4UHKA

Crystal structure of the receiver domain of cpxr from e. coli (phosphorylated)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
130
structure length
129
Chain Sequence
NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Structural Coupling between Autokinase and Phosphotransferase Reactions in a Bacterial Histidine Kinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 129
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhkA00
3RVKA 3RQIA 3LMKA 4TLLB 3TO5A 1M2EA 4XAQA 4MR8A 1Z15A 3KLNA 2PL9A 3O2QB 3N0WA 1MB0A 3GWGA 3F6CA 4RY0A 1SD5A 5KQLA 2MYNA 1TLFA 1DBWA 4RKQA 2WY2D 4HYEA 4Z4IA 5HQJA 3S99A 7ABPA 2CHFA 1YS7A 2FN9A 3Q7SA 5FWYA 1E2BA 3N53A 1J56A 5JNRA 1ABEA 3H5IA 2WB4A 2PLNA 3CLKA 4NQRA 4FE7A 3CS3A 1NXOA 3QLTA 5GQSA 1BAPA 1QNLA 2PUCA 2FLKA 4LX8A 1P6UA 4G0QA 4Q6BA 4WUTA 5KC8A 1PEAA 4RU1A 1ISSA 2HQOA 4ZJPA 3CFYA 3B2NA 4MQEA 3SM9A 1PEYA 3HDGA 5KI6A 1ZY2A 1A2OA 2IYNA 1URPA 3HK2A 4G0MA 2PJUA 3NNDA 3E3MA 3JPWA 4Z4GA 4YWHA 1FFWA 1U2QA 2MYPA 2OQRA 2FQYA 3O1JC 1QO0D 4HNQA 4LZLA 4EYGA 2A9QA 4G0ZA 2YHBA 3LUDA 3FDFA 3ILYA 3SAJA 1S8NA 4QPJC 4Z4CA 1PHRA 4WWHA 1NXXA 1JFSA 1NXTA 1Z12A 2PUFA 4YLEA 1K66A 1ABFA 4IGAA 1ZESA 3KJXA 2FEWB 2NT3A 4RY9A 1ZN2A 4OBBA 1MVOA 5IUKC 1Z26A 3KTOA 4XXHA 2F8TA 1VPWA 3LUHA 5EWJB 1JYFA 5EWMB 1RZRA 3T8YA 1BVHA 3KSMA 3LKBA 3Q15C 1P6QA 4PEVA 1DC7A 3OO1A 5KC9A 1MAVA 4RS3A 1P2FA 1YMUA 2FKAA 3EQZA 1YK0A 2R48A 5TPWA 5C5EA 3QEKA 1GUBA 4KV7A 4DQDA 4MS3B 4JB2A 3FGZA 2NUBA 2WMYA 1EHCA 3OLVA 3R0JA 3GRCA 3BRSA 5D2CA 5IEJA 1QPZA 2IPAB 3LUKA 4L4UA 1KRXA 2TMYA 1GCGA 4D6YA 2PMCA 4MAAA 1Y1LA 4MLDA 1EAYA 3OQNA 5ED4A 1K68A 1NTRA 4IMIB 5CNKA 1DBPA 4D74A 5E3JA 1TMYA 3H5WA 5T7BA 1NXVA 3CG0A 5B3JA 2QU7A 5TQ0B 1DJMA 1JBEA 3HXMA 4Z99A 4UHKA 3RVPA 3H1FA 4YRZA 1D2AA 4MS1B 4KK3A 2A9PA 4Q7EA 1U2PA 2DRIA 3IDOA 4IILA 4FE4A 2ID7A 4KQCA 4Z9BA 4B09A 2PKXA 5HKOA 2PUDA 3QLVC 5HSGA 3GA5A 1YMVA 1VLZA 3A0RB 4RXMA 1BDHA 3MMNA 4N0PA 1XHFA 3RVRA 3RH0A 2RJNA 1QP4A 4P98A 4H3HB 1BA2A 2B4AA 3HCWA 4MS4B 1QP7A 2GI4A 4G0XA 2IPNA 1JFVA 2IDMA 3FFTA 3O21A 3OLYA 3L6UA 4PE5B 1Z25A 1CEYA 3QLUC 5CHYA 5I4CA 3JS5A 1ZVVA 4JAVC 3GBPA 3DLHA 1E6KA 5CNJA 4S05A 1T34A 4KREA 2L17A 2RGYA 1QP0A 4RK1A 1ZH4A 1Z18A 2FQWA 1FQWA 3GL9A 4Q6WA 2PUGA 3NNSA 3ILHA 4G97A 2PAFA 2H3HA 2HJ9A 4RK0A 3O74A 3D8UA 5JS2A 4EYOA 2QSJA 4QYMA 1R8JA 1IIBA 4OATA 3UUGA 1EWVA 3ROTA 1FFGA 3KYIB 4KMRA 4JP1A 3KHTA 3KG2A 3Q9SA 3EQ2A 4YO7A 3BBLA 2FQXA 3QK7A 4JOQA 3T95A 3D02A 3LUCA 5IX8A 3O1IC 4EVQA 1LK0A 1YTUA 8ABPA 1C4WA 3F6PA 4IF4A 1M5TA 3CU5A 4JASB 2HSGA 3I45A 1LJUA 4F11A 5DCLA 1L5ZA 5KQGA 1JX6A 3JVIA 4KZKA 5EWLA 4L85A 4MQFB 1OXKB 1YVUA 3H5TA 4KNYA 5TQ0A 1GCAA 4XFKA 1YS6A 4OLBA 1D1QA 2MSWA 3I5AA 3HVRA 4E7PA 1DBQA 1PNRA 2RJOA 1DP4A 1H9CA 1VKRA 1LBIA 3NNNA 2QW1A 5TE9A 4F8JA 4G0PA 3N0XA 2ZWMA 1E6LA 4NCAA 1TJYA 4HNRA 2VUIB 4W5OA 3I09A 3HS3A 1F4VA 2WJAA 3G1WA 4LE0A 1ZAYA 2R47A 2WRZA 3HZHA 3HUUA 4FB4A 2WJWA 1MIHA 4MS4A 3H5OA 4YCSA 3Q7TA 2IOYA 3N0RA 4H3KB 5IUJC 4RK7A 2F8SA 3ROFA 5FWXA 3TMYA 4JB0A 5CNMA 4RWEA 1SXHA 3OLZA 4O1IA 3H1EA 3TX6A 3C3WA 4WXMA 1EWTA 1USKA 4ZPJA 1M2FA 2JVKA 5T3YA 2GKGA 2NT4A 5TPZA 5B3JC 4MR9B 3GYBA 3VNAA 3M9WA 3MIZA 3NHMA 3DZDA 4YGXB 2LIVA 4NICA 4TN5A 5DLEA 4N03A 1DCFA 2P4UA 5BQ3A 2PL1A 4O5AA 3KYJB 4RXTA 4P1ZA 2QXYA 3URMA 1USIA 3P9YA 3OMWA 1D4ZA 5KQPA 4YP9A 3DBIA 1D5WA 1BDIA 3JPYA 4RK4A 4N0QA 1BDJA 6CHYA 4WT7A 4WZZA 2JCGA 3A3KA 1CYEA 4MQFA 4G86A 4RY8A 3KKEA 2CD7A 1FSPA 5FBHA 3DGFC 1VRVA 4H60A 1DRKA 4EYKA 2BGGA 2LP4Y 1RPJA 1P8AA 3LKVA 2IPMA 2JBAB 4MPTA 2KYRA 2LPMA 4RK6A 3LOPA 1D1PA 3C97A 4O1HA 3E61A 4RKRA 3SY8A 3VNBA 4MLCA 2HQRA 4W5QA 4Z0NA 4YR7A 5DGCA 2QZJA 4QYWA 4XARA 4RV5A 2E4VA 2RDMA 3FMVA 4E7OA 4RK5A 2W42A 1EFAA 5JNWA 3MM4A 1USGA 1UDRA 1JWLA 1KRWA 2JRLA 2FMIA 1GLGA 4M88A 2LUOA 1CHNA 2VYCA 3N75A 2E4UA 3K9CA 1SRRA 3OLWA 4GNRA 4DADA 1RZRD 3M6MD 2VK2A 3LUFA 3OMXA 5DKFA 2X7XA 3O75A 4Z9AA 4EVSA 4GPAA 3K4HA 1QMPA 5TQ2B 4YV7A 3IPAA 1DCKA 5JS1A 4F3TA 2H0AA 5GOTA 3OLXA 3CZ5A 2QV0A 5JNUA 3LFTA 3OQOA 2FVYA 3RVJA 4EGSA 4PYRA 1RXEA 5EWJA 5KWSA 3M9XA 5EWMA 4TMYA 1NXWA 4QICA 2E4XA 2M1ZA 3MYYA 3HSYA 3OQMA 4RDCA 3FFWA 3HDVA 4MS3A 2JK1A 3F7NA 2PUAA 3HO1A 1W25A 2AYXA 3QELB 1XHEA 4CBVA 3JY6A 3N8IA 4ZMRA 4UHJA 4XLTA 3H5VA 4TLMB 2ID9A 2FLWA 3DGEC 4Z4FA 1HEYA 3H6HA 3EODA 4MRMB 1TVMA 2Q5CA 4EYQA 3KS9A 1JF8A 2JB9A 4NV3A 3EGCA 3RVNA 1QQAA 4MR7B 2B1JA 3IP6A 1AB5A 2MSLA 3O1HB 3NHZA 2LBPA 1ZH2A 1DC8A 4KQ9A 4F06A 3IPCA 1U04A 1F51E 1Z2EA 1RXIA 3QEMB 5BRAA 1RNLA 1APBA 3IP9A 4Y9TA 1JLKA 2E4WA 3HUTA 3LUGA 4G0YA 1JL3A 2VUHB 3F73A 1B00A 4ETNA 4MS1A 1QQBA 2JVJA 2NZVG 3CZCA 1DZ3A 3G85A 4LRQA 4W5TA 3SNKA 1QO0A 3QX9A 4KFCA 3BRQA 4HNSA 2I6FA 3KLOA 5TQ2A 5ABPA 2N9UA 1QKKA 5IUNC 3UK0A 3CRNA 5TQJA 2GBPA 2HPHA 2A9RA 3CNBA 2M98A 4N47A 2NZUG 2FTKE 2PUEA 5FBKA 5TPWB 1Z17A 2PE5A 4F12A 3C3KA 1E6MA 3O2JA 4DN6A 4N41A 3LUAA 4RXUA 2J48A 1AB6A 2E4ZA 4ETMA 3QLVA 4IMJB 1U0SY 2V0NA 3TB6A 3UKJA 5JNSA 3DLBA 4KVFA 3W9SA 1LJLA 2GX6A 4KPYA 4Z4EA 3A10A 3JTEA 1NXPA 2CHEA 3QELA 3O2SB 3L49A 4Z4HA 9ABPA 3RVOA 2L2QA 1TM2A 3H1GA 3T6KA 4D6XA 1KGSA 1JHZA 3QLUA 1M5UA 1Z13A 4MRMA 2PUBA 4MR7A 5PNTA 4OLAA 4EVRA 3BREA 2P9HA 3RVLA 3GT7A 4PICA 4RZSA 2L18A 5BRJA 2R4QA 2IPLA 5BR1A 3CG4A 3I42A 2A9OA 2QVGA 3H6GA 3QEMA 3HEBA 3HV2A 3IP7A 4XASA 1I3CA 1NATA 1SXIA 4ZYLA 3LTEA 1JYEA 5IBQA 4W5RA 1PNTA 3OO0A 5JNVA 5IEBA 6ABPA 3MQ4A 2MSKA 2CWDA 3LUJA 3GBVA 4S04A 3EJWA 1Z16A 1GUDA 3EULA 3H5LA 3N6VA 5HM6A 2FMFA 1JH9A 1ZGZA 2O20A 2FEKA 2MYTA 1ZHHA 2YHAA 5KQMA 1L5YA 5TPZD 3C3MA 4YS6A 2FN8A 2QR3A 4MR8B 1PUXA 2ZAYA 3SG0A 3A0UA 3CTPA 3EAFA 4IRXA 2FEPA 3SQNA 2MYUA 3T38A 3C6QA 4JA2A 3OM1A 3FFXA 3OM0A 2GWRA 4OTZA 2FW0A 1YK1A 5F64A 4ZMSA 3CHYA 3Q41A 1NXSA 3TD9A 4KK4A 4NCBA 4KRFA 1MB3A 3KCNA 3MF4A 2E4YA 1ZITA 3RVQA 3QX8A 4G0OA 1ISRA 4MR9A 4EY3A 2FMKA 4OG2A 3HM9A 1C0EA 1JDPA 3BILA 3EDCA 5FWYB 4RSMA 2WWVD 3H75A 1W9HA 3Q7RA 2HQBA 4LE1A 1A0OA 3RVSA 3GV0A 2R25B 5IC5A 4WXEA 4LDAA 4LE2A 5EWLB 5C5CA 1EWKA 3HJFA 5JNTA 1JDNA 1ZDMA 1DRJA 1JFTA 1DCMA 2L19A 1XWWA 1A04A 2XDYA 4MYRA 4MGEA 2FSPA 2FXIA 1SXGA 4PZ0A 1Z2DA 1OXBB 3IP5A 4W5NA 2QVCA 1FFSA 1U8TA 3JVDA 4MQEB 2OENG 3MA0A 3RVMA 4EUKA 1DG9A 1YIOA 3NBMA 2FMHA 5DTEA 2JBAA 4N76A 1LBHA 4ML3A 4LDZA 1NY5A 3CKMA 5FWXB 1WETA 2AYZA 2IKSA 1KMIY 1ZGGA 4ETIA 5CNIA 5IULC 2JVIA
chains in the Genus database with same CATH superfamily
1O8BA 5I9SA 2PT6A 1OAOC 3LWNA 1XVAA 4FYYA 1XYVA 1GR1A 1H1LA 1SEPA 2JI6A 2VHCA 3E0XA 3BWDD 5CR9A 4ZI5A 3ECSA 2EHDA 3Q11A 2AOVA 2C3PA 5A3VA 4BMCA 3U2QA 5AVWA 1B41A 2WWIA 1IBSA 1Q95A 3T7RA 2GNPA 3ANTA 3ER9A 2R4UA 1I3MA 3QWFA 2NO1A 5CTJA 1G3QA 4RKQA 4DCUA 2OPBA 4LHXA 4K9OA 3B7WA 4IGIA 4OFWA 3WGJA 1AA9A 4JJ6A 4EHNA 3L6EA 1ONNA 2OZVA 3R4VA 4GX0A 2B92A 2BRUA 2WJYA 4D25A 4CMIA 1QTQA 1X1CA 3TF5A 1RE1A 2V9ZA 2Q1XA 1VL5A 3LA8A 2D7JA 2NTVA 4YRMA 1FQJA 3UH0A 2Y1WA 1YS4A 3CNQS 5TDHA 1R74A 4IRMA 5GQSA 4TWRA 3KKLA 3I12A 3OX2A 3AP3A 2OV2A 4PFSA 4Q03A 4G0QA 3KO8A 3RBXA 2AEEA 2JASA 4TTPA 1FS4A 1NR5A 3M0EA 4WCFA 5F7OA 1FCJA 1XHLA 5GADl 1JUDA 2GS9A 3V5NA 3WKEA 1QGUA 2X0EA 1GRCA 1KYXA 1XJ5A 1SOAA 4EK9A 2XXAB 3V97A 1SWVA 3OSZA 3Q0TA 2QD1A 3NS7A 3PHBE 1DJOA 3LC1O 3DCIA 4X93A 1C4XA 1F12A 2C3UA 2PJUA 4R2IA 4F60A 5IH7A 1XTSA 3ACBA 4FPXA 2G09A 2G6TA 5AI6A 3WIEA 5L4LA 1AE1A 5FBZA 3IMCA 2XNCA 3T5BA 3FKQA 2ST1A 3GT0A 4G0ZA 4GOMD 4GBMA 3S1LA 4EM6A 3OX1A 4WFKA 4IIJF 1TK3A 3WMWA 5M34A 2PUFA 1K66A 2CCKA 3R5HA 2VT3A 3ND6A 3OJOA 1RWMA 4AICA 2Z5VA 3UC5A 4I1SA 3WX0A 1EINA 1ZD3A 5CJ2A 1J0AA 1GGMA 1JQBA 2NYRA 3F4KA 2C95A 4XCQA 3PHGA 4BWVA 3VR5A 3ZWDA 3FY4A 1V8DA 3DONA 3HBFA 4KPUB 1J42A 2CXUA 4J4BA 4R7ZA 1Z22A 3S8MA 2GYWA 3E5MA 3F9CA 2ZUTA 3Q15C 3N07A 3JWGA 1HT1E 3OX4A 5JO0A 4Z6KA 3GROA 2KSQA 4KBGA 4M0DA 5F5XA 3GX1A 1V6CA 3L0SA 1K9SA 3BHMA 4OVKA 3K0CC 4WNIA 4I55A 3IFSA 4OMFG 5HQ3A 4B5LA 1C1XB 1CJTC 2E0IA 4M7PA 2ALJA 4N40A 3LQKA 1ZZGA 2IFTA 4M3NA 5BV8A 1GT91 2HDNB 4YRIA 2OGWA 5IVHA 3FJ1A 5T4BA 2WU1A 3FZYA 4L4UA 2CLIB 5FNZA 4DIBA 4TS4A 5CHEA 3P9QA 3HUEA 2VWQA 5ILGA 4J16A 4MAAA 2QM3A 4B7ZA 1UMKA 1JLHA 2V1XA 2ZXEA 4P83A 4NJMB 4XQEA 3WZ2A 4G5HA 1YKSA 2V7GA 3FWHA 3TQHA 4AUKA 2C7OA 1AXRA 2IEIA 2VK4A 4MXDA 5DRYA 1HC7A 2EP5A 1DOZA 7MDHA 4RMGA 3TLGA 1F5SA 1NRWA 4MJLA 4Q7KA 3RBAA 1QTRA 2PRZA 2ZYRA 1ODIA 3WK6A 4BV3A 3Q3CA 3AHDA 3LCCA 4HDSA 1B6SA 3QPCA 3VR6D 3K32A 3T99A 4HNVA 1X7DA 1E92A 1HMPA 2M6KA 6YASA 1SU6A 4HDKB 4QLAA 2EQ5A 1VA5A 2X3UA 1ZK0A 1S1MA 2B20A 1TK2A 4TS3A 2PKXA 2WA1A 1WNFA 3GHYA 2H1LA 2WIBA 3W1EA 3NASA 1WMAA 1JDTA 3Q3GE 3FOAA 3UMJA 1GNPA 1Q12A 3NAMA 1UMCB 4LDNA 4WLOA 2YV2A 1QP4A 1L5OA 2PGLA 4P31A 3JQGB 1B74A 4H3HB 3RTDA 1XZCA 3OZWA 2IS6A 5G53C 1LF0A 2PBFA 4OJTA 1DV2A 3UHPA 1QSGA 5CHYA 1NVKA 4JAVC 4QEKA 1ZVVA 3D0RA 3OICA 4JUCA 3NVMB 2FZ5A 3KZXA 3AB3A 3LW7A 4QDXA 1IRIA 3N2GB 5DMXA 3VHLB 1JG1A 2HWWA 4DV0B 2ZTVA 1QG0A 4N7BA 4O4JA 5F33A 4XPIA 2G9UA 1U9YA 3RTEA 3PC8A 1BG6A 2FPRA 4NBLA 3U3DA 3ZN2A 2MINB 4MWGA 3T5CA 4I1YA 4LJ7A 3FYHA 1BKDR 3D5TA 4JP1A 3MIIA 3WNZA 1U2SA 4YO7A 3K20A 4DAOA 1E20A 3D02A 3HWRA 3IDFA 3O1IC 4U7HA 4UTZA 2HA7A 3Q5EA 1NBMA 1P5HA 1R5BA 5DBOA 3RLFA 5HCIA 4O2BA 3LVRE 2E3JA 4RNCA 2W6MA 4WLVA 4E1VA 3TN7A 4A8PA 1EJBA 3LIIA 5JZBA 2ET6A 5BUCA 1L5FA 1VIMA 4FCTA 4U02A 2CMKA 4IGFA 4U2CA 1QRAA 2AJ8A 3KTAB 1DP4A 3I6IA 3S1SA 3C6ZA 5A7HA 3HNRA 3RFCA 4LZJA 1ZVJA 1J5XA 1FSZA 2FFHA 1DAHA 2GB4A 4G09A 5BN3A 2OB1A 4QDJA 4CQLB 3K70C 3AXTA 3A3PA 1RZ3A 2P9BA 3KOUA 2B6NA 2W6OA 5GVRA 3B13B 5KDLA 3WLFA 2YCBA 5IDWA 4XQGA 4LE0A 1KMCA 4D3FA 1HEUA 1E62A 3OU6A 1XXHB 5FHRA 1YUBA 2AZDA 1Z45A 1WLYA 3T7TA 3H2HA 1S5PA 1AC5A 1HFKA 3D5QA 3FNQA 4KACA 1E0SA 3OLZA 3BB3A 4HH0A 5EC8A 1G8YA 4YYZA 1T5LA 1P4RA 1HLGA 1Z38A 5TARA 2ISCA 4BNXA 5CDFE 4GE3A 2A7XA 4QUGA 4JSTA 1YULA 2QD5A 3OD5A 1NURA 5EOVA 2DUUA 4MR9B 4QECA 1JVBA 3WWDA 1DWOA 1F2DA 1KEWA 2ISSD 1O7JA 3FOWA 4MJXA 2VDWA 4X45A 2FA9A 5SY6A 2JFBA 2XNKA 2EATA 3ECCA 4MMXB 3HCFA 4LYDA 4BFUA 1DCFA 2O8DA 2PL1A 1ZICA 4W7IA 3ZXXA 1BRTA 1ZUNA 2A78A 1OXUA 2DCMA 4O3FA 2D6FA 4M86A 3DBIA 3D4BA 3RYHB 1B0PA 3EZXA 3ZQJA 3HH8A 2NADA 1M34A 3CJTA 1NASA 2IHTA 3KQUA 1P2DA 1ML3A 3KWFA 4XQ0A 5ICEA 4EGJA 1WQ4A 1ESCA 1Z4IA 5DGXA 5K3DA 3ORYA 4AF8A 5HIIA 1I3OA 3TTXA 4B3JA 1U3WA 2HJWA 3ESDA 2GASA 4F1KA 2QJTA 2QW8A 1NTOA 3AF3A 3O73A 1Y33E 4IHAA 3VHQA 1H2XA 1U7OA 1WUKS 3EGVA 3K9NA 1OAAA 1PS8A 1SZPA 2IUTA 3HY4A 1L8AA 1BC5A 4FQ7A 3SZGA 2P41A 2C5AA 2EF1A 2H4WA 3AZQA 3DYBA 1QYRA 3OJLA 3R09A 2PZKA 3OOSA 4M6WA 4ZO6A 2VAMA 3NTQA 3R0VA 2HMAA 5HF5A 1Z56C 3EJ6A 3TQTA 1M8FA 2RKWA 2BCEA 2DP4E 4Z7JA 5E9JA 2C1ZA 2I91A 3RS2A 5JCXA 4JT9A 3WJ2A 5K8JB 2RDMA 3FMVA 4OQXA 2P7IA 2QRUA 4IG9A 1BMTA 1PBTA 1E6EA 3CRMA 4MQ6A 1GRNA 2EJUA 5F51A 4EPVA 1MJNA 4JP8A 3QJGA 2I4OA 1FJ2A 1M2HA 3GFOA 4QEDA 2DR2A 1TECE 1W1WA 3DTVA 2UVDA 4Y0NA 1YVPA 1PFUA 4RKFA 3UCEA 3Q3EA 3FB1A 4Z2AA 1SRRA 1CW2B 1NFQA 3C5EA 1PUJA 2F1OA 2VK2A 4C3OB 2A0YA 5DKFA 5L45A 3QQPA 5FEUA 1XXHE 3DMTC 1RLTA 3ADCA 4XKJA 1IZ7A 2BVNA 4AU1A 3KHUA 1V11B 4C4AA 2WD7B 1S8FA 3M1AA 4LNUA 4FN4A 5LYJB 1VMKA 3VR2D 3TAHA 1U8FO 3CZ5A 2XEDA 4HEQA 1GKKA 1JZTA 3DJFA 3PTZA 4MUIA 5JD3A 3T3OA 3DP7A 3IAXA 1P1CA 3NDJA 5BPHA 8AT1A 4XJXA 2BGWA 2C2WA 2SKDA 4DVJA 1VE5A 1LDYA 2V97A 4M83A 3CVXA 2OBBA 1R0ZA 4B3RB 2WDPA 3B8EA 3U1BA 1E2KA 2HRRA 2WF5A 5EP4A 2IP2A 5ARBA 1V3UA 5K3OA 2EW8A 3BMNB 3ZWXA 4CQJA 3JY6A 1HNWB 4U9IS 2IOHA 3PICA 3AUTA 3H5VA 4ZVQA 1U3DA 4KE8A 4D41A 1YU9A 1QP8A 2FQ1A 1EA5A 1N6PA 4CDRA 2H8GA 1JA0A 3B3JA 3FW1A 2I87A 3NIFB 4NBVA 4C0WA 1FZQA 4MINA 2MSLA 3R0QA 1BFUA 3FWYA 3AVVA 5BVGB 5B2ZA 1FMJA 3IQIX 3H16A 1JHPA 3GLRA 1ZH2A 3WFJA 2HK9A 4DRZA 1PYOA 1W44A 5JBIA 3TTVA 3UOWA 4EKIA 2VQ3A 4PX3A 3RJZA 4AMVA 1F51E 1BCRA 1OB2A 4C0LA 4MYTA 2OLKA 2OGSA 1APBA 1CNFA 2ZUVA 1JLKA 1H5NA 3QOWA 4F71A 1HDYA 2XKKA 2PUHA 1CUAA 4RJTA 1J9ZA 4Q1FA 2JHGA 3CN7A 5I7OA 4G9BA 3QFHA 3L6BA 1UF9A 2A1UA 3EWSA 4B76A 3PITA 4NMXB 3ZI7A 4NOKA 4A0HA 4CCYB 2FR1A 2XMRA 1Z08A 5IUNC 2QTCA 3CF0A 1JFLA 1LV7A 2BI8A 3EYWA 4LC1A 5ICMA 3ESQA 4NECA 4Y7CA 1X77A 3DO6A 2P4HX 2FTKE 2NXJA 4MPRA 4W5HA 1VPEA 1OXXK 3TLBA 2H4FA 2M6RA 4F12A 2OWEA 3C3KA 3CVJA 1U3VA 1Y3FE 5HJEA 3MTIA 4GR9A 3ICOA 4GEKA 1AB6A 1Q7TA 4HOYA 4PBRA 4DR5B 5FLXA 3PE3A 3OOEA 4XI9A 5IYZB 1LJLA 3TOCA 1YFZA 3CUUA 4FSHA 2BFNA 4AS1A 1FJGB 2B25A 2N47A 3QELA 3G0OA 4B0PA 4WV3A 3ZW9A 3QVMA 2I8CA 4GPBA 1Q14A 2L2QA 5GGXA 3A1VA 1Z6GA 3PI7A 1Z13A 3AH8A 2HZBA 2QR5A 2VDLB 3D8NA 4D4IA 2DKNA 1UFOA 3GT4A 1NMXA 2EAUA 4X7MA 4H27A 1TKAA 4EVRA 2HQSA 3GLHA 5KAMA 2FSUA 3SHVA 2WFMA 3WBFA 1BQ3A 3GHHA 1OV6A 3TG8A 2F1IA 4IBOA 4ZJZA 2PKYX 4X95A 1S6YA 2G1AA 3GZNB 3QEMA 1C1DA 1FW8A 2EJBA 3LHSA 1VKJA 1JYEA 1L1EA 4ZPXA 5ESXA 5IBRA 4BP3A 4OM7A 3HSSA 1A9YA 2X4GA 4NI5A 6ABPA 1U0HC 1SD1A 2NSHA 4CJXA 2XWJI 4DR3B 1HV8A 1IG0A 1O08A 3MQ4A 3Q8KA 1Q44A 5DT9A 1PBNA 3FMIA 4P81A 1RPZA 4ASUA 1UEJA 3R5FA 3C5VA 3GBSA 3GP5A 1T36B 4E2ZA 3DTTA 3EFOB 2C4MA 1BMDA 3SC2B 1RYEA 4MKRA 5AM4A 4H6PA 4IJ6A 4ZT6A 4MR8B 1VCNA 2PKRA 2XVZA 5FFFA 4CMAA 3EPJA 2GJ4A 3PTLA 2WU4A 1CTQA 5AM5A 1BZYA 1NBWB 2E1RA 1G6HA 5G0TA 2PX5A 4CMEC 3HDHA 1EH5A 4D9IA 2YWDA 2IV3A 4BQNA 4Y98A 1PWEA 3WGQA 3EN0A 3RAFC 3CHYA 2Q5QA 2LZ0A 1NXSA 3DLTA 4N5DA 3DNFA 5IHXA 3BE4A 3AVUA 3R5JA 1SKYE 1VHLA 2HDHA 2RGNA 3C4VA 1CZLA 4X1YB 4IHKA 4CM8B 2ZRPA 1OF1A 1V8OA 2V6MA 1ML4A 5GAJA 1DIOB 2RHOA 4RHCA 5JXWA 4RLSA 3KJIA 2G9ZA 4KMMA 4O4IF 2O59A 4OBEA 5EQDA 4WASA 3ELWA 5K7SA 2C5FA 1VRCA 4GMFA 5EL0A 4BC0A 1Q0UA 4LYHA 4IXTA 4Q3DA 5FPSA 1DZIA 2DX7A 4MI1A 5FH9A 1T3HA 2J6CA 4Q3OA 4NLLA 5EP3A 5DHUA 1JG6A 2J46A 1DRJA 4R1LA 2PRYA 1Q2UA 1XWWA 3E7DA 4CEIA 4ZGGA 5GOZA 1EM8B 5CCBA 1IN5A 4QBTA 1TL7C 4R31A 5ALSA 2W5UA 4J0FA 3RLIA 2XH8A 2MR5A 1EB8A 4DLUA 4DYDA 1I30A 3QTBA 5A5GA 4AMGA 1EFPB 2BBOA 3KXKA 5C8VA 2UYGA 4MDHA 1SVSA 1VA4A 1XEWX 2JBAA 4Q9HA 3OQ1A 3ZBQA 5K0JA 4ZRMA 4XEUA 2P9QA 3COSA 4ZTZB 4FFNA 4NZ9A 1EXNA 4PAOA 3IEKA 5A3RA 2WWWA 3DZIA 1C8KA 4F93B 1KMIY 4YCDA 3I5UA 4H7KA 1E1QA 2FPLA 3CH7A 3LMKA 1D0VA 3D59A 3KLNA 5DTMA 1ECBA 1LDMA 2VRCD 1P62B 4M46A 1XLUA 3E53A 3AW9A 4MHOA 3RS4A 3WK4A 1QGDA 4PZPA 5E6RB 3L0IB 1T3GA 1LY1A 3ZE8A 2PLAA 1P0MA 3W7VA 3J81A 3SVTA 1WDKA 3ZY5A 3DKVA 3C6KA 1FYVA 1Y4ZA 5K3BA 4DRXA 1W6RA 3UGTA 4DJDC 4JK3A 1I1QB 1US8A 2YS6A 4B3DA 4Z4IA 2OV1A 1P1BA 4G36A 3QRWA 1TE2A 4CMCA 3FLBA 3Q7SA 2PKQO 1K98A 1CUDA 1E2BA 1GZ6A 1B0AA 2J0UA 3Q9UA 4RZIA 5A6VA 5E0KB 2H2AA 2DF8A 1DMSA 1V47A 2RD2A 3MJFA 4TMTA 1LX6A 3H13A 1CDEA 3QVOA 5F3RA 4NEGA 2FEMA 3CS3A 3UQYS 1R6DA 5CBPB 4E5VA 3URKA 3UT5A 3B8HA 3DMDA 2ZYUX 1L4GA 1E1NA 1PQPA 1SK8A 5DIFA 1MO4A 3F67A 5A9TA 4YBRA 1Z0JA 4RYLA 4YJGA 3F5MA 2P35A 1SKAA 2XA2A 2IZ1A 4ZALA 3OA2A 3V00A 4OAQA 5JEEA 4BMPB 4IV5A 2BR4A 4JJIA 4B43A 1RW4A 1C9KA 2FUG1 2OKCA 5LP6F 1K8XB 1IUPA 2XITA 2MSEB 3U3OA 5CVDA 1UAGA 3NNDA 2QX8A 4M4SA 3O3CA 4N7RA 3CW2A 4N7JA 4P4NA 3WG9A 2ZUWA 3LCRA 4FYVA 3O8LA 3D3KA 4YAWA 5KKAA 1AHNA 2O0HA 3GUHA 3QVVA 2WVAA 2BKVA 1GILA 3GLFB 4S0XA 3I1IA 2W70A 4ENVA 2O57A 4J0JA 4B47A 2G4VA 2WLSA 2XCOA 1QIIA 5AKEA 5G0UA 1Q50A 1NLMA 2AGVA 3N0TA 4HAZA 2ESRA 3E8XA 3AO0B 2J9FA 4II7A 4MMYB 3WGZA 4ZO8A 3WA6A 1Q0RA 5JHHB 3GJ8A 4G1FA 3QVGB 4FJ2A 4E94A 4OBBA 3OTGA 1P0PA 4MWOA 3V7YA 1L1QA 3TTUA 5D3MB 4XZ3A 5DXAA 4XD7A 2BMAA 4UFOA 4EQ6B 4KR6A 4RHYA 3VH1A 3KQQA 1L7PA 4HWPA 3V7NA 1JTEA 3BQMB 4ZKDA 5BXYA 4Q7JB 4I1OA 1O8CA 4TYMA 3RD5A 1OFIA 3D1VA 3DOFA 4MCAA 3H2IA 4L5CA 1A4UA 1M6VA 3HI6A 4MCHA 4RS3A 2ZSBA 1FYFA 4JLSA 3KYCA 2VVTA 3QENA 4PCVA 2PRIA 2PSFA 3E58A 1X86B 3PNOA 3N3AC 3FGZA 3PDHA 4RTRA 2Y1OA 5THQA 1BOOA 4YCLA 1DUIA 5HBGA 3Q4GA 4WNAB 3D64A 1HM5A 3ZVKA 1QPZA 3O4GA 3C4JA 4N49A 1ZK4A 4LKRA 2RAPA 4CYMA 3LUKA 1D9XA 3I53A 5MFZA 3CLHA 3HRIA 4E08A 3GAFA 3OPNA 2H65A 4KKXB 4MUMA 1MEEA 2D1FA 4DMLA 3OQNA 1YA8A 2OORC 2JFNA 1MF7A 1KL7A 2WSSA 3AGPA 3I9LA 3ZEIA 2ZT5A 1U6KA 1JQKA 3AETA 4H6WA 1FRVA 3RSFA 3RRXA 4AY6A 1GSHA 1M66A 2WIAA 3KFVA 5L3QB 3WB1A 3V2IA 2Q27A 1RADA 5TQ0B 2AG8A 1JBEA 2GEBA 2PQMA 3VVCA 3HXMA 4UHKA 5DE3A 3AT1A 4GI7A 1FPMA 3C6YA 2B36A 1QRSA 3M4YA 3X3HA 1NI4A 1O03A 3KJHA 1IUKA 4NZMA 2XUAA 4ZCIA 3JVUA 4HH4A 1TTQB 1ZQ1A 3HJBA 2D1QA 4F5ZA 1XNRB 2G5PA 5KOIA 4B7UA 1Q0ZA 1GLVA 1WM1A 1P0FA 3IEUA 3H3XA 2DUJA 2CEAA 3UG6A 4F86A 3OZUA 4US2R 3U7FB 2NNLD 3L6UA 3DM9B 1LCIA 5A6SB 3BSSA 4PN3A 3H9UA 2FZWA 2B7BA 4PGHA 4JX9A 4JLOA 4EG3A 1R4NB 3HGQA 3RFVA 2X0DA 2HD4A 1Z18A 2P3SA 3L7BA 4NH0A 2C77A 4X44A 4YGYA 3RASA 4MVCA 2OC4A 3ZDBA 2JH8A 4TL9A 1QOZA 1T1IA 3DOUA 1P1FA 3B51X 3H8JA 1YZYA 1FS5A 2QSJA 3OFKA 2J0EA 3OKCA 3VU0A 4CKEA 3AU8A 2W2LD 4KDCA 3UFXB 1LI4A 1XCOA 4IDFA 1XTPA 3FPSA 1SOVA 4U00A 4W6QA 3VZDA 2CFIA 2XRYA 2JC3A 2IV2X 2WIJA 4RAOA 2X1LA 5EUBA 2VYVD 2G67A 4NSNA 5K0GA 1PG0A 2BMJA 5C0OE 3KTDA 1LK0A 1KI9A 3L06A 2FN3A 4H08A 4TV9B 3ROQA 3HJGA 3DAHA 5JIBA 3CF4A 5AUQA 3LT4A 3TSZA 4CL2A 3A6LA 4JHXA 4E33A 5BV0A 2AE1A 4QUEA 1JX6A 5CH5A 3ZDAA 4QXAA 2AHOA 3Q6IA 2O8VA 4RKYA 2HLPA 1T2FA 1K4KA 2ZIFA 2VP9A 3P9RA 4E7PA 2VCHA 2W6ID 3C7KA 1G8PA 1U8EA 4K81B 5ENDA 1F8YA 4J9VA 1EPUA 1WY5A 3PVSA 3U4CA 4JP2A 4EATA 5IJ0B 1MQSA 1EIZA 2V45A 3A1EA 3ZZ0A 4CKBB 3NR2A 5AHRA 3VX3A 1U0RA 5JFTA 3DBVO 1XZAA 4KYUA 1SIOA 2UAGA 3AZPA 4Q3BA 2I29A 3G6WA 4MVJF 4CODB 5KYXB 4IEIA 3PNQA 4RGQA 4RQAA 4A1OA 1ISJA 3KK0A 3ORRA 1GZ5A 1ORHA 4S12A 2Y1EA 4Q3NA 5LZ5A 2R1TA 5DM60 3NDPA 2GJSA 1N36B 4Y0VA 3VYWA 1F0YA 5ES3A 3ZQ6A 2WFLA 5D7NA 5C1DA 5LP6A 3L1JA 4YRKA 3GC6A 4MQ4A 3SJ7A 1M2JA 4N3BA 2V6FA 3WYBA 4DUPA 4Z4QA 1N77A 2PX8A 1SMKA 1EAMA 1GPJA 3NVKI 1PKXA 2EP8A 1M10A 2P4UA 1D2EA 2VNKA 1N4DA 4O4HA 5AVVA 2X1HA 2ZRKA 3N7TA 1N2CB 4FXOA 4D6PA 4RA9A 1N0UA 1IFXA 4CR8A 2YWBA 2ZRJA 1M0EA 2QRKA 2P1ZA 3EVDA 2ZIUB 3A1FA 1B43A 3PWZA 4GQBA 3ONEA 1TUGA 4PF1A 4YRCA 6CHYA 3TW8A 4M1TA 1WTAA 1JG2A 5BSWA 4B3SB 3FD8A 1DC6A 3M34A 3PNKA 3LKDA 4MUKA 3DQQA 2BTQA 3SXUB 1XVUA 1NUPA 2VHQA 2QPAA 1TTHA 3G2NA 2O54A 2J5KA 1VJCA 3VR6H 1Q22A 1SPXA 3GD5A 4LZAA 1JQJC 1IJKA 2CL0X 1J8QA 2M9MA 3B82A 2FJUA 2YJGA 3N1UA 3Q2KA 1CU1A 4G85A 4GI5A 4R2JA 2LPMA 1Q6YA 1X14A 3BGVA 1D1PA 4LMBA 2CZGA 4RFLA 3H3FA 1SKMA 5BSUA 3LBIA 5KDDA 5D84A 3V1UA 2NXEA 2HCTA 3A28A 5JY6A 5J2UF 3VHXB 1A9RA 5FAXA 3JD0A 1WPRA 1FK8A 2QZJA 4TUYB 4Y1GA 5I8PA 4QYWA 2QYTA 4LVUA 1A97A 2FEAA 3TJRA 1C8BA 1U4SA 1ZMOA 2ZOSA 1ODCA 1W87A 3EEQA 3M5DA 4IFTA 2DPHA 4IVQA 4Q5IA 2IS2A 4RH1A 1W52X 2IXEA 4MRRA 1E5LA 4MDFA 1XP5A 1PJAA 1CHNA 2OHOA 4BMNA 1WSAA 4WN9B 4DLLA 2P6PA 3MMZA 3M6MD 4IV8A 4GZ5A 5HW0A 3K0HA 1PVVA 2GEUA 5CW2A 3WSVA 1F48A 2PZGA 3IJEB 2NUPA 5K0CA 2CE2X 1H2AS 3GRFA 4HXYA 4M8LA 2QN8A 3LDGA 5CVCA 1JR3A 1RXWA 3CBGA 5GOTA 3OE5A 4G8CA 4W1QA 3NT4A 4GF5A 3EG9A 5DU2A 1F60A 3FNFA 1TTTA 1ZGAA 4BNVA 1P45A 1ZGCA 1JSRA 2BGJA 4L8YA 1U3FA 5J1TB 3ADBA 4OX9B 2J0QA 3I5YA 3L8GA 1ZLYA 4II3A 1E77A 1GCUA 4EUSA 3KUUA 6REQA 1P81A 1XCLA 4MIYA 3RREA 3A6ZA 4RVGA 4MK4A 4YTEA 3VH2A 2HGZA 1UBRS 2EJVA 2QLMA 3QYAA 1D07A 4JI0B 2W00A 1G3MA 2IU6A 4J3NA 4C7OB 2WHYA 3BXGA 1ZCFA 1N2CE 2H4JA 3I9OA 2O7SA 4DM7A 1E4VA 4OUDA 3SQXA 3R9WA 5KYYB 2DY1A 2FXVA 5CLGA 1PJLA 1TQ4A 1KNQA 1XE3A 1UFVA 2HMTA 4DMUB 3NQ41 3R7SA 4N39A 3RDPA 1A82A 1LRJA 1E5QA 2V6GA 5T6BA 4ID3A 1EXVA 4NCHA 2C54A 4FGZA 4YQZA 3JD2A 3BTUA 1QVZA 2HA2A 1JGTA 4CR7A 3P97A 2X1VA 4ZI7A 2J30A 1SOWA 3ITNA 4HDMB 1VI5A 1X80A 2P0EA 2GBFA 3GJSA 1WQ3A 1MN6A 1CQIA 4CI0B 5K5EA 1U7HA 3DR5A 1SHTX 3H87A 4PLGA 5HXAA 3C3JA 3JQ7B 2OGZA 2V7VA 4QA9A 2H2GA 5AM3A 3R23A 1V7QA 2OGUA 3K9QO 1Q7EA 2IYPA 5KSZA 5C1OA 3HLYA 4KU4A 1BVHA 1JKIA 1PN3A 5ADWA 1UBMS 4OGGA 1DJLA 2GBPA 3T3DA 5JXHA 1UOQA 2J59A 3U13A 1H0KA 3GN1A 3AZOA 2ZBEA 2P5UA 1ADFA 2PGIA 4GRIA 4HB3A 4XUCA 3FHTA 5COAA 3IIIA 2DOKA 5TPWB 2VPZA 2GAAA 4JFAA 4OX9Y 1MXFA 3KRTA 1N3LA 1SBYA 4URVR 5T4EA 2ZR7A 4YAFA 1Y48E 4QKQA 3AKDA 1SZDA 5KTTA 3CVWA 1WB9A 1EZ4A 4HAVA 4WEOA 4JJ4A 2WT9A 2ZBRA 3ITKA 2WJ4A 3C8MA 1XLVA 4KRYA 4V0KA 1OBHA 1XMJA 3KYDA 3QYPA 4IKOA 1A27A 4PTYA 4X24A 1DKRA 1SVIA 5IABA 4KPYA 3BERA 1NBMD 3WB0A 1JKJB 5ISMA 1JJVA 3GO4A 3NUZA 4UQPA 3UT6A 3FUWA 3U7EB 1WVGA 2Y93A 3B12A 3LWZA 4MVJA 3I0ZA 4NZNA 4MRMA 4BE4A 4RTNA 3T7JA 3TXAA 2PBZA 4YCCA 2DFDA 1GA1A 2FV8A 2WSIA 3QHPA 2RE8A 1QRTA 4YMVA 2QTVA 1CJVC 1RDFA 3B1XA 1KRHA 4F3KA 4EY4A 3AUYA 3ISTA 2ZRHA 5JMOA 1SCUA 3AGQA 1GRQA 2L18A 2W58A 2R4QA 1KFEB 5E7JA 8OHMA 1ZD2P 2WJ3A 1YACA 2PSDA 3LL7A 1X94A 2FG7C 3EW9A 1SXIA 3PUXA 3LTEA 4L0CA 1MUUA 4GPZA 3VR3A 1JKMA 4HQNA 4I19A 4MV7A 4R8KA 1YA6A 2P3LA 1KZHA 4Y2YA 5ETJA 1KAGA 2WYIA 3FNRA 4TYQA 5BN1A 1VP3A 1BFKA 3IVMA 2JG3A 1CB7A 1CS0A 3AEQA 1E89A 1GXSA 2ORYA 5KTNA 2F1KA 4KWCA 1Z8DA 2GWHA 2QX7A 1MJ5A 3B6ZA 2BISA 3FXAA 3N6VA 2I2WA 5AJYA 4CLEA 3DVSX 3NVDA 4UASA 1YCDA 3QWBA 3HPQA 3PC2A 3T94A 4OHYA 5EJEA 1BJTA 2AMJA 2AWNA 2R6DA 2ZBUA 2ZSFA 4H35A 2X5NA 2B9EA 2H07A 3ANXA 3R3UA 5ALPA 4RTKA 2DHEA 4NFSA 4I5DA 2C8KA 1TQ8A 1RWVA 3U7IA 2RBEA 4HB2A 3G0GA 2Q3FA 1AVTA 1CNEA 3CPHA 2OCAA 3DDNA 1KAQA 2IHUA 3RS7A 3IVAA 2LIPA 3O8BA 3CGWA 4IWNA 4KGVA 4US1R 5TC4A 5MDHA 1PDOA 2AUTA 3TRIA 1FYWA 4UTNA 3I6MA 4YQFA 1ZITA 2DR3A 4BQPA 5J2UA 1JG7A 1JECA 2OP0A 3HZOA 3WRVA 4HD8A 3S1AB 3DH0A 1XTJA 4E12A 1LWNA 3C3EA 1DBVO 5JVDF 3EDCA 3WMGA 4C9BA 2WWVD 1HA3A 3GGCA 2NWQA 1VJGA 3Q7RA 2HQBA 2YFKA 5C4MA 3RVSA 1ZMTA 1WZIA 5A2QA 3ESXA 3AVTA 2I4MA 2ISQA 3O8QB 1J4AA 1SXJB 3TTSA 2Z2ZA 4G1VA 4TZTA 1AN0A 1YFJA 3G17A 1EDBA 4QJ4A 4B6EA 4JIGA 3VVBA 5FPPA 2PT5A 1IJEA 2VSNA 2G63A 3DZHA 3LLVA 3U49A 3M6IA 1SXGA 1IN1A 4NU8X 4JOCA 1U3UA 2F55A 1FSSA 3WAJA 1XWFA 3BYZA 3P9IA 4MQEB 2OENG 4R1MA 3HNPA 1YIOA 2ODPA 4FMCB 2EFYA 4WJLA 3G49A 3GLUA 1T0HB 3BJEA 4IHJF 3OCVA 3N70A 1L7BA 1VYUA 4LQLA 5FV7A 3OQJA 4MCJA 2FUNB 2IXBA 1Y8QB 2W6CX 1IQUA 1L7NA 3PNSA 3DTVD 1UP4A 3O0TA 4ZZ0A 1EP9A 1JEAA 1L4KA 4AYTA 3PJFA 5HP4A 2R5FA 1PGOA 4QGHA 1BD3A 5C3MA 3HR8A 1QF9A 3VRHA 5CNIA 4ITVA 5HKAA 1OH7A 2VYFA 1P80A 5LQSA 4E4RA 1FVHA 1YQUA 3FETA 4LZZA 3U39A 3G9UA 4LF8B 5JH7A 4HGZA 4IPTA 3WE7A 5D85A 4TZKA 5KQLA 1TM1E 1JHXA 3LX8A 5B53A 4UHBA 4RBNA 3M89A 4ONEA 2P3QA 4K2HA 1Z5WA 3R4CA 4P9NA 1KDPA 3TIGA 1RWQA 1TGYA 2AG5A 2QOEA 3C70A 4CW7A 1XEAA 3FMOB 4QUKA 1P1RA 4QULA 3RS0A 3USCS 3Q9LA 1CUWA 4K6HA 1OYWA 4QGAA 2D4HA 5BMOA 1X0XA 1YS7A 3FPLA 1ZPDA 1DEAA 5KQSA 5BSTA 1W75A 3AFGA 1O1YA 3V7FA 2VTVA 2C9YA 2F2TA 3NRJA 4Z51A 1NVVR 3HACA 2QZ4A 2ZI5A 3UV3A 4CG3A 1ABBA 3IXLA 3HV0A 2XXJA 3CLKA 1EFRA 1QYXA 1SBTA 4G37A 4LWZA 4Z2YA 5ALJA 3FUCA 2G7ZA 3T9EA 4DLBA 1T9GR 4K2AA 3I9JA 3EIQA 4WESA 5DK4A 2QG6A 1BAPA 4DABA 1JEOA 1NA5A 4YJKA 1ZSYA 1YJBA 3R7WB 3GLKA 1G2OA 2R3SA 3KB8A 3WZLA 3TL3A 5JTUA 5M04A 2BTOA 1J0XO 2V5UA 2QRQA 1FFBA 1N5OX 2JIDA 3EVFA 4HZUB 4OREX 2XKJE 4UNSA 2BMDA 1R9NA 3DPUA 4CTJA 4JC4A 3U80A 5IAJA 13PKA 1A9QA 3JPWA 1QGYA 2N0SA 3ZZUA 1YQQA 1Z33A 1E0DA 2OHXA 3PI6A 3L0YA 2EEZA 1YTLA 3S27A 5JSKA 1BEUB 3CSUA 4CF6A 1SHKA 4WNYA 2Z5FA 2VJKA 3H1BA 3Q8WA 4LS3A 1Y3BE 3N5CA 3QZUA 1MEJA 4JT4A 3VH4A 5JD4A 3GCDA 2P65A 2ZSAA 2DUNA 4X7PA 1U8CB 2CVHA 3PGXA 4PAGA 4XLZA 3MLBA 2VAVA 1KOFA 3U9TA 3PSAA 2RARA 3PK0A 1NIJA 1NF8A 1H4TA 2GFHA 3OIFA 3QGMA 3V1NA 5I9BA 5A2GA 4YREA 2R68A 4C4PA 5HJ7A 4MKXA 1XJWA 4MKZA 4C6RA 1YZUA 3OFNA 1YCHA 5M3BA 3LG2A 4Z1OA 1FZTA 1VZ3A 2NAFA 4EKYA 2ZYVX 3EQZA 1DIHA 2FKAA 4UXJA 1UBTS 1IN8A 2BZ0A 3FAKA 4MW0A 2GYYA 3WNCA 3SX4A 2ZRFA 4RM3A 3H2YA 3D8RA 3MRVA 3ZLTA 1KZ4A 3NALA 4ZI2A 5AVYA 5FQOA 5REQB 2NTYC 3MJCA 3HMKA 3W6PA 3FPFA 4B80A 2YZMA 1DADA 5JSFA 2AOWA 4NYIR 4HO1X 5JDCA 3T1YB 3K6SA 2PUTA 3RAJA 1GCGA 3W2IA 1CRWG 1DX4A 1ODFA 1Q7GA 3NKVA 4RADA 4RSRA 5HKLA 4IF6A 3L77A 1A9XA 1I7SB 2OZPA 4DV2B 4B44A 4RF2A 2OO5C 3O03A 2EW2A 1ODTC 3PCRB 5E3JA 4D74A 2HYIC 3H5WA 5ALTA 4EGAA 2EZ8A 4EJFA 2FPGA 4D81A 1CQPA 1UINA 2HHCA 4HDNA 5IM5A 1QZXA 3D2AA 2AJBA 1U2ZA 3H8VA 4MX8A 4ASUD 3OEEA 2XYHA 4E2XA 2FZEA 4KK3A 4LJ9A 1DJPA 2ZDHA 1YZQA 3LP6A 3PFWO 2BGIA 1V48A 4KQCA 3OA0A 5EAIA 1HURA 3GA5A 1TB4A 5A5VA 3KUXA 1VLZA 5AW1A 1Y7TA 2R6R1 3PIDA 4CV3A 3OIUA 3FPKA 3BXXA 1E98A 2BSAA 4MIKA 1NJ5A 5D51S 2R6GA 4LF4B 4R2XA 3WZMA 2BEVB 2RBGA 2QPLA 2R97A 2O05A 1NPYA 4ZA2A 4XGKA 5LUAA 1WW2A 1CVIA 2IDMA 5LC1A 1W4BA 1U28A 2PD3A 5SYNA 4HX2A 3K9BA 1OV4A 4B40A 1SO8A 1GEEA 1NBHA 3JQ9C 4ZT3A 4XDYA 4LPKA 2WHQA 1E3SA 1F2UB 3VZQA 3VKHA 2C82A 3BVPA 2V0CA 4ICIA 3LAWA 3IEPA 4IHJA 4LCJA 1YR6A 1KFKB 2VF2A 3P0RA 4B3IA 1XUOA 5E3HA 3AJDA 1YWGO 5AT1A 4FLMA 1XO1A 4C04A 3OIYA 4EPTA 3JQAA 2BEWB 5BMVA 1LDGA 3VJKA 5BSGA 3ESAA 4QPDA 4C4ZA 1UP6A 4F92B 3TIIA 2P8SA 2ZJFA 4BX0A 4U7DA 2X3YA 2K5UA 2FQXA 2Y9MB 3FNIA 2IF0A 3QF7A 1FFXA 4FYWA 3T0IA 3WRXA 1MX9A 4DTCA 1QO7A 2JJ2A 4EVQA 5A5DA 2XCIA 3ZV5A 4LJKA 3L3BA 1KPGA 4XB1A 2EKLA 3PCXA 1GPUA 4E46A 4X8MA 3WLOA 4MROA 2WQ6A 3RI3A 3INRA 1R64A 1L5ZA 5KQGA 2XMQA 4L4RA 3X2SA 3S2SA 3JYPA 5CH8A 5C8XA 7GPBA 3NHUA 4P92A 1D4OA 4ZCPA 1TZBA 4G84A 3HVRA 3TLZA 1NMQA 2H4ZA 3WHKA 3KOWA 4BC1A 3VO2A 2LE0A 3NYIA 1LFDB 2NW6A 4ENWA 2CLLB 2ZWMA 1E1QD 4KUHA 4WZAA 1X7YA 3VC2A 3VDQA 2XUQA 3ANSA 1MDFA 1IHXA 2WHPA 5EUCA 3X43A 3P26A 2R47A 2NYUA 5CK4A 4YRSA 4JQYA 1UJ5A 4CLRB 1NR7A 2WUEA 4IIEA 3QXGA 1SULA 4PLTA 3RVBA 1TZCA 1G8MA 4P32A 4V0NA 4PG7A 2HO5A 3UAWA 1NWCA 1DINA 2NVOA 2WZQA 4LPSA 4B6GA 4GX1A 4ZYTA 2I78A 1IL0A 1USKA 3E5RA 3W5HA 4D4LA 3UXMA 3ZXIA 3UGJA 1RRCA 2GCOA 5C37A 4G41A 1ST3A 1C8LA 1J90A 4IUCS 3CLRD 3AX6A 4NYMQ 4YY3B 2VF7A 3SU8A 3CUSA 1E9RA 3VNAA 1YONA 2JIRA 1THTA 2ZYGA 3ZR4B 2C94A 3L07A 2GJKA 3VSBA 1Y9AA 2IE8A 3PV0A 3ZWOA 3NEYA 4HFNA 4PG6A 1LQTA 3P9ZA 1TGVA 4O5AA 5CLHA 3RS9A 4RTQA 4QXMA 3TI9A 1UBSB 1M2VB 3LT0A 1G16A 5EJGA 3U26A 3EZYA 1U2DC 2A84A 1RI3A 1BDMA 2KB0A 3OPQA 4M0EA 3KM0A 4U6NA 2D5BA 2PH3A 2NUTA 1RQGA 1PL7A 2FPPA 2OOKA 1P2TA 2VXYA 3DAFA 4WACA 2AJDA 3B1FA 2PCJA 4RY8A 4AUEA 1U3GA 4DREA 1CFZA 1VRVA 2FZVA 2Q0QA 2Q50A 3GPBA 3OU2A 3PT5A 4UARA 4YI5A 3X1MA 3OP1A 1G6OA 3GJYA 5IKOA 2BELA 2ZJ0A 2QD3A 3A2KA 3D8SA 2VJYA 4KJXA 1E3DA 2R6AA 3E61A 1TAHA 1EVJA 4J2TA 3EB9A 3SY8A 3CLTD 3TNFA 2IU4A 1UK8A 2W7TA 1T1SA 1WW3A 3EFHA 3OJFA 4FP9A 4RF3A 4EB0A 2J5QA 3WFIA 3GPCA 4DCGA 2EFHB 4W1PA 4I9HA 2NACA 3V1MA 2XVMA 4YAKA 5FOUA 3C6MA 4AJ9A 1ADYA 2D5LA 4D97A 1CJMA 3NOVA 3VDMA 3LLUA 5FOXA 1X0VA 3FE2A 4TOIA 1AV7A 1OI7A 4UXHA 4XD7D 3FPGA 3OQIA 1K5GA 3UKDA 2D13A 2RHGB 2VZEA 4TRRA 1GZUA 3VV3A 1E9VA 2B1RA 3U56A 1PZEA 4RLHA 2HF8A 1IAQA 2TMGA 3NAGA 4UMFA 4EYEA 3QX7A 4KQJA 5KWVA 3DEAA 1FTGA 1GN9A 3DFZA 3L05A 2EF0A 1NNUA 1KGDA 2R9VA 2DBRA 3MK31 4Z1MA 3HCDA 3UWKA 3O47A 5KJCA 5EWMA 3GI1A 1QGED 1WF6A 3JQQA 3LQ2A 1RC8A 2AI2A 2FPWA 4RC9A 2CB9A 3WR5A 5DNUA 3BDVA 3K1AB 1CR0A 3HSYA 2F64A 3E3LA 3LQRA 4HXEB 1M73E 5EMNA 4OBWA 4DS3A 2J0SA 2YWCA 3M81A 2I6TA 1N2HA 3TKYA 2WSSD 3LT5A 2H06A 4QRDA 2YKGA 4YUYA 1EUYA 5FUVA 3VUEA 2GYVA 1GADO 3QVJA 1QG2A 1XKQA 3IT0A 1GPLA 2VPQA 2FLWA 3WGLA 1X1DA 2ZJ2A 1HEYA 3PF9A 5EXXA 4BJHB 2CF5A 3ENQA 4N48A 1QQAA 2ZS8A 3KV3O 2WKWA 3KT3A 4NCJA 5LIRA 2WIFA 2R0QC 1QM5A 4ESOA 3VDXA 4FFPA 3K5WA 4ISBA 3P2KA 4OP2A 4C88A 1G64A 1RTTA 1ZJJA 3TQFA 2H0RA 1NULA 4MTCA 1UM9B 2GEVA 1KAEA 3AEUA 1P4AA 1HPLA 1HZZC 3CMCO 1T9ZA 2EZTA 5BRAA 3QKRA 4K9NA 2ZIVB 5KVQA 2O4UX 5GJCA 4XB2A 2P1RA 1U65A 1ONOA 1XVLA 4G0YA 4LK3A 4BO1A 2C59A 4TKVA 1TX4B 3QW2A 2RGDA 4IIUA 2FSFA 4FFSA 3B53X 1DZ3A 1YBFA 3LHIA 4R5MA 4JMLA 1Z7WA 3VTAA 3VXKA 3W8DA 4UOEA 1HE4A 3D0OA 1P0IA 3C16C 4P82A 1R0SA 1SG6A 3EA4A 2AQIA 5CX1B 5BVHA 4P3XA 5EHQA 2PS3A 3B78A 1XEFA 3G0DA 3CVUA 1SU4A 2FVXA 4MRNA 5TVGA 2C8VA 1UIRA 2QMYA 4YJHA 1TPZA 1E6MA 3A14A 1EA7A 2ZPTX 3UW3A 4N41A 2DWUA 4DRYA 1NQXA 2WV7A 1EU1A 3CPEA 3NH9A 4HGOA 3A37A 1LFAA 1DGQA 1A69A 1QHXA 1XZNA 1JRLA 3F8TA 1FP4B 2FUKA 3BGWA 2WJVA 4MDYA 3DM5A 1P2GA 5AOBA 1L5NA 2JIMA 4P34A 1KP9A 3ZGLA 4NG5A 2DHRA 2P11A 1VRWA 3B6KA 3B3QA 1MC5A 1TQ6A 3KWMA 4AN1A 3CX4A 4CIXA 5I7FA 1HNZB 4BJ3A 2PO5A 3AIIA 2QBYB 4MI9A 1GG8A 1T1RA 1MW8X 1T6ZA 3ZLUA 2W4IA 3VMMA 3RSQA 4C21A 1GPBA 4N0MA 1OAOA 3DFMA 4PRLA 1YB4A 4TSFA 5E95A 4OLAA 3WV5A 4FDLA 4I50B 1NYLA 3J80A 3GMSA 1V5WA 4K6FA 1XZFA 5JY1A 2QVGA 1F2TB 1EB9A 4GL2A 2RHDA 3E6AA 4C2AA 1J20A 2PZ8A 1XMOB 5TMEA 1E5XA 3EVZA 1L7DA 1S3FA 3W5CA 4K9MA 5DLQC 3SNHA 1ZEJA 4K7JA 1SG9A 3WSWA 4DDWA 2RGEA 1T4BA 3RV4A 3JVVA 3MTJA 1Q0QA 2XB6A 7MHTA 3E7WA 1HSOA 5JI2E 1OFUA 1FXSA 3OE1A 4J94A 4GBJA 4KR0A 3BE6A 1D0IA 3E05A 5B6PA 5JPDA 3RYCA 2WC1A 3AR7A 3NM4A 1HLDA 4HNTA 4LNHA 4JKOA 4WSOA 2CXRA 3O4RA 3FGNA 4GGPA 2GWRA 2R66A 2VDPB 2R8PA 5B7PA 3QYJA 4LBZA 4KK4A 1ZGHA 3MBIA 4Y1RA 1C7EA 2ZVDA 2P9CA 1Y89A 2ZWVA 2JI9A 4FHZA 1OLXA 2I2DA 4UVDA 3AYXB 4RANA 1RHUA 4Q9AA 5EJFA 1E6UA 4ALJA 2OD7A 1A4IA 3ZHVA 5F23A 5L40A 2RCYA 3L9XA 5C1BA 1GSOA 4YRDA 4P7GA 5E9WA 1Q84A 3GV0A 3L8HA 5D5QA 3PX3A 2XMGA 4WXEA 3JRWA 3U3RA 5BOSB 8GPBA 2IYVA 4NBWA 1UPBA 3W77A 4D56A 1FMTA 2Z58A 4QU0A 2GK4A 5AJTA 1JFTA 2D59A 4XSHA 1BX0A 2AHRA 3ROZA 3GPDG 4NZPA 4WXPA 3P45A 4QYIA 2H48A 1RJGA 3EOAI 1QV6A 2AA3A 3BE5A 1NHGA 1PJZA 4F97A 3CM0A 1ZNXA 3R6DA 1E7QA 4WY8A 3DWFA 2XLBA 1VDMA 1RM0A 4ENUA 2IVZA 1PVDA 2OVFA 2QENA 1V16B 3PPIA 4PCLA 4UUQA 5LMUB 3SX2A 1LBHA 3FPAA 3L4SO 4GE0A 3TQRA 1WZEA 3HY6A 3TZQA 4K9KA 2O2CA 3U48A 1K3TA 5DM70 5AD1A 1AJEA 2O0JA 3F1KA 4IW3B 4Q9IA 3I2GA 1GEGA 1HT0A 3QUBA 3SF8A 3L8ZA 4DYHA 5C32A 5GJBA 1WXWA 1PWZA 2YIMA 4E22A 1C2TA 1RYNA 3U7JA 1GUZA 5FNVB 1JR3D 2FW1A 3HZRA 4ND2A 5SV2A 4I9GA 5D86A 1E5DA 2OQVA 4AY5A 1W2HA 4QJIA 1AY0A 1G17A 1TLFA 4XGNA 2Y8EA 3SHTA 1G20B 1Y8CA 1PWYE 2CLOB 3HXTA 3ZDYB 2AN4A 2CNBA 3FDZA 1KYYA 3GCXA 3EGIA 3PFNA 4CTMA 4N1AA 3KDSE 2GJ8A 1KI1A 3I58A 4MV5A 3F6YA 1Z63A 3NTRA 3EWIA 5LA6B 2OCYC 3WL5A 4Z7OB 1UKEA 1IN7A 5EJ5A 5HZHA 3GXBA 5FOVA 2YNMC 1DAPA 3TIFA 4N01A 1JDJA 2WB4A 2WINI 4O59O 2B5VA 2VBGA 1AZLA 4WA8A 4BO6A 1JDUA 4BUZA 4YT8A 4QOSA 4LHZA 3WIVA 1SY7A 4Q02A 4RO0A 1MH9A 3SC4A 3P96A 1BHO1 3KALA 2PUCA 1QNLA 1FRNA 1NRJB 2H1FA 3GQBB 3RUHA 1QQ6A 5IG2A 5BOVA 4EHFA 3EHEA 3A70A 1KVUA 1ISSA 1USVA 3NB0A 4WL0A 4ZJPA 3GOQA 5TF0A 1QOQB 4BB6A 3T4UA 1Y3IA 1A8IA 2VA9A 2C1EA 3NFYA 2ZKLA 3UHFA 1YRHA 4EKEA 1EI9A 2BEUB 5E7MA 3TOVA 1TLTA 1Z7GA 2IYNA 4C2TA 3NOOA 4KXVA 3WQHA 2OCIA 2Z9CA 1ZX1A 1FFWA 1F0NA 2N75A 1RM4A 4NENB 1WMDA 3EUAA 1IVNA 1KJZA 2IZ7A 2J32A 2OUIA 2IEGA 3ETNA 3FUTA 3OZXA 5E3IA 1C2YA 4HNQA 4KX5A 3LGXA 1FMCA 2HXSA 3G2IA 5FR2A 2EWMA 1XTQA 1P77A 3HG7A 4M8KA 5GONF 4Z4CA 2VA8A 1C80A 2CFSA 3TS1A 3BFVA 4DLAA 1IXZA 1V45E 4DMKA 3E9RA 4JLPA 2QZ9A 4UUPA 1ABFA 2CNNA 3LUBA 4K9QA 1CR2A 2B3DA 2NT3A 3ILVA 2W90A 4GYJA 3ZG6A 2JGAA 3CV3A 3K4QA 3NGLA 1IUNA 4RE6A 4X3CA 4XWGA 4AG3A 1KFCB 5B57C 5JV5A 6NULA 4BU1A 1MAHA 1V4NA 2H2FA 2I7VA 4GLFA 2OOSA 2P30A 2XWBF 3G02A 4R8MA 1E0JA 5ED0A 4PYQA 5I48A 5M2QA 4TT8A 1MAVA 4K9DA 1YMUA 1WD7A 4ENRA 1FSGA 3SYMA 2HT1A 4EUNA 3A4LA 4UW9A 1ZH6A 4HEHA 3THOA 1CF4A 2CLFB 1HNXB 2QVLA 1EVLA 2PJZA 1SCIA 2R8BA 1XD8A 3ONVA 4MVJD 3W2EA 5F98A 1EP1B 2IP1A 4I14A 5BUQA 2NVUA 3IPXA 3GRCA 3EIEA 3WTBA 4CHGA 1LLQA 3PXUA 1QIFA 4DR1B 3L7YA 1YZKA 3OM9A 4C01A 2AJTA 2VZ9A 4FKZA 3MMPA 3QBDA 1TU3A 4G5GA 4FNGA 3TVYA 4E4YA 4QLOA 4QXOA 1GAXA 3C3AA 2XXAA 4ZZ2A 1TEHA 2XRZA 4B3BA 2LXNA 2EVWX 2SICE 1PD0A 3G88A 4Y3UA 5KPJA 3F6EX 3VR3D 4FEEA 4YT5A 5CITA 1TMYA 1UUFA 1QVVA 2FR8A 3FRHA 4QTTB 4WXRA 1DFIA 4KUEA 4ZEXA 1X7WB 1A5AB 5IXJA 5T7BA 1NPDA 1U9ZA 5HOQA 1ZJZA 4D9FA 2Z08A 1DJMA 4DGSA 2WJZB 4Z99A 1Z5NA 3OT5A 4RMHA 4BNJA 4YRZA 1BN6A 1F7UA 2ZUCA 4MS1B 3C3YA 2A9PA 2AVDA 1TM4E 2P2DA 4EHKA 1UP7A 4FE4A 4Z9BA 3TTWA 1WEKA 3GYGA 3O82A 4OIFA 1YBAA 3NZEA 4U2GA 5EE3A 3GGOA 2RJNA 4MOWA 4X6YA 4OXIA 5C1IA 2XVAA 2JH3A 621PA 1N6OA 3BEOA 2Q4DA 4KQXA 4IXDA 4IIFA 4KPUA 2D1YA 3WQBA 2JFOA 1E1CB 3AW8A 3FSGA 1RMTA 4NH4A 3W06A 5FTLA 5KNCA 2GHQA 2RGGA 3LWBA 2E5FA 1F2VA 1UAAA 1ACMA 2Y05A 3G5MA 3SHOA 3V8MA 1QP0A 2CXTA 3AVYA 1MKYA 1G1AA 3FGOA 1C1XA 2PQ2A 4RSGA 3UJ3X 3VGJA 4RLFA 4JGBA 4QYMA 1DC3A 2PNJA 2PA3A 3K16A 5E1DA 2I3GA 3W7AA 1U9JA 1G55A 4MW9A 4XVUA 4GLLA 4M1ZA 3EQ2A 5IDQA 1HLFA 2P5TB 4TTJA 4RHXA 3D3JA 2D7DA 4NJMA 1R6TA 3KSDO 4FLFA 5F12A 1EJ0A 1P17A 1FJHA 3U1TA 3S8YA 4F9TA 5JAOA 1UWLA 1G0NA 2RONA 3TEJA 2IYUA 4PY2A 4US0R 5B4UA 3U16A 4FILA 1FQKA 4BO4A 3DE2X 4HNHA 4RUKA 4A2WA 1W85B 3WIOA 4BN4A 4L85A 4RDXA 2XMCA 2Q0HA 3SN6A 4J1SA 3EBLA 4Y9RA 4GICA 3LC2O 1J5PA 4YJFA 3UXEA 4D9EA 4HDKA 3LT1A 1AHIA 1IN4A 2O7NA 1H9CA 3CX7A 3LI2A 4H3SA 4FGLA 2XHZA 1SUDA 1UZMA 3JWHA 3KZ1E 2O0KA 4FHGA 3STHA 3R41A 5JYBA 2E6UX 4ZHQB 2ZSDA 3ZZTA 3K1TA 2W11A 1ECGA 3TGWA 2PLFA 5CDFA 1IZ8A 1UMCA 4WBXC 5BR4A 2XQKA 1IY9A 2WRZA 2X2OA 3UPTA 5EMLA 1LLDA 3JQGA 3NIDB 1BO6A 3ZUPA 5JFGA 4RGBA 3N0RA 3BKWA 3NHAA 4RK7A 5JCOC 1C1YA 1NF9A 4CMGA 4AP6A 1DTWA 1S4QA 3TX6A 3U17A 2XUHA 1DOAA 4FVTA 4KFTA 3AFOA 2IWHA 5K01A 1Y4UA 4DJ5X 5C34B 3N2GA 2GKGA 1M6HA 4S2EA 3Q87B 5CLQA 4PM4A 2YL2A 4MA4A 4AIRA 3M9LA 1H4QA 2GZDA 2IHZA 5K9ZA 1CS4C 1U1EA 2VH1A 3ROEA 2IIQA 4D8TA 4LXUA 4KO3S 1Y1SA 2IJGX 4NICA 4FB5A 1P6XA 4JI2B 1EFRD 1JS1X 1UMDA 3DNPA 2ZJYA 5B2FA 2FETA 2IHJA 3URMA 1D2CA 3OMWA 1D4ZA 2JAWA 3DHVA 4FCWA 4RGVA 4ND8B 4HQ6A 2D1RA 5ELMA 1M83A 4KE6A 2IIBA 1ZNZA 1TA0A 3FPCA 2AC2A 3N74A 4D9KA 4B2LA 1VXOA 1B26A 1KYVA 1NUAA 4PXAA 4G86A 3TCKA 3FNEA 1CZOA 1AHHA 4BB9A 3STYA 4KSYA 4EG0A 1D6NA 3GRPA 3KKEA 5HKKA 1VE1A 5K3FB 1B6TA 5H9WA 4KLZA 3L7OA 3C1AA 2JLXA 1JLRA 1KO1A 3IKLA 3NBXX 3K31A 3JASA 3EIFA 4U4AA 4JHLA 3IQFA 5B6IA 3LOPA 4CQLA 1DQSA 4KOAA 3E2PA 5IYZF 1JIUA 2GEDA 4PLFA 4RKRA 4U8HA 1QC5B 3JAKB 2VP0A 3R3WA 3PQ8A 4GSYA 5BV2P 5I4KA 4W5QA 4R83A 4CEJA 2XUPA 1NUQA 3IQXA 4YR7A 2AJLI 1R8QA 3F90A 1XXHA 2HADA 4M1SA 2NPOA 3IP8A 1OLOA 1NW5A 3KQYA 1G9SA 1VGRA 1Y9EA 2BD0A 3N76A 2CEKA 4P2BA 3I76A 1U4NA 4HAXA 4R41A 5IWCA 1FVFA 2JRLA 5JXIA 1YV9A 2A5DA 4QZVA 1DX6A 2QJFA 3GG9A 5IBCA 2V58A 2VDRB 4KYVA 3VSEA 1QRUA 1HGXA 2WAOA 2IHNA 4U63A 1UJCA 2PXCA 5LD2C 3OFND 1JQEA 1UBJS 2ACVA 3WIDA 1N8KA 1S8OA 2JCYA 1H2ZA 2JLQA 2EFEB 3BB1A 4G63A 2RHTA 2PMEA 3T7IA 4DLXA 1M1YB 4G1UC 4GM1A 1OZGA 2H0AA 4YUVA 4A03A 1GZHB 3OCXA 1CQJB 4JA0A 5AWFC 3U0BA 3PDJA 3FMGA 4GO1A 4NMLA 1A9TA 3HPRA 5EWJA 3WWYA 2HMWA 3M9XA 4B46A 4DV6B 1ZN9A 4WJZA 3RYHA 3EHDA 4IDAA 1C0LA 4UCFA 1PW5A 4AX8A 4NAUA 1HTTA 2C2HA 2DC1A 1L0BA 3IODA 1FY2A 4J0KA 1S2LA 2FP4B 1PFVA 3OKFA 4EMSA 4F45A 4OSPA 1BIFA 1XMIA 1T25A 2P91A 2XGSA 2WNSA 1NKVA 5EMHA 3AY7A 6ADHA 2OPHA 4S35A 5EKTA 1KETA 2OHFA 3DEZA 5ALIA 1VZ2A 4H1VA 2QE7D 3ZNNA 4GXNA 4AO6A 2O14A 2P1DA 2W0SA 2QMZA 4S24A 4K6CA 2JFHA 5FWNA 5J43A 1AKVA 1BXGA 4JR2A 4Y8VA 5ADVA 4ZO4A 2GESA 1DWQA 2R65A 4ER5A 2UXCB 2F3SA 1YAHA 4LF6B 1H66A 4MP3A 2LBPA 4XUGB 4CMEA 1QPBA 3HYTA 4BKRA 1FYDA 2H1HA 3HUDA 1O57A 2AR7A 3M49A 5AM1A 3ENVA 4OQZA 3ZVMA 3BWXA 1ORIA 1WJGA 1KPIA 3NU1A 1BSVA 1H93A 4Y9TA 3S2IA 1H85A 1Z68A 2CXQA 3NETA 1JHRA 4AJNA 1T2VA 1H6DA 1XQ9A 2Z8ZA 3F8SA 4MW7A 2VUHB 3D6VA 3T61A 3UPDA 3PEWA 1RABA 2E18A 5FB3A 1QQBA 4RJLA 4EFMA 4ZAGA 3GIDA 1B16A 5IT5A 1YVDA 4TRMA 4FZJA 4JYMA 3GEPA 5FUXA 4RJJA 3IVXA 4XVCA 1PUIA 3AI3A 3ZXSA 4HNAA 3OECA 1XRQA 1S1CA 3BRQA 4LY0A 4OH1A 1IG3A 3A3NA 1CJKC 2OCDA 3LKZA 1EM6A 1V11A 1W1UA 3CRNA 3FDJA 1AXGA 4H1UA 4HMPA 5L3RA 4DQ0A 3BQ9A 2DWPA 4DL9A 5LYJA 4ZGBA 4PTLA 2PR7A 3PQEA 3VKVA 4F4HA 5C7YA 1Z17A 5JO9A 3IAUA 3L82B 1R0RE 4CLOB 4MYDA 4B35A 4U2EA 3S3TA 5HQ3B 2ZJAA 3O2JA 4HEA1 2Y2VA 2QSYA 2VJDA 3JQAD 4XA8A 2OC9A 1HFJA 3OOHA 1JB9A 3T1VA 3GLIB 4K26A 4KVFA 5AQEA 3ICVA 3SIRA 4B4UA 1J70A 4IZOA 4YP1A 1M1YE 2C5GA 4HXFB 1LVGA 2JJ2D 3AUSA 4BBJA 3BMNA 2YHSA 3JTEA 1KZ9A 2DBZA 3PR3A 5EQTA 3NRBA 3I3SR 2XQIA 4TLDA 1QUFA 2H7CA 4P36A 1RC0A 3H1GA 1NSTA 1QHHA 1M5UA 2WTMA 1JEDA 5B1YA 4B4DA 4GWKA 3RGGA 4IJ5A 1XYYA 2ERXA 3TLGB 4ZZIA 1G5HA 3KUDA 3SKVA 2VF4X 1DAIA 3P2OA 3PWKA 1SKBA 5IDXA 3DE3X 5IC6A 3VFDA 3LY8A 4AZTA 3AJAA 4FD2A 1L4NA 2BONA 5EIBD 5T8KC 3SM3A 2A9OA 3T1OA 5JJ5A 5KWIA 1NATA 1TCAA 4FBLA 3WKDA 3WRYC 4ARAA 4W5RA 4CV0A 1T5OA 1UK7A 3MT7A 3KVNA 2J5BA 5U1PA 3V8QA 2XGJA 1E2JA 3B70A 1UEXC 1L3CA 1CF2O 1XMSA 2W2TA 3ANNA 4XWTA 5LDGA 4CMBA 3FTDA 3Q88A 5BSVA 5I7RA 2HYDA 2ASVA 1K2WA 1C7QA 1Z16A 2XSZA 2HT6A 1WUIS 1QQ7A 1R5OA 1WXHA 1I0IA 2ES4A 1KY3A 2FMFA 1B0UA 2NQTA 2W43A 5BSEA 2MYTA 1KQGA 1ZHHA 2ZJ5A 2I6GA 5EERA 1U2EA 5KQMA 2VJAA 4AP5A 4TYWA 4QGSA 4WW0A 5ILQA 3TQSA 5AVTA 4EFNA 2CLDX 2CDRA 3PNYA 1FLNA 3A0UA 5B3KA 3IC5A 2P3OA 2QTNA 4H15A 4MIOA 4O4JB 1LTQA 4XPIB 4E1AA 1E2EA 5D5HA 2BLLA 2ZCUA 3CA8A 1E96A 1XZBA 3UFBA 1DRUA 2CMHA 2DQ4A 2ZDQA 2E9SA 1AZTA 4OTZA 2W2QA 1RPTA 1NDUA 5IYZA 2LKDA 2GA9A 2A14A 2VR1A 3D6JA 2XUKA 1J22A 2E4YA 4HYTA 5BT9A 3RVQA 1QFJA 5KCMA 3ZTTA 1K97A 2ZSUA 3FSJX 3MN1A 4D9MA 1MX3A 3DYIA 2D5IA 3L7CA 1QE5A 2OO3A 3BILA 3FYUB 2ICAA 2ZETA 3H75A 4FM9A 1OFTA 1NJ8A 4LE1A 4AF7A 1YRLA 1FRFS 5FQNA 4DG5A 4GYWA 3GLIE 3H2BA 2OCLA 1BCSA 3KR0A 4LDAA 4DC0A 2A9JA 2PRJA 2B0CA 4LEIA 1N4AA 2TRSB 3HJFA 1YDGA 3Q2IA 1P4JA 5K99A 5LP1A 4Q3CA 5BR7A 1ZBDA 1CRLA 1NVXQ 3QBVA 2ZYTX 4V0QA 2GLUA 3H7IA 3ABQB 3JD3A 3UMFA 3VUFA 1Y5IA 4KLRA 2A67A 2CXHA 5FV4A 1J9EA 4E51A 4QUIA 2A5FA 4TS9A 3IOEA 5KUTA 1RWNA 2QLTA 4L5AA 5ILOA 1LTHR 2P2SA 3DV9A 1MAAA 1PU2A 1T0JB 2BI7A 3VBEA 4BLWA 4DNOA 1THGA 1EXWA 5LQDA 1XWIA 4FINA 1RC1A 3QTLA 1W1IA 5HFJA 1YR1A 4ILKA 1Z2NX 4C87A 1KJ9A 2ZEJA 3R6LA 4KI7A 4Q4CA 4AYXA 2RI0A 2BBTA 2BHNA 3EFOA 2KJQA 3GAMA 4HVAA 4MVJM 2CYAA 3SC2A 1U31A 3A9VA 2GKSA 3RQIA 3ZEAA 1SD2A 3L41A 4MR8A 2RCNA 4MV1A 3UV7A 1K5HA 3Q1LA 4JJFA 4FJ1A 4RM2A 2BOVA 2B7CA 4F21A 1E18A 3B1WA 8ADHA 2FE4A 2FDRA 4Q37A 2CJXA 2RHBA 3A1DA 1WV1A 5K3AA 1MGPA 3ZD6A 3U60B 3AI1A 4AY3A 4UBKA 2ZJ8A 4LUCA 3BOSA 4O8CA 1DO0A 1NAIA 3WKCA 4Z1MD 2MYNA 2QQEA 1RAFA 1D6MA 4Z5XA 4J76A 1H6BA 1X7XA 2OB2A 3GRUA 5HIAA 2E4AA 4J0IA 4TKUB 1GO2A 4M9SA 5J23A 1M54A 1XDZA 2BSXA 4NBTA 4M0KA 3E9CA 3HFJA 4IIJB 1M34B 4ZVSA 3IALA 1KWGA 2BWJA 2MJLA 2YV5A 3R7BA 2F6RA 2HHLA 1KEUA 4TTQA 4XX0A 1W2WB 4CF3A 1MVLA 4V2IA 1HYQA 4KXWA 3HZZA 3ZU2A 4NEQA 3UXYA 5LXTF 3AKEA 1YB2A 4WBNF 3NEPX 4NBKA 3Q5GA 4WNCA 1MFZA 4P3KA 1CIVA 1YIAA 4N3AA 1SWWA 3EGEA 3F6SA 3HUFA 4WA7A 5KC8A 1JWAB 2FF5A 4D8WA 1PNQA 1QGAA 2ZRAA 4DFDA 1AS3A 1N3YA 1P4GA 5H9VA 1RI4A 1Z0IA 1L9XA 3KIPA 4KO1S 1EFPA 1ZJ6A 2R79A 3QV1A 5CT8A 3C6XA 5EIEA 2P4SA 3TGPA 4KVZA 3ELUA 1AIPA 4V0OA 1ZJYA 3V8VA 2GPYA 4X66B 1ISPA 3C98A 4YWHA 1H4SA 4X7BA 2CHQA 1OU0A 5EEGA 4MZXA 1JEYA 4H1HA 4I8DA 4BLOA 4WLFA 3PRKE 1GSAA 2FPIB 4WOKA 2Q29A 1YGYA 2CW5A 3AJ9A 2YDXA 3AVPA 3FDFA 3ILYA 4J7XA 4PTZA 3WMXA 3VR1A 4JWKA 2D2IA 4OQQA 4AJPA 1CJBA 1Z0KA 4NL4H 3KEGA 4YLEA 1KBOA 1MJHA 1OVGA 1ZWKA 3LX5A 4JC0A 5H81A 4L0QA 3WRWA 5JXGA 2C9ZA 4GKBA 2I33A 1GAWA 5AK3A 4ZO7A 2FMUA 1DT3A 3FTCA 3B6IA 4UAUA 3PEYA 1W94A 3PUWA 5FFNA 4XIJA 4TM8A 4OB6A 3TSCA 5B3LA 5DF1A 2HV9A 2CXOA 1M72A 1UM8A 3D7MA 3Q10A 1JQ5A 5B36A 1V4BA 1RZRA 2ZWIA 1VL0A 4BFVA 1T3ZA 1GL3A 3BWMA 2WJPA 1TUIA 3QEKA 2VATA 4FYHA 1HG0A 3ZV7A 3BIFA 2UU9B 1NJ6A 1A2KC 1WEHA 3G82C 1EHCA 3KPUA 4FDUA 4LV8B 3WYGA 3V33A 2XE8A 3ZJ4A 3AM3A 2XADA 4V3BA 4ZAFA 1M8GA 3U3JA 2ZQ5A 3R74A 2DFVA 1XTVA 2RGBA 5KO2A 2G25A 3CH4B 3QIAA 5IMSA 2X6QA 5DMHA 2HMUA 2QY9A 2YOGA 3L0BA 2X9NA 1YXMA 2VWHA 5ER9A 4BGIA 2R7AA 5ITVA 1IDN1 3OT1A 4X65B 3QPBA 4F2DA 1DNPA 2GLTA 1FFEA 1NVDA 4MGIR 3WDMA 2LGJA 2F9FA 1H3NA 4B83A 2X6RA 1P74A 1QOPB 5AVZA 2P6RA 1IY2A 3D7LA 3DLCA 2Z09A 4R1TA 3ZQUA 5L3VA 3LVBA 4FT2A 4IINA 5SZKB 2NSYA 1X13A 2C9BA 3DCYA 4IILA 3AP2A 4O6VA 3E1KA 2XBLA 4B09A 3EASA 1WD5A 1E3TA 4ODIA 1QLHA 3RU9A 4M98A 1ES9A 4OQYA 1IM2A 3IT3A 2FN7A 3KKKA 1JZQA 2Q2WA 3QVGA 1RHRA 2FOXA 3AL3A 1DAMA 2ZIZA 3OQBA 5KREA 1JPVA 1IXKA 1K7EB 2AF3C 3M1IA 3KP1A 4MS4B 5D3MA 4HFJA 1GIAA 2H7YA 4IRUB 4EZBA 4EQ6A 1QHFA 3UCXA 1D1SA 1XXLA 2X8AA 4QYSA 1Y1TA 3BWEA 4IZIA 4EF5A 2PZMA 3A9WA 3G2LA 3AJEA 1PQWA 1E6WA 1RXYA 3GGPA 4QWWA 4CNQA 3IBFA 2QRVA 3G2QA 1ZH4A 2O50A 1REQA 1SBQA 4XVHA 1Y9JA 4YV0A 4RQBA 1VKHA 1W8DA 1ZMBA 1UODA 2WWTA 3IVCA 4UFNA 4L16A 1R8JA 4BQRA 2VPIA 1NUUA 5IT4A 5BYKA 1ZVMA 4FFBB 1VBMA 3IT2A 4F3RA 2JGMA 1D04A 2NZJA 3TZEA 3C14C 4C2BA 4PHHA 2QMQA 2HLHA 3HABA 1PJRA 2X4LA 2BGNA 3FLEA 3FYTA 1BQ4A 3V48A 1PP4A 2OM2A 3RNLA 3EQ6A 4LISA 3S68A 1IUOA 1N0VC 4B6SA 1Z9BA 4D4JA 4JCOA 2AT1A 4CIBA 3DHWC 5L3QA 5AI9A 3L0PA 2JLRA 3ANMA 2UUPA 3VV2A 2XMZA 5TQ0A 4MO2A 1YS6A 4WQMA 3I5AA 4X3OA 3EZ6A 1DBQA 3HCNA 4LHWA 4P0TA 4G4SP 2GR9A 1SZCA 2QRZA 1YQGA 1D09A 2P9FA 2R00C 3NNNA 4NRDA 4QBKA 4QQFA 4UEJA 5I01A 3CRQA 3PXXA 4NCAA 2ZVJA 2QLLA 5DI9A 4AMZA 4BX9A 4PSUA 1SVNA 2OQIA 3A6FA 1T4CB 4AY4A 2HA0A 4JITA 4P33A 1ZIPA 1ZN7A 2ODEA 4FCVA 1ZN8A 3SHWA 3H19A 5JTTA 3SFVA 3H1TA 5DYWA 4YCSA 3WWOA 2ZIWB 5IT0A 5LXTA 2DLCX 3CH6A 2X8JB 4GX5A 2B21A 4Y2HA 3QNWA 5FWXA 3QWHA 1S2DA 4AJIA 2PEYA 1DUVG 3ABOB 4O1IA 3H1EA 1Z6PA 5FOTA 5J5VA 2P67A 1QUEA 1I7NA 1L5QA 1N6HA 1B2LA 4AG6A 3AF6A 2GM4A 1R4NA 3U6BA 4PGGA 1L9KA 3TXYA 4ZPJA 2A30A 3ZXYA 4ZANA 2NT4A 3IPLA 4PLWA 1BKYA 1QR6A 4ZN6A 2ZS7A 3W5DA 3DHNA 4MITA 1AGRA 3ZCQA 1XQWA 4RZUA 1M0WA 1RQPA 2E2WA 5CFMA 4MVJH 1JR2A 1N0HA 1MBZA 3CT6A 1ZC4A 5ALHA 2ROQA 3NHMA 2E87A 3VR4D 1VCIA 3CN9A 4M21A 4D7AA 2YCLA 2BDEA 2YFHA 3G5TA 4N5NA 5AVOA 2VBCA 2XBUA 1L5KA 5CD1A 1AGYA 1NF2A 4R81A 2GVNA 3U4GA 3W5VA 1R15A 1IY8A 1HRKA 1L5SA 1XCPA 2R5NA 4KKVA 1P1IA 4RJIA 4TV9A 1GQYA 2VRBA 5FI5A 1YI1A 4CEIB 4LAFA 1A9SA 2JCGA 1XIVA 3BPSA 3GJQA 1N2EA 3IR5A 3NYQA 4WZZA 4XQ9A 4F2WA 4FUQA 1A4XA 3EVGA 3N86A 2R2AA 1UOPA 4ZU6X 1KZYC 3G13A 4LV5B 2Z5LA 3KZNA 2Q4EA 5K3SA