4UHKA

Crystal structure of the receiver domain of cpxr from e. coli (phosphorylated)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
130
structure length
129
Chain Sequence
NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Structural Coupling between Autokinase and Phosphotransferase Reactions in a Bacterial Histidine Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 45
structure length 129
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhkA00
5TPWA 1L5YA 3O21A 2IOYA 4XXHA 3BRQA 4WUTA 4WXMA 3HZHA 4LZLA 4PZ0A 1YVUA 2LP4Y 3EDCA 3Q7TA 2MSKA 5T7BA 4EGSA 3FFWA 3KCNA 3C3MA 3OLVA 2ID7A 2JVKA 5HQJA 4PE5B 1ZGGA 1RNLA 2H0AA 2L18A 1M5TA 1A0OA 1B00A 4RS3A 3A0RB 3NBMA 1RXIA 3BILA 1VPWA 1DP4A 1EFAA 3HXMA 4MR9B 1D1PA 2YHAA 3S99A 1SD5A 4FB4A 2X7XA 7ABPA 3H5IA 2E4YA 3HDGA 1NXXA 4MS1B 1MVOA 1YS7A 5D2CA 3H75A 4RDCA 2E4WA 2JRLA 1ZH2A 4MS4B 2W42A 1P8AA 3C3KA 2H3HA 2IPLA 2R4QA 4HYEA 3SAJA 2FLKA 4Q6WA 3CLKA 4MQFB 1ZH4A 2QU7A 3BRSA 2N9UA 3HS3A 3KLNA 3N0RA 4RU1A 4WWHA 2O20A 5IC5A 5EWJA 4G86A 3VNBA 5JNWA 1USGA 4Z4FA 3RVJA 4XAQA 3GL9A 3QLUA 3SG0A 2B4AA 3T38A 2NUBA 2CHEA 1ZDMA 5BR1A 1JFVA 4JA2A 2WMYA 4E7PA 2QVCA 5T3YA 4MYRA 1J56A 4ZMSA 2MYUA 5TQ0B 4P1ZA 4OLAA 1Y1LA 2M98A 3ILYA 3W9SA 3IDOA 2NT3A 4UHKA 3I42A 3N75A 4MGEA 4OATA 4JB2A 3CFYA 3I09A 4MRMB 3H1EA 1XHFA 1CEYA 4IF4A 3N6VA 5TPWB 2AYXA 4D6YA 1USKA 2A9OA 3JPWA 2RJNA 2FN8A 2PJUA 1VKRA 2QV0A 3SNKA 1AB6A 2P4UA 2GX6A 4OBBA 3MYYA 4HNSA 3HVRA 2ID9A 3SQNA 1ZESA 2FMKA 1JX6A 2FQXA 4HNQA 1DBQA 4MR8A 2FLWA 3IP5A 5GQSA 3FDFA 4XASA 3OQNA 4ZYLA 5C5EA 4F12A 4LX8A 2FVYA 3EQZA 1USIA 4FE4A 3HV2A 4ZJPA 5EWMA 1EWVA 2NZUG 1A04A 3LKVA 3QEKA 3DLBA 1FFGA 2IPMA 4HNRA 4WT7A 1RZRD 2RJOA 4MR7B 2A9RA 2M1ZA 3CG4A 3HUTA 5JNVA 3FFXA 2QVGA 3RVOA 1YIOA 1Z17A 2FTKE 1Z2DA 2PLNA 3OLWA 4JAVC 3BREA 3LUJA 3OQOA 2PUAA 1M5UA 3VNAA 2PL1A 4RK7A 2WY2D 2GI4A 1ISRA 4MS1A 3JTEA 3KHTA 4F11A 2GBPA 4YV7A 1APBA 4MS3A 3CTPA 4MS4A 3UKJA 5FWXB 2QXYA 2QZJA 3H5OA 4W5NA 5CHYA 2PL9A 3EJWA 3N0WA 5IUJC 1LBIA 4IMJB 1NXSA 3EAFA 2HSGA 4PYRA 5B3JA 2HJ9A 1QNLA 4Z4CA 4H3HB 5GOTA 2LBPA 5I4CA 2PUCA 3Q9SA 1M2EA 3K9CA 3R0JA 2FQYA 4LRQA 1NXWA 5IBQA 5TPZD 4YCSA 1QQBA 2PUGA 2WRZA 3QEMB 4P98A 5KQPA 4F8JA 1BDJA 2MSLA 4W5QA 8ABPA 2CD7A 3UK0A 1JDPA 2E4ZA 2A9QA 1HEYA 2FXIA 4LE1A 4E7OA 4KK3A 3L6UA 1PEAA 1DC8A 2QR3A 3QLTA 3JS5A 4G0QA 1E6MA 2R25B 4MR8B 1DC7A 1DBPA 2PKXA 1TM2A 1P6UA 1RXEA 2FEPA 3KTOA 3CZ5A 3LTEA 5JNRA 1SXIA 1TLFA 1F4VA 4RWEA 4NV3A 4GPAA 1D2AA 1FFWA 1D1QA 4H3KB 3RVNA 2E4VA 3Q7SA 5EWMB 3P9YA 3L49A 2JB9A 4RKRA 4RY9A 3A10A 3GA5A 4O1IA 5FWYB 4NCBA 5DLEA 2E4UA 1JFTA 3DGEC 4ML3A 2Q5CA 5EWLA 2ZAYA 5CNIA 1DRJA 2L17A 2LIVA 4MPTA 3O74A 4RK6A 3LUAA 4W5OA 3CRNA 4M88A 4N47A 4Z4IA 3M9XA 3HO1A 3NNDA 2V0NA 3OLZA 1NXTA 3CHYA 1PHRA 3EODA 2TMYA 3O2SB 2PE5A 4RXUA 3RQIA 5KC8A 4QYMA 2PAFA 1TJYA 4RXMA 4MR7A 1EHCA 4MS3B 1WETA 1SXGA 4EYKA 2IDMA 3A0UA 4YO7A 5HSGA 3HDVA 3E61A 4RSMA 1QO0A 4JB0A 3OMWA 1CHNA 4ETMA 2E4XA 3GBVA 3HM9A 3DLHA 4YLEA 2L2QA 4LDZA 1U8TA 3LUDA 5IEBA 3C3WA 3MQ4A 5FWXA 2JBAA 4IRXA 1YMVA 1U04A 1CYEA 1YK0A 4G0PA 4EVRA 3EQ2A 3N8IA 3E3MA 4EYGA 5KC9A 3OLYA 3FFTA 1PNTA 1TVMA 2WWVD 5C5CA 1Z16A 1GUBA 3KLOA 2BGGA 2OENG 1QPZA 3A3KA 1Z15A 4WZZA 1U2PA 3SM9A 3Q15C 3LKBA 1U0SY 3JVIA 3RVPA 1E6LA 3QEMA 4Z9BA 3MF4A 4GNRA 2NZVG 1ZY2A 2P9HA 1EWKA 3ROFA 1ZAYA 4Z0NA 1DCMA 2HQOA 3HUUA 1JHZA 1D5WA 2B1JA 1MAVA 1P6QA 1BDIA 3JVDA 4KNYA 1QP0A 4G0ZA 4G0MA 4KQ9A 4N03A 2FEWB 2YHBA 5BQ3A 1QMPA 5E3JA 2FW0A 1M2FA 4KFCA 1ZHHA 3KS9A 3N0XA 3CZCA 1FQWA 4QPJC 2JVIA 1L5ZA 2RDMA 2ZWMA 5EWLB 3TO5A 3OLXA 1BVHA 1AB5A 1GCGA 3QLUC 5PNTA 3LUGA 5BRJA 3QK7A 2JVJA 3TMYA 2CHFA 3H1FA 1Z13A 2L19A 3F6PA 5FWYA 4UHJA 3DZDA 4RK4A 2LPMA 1EAYA 1JDNA 3O1HB 3ROTA 1I3CA 3HK2A 4Z4GA 1VLZA 1K68A 3FMVA 5CNJA 4ETNA 3KKEA 1PNRA 2FMIA 1ABFA 4IGAA 3CU5A 4RKQA 1NXPA 4O1HA 3T8YA 2VYCA 3RVKA 4MLCA 4EUKA 4S05A 1Z2EA 3D8UA 3H1GA 2PMCA 5FBKA 1JLKA 1MB0A 4PICA 1Z25A 5CNMA 3KJXA 2JBAB 1IIBA 1DBWA 1ABEA 3QX8A 1KRWA 5TQ2A 5IUKC 1ZGZA 1JH9A 1DCKA 2MYPA 4NICA 4N76A 3C6QA 4XARA 1ISSA 4O5AA 3I45A 4RY0A 4OTZA 4YP9A 3QLVC 4ZPJA 4XFKA 1DCFA 4YS6A 3H6GA 4RY8A 1SRRA 1XWWA 3HEBA 1P2FA 3FGZA 2WJWA 3H5TA 3GYBA 3CKMA 3GT7A 3UUGA 5KQGA 2F8SA 3GWGA 1JYEA 3JY6A 1QQAA 5FBHA 3M6MD 1RZRA 4G0OA 1PEYA 1JL3A 9ABPA 2PUDA 1F51E 4Z99A 4TLLB 3DGFC 5DGCA 3I5AA 3URMA 1ZITA 4DN6A 1KMIY 1ZN2A 1NATA 5DCLA 4ETIA 1GCAA 3JPYA 1URPA 2MYTA 4G0XA 2HPHA 1NXVA 4PEVA 6ABPA 3EGCA 4MQEA 5JNSA 3IP7A 4KREA 2PUEA 3HCWA 4D74A 1DRKA 4N0QA 1DZ3A 4W5TA 3MIZA 1FSPA 2FN9A 1QO0D 2AYZA 4DADA 1LJLA 3O1JC 5B3JC 5TPZA 4ZMRA 2KYRA 4IMIB 5TE9A 3O2JA 1KRXA 5HM6A 3EULA 4N41A 3DBIA 2DRIA 3Q41A 1D4ZA 1TMYA 5IX8A 1SXHA 4QICA 1MB3A 1OXKB 4KZKA 5TQ2B 3LMKA 1DJMA 3NNNA 2CWDA 4JASB 2QSJA 1NTRA 2R48A 2F8TA 1PUXA 1NY5A 1LJUA 1Z12A 4KV7A 3HSYA 5DTEA 1XHEA 4KVFA 3RVRA 3GV0A 5KI6A 4KRFA 5JS1A 3HJFA 2J48A 3OO1A 1DG9A 3OM1A 1BDHA 1JF8A 3NHZA 4KMRA 4EYOA 1LBHA 3LUCA 1OXBB 3F7NA 3O2QB 3RVSA 4LDAA 3RVLA 4F06A 5TQJA 4KPYA 3F73A 3M9WA 4NCAA 2VK2A 4EY3A 5IULC 3O1IC 3QELA 3KG2A 1JWLA 3IP9A 3LUHA 3IP6A 3F6CA 4B09A 4EVSA 3G85A 4Z4HA 1QP7A 2FKAA 3CG0A 4MQEB 3TD9A 2WJAA 2RGYA 3ILHA 4EVQA 3IPAA 6CHYA 4TMYA 4YWHA 1U2QA 3RVMA 4N0PA 3H5VA 5HKOA 4Z4EA 1YK1A 4S04A 2JCGA 4DQDA 3KSMA 1QP4A 3H6HA 4L85A 4RK1A 4RK5A 5JNTA 5ED4A 3H5WA 3H5LA 5F64A 5KWSA 2IYNA 1GLGA 3KYIB 1C0EA 1E6KA 1H9CA 1BAPA 1KGSA 3G1WA 4L4UA 2FQWA 4YRZA 5CNKA 4XLTA 3CNBA 4F3TA 2JK1A 1YTUA 1ZVVA 2A9PA 1A2OA 4RXTA 1VRVA 3OO0A 3QLVA 1QKKA 3GBPA 3D02A 5JS2A 2IKSA 4YR7A 1K66A 3OM0A 1NXOA 3MM4A 3T6KA 2PUFA 4IILA 3LUFA 1JYFA 2HQRA 1Z18A 1MIHA 3CS3A 1UDRA 4FE7A 2I6FA 4OLBA 4LE0A 2FEKA 3B2NA 4RV5A 5ABPA 2MSWA 1E2BA 4Y9TA 3BBLA 2VUHB 4OG2A 4Z9AA 1YS6A 3GRCA 1JFSA 4G97A 1W25A 5KQMA 1GUDA 4MR9A 3IPCA 2XDYA 3KYJB 3OMXA 3LFTA 3QX9A 2FSPA 5EWJB 3C97A 2LUOA 2R47A 4QYWA 2FMFA 1JBEA 3QELB 4Q6BA 4W5RA 4JP1A 3MMNA 1Z26A 4WXEA 1T34A 4KK4A 3TB6A 5JNUA 2OQRA 3LOPA 3K4HA 2HQBA 4MQFA 2MYNA 4CBVA 1FFSA 3LUKA 4MLDA 1R8JA 5DKFA 1BA2A 5IUNC 1YMUA 2IPAB 2IPNA 3N53A 5IEJA 3O75A 4JOQA 3SY8A 4EYQA 4RK0A 3RH0A 1RPJA 4MAAA 4D6XA 3NHMA 3OQMA 1S8NA 2FMHA 4KQCA 4TN5A 4TLMB 1LK0A 5KQLA 3RVQA 3TX6A 1C4WA 3NNSA 4RZSA 4Q7EA 5TQ0A 4LE2A 4YGXB 2GWRA 4H60A 4G0YA 1W9HA 2PUBA 2WB4A 1EWTA 2VUIB 3Q7RA 4MRMA 4NQRA 3T95A 2QW1A 3MA0A 2NT4A 5BRAA 2GKGA
chains in the Genus database with same CATH superfamily
4QFMA 4U0KA 2B1IA 4Z49A 3I0ZA 2VPWA 1XKLA 2NVUA 5DDIP 5I3CA 2WU3A 3A2LA 4HQKA 4EPRA 2QE7D 3NZEA 3IB3A 3IE1A 4CEIA 2A9JA 1O03A 4GH5A 4WACA 1Z0IA 4CM8A 1C8LA 2FF7A 4PSAA 4JHLA 3PGKA 1E5TA 4QG3A 2A1UA 3GRPA 1L5OA 3M6WA 2HDHA 2RBEA 4H7PA 2ZYVX 1RZVA 2WYHA 3F47A 1BMFD 1G8SA 4CDRA 3ZE1B 3I1JA 5LLSA 1I6LA 3OE4A 2J9RA 1BWSA 1E79A 5F73A 2ZBGA 3AXTA 1JTEA 4MW9A 4DQ0A 3P9CA 3I04A 3OX3A 1C9DB 4QAQA 5IYZA 2Y4NA 3EEFA 2GEVA 2H4ZA 3K70B 4CPDA 3JWJA 1L1QA 2BDEA 5D2CA 4Q9KA 2OD7A 1UKZA 1Z2OX 4NENA 5T57A 2D1SA 4AS2A 4FBGA 1Y4AE 2VZ9A 3ZVNA 4MQFB 4OGWA 3RBXA 2I2WA 2I6XA 3KJEA 4R98A 1E2UA 3OPXA 4WWHA 1NAIA 3I64A 4A26A 4DQVA 1STOA 1VKZA 3HA7A 3PFKA 5DBHX 1GQYA 1R8QA 4XAQA 3RVJA 3U81A 3C8HA 5IJ0A 2I55A 2OCIA 4G1VA 3IQIX 2V5UA 3HRKA 1F5SA 2O48X 2Z2ZA 1JFVA 1ZYUA 4LDRA 1K92A 3UMJA 4JS0A 2MIIA 1QZZA 3DFUA 3EPRA 5DHPA 3TDKA 2LCQA 1KDZA 4P1ZA 3D6NB 3JV7A 1N1DA 3NIFB 5A2GA 4WRRA 4NBWA 4QJ4A 2CMDA 3F5MA 4WADA 1W48A 3SS7X 2QRZA 1NA5A 3HV0A 4G1FA 2NAPA 4H7EA 3I76A 3TOCA 4ABTA 3GLFA 4UM8B 3O82A 3PC3A 2DTEA 2VKQA 3R8XA 1MB4A 4JGIA 4C7XA 1H2WA 1E1RA 4JLMA 5DULA 3NYQA 2FN8A 2BGTA 4N9QA 4X0EA 1SO8A 2X3UA 1VKRA 3CT6A 4C7MA 1U80A 4UUPA 3U3XA 8AT1A 2B69A 2C59A 1OLSA 1GLVA 2IRWA 3OIFA 3WGZA 1Z08A 1CQPA 2SKDA 5ED0A 2O50A 3RADC 3NAGA 3NI2A 1ZUHA 3WJ2A 5GQSA 4URHA 4BX0A 3W6UA 3PUIA 4XASA 5LSAA 4M1OA 5IDYA 3RE1A 2E55A 2JFOA 2V6BA 2ZITA 2ODEA 2ALJA 5JU6A 2C98A 4HRVA 4Q4JB 4FE3A 5B2EA 2AN3A 1EWVA 1ADCA 1R0WA 2X0FA 2IIBA 1W88B 3E3NA 1X1SA 3TRFA 1NT2A 1XA0A 1A69A 1XDGA 3GGSA 4NJEA 1ZWLA 2IPMA 4DABA 4EHHA 3K9FC 1ZRSA 5F52A 1RZRD 1QU2A 3T0GA 1DNPA 2J3EA 4Q1EA 3GZNA 1A2KC 2M1ZA 5CCXA 1H1DA 4TS4A 1ODCA 2YASA 1JYSA 3CLRC 1Z2DA 4OLJA 1MABB 3KFXA 1Z6QA 2VHEA 2FN3A 2WWWA 1FVOA 3C45A 3WWZA 5BSKA 2QV7A 4YR9A 5I51A 1IEWA 1RCUA 4RD2A 10MHA 3BWVA 5FLXA 5TLSA 1NQUA 3MRXA 4F8EA 4ZVOA 5D7NA 2F59A 3PIRA 1T1EA 4PHGA 3V33A 3OCZA 3TLGB 4PBRA 3ZI7A 4ZGGA 1IAVA 2F1IA 2QDKA 1OV4A 2IYYA 3ICPA 3MOIA 2FDRA 3DT6A 4ZHQF 1B2RA 1U1IA 4IJWA 1GZHB 3WYGA 4PYRA 5EE0A 4OFXA 3RAEC 4LWPA 2PY6A 4Z4CA 3B48A 5JBNA 1P44A 5F77A 4YUAA 4AVYA 3AG5A 3ZBUA 1ZK1A 2PXCA 4EG6A 2PUGA 2Z8YM 4WKGA 3RSOA 3D59A 5K3EA 2O7VA 3HVHA 1Q95A 4QFBA 4RTKA 3VGPA 2WG2A 2XODA 3EB9A 4LBVA 1SELA 4RV4A 5C3UA 3RQSA 3WZ2A 3VZDA 4X66B 3CLTC 4JJIA 3M2TA 1BDBA 3OQPA 3ZR4B 4FD3A 2HMYB 3SSNA 3D8NA 4YAWA 1E6MA 4MR8B 3DBHB 2A0YA 3H8VA 2GPTA 2HXGA 3D3NA 4KX3A 4GVXA 5IYZB 1IG0A 5DXAA 2R9VA 1E1CA 5H83A 1XL1A 3DG9A 3ZE9A 1M7HA 1KAQA 4RVCA 2AKAB 2AEMA 4YFVA 3Q7SA 4PQYA 4Z4QA 4HMOA 1BFKA 3GARA 3OOWA 3BK7A 1LS6A 1KL7A 1Z37A 2CDNA 1GIAA 4FHEA 3W7VA 4BNDB 2FY8A 1UXOA 2I4MA 2Q5CA 1NHWA 1U9JA 3GXOA 3TSYA 2ZAYA 2OHXA 4JDPA 4EI8A 1WXGA 1DRJA 3I4LA 4GL2A 4BQQA 1KS2A 4FNAA 3KOZA 1KS9A 2OXCA 3TR6A 2W2LA 3LPMA 2CL6X 3GVHA 3VOSA 4K6KA 4CUJA 1QE0A 1PFYA 4WCFA 1P3JA 1LFAA 1YQ9A 4Q82A 4OI1A 5KC8A 4BNWA 4MULA 1D2GA 1UOQA 1U02A 4IINA 4MR7A 3V8RA 3PGA1 2OT3B 1ZL2A 2H92A 2ZT5A 2HMVA 4J43A 1YI0A 4MWBA 1N2BA 1N2ZA 1A8PA 3ZBTA 4ZCMA 1GZVA 5KVVA 4HN9A 1JQJC 1Z7WA 1Z4NA 2I2BA 1ZWKA 2WTMA 3IVCA 4M1QA 2OC9A 3W5IA 4OGKA 1T36B 3WAKA 1RZUA 4JXXA 1M83A 3NASA 1FVHA 2D5IA 2XT0A 4HBZA 1U8TA 2ZYIA 5IEBA 1LKZA 4NYIR 3PHBE 2NU6A 1CNMA 1YMVA 2RK3A 3FZEA 3Q10A 1TPYA 1DBVO 1YQEA 1X7ZA 2XRYA 5B4VA 1UBOS 2B0JA 1RQPA 3BMNA 1SG6A 4G07A 2O5EA 4GR4A 4PG6A 1NDHA 3DE0X 2D2IA 1W6UA 2RAVA 3ZY2A 1KP9A 3KP1A 3FWPA 1KFBB 3LHFA 4TV8B 4R83A 5AYVA 5AJXA 3LKBA 4RPGA 4QO7A 5AQ1A 2H57A 3QEMA 4NHOA 1FYVA 3IBGA 1ZAYA 1TU4A 3MTEA 2DQKA 4C6HA 4L3OA 3M7IA 4GYWA 5DCUA 3ZUPA 4DNQA 1TEHA 3FNIA 2AEEA 4ZCTA 3AKCA 2JHGA 2OUKA 1L4YA 4EBFA 2H1OA 4O25A 2QYTA 1C1XA 4HZUA 4OA5A 1OFVA 5I7UA 2NTVA 4E51A 3G68A 3ZXUB 1B73A 3FNQA 1D03A 2H2GA 3TLBA 1ACLA 2ZI6A 4KN6A 2L42A 5HCUA 3FBGA 2YOGA 3RSGA 3KUXA 2FJUA 4O4JB 4E2FA 1R0CA 2ZSAA 4JBXA 4CLOA 5JYEA 1MQSA 2C7PA 3OHSX 1Q7RA 1XMOB 3W34A 1IPFA 3FLAA 1LSJA 3BZWA 2QMUA 5CEJA 1JR3A 1MH1A 4JOSA 3TTXA 1FMFA 4Z4GA 2Y1LA 3IMGA 1TZKA 4AIRA 1XZHA 1QWSA 3UMBA 2YZ7A 3A1VA 3R5XA 3IA2A 1JP7A 4KBFA 3T8YA 2A5YB 1PE0A 4JODA 4MLCA 1CRLA 3NAMA 3T12A 1CUUA 4R6XA 5BNFA 4DW8A 2EKBA 1UADA 2PMCA 1C1DA 1MH9A 1MAWA 3C1OA 2R6AA 4YPOA 1H8HA 4HYYA 2JBAB 4M1KA 5KDDA 1DBWA 3OCYA 3UJ9A 2ZETA 2K2WA 4AMGA 4LJ9A 1PFKA 4LTNA 4UREA 1F0KA 3ZDRA 4AN4A 2HEGA 4NE7A 4YRGA 4Q93A 4XCXA 3T9DA 3G8DA 4G8JA 4FEEA 5D87A 2GPSA 1ZQ9A 3I2JA 1Q7CA 3WMEA 5BWCA 3AINA 5BWMA 4MCJA 1NNLA 1PJAA 5FJJA 4L0QA 5A4FS 1QCCA 2JJ1A 4KX5A 3UT5A 5L7WA 3OZTA 3A05A 4KC0A 3UOWA 5F12A 3FCYA 2VP6A 3IMKA 4RL6A 1XZQA 1ULHA 4Y2YA 5DWQA 3GN2A 1QB8A 1XVLA 3EXFB 2OFFA 3SBEA 5HUQA 5BVGA 1LLDA 1PEYA 2REOA 2QD4A 4Q9NA 5JZVA 3ZDEA 1Y8RA 3ABZA 5HTKA 5F51A 2P40A 3HFJA 3STXA 1IBMB 1WHTB 3DAPA 4AIIA 1ULUA 4C5AA 4DLBA 4DN6A 4MVWA 3PPIA 4PGFA 4PU0A 5EPEA 3ADBA 1U1CA 3KXPA 1IZ7A 2B83A 1MEEA 3INRA 3ZE2B 2Z5GA 2W98A 1BE1A 1IY9A 2R8YA 2ZYHA 1TO1E 4J16A 4NRDA 2HWWA 2G9VA 3MC1A 4S1WA 4XJSA 3ZE6A 4EJSC 1I7LA 1GQQA 1OGIA 2Z6QA 1L7BA 4MPDA 3C5HA 5BN4B 4IH4A 1GN9A 3RLFA 2XQFA 3UHJA 1XHLA 4MTLA 1XWFA 5D7BA 4DLYA 1P81A 2YQ4A 4IMIB 3VC2A 2EW8A 1B3BA 3FUVA 2VXCA 3M4ZA 4TQ9A 4ENRA 3QQ5A 4IBOA 3DBIA 3UG7A 2DBQA 3L0BA 5L9AA 2ACWA 4CEHB 1AM4D 4MIYA 4X3OA 2XMZA 2I5PO 1M2KA 1OXKB 2GF2A 4DWWA 4Y1GA 5HM8A 2D7DA 3ZK7A 1AJEA 4M76B 3WRYA 3K0CC 2OESA 1T3SA 2Z3WA 1Z5ZA 1NLYA 3DKIA 3VV3A 1PVDA 2CB0A 1O97C 2WP0A 3ZD6A 4OX9B 5AVWA 3C48A 9ATCA 1DDOA 4TVKA 5DMXA 5BSFA 5KU1A 4GPD1 1UPFA 1QIJA 1SC1A 4D3FA 4RQBA 3WGHA 1Z4IA 2HMAA 4JBLA 4PIVA 5JG7A 1Z0SA 3B1XA 4F91B 4BKMA 3BAZA 2H4YA 3L92A 4HLCA 5DWDA 1U3FA 3IUNA 3AG6A 5ECYA 3VU0A 3A9CA 3KZ1E 1WY5A 3PXGA 4ODIA 4H9GA 2DR3A 3G17A 1N33B 3NOVA 1NSFA 1F2TB 1Y81A 1Y98A 2UZ3A 3D5QA 3NIBA 2R5WA 5CDFA 5GMOA 3V48A 3EA5A 2HSWA 4LYJA 1Y8AA 4OHKA 1JLRA 3HR7A 3OF3A 1XCJA 3IP9A 3B85A 3PNKA 3F6CA 4K87A 4OVKA 4X1KB 1WMBA 3DEIA 5KAMA 4B09A 4MQEB 1KI2A 3CG0A 1X7DA 2AFHA 5IXJA 4E5DA 4F2GA 2BE7A 4F21A 5LXTB 2P2LA 3EDMA 2OP1A 4U5QA 3LGSA 1N2JA 4HQRA 3EJ6A 4P5EA 5K6AA 5LD2B 1TA0A 4NZMA 3A04A 3NHUA 4YJKA 3FCSB 3KTAB 2QE6A 4GMKA 4MKGA 5AVOA 2FZEA 2VN8A 3ZQ6A 2EF1A 2Q8QA 4J3NA 3BTOA 4CHTA 3K4PA 4Q4CA 5ADHA 2V9ZA 5CVJA 2IEAA 3ZHBA 4DQUA 1X6VA 1ENPA 1VJ1A 3JYOA 1H93A 4R3WA 1BAPA 5JMOA 3DKPA 2NMVA 3SHVA 4ALJA 4CLDA 2I7CA 4TV9B 1A77A 2GPYA 3VZBA 5A7FA 2IX9A 2Q2VA 2X6RA 3I1IA 2M6LA 3UJ6A 4G84A 2LWIA 5ITWA 3R5JA 5JZOA 4IWYA 4DCOA 1YB1A 3KM0A 3Q40A 1CRWG 1K2WA 3A37A 2ZRLA 2ROQA 1BW9A 3LL4A 4GKAA 4PRLA 2R6CA 3AQIA 1IJEA 1BH6A 2RIPA 3FDZB 4C5CA 1R6AA 1ZG3A 2RGNC 3DXYA 3WLPA 2NNLD 2JGFA 2P9YA 3GAFA 1T9ZA 3FTDA 3G9XA 4R51A 4M0MA 4ND6A 3U4MA 3RKSA 1USVA 4DV6B 4Y9TA 2EERA 1F0NA 2NXJA 3O8DA 4L4SA 4QSHA 2O2XA 3FMOB 4X65B 5IT9A 2NYRA 4N49A 4P3XA 5G4KA 4LBWA 1CIVA 1XCGB 4ZC1A 3WXMA 4OM7A 5KYTA 3PVSA 5MGNA 2FSPA 1P4GA 4HAZA 3G2JA 4JCCA 4A23A 3IR6A 1IZ0A 4F1WA 3A6LA 1YWGO 2UVPA 2BGNA 4G25A 3QELB 2BMEA 4YDRA 3GUVA 5CUQA 5JCOC 4GXTA 1NAHA 3R3YA 3V42A 1JT2A 1BGWA 4IDDA 4ICIA 4HDNA 2HQBA 1B15A 5FQOA 4FC6A 4QDXA 2RAFA 3RYTC 4AL4A 4ER7A 4WHMA 1U0EA 1JJVA 1U3WA 1YB2A 3QX7A 2GLUA 4OB6A 2G88A 2PRKA 5DKFA 5AUQA 3HABA 2NQ8A 3VYRB 3WFZA 3E2IA 4UTNA 3KFVA 3IGFA 4AC9A 2E85A 1VLLA 1GARA 3HXOA 3ZD9A 4EYQA 5FUMA 3ETLA 5A0TA 1KJZA 1OILA 2JKZA 3DOHA 3SHWA 3VR2A 5BYKA 3FFAA 4GR5A 2WAAA 3PR3A 1UT6A 4RGBA 1U0TA 4KI7A 1Q50A 4TKUB 4AMBA 2NWQA 3NTLA 5HVNA 2GD2A 2VDNB 1JVBA 5EP3A 1H8ED 2SECE 1GNPA 5BV1A 1R9MA 2WB4A 3EWSA 2GFHA 1HG0A 3WGNA 5A02A 3I58A 4OP3A 3UOGA 3ICEA 4YRNA 4DLWA 4R9VA 1PD1A 1OXXK 1CY2A 3FNEA 3QWHA 4Q66C 1G5RA 4W1QA 4L8YA 2B3TA 1FDWA 3DPIA 5JASA 1WMAA 2XUFA 3F4LA 3IHLA 3X1KA 4BFXA 4MV5A 4UUMA 2SICE 5KTMA 4OQYA 3FJ1A 3T5CA 1L5MA 1GGNA 2VC2B 3Q4GA 2BMFA 1X1AA 2F8LA 4EGSA 1GITA 2HIAA 2OAP1 2Q6IA 3OLVA 3PKZA 4RPHA 4UMFA 1NDQA 2JVKA 3T4EA 1SD1A 3VGJA 1YH3A 1OIXA 1ZGGA 4MWEA 5C81A 1WW3A 2Q6OA 2NZXA 4UPEA 1ZNQO 4REOA 1PUJA 3HBAA 2HFKA 4GP7A 1M5TA 1AKVA 4Y2HA 5HIMA 1T1JA 3ZK9A 2CHGA 2P9EA 4GKBA 5CAEB 1DP4A 2BL4A 2BLNA 4ZDIA 1U2SA 3DAGA 2DFVA 3BERA 4MR9B 5CA1F 4XVHA 2EWVA 4PZLA 2Q5OA 3E2MA 3EN0A 4E2YA 1ZD5A 3KU4A 5EXPA 1OI3A 4WV3A 3COWA 5EHGA 2JRLA 1SBHA 4JR0A 4CQLA 1IZ9A 2JJQA 4HYEA 4TS1A 2PKCA 3CUWA 4WBNA 1F5NA 1VECA 1J8FA 2JI7A 1PTJC 4GMGA 4RA6B 5BSMA 3KIPA 5JRJA 3KFLA 5FL7A 2B4AA 1KI8A 2HQ1A 2QI9C 2VYVA 1H05A 3OURA 5HJ5A 4OXIA 4BV9A 3NU1A 1ONNA 1WE2A 5DNEA 1FFCA 1GPAA 1Y82A 1EEHA 2NM0A 1R0XA 1FU4A 3I9OA 4PX9A 4Y1RB 721PA 1JG7A 2ADOA 4MYDA 5TQ0B 1O0BA 2CXSA 2EP8A 4EJFA 5A5VA 1SIBE 4OLAA 5EHZA 1OWMA 2C78A 4M9SA 4RDHA 3LQFA 1EDZA 1HLDA 1WCXA 1W8IA 2JCBA 3K0SA 2ZJ1A 3RJMA 2Z0MA 1GG2A 4LIPD 5H9VA 3FB4A 1NBAA 4ZOLF 1LC3A 1ZM9A 4IHKA 3N8DA 3FYUB 4EY6A 2G28A 3L7KA 3JPWA 2BONA 3QKSB 2C5SA 3BL5A 2QV0A 1THZA 4KXXA 4REQB 4U7GA 1JEEA 1Z5UA 3BXEA 2CJXA 3CYFA 3V32A 4M0DA 2OYSA 2W2PA 3C3XA 2YBDA 3QENA 1D4OA 2ID9A 1ZESA 5SICE 4L72A 3WADA 2EKDA 2XQVA 3NALA 4J1TC 1QSGA 4AQ7A 3GPDG 3I52A 2ZR7A 2CBZA 3N2NA 4PYQA 2ID8A 1JGTA 3IP5A 1X74A 3CLUD 2Q5FA 3T9BA 4RTQA 1V3TA 4OFZA 1UDCA 2HF9A 5I9SA 3U31A 3QJYA 1HE4A 2ZYUX 3HCOA 1F4PA 2ZUBA 4BRSA 4PLTA 4LXQA 3PDWA 3LT0A 5HS6A 3R6TA 5WRFA 2PGJA 3GPCA 2RH9B 1IUOA 1R88A 4N0DA 2FKNA 1IB6A 3EXHA 3H0EA 4PIMA 4X5OA 5LP1A 2ASVA 3KLPX 2X2PA 3PCXA 2O8FA 4RKWA 4J3FA 4RHEA 4F2WA 5IKMA 5CVEA 5DNYB 1CETA 4LYAA 5A4KA 3IVMA 5JTUA 2ECOA 4BMSA 1LXCA 4GOMD 2AZ4A 4GPEA 4E5YA 3QYPA 3OM8A 3OPYA 4JBNA 3ELWA 4HEA6 2XYGA 4ZA2A 3R3VA 3E84A 2X1VA 3LUJA 4LXHA 1NASA 4URUR 1C7FA 3HMQA 1FMTA 4BNFA 1NQWA 3EBPA 2OQIA 1CERA 1WVIA 1M74A 1QLHA 3G0BA 3KBOA 5JWOA 3ESRA 1IK4A 1I30A 4Z9FA 1F06A 3Q3IA 1JI3A 1UEJA 2QXYA 2XVYA 3K35A 5K51A 5C8YA 5C2JB 5EJEA 5KNDA 3CNHA 1K75A 3SC2A 3EJWA 4RSHA 5ULLA 2ZBUA 2X5JO 3N2GA 4Q1CA 2FZ5A 3EAFA 2GD6A 3TQFA 4BBAA 4E09A 3AI1A 3ELDA 3LKDA 1EP1B 1LLUA 1WSBA 5E4JA 5T8KA 1IN8A 1W85B 5EOVA 4FCTA 4WXRA 3BSFA 3PPYA 2PZKA 1WVMA 1ZEJA 3B78A 1WSAA 3RJTA 3ANMA 5KQPA 3DMFA 3TIGA 4F8JA 5LLTA 1JAIA 1UBMS 4JEMA 3L5OA 3IAS1 4GSLA 1ITZA 3UK0A 2E4ZA 2QX8A 1AKUA 2YZMA 3AESA 4LE1A 1EA5A 1OYYA 3FNHA 4Y8VA 1ZGAA 1VA4A 1Q91A 1OVGA 5ICGA 1IHOA 2Y1EA 1ID1A 1ND5A 1RXEA 2YH2A 3JQGA 2WMOB 3KSZO 1NYRA 4M6WA 1U5AA 2B9VA 4LOLA 3VVBA 1RYNA 2CUNA 3VI3B 4B2IA 3II6X 3V4ZA 3ZZMA 1MQ8B 1ZVJA 4K1LA 3U61B 1QHHA 4KXMA 1Y8ZA 1LV8A 2WEKA 2E4VA 4QBGB 3S1LA 2EQAA 1K6IA 2C57A 3LOUA 2AOXA 3U1BA 3WQHA 1W0KD 1NUQA 3P94A 2ZJZA 4KN5A 1SUWA 1QQ5A 3V9AA 4AMYA 5C8VA 2H17A 3UEOA 1TLLA 1VIYA 3BOSA 3ISJA 2XRFA 1RAEA 1XRLA 1U0LA 4LDNA 4MMYB 4LYHA 3PLAE 1FUIA 1BC5A 1T5LA 4M88A 4TKLA 2WE7A 3R0ZA 4RF5A 1WY7A 3OBBA 1E2LA 3O7MA 3CHYA 4CL0A 2CXPA 3D4NA 1SUBA 3H7IA 3LK7A 4NCHA 4V02A 1Y1SA 1MAHA 3AOGA 1ZOSA 4NECA 3DLAA 4AYXA 3NHPA 4YRIA 1JSXA 4KB5A 5FEUA 5AVTA 1XMPA 1Q0TA 2Y0BA 4XEUA 2OMKA 2QXUA 4FGJA 3U6BA 4GKKB 4PHHA 4RZ3A 5B5SA 1EYZA 3J7TA 5ALXA 2AJBA 2V9PA 4ZT4A 3W5CA 2FYTA 2VHJA 1V6AA 1I5RA 4DCTA 2LKCA 4K8RB 3AVQA 3ZYCA 1QOPB 2Y1GA 3IEVA 2RIRA 3A6GA 4TYNA 4YLEA 2J5XA 1K6XA 1OXTA 2F48A 2EX0A 3ZN2A 3ZV7A 2RI1A 4TLAA 4DFDA 2NYUA 4DLVA 3TBHA 3QYJA 5D6NA 1THGA 3U6KA 2VRCD 2OILA 3U0BA 5I7HA 4KQEA 4ZVQA 4NJMB 1WTAA 2AC2A 5IVPA 5NLLA 1Y3FE 3IYLW 3LUBA 1OTYA 1E1QD 5FUWA 4HB2A 2OCBA 3Q3HA 4XJXA 3IJRA 4INOA 4PANA 4DMLA 2GEKA 1AZLA 4Z9BA 1E7WA 5P8WA 3R7LA 3H1TA 1EWKA 4DSNA 5AXAA 4Z0NA 4NBSA 5G3YA 4ZV4A 1MKYA 2HLDA 3HXLA 2I2CA 2C8JA 3M1YA 2OC4A 3UW1A 3L41A 4ZJZA 1NW9B 1EJBA 1ODJA 4C2UA 3ML1A 3FMFA 5AW3A 3MCTA 4Z5XA 3GMIA 2ACVA 1G64A 4DANA 4IGFA 1OAOA 4MQ6A 1AO3A 1QMPA 3KAPA 3MJCA 2IDJA 2G1AA 2OD2A 5D5QA 5G4LA 1GLNA 2JAQA 3OQBA 5FH9A 2OZPA 5KOYA 3KS9A 2GETA 2HO4A 4QELA 4TT8A 3L8ZA 4X94A 5EWLB 1EVLA 1VG0B 2X9NA 1KZYC 3PF8A 3TRDA 4UCFA 4BO2A 2QY9A 1K7FB 3E9EA 3C4QA 1P7VA 4KDFA 4KL8S 4EKYA 3RC8A 2HNAA 4EITA 4UXJA 1V4NA 2BWJA 2VIIA 4BAGA 2YNMC 2DQ4A 1JDNA 1P3DA 2HREA 5C9ZA 4E3ZA 1OH5A 3UQZA 1YBMA 2DKOA 3HK2A 1RAHA 4LQ4A 1XAJA 2V4ZA 1C7QA 1QQ6A 2G40A 3DZIA 3OFNA 4D4MA 4DJFC 2QX4A 3LTNC 4E70A 5JWHA 3RPEA 5HBRA 1SN7A 1E63A 1UZNA 2F3TA 1KPGA 2FE4A 1WF6A 2EZUA 2FPOA 3GLVA 4G37A 5T4HA 1ORHA 4FDTA 3OD5A 1JLKA 3EWIA 4IUDS 1QJ4A 1CZHA 4DDKA 3OX2A 1D6JA 3KJXA 4P80A 2EBWA 3UA3A 5LDHA 5EJIA 1P74A 3QX8A 4AMZA 2QBYA 4RD4A 1EQ2A 2AJLI 2H5IA 4FCWA 1EE9A 4YMIA 1QX3A 4HNAB 2WF5A 5ALIA 3N86A 2OV6A 4KH0A 1I1HA 2OHJA 5BO5A 1G0OA 3H4TA 5ITZA 1T2FA 3GRUA 3K05A 3OWHA 2H2HA 4N3NA 2H5JA 4UTOA 1A9XA 2Q5JA 4B4WA 4QTTB 3COVA 1KBZA 1I4DD 3T3EA 4W8HA 4F3CA 5GV8A 1ESZA 5GIOE 3O92A 4L6CA 2R0QC 4FYPA 1M34E 1H1LB 3WA6A 3GJQA 1VE5A 1SKYE 5AW9A 1JYEA 5ISMA 1UM9B 3B6EA 4S1OA 2DSNA 2WFAA 3ET5A 1S3IA 2VYQA 2R6DA 2J9XB 2WYUA 3PKJA 3LGAA 3MXOA 4QDOA 2DP4E 3K4QA 4CKBA 1O96A 1HG1A 4PX5A 5HJEA 2GZDA 1SRQA 2I1VB 3IXLA 2M6RA 4PYNA 4X84A 4B71A 3E22B 3JASB 3A9UA 3Q0TA 4UBIA 4JI1B 4IDGA 4KE6A 3CRMA 3RYFA 1NUHA 1XQXA 2ZS7A 2W2LD 3L18A 1M6NA 4B8ZA 1ISGA 3UWSA 2WT9A 1U6IA 2CV1A 1DRKA 2HXSA 1KMQA 1G8JA 1M1YB 3QG1A 3W2GA 3KOOA 4KW7A 5CDUA 1Z0UA 1NMYA 4EG4A 5KHLB 1G3IA 1V0JA 5F7XA 1BE0A 4G5OA 4LJYA 4V1CI 1YZGA 1Q15A 3PHIA 3RC1A 4BVFA 3E7FA 4DIOA 4INAA 2QA5A 2JGNA 3Q72A 3OZGA 1UBRS 3WZLA 3WK5A 4CG2A 2OHIA 3B1FA 4YY3B 2GXAA 4YHBA 4CKZA 3S28A 4JT8A 3QVGB 2C3MA 2NZ8A 4TL9A 5DBOA 3VZSA 4D4LA 2CJYA 1RKBA 4P7KA 4BFUA 2OORC 3HXTA 3W77A 1NVEA 1I9GA 5TQ2B 4EK9A 3UJHA 3ZZNA 2XXAA 4RPCA 3KE8A 3WL7A 5KOJB 1IG3A 1JFFA 3S1AB 4MO2A 4DG5A 3TLZA 3PFGA 4TQUS 4BXOA 1E3WA 4CGYA 2ZSKA 3MTAA 4YYZA 5KTNA 3BJZA 3WNBA 4KVGA 4N5MA 1VDZA 1PR1A 1L4GA 3SSMA 2XTAA 1J0BA 1FX1A 5LLDA 2PQ0A 3HSYA 4EGQA 3O83A 1E8NA 3RVRA 2ASEA 2PXHA 1VI5A 4BP8A 2ZZKA 5IFKA 1D0SA 2GNPA 2IZ5A 5KI6A 3KSAC 5GZ1A 5TVKA 3B12A 2Y6VA 3E1SA 1CY0A 3CXUA 4CR7A 4AYWA 4DS3A 4TZKA 1CK4A 3SMQA 1DHRA 3SSOA 3T7CA 1AN0A 2XH8A 3RVBA 3JSXA 4CMGA 3BFKA 2RGAA 5DB4A 3NM6B 5HE8A 1G7TA 4W1RA 4X6XA 2CF6A 4D82A 3VR1A 1FZQA 3N8GA 2ZCVA 3EPPA 2YXBA 3KZNA 3UBTA 1T0JB 4LS3A 4RAQA 2O9JA 5BNTA 3JQ6A 2UUBB 3TLMA 1YOVA 2HIHA 4E6EA 3L4BA 4OUKX 5EIBC 1Z7EA 3VJKA 3EXIB 5EIFA 2DWUA 1ZHFA 3RYIA 2HWXA 2RHJA 5AKLA 2FPLA 4N0PA 1VBNA 4IICA 1E5DA 3B1KA 3M6UA 1G2IA 4ENQA 4IFTA 4IRMA 1N75A 2ZAMA 2ZSFA 4K40A 3EG9B 4XE5A 2O1WA 3H6HA 2FF5A 3S2EA 4CLHA 2WPDD 1KK1A 3L0OA 1W47A 2HYIC 4TKVB 1H69A 5H80A 3EE6A 3I5YA 1J9GA 1XMQB 2R6JA 3AC0A 3GUUA 1EDEA 1ATZA 1HE2A 2ZE8A 3CWZA 5DLDA 3SXUB 2ZGVA 2N1MA 5K0ZA 1J97A 2X5KO 3GGOA 4Q18A 5EYPB 3UJ7A 2VDWA 1H8HD 2GLTA 5LU8A 2IUEA 4RNDB 2A9PA 2JBWA 4O2LA 3ZQJA 3EGOA 1W36C 4BE7B 4P84A 3O8OB 2YYAA 2AFIB 1PU2A 3H9JA 5TJHA 1Z2CA 3M4NA 3X2EA 1AA6A 5E9JA 4BUCA 2HK9A 4YROA 3RAJA 4DMKA 4ER3A 3DMTA 1W34A 2D5BA 5DNDA 5FLYA 1CUIA 1LTKA 1DKRA 2Y93A 2VWPA 2HQRA 2GRUA 4YHHB 1YQQA 4BQRA 5LJIA 4BL5A 4OSOA 2Q45A 3AU8A 3B5JA 3F8SA 3GJ8A 2Q3DA 4QTXA 4M36A 3KDPA 4ZO9A 4B80A 6AT1A 4CF5A 1WBBA 2DMRA 5EEHA 2HH9A 2GHIA 5CBKA 2DY0A 4QIHA 3LFTA 3C70A 4QVGA 4P9NA 3RIEA 2NW6A 1E32A 5E2IA 2PWYA 4I8XA 4X93A 1ACMA 4ZKEA 5KVSA 4O2AF 3B1YA 1JHVA 1G8PA 2QL5A 5FBRB 3LIIA 1SIOA 1FEZA 3A1WA 2YFKA 2ZLBA 3G89A 3R6GA 5HMMA 5DGTA 3OTHA 1XJWA 2P11A 5BMVB 1I0IA 3W78A 5AM2A 1GVHA 1FFEA 4IVQA 3GLFE 4Q7EA 1FFSA 5FTWA 3UTDA 2Y4OA 1JVSA 5LA6A 3VV2A 4DRYA 3Q3GE 2IPAB 1QPGA 4BMZA 4LRUA 1I6WA 1TAQA 4OJTA 4YT2A 3LFUA 4OJKA 3DDNA 4KSCA 2E82A 5G2OA 3W6OA 3NNSA 4REMA 1KHTA 2QHXA 3AIOA 3H87A 1Z4LA 3DFIA 2AN1A 3IPRA 3IS3A 3NH6A 4LE2A 3PGVA 4F60A 1E6EA 4KR6A 1NRIA 4RIEA 4A03A 3KAQA 1NBOA 1GYRA 3TFWA 5JAMA 3OQIB 3E9QA 1P17A 3RLIA 5CJJA 1EWTA 1UC5B 1I0LA 3UA4A 3FRJA 4ZXFA 3O93A 1GTRA 3G0DA 5KYYA 1KY3A 4EECA 3O21A 4DOMA 1ZJ5A 2ZRFA 2HIGA 3DE1X 3WLFA 4GBJA 3O7WA 4C7JA 1KFJB 2BM9A 3SX4A 2OLJA 1G1AA 1DINA 4JBYA 3LC2O 3PUZA 3QP9A 5E1DA 4V0KA 4DY4A 4U9IS 1KSGA 1DELA 1W0CA 2GM9A 4IEIA 4LOKA 5CU7A 1WCIA 4D9CA 1DWOA 4ZAYA 2VBCA 1UPUA 4F1KA 1MIOB 3J81k 4HGPA 1RAGA 2O2CA 3W7AA 1SCDA 3BDAA 2HBQA 3ZDQA 4JZKA 3NBMA 1G1MA 1TM7E 2QM8A 4J2OA 1L8XA 4QPNA 4ZCRA 5KTSA 2H2FA 2QAIA 3V7YA 3VH1A 5ARBA 3BFPA 1CUZA 3S99A 1RYDA 2V6FA 4G1EB 4IYJA 4BNJA 2BGUA 2X7XA 5BSHA 2XYQA 3ZNPA 4HQ0A 1PZGA 3S70A 1N7IA 1YS7A 4DXDA 3VSAA 3ZU4A 2BT4A 4LCEA 2JI6A 2C04A 2IPLA 3LXUX 3ONFA 5F1KA 5J2UB 3DMNA 3EZFA 2B20A 4Q01A 4QQRA 4MB2A 2F62A 1AA9A 3HS3A 3PBKA 3HP1A 5EMHA 1OU4A 4OQFA 3RU7A 5EWJA 4D45A 3ME5A 2XDWA 3N2IA 4K9LA 4AN0A 1KYVA 1P1KA 3IAS6 1NKSA 2XHZA 4W8OA 4QDZA 4B9AA 5ICCA 3U7GA 4J7UA 3MT8A 3EIUA 1YUBA 3RC9A 3GT4A 1ZDMA 2RK6A 4JA2A 2HSJA 1VL8A 2PSJA 2YL2A 4ZT3A 4WCFC 4KJXA 1QIKA 3ENZA 3RRZA 3M5WA 1VQ1A 2BSAA 1GU7A 2DCUA 4HH3C 5JHHB 4R1SA 2RKBA 1B6SA 4R2XA 4P4LA 2EKPA 1U8CB 3W6NA 3GAAA 4JXZA 1U1FA 2YQZA 5B58T 3EVNA 1W1IA 2G04A 3PDHA 5EIWA 5K0CA 4ZTZB 3HLKA 1CY7A 5I9MA 1FX0A 4EENA 1UJNA 1XBTA 2J0EA 3WKAA 4A16A 1JB9A 3QKTA 1TK9A 3KVYA 5KWIA 1YU6A 2DTDA 4A4DA 3IELA 4MMZB 1TT5A 1VGVA 5ALJA 1JJFA 4R8VA 3KT6A 4XDZA 3L7BA 3I4CA 1TK2A 1GCOA 4GPIB 4UPVA 3U2QA 1SB9A 2VK1A 5IJAA 1PX2A 1L7NA 3EIXA 3VR6A 5GINE 3NHSA 5BOVA 4CHGA 3OQNA 4URXR 3RIGA 2YJTD 5C5EA 3H84A 4R31A 3OQ1A 1WZUA 2C4VA 4D8XA 1JE1A 3L1VA 5LZ4A 1TM5E 3QE0A 3OZBA 1CZRA 4PC7A 4LRYA 1M10A 2B4TO 5C7YA 2ZUEA 2J87A 5L3SB 1KJ9A 4C0AC 4YASA 2ET6A 2ZXEA 1ZHOA 3QEOA 4IXNA 4V0LA 4A27A 2IL1A 4CW7A 3MTJA 2POCA 2XAUA 4MVJM 4KAJA 1MGOA 1QS0B 3MBKA 3WSVA 5DNUA 4FQ5A 5JNVA 1Y6GA 2O3SA 1Z17A 2BH9A 2PGAA 3C1AA 3MMXA 4MEBA 4EQ6B 3BREA 3NVMB 3FKSA 2UXBB 4MUNA 1QC5A 1ZR4A 2Q1YA 3RK4A 1U28C 4C7BA 2UAGA 1AKRA 5DI3A 3OE1A 4AN1A 1IMJA 1JPUA 2G4LA 3B3FA 3MUFA 2XWPA 1AGXA 3HVJA 3CNQS 2IYOA 4WLNA 5EXXA 3U13A 1R9JA 2C4TA 2ZS9A 5FJIA 2N0SA 1YRAA 4Y1EA 1YL5A 4MQ5A 4ZU3A 1LBIA 2R8ZA 5JAOA 4NABA 4O4LF 2HSGA 2YINC 5UKDA 2F55A 4XH9B 4E5VA 1WXXA 3HJBA 3IIKA 1MTOA 4RY2A 3HYRA 2YWXA 2CJWB 4CIXA 4C4AA 1G5QA 5B53A 3N2LA 5TPZD 5CD9A 3ZCRA 1GTMA 2CZQA 2FSUA 1GGVA 2H06A 2OAEA 2WRZA 2XA1A 2XUIA 3CPEA 4FC7A 4LSZA 3TIFA 4BNHA 2P9QA 2I3BA 1IYZA 2OO3A 4QUGA 1Y34E 2QLMA 2DM6A 1V5WA 4IGEA 1GV1A 2JIDA 3EFEA 4WLUA 3OCUA 4DARA 3CUEF 3BHJA 4BKUA 2YJ5A 4AX4A 2WZCA 1IEQA 5JNRA 1DJPA 1N2GA 3OY2A 4JJEA 4LHZA 1JR3E 4C78A 4P0TA 5G53C 1RHKA 2NP6A 5JJ5A 1S4QA 1TFRA 2PX5A 1PG2A 1WZEA 3S2IA 4DVJA 2FFQA 3OLCX 1T2VA 1T6XA 5DHTA 5T64A 2E4UA 2XCSB 2RGXA 1IJBA 4O33A 1Y8CA 3C3EA 3SCZA 1OV6A 4MRAA 4UU0A 3JQ7B 5G1NA 1E59A 5BT9A 1HDXA 2JBHA 2C83A 2GN9A 3LUAA 4Z4IA 4LNUB 3I3SR 4Q4JA 3Q3JB 3KQHA 1BNCA 5FL7D 2YWEA 4K6FA 1H3EA 1FFAA 2VYVD 3QW2A 1W88A 4N1AA 2GSWA 2TMYA 4P4TA 3KPYA 4NVRA 1N3LA 3HHPA 2VZ8A 5CR9A 2GAJA 1N5IA 1FTWA 2IZ7A 2PL3A 3EIQA 4FKMA 4L8VA 3HXPA 4J16C 3KSUA 1C3EA 3AUYA 4U3JA 2D4HA 4M55A 1IHYA 1ST2A 1KO8A 3HPRA 5CTAA 5BR4A 1P4RA 1L4EA 1N2EA 1P4AA 1PI3A 2WZBA 3BEDA 4AM8A 4E03A 3DDUA 4DQKA 2PS0A 5SV2A 1ADYA 4WXHA 3GRRA 4IEEA 3W7BA 621PA 3TLGA 3R6DA 1OR8A 3T94A 3EQ2A 1EXNA 5KX5F 3BRCA 1Z6AA 4OB8A 4RWZA 1CW2B 3OQVA 5C5CA 4TWZA 1M3SA 4GM0A 1N4DA 2OSVA 4O59O 3ZQKA 4WN9B 1QV9A 1W94A 2OENG 4QHYA 2VJAA 4LSWA 4MVJH 3MT7A 3ZVKA 1R8SA 1R5BA 1M5RA 3GROA 1SKUA 2FLVA 4GE3A 3WRYC 3WRVA 3JVEA 4FLMA 3C4VA 1XU9A 4Q9LA 5IM5A 5FWDA 2P65A 1K8QA 2V55B 4OF4A 3T3OA 4N82A 2OPHA 1D5WA 2I34A 2X23A 2VXOA 3NV9A 4QNRA 3I5UA 3V46A 5MFZA 4BNYA 3DXZA 1IXZA 1DTWA 1GQ2A 4KAAA 1DKUA 4IJ6A 4KE9A 5L53A 4LC1A 3VR3D 3PQFA 5E3JA 3ZWAA 4DSTA 1H1TA 1GZDA 3N6RA 1EFHA 5FR1A 1ZNZA 3T3DA 2LR0A 5ER9A 5C46F 5TGDA 2PYZA 5BPFA 2XCQA 2CXXA 2QQEA 3P9XA 1WAMA 2RDMA 4C2TA 3GMTA 4IDBA 4US2R 3V4RA 4J3JA 1E5QA 2QMQA 3NLLA 1I2BA 4YUVA 5DYYA 3QHQA 4J0KA 3V7WA 3VBEA 3AHEA 3FCOA 4CKCA 2J4DA 1CR4A 3GUHA 3GXBA 1TYDE 3E9YA 4XTCS 5EXDA 3ZGLA 4BNDA 1E66A 2FFBA 1DBRA 4U9UA 2M6SA 2YS7A 3TQQA 3TWOA 4QXPA 4GIBA 3HACA 1CZNA 2P2DA 4ETNA 5IKXA 3KKEA 5CGQB 3LY5A 4UW9A 1QPBA 1I5EA 1LSUA 3GJ0A 4MYUA 3AB8A 4WK2B 1YOBA 5TMDA 3BE4A 4GZ6A 2PH7A 4J0HA 4AP9A 2OHFA 3TTSA 1V6SA 1ZU5A 2PVCA 3ONVA 4W7IA 3WVNA 4Z53A 2VH1A 4P54A 3K6SB 1OX6A 3KR2A 1NVGA 3COSA 2R96A 3NUZA 1R0BA 1VYVA 3VAYA 2R11A 4DPKA 4ERNA 1AQJA 2GN0A 3MTBA 5K6RA 3BB3A 2GAOA 3DZBA 4E2WA 4Z7JA 3KYDB 3BRWA 1G0NA 4V3CA 3QU2A 1ONOA 4OXRA 4D1YA 4N76A 4YRJA 4JIMA 1UT5A 4FYYA 4TT3A 3LHKA 1D1TA 2BC9A 2C84A 4GQAA 4EB8A 2C8LA 1AQNA 4RJ2A 4UAUA 4YLYA 3L7NA 4RY8A 1U81A 2ODTX 4RVGA 4NZYA 3AY0A 2B1RA 5B1IA 1GQOA 3FGZA 2C5AA 1A71A 4UZEA 4ZYYA 3NRJA 1ZR2A 3GVCA 3JY6A 3WGKA 3VDQA 1T0BA 4EAAA 2X8JB 3GZ4A 5HOEA 5GONA 4UJ3A 4C0XA 5KCZA 2EFHB 3MCZA 5I4BA 1WS6A 2SCUB 3F0TA 4I1VA 3RK1A 4U6QA 1Y6RA 4LY3A 2IU4A 2ZULA 2Y3IA 4RX1A 1KY5A 1GKUB 3L8GA 3HPQA 2DPLA 3AM3A 2VSYA 2VHQA 2XA2A 5TRTA 1V95A 3WISA 4M8IA 4R0MA 1OLUB 2PIDA 1H2RS 3KOYA 3NRBA 4C08A 3EW9A 3F49S 4GDMA 2EIHA 3E6AA 3WNDA 1S0UA 1GTJ1 3OJ0A 3F67A 4DV5B 4Q34A 2WILA 2QR5A 5K3FB 4J1QA 2X40A 3VSDA 2PSFA 1OHHD 5AJTA 5LQCA 3TCXB 3WFJA 4DADA 3O1JC 4HWTA 1UK9A 3E5RA 2QD3A 5B3JC 4JYPA 5CFNA 1NN5A 1E2JA 3JALB 3O2JA 1WM1A 4P0QB 2ST1A 1XZFA 2QRHA 1HKHA 3AR6A 3HYNA 2DFTA 3IUSA 4R1UA 3X1DA 3TECE 4AKEA 4A8JC 3QF7A 1SXHA 4DCNA 1E7MA 4G0VA 4KQKA 3L0CA 3H1PA 4PLYA 5FUQA 1Y9AA 2AQHA 1KK2A 2EJBA 3LNCA 4TTJA 1G6Q1 5AKHA 4E13A 1RI1A 2OBMA 3DVRX 3DJYA 1FP4B 3AR3A 1GFWA 2JFXA 4K86A 4A6PA 3SZOA 4CMEA 2ZBDA 3D0QA 4U7FA 1XHEA 2XQKA 4KVFA 4L50A 4NCJA 1W4AA 4OREX 2HLDD 3O0DA 3CZ9A 4IHJF 1TD9A 3L46A 4AZSA 5BUCA 3DMPA 1HYGA 3IE2A 3NRCA 1NNI1 2NAFA 3MLEA 4L8GA 1SKMA 1H5NA 1SNYA 3EWNA 3WMFA 1YNSA 3LUCA 1NP6A 1RP1A 3AR9A 2YQ5A 2C88A 3HO8A 4KPYA 2QT9A 1TE2A 3CZAA 3EQ9A 3L7LA 1HQKA 4BNGA 4EY3A 2V65A 4DVGA 1OH7A 1NVAA 1JNYA 1PNQA 4RZIA 1W0JA 2B35A 2VDKB 1A72A 2HT6A 3E1GA 3GGCA 2FKAA 1NMZA 1V16B 3IPAA 4QQNA 3CW2A 3D6JA 3NVAA 1K86A 1WHTA 3GW8A 3AEKA 5M29A 4M7WA 3QPCA 4OMUA 4X45A 3T7JA 1P1IA 5AFSA 2GERA 3KNZA 1HDYA 1RTTA 3OAAA 4LWZA 2OCKA 1PSDA 1YD7A 4MP8A 1DLJA 3KSMA 2G8LA 1EM6A 4NFYA 2DVMA 5I7WA 5JAZA 2XRZA 1YCDA 4UUAA 2IK8A 2RAUA 3FI0A 3TIXB 3B8HA 2IYNA 1XUOA 3FLBA 3R3WA 3F96A 3OM9A 4TLEA 2ZWOA 5EKSA 3AZQA 4MIOA 3CIOA 1YFKA 4HFJA 9MHTA 1QG6A 4FSDA 4P3NA 4XLTA 1XDBA 2F3PA 2WD8A 1NF9A 4FFBA 5CFLA 2Q21A 3W2EA 1SZCA 2GGSA 3BWXA 5BN4A 2GS9A 1ONSA 2HRDA 3PENA 2J5RA 1FNDA 2R8XA 3Q88A 1N9GA 3RSCA 2WJGA 3LA6A 4FGZA 3VDXA 4AG3A 4B47A 4B6RA 4UHBA 3B20A 1K0FA 3Q7IA 3P0EA 4K28A 4DMRA 2F43A 2AMFA 4G4IA 1OA1A 3WLSA 4G5QA 1XZNA 2DERA 5BY2A 4WK0B 1ZK0A 1T9HA 1NPTO 3CS3A 4FE7A 1KTIA 1XPOA 3UV3A 3RHTA 1EG7A 2WA2A 1F3OA 5ABPA 2MSWA 1IIRA 3OKAA 4ITUA 5AM0A 4RC9A 4MA5A 4KITB 1F9AA 2O23A 2WBLC 4ALKA 3WHPA 1YR3A 2FFJA 2G0AA 1JE0A 1XZDA 4IWXA 1MOQA 4LHSA 4MLZA 1ZLYA 4DA8A 3UJCA 2GH1A 3QXXA 1A8SA 1TJ5A 3EOAI 3IPCA 5CXQA 2NU7A 1ORWA 4C4PA 2GD0A 4LJ5A 3SQWA 1CUJA 4UAVA 4AUNA 2IXAA 2P90A 4NV1A 4B7UA 4TLDA 2FHSA 1E9BA 2WPNA 1XAHA 1J06A 3EXHC 2GUGA 1N2CB 1W5SA 1RPZA 3RRXA 1EUCA 3TSAA 1RLMA 3NKLA 1VJGA 3GJ7A 3K4HA 4WVFA 3KDSE 1HDGO 3HJTA 3K73O 5DJ5A 5K4AA 2RGCA 2AVNA 2P9GA 4WSOA 1N0WA 4FNOA 1F2TA 2BW0A 4JVNA 1N3IA 1OWNA 2XUPA 3OZFA 3PQDA 3PU6A 4ID9A 1EIWA 3N53A 5IEJA 4RNCA 4G5HA 2I8CA 3DNPA 4EI7A 3CO5A 4IHQA 1RXYA 4V1CB 3R24A 3SNHA 3S7ZA 1EWRA 3LH5A 3V4VB 2C94A 1T2EA 3CLSC 4QBFA 3R7NA 2NNWB 2EF0A 4P08A 2GR9A 4B2PA 5LXTA 4TMWA 2X77A 4R40A 1A5BB 4AW9A 1W5TA 4EKDA 5C8DA 1ZJYA 1ZXLA 3KTAA 1XL0A 2GJSA 1VJ5A 2PR7A 3KHSA 1XFAA 1O6ZA 1R9NA 4G26A 4J0GA 2NSLA 1JEDA 4MRMA 5D1NA 5ESDA 3TMAA 3H0CA 4QLAA 1SVIA 3GO4A 2CUKA 3SXJA 3NKVA 5CW1A 2FEMA 1PP4A 1C9NA 3VR5A 1SA0B 2HI0A 1C3OB 2UUOA 1HF3A 1ZH8A 2FFHA 3KZKA 3MJDA 2CLKB 2W2QA 1UXKA 4I2VA 4MWSA 1XLTA 4TV9A 3WKEA 1J5PA 2EFCB 2Q1XA 3T1YB 3F71A 2YVKA 1ZJ4A 4XW2A 4WY8A 2XMGA 1FP2A 4NOKA 1YF3A 1SXJB 2IY7A 2DUNA 5JD6A 5EIXA 1TTHA 3ZCQA 2ZRQA 3AEYA 2J45A 3AZOA 3DDZX 3LVQE 2PANA 5LQNA 4UCWA 4JMLA 2JNWA 3FDZA 1KFKB 2W8ZA 2LZ0A 4LJLA 3WAGA 1EFAA 4ZQIA 3VTZA 5FBZA 2OQ2A 2HK7A 4HK4A 1KWGA 2Q9AA 1QR6A 2P7HA 4DV0B 1SBCA 3M4YA 1AO0A 1P1HA 4X1YA 3I9JA 3UT6A 3DB2A 3H19A 3I8OA 3CUTA 4M3NA 1PLKA 4PLHA 1ZRMA 2HRCA 5EINA 4N3CA 5JJKA 3NC0C 1ONPA 3HY4A 1BXZA 4HB4A 2GBLA 1AU9A 4BQEA 4UTPA 2PBFA 4I4NA 5DM2A 3TIVA 4E5NA 2V4UA 4MVJD 3AF2A 3GFRA 1D07A 3IEKA 4RU1A 4EEKA 2Q07A 2FQ1A 1CIPA 1X39A 4WA7A 3SG0A 2JGRA 3ZW8A 2NUBA 3WA7A 1SCJA 3SC6A 1WUIS 4I55B 3PFHA 3BKXA 4MAFA 1RLJA 1CJMA 2AG6A 2F3QA 1JSRA 3K8QA 1II0A 3NBZC 3Q7PA 1T0PA 3UKDA 1U8ZA 4C0LA 2MYUA 3QKIA 3KOXA 2AG5A 3VNSA 3W6PA 4MWTA 1Z0AA 3VKUA 1XQ1A 1W581 3MGKA 4WUVA 1O94A 5CH8A 1HNNA 3C3DA 3ILYA 3V5NA 3TQRA 4D5EA 4CMAA 1OGJA 4MV6A 4DHEA 2R62A 3DHNA 3HKCB 4Q3OA 1RMQA 4DZRA 5ICMA 3Q2OA 4FI3F 1YFLA 3BWCA 1QAQA 4J7AA 4P5PA 5HILA 2FZGA 1QHEA 1LV7A 3S2ZA 3DT9A 2QK4A 3TQSA 7YASA 3EFOA 2XBUA 1N6PA 1JX6A 2J30A 3LX4A 3MGBA 2ECQA 1OFIA 2C1EA 3LPNA 2ZB2A 2MR5A 2ENUA 4MJ3A 3V4PB 3X2FA 1JQ3A 1U3DA 1XD8A 4HDOB 4YO8A 1WO8A 2ERCA 2FPIB 1TJNA 3OP1A 3W1WA 4C0KA 4ESEA 1AHIA 3GDOA 4NONA 3RW9A 3SYKA 3GLUA 2FW8A 5JATA 1MO5A 1DKMA 3QMVA 5KJEA 4C0SA 2YOHA 1RTKA 4OHVA 3SK0A 2PZEA 2NZUG 3WLRA 3ORFA 3TG8A 1CUFA 3WLTA 4KLRA 1A97A 3OOSA 3WG9A 4DRXB 1UKCA 4FDVA 1AUXA 2I9KA 3CURA 4CCAA 2UXCB 3LBNA 4GRDA 2BUCA 1TUEA 3I37X 4O2AA 1DAKA 3ZV6A 5BN1A 3STUA 1ZK4A 2ODPA 2DFDA 2VPIA 1L5SA 3AOEA 3QU4A 4RHTA 1PR3A 2UYOA 1KDRA 3LLMA 4RK7A 2WY2D 4DR2B 3TK1A 1ISRA 2FWJA 5AUPB 1QUFA 2AFVA 5HCIA 2NO6A 2P5YA 4ZRDA 3MWDB 2KLHA 3IJPA 2RHGB 2Y0CA 4NH4A 5CHYA 4DNOA 3TDNA 1Q84A 1SBNE 2CNLA 4BLRA 5GOZA 4XYLA 2A86A 2FN7A 1CEXA 2FOLA 4EY8A 2XLBA 4H4DA 1BFUA 1RWOA 2WAYA 3PCTA 5BSVA 4GL4A 4DR6B 3RU9A 4EB0A 4AJJA 3AETA 5E7IA 2PUCA 1E0KA 4YQYA 3FOZA 4EZIA 1YKGA 2XNDA 1JILA 1GM5A 4Y1RA 3VHRA 2D0OB 1LDMA 1U7ZA 1QQBA 4EW1A 5JAPA 1CUEA 5B4UA 4TSRA 3QNUA 3TOZA 2CKDA 5FLKA 5JRZA 3AF3A 1SOUA 8ABPA 3ZWNA 1ICIA 4B6QA 2GF9A 3A58B 3LDUA 5JI2E 1WLSA 2GJKA 2P9BA 4P35A 2SKEA 5HUHA 1PR2A 4X7BA 5JI3E 2Z98A 2J33A 1JA9A 3MSCA 2ZYRA 3ZE7A 2G76A 3FYUA 4HEHA 3BQMB 2ZDQA 4ZHSA 4MWOA 1UDXA 4N5NA 1DBPA 3F6YA 3NPMA 3OJCA 4HMPA 1G291 4ZTUB 3ZQUA 5DXJA 5EUBA 2PUVA 1VIMA 2IYLD 1FFYA 4FOTA 2X22A 3BXXA 2I1LA 3ICWA 4OHCA 3RVNA 4DR5B 1E96A 3DKRA 2HMTA 3GLSA 3LK6A 2BFFB 2I3GA 1GHTA 5EUCA 4LHWA 1FK8A 4ML3A 3Q5EA 1G63A 2BR3A 2XMCA 3U4AA 2OOKA 1W75A 4IH1A 3ZWQA 3D6HA 5JISA 1SU6A 1UJBA 3NHJA 4A2WA 1SCUB 2C9DA 3NDBB 3ZDZB 2IYTA 4FR5A 3ZS9A 1NJFA 3QHAA 2OTCA 5C37A 4NXMB 4MGYR 4RTLA 1QYCA 1SUSA 1T2UA 1HQYE 1PJBA 4BC0A 3N3BC 2ZYGA 5C1IA 4RXUA 3H8JA 3K96A 2PAFA 4MW7A 1SKBA 4WY2A 1F17A 2XZDA 4HGYA 1CWUA 1Q3TA 3ENWA 3HDVA 4P6VF 3E61A 3CVWA 2GLXA 1D6NA 2G6BA 4ARIA 3PPVA 3ZGZA 4JB0A 2HY7A 4OHZA 3HM9A 1GA4A 3MBOA 1E64A 1SWVA 4QAJA 4ZARA 5FNVB 4TWJA 4BJ1A 4UEKA 3D7MA 4FJ2A 4RPIA 4V0RA 5T5QA 1M0EA 4JI2B 4QM6A 1T0HB 1YJBA 2XWJI 1UAYA 2P3OA 2QB5A 4BASA 1K1EA 1R8XA 3E3MA 2XMDA 5DYNA 2Q3HA 2XUZA 3PSHA 3BF8A 2AMJA 2BE9A 3EGDB 1T13A 4W4TA 3RF7A 4H31A 3C5VA 4EL0A 5CYFA 1NW4A 3LXMA 5E6UB 4K9NA 1W85A 3BICA 3WMRA 1Z2NX 2VBGA 4PYMA 1HE1C 4I1UA 5F9HA 1ORIA 5IT4A 3LW7A 4EG0A 3IQDB 4BQOA 4YRBA 1K5DA 3IUJA 1O89A 3TH5A 3S8YA 1JHZA 1X7WB 4GUAA 1B26A 1UPTA 3C6XA 1VZ3A 3EGIA 2ON6A 3SC4A 2ZS8A 3TE7A 4INPA 4WEQA 4RPJA 1OGYA 2QM0A 4HEJA 5F1YA 3DONA 1PZXA 1PT8A 1DXHA 1WVGA 3GFPA 3LYLA 4MP6A 1FTSA 2WUDA 1ZD4A 1FBNA 4RTNA 3WIOA 3HP7A 1SVLA 4II2A 3PFFA 1XELA 2JVIA 3ILSA 3KU1A 4MV3A 5ALSA 4UUOA 1ODFA 3QVXA 1YQUA 1JQEA 1NF2A 1T0IA 1BVHA 4ITRC 5PNTA 2NOAA 3I39X 2QQFA 3CE6A 2QYSA 3GJXC 4QUBA 3QNMA 2XGSA 2G7MC 3TAHA 3K70D 4TZ0A 3L4BC 1JA1A 4EJ0A 1N0HA 4JIGA 4NZPA 4D9KA 2D62A 1R4NB 1HY3A 3IHKA 4J4BA 4PVCA 1TZ2A 3KALA 2HJRA 1K68A 3PEVA 1ML3A 5FR2A 5HE9A 1BQEA 1ABFA 1MRNA 2W93A 4RFLA 4X97A 1PNRA 2F2TA 1NXPA 1XMSA 4NE2A 3ROKA 3B9PA 4R1NA 5HGJA 4JKIA 5FBKA 4MV9A 2CBXA 4FFOA 3SE0A 4DMUB 5DPMA 4XEHA 4O4LA 1ULSA 5CX1B 4BP9A 2J8ZA 1XNQB 2YHSA 2C0PA 4WPGA 3GGGA 3BF7A 3TNLA 2AK2A 4E5MA 1QBKC 1WULS 1YFZA 4EF5A 4NY1A 1UAAA 1BGVA 1Q11A 2GVDC 4O5AA 4BPBA 2IXTA 3NH9A 1N6HA 4LNAA 1L5VA 4YS6A 3A28A 4M37A 4Q1AA 5K1ZA 5FV7A 2JIBA 3QA9A 1C9MA 5K6TA 1VYTA 1L2TA 3Q7QA 4WDQA 1FSSA 3DMTC 4MW6A 3GYBA 1V4BA 1VXOA 4WJLA 1XAIA 4NJMA 4KQFA 2XE8A 2O0JA 3HDYA 5FBHA 5BW6B 3U3RA 3ZV5A 5ERXA 3S44A 4G0OA 5DF1A 1M75A 1RVV1 3V6LA 2VCHA 4BAUA 3A1CA 1KIAA 4I8IA 1MX3A 2YYYA 1TUGA 4U9HS 3UGQA 4OK5A 3OFKA 1ADJA 4F4DA 1ZN2A 1VL5A 3QGMA 4G0XA 1MGPA 4HAYA 5E6SB 1YZLA 3EZXA 1HTWA 3H9GA 4BO5A 3IJEB 4NZZA 4PO8A 3VR5H 4DPMA 5KWEA 2MU1A 1HDEA 3GFQA 1QRTA 4EY4A 4RVFA 3BBPA 3H99A 5E6RA 1A4IA 2I7XA 3FXAA 1DOHA 3H3JA 1UFRA 2O3UA 2ONYA 2ZSEA 5EQJB 2EG9A 5EPUA 5K8LA 1XRNA 3GRFA 3B2QA 2W5UA 3I34X 2GPJA 1RRVA 3L07A 1GSAA 3W4JA 5AXDA 2HLNA 4HGQA 1Z6XA 3R77A 1PCXA 3R9IA 2I8LA 1UXIA 2YXPX 4GM4A 3PQ8A 3U4CA 4YA6A 4XVRA 1AKWA 1ZA2A 3WXBA 2IXGA 2AX3A 1OBVA 4GI3A 2LRHA 5G0VA 2ZUFA 5LR6A 2VJPA 3EH1A 1H0SA 3LDHA 1HEUA 2WHQA 4UZSA 1U3VA 1KRHA 1HBJA 4YCCA 2WWIA 2XSZA 3RFTA 2P9CA 2HTFA 4NI5A 1CRPA 4M1WA 3U3DA 3U40A 2IW3A 1WU7A 2IEGA 5CLFA 2ZR0A 3HFSA 5LWHA 1CQIA 1NVVQ 3KXLA 4OKSA 4HXGA 3SZUA 3AUKA 3C4JA 1JQDA 2R00C 2YY7A 1Y8QA 1AD2A 2P2YA 1DC3A 4XD7A 3VKWA 3R8CA 4HNAA 3BWMA 2LCFA 4PSCA 2OG1A 3ZV4A 1DLIA 3HSSA 3N58A 4YYEA 4A6DA 4DYVA 1AV7A 2HWUA 1O4WA 2J3QA 1RAFA 3ZJVA 4B3TB 1ZKDA 3DE7X 2Z2KA 3RVLA 1NVUQ 5G1PA 1XZGA 1YZUA 3SKYA 4NL4H 3G2HA 1H3NA 3M9WA 3M5CA 3U3OA 1FTYA 4HVLA 1DDGA 1KYWA 3AUXA 2QVZX 4YIKA 1YE5A 1QF9A 1A1SA 4JLJA 1UM9A 5ES3A 1JWLA 2PEYA 3BD8A 4W1PA 3BMQB 3J80A 5B1DA 2DQSA 4Z7QB 2J32A 3DCNA 1YVRA 5K0FA 3ILHA 3BSSA 3V1NA 5TXGA 1V8BA 3TXAA 1IBCA 2QY6A 4G1UC 4OSEA 1EIZA 1DRWA 1ULBA 4K3UA 4WW0A 1UJCA 2PD4A 4N40A 3ZHYA 2QLJA 4ZEWA 3SJCA 1A9TA 2QTBA 4GQIA 1NN3A 1X87A 5KNLA 1G18A 4DDVA 1J1UA 1F1JA 3FSRA 4RA9B 2GXUA 2VYFA 1TO6A 3V7UA 4C04A 4HS9A 4ACBA 4UC0A 5G02A 1CG6A 3WRXA 3EH2A 3FHJA 3OIVA 2PUWA 2GAAA 4BV3A 4WZ6A 2REXB 4POOA 2OWDA 4PPNA 4BO9A 1NVMB 4ZZ0A 2WZDA 4JD5A 1MC4A 3AEZA 2HN9A 2IP1A 3BRWD 3U7EB 1BVYF 1QKKA 1NUAA 1C1YA 1JDUA 1E1YA 3AKDA 2ANBA 3GYGA 4ILKA 2Q6LA 1J7JA 4RJTA 2NUTB 3LBYA 1JDTA 3N76A 3OM0A 3RIYA 4D96A 4EMSA 2APJA 2PUFA 1JZSA 2X4LA 3QVGA 1U94A 3F6EX 4GR9A 3WYAA 1TIBA 4JJ8A 4TMFA 4DLRA 2I1QA 5BMOA 5ICEA 5JIBA 1XJ5A 2IOFA 4MW0A 2PCLA 2RI0A 3KUDA 5FO1A 1P39A 2JFYA 9GPBA 2BN4A 3GG2A 5KOJA 5CVDA 4CDNA 3T34A 5CXXA 3R9XB 2JIMA 2QPOA 3CUSA 4WY5A 5FA6A 4IIUA 1O6CA 2FNAA 1T1GA 4Q4HA 4QUIA 1SU4A 4J76A 4TM7A 2P3SA 1ND6A 5ENDA 1Q7BA 3AGPA 1QH0A 4ND2A 2P9ZA 3QX9A 1AUOA 3R23A 5D8DA 8OHMA 2LUOA 5EP4A 3HBJA 1DFHA 1XWIA 2IDZA 2Q3CA 5FULA 1NJ6A 5I9LA 2ZT7A 4GI5A 3H5AA 4XR9A 4YBZA 4CG3A 2WWYA 3OY7A 1O0SA 2H51A 2Y1CA 2ZDHA 4PFQA 4ESHA 4F9FA 4F92B 3ZWYA 4PBTA 2ZAIA 1IZ8A 2D7CA 2VLIA 1JB1A 3NVDA 4KK4A 4OOFA 4PYKA 1PJCA 1T5HX 4CU5A 4QUKA 4K0KB 1LK7A 8MHTA 1Z2PX 2HHAA 2BBOA 3M5DA 1HNWB 1NN1A 3Q11A 3NHYA 1KMCA 2J3DA 3FH0A 3KZVA 2HJHA 1P2TA 1RJ9B 2VQ3A 3FPFA 5IUNC 1WQ3A 3K9GA 3RKUA 2HR1A 3EPHA 1KI9A 1GR1A 2NSYA 1ESNA 1RWXA 3PYXA 4FSXA 1Z06A 1LNQA 2B1QA 1BKSB 3RH0A 4FHDA 3ER6A 1KU0A 1U0RA 4JN6B 4TLMB 1BROA 3WBBA 3EXIA 3K70C 1XOIA 5CCDA 4IKEA 3E0QA 2VP3A 2YY5A 3L8YA 1A5TA 4PO1A 4XKJA 3AFGA 5CYOA 5KYKA 2YCBA 4H60A 3RABA 4G0YA 2P6MA 5DTMA 1YDMA 4NQRA 2QW1A 4IXDA 5JJCA 1DSSG 2PU7A 4UUBA 4JJ6A 4TKVA 1PGOA 2H1VA 1L7DA 3SXUA 5BXQC 4PPYA 4P7BA 5AIBA 4L8WB 4KPFC 4KPUB 3ICQB 2ATXA 5A4JA 2FEOA 3TM5A 3TSZA 5BQXA 2LP4Y 3L4EA 3K31A 4OHOA 5TEVA 3KVVA 4HOYA 4RVUA 3LYHA 3P0FA 2EWWA 3O8OA 3A7DA 1JUDA 4MUGA 4E12A 2UYCA 4EI2A 4JLPA 3DC7A 2P9FA 2Q3LA 1TK3A 2O5CA 3UFXA 3AEUA 2UYGA 2C5LA 3V3TA 2EAUA 1BXKA 1TDJA 4DJAA 4FTWA 3NCTA 4OHBA 1CYDA 2IZOA 2VKTA 2V45A 4IHJA 1TJPB 3EPKA 1N9ZA 2GBIA 3DMGA 1C7IA 1PSWA 1FTNA 3HXMA 1JA0A 1T5DX 1XTBA 2WTBA 1P33A 1I32A 5GP1A 4Q7JB 1VL6A 4PC3A 1KZ4A 4U2DA 3CMCO 1VG1A 1W0JD 1JAXA 2A94A 1NXXA 2CUTA 2JGJA 2QRJA 3T1OA 3TBFA 3O03A 2H48A 1XIVA 4K2AA 4E15A 1OZAA 3F5QA 4MS4B 5FOQA 2GCPA 5ELMA 1UUFA 2OY0A 1ST3A 4RCVA 1LBQA 1BN7A 4HT3B 3HE3A 2IBTA 3WV4A 1UDBA 3DPSA 4M1ZA 3TBKA 3OAAD 5IC6A 4TTVA 2A67A 3B8EA 3MTIA 1DC4A 2W2KB 3RRNA 3OZRA 3A11A 4TZTA 1Z7GA 1B1CA 5DBGA 2QT1A 3FKJA 4E7PA 1IH8A 5CVCA 5DW3A 4X62B 4DT1A 3DD1A 1EGVB 4V3BA 1PNOA 5LMNB 1DKQA 3BCHA 3VI4B 2HV8A 3LO8A 1ACJA 4KCGA 4MQ4A 4PSKA 4QT4A 5A6VA 3TLEA 1ZIXA 5K99A 3V8EA 4OYLA 3DH0A 1A9OA 1EJ6A 1EVQA 4PRYA 3TINA 1AK1A 3KHUA 5CDYA 2HT1A 2HKIA 1F0YA 3ZLVA 3K94A 4AY5A 4D3YA 3A3YA 2EHJA 1JG6A 1MNQA 4BLVA 5LQAA 1S9HA 1GNTA 2AR0A 1ZRNA 2K5UA 2XB4A 3F5DA 3FYHA 3JQ9C 4DDHA 1X8KA 2GX6A 1LDGA 2BCJQ 2WJ3A 3GY0A 4CM4B 3T0FA 3OQIA 2JAWA 2IOQA 4DUYB 3S81A 4HNQA 1QGUB 1YB4A 5BRNA 3TGWA 4E30A 1ZMOA 1JHXA 4KWEA 5E7MA 3DA8A 3GP3A 3BD7A 3E7XA 4XIGS 4YB8A 1VJTA 2HPAA 5HIIA 2WDZA 5A3QA 3F7OA 3JQBA 3NEJA 4BNXA 4DIDA 1OH8A 4L1KA 2PGNA 4EG3A 4O63O 4IFEA 2MOKA 3IURA 2QTCA 5LYJF 5EKTA 2HMSA 3HJHA 5EJMA 4QWWA 1KZGB 1L9XA 5AVRA 1GXSA 4B3MB 3QVLA 3ZU6A 3O26A 4DJDC 5SY6A 5AVVA 2A9RA 2G8NA 3OJOA 4LEIA 3BDIA 4RIIA 2DGDA 2NTYC 2DFKB 3L8MA 3CVXA 2V3VA 2YYSA 1KZ6A 1MXFA 3L7CA 1KEWA 2NZ2A 1KMNA 2X0JA 4K9MA 3H2BA 3LPDA 1OZHA 2JFHA 4TTSA 5CM9C 2ILVA 2WFLB 3LOQA 1XTSA 3SJAA 4X9XA 1EDDA 3PRJA 1RU3A 3LX8A 3ZNQA 4MS3A 1HDRA 1NX9A 2G1JA 2JCVA 5FWXB 1QGAA 2VR1A 3OZEA 3H5OA 4ZQBA 2W6CX 3P2MA 1JV2B 2IU3A 2V0CA 5J2UA 2B92A 5FOXA 2IITA 3DTVA 3I1FA 2WFZA 4FMDB 1QORA 2JD2A 4H59A 2IV3A 2XKKA 2JZCA 3HR4A 5JYCA 2CHQA 4PW0A 1X7YB 2BKXA 3SOZA 2HJ9A 1QNLA 4BU1A 4H3HB 1VSQA 2YJNA 1LDBA 3Q9SA 1GAQA 4PZEA 4EW3A 4F93B 5DHSA 4XLZA 3R0JA 5KSZA 1MQ9A 4IIJA 1Y42X 1DV1A 3VR5D 1O58A 2DPGA 1RMYA 1RVDA 1K63A 2YDYA 1V2GA 2VSXA 4JKOA 2MSLA 3TEMA 3RK0A 1ISFA 1G6HA 2JIRA 1BS1A 1H3FA 5DLQC 2A9QA 4LY6A 4YJ3B 1A7JA 3BUSA 2DR0A 5IH7A 3DWEX 4KK3A 5JXHA 3UMMA 4B73A 2AD1A 1SM4A 1MJGA 2VPTA 4K05A 5CH5A 1LBTA 4RQTA 4Z3OA 2PL5A 1DEXA 1M2JA 1EGMB 4WKOA 5TV2A 4FXOA 3E0XA 3NBQA 2IYSA 3OCCA 1HYBA 1EVKA 2PGOA 1PL7A 3BX1A 3PD1A 2PX2A 1S02A 1DUSA 4ZIRB 3S3TA 1Y1PA 3WYNA 4JVLA 1ENOA 1L7RA 1T8WA 1UCFA 4P38A 3T7KA 2WWTA 5ALRA 5ALUA 3A2NA 4RY9A 3RV3A 3A10A 5B6PA 4MVCA 3OJWA 1JFTA 3DMRA 3ODGA 1LLFA 4L57A 4UHHA 1DIBA 4JFRA 5FOUA 5JD3A 2BTQA 4RENA 3VMFA 2P5UA 4MUKA 4HRXA 4ZAVA 3UHOA 4JELA 5EMNA 3M9XA 1Z75A 1P7ZA 3IUPA 5BNIA 1YVPA 5FAKA 1CLUA 1KEKA 4RGYA 3ZGNA 1F6WA 2VQ6A 2JJ2A 3ZHQA 3EF1A 2AC4A 2QP4A 4WFIA 3TMKA 1A1VA 4HTFB 3EASA 3S7TA 1Y6JA 3SKVA 4KODA 1GL3A 5JHGB 3DZJA 3KJGA 3BXOA 2ZYTX 4E32A 2GFQA 5AI6A 5KBYA 4A10A 4ZEVA 1JXMA 4S2UA 1GT6A 1U7PA 4M8NE 1C1HA 4QYTA 4WNIA 3RCBA 2IYPA 1B3RA 1SQSA 3IOMA 4CKEB 1U1EA 1VI6A 4EQ6A 3DAFA 3WL8A 4PZPA 1QV7A 1X86B 1CHNA 2ECPA 4HHEA 4ATNA 3X1ZA 2D13A 5LKRA 4D9HA 2JFZA 2OO7A 3HBNA 2XUQA 2IS6A 3UV6A 4DB2A 5IW8A 4HGNA 4C03A 1Z8HA 4J8PA 2DETA 4PF1A 1NJ1A 1X1CA 4NBLA 2QS9A 1XK6A 2RHTA 4KE8A 3KLOA 1UQUA 2YV5A 3UJPA 3RWMB 1QPZA 5EZ5A 2RGRA 1NWCA 1XI2A 2CJWA 1W46A 3HNOA 4R1LA 3SM9A 5JFGA 4DCVA 5FCDA 5HWSA 1HQCA 1M6VB 1N0UA 1Z8DA 2WKQA 2H2DA 2G4CA 1WF3A 4TMVA 4ZDJA 3ZXXA 3FFBA 2WD7A 5AHXA 1SBYA 1CJUC 3EOZA 4V0SA 4CMEC 3K6JA 4HDKB 1NRJB 4YECA 4G0MA 4DE5A 2XXBA 2QMHA 2H4FA 3BORA 5CT8A 4ZAZA 4AECA 2QYOA 5BQ3A 4PXSA 5F23A 1KAGA 1N5DA 3DE5X 1M1UA 4OY3A 5EMLA 3KQYA 5J5AA 1T3ZA 1L5ZA 1PZNA 4PINA