA 1RZVA 5B2FA 4YAIA 4Q3OA 1ZN2A 3C1UA 4LI3X 4Q7QA 2AW3A 5ECWA 4M2LA 2HRRA 4P80A 5ALKA 3FMFA 3IP9A 3L8HA 3LQ1A 3PFKA 2JKYA 2ZRJA 3PUIA 4PCUA 4ZQIA 3ZE8A 4J2TA 3K6KA 3ZWYA 4YAWA 4N1AA 1XE3A 3QXSA 1E1QA 4G07A 1ADJA 2HBQA 4GP9A 2P67A 3NHUA 2BFDB 1KK3A 5CT4A 4A9AA 3ZHSA 2TMKA 1U9ZA 2DTEA 2BDEA 2WWXA 4IXMA 1F6BA 1H42A 1UKEA 2KLHA 1Z6YA 1B6GA 4N5MA 5KKAA 3TMKA 2VBGA 3RR2A 5FL3A 3OWXA 4D4MA 1V4NA 4CE6A 4YLYA 1KU0A 3OKAA 2NVUB 1FW8A 2IDZA 3PQ7A 1FRNA 1FXUA 4OP2A 1ZJ5A 4FONA 4MWCA 5ALPA 1T5SA 3F6YA 4BJ3A 1Y9EA 2ZW9A 3DMYA 2VWHA 1VZ3A 1QYCA 3HI4A 3VM6A 4WBNA 1Q0LA 2W58A 2P78A 2Y9MB 1W5TA 3OZEA 4L7QA 1ONNA 1WHTA 3GY0A 4HNQA 4UUPA 5J2TB 3ZWWA 1L7DA 1TA0A 3ZZ1A 2CGEA 4HTFA 4IV0A 4P3KA 1O95D 5JAPA 2RARA 3U7QA 5D5HA 3IBGA 2VJOA 3PQ5A 5HUHA 3MJHA 2FUG6 3BG5A 3W5AA 3KOYA 4AO7A 3GX1A 1U4SA 2YYZA 4O2AA 4NBSA 3UJPA 5A71A 2I6XA 1QHYA 4RGYA 3U4HA 4AY3A 4KDRA 2F6RA 3VDXA 2ZIUB 2H1LA 2JCXA 5DEOA 3AVYA 1O6ZA 3A1VA 1XMIA 1P9OA 1J06A 1ODFA 3DR3A 1C81A 4MI1A 4UEOA 3URKA 4EBBA 1AUPA 4YRJA 1K7EB 3BKWA 3M5DA 4QXPA 1R4MB 2FSIA 2LW7A 2AVDA 2O8VA 3SVLA 2W5UA 1ST2A 1IB0A 4RV9A 1R6DA 2OCKA 1J49A 1AQLA 2C59A 1G9SA 1CJCA 1ZJWA 4O2BA 3TB4A 4CUKA 1JDUA 5IT5A 4WZBE 4ZTUB 3EFOA 1H0RA 2GPSA 2ZYTX 3NX4A 3PE6A 2AVNA 1HE5A 4LY0A 3M49A 5KI6A 4EYSA 2CXNA 2HCTA 3Q9NA 1XJ5A 4Y1RA 4CKYA 5GINE 4JK3A 1KF0A 1OLXA 1IATA 2PMWB 2QTLA 5ALHA 3RABA 1TO6A 2OGTA 3EH2A 3RAPR 3UHPA 1M5UA 2REXB 3ESDA 3DBRA 3U5ZB 3FETA 3PD7A 4F56A 3R4VA 5A3JA 3LC1O 4QOHA 1UF9A 1NMSA 5BR4A 5JSHA 2R8OA 5DGTA 2PTGA 4YN3A 2BFBA 3M4YA 4FFMA 4OY3A 5IK2A 1KR2A 1LNQA 2C84A 2OYCA 4JGGA 2B5VA 1LRJA 2GRJA 2Q28A 5IYZA 1LDNA 2O14A 3QFTA 1GZ4A 3OT5A 7REQA 5CM2Z 1U94A 4YRPA 4PVDA 3L0YA 3P0JA 4PFQA 1LVGA 3VU1A 3ONDA 2D5CA 4BVGA 4B44A 3WNBA 3QLJA 2WWFA 1I0ZA 3R6DA 2ZWPA 3ON5A 4BGUA 3L4KA 3RHSA 3A6JA 2JBWA 1UJNA 4FHDA 4BKQA 4F86A 3H9CA 2OV8A 3H5LA 5TEWA 5L3QB 1CS0B 3HKDB 3KOOA 4FGLA 4KBFA 1GPUA 1UUFA 3OKCA 1D2GA 3BWEA 5BOVA 4RX1A 3WFJA 2H4ZA 5FLKA 1J25A 1R0CA 5KVAA 1OREA 4MVYA 3AV0B 1PNOA 5C34B 3GLQA 3S29A 4O59O 2CLCX 1A95A 2EWVA 3GARA 3KYCB 1J5PA 3GP8A 1QO7A 2P69A 3BD8A 5CXUA 1Q92A 1XZKA 3M6XA 4C78A 3VOTA 3R8FA 3ZHBA 4M0FA 1F9EA 2HA4A 1XU9A 1XU4A 1ZCAA 4YV0A 1ZHFA 3UK1A 4A36A 3I09A 4P3OA 1XK7A 2OP1A 3EVEA 4XWGA 5AVYA 3K5PA 4KPYA 3MJ4A 1OXXK 2FSVA 3WAJA 1X1BA 2PS1A 5C8XA 2FMKA 1RXUA 1XTBA 2QYSA 1PV2A 1SCIA 1B8UA 1W0JA 3U81A 2V3WA 1CJBA 3JWPA 3PHJA 2C4HA 2UAGA 2HH9A 2GHQA 3WP1B 5A02A 1T4BA 1XRNA 3V1UA 2P9GA 3IQFA 3KO8A 2VA8A 1YI8A 4EG1A 1NBWB 4N7JA 2GB4A 3U7JA 1E3JA 4FSXA 4KVZA 3D3KA 4EMSA 3ZDBA 4YCCA 2D59A 1XROA 3DQZA 4QNNA 3KETA 5K0BA 1T36A 2PFSA 5LXTF 2DPXA 3VPAA 1H05A 2PH5A 1FDIA 1I3MA 1YB1A 3ICQB 1H5UA 1ECCA 3DE3X 4C21A 3VU9B 2IPAB 4DNQA 2XXBA 4C6TB 1JDBB 1V9SA 3LX5A 2XZDA 1U3WA 4QDZA 3THSA 3WO1A 3EGVA 1R50A 5GJBA 4KC0A 3CRMA 3DNFA 3G8AA 1MIOB 4IHQA 2QR2A 2VJKA 1GQRA 1L5WA 1OVMA 3COSA 3STTA 3UA3A 2IZOA 3G2HA 3K5IA 1MB9A 2OSVA 5FHRA 1N33B 5TQ2A 4LKOA 2R7NA 3ID6C 2ZYRA 3N75A 4XASA 3ZW8A 2PQ2A 4H0CA 1FJHA 4EY6A 5FBQB 2I4NA 3AKDA 2HUNA 5DHRA 5B1HA 4DUPA 4DV4B 3NW9A 4O8ZA 2GZRA 2A78A 1RC8A 3I9FA 3B3AA 1WTCA 3PFFA 2F3TA 4FQ7A 2XQVA 4EI8A 4YMTA 2ZUDA 4QGFA 3E9ZA 1XDGA 2DY1A 3I5AA 3W6PA 1T6ZA 5E4FA 5I7VA 5JNUA 4ZI5A 3EPKA 2XODA 1ESDA 1EP3B 1U7XA 2BTQB 1F2DA 4BNGA 4ERXA 4GYWA 3W5DA 1GCGA 5C31A 2IS4A 1V6CA 2NX2A 4C5AA 3Q8KA 2N0SA 2QV7A 1D1PA 3CWQA 3E7PA 1GG9A 1ZITA 4GPD1 5CFOA 2X23A 1AD2A 3I1JA 1EFVB 4PC1A 3ROKA 2PD4A 2JHGA 3U4IA 3BB1A 4LOIA 5F73A 5DBGA 3MAGA 1RHQA 2QI9C 4X6XA 5BURA 4B0PA 1FLDA 3FF4A 3BWDD 5LWQA 3RF7A 5CJPA 1NV9A 4KPFC 4Q1CA 1U3FA 2IXTA 3ZU3A 4F72A 2G70A 3T3EA 1H2FA 1XXLA 1PR1A 3BXXA 2L69A 2P2SA 3O8LA 4R01A 1PJ3A 5FR2A 1ZM4A 4AKTA 1T9ZA 3DBIA 3W5CA 1JXAA 4WCVA 4JWKA 2W2TA 5DHAA 4DYHA 3Q2KA 3HGTA 4BGDA 3WLQA 2H3HA 4Q7KA 3TAUA 1LK7A 5E1DA 3EHEA 1CY6A 2DU8A 1SIBE 2WTAA 2YHUA 1Y3DE 2F3SA 1Q57A 1M0WA 2C96A 3T3PB 2XLBA 1HM5A 1UPTA 3I12A 4CTJA 5BR7A 3U7EB 3K20A 2W0SA 1RKQA 1AA9A 1OLUB 1PYGA 2ONYA 4YJ2B 3W7AA 5TQ0A 3WK8A 3O92A 4J0FA 2R751 3UVEA 5D3MA 3SSNA 4G9GA 4CM8B 2YC2C 5EERA 1XD2B 2PGNA 2PX6A 4UNNA 3RQIA 4A5OA 4EA7A 4OYRA 1CUDA 5EUQB 4HGRA 1PUIA 1LW7A 5DX1A 1SHUX 3FPAA 1Y3AA 2OHVA 1RRPA 3A2MA 3C5WP 4YBZA 3TVTA 1WSWA 1CUWA 3IO5A 4BE9A 4MMXB 4AY5A 3MYYA 5BWMA 1CETA 1ZH2A 5IZCC 1G20B 4PSDA 4GPIB 5BNFA 3IJ5A 2CHVA 3GDFA 5GMOA 3ZQKA 3JQAA 4RHCA 3HO6A 1TD1A 1QOPB 1KPGA 1WXWA 2BD0A 3FIJA 2G4LA 3LT0A 1ENZA 3ZY5A 4B74A 3GMIA 2Q3HA 3AJAA 1USKA 3O0DA 1M6NA 3DDCA 2F3RA 3DO8A 5J3JA 1MAUA 1XVVA 1EXWA 2C97A 2E49A 5FPYA 3VO9A 1DWOA 3K73O 1XDZA 4BEBA 2X9QA 2IHKA 4U6SA 4V0RA 2ZAOA 2AMVA 3AV3A 3UMJA 1P2VA 2W2VA 1XIVA 3F6RA 2J3DA 4UHHA 1IUPA 1JEYB 1JDPA 2GUGA 4AY6A 2LZ0A 4PX5A 5HM8A 2YN0A 1HOXA 1YZHA 3ZBQA 4DNXA 4YRIA 3W05A 3H2KA 3HRIA 2HMVA 2J3EA 5FYDA 4BQEA 1JLLA 4KOEC 4QPZA 4XD2A 2COKA 3LT5A 4HMOA 4ZJYA 4UAGA 4CMAA 4YHHB 1GP2A 2ZT7A 4G5GA 4KLZA 3GQVA 4UBMA 5H3HA 3FOFC 3K53A 2G25A 3GGGA 3BWBA 4IMPA 1M2EA 1E2LA 4H35A 2IEZA 4TMYA 5FXMA 1XJQA 3RAGA 3NHYA 5JALA 3HWRA 4M9RA 4QM6A 4CTOA 4OQYA 2H52A 1UR5A 2FUG1 1QLHA 1UBLS 3OETA 2CLEB 1QYXA 2G6BA 3JQFC 5ALUA 2H57A 2G1AA 4C0WA 3GRUA 5KOIA 5LKAA 4WAUA 4K86A 5F33A 1W87A 1TYAE 3DPSA 4I3FA 3TTXA 1KHHA 2AG1A 2WLSA 5FUVA 4EENA 4P35A 2BEWB 4YFVA 3ZWCA 1E69A 4F84A 5AI8A 3H9BA 4DGSA 4ES6A 3GH3A 4IF6A 1HZZC 2D0DA 4UUMA 1N3IA 3ESZA 1NTRA 3OE4A 1CEYA 1S3SA 4EPXA 1G17A 5FLEX 1ACLA 3F4BA 4Z3DA 1TZKA 3ND5A 3BK2A 4TS9A 1WOYA 5DKFA 4E21A 3BB4A 1TYDE 2QTRA 1V7QA 3FKQA 3EQZA 4LSWA 1HF3A 2O5CA 3VQTA 2N1MA 1PQYA 3OQ6A 1ZCZA 3ILSA 4J03A 4B2IA 4MVJD 4RYLA 5IUNC 4IIGA 4LQCA 1DDIA 3E1KA 5KX5F 2O2YA 1RRKA 3PQ3A 4J0EA 1CVIA 3LUJA 3GP5A 5ECGC 1L5HB 3IJEB 5M5BA 4GO1A 5EUBA 4KWCA 5BN1A 3FLEA 5BMVA 1D7AA 1QK4A 1M10A 1YIDA 1S0UA 2D1FA 4FFLA 3GRAA 3PHLA 4HQNA 3EXFA 3F9IA 5HQ3B 3RYIB 5ICEA 4PSKA 2H2IA 1C7IA 1PWYE 3KB2A 5LKRA 3ET5A 4G0OA 3FFTA 1M2FA 4AG3A 3VDNB 3OWHA 1LUAA 1LXCA 4Q9LA 4RF5A 4C22A 4DA0A 5HM6A 2X13A 2CZGA 1U8YA 2PX4A 2VSXA 3KHUA 3NV7A 4S24A 4YMWA 5J63A 4D41A 5B1EA 5F23A 5K3EA 4BVLA 2XMBA 4EQ6A 1PU2A 1Q7BA 5FULA 1HPLA 1M1NB 1UBNA 3JQPA 1EFPA 3T3MB 5CLJA 1G3QA 1TM2A 2Q5FA 1L5SA 4WASA 2QGFA 1XMXA 2HRZA 4C1BA 5K9ZA 1J0BA 3LPLA 5BRJA 2NZ2A 4AO6A 4KQFA 4JJKA 4QBTA 4BNFA 2PZLA 3MB5A 4KRXA 4AKIA 1DBVO 1E0JA 1AZWA 4X71A 3VV3A 3F8WA 1EK1A 3V2UA 2H7XA 4BNVA 5L45A 1R4ZA 1RXYA 5CYPA 1JJBA 4LZJA 3L0CA 3GAFA 1GUYA 3ML1A 4M1SA 4GD3Q 3Q7SA 2D1TA 5FFMA 5ICGA 3LWDA 1HQDA 2GCPA 3IKVA 5LDGA 2PYZA 4HSEA 4AKSA 4C4TA 3DCJA 2DY0A 3HQ4O 4PC2A 2LVBA 4ZT6A 3UC9A 3DAPA 1L5GB 1FEZA 3ENVA 2E4VA 3JZMA 3NORA 4N41A 4LJ8A 2PVPA 3OBIA 5JIBA 3ISTA 3WTCA 1NRWA 2XD9A 2HDHA 3KDSE 4QOFA 3C15C 3B3JA 1M7GA 2J1LA 3O90A 2RGRA 4OREX 4WEOA 5LOVF 5KINB 1AE1A 3OFVA 1O97D 2CVFA 1ZC4A 3BRWA 1OY1A 8GPBA 2E6UX 3ASZA 5HGXA 1JBQA 4FM9A 2G36A 1V8ZA 2A1UA 3SVZA 4LWZA 1VHLA 1MDBA 2QGNA 2CF6A 2KB0A 5ARDA 2IS1A 2FEOA 3B6MA 4HFJA 1EZZA 2RHWA 3KSMA 5CD9A 1Z4PX 1X92A 1X3LA 2PT6A 2YY7A 5CBPB 5K20A 2XYQA 5EQFA 1N2GA 2P9ZA 2H31A 2GAOA 2YUIA 1KYWA 4KSCA 3R20A 3H6HA 1LBEA 4M7PA 5ALDA 4MS1B 1ESZA 3MGAA 3LP5A 4ZOLF 1ZHOA 2H2FA 4JY7A 3SR3A 4YGYA 4OQQA 1OXTA 1SB8A 2G0AA 3CX6A 3NT4A 2ZI7A 3ANYB 4A6EA 4ZFNA 1ZL0A 2ZXUA 4DMGA 3L07A 721PA 2ASVA 3R4CA 2WJYA 2X15A 5LYJA 4R2HA 4B4VA 5A2QA 4UDXX 5G40A 3TRDA 3OO1A 5KNBA 1OFIA 1PS8A 5DWDA 5EIOA 1ICIA 2QM7A 1VJ1A 3L7MA 1XRJA 4YPOA 1V6SA 4P5EA 3X1XA 1RHJA 4NPHA 1ONPA 1K8ZB 1YVPA 2AK3A 1T5LA 2V7TA 4LHXA 2R8ZA 2I7DA 3DOFA 4Z54A 2EKBA 3T94A 1JMKC 4E2ZA 3PPWA 2QJRA 1C7EA 3FAKA 1U6KA 1G8AA 1Z17A 1TA4A 3WYDA 3CPSA 4W9RA 5SY6A 4MV7A 3Q41A 2OXTA 4ZA2A 1GZ6A 3S4YA 2XCTB 3RUEA 3C6YA 1VA4A 1J97A 3JXEA 1TQHA 1SZCA 2OCGA 1WNTA 1NRXA 1Z7GA 3KUUA 4M1KA 1UZMA 1QHNA 2FE4A 4S1NA 5GY7A 1GRRA 1MG0A 2JLWA 1R9NA 4B7XA 1SKYE 2O1WA 2WUVA 2VDPB 2FSHA 2AT1A 3HACA 3SC6A 1Y63A 2V0CA 2CB0A 3JAWB 4ODIA 1EK5A 1KJ8A 4V0QA 4ZVVA 3V2IA 4DAOA 3O73A 3OA2A 3V55A 3MCWA 2GYWA 4TRRA 3DE1X 1TCVA 2EIHA 1DZIA 4ACBA 2I2WA 4Q4CA 1IFXA 3KYDB 3ADCA 1YFJA 2B30A 4X95A 2C3OA 5CA0B 4B7ZA 3TQHA 3OT4A 3MERA 1P7WA 4GNKA 3ZTTA 1R3UA 4RHTA 5HILA 3RS8A 4Z1MD 2KLBA 4NQZA 3O75A 4DN6A 4RLSA 1S8FA 1NQTA 5LQSA 1XPUA 1GOTA 2D5IA 3FMVA 4BO0A 3N87A 2UXBB 1NHGA 1KC1A 5NULA 2XF8A 1WPRA 1SC4A 2B8WA 1EGQA 3LDUA 4P31A 5ITZA 5KWIA 3QMMA 4GQAA 4M8IA 2EFJA 1SG6A 1KAEA 3VHLB 3VPHA 4E33A 3HYCA 1EJ2A 2O4UX 3RJZA 3VR5H 3WGHA 2Q2QA 3IV6A 3UV7A 2QVCA 3UA4A 2P9QA 3IHWA 3WGLA 1UAYA 2AA3A 1TF2A 2IITA 4H59A 1YFLA 2C2HA 3L7BA 2VQDA 2FVYA 1S9HA 1XWIA 4NE9A 3RRNA 4IFIA 4PAMA 4HDKA 4MA4A 4D57A 1JFRA 4JOCA 1WCV1 1O2DA 3KSUA 3ZDRA 1AQIA 4M60A 1X38A 2FWAA 4J0KA 4Q4HA 1SOUA 3ILVA 2ZP1A 3AIOA 3LLUA 1XMSA 3EBOA 2HMSA 3WL3A 3ZDDA 1VHDA 2V7XA 3BHMA 4O0LA 2A9KA 3B5EA 3T7RA 1MGOA 2RGXA 5H3LA 2YY5A 1V0JA 2H2DA 1RMQA 1GCAA 4JWTA 3GLTA 5DSTA 4C4ZA 4BX9A 5M34A 1ZCJA 2Q3FA 4J0JA 3ZLUA 1QIJA 5ALXA 3KJHA 3N2GB 4PPYA 5AI6A 3SD7A 3PQ2A 4FDUA 1WZNA 2QD4A 3H5TA 4RY8A 1OYWA 3ZZUA 3HJRA 5CTJA 2IL1A 1LB1B 5KTPA 5CIWA 3IQEA 4MW2A 1SIOA 1HOTA 1UBSB 3ZBUA 1M0TA 1W2HA 3CIOA 1JQEA 1VCOA 4X60A 1G1MA 1Y4UA 3FVRA 2C2ZA 2GK3A 4OLJA 4MW4A 2GFIA 5BWLA 2YJNA 3DEKA 1K27A 1IXKA 2COEA 3PEVA 2WICA 3ZXSA 4NI5A 2EF1A 3FB4A 4K05A 4F9TA 2IDMA 1A4RA 2F4NA 4B2YA 1K3TA 2VZEA 3L46A 5CR9A 2DHRA 2GFHA 3VVCA 2JAQA 4QYMA 5JZBA 3A3NA 2IHBA 4P7KA 3M1IA 4M55A 2XA1A 4OI2A 5HJ5A 2BAGA 4PN7A 1X1RA 3X1KA 4IR7A 1RLIA 4F6RB 5BW5A 1ZNWA 1YZTA 1ZIOA 3DZIA 3QYFA 1XTPA 1Z6PA 2GJKA 3WQSB 2UXCB 3DAFA 3BL5A 1EWRA 3D3WB 5CG1A 1SUBA 2FV8A 4H6XA 3I6MA 4PYNA 5LZ7A 3FN4A 3HY3A 4JUBA 3VNRA 4G67A 1WZCA 4MWDA 4XX0B 4MK4A 2TMYA 4EL0A 2OK8A 2VXOA 4CLOA 4DLRA 5E7MA 4KXFB 4OGFA 4U00A 3RK4A 5IKXA 4H1UA 2YVAA 4OO3A 5DHFA 4RSHA 4OJMX 1YJ8A 2K7FA 3V1MA 5IZCA 2NUPA 2VYNA 4C14A 5LU9A 2WHRA 4F60A 3RBXA 4JXXA 1G9XA 1V9LA 3E8MA 1SVWA 2XZOA 4AWXA 4QYWA 4Q3BA 1DKRA 4EFKA 2FEXA 4BMXA 5A4IS 1CHDA 1JJVA 2Z6VA 3WJ7A 2WSBA 4JN6B 4E7PA 3U31A 4CW7A 3NIBA 4KO3S 2I22A 2EKLA 3OP4A 4B33A 3COVA 4RK5A 2ODQA 1HEUA 1HMPA 4LDZA 3LUDA 4H1TA 5CDUA 4MVJP 1DI0A 4HDOB 3GUZA 2WUFA 4QTZA 1NVXQ 3WJAA 4KQCA 1RKUA 4OGKA 3GRVA 4JYMA 1Y9JA 1O7JA 1U8FO 4NWIA 3RYFB 1DFHA 2GM5A 2A84A 4GI7A 1ZWLA 3K2IA 3WY9A 4AMYA 4BLPA 3MHPA 4MNTA 4GG1A 2Q45A 4QELA 5BN5A 3RUPA 3JQFA 2FLVA 2W11A 5DNAA 1GILA 1L4KA 1L4MA 2NTYC 4CHGA 4EKYA 1Y4AE 1LTHR 1SR8A 1NBIA 2XDQB 4KQ2A 5AJZA 3VISA 4AMBA 3ZZMA 3SMVA 3JARA 4E14A 1Q1QA 1Y6JA 3ITKA 4OH1A 4DUGD 2PAFA 2CNWA 1GPBA 3TPCA 2HV9A 4LSGA 3UJDA 3ZV5A 1HZZA 2O50A 1GGNA 5DHUA 2NQ8A 1LI7A 1CZUA 2BF7A 2WMYA 4K6OA 3GZJA 4UBKA 3LO8A 2ZBRA 1TUIA 4MQFB 4XQGA 2ECPA 5ERGB 1OXMA 2SNIE 4B5KA 4K8RB 4BV2A 5IZ4A 3KSAC 5FNVA 4MP6A 1KJWA 3KAKA 4XXHA 1KJYA 1A1VA 1O94D 1T2AA 1HBJA 4LDPA 3OTGA 2YMPA 3LCRA 2CUZA 3DCIA 3RIEA 4Z9XA 3Q8LA 1EXMA 2GN4A 2WTMA 2XYPA 3PEUA 4PANA 4ZI7B 1PFQA 3VDQA 2HJSA 4G1MB 5IM4F 4F3CA 3KS9A 4U63A 4D9NA 1WF3A 5DM2A 4CLRA 1YOVA 2VK1A 1E6KA 4KO2S 4P4UA 1WCIA 1I2AA 4DGQA 1BDJA 3RJ5A 2XH8A 3MPOA 4QBFA 2E6KA 1THGA 1X6VA 3JQDA 3PDUA 4ZANA 5F77A 3PT9A 1B43A 1GGJA 1PGNA 5AOCA 1IY8A 3FPCA 3OC6A 1WP4A 2QDKA 1Q0RA 4NENA 1VL5A 3O8DA 3PDIB 4RPHA 2JB9A 1GIAA 1K7YA 2D1QA 1WB6A 4NMLA 4NYMQ 5DM1A 4B3FX 3KLMX 1T3HA 3HH8A 3R0XA 3DL0A 4TTTS 5ALQA 2HWYA 1U8TA 1JE0A 3W5IA 1UDAA 1HNNA 2AL7A 2JARA 3TM5A 5JD5A 3R7DA 5DI3B 4LF9B 1VMKA 3QE0A 3A32A 5T7BA 1E9RA 1CHNA 5LMUB 1GFSA 4G4JA 3SI7A 3OTOB 3WQQA 4FYXA 3X1WA 3HI6A 5HKKD 4KK4A 4Y6GB 4JBNA 5GONB 4HUTA 3MWKA 4IO0A 4RFVA 3THOA 4BTLA 2BKEA 3EXAA 3MBOA 3BWYA 3L8CA 5IAGA 3R3YA 2RB4A 2ZIWB 4D9GA 3SC4A 2HC9A 3KZVA 3LCMA 3ETCA 1P1KA 2DBQA 2XBLA 3WA7A 3IVCA 1ZUHA 1KO5A 3MFQA 4QG3A 4QGSA 1UDXA 1XF1A 3JZIA 4P0QB 1M75A 1BHSA 5A0FA 1KEZA 4BO1A 3AVUA 3IKJA 1ZS9A 4O08A 4KVAA 1PGPA 5IMBA 3E8XA 3GFSA 4RXMA 1QAQA 2XY4A 4CQJA 1B3BA 3P9IA 3IPRA 5C0OE 5ALNA 3QLEA 4IWYA 2QP3A 1X1QA 4UMDA 3PFIA 5DV9A 1EE2A 3F7NA 4QFCA 3HDYA 3RSCA 4Q1DA 4C07A 4M1WA 3CRQA 3M9XA 1UJ5A 2HJWA 2BM8A 4GICA 1YA8A 1CB7A 4I6EA 5IJ0A 4KBGA 3OH8A 5JWRA 1Z62A 5HIMA 2EHJA 2PZAA 1AUQA 2G72A 4WZBA 1CEXA 2AFVA 2VRWA 2WWRA 3L7DA 5IANA 1L5KA 1ZO8A 3ILYA 3WIEA 2WMNB 4K3UA 2WWIA 4HX5A 4L9WA 3UC5A 1TJ5A 1Y42X 4NCHA 4BU1A 4IL5A 2BMFA 1E2KA 2GBLC 3I23A 3M9LA 3WMEA 1USUA 3PGKA 5AVZA 4HFMA 2ZB3A 3N3BC 1G3IA 1NX6A 3LM8A 4HP8A 3VX4A 1ZH6A 2P9FA 2EOAA 4J0IA 1M2KA 1ZOSA 3CRZA 2PUJA 3MXOA 4BPBA 1ID8A 5EA2A 1F6WA 3KT6A 4NJEB 3EISA 4ZT3A 5H0IA 4GBED 2WU0A 5H4GA 4E11A 4NBWA 5F21A 1CZRA 1KDZA 4NV3A 1G2QA 1K63A 1PWZA 1YRLA 1XBTA 2VYVA 2K5UA 3KEMA 4L75A 4PO3X 4LDJA 1HETA 3EMVA 2H8GA 2O8DA 4WOKA 2A0WA 4EG0A 4J0GA 2DPMA 1G60A 1MV5A 2QLNA 2B3TA 1XVUA 4H0FA 5THKA 1QGUA 2HA3A 3MUOA 5C7OO 2Q5CA 3JD3A 2PXHA 2HFKA 1R74A 1RRCA 4URYR 1VYVA 4PRKA 4W99A 5LN1A 1NQOA 1BG6A 1BEZA 1I7QB 2CNBA 1D2HA 5FAXA 3ISJA 4CQMB 3K9HA 1R4NA 2BR5A 2DBYA 3AIKA 4O4IB 4C4RA 5L4LA 3FVQA 4I1IA 4FCVA 2J6CA 5FOUA 1V4VA 2R7KA 2P4QA 2R87A 1E9BA 1S4QA 2ZI4A 2CUNA 2IGTA 3AI7A 4WKCA 4X7RA 4BQOA 1UIRA 3M6AA 1OJLA 4JLAA 1GNRA 4IJ6A 5KWEA 2DTXA 3NNNA 1M76A 2BISA 2YY6A 2XWJI 3SZUA 3ZOKA 3QOFA 1MNQA 3GVPA 3H5VA 2BGWA 3IB3A 2OFFA 2JGJA 3C8UA 3BH7A 3OQJA 4UXHA 2HWWA 2XITA 1QWSA 4DCCA 5BQFA 2FGKA 1GAWA 4BS9A 3OM8A 4NCNA 3RTBA 4L5BA 3G7NA 2CXTA 2HNKA 3OM1A 3M6LA 1EQAA 3GVCA 3OQIA 1ZIDA 3HRKA 4MRNA 2C3YA 4AT1A 4DQUA 3FH0A 2JGKA 2OV6A 4KR2A 3AR7A 4OLFA 3V2GA 4HNUA 2WF8A 1H5QA 1DJLA 1N6LA 4W7SA 4ZV7A 1FDWA 1M8PA 3EWIA 3BYZA 2N3ZA 3HYSA 4MKHA 1NW8A 3UGQA 1D2RA 3FR7A 3R2JA 4I1VA 4OHRA 5TIIA 3QNUA 3B78A 3VKHA 2BE9A 3WNZA 4KUEA 4FXPA 3H86A 5DNVA 5FWNA 1U7TA 2IC5A 1H0HA 5AKIA 1VJTA 2FHPA 3VSEA 2B98A 3TBHA 1U65A 2FHSA 1RFLA 4H3VA 1SCUA 1OWMA 4IV5A 4FS8A 4PU0A 4F9FA 1HO3A 2ODBA 2F1KA 2KM1A 2Y0CA 3GUUA 3H4VA 2QYHA 3QMVA 4PRLA 5LP6C 5TJHA 3UHFA 5E0OA 3WMGA 2MOKA 3KV3O 2LIPA 4Q9IA 1U5BB 3O8BA 5BYJA 1TAGA 3GG9A 4K9OA 3R7WB 5ADHA 5IJ9A 4ROSA 2G08A 4URWR 4S12A 1ONOA 1WHTB 3L0OA 1NJFA 5KQPA 1MRZA 4D80A 3G5TA 2R6FA 3OZUA 5C7YA 3E9RA 1AQJA 3I61A 2ZB2A 3HJNA 3MVEA 5D5PA 3UHOA 3HB9A 1QQAA 1E3MA 4C2TA 3D4PA 1PQWA 5EOVA 4RULA 1BCRB 1MB3A 4MUYA 3QTBA 3U37A 4HT3B 1NF8A 1YMQA 3DDZX 4IDCA 2DGDA 3N0TA 4L57A 4TVBA 2YMMA 3GWGA 5KNDD 3K96A 3CF4G 1N8NA 4EKNB 1NUAA 4K8OA 4MR7B 4QD3A 2KI5A 2W42A 3GJ0A 1H8HD 1UBCA 1YBVA 1EHYA 2FXVA 4P2GA 1HTBA 4MSUA 4PCVA 5JY6A 5EWMB 2PG3A 4OL9A 3WLRA 2IYUA 2VEOA 3MJDA 2ZBFA 3C3MA 3N6VA 1PZGA 3PGMA 2AZ4A 2JVIA 3L93A 3LS2A 3X2EA 2B5OA 4DIDA 1O5IA 1TI7A 3OECA 3WLJA 4O2BB 4B31A 5AR1A 1T1IA 1BAPA 1G8SA 3DC7A 5JU6A 1CPYA 4RQUA 5I7AA 1VE6A 4ARUA 1YCFA 5C2JB 4M0KA 1QUEA 1LBQA 4Q0MA 5E6RA 4QO7A 2HF9A 4LBZA 2QRUA 5M04A 4AZ3A 5IF9A 4Y1RB 4V0ME 3CCCA 3PVCA 2XMSA 1M2VB 3QE9Y 1CNMA 3R09A 3K5WA 1W8IA 1SU8A 3E5NA 2NU8A 3TW4A 2V7BA 1P6QA 2CC2A 3H6KA 4GI3A 3WK5A 3UBMA 4Y7CA 3FCUB 3KPYA 5EJ2A 5L3RA 3LT1A 1H2EA 4U1RA 3RU7A 1PR5A 5IYZB 3PJRA 4Y1GA 1WF6A 2GX6A 5TXGA 4AN0A 1KY4A 1A9XA 4RNCA 2XWBF 1F38A 2QJFA 3TTSA 4MMZB 3SXPA 3LZCA 1XV5A 4UMEA 2P1DA 1O95A 4FFSA 5AI4A 1UDWA 3IYLW 3QOXA 3ZKAA 2NZXA 4OCZA 4QDTA 4AK9A 3K1AA 4NYIR 3N2NA 1G0NA 3ABQB 2JANA 3CNNA 1P2SA 1O54A 5HE9A 4EJSB 1FZTA 1U04A 3SFZA 1UJ6A 2VJLA 1OYVA 1TC1A 1LRKA 5H3CA 3U6KA 1JHRA 3DLPX 3EJ6A 3B7GA 2PUWA 3VSDA 3GMSA 1JFLA 2O2IA 4MQEA 4C2BA 8OHMA 5LIPA 1W7AA 1OBOA 2MR5A 1KSGA 1L4LA 3RJ9A 1NXVA 1M83A 2GEFA 1XZBA 3NH9A 3CG0A 3OUUA 3ZCUA 2JJYA 1O97C 5AHKA 2JJ1D 4XUEA 5CYFA 4INZA 1V39A 3EFEA 4MP3A 2ZAMA 5A05A 4RIGA 1YSCA 5DHQA 3SIPA 2VKTA 2CD9A 3CRW1 5JAQA 4NYJR 2OCLA 2FN8A 4G26A 4AUEA 4D7AA 4H77A 1Z2EA 1YVUA 1NFQA 3MTQA 4XB2A 1ICEA 2BFPA 2G9UA 5JPIA 3VH3A 3TZEA 2ZSJA 1TL7C 2XADA 2WYIA 1DCFA 4M22A 2PWBA 2IK8A 4EO7A 2PMDA 3ZI0A 5B1YA 2ECOA 3EC7A 1Z39A 1RC0A 3CEAA 3F46A 3K6JA 1YD7A 4FDAA 1NBAA 5H70A 1VHJA 1DQNA 1WXDA 3ED1A 3HMQA 1SNYA 5FFNA 3ZG6A 5L9AA 5GIOE 3MWFA 1ORVA 3TI7A 2WF9A 3FFXA 5I4IA 3PQ8A 1VJGA 4DSZA 4B34A 3EDYA 1BMTA 2GA9A 3MWEA 3OPMA 5FCDA 3QWBA 4JLUA 3T5CA 4C03A 5JCXA 3U44A 2V65A 3CJTA 3UH1A 5MN4A 3ZWKA 3IPXA 4HJXA 2EFHB 4M1EA 1IUOA 4MCAA 4UMVA 4CKEA 4IGEA 5M29A 1XI2A 2PIDA 3C3EA 3NXKA 4D8VA 1N7GA 2JEYA 3K31A 1WXQA 3ELYA 3N0XA 3INRA 3QSGA 4NFHA 2XVYA 4R5MA 5DYWA 1FXWF 1T1SA 3I1YA 4MWEA 3UOGA 4KPGA 5ESXA 5BT8A 4B9EA 3G3EA 1JP7A 5AOVA 3B1XA 4FLEA 2CY0A 5BO5A 3LPMA 4XTCS 1A2KC 2VP0A 3OX4A 1Y6QA 1J8FA 3FLBA 4K6HA 3UWOA 2WTEA 3QELB 3H6GA 4MMYB 5J40A 2TRSB 3EC2A 4LHYA 2JH3A 4KPEC 3NR2A 2E7ZA 5ERYA 3K6SB 1CZNA 3W6OA 3G0IA 5IEBA 1DQPA 2FX5A 3GNTA 4Y7DA 3AQ4A 3D5TA 4R3NA 5CITA 5L6LB 1QIMA 2I2CA 2RKWA 1OAAA 3TRKA 1JHOA 4DDMA 3TI9A 4F3YA 3UAGA 4F96A 4X7MA 1RZRD 5C8DA 3BFVA 4FNMA 4PLWA 5JBNA 1J07A 1YL5A 3EIQA 4FYJA 4B7AA 2OHJA 4I3GA 3FPLA 4A27A 2EKZA 2R7LA 2BFCA 4IWNA 1G5QA 1B2LA 4PHFA 2VPIA 2VQ6A 1RWXA 3WWZA 2XTZA 1XZEA 2JAXA 1FQJA 4PO1A 4ZAWA 2ONJA 1PHPA 4L4ZA 1N9ZA 2RD2A 2C7VA 2DFPA 5EP3A 2LKDA 5FBRB 4CM9D 5C4MA 3BWCA 2EDAA 4U0KA 4OA5A 1EHIA 2ZYWX 1SU6A 2BHSA 2OOSA 4W4TA 2GCEA 1WHSA 1PTJC 2PUBA 5B7GA 3EPJA 3ZH9B 2VAPA 2PUGA 3JZAA 1E8DA 1NMQA 1L8OA 4INPA 3ZY6A 5J5CA 1CQPA 5AK3A 2P62A 3N2KB 3U60B 4UEWA 4CF4A 1RZ3A 3R5XA 3PXGA 1UPUA 2QRJA 4RGVA 1Z75A 5JAOA 3PWZA 1CP3A 3RV3A 2FMHA 1CJTC 2C0QA 3FG9A 3CG4A 1T0UA 3G13A 5IKOA 2OZLA 3NYWA 5JXIA 1JIIA 1DOAA 1T9HA 1VG9B 4RMJA 4F4DA 2XDYA 4GBGA 3OQNA 4ZO4A 5C8YA 2JLZA 1JBKA 3DFMA 4MR8A 2WUWE 3GUYA 3ZR4B 3AHGA 3B6IA 3EGWA 2QTVA 2YCBA 2EW8A 3AINA 4UFOA 4A10A 3ABOB 1Q91A 5TQ0B 1VSVA 1K6MA 2JIQA 5D3MB 3C4VA 1H6CA 4OSOA 5FF9A 1WD7A 2B34A 3IR6A 4D4HA 4DCVA 2FFJA 2Q21A 4JP5A 2WU1A 1PR4A 1X8LA 2RHTA 3GRFA 2V97A 3P0EA 3PLAE 1V7PC 4HPXB 5HA5A 1Z37A 2IZ7A 1M0SA 2EWWA 1Z4OA 1KP9A 2BC9A 3P9SA 2PFGA 1Q1EA 4EVSA 2PUCA 4JROA 2FPXA 5DASA 3JQAB 3DKKA 2GN1A 4JFRA 3L0BA 2YMQA 4GVLA 5HDBB 5IC4A 3LQ2A 3A0UA 3L6DA 3VTKA 5KB3A 3F4LA 1ISSA 4LJKA 4Q1FA 5FB3A 1THTA 1XVIA 2MIIA 3O4GA 4DJ5X 5IHPA 4LFAB 4CM7A 3LSTA 3EE6A 4LAFA 3SZRA 5JQGF 1RVDA 3K0SA 2VATA 5FPQA 2Q1TA 1STOA 3JWHA 4OHFA 2I87A 3ENKA 1F2UA 3KVOA 2JLRA 3QKWA 3OIFA 4P83A 4UD2A 3PRKE 5AVUA 3DQPA 2JZNA 1HT2E 1I33A 1PDWA 2GBLA 2H00A 2X0RA 1MXHA 1VXOA 3EFBA 2PS9A 1DOHA 5BUCA 1T9CA 2HK8A 2FOLA 3O1IC 1E0SA 5LL6P 4DTIA 1WDTA 3QHPA 2G28A 2WV9A 4P33A 4Y6LA 3TX2A 3QNWA 1Q6ZA 1YGYA 4IIEA 4XM0A 3GT4A 1F8UA 1IK4A 3ADBA 1I01A 1TW3A 3J7TA 5KEIA 1LDGA 2QVBA 2YJGA 4JLBA 4EI2A 3PX3A 4WXRA 1USGA 3QF4A 2WU3A 2EKDA 5TY0A 1MOSA 4UEKA 2D8AA 4U8HA 2YQ4A 1O5OA 2Z8YA 3GI1A 4NSNA 4RHEA 4PLCA 1PR6A 2J85A 2KBEA 2LGJA 1DXHA 2QY9A 2RAPA 2Y76A 3V8BA 3T9DA 3AESA 3ZYCA 2EG5A 2QN9A 4B35A 1D6SA 2IP4A 3CRVA 3IO3A 3OQHA 1XRLA 5KJCA 3L9XA 1NXOA 1JECA 4NZNA 5TARA 4XVCA 3FSGD 2FFQA 4X7BA 4MI9A 3JVUA 4HWPA 4JGBA 4BLVA 1RYYA 2PVSA 4YACA 3WYAA 2FMXA 3JY6A 1E5TA 3I30X 4PGMA 3FFWA 4ALNA 1QLJA 3AF4A 5C18A 4XEHA 3QH4A 1ENYA 4O1IA 3MW8A 3O2SB 5IDXA 4MUGA 5AW6A 2GZAA 1QVAA 3M4ZA 3BCUA 4AN1A 3H9UA 2E4XA 1ZUNB 2OVBA 3PXXA 5AHWA 3AX6A 2JFWA 4URXR 2QSZA 1QIDA 3RC2A 4EB8A 3DDWA 4DZRA 4DNPA 2ZWVA 4Y1FA 1P1FA 2C82A 3VU3A 5BMVB 3AMVA 4JJ7A 4LSZA 1QRAA 4WQMA 3IE1A 4V3CA 1H9BA 1W6UA 2WAAA 3DL7A 2FPPA 4JCOA 4BUJA 1C50A 3EXFB 5EIAA 1SD1A 4LA4A 2FRVA 3SLGA 4HDSB 3RUHA 3T5DA 2WHPB 1NQWA 4II2A 3GLFA 4HNSA 4WK6A 1GPWB 2YHSA 1ZN9A 3BQ9A 1UK9A 4O4LF 4UM8B 1A96A 2J48A 3IQDB 4H3HB 4RVOA 3TCNA 4F4FA 1IY0A 2ODTX 3I92A 2V7PA 2WM2A 5GVRA 1MUUA 3PTLA 3R3HA 3ROGA 3O82A 1EFPB 1CE8A 5HR5A 5L7WA 2W37A 4PC7A 1ZGHA 4Q39A 2H1OA 2VPWA 1FUKA 5LP6A 2OFXA 4RD3A 2Z6QA 3WZ2A 3ELUA 5EWJB 1I0IA 3QF7A 4KX5A 5FYQA 4LK2A 4FYKA 4CFSA 1NR5A 5KYWA 2H11A 3IIJA 4Z3KA 3LWNA 1R6BX 4NK5A 3RRFA 2WSLA 5A5FA 5TQJA 1JG7A 3WDMA 4A1FA 4Q93A 1EFCA 2C1ZA 3A1EA 3QKRB 2WM8A 2WUEA 4FMCF 3HZOA 4FOTA 5DGCA 2OHHA 4CV2A 2IUFA 4ZCLA 3ZUGA 1SZJG 1NW3A 3W2HA 4K2HA 3RVNA 2GPBA 1BTOA 4MVJA 4PNEA 5FEMA 1PFYA 2R8XA 4JSRA 3EEBA 4HKTA 3RAEC 3R6LA 4QYIB 1TVEA 1ZL2A 3K8ZA 1J2RA 1FX0A 2OT3B 3FRHA 4KAXA 4Q47A 2GASA 3O3CA 4HRYA 2J5XA 3COZA 4NV0A 2I4LA 3VUFA 1Q0UA 3FJOA 3B52X 4K2AA 4MAAA 3W8RA 3T1VA 2FWIA 3CLRD 5IWCA 1R0KA 1V4BA 1VCMA 3ONEA 1E0AA 4KNWA 4E51A 3AOEC 2GEUA 5G1NA 1OGYA 5G2OA 1A98A 121PA 3FCOA 2B0CA 3V1KA 2B35A 3P5SA 3UW3A 2VZLA 1NULA 3T8YA 5CVCA 2VP5A 4DMFA 2QL7A 3U5TA 3RS9A 3EZNA 4OHBA 1NQXA 3O6VA 2JFHA 3TIXB 4D43A 4IGKA 1EG7A 3H9GA 4WUVA 4YC7A 5BSTA 3VJLA 1NSYA 2F7SA 2P8SA 4K03A 4MV8A 1FL9A 1DO0A 4KZPA 4R2JA 3AEQA 3ZZTA 3GFRA 2CL0X 5JISA 2O7SA 2JRCA 3OZ7A 1N92A 4YJ2A 2GZHA 2CHGA 3H5RA 1ODKA 4XSVA 4QRDA 4YP7A 4FDVA 3T1HB 1ML3A 2Q62A 2IYOA 4G2TA 1PUXA 2Z8XA 4JZYA 4OMUA 5HXAA 1WZUA 1LLUA 1BRTA 1QYVA 2F17A 1DADA 3RPEA 3PBKA 3AVVA 4A0HA 4C05A 1EX1A 1NNSA 3HDTA 4N7BA 3Q5DA 5EINA 3NOVA 4TRJA 3GPLA 3L92A 1V8PA 3PRJA 5AKZA 3P20A 4NNPA 3JW8A 2PV0A 4DVJA 5C9ZA 2ZPTX 1SUFA 4MV3A 3UAZA 1XR3A 3HKEA 1GZSA 2QN1A 4MI6A 2DWQA 1JWLA 2RC6A 4MQ4A 3SM3A 2RK3A 1DQRA 1G41A 3C6ZA 1LTKA 4C7MA 1GR0A 2QP4A 4Z7OB 2YZKA 1BW9B 2ZYAA 2CMDA 2HO5A 3CLKA 3QVGA 3BFXA 5DDIP 1WETA 3KTDA 1T0BA 3LHFA 3MSXA 1HFWA 5IHXA 1ZR4A 5G0TA 3LLCA 1IK6A 4DIKA 5I7EA 1W5AA 5FQNA 4KXWA 1SHJA 2YRXA 1H2YA 3GD5A 3MWGA 5AW5A 3RSGA 3WGJA 2NU6A 1RPZA 3J81A 1N4DA 2FMUA 4LHEA 4RPIA 5E1OA 1N4AA 1YAHA 3K1ZA 3TM4A 2Y1CA 4H17A 4D9JA 5BV2P 3EG5A 1BXRA 1RQNA 4W9MC 1URPA 3U7FB 2OO3A 1C9DB 2KW5A 4LZPA 5HEKA 1KS9A 3H5AA 5LQJA 3IELA 4NK4A 2EFYA 3NBMA 3MPUA 4MDEA 2IPMA 1N2BA 4FSHA 5LA6B 2E82A 2Y67A 3WV4A 1GXSA 4TL7A 1U7PA 3T0IA 3N58A 4LJ4A 3IVAA 5FI1B 4FYWA 4KQEA 2B20A 3I8XA 2DUJA 4AXXA 5IVIA 4DCUA 4D4GA 2QLMA 4BFSA 5HWSA 1SHTX 3Q15C 1L5NA 1VIYA 3IA7A 4IH9A 1KOLA 1ZM3A 4HZUA 2R65A 2VHVA 1C9EA 5K0LA 3CGWA 4JLVA 1ZEJA 1NY6A 3DMPA 3PP8A 1UEJA 4KAFA 3VKFA 3RM3A 4MYDA 5TGTA 5F2EA 4ZOAA 2Z5LA 2BMWA 2VJBA 1GSHA 1L7XA 2A5DA 1LQ2A 4QEDA 3TZ6A 4BVAA 1FMCA 4HDKB 2O52A 5HSGA 1P0MA 1YE3A 3W6NA 1GGFA 5KNCD 2QL5A 3X1ZA 2A86A 1KI8A 3O9MA 3GBPA 3JPWA 4DC9A 5FPSA 2BVNA 2C7BA 4HPWA 2OORC 1Y5NA 1JHPA 2WR8A 2JGNA 2YWDA 3QVTA 4DXAA 1B0ZA 1CDOA 1FNNA 3DOEA 3IVMA 4LGCA 1QMGA 3NIGB 5G4LA 4H3KB 3PNYA 4MPDA 4WK2B 1NTOA 4GU5A 4UZSA 1YZYA 3LQ4A 3OHSX 4TWZA 3ZCRA 3QHQA 4EEZA 2HA5A 4P92A 1KQFA 1F7UA 2RI1A 1Z0KA 3SIWA 4OM7A 2OB1A 1CIVA 1ZVMA 4TKLA 3FI0A 2ZG6A 3R0VA 1VGVA 1HE8B 3CTPA 3TZQA 3PPXA 6REQA 1O4VA 4HJRA 4FBMA 3C3XA 3E2PA 1UKCA 4BFCA 5L4SA 1OILA 2P7HA 5F76A 1IBMB 2ARKA 3OFKA 4K1XA 4L6CA 3T0FA 4M49A 2IFTA 3BHJA 3JVDA 1PTJA 1Y3FE 3HG7A 1NW4A 2R96A 3CW2A 3R23A 4H1HA 4N0DA 4B6JA 1TZ2A 5HIKA 1MC4A 3AVPA 5T6BA 4Q9AA 4RK0A 1C4WA 1XU7A 1XZHA 4H08A 4LE1A 1N25A 2DBVO 3KXIA 3NHBA 4MTCA 4MW6A 3SKYA 2DFVA 3OZRA 3SIXA 3Q0IA 4INJA 1PZMA 3NUQA 1DXQA 2O4CA 2XNDA 4V0NA 4KREA 2PNFA 4N7RA 4Z0PA 2YZNA 5JPDA 3MGCA 3LBAA 4YP0A 3RGWS 2ZBQA 4JLJA 4R69A 2PRSA 3V1NA 3LDGA 4MGHA 1WUHS 4WKOA 3LQKA 5H81A 3R9KA 5AKXA 4B9AA 4N3GA 4KWEA 3CSUA 5J2UA 1JG4A 5CXXA 3TE6A 3U9SA 3S0JA 3JD1A 3DEAA 3KPVA 3AR3A 1ZA2A 1N0WA 5FI5A 4KDCA 3DVLA 3IIIA 3UT6A 3FTEA 1J2UA 2PWYA 2R8YA 4QTUB 1V1MA 1U9CA 3VR2D 8ABPA 1T9GS 2WDZA 4WECA 2I91A 3TOSA 4CLOB 4OHMA 1YZ3A 2ZQYA 4NOKA 4WJZA 1CC1S 1CEQA 3T7KA 3O1HB 3QPVA 4L5JA 3UG6A 4BYMA 4FFWA 2OE2A 3R7SA 3NATA 1U9YA 3E9YA 3MLBA 2IIPA 3L1UA 3L84A 1QIEA 2H54A 1IEVA 3HXTA 2NUPB 4RUKA 2UYHA 2CW5A 3MIZA 1Q7GA 3S7ZA 1SVKA 5I7SA 4XVRA 2XIQA 1CUFA 2YZGA 2Q6VA 4CQLA 1PSZA 1ADCA 1EFDN 3CZMA 3EFHA 1PJTA 2H2WA 2GPAA 3BS4A 3CNLA 1FZQA 4M1YA 5EMMA 1QH1A 2FE1A 4M37A 1REQB 3BE6A 1KFCB 2V98A 2QT1A 3P9QA 3C5VA 5AJYA 3SXJA 5EIHA 4F3NA 5JXWA 2CXUA 3ISVA 2E5LB 3B48A 4L2IA 3ECCA 2QI9F 1Z6TA 1GO2A 3OEED 4G5OA 2WOJA 1US8B 1UP7A 3EVDA 5L7TA 2WYVA 1WMBA 2ZT8A 2PLWA 4IQ8A 4WV3A 2XUOA 2JLCA 3WKDA 5BY2A 1RKVA 1OX5A 4FYMA 4A4DA 3DOCA 4EBFA 5IT9A 3OZCA 4OU4A 1Z9BA 1DKNA 4B3IA 4FMBB 1O8BA 5IKEA 3PEEA 2MSLA 3NUGA 4M36A 2HL6A 4PO9A 3G2NA 4W5RA 3HKCB 5CRIA 5K2OA 3ZCQA 3B8HA 4O29A 4NZYA 2I55A 2B2NA 3DFUA 3X43A 1YTUA 3EXHA 3DM5A 2HAEA 2NVWA 3L7JA 3REGA 3SQDA 3LNTA 4KR6A 4GUAA 5F7ZA 1II8B 5BMOA 1RBQA 3JARB 2Y6VA 3OLXA 1WW8A 3SJ7A 4R54A 3RYTC 1XA4A 2MSKA 3GFTA 3E0QA 4RJJA 1XAJA 3CJQA 1PZNA 5E2IA 3SR0A 3WGZA 4PW0A 4UBLA 1LC3A 4KB5A 2AG8A 1JZQA 4RK6A 4X1KA 5BNZA 3BEDA 1SVSA 3PL1A 1AHPA 2ZANA 1OPXA 1QH8B 1PNTA 2ANBA 2UYGA 3BKXA 1JR6A 4C7VA 5I4KA 3AUYA 3HA2A 3LYUA 4CKCB 1MEOA 2X6RA 2DT8A 4FHZA 2UZ1A 2ORWA 3FCEA 4O4HF 1OH8A 4R9RA 4M0PA 4E88A 4R68A 4AZ0B 4ETIA 3WZLA 1QORA 3MQ4A 1EZ1A 1YOVB 4EMUA 2I7XA 3LC7O 4X20A 1VIDA 5JSZA 1DO2A 3MJSA 1RQ7A 2V0GA 2MSNA 5TR9A 1NVKA 4C76A 5FJJA 4E5DA 2QRHA 1TA9A 3DBHA 1CUXA 3OI7A 4A23A 2C07A 1QZUA 4WNAB 1EYZA 4HGPA 3RT1A 4EOGA 1N7JA 1YE8A 2R6DA 3R75A 5UKDA 1BXGB 2BFEB 2FETA 3MBKA 2M1ZA 1Z7WA 2ECQA 3JR3A 2C9BA 2PVCA 2ZU6A 5JJCA 2ZAGA 1RRGA 2W4QA 2ZAYA 1OVGA 5G0VA 2CHQA 1V35A 4PSAA 1L8XA 1VE9A 1OX6A 4M86A 3ZC3A 2NPOA 2IHUA 2O2DA 1R1DA 3FDJA 4LRTB 1H6DA 2OO7A 4YJ2F 2CFIA 1JN0A 4NLLA 5CNIA 4OKIA 1YONA 4DUGA 4E2YA 4LRSB 2ADOA 1JA0A 4EY4A 4ABTA 1X9HA 3EQ6A 1WNFA 4I1SA 3NDBB 2XTMA 2XNKA 3UQYS 2YRFA 1HTWA 3OZIA 1T4DA 1XALA 1MABB 3GAZA 2CNDA 3PVZA 4OYHA 4F5WA 1GU1A 2QE6A 2NSYA 2XE8A 4HXEB 4KAAA 2IXBA 4M1TA 4NZZA 4W1SA 4WLFA 5HBRA 3WB2A 2BT4A 2XUPA 1B2RA 4TKMA 1K8QA 1NURA 3HZHA 5J1TB 1O94A 3CLHA 3QVOA 1Y34E 4KODA 2QTFA 1Z2NX 1TRKA 1A9OA 2CLHB 1DAGA 2QVZX 4A2CA 5SYMA 3BHIA 4UBIA 5E4TA 1P73A 2ZJ6A 1XZDA 4WTOA 1MHTA 1AQ6A 2J6HA 3SYKA 1R9MA 2XMRA 3GJYA 2AOTA 4NESA 1IWBB 5FBWB 2HK9A 3JWIA 3RG2A 2FMTA 3QKIA 3WOHA 3ESXA 2XBUA 4LCJA 1JSXA 1I0LA 1NONA 4NBTA 1E77A 2H1IA 3G49A 1GVHA 4H4EA 3Q5EA 2AKYA 3ZTWA 4B8ZA 5D01A 4L27A 2Q2NA 4HC4A 4HVTA 3WLSA 1NF9A 4RZSA 3KJQA 4ARVA 4BX8A 5IJ0B 1PV4A 1ZNQO 5H16A 4JJAA 3C3PA 3NEPX 3U3DA 3V4VB 2WABA 3E9MA 5FL7D 3AOEA 4HSGA 3CMMA 2VDVE 3T3NA 2A0YA 4C0QC 2BM0A 2A3RA 2HXSA 4CRWB 1IIRA 5JAIA 4X85A 3UV6A 4GKJB 2OR3A 3NWJA 1SQSA 4TV8B 3KEOA 4H7FA 2PSSA 1SVMA 1OWLA 2EP5A 4I4TF 4V0MA 3W5BA 2VK4A 1JHUA 1QSGA 5JZMA 3CUTA 3FPJA 4RF3A 1I4LD 2CLLB 2NSDA 4V0OA 2B5WA 4S2EA 4EITA 4REOA 5KO2A 1DRUA 1U8AA 5IP5A 4JI3B 3HBFA 1M9NA 4UMFA 1LEHA 2EW2A 3NWPA 4FE4A 3FFAA 4WZ6A 5HKKA 2HR1A 1TQ4A 1WXEA 4NG5A 4I55A 1G42A 1JSRA 4PR3A 1OBHA 3AFNA 3DMTC 1MAAA 2OBFA 3UJ8A 3G2QA 2XVMA 1U28C 1M5TA 4BMVA 3AY0A 3ET4A 4C7OA 1AV6A 3MNFA 1GTMA 1RJWA 4X9XA 2O8DB 2IP1A 1EE1A 4FOOA 4DSUA 1HKHA 2C5AA 3FVWA 1V16B 4TRMA 4N3BA 1QGUB 2FUNB 4NV1A 1ULZA 2EKQA 4HNGA 3SKVA 1XCMA 4DCGA 4MKZA 5HOQA 4JVMA 1TGYA 2VBIA 4ER7A 1GAXA 4G0XA 4OJQA 1A04A 3WBJA 4YWJA 3ZVMA 2XTAA 4RZ3A 4JBXA 2BYTA 2XMZA 2WP8J 4G5YA 2PWAA 5DULA 3MGKA 4KI0A 1F8YA 3ILXA 5B7PA 4E5PA 2H2HA 4BNYA 4URHA 2V8BA 3D8HA 3EGEA 5FOVA 4BU0A 4KLAA 4BNWA 5MF6A 3TW6A 2GCNA 3ELDA 1KEWA 3VHXB 4LV6A 5B2ZA 1J8VA 3PB3A 1E94E 2LRHA 4YP6A 3LCVB 4RMHA 1CY8A 2GAFA 3MD0A 3N05A 1WUYA 4ESHA 2GN8A 1EWTA 2G07A 2G9QA 1YIAA 4OF4A 3U3MA 2A7QA 1I1NA 3NCTA 3OQBA 1A77A 1UL1X 4L02A 5EHNA 3SJBA 4B80A 2PWPA 3NOQA 2ZM5A 3JD4A 3UN1A 3G2OA 4TZTA 2HBZA 4Y2XA 4Q82A 4JJ6A 1Q20A 4IEIA 2HADA 1LPSA 3W5VA 4DIOA 1GJRA 3N2EA 4HDAA 4NCKA 3C1OA 4Q16A 4RCZA 1CY0A 5D86A 2RI0A 3CZ4A 2VHWA 2P2CA 3L82B