2FLKA

Crystal structure of chey in complex with chez(200-214) solved from a f432 crystal grown in caps (ph 10.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2flkA00
4HNQA 1ZVVA 5FBHA 3N75A 2E4YA 4MPTA 4F06A 1SXGA 1JFTA 1Z26A 2N9UA 4Q7EA 3Q15C 2MSLA 1PUXA 3O1JC 5IC5A 1YS7A 2HSGA 3MIZA 3SG0A 5JNVA 1ABEA 2PKXA 3TMYA 4Z99A 5KQGA 1QPZA 1U8TA 2FXIA 3BRQA 4F8JA 3LUCA 4YGXB 1JF8A 3F6CA 4N41A 4EVQA 2WB4A 1SRRA 1QKKA 4JAVC 3H1FA 4MGEA 3T8YA 1RZRA 5DTEA 1U04A 3HSYA 4G0QA 4MS4A 3ILHA 3MM4A 1JYFA 3BILA 1PNTA 4Z4IA 1QQAA 2A9QA 4MQEB 3A3KA 1GCGA 3OLYA 4RV5A 1NXWA 2FN8A 1XWWA 2GBPA 3QELA 3RVNA 4YRZA 4KNYA 2LBPA 1E6MA 3O1IC 4RK1A 5ABPA 3RVSA 3JVDA 8ABPA 3GBPA 3VNBA 4RK7A 5CNIA 1ZAYA 3LTEA 4ZYLA 3KKEA 5TQJA 4YWHA 2FSPA 3CKMA 3H6HA 3F73A 1EWKA 4O1IA 1EFAA 1NATA 1DCMA 3JY6A 3KYJB 4H60A 3H1GA 4JASB 5EWLA 3NHMA 2QR3A 4G0PA 4H3KB 3HVRA 3C3WA 1YIOA 4TMYA 4HNSA 5KQMA 2FVYA 4RDCA 1FFGA 5EWMB 2VYCA 1DG9A 2R4QA 1FFWA 1A2OA 4G86A 1Z16A 4MRMA 5BRAA 3KG2A 4Z4EA 3O21A 4IF4A 1U2PA 3NNNA 4MLCA 4ZMRA 4ETNA 1E6LA 2QZJA 3O1HB 2JBAA 1RPJA 2QU7A 2R48A 1NXOA 3O75A 4LDAA 5IEBA 3D8UA 4NQRA 4N0QA 3Q7RA 5JNWA 3S99A 2IPLA 3H75A 4TLLB 4EVRA 1BAPA 4RY0A 3A10A 5T7BA 1DRJA 4WT7A 4L4UA 2MYNA 3GBVA 4KVFA 5TE9A 2NZVG 3C97A 2FMKA 4WUTA 3FFXA 1B00A 1MB0A 2ZAYA 3HK2A 3FGZA 4UHJA 4KREA 2FEWB 2WJAA 3I45A 3OLZA 4OATA 4PEVA 1TLFA 3BRSA 3EQZA 1IIBA 4MR7A 2TMYA 5JS2A 1D2AA 4LX8A 3CTPA 3E3MA 3OM1A 4XFKA 3FDFA 4LDZA 3K4HA 5DLEA 2P9HA 4Q6BA 2IKSA 2E4XA 5JNSA 2FLKA 2CWDA 5HSGA 5IEJA 2W42A 4EY3A 2WY2D 4M88A 1NTRA 2JK1A 3RVPA 3LFTA 1M5UA 1QQBA 4YV7A 4O5AA 1BVHA 1TMYA 2IYNA 3R0JA 4MS1B 3O2JA 4LZLA 5T3YA 4KPYA 2ID7A 3SY8A 1T34A 2CHEA 4DQDA 1XHFA 1FFSA 2Q5CA 4NCBA 1NXXA 4RXTA 3TD9A 2L18A 3IP5A 3F7NA 1DRKA 1ZESA 3N8IA 5BR1A 1ZH4A 3OLVA 3GYBA 2PUFA 2PL9A 3CZCA 4NV3A 3GA5A 3EJWA 5TQ2A 3C3MA 1W25A 3IP6A 4MQEA 3CNBA 4RS3A 1NY5A 2L19A 3Q9SA 2JRLA 3MMNA 3IP7A 3FFTA 2E4ZA 4W5RA 3RVRA 4OLAA 1OXBB 1D1QA 2FN9A 3LUDA 2AYXA 3BBLA 5D2CA 1Z12A 3H5WA 1QP0A 1P6QA 2IPAB 3OQNA 2GWRA 1PHRA 3N0WA 1LK0A 3G85A 2WWVD 4RSMA 3QEMB 1C0EA 1JYEA 2QVCA 4XAQA 3QLVA 3H5TA 4KMRA 4MQFB 2VUHB 3L6UA 2LIVA 5IBQA 5EWMA 2E4VA 5JNUA 2OENG 4Z0NA 4GPAA 2QW1A 1USKA 3QX9A 1YTUA 1CEYA 4YP9A 3RVJA 1S8NA 4IMIB 1M5TA 1Z17A 4MYRA 4YR7A 1VPWA 4D74A 4EYKA 4F3TA 1URPA 4S05A 2M98A 4KV7A 3SAJA 5KWSA 7ABPA 4W5NA 4G0XA 1GLGA 1YMUA 2JB9A 3P9YA 3IDOA 3JPYA 3KTOA 3H5LA 4RKRA 5JNRA 2NT4A 2WJWA 4D6YA 4QYMA 1L5ZA 4F12A 3HCWA 2B1JA 3H5IA 3RVQA 1D4ZA 3M9WA 3UK0A 1DP4A 2PL1A 3DGFC 2FMFA 1YS6A 3O74A 4Q6WA 2GX6A 2PUAA 3DBIA 1ZH2A 1P2FA 4G0ZA 4KQCA 1P6UA 3N0RA 4WWHA 5EWJB 4Z9AA 4EUKA 5FWXA 4MR8A 5TQ0A 3VNAA 3H5OA 4RK6A 3OM0A 1EHCA 5TPWB 3T38A 4F11A 2ID9A 4XLTA 3LMKA 2L17A 1E2BA 2FQYA 4G97A 4ETMA 1GUBA 2LP4Y 3KHTA 2MYUA 4JB2A 3HO1A 3CHYA 4E7OA 1JDNA 4DN6A 1D5WA 4H3HB 3KSMA 4JP1A 3C3KA 4MS1A 4E7PA 1DCFA 2NT3A 1BA2A 4YLEA 2WMYA 2JVIA 3E61A 3Q7SA 2HQBA 3SNKA 4KQ9A 2B4AA 4G0MA 4ZPJA 1MIHA 1Y1LA 3EODA 5CNKA 5IUNC 1VKRA 4JOQA 4P98A 1DC7A 3CLKA 1VRVA 2FQXA 4G0OA 1YK0A 3HUTA 4YS6A 3LUAA 1RZRD 3H5VA 2RJOA 3LUHA 5FBKA 4ZJPA 1ZGGA 1ISSA 1YVUA 1TVMA 4W5TA 1LBHA 3H1EA 4MS4B 2O20A 3HDVA 2H0AA 3HXMA 4PE5B 1PEAA 3MQ4A 3KYIB 3OMWA 2FQWA 1ISRA 4EYGA 5PNTA 1QP4A 2FTKE 1JBEA 2IPMA 3I5AA 1YMVA 1QP7A 3N0XA 3K9CA 3I42A 5B3JC 4ZMSA 2J48A 1ZY2A 3DLHA 3CZ5A 1C4WA 1A04A 4N76A 3QEMA 2FLWA 4IGAA 1DZ3A 2VK2A 1ZDMA 4KZKA 1E6KA 3B2NA 3KJXA 2R47A 3QEKA 4MS3B 5JS1A 1USGA 2FMHA 1ZHHA 1JWLA 4MAAA 4OBBA 5BQ3A 4LE0A 3LUGA 5KC8A 3DLBA 1DBWA 3HS3A 3N53A 2GKGA 3EGCA 5EWLB 1NXVA 1BDHA 2MYTA 3CG0A 4FB4A 2IOYA 2RJNA 3RVMA 1R8JA 5HM6A 3MF4A 1BDIA 2PUGA 1Z15A 1MB3A 4B09A 1A0OA 1TM2A 3HUUA 3M9XA 5GQSA 1UDRA 3OLXA 3EQ2A 3KS9A 1AB5A 4RXUA 4S04A 9ABPA 3RH0A 1DJMA 1QNLA 1TJYA 2E4WA 1EWTA 3OLWA 3GWGA 4PZ0A 3TX6A 3LOPA 2PMCA 2HQOA 4YO7A 4WXEA 1J56A 3T6KA 1APBA 2CD7A 2FW0A 3HEBA 4JB0A 5TPZA 1AB6A 3F6PA 1NXPA 2ZWMA 5BRJA 2V0NA 3CRNA 3HZHA 5KQLA 3EDCA 4N03A 3QX8A 3G1WA 3TB6A 2A9RA 3QLUA 4FE7A 4MR9B 5DGCA 3UKJA 5JNTA 4PYRA 3FMVA 1M2EA 2FEKA 1EWVA 3LKVA 1QO0A 1I3CA 4MR7B 4RKQA 4YCSA 1KRWA 5CHYA 2QVGA 3HDGA 2PUBA 1ABFA 5GOTA 1K66A 3KLNA 4KK3A 4DADA 2MYPA 1JX6A 3T95A 3MYYA 3NHZA 2YHBA 1KMIY 1GCAA 4IRXA 1USIA 3W9SA 2LUOA 3QLTA 2PUCA 3A0UA 5C5EA 1KGSA 1DBQA 1GUDA 1K68A 1FQWA 1P8AA 4LE1A 3CG4A 1W9HA 3GL9A 1PNRA 2PLNA 5IUKC 3C6QA 2QSJA 4O1HA 3QK7A 3OMXA 4ML3A 1CYEA 1SXIA 3DGEC 5DCLA 3HJFA 4PICA 4MLDA 2FEPA 4RK0A 5CNMA 3ILYA 4Z4GA 4QPJC 2AYZA 1ZGZA 3L49A 4LE2A 1M2FA 3IP9A 3LUFA 5TQ2B 3JS5A 4RK4A 5FWYB 1Z13A 4Z4FA 3LUKA 3UUGA 2CHFA 1YK1A 1ZN2A 4KRFA 4XASA 3GT7A 2XDYA 4RY8A 1Z18A 3JTEA 5KQPA 4QICA 3D02A 3RVKA 4ETIA 2RGYA 1KRXA 4EGSA 4MS3A 5TPZD 3N6VA 1LJUA 1F51E 4EVSA 4EYQA 3OO0A 4Y9TA 1JHZA 3NNSA 1Z2EA 3Q41A 2M1ZA 1JL3A 3TO5A 3BREA 1LBIA 2PUEA 1SD5A 4N0PA 4RU1A 4GNRA 5IUJC 2L2QA 1U0SY 2JVKA 4TN5A 5HQJA 3CS3A 1QO0D 2NZUG 2MSKA 1PEYA 1QMPA 3M6MD 2JCGA 2P4UA 4RZSA 3SQNA 5ED4A 2H3HA 5E3JA 5IULC 2F8TA 2WRZA 5F64A 1VLZA 4W5OA 4QYWA 3OQOA 1OXKB 1DBPA 2BGGA 3NBMA 2PE5A 4L85A 1WETA 1MVOA 2PJUA 4NICA 4OTZA 1Z2DA 1RXIA 3HM9A 3MA0A 4D6XA 2IDMA 2YHAA 3O2SB 3QELB 4JA2A 2E4UA 4W5QA 2LPMA 4UHKA 2HPHA 2NUBA 3CU5A 2IPNA 1EAYA 3IPAA 4G0YA 1JFSA 4FE4A 2A9PA 2I6FA 3LKBA 2VUIB 3ROFA 2PUDA 4MR9A 2OQRA 1RNLA 2PAFA 4MQFA 4OG2A 4HYEA 4P1ZA 3CFYA 2QV0A 3OO1A 3KLOA 3GRCA 3URMA 1F4VA 4LRQA 3Q7TA 4CBVA 1FSPA 3O2QB 5CNJA 1HEYA 5FWXB 1RXEA 4MR8B 2DRIA 5TQ0B 6ABPA 5KC9A 1NXSA 4N47A 2R25B 4RWEA 4HNRA 5I4CA 4IMJB 3RVLA 3LUJA 1U2QA 4WXMA 4XARA 3JVIA 4KK4A 4MRMB 4WZZA 5B3JA 1CHNA 3HV2A 4RY9A 2KYRA 3KCNA 3OQMA 3ROTA 4KFCA 2QXYA 4EYOA 1JH9A 1Z25A 3RVOA 4NCAA 2JBAB 2X7XA 2RDMA 1L5YA 4RXMA 6CHYA 2HQRA 5HKOA 3JPWA 3H6GA 3DZDA 3SM9A 1JFVA 1SXHA 4Z9BA 5KI6A 2JVJA 2MSWA 3A0RB 4Z4HA 3I09A 1LJLA 5C5CA 3QLUC 3GV0A 3QLVC 1MAVA 2GI4A 3RQIA 1JLKA 3FFWA 5EWJA 3EULA 4XXHA 1JDPA 2FMIA 2HJ9A 4TLMB 1D1PA 5FWYA 4Z4CA 1NXTA 5TPWA 1XHEA 2A9OA 4IILA 2FKAA 1DCKA 5IX8A 3EAFA 5DKFA 2F8SA 1BDJA 4OLBA 4RK5A 1ZITA 1H9CA 3IPCA 3NNDA 1DC8A
chains in the Genus database with same CATH superfamily
3H0KA 2E4YA 2O7NA 1Z26A 1Q22A 3AERB 4IYRA 1Y7TA 4D42A 2YUIA 1CR6A 1XCMA 3DO8A 3PXEA 4UHCA 5DCYA 5EEGA 2DH5A 4WXHA 1SHLA 1AA6A 4WOCA 2QVLA 4Y8VA 4FDAA 3RIMA 2PKXA 2QQFA 4PXAA 4AY5A 4Z99A 5LQKA 1AUPA 3QEOA 2NN3C 2OUKA 3DEJA 2H7CA 5AHWA 5AW2A 3U3OA 4CWAA 3DKKA 1RPZA 4JOBA 2VFAA 4MVJE 1T1IA 3QPDA 3ZCSA 4DV2B 3CB2A 5KX5F 4UHBA 1C9NA 1JI0A 1QR2A 4LF5B 3RNLA 2BM9A 3F97A 1G2OA 3DR3A 2BCJQ 4DLZA 5T8KC 3NP7A 4RJIA 1NVVQ 4URUR 1XWIA 4F4UA 5KJCA 3IVMA 4IXNA 1PUJA 1D9XA 2ZSUA 4OP3A 4W63A 2Q3EA 4RTKA 5M7EA 2XADA 1JPNA 3O73A 3WIEA 1ZRNA 1ZUWA 2B4YA 1J1ZA 1VMEA 1FDOA 5B3AA 5DWDA 1FTYA 1XL0A 4B45A 4Y0AA 2O0JA 1ISJA 1FFCA 1P45A 2JW5A 5EZ6B 2JEZA 4CG2A 3HG7A 1ENYA 3LW8A 4MWOA 3SHFA 2Z43A 1V0JA 5K0JA 1GL6A 3E9EA 1XZEA 1N32B 2FOLA 1ZRHA 4MV5A 1AQLA 1UANA 3O3CA 1VOTA 2CVFA 3FWYA 3H6HA 3KEGA 3MLAA 4RPIA 4PCVA 3E5HA 5IW8A 1NATA 3K31A 3L41A 2F7SA 3ESAA 2Y68A 2FOXA 3DE4X 5C3MA 1U0GA 5BYJA 1NU8A 4EGJA 1CIVA 2QGNA 3I6QA 3DCJA 1UT8A 3JSXA 3T12A 2UVQA 3FVQA 5BUZA 5AJWA 5KQMA 2DHEA 2H8GA 2WIDA 4JJ7A 3FOFC 5KBYA 3X1JA 5CB4F 2REQB 1MXFA 1UJCA 2QTCA 2QN8A 3BE8A 2JGRA 3IUBA 5CX4A 4Z4EA 2DOKA 4KL8S 4TSRA 2YH2A 3RS7A 2XVZA 1FL9A 4RV4A 5J1TB 1KQFA 3UAYA 2DH6A 2V6FA 5DNYB 1NZDA 1ZI6A 2JBAA 4C6RA 1A1VA 1M7GA 3CH5A 2JFQA 1KO8A 2JF0A 1RYBA 2F8LA 5LQUA 4G3XA 4DDKA 1JKXA 3G2LA 3QTBA 1QVWA 2X1HA 1NI4A 2X2OA 3C4QA 2A1TR 1W4CA 1F6BA 1TXGA 2OHHA 1M34B 1U2DA 2PLRA 5D00A 5BV1A 3CLVA 3FFXA 3QVLA 3PXAA 1UPAA 4KMMA 4BB5A 3EXFB 2IUSA 1Z6ZA 3I45A 2R1UA 3IVRA 1OBHA 5FV7A 4P0TA 3BRSA 1KEEA 1XQVA 3ADDA 1M6NA 4M9CA 1F48A 1M8JA 4X7RA 3QVXA 5HF8A 4Y1RB 2I6SA 4OV6B 5DLEA 4M9UA 2QTVA 3OFKA 3JQBC 3P1JA 4H16A 3ZI7A 2FF5A 3DVQX 5JNSA 3M4JA 3WMWA 1F1JA 2M32A 2OAQ1 2QX8A 4JJZA 2JJQA 3VYTB 4B6JA 3CZPA 3H9QA 4ZAFA 3LYUA 1M8GA 2I22A 4MXDA 2F4VB 4G0WA 3ZYCA 5DISB 5DHRA 3DE3X 3GNLA 1WB9A 1NASA 3FYHA 4LXXA 1L7AA 5JROA 3PENA 2WQ7A 1P7YA 1KP2A 3MK31 4UU8A 5B36A 1GGMA 2HXGA 5CFZA 5J4VA 1XHFA 4PAMA 4KYUA 4RJKA 4RXTA 4OK3A 1CUBA 3RFVA 3JCZA 2ZREA 4M21A 5EXDA 1JDUA 3TRHA 2A2ZA 4QFDA 1WW2A 2EJTA 4OGGA 1PZEA 3ETDA 1XDZA 1D2NA 1D2EA 1OC2A 1NY5A 2XE6A 2F3RA 1VA5A 2Z30A 2ZRFA 5KKNB 3ZWAA 3EEOA 2Q6IA 2AOVA 4JD5A 1JQ5A 3ER6A 1CUYA 4LIPD 3GEHA 5D7BA 2HYDA 2PKRA 4DCPA 3IUJA 2CNNA 3Q3CA 5CK5A 3G1UA 3WIOA 2CF6A 4K86A 5C8VA 1OT3A 1N9KA 1RKUA 2Q3CA 4CU5A 4OHFA 3VO2A 3FNFA 4AAYA 4ZAGA 521PA 3AL2A 1M1YB 5JXIA 3H3JA 2DPGA 1G9SA 1NU6A 5JO9A 3DE7X 3MZ0A 2JKZA 4AD8A 1X7YB 1Q21A 4K88A 1WB4A 2ZR9A 3BGDA 3KEFA 4F4DA 2HMTA 1B43A 1PS8A 3L7AA 3ZE9A 3W2FA 1MP0A 2BJHA 3RSFA 3WGGA 4LNAA 1GV1A 3K8YA 1HNXB 2FG7C 5K8VA 1B8NA 1KIFA 2P0AA 3L4EA 4R1NA 2QIPA 4XIIA 5IJAA 2VUHB 4JLVA 5A05A 2YNMD 5E4FA 5HFNA 4GPAA 3UG6A 2HO4A 3KPJA 4RKFA 1UZMA 1G7RA 3JASB 4E13A 4OFWA 3TLMA 1JAZA 2WJHA 2IP1A 3AKYA 4XVUA 5IABA 3F98A 5FNVB 1EFVA 1C0IA 1LK7A 4URVR 3R40A 2G76A 4D9IA 3QI2A 4XJSA 3WKBA 3Q9NA 2EGHA 3GLIB 1DEHA 1VYTA 2ZSJA 4S1NA 1C1YA 2D3WA 5G4KB 1AKYA 2IXTA 4MWEA 2ZB4A 4RE6A 3I1JA 3USCS 3JZFA 2RGNC 3ISVA 1XGKA 1BHO1 1SC4A 4QYMA 1Z0JA 5CFPA 5J47A 2B1JA 4GOLD 3E3AA 4JBYA 1GITA 1GU1A 3RB8A 1TYBE 5IH3A 2VKQA 1DP4A 5DNVA 4UQPA 4R01A 3WTCA 4EJ2A 4L0DA 2P9FA 3W8NA 5KPDA 1VL6A 5C4IA 1BQ4A 4G0ZA 4DDMA 1EG2A 4X24A 3NTQA 1TOAA 3S2GA 5IAOA 1OX6A 5T8KA 4Y2TA 1S3IA 4EPYA 5MGBA 2M2IA 5CYOA 1KAGA 4RGQA 3OM0A 3I1YA 3K71B 4GLOA 4MHTA 2BKXA 4AQ7A 1E1RA 1E2BA 2XI4A 1QGOA 1QF6A 2WM2A 3AEQA 1RLOA 4R0VA 3B1WA 3R4CA 3WQBA 2EQBA 4L15A 5I9TA 2I34A 1DARA 1BC5A 3O8LA 3ZVMA 3H9JA 3A2MA 3HXLA 4CV2A 1QZTA 2D0IA 3SNKA 3I28A 1NUHA 4KQ9A 4PY2A 4ZQFA 2PMEA 2DXIA 3U80A 1GSOA 3B51X 2Q9AA 1G3RA 3KXIA 2G4LA 1Z4PX 3K72B 4CCYB 2HJSA 2ZBVA 4Q4DA 1XZBA 4WDQA 3ZDXB 1Y6GA 3PQ7A 1GKIA 2FQXA 4H7EA 3UV6A 3FE2A 3U16A 5JSYA 1QDEA 5F9FA 2FW8A 5KCMA 2Z9BA 3OQ6A 5FBKA 5HUHA 2LVBA 3NM5A 1IUNA 1DOHA 1LVUA 4ZQGA 3NMUF 5ALGA 1VBFA 3HA2A 3TW8A 2Q3JA 3RT1A 4V38A 2Q27A 1UKYA 1U2SA 1PEAA 3AWIA 3BFXA 3GEPA 2Y1WA 3LW7A 4HXYA 5M3BA 3ZPXA 5KC9A 5MDHA 1XTTA 3U4CA 3F4KA 4JEIA 4EYGA 3HXOA 4FM9A 2GZRA 3NJ8A 4D5GA 3UXHA 2KQUA 4I4TB 1NWHA 1A9PA 1XC7A 4P93A 5FOUA 1ZN8A 3ZDAA 5ALSA 1LRJA 4CTJA 4RZQA 2J48A 1CJMA 3UOAB 3DLHA 1NPDA 1Z4MA 3GGPA 1FTSA 2OSBA 6YASA 4P3OA 1SG0A 5KHAA 4M0FA 4Q4CA 2RKWA 3AVPA 2MR5A 3SI7A 3TNFA 2MT9A 2HMVA 3AG6A 5BSHA 1QTIA 2CW5A 1BWSA 4Q3EA 4RE5A 4C21A 3A05A 5HIIA 5KQSA 2BMWA 3RPEA 2IP4A 2Y4NA 1GZVA 3ETGA 3NHAA 5FUYA 5HXAA 5I4IA 3RYCA 3D1JA 3FMPB 5HRAA 1Q0QA 1HSZA 4YUYA 5HM8A 1A5AB 1N5LA 2F64A 1P72A 1CS4C 1ZC3A 2REBA 4L1KA 4RABA 2B4RO 5F5LA 4BKPA 1QGZA 5BXYA 1JR2A 2EKDA 4KH1A 2Q5OA 3GFFA 2BFCA 3HJAA 3LUPA 2DZDA 1QFZA 3HVKA 2GK4A 4I5EA 4O4LA 4U7FA 3E2MA 4RH1A 3SR0A 3ECAA 3JRXA 1A98A 2BGIA 3DMGA 2V9PA 4Z9FA 4S04A 1VZ2A 1AMUA 5BVHA 2AQIA 1VLLA 3JD2A 1MN6A 1ZNWA 2XHEA 5EHQA 2CDRA 6GPBA 3LOPA 2FJ0A 3LZCA 3G2OA 4EB3A 1K89A 3KQUA 3ULKA 4XPZA 1NI4B 2HK6A 4AMVA 1KBZA 2D13A 4DMHA 2QUHA 3HBMA 3FPBA 1OAAA 3ICWA 2OVFA 1U6IA 2HHAA 2XSZD 3V4FA 3VNVA 1XLVA 4K9DA 4QDXA 3R3SA 4OI0A 3H86A 4KQFA 4ASUA 2A9RA 4FE7A 4QTXA 4DJAA 2IIBA 3UT0A 1AQNA 3G89A 1BH6A 1FNCA 1KH3A 1V3UA 2NU6A 4CQLA 2FEKA 4HTFA 5DBHX 4RKQA 1I3CA 1B8VA 1IFXA 1KEEB 3AKCA 5FTKA 3E7DA 3RROA 3W1WA 1O8BA 1RCTE 1SUBA 2GTHA 3LQFA 3M3HA 3JWEA 2BR5A 5A9SB 1JDVA 2QTVB 3OPNA 3LQKA 2A59A 3I2GA 1H1LB 3MGAA 4HUTA 3KLNA 5KSWB 5F7ZA 4ENWA 1SCBA 2C5SA 4TMZA 1ID1A 2QL7A 1RP1A 1GCOA 4HN4B 2PUCA 4TWRA 2OPBA 3VR4A 2ZI7A 4K9MA 4XUEA 1LI7A 3HZOA 1LK5A 5JZSA 1BG6A 4O3MA 1IONA 5K3CA 3V7UA 4FFBB 4S1PA 1U94A 1E63A 1KVSA 1P1KA 1VFPA 2NYRA 3GL9A 4YJ3F 1J8YF 1GAEO 3AZOA 3OFNA 3EVEA 4FZ5A 4FQ5A 1IVNA 4JC4A 1U2GC 4YCJA 1N2HA 4PICA 4FZJA 4U6NA 3HBFA 4HFRA 4ACBA 4JZKA 1P80A 1B6RA 3CLUC 1BX1A 3COVA 3WJ2A 3A6PC 5F7XA 3W5AA 4Z1OA 4YAFA 1DDGA 4RK4A 5FWYB 1EB8A 2Y3IA 3EIOA 1WWKA 2GXUA 1OC4A 1WUHS 1HH4A 3KHKA 3P9PA 4HOYA 3V2IA 1Y8ZA 5DLQC 2WWRA 4P3YA 3G8CA 4BFSA 5AH0A 1KDYA 3SICE 3H9BA 4QG7A 5I9BA 3D02A 1QQ6A 1XROA 4AG5A 5JXGA 5TPZD 1GY8A 4K8OA 4QRHA 4RZXA 2FW9A 2RGNA 3NIFB 5FI0B 5JATA 4RACA 1Z06A 2WWFA 5HIAA 1HLFA 4WVLA 5LDHA 3BZBA 2HSWA 1KZ1A 1BA3A 1WS6A 2OHJA 3NNSA 4MNTA 1Q14A 1NHGA 2JJMA 4GDMA 1ZMOA 4MGYR 5K0TA 1SD5A 1EGMB 2Z8YM 3PEFA 3PP8A 4FCCA 2ONKA 4LZNA 1EK6A 5A3QA 3QXGA 1DELA 2VK8A 1SKYE 2BV3A 2O52A 3WMGA 1E1CB 1U9JA 1VBNA 1RHJA 2ASEA 2ZKLA 2OFFA 3QEBZ 4JDPA 3NJ4A 3R3WA 3VOTA 1KY2A 4QYWA 4N40A 1E1QA 2FX2A 4QASA 1UBEA 1C1HA 1GZ7A 3BGWA 4QXPA 1XQ6A 5K0LA 4B75A 3EFBA 1VIVA 3EK2A 1GUYA 1ZU4A 5JASA 1H4QA 5AHOA 1JTVA 2MSEB 2VBGA 3LA8A 4AS3A 4R8VA 2FKNA 1YF3A 3F3MA 1UOEA 4ZVLA 3EY4A 3PXDA 3EIXA 3HQ4O 4LJ6A 3H2KA 4OJQA 1XN1A 1H65A 4DR1B 1JW9B 3TTTA 1CVLA 4KW7A 2VTVA 3TTXA 3REQA 3RAEC 2IU3A 4PGHA 5AESA 3EW9A 4QM7A 2WKSA 3O4GA 4HQ6A 3WAJA 1U81A 2PUDA 4NH4A 1RNLA 1KI9A 2JGFA 2OO5C 4MQFA 3U1VA 5BT8A 1BW9A 3CFYA 4HVLA 2BRUC 3PDUA 2Q2QA 4LHXA 1QAOA 4QOSA 4WKBA 3URMA 5JECA 3IVAA 2XECA 4X5OA 2HWXA 1NR1A 2XA9A 5JNLA 3ND9A 2DFLA 3O2QB 1RXEA 3FN4A 3KPWA 2FJPA 4BKMA 2NLOA 3PNBA 2HV8A 4GHWA 4IAOA 3SZGA 3PT5A 3WAKA 1BMTA 3PC3A 4JYMA 2VDVE 5FB3A 3U62A 4XCXA 4C04A 3FTNA 4NAVA 3TLYA 1H9AA 5GY7A 4MRMB 1U11A 3WYBA 3FVWA 2Q4TA 2O2YA 4UD6A 3ZGLA 1AXGA 1U8EA 2EJVA 1RC0A 5A0FA 2WWIA 2VZ0A 5LB2A 3AVUA 2WW8A 1F8GA 1HQKA 2YYZA 3AY7A 3QE2A 4DOMA 2APJA 4D0LB 2J07A 3E35A 4V24A 2L42A 4P4NA 2JVJA 2MSWA 2X22A 1T5SA 1M1NA 1N57A 5KYGA 1S2LA 3ZVKA 2FUKA 4RDHA 3NHPA 4RVNA 1JLKA 3AG5A 2VP5A 3EF3A 3QVTA 2O05A 1E6WA 3KOWA 4BP8A 1KRHA 2Q9CA 2M6LA 1AGNA 1YR1A 2WQZA 3DO6A 4NEQA 4RTPA 1PL6A 2XGMA 4QQRA 4I1RA 2ZUFA 1TIBA 1MKYA 2WSIA 5IM5A 3BMNB 3TW8B 1XQXA 4RCVA 1EEHA 4OM7A 3TJMA 4HPWA 4RK5A 2WYOA 5B55A 2H92A 3I4FA 4TZKA 2RI1A 3S5JA 5AM0A 3QF7A 1G5RA 1QGED 1J0XO 2ZEJA 3IXLA 2XD4A 2ZS9A 3NANA 1DXQA 4Y0VA 2QVBA 4C0SA 1W0CA 5DK6A 1NVAA 1TIPA 1BXKA 1B0AA 3QF4A 3GJ0A 4HYTA 2I1VB 4DCOA 2G4CA 2OAP1 1I94B 2GD6A 3AB8A 5FJIA 2UZ3A 4WCDA 5ELXA 2OXRA 3IOBA 2RBGA 2E87A 5K05A 4G5XA 3F6CA 5FBZA 1Z5GA 2O23A 1QKKA 4YACA 3K35A 1DTWA 1Q1AA 3I4CA 3LXXA 4R1TA 1I10A 5CFLA 1P7ZA 5IJ0A 4MGEA 3RYCB 4P4SB 1UEIA 4OHKA 4YASA 3ILHA 1IC6A 2H4ZA 4RVOA 3ST7A 2HMSA 5EJ7A 2X8WA 1F8UA 4OHXA 5JCXA 1DKUA 2NIPA 3C0KA 1QIDA 2NM0A 4TV8F 4B3IA 4Z7NB 2VEDA 3B8EA 3M4NA 4O4LB 4PG6A 5BN5A 2A1UB 5AHKA 1TCVA 2BN4A 2GLTA 1X94A 3ETEA 3X1YA 1H2HA 3LHKA 3OHMA 1C1DB 3GDGA 5ABPA 1X7XA 1YZHA 1E7WA 1TCAA 3OZUA 5DT9A 3RVSA 5BVHB 4N48A 1CNMA 3GBPA 1IY8A 3ETLA 4KDCA 1VJ1A 4TXMA 3EQ7A 1ZM2A 1JH8A 5DHFA 4W9RA 1NRIA 4AT1A 3KEOA 1SPXA 1E9AA 5A6VA 3QH4A 4RLFA 5DN9A 5SICE 4C0KA 2ZSAA 4OBWA 2VJCA 4YDQA 1U2GA 4YONB 4DLYA 3HVRA 1RCFA 4F45A 3MB8A 1CJBA 4HH4A 1PSDA 2NU6B 3L8CA 4B34A 2VJDA 4P7GA 1GRCA 4IUYA 4IKOA 4C20A 4DNOA 2MMGA 3UPDA 3LDFA 3NV7A 5HKLA 2XQIA 1DXOA 1ZA2A 1OXTA 3DKVA 3KSUA 3DR5A 4OA8A 3R7WB 1RWWA 2QZJA 1XCJA 1YL7A 1F2VA 5KNCD 1Q1EA 4AJOA 3WTBA 4EYKA 1G18A 4QXRA 2JIRA 2VWQA 3ZHOA 4BE7B 4EVRA 1T9CA 4X1KA 3UH1A 4Z54A 5KVCA 1O96A 5U4XA 1L7BA 3DTYA 1WPRA 4PAOA 2BT4A 5TE9A 4BFYA 2VHJA 4XD2A 3PJFA 1SA0A 3DZ8A 3O91A 4P0QB 3NIDB 1LPOA 4S24A 1XELA 3AKEA 3KKZA 3FGZA 4PCUA 4X00A 1Y9JA 2FJUA 3N8NA 2DPLA 5TEWA 1KQNA 3TAXA 5DN6D 1J07A 5AJVB 2WYIA 2F1HA 4G8DA 4KNVA 2O8VA 4NZPA 1JYSA 1NN5A 3OHSX 2PUJA 3FDFA 3PUHA 3K4HA 4BLVA 2P9HA 3FI0A 5TR9A 1BVRA 4NXMB 3NI2A 2CWDA 1DFIA 4NBNA 4K0RA 3QXSA 2JK1A 4OXIA 4WFJA 5K3SA 2ESRA 4CR8A 1G8MA 4Z7OB 2Y8EA 3AEUB 1M5UA 4H3VA 2QY6A 2WU0A 2Z6AA 1TVEA 3H42B 5A1JA 1NQUA 3SMQA 4R0MA 2YV1A 1V8FA 3LK6A 1V25A 4PXSA 4D5EA 1FNNA 2PR7A 1KZ6A 4KDEA 2GS9A 2BHLA 4BL5A 4IX1A 1B8UA 2CLEB 1IOWA 3CLSD 1EZ4A 4R8KA 5KNCH 5B4TA 1P0PA 2IYPA 4E6PA 1O0CA 4JBGA 4BFVA 5MN6A 5T57A 4I4TF 2VNJA 2AD5A 2ZI6A 3GA5A 5T4FA 4CT0A 3JW8A 1COWD 5D01A 2WPDD 4ZEWA 5BRNA 1RC8A 5KPJA 2JCBA 4L5BA 1QIJA 3L7BA 1RWPA 2GAFA 5BUSA 3MMNA 1NIJA 1YJAA 1PKXA 2F62A 3TM4A 4EPVA 2Q5QA 3LNTA 4V0KA 4XWAA 3ZH9B 3VHLB 3MWLA 2C54A 2FN9A 2PBZA 5G02A 3GPIA 3TNYA 2GILA 3WDSA 2R7KA 3ANTA 1GPMA 2PMDA 2N0SA 3GUHA 2FWIA 5DSXA 1HDYA 3I6BA 2WVHA 4LF8B 1TA0A 1TO6A 2EIHA 1U0NA 3REQB 1FDTA 2ZIXB 3T1YB 3EXHC 1OYWA 3FUXA 3SYKA 4C05A 4LYAA 4MQFB 1I9CA 3R6DA 2QAGB 2X0KA 2AYYA 5EE1A 1K97A 4FP9A 1H9BA 2IOQA 4QXMA 3DHWC 1LQTA 4C7OB 4E5YA 3I9MA 3A2NA 5TARA 3KB1A 1WUIS 2AD1A 2R5FA 4IKEA 2ZB3A 1W1UA 2IELA 1AMNA 3BKWA 3AUSA 4Z5XA 1RAIA 1HE4A 1RCUA 1Z8DA 3NBUA 2EQ5A 2PZEA 2Z58A 3PB3A 1GUZA 2WK1A 4IKPA 4AMBA 2M98A 3A4YA 4URHA 1ZWKA 4OGLA 3VU0A 2I99A 3LZDA 3R3UA 3ZQKA 1GLGA 2JB9A 1F6DA 1KY4A 5C1DA 4KAXA 1P0IA 3IPYA 3MS4A 3DVSX 3SLRA 5MF6A 4UZSA 1BDBA 3VPGA 5JNRA 5IHPA 1NOJA 3DBLA 1L5ZA 1E1MA 3GLHB 2F55A 3QEAZ 2A3NA 1UDBA 2ZPAA 2R11A 1QNFA 4YK7A 4ZQBA 1M6HA 3D7LA 1P2VA 4PZUA 3UMVA 5EERA 3OEED 1KL7A 1W36C 1QG6A 4P34A 2XTMA 5K6TA 3TEJA 1VLVA 2Y1DA 4H7FA 4JNCA 2CEAA 3IR5A 3LBFA 3HRHA 3L7JA 2V1XA 4OI1A 1U7TA 2Z09A 3OPVA 3GUUA 1EFTA 4GPBA 3U4MA 2WD7B 2AK3A 3A4LA 3CHYA 2E7ZA 4E7OA 5C7LO 3RU9A 4H3HB 5EYPA 2FZEA 4J2HA 1R74A 1ULBA 3M3DA 3V3KA 4JBHA 2KHZA 2F90A 3C8DA 1JDBB 2JVIA 1KXZA 3KQMA 1SU7A 5JMWA 3ADCA 1YRBA 4L72A 2C03A 3UZUA 3QF4B 4IIEA 4KGXA 1T2VA 2W37A 3AQIA 1U1EA 4G0NA 5BV8A 3NTOA 3EFEA 2AJCA 4M53A 4P3XA 1C9JA 5KAMA 1RS0A 2F3QA 5FEUA 5ARDA 1ONBA 5JMOA 2O59A 2QLBA 1IXKA 2IUEA 3AGPA 3OJWA 4EUFA 1EHYA 2JZNA 4QUHA 3S2FA 3H5VA 4LQLA 2PXHA 1Q77A 3VZCA 1YDWA 2ZYHA 4HX5A 1YI0A 2BC9A 2DQYA 2FB9A 4ALNA 5EKUA 3CCBA 2UUOA 2WJJA 5EMHA 2H29A 1VYUA 1P4JA 5D1NA 3QWIA 2Q9UA 4RUKA 4PE5B 1XKQA 1M66A 1XMJA 3R7BA 5BV0A 1Q84A 1U1DA 5FR2A 1M2VB 1LNQA 5BOVA 4FONA 4EUHA 2E37A 2FTKE 2JAPA 5EINA 2GYVA 1OYOA 1ZIDA 2H1LA 3CT4A 3EHDA 4NE9A 5EE9A 5BN5B 1M83A 3PUIA 3N7AA 3SIRA 3WRXC 3NDRA 3P2MA 3PHGA 3QU5A 3N86A 5ALKA 2XWBF 1KWKA 1M2JA 1K4YA 1X7XB 2WAYA 4LHZA 5ECDA 2F1JA 2P0EA 3DWEX 4R9VA 2JGEA 3A9CA 2JASA 3I76A 4TSFD 1NULA 1SHKA 2CN1A 1DZ3A 3N70A 1IUKA 2ZCUA 3OE5A 4IINA 5DGDA 3WWDA 4DQLA 4YRFA 2ORYA 3OTWA 4GM1A 2O07A 3SC4A 4PG5A 2GK6A 2C8VA 4NC9A 2ONCA 5KTMA 3FROA 1DUSA 1P33A 1SIUA 3GUYA 5CTAA 3O3OB 4NCNA 1NHWA 2ZPTX 3EIEA 4ZPXA 5B3KA 1DHRA 1J8QA 2PRZA 1R8JA 2H31A 3LPNA 1LPSA 3PGKA 4CU2A 2O5EA 1UBLS 3IPXA 1DUVG 1V4BA 1VE5A 2NPOA 2J0VA 4J03A 2C7VA 3GP3A 4ED9A 3AR3A 2P7IA 1A0OA 1TM2A 1JN0A 1ICEA 3DEYX 4L6IA 4BNLA 3QXXA 2I4MA 3KALA 3EQ2A 2J3JA 5F3WB 2C2BA 1T9GR 1J33A 1E96A 1TT5B 1NNEA 1IQUA 3V4VB 2ZBEA 4TVKA 5HFAA 1OI7A 3QVVA 1XDDA 1YRHA 3N1UA 2R7AA 3EIWA 4Q47A 4YO7A 1EFRA 2YS6A 5J3JA 1ISGA 2JA1A 1MJNA 2CD7A 1TM5E 3HEBA 3L0OA 4EM6A 1DWUA 1O96B 2ATIA 2XUQA 4HRAA 1NBWB 4JB8A 4K1LA 4C43A 4F85A 2H1RA 1SA0B 2V0NA 5BRJA 5JADA 1HFJA 4MV8A 5HMLA 4HB3A 2VT2A 3E0XA 3IV7A 3E9CA 3HADA 3QX7A 4LHVA 1ZH0A 3K0HA 3MWYW 1XNGA 2N47A 3OUZA 4FZ3A 2VAXA 1KPGA 3MFYA 1P0CA 1HL7A 2J87A 3S8MA 2II6A 3GVPA 2Q6OA 3AEKA 3OA0A 3KOMA 4W82A 3V97A 1W19A 3WLPA 2HU8A 4N82A 4AULA 1NX6A 3EMKA 5GOTA 2XA2A 3AL0C 3GRKA 1TZCA 1JX6A 3JQFA 3KJNA 4UAGA 1EYZA 5DCUA 3T95A 4DLPA 3GI1A 2YHBA 4IS3A 4O2LA 1USUA 3CPJB 4NOLA 4UXJA 3VR1A 1OJ7A 2LW7A 3OE7D 3NOVA 3VSCA 3WGOA 3A1WA 4MLZA 4NF2A 2VR1A 3CG4A 2NSDA 5FFFA 4A9AA 1WABA 3TZCA 1I4EB 2HNKA 2R1VB 1DFHA 1ES9A 3PVSA 2D6FA 3VYSB 3CWZA 3S2ZA 2JBWA 1VHDA 3EF0A 4AWAA 1O0SA 2AFHA 5B6PA 4CGYA 2GEUA 4QJ4A 4YQFA 1DG3A 4RK0A 5CNMA 5L3QB 4IIUA 2B98A 2X5OA 4RJLA 1VHJA 4S1VA 1B8OA 1GA4A 2PEZA 4UUPA 5FLYA 3D3WA 2VYND 1I2ZA 1V1RA 2NVBA 1W5SA 2OO3A 3TH5A 2W6MA 4FUTA 5HKBA 2JFFA 1RPTA 2UVPA 3CNEA 4LWQA 5CTJA 5KCZA 2ALJA 4O1MA 2JFXA 4DCVA 4GL2A 2P3LA 2ZM6B 1VL5A 4I1VA 4GMKA 2EVWX 3RJ9A 3VR3D 1ND6A 3N6XA 3O47A 3QU2A 4NOJA 2OXIA 2EIXA 3LY9A 5IM4F 1C7QA 2OGSA 1L4NA 5HK9A 2HT1A 1JEJA 3N6VA 1XZPA 2PGAA 4IY1A 5AQEA 5A3RA 2FOIA 4DV6B 4EA6A 4DNQA 3PPVA 1P2SA 2GBGA 4AIIA 1JDZA 1JL3A 4QUBA 3V2GA 3L92A 4CTMA 2IYVA 2VK1A 1MC5A 4UVIA 5JSKA 4LAFA 4BZXA 1E3WA 1IUOA 5C35A 3AHJA 4PZEA 5AT1A 5K0SA 1IEXA 3CS3A 1AK1A 3M6MD 4K05A 2AZ4A 2HIHA 3MBIA 3DVAB 1CVIA 1LJ8A 4FOTA 1EG7A 4LV8B 2FWBA 1KTIA 1A71A 2WVJA 3I2HA 3PFNA 2YIMA 3NBMA 3HK2A 4O4IB 4AKHA 1GDHA 2XGJA 2H63A 2C7BA 2KE5A 5GAJA 4G65A 4MQUA 3CNNA 5K8CA 2IS6A 4UOQA 1E66A 1WXIA 1QP8A 2YMMA 4LPKA 4WNCA 3OBBA 2IHBA 5KNDH 5KWVA 4DFDA 2Q2VA 1FZTA 1OWPA 1JJBA 5AK5A 4R9UC 3RC7A 2WG2A 6AT1A 2PSFA 4G85A 1SH7A 2IPNA 3JYLA 4TL8A 3T4PA 4IJWA 3UJ7A 1JFSA 5I47A 3GRZA 3LKBA 1K75A 1L5VA 5D86A 1VI6A 5FOSA 3GNQA 1Z6PA 3AYXB 4C3VA 3Q98A 2RBKA 3BXFA 3N87A 4G5HA 4CEJA 3R3HA 3F5QA 4KYVA 1L5GB 3MMXA 1RYMA 1PV2A 1NXSA 1G16A 1PRYA 3GFPA 3HJGA 4B6GA 4RWEA 2BR4A 1T8YA 5D3MA 5LXTA 1IPFA 5GMOA 4HDRB 2I1WA 3IT2A 4NULA 4X94A 1EFLA 2K6GA 2QX7A 4WLNA 1L7MA 1M10A 2QYOA 1OUMA 1P19A 3KLBA 3IQZA 1SVWA 2KLBA 5TJ9A 1J09A 4FVTA 3WRXA 4EK9A 3L8HA 1J2TA 5LZ8A 2ISSD 4L3WA 4EY8A 2G82A 5TXGA 4L57A 1YXMA 4LVOA 1DO2A 2D1SA 1X1CA 3M7IA 2O8NA 1Q0PA 3K8ZA 1PVVA 1EHIA 1DAGA 3QVJA 3NDPA 4LMAA 4NJOA 4RXMA 2EWWA 2R6AA 1MBZA 4MIEA 4ZEXA 1A7UA 3ZDZB 1XZAA 3WXBA 2BFDA 2JGJA 2A57A 1FVFA 1HDGO 1VCMA 4EWLA 3I9JA 1ECBA 1B15A 5IVIA 2FPMA 4GKJB 5JQGA 1JG2A 4BKQA 1FF9A 5ILGA 5A02A 4ZJUA 2VP4A 1M7BA 3PNVA 3V8NA 4Z4CA 4J8PA 1N9GB 1FRNA 3DDZX 2WDPA 3JRNA 4PAQA 1UXJA 1AOXA 4R8LA 4QLBA 5FWNA 4ZCSA 2B21A 4JLPA 2I6XA 3U4IA 2E48A 1H23A 3IPCA 1GTG1 1M8PA 1ZVVA 1W4BA 1V71A 5IF3A 2DECA 2FQ1A 4W5JA 4IV0A 2C4TA 5MN5A 4TM7A 1TKCA 3LC1O 4IJKA 4DIBA 3P0EA 2DR0A 4ES6A 2E5FA 2F2TA 2H2WA 2JLSA 5H9WA 1CEEA 2XWSA 5ALUA 2XZDA 3F71A 1C3OA 1ZYUA 2OV1A 1CY4A 1UFVA 4OUKX 3ZGXA 1U8TA 1IHYA 1OI2A 1R0ZA 2JLBA 4PHGA 3B12A 5B1SA 4ZD6A 4FDMA 3ONNA 5IWCA 5L95A 3AX6A 1VSVA 2COEA 4JI4B 2X7HA 2DR3A 3MUFA 1C3LA 3H18A 4YMSA 1XALA 5IJXA 4BVLA 5DASA 4DJ5X 5BSWA 5JBQA 5LOVB 4DGQA 4N8EA 2YN2A 1G5HA 1H5QA 3ZK7A 3HFGA 3M6IA 1DQZA 4B3RB 3F8SA 2PUHA 3WMXA 5I7OA 1XMQB 1YHNA 4CKXA 4AZSA 2ZDHA 4RDIA 1K9SA 4OQXA 1QG2A 4WRRA 3CQ9A 1FS6A 2VRNA 2H17A 3N7UA 4EQ6A 1V1JA 3S5UA 4EQZA 2V7VA 5EP2A 1EMDA 1XLTC 1FP1D 1O89A 4DV5B 3QKTA 2GEFA 4TZTA 3DJFA 5A62A 1VIAA 4PSCA 7YASA 4HATA 1JHQA 3LQRA 2CE2X 4S1TA 3WZMA 1SCQA 3ENQA 4JJ6A 1PCXA 1HFWA 1FFHA 3PUKA 2ZBGA 3UPUA 1ZIPA 2WFZA 4DSZA 4PR0A 1JIKA 1GPLA 2PSDA 5EUMA 1QE5A 2Q28A 2XITA 3LCJA 1A88A 4EMTA 2IEYA 4LXQA 5DSZA 2C3MA 1E9CA 3HJCA 5TC4A 4JXZA 4TMYA 2GPBA 1QBKC 3CBQA 2J8ZA 4WZBA 4ZCQA 3BGSA 5JFGA 3Q3VA 4BZQA 5AUPB 1C2YA 3FCUB 1JJIA 1D6MA 1KFCB 1U8UA 2Z2YA 3FETA 4IUBS 3AEKB 4PTZA 1AZLA 4R81A 4WZBE 4C7VA 2XXAB 2IF2A 2Z9DA 4BNNA 4EHHA 1ODKA 3GZ4A 3NNNA 3OQ1A 4Y2HA 5AICA 5ALNA 5CGZA 2GRUA 3SEQA 1D2MA 1QGUA 1UJNA 2CKMA 3O1HB 4O63O 4RIGA 1E5QA 2QU7A 4AKEA 4CE6A 3RUAA 4TTTS 3BAFA 3EG9A 4N0QA 4LGVA 2NOAA 5JNWA 3PJDA 5BYKA 3U56A 1LVGA 2F43A 3ESXA 2ZYWX 4HGPA 3OX2A 4ICIA 4IX9A 2P4SA 4K9OA 3NWJA 3RHTA 1ULAA 1NF9A 1Z7EA 4ZT3A 1GG9A 5GTDA 1JR6A 1ZUHA 1DKLA 2EZUA 3MS7A 4MDHA 4O0MA 5ISMA 2ZIEA 3DC7A 3H83A 4L4YA 4TWIA 4DR4B 3B53X 3VBCA 5SY9A 4RTSA 4O0LA 1L7NA 3UO8B 1N8SA 2QPAA 2AFHB 3F67A 4MVJP 1D1SA 4NPAA 3TRDA 1QGDA 1ZIOA 2JKVA 1UDXA 3L2OB 2AK2A 1THGA 3NTRA 2N3ZA 5H59A 1K6JA 1XT6A 2CUKA 2W58A 3FFAA 4BTLA 2V55B 1A8PA 1SFRA 4R3NA 4U2FA 1Z62A 5E6SA 3S27A 1UC9A 2HTEA 2JFWA 1IWPB 3PSHA 3NTXA 3KWFA 2W42A 2X9NA 3U17A 3A28A 1AKNA 1M75A 3FUTA 4UNSA 4MGZR 3R74A 1A4UA 2YXLA 2FPLA 2P6OA 3GH3A 2I3DA 5CLHA 3BF8A 3P0HA 1SJ9A 2P8JA 1XG5A 4II3A 3VO1A 5A03A 4ZGWA 5JR3A 2ZJ0A 3KJFA 5AOCA 3ZGOA 1N7JA 1QWSA 1QSGA 2ZT8A 3R0JA 4LY6A 3I5MA 4F9TA 5KTOA 1T34A 3WFJA 1PR3A 3MWGA 1X3SA 4H31A 5DBOA 1FFSA 4P9NA 2DC1A 3DE6X 4H35A 2YJ4A 3F6SA 3IEUA 1DRKA 3BIWA 3DL7A 4GLJA 1E3WB 3B1ZA 3BJMA 1KOFA 4TL7A 2HAEA 3KL4A 2WE8A 1CQIA 3CZCA 5CDSA 3WOHA 3PRKE 2NUTB 2UAGA 4I9HA 3EJWA 2AN3A 3WHLA 5AXAA 1R66A 4RS3A 2DLCX 4UHHA 3OZFA 3VDQA 3B7WA 4YV2A 1JDSA 1I3MA 1WP9A 2SNIE 3VKWA 1U2TA 2GR9A 1EIZA 3IAS1 5AJZA 1T1SA 3Q5EA 4KXVA 1E99A 4YRNA 4FNMA 4LPSA 3NAGA 3GGDA 1HT2E 1YZKA 2IGTA 3GEBA 3BBLA 5AK6A 5TF4A 2WJZB 5CAEA 5EHXA 1UM9A 3CZRA 1TJ3A 1MJGA 1EWYA 1P6QA 4YJ2B 3HDTA 4KQ1A 2C99A 4OAOA 3HPQA 5J23A 4KACA 3FTEA 3MT0A 2XH8A 3D0QA 3PIDA 4BE9A 4DZRA 1VA4A 3FJ1A 3RDPA 1OIWA 2CHUA 2QXTA 3E27A 4RSMA 1X1AA 5IXSA 1SWVA 1C0EA 3VJKA 1JSCA 1WXXA 1JQ3A 1SKUA 2Q99A 5K3OA 4KMRA 2VWGA 4B2LA 3CUYA 1XTVA 2JKYA 5A04A 5EWMA 3JQGA 2A5LA 3BOSA 2OENG 4FNGA 5DYGA 7REQB 1KJJA 4B87A 4Y2JA 3PXUA 4YP9A 3GMTA 4INOA 1CR2A 1RPAA 2FY8A 5TGZA 5BWNA 5HQTA 3IODA 3CVVA 3DV9A 4MYRA 1KC3A 3F6EX 5D3MB 4MWTA 5D5QA 5DULA 5BWLA 5K45A 2ZS7A 1RU3A 4D9BA 1Z8HA 2ZCVA 4YCDA 2G5GX 3ICCA 5KVSA 2Z56A 1EEXB 4UNIA 4EKEA 1ZHOA 3LK7A 3A9TA 5HF9A 4KE8A 4CV3A 4Y1FA 2AN5A 3U7JA 3MPOA 9LDTA 1DSSG 2GJSA 2F9LA 3H4TA 4Y7DA 1CULC 3HGTA 3BK7A 1RJEA 2O1EA 3M9WA 3WGKA 3ZWBA 2BTEA 1UK8A 2BFDB 2GDJA 3BWVA 4MX8A 4F6CA 1KR2A 1HEIA 1YBMA 3BMQB 4FW9A 2FZ4A 1PG2A 2J5KA 1TKAA 3ETJA 4PAGA 5JQGB 4D56A 3ELYA 4JFRA 3TOXA 2D3TA 1L5FA 5F4ZA 2JZCA 3O9ZA 3ADOA 4PFSA 2CBZA 1GLNA 3OICA 1Q12A 1W1WA 3D4OA 4CKZA 5GZ6A 1LSUA 3C7DB 4LWPA 4RYDA 2C4KA 3HO1A 1FX0A 1UJBA 3N0VA 4JYAB 4GVPA 2KWIA 1BFUA 5KAPA 1AUOA 1JE0A 4PIMA 3IUQA 4AZ0B 3GVHA 5C32A 2J5QA 1SIOA 4HB2A 1VGVA 4Z0TA 1V7PC 4DA7A 1ZMRA 3AFOA 3FTQA 1RE0A 1XLTA 4TTSA 3WS7A 3PIIA 2A5YB 4HAYA 3T15A 1RHMA 3I39X 4UBJA 3QOYA 3MFQA 1C3OB 1DAOA 3W5SA 1NYLA 1FOEB 1C3XA 1RC1A 2WYWA 3FIUA 1MH1A 2EARA 2YJ5A 2ZIFA 4G0OA 4M54A 1YK0A 2QSYA 4YQZA 4PYLA 5AW4A 3A37A 4QO7A 3O8OB 4DG5A 1CG6A 1Z5WA 1BX3A 1N2IA 1R5OA 1WEHA 3FWKA 3H13A 4JT4A 1ETUA 4B3BA 1F8YA 2YFHA 2TMGA 1CW2B 1XTIA 3CB4A 1NG1A 1OR8A 5EKTA 3HMKA 2XJ4A 3MWDA 3O4HA 5SZIA 4D9NA 4IHJA 1JR3A 3BT7A 4YBZA 1EDBA 1T9KA 1QV6A 2WT8A 4GGOA 3COPA 4NP6A 1IZYA 2IE8A 3ADKA 4MI9A 2IEGA 5EE3A 3TOSA 4EW2A 5AW7A 4ZVRA 1T91A 2FSHA 3HABA 5HZHA 3DAFA 4EQ6B 2J67A 1P1JA 3LDUA 1KSHA 2XGGA 1W4LA 1G5TA 1WCWA 3U7EB 1RXCA 2VCHA 1A7JA 1U28C 2ZIWB 4GM0A 4MS3B 4PCAA 2PIDA 3RASA 3DMYA 5JWRA 1BCSA 2FMHA 2W9XA 4GQIA 3ZE2B 5ALXA 2A5FA 4IGKA 1IBCA 1NP3A 1ZNYA 1N2SA 1LU9A 4R2XA 5JRDS 2WF5A 3CWQA 1Y98A 3P0FA 1GSIA 3ZHBA 3FPEA 4KXFB 2L82A 3IA7A 3RVDA 4IFTA 2RGWA 1E1RD 5K6AC 1SK9A 3DMFA 5AO9A 1MG5A 3N39C 5L3RA 1L7OA 4QDUA 2Z6VA 4BE4A 5KUTA 4BXOA 1AKEA 1FC0A 1TZ2A 1E32A 1UIRA 3EIHA 4KQJA 3SDBA 1W2WB 2QU8A 2Z1NA 3R5SA 3FVTA 5TT0A 5LPNA 2ZRGA 3A9UA 4N5MA 1ZD8A 1Z08A 2PQ0A 2W2QA 1LXCA 1TC2A 3EE6A 1QGUB 2H1CA 4R68A 3M4XA 4JUIA 5KYWB 1DJMA 1TJYA 3KQTA 3UMBA 2O4CA 2AKEA 3EG9B 3A3YA 3L77A 5AKZA 1N1MA 2F43B 2I8LA 2PMCA 2V7EA 3EXG1 5J2TB 1DI0A 2J1LA 5KKCA 1DB3A 2ZYVX 4B8ZA 5K4GA 3EOBI 3RIXA 2H8KA 1WXEA 2BZ0A 3HZHA 5HILA 5JALA 3T7CA 2IS2A 3VQTA 5A6SA 3G1WA 3MTJA 3QLUA 2VXBA 4Q3KA 4ZP1A 5BWOA 2OXCA 2NTEA 4F92B 1W5AA 2X0NA 3QYAA 4HC4A 2BM8A 2OGTA 3IQIX 4PYRA 3GLTA 2JGNA 2VUSA 5DYWA 4W8HA 4JDUA 3KOOA 4NTZA 4CR6A 1WCXA 3LM8A 3K6KA 2HK9A 3M8KA 4M6WA 4OQPA 5C46F 5E6SB 4DKXA 4B5LA 1E5VA 1RJGA 1OGYA 1ABFA 5ALQA 1NBMA 1KOJA 1M2OB 1QB8A 1RRFA 3FBWA 4IGFA 1PJSA 2I9PA 1ZVQA 1VSBA 2GM9A 1MGOA 4DMLA 4W6QA 1QOPB 3L8ZA 3I12A 4RZHA 3VM6A 2LUOA 5JJBA 1DIAA 5D5PA 3DZJA 3EPPA 4JU9A 3FLEA 4S2EA 1DBQA 3H2IA 2P2SA 2BONA 2IIVA 2F9FA 2VC2B 4WNIA 2FZGA 5CX1B 1NC3A 4B85A 4CT4B 1P8AA 4XB1A 3C2QA 4HXFB 3MTAA 1JKJA 2DU8A 5FI5A 1NP7A 3RSCA 2GD1O 2GYWA 2VSOA 5KNBD 2FXVA 5L51A 3DKIA 1L8AA 3REGA 4M2LA 3RE1A 4Z4GA 2ROQA 1CZUA 4TQUS 1DLJA 2G5PA 4BKUA 1H6AA 1YKFA 3IP9A 1FQJA 3DBVO 5IKXA 1RYEA 1TJPB 3JS5A 2VTKA 1B4DA 5IC6A 1XPOA 4Z4FA 1YQEA 2XMCA 2O3SA 2K2QB 2VJMA 3KQQA 2UZ4A 4XASA 2Q41A 3OD5A 1PGNA 4B8YA 5FPHA 3JTEA 2QK4A 5CAEB 3TW0A 1X74A 1UM9B 1YDHA 1G5FA 4LN1A 4XYGA 2OQVA 1RIFA 5JJIA 1K5PA 1U5AA 1QU3A 4WKOA 3NH6A 4CFZA 3F4LA 3I32A 5LOVF 2VHCA 4R6WA 2FHSA 3D2LA 2IODA 1IBKB 4IIJF 1IWOA 2NU9A 3DDNA 4N0PA 3M1YA 3RR2A 3V8RA 4GZMA 3U9LA 1E7SA 1PZMA 4Y9RA 3SYNA 3TR0A 2Y1KA 1OAKA 3CJTA 3NYRA 4IDGA 5BOSA 2HW8A 3JQEA 1AF4A 3MAJA 3U6BA 2P3QA 3A3NA 2XOEA 1TM1E 3KCQA 4L08A 5ENVA 1X1QA 5F64A 1DBPA 1GILA 2G40A 2WA1A 4XM1A 2BGGA 1AV6A 1V41E 4D9FA 2BIFA 1QHIA 4GE3A 2QEQA 3OIVA 2O2JA 3BXZA 2X76A 3DZCA 2J5BA 3RO7A 3ZX4A 3I2JA 5KNBH 1WETA 3TL6A 4F46A 2QAIA 4G9GA 1OAOC 2PJZA 4CCSA 2UXBB 4HH0A 1W44A 4DBLE 4DIEA 5CA0F 1RQXA 4UM8B 4COOA 4RBNA 2B6NA 4C06A 4BMZA 1RSZA 4BQSA 4HZGA 3A04A 3OFND 5KTYA 2CMFA 2CZQA 3KFVA 3L01A 2GZ2A 3EDQA 1L4YA 1LQUA 4HYEA 4RVFA 4TMTA 3BH6A 2AJBA 2P6MA 1TEXA 4GI5A 4BX3A 2JJ1A 4UFNA 3MUEA 2Y92A 3UICA 1X13A 4OJTA 3B78A 1X1EA 1SBQA 3PG5A 3IE1A 3H2JA 4UE6A 3ZHQA 1YOVA 2EQAA 3BMCA 4LY0A 3HN7A 5HIJA 3PKIA 1WJGA 1V5EA 3B20A 3L8FA 4KODA 4F4HA 2AQHA 3EYWA 1FNSA 2V54A 2Q45A 5IH7A 1ONNA 1FX0B 1P74A 2WD9A 2X6QA 3MNFA 1GGHA 4KIGA 3SF8A 4IG9A 1KERA 1DU4A 3ADPA 1KP9A 4ZYWA 4TXHA 1SUDA 1ULTA 1NLUA 3IIMA 1KVTA 3MJHA 2GF2A 5DO9A 1SC1A 3G2HA 3HY3A 3SC6A 4CIXA 5JQWA 1Y8RA 2RJ3A 1U28A 4FDLA 3SM9A 2O7RA 4JJKA 4K9QA 4Z4HA 1W35A 2RG1A 3ILXA 3DDWA 1MTZA 1Z4NA 3BTOA 1QAMA 1Y33E 5DNCA 3V4SA 3DLCA 3W05A 1KWGA 3KOXA 5CGQB 5EWJA 1FFDA 5FT9A 1AS2A 1FXUA 1G98A 5JSUA 2QJFA 1K2WA 4AYXA 3OETA 3LZ6A 1X87A 3ZWVA 3SC2A 2RC6A 2Z9CA 3KOYA 1GN8A 2V7TA 4GSYA 3NOOA 4X6XA 3B9RA 1XHEA 2QRJA 3CIOA 3OLCX 5L45A 1PR9A 1BSVA 3CN9A 3K2BA 3OTGA 2CZGA 4D4JA 4FMBB 5G1PA 1T6ZA 4L9WA 1CUFA 3LWBA 3NC4A 4A27A 1UH5A 3OZRA 4MPTA 4YMTA 5B7NA 2B36A 3ZZ1A 1S2IA 2QHXA 3PC6A 3G0HA 3PJGA 3RU2A 5BW4A 3Q15C 1PUXA 4EGCB 3VPSA 1Q83A 1UXHA 2NYAA 1HDRA 4BO3A 4FYVA 1XD2B 4OMFG 1IZ0A 1NYQA 1XEWX 2ACEA 2CJFA 1JVBA 4G4IA 5E38A 5KQGA 1LY1A 1YQXA 2J0UA 8ATCA 1A69A 2W2TA 3GRAA 4RTQA 4FBGA 1GG8A 1NW4A 2IUTA 5THKA 1JECA 2BGJA 3ENVA 4AJPA 2DUJA 2YWGA 2ZR7A 1P75A 1K6EA 3MGKA 3DWIA 3T8YA 5J4LA 3FJYA 3NVDA 4KXNA 4J0FA 5JZMA 1O6GA 1DAMA 1EUCA 1WZNA 3OT1A 1K5HA 1YDEA 1T8RA 4YJ2F 1KAMA 3GGJA 4R7TA 1MMFB 3ZDDA 4RH0A 1SKQA 2DG2A 4BXOB 4K6MA 3U7QB 3OLYA 2FZKA 3GCZA 4RV5A 4A91A 1IRXA 3WLMA 3PXXA 2A7XA 4X9XA 1B2LA 2CLMB 2XQGA 3H5RA 4CLOA 1LZKA 2H4JA 3GFBA 3IQHX 2BDUA 1ZMTA 2ZJZA 3TPFA 2AMVA 5DHPA 2C5AA 1Q16A 3OQMA 3D8NA 4F2GA 4MARA 3DE2X 4GRAA 721PA 1YZVA 1Y6QA 3A9RA 4NI5A 3QY0A 2IEBA 1DDOA 4FCTA 4O1IA 4WZAA 2O4UX 2OKGA 2DSNA 3RUFA 1EFAA 3GPBA 1R5BA 4I36A 2QRHA 1E2KA 4H60A 4ZI7B 3PX7A 3LQ4A 3C15C 3PE6A 1E9EA 3QIAA 4Z0PA 1CUVA 1V9SA 3KLMX 4KFRA 4TYQA 5F2OA 2YRWA 1Q0ZA 3S2EA 2EERA 3B1FA 3TLXA 4LS3A 5JD6A 3EBOA 4YREA 4M6WB 1Z16A 1N5MA 2HH9A 5K3DA 3FSEA 2ODAA 1MHPA 1U8CB 1P5FA 3FW1A 4M9RA 2AEMA 5G3ZA 1N7IA 1CE8A 1N92A 1P2UA 1RPJA 1YRAA 3AUKA 1KDTA 3ORYA 1M76A 3GGSA 2PQ2A 3IUEA 5AXCA 3PR2B 4WIAA 5KB3A 4Q9IA 1GT91 2ZB7A 2IPLA 4NR0A 1FQKA 4RCYA 4YI5A 5DWQA 1ADFA 3A10A 3N2ZB 1ULSA 4A7PA 2UZ1A 4G07A 3OZSA 4FX5A 1SXPA 1MX3A 4YJHB 4YT8A 2BKEA 3TQRA 3AR5A 1XTZA 3GAFA 1JKJB 1YT5A 3Q7IA 3Q85A 4DCMA 5BW5A 1Y1TA 1UMBA 1RP7A 4D8UA 4DCTA 2FEWB 2Q5EA 3C6ZA 3IHLA 5AWFC 5C37A 2G07A 2BE9A 2ZRQA 2DERA 4WA8A 2CFSA 3ZHXA 1XVIA 3EGDA 4TYYA 1BGXT 1X7WA 2BGNA 3IE2A 3RD5A 1KYXA 3QV1A 3ZJTA 4MQLA 1WDWB 3GGCA 2Z4SA 5LP6F 3NONA 4K3UA 1NVUQ 1ZOSA 2VJMB 1OFUA 2WY2D 4RORA 1KF0A 2F3UA 1OAOA 2PG3A 2PL3A 3CH6A 2P4HX 2X19A 4D9MA 5SYAA 1KS2A 5J2UF 5IAEA 4FOPA 1X0XA 4FHEA 4MYSA 4MKZA 4WLVA 2OBBA 3UC9A 5HZGA 1QQBA 1TUBA 4HWTA 2XCOA 3QVKA 4QEKA 1D07A 1PLKA 2ZRBA 3LLVA 1NL3A 2K4MA 1YH3A 4RZ3A 4UCQA 3SQDA 4F96A 2IGBA 2CVZA 4FMPA 4R6XA 4IHAA 5DRYA 2NVOA 3G59A 1GTZA 3LCUA 5FEMA 2RI6A 3P5BA 1PBNA 4Q4HA 1FXSA 1ST2A 5LDGA 1VPTA 5LZ7A 2NU9B 1Z5VA 3UFXB 2JS7A 2R5WA 2ST1A 4L5AA 4KLRA 6REQA 4DR6B 2GAOA 1BN6A 2LGJA 4YCAA 5IT0A 1FPQA 1XNRB 1PJRA 3C3MA 3AJDA 4MQEA 5CH3A 3C87A 3E1KA 4FOSA 4HNHA 4OHRA 5LLDA 4K6KA 1DRUA 4S12A 4X93A 1ZW1A 4EG4A 5JFOA 2WU4A 4UM9B 2D2FA 5JXJA 4WECA 4E33A 3AUXA 3LUDA 2RH5A 2I2WA 4RQAA 3ZW9A 1DO0A 4YJFA 1CYDA 1GPNA 4D0NA 3SHVA 2VRBA 2BGRA 1N2CA 4KPFC 4UOEA 3WNDA 3R0XA 4XOUA 1OBFO 4PZPA 3S0JA 4DA6A 1LI5A 3ZU5A 1I7QB 3HCOA 3G85A 1N2CE 3KD3A 3NAQA 3QKSB 2TS1A 4QPNA 1D03A 4B3FX 3ZWDA 5BNTA 4Q37A 2SHKA 3ZWMA 2D7JA 2IS1A 1EJ2A 2VI5A 4LYGA 1VSTA 3FD8A 5DE3A 2YZKA 4EGQA 1XCGB 1JKFA 3MSCA 4BU1A 4ZYUA 1FU8A 2HREA 4A15A 4E3ZA 2PCJA 3GLGE 2WD8A 1Q44A 1QONA 1WQ4A 1RE1A 2BBSA 4P58A 4KSYA 1WBDA 2C5LA 2PD6A 4L78A 3BMCB 1M5TA 2DTDA 1OV6A 1QYIA 1Q1ZA 2GK3A 2W83A 2P90A 4M8LA 5J2TF 4Z4QA 1KVRA 3DOIA 4Z0HO 2Q49A 2GYYA 1Z5ZA 2VWPA 1MUUA 1GRRA 1XYVA 4BX8A 4ZV4A 5EIHA 1H0HA 1XRMA 4FILA 5D3ZA 2C20A 4L5IA 4NZOA 3OQOA 4W9NA 2Y0PA 3AUFA 1DV2A 3MTBA 3FDIA 1F2UB 4RKRA 4AP5A 4YCNA 2HFJA 3R9IA 2P4EA 3ZDRA 3DM9B 3ZYZA 5ALPA 2AS0A 3WGLA 1Y8RB 4BVFA 3DGFC 2P41A 1CFZA 2IWRA 1AKWA 1PFUA 2JLYA 4GQAA 3U7FB 1I4OA 1N0HA 3A2LA 3R5HA 2PRJA 3ZXYA 3O4JA 4W8GA 4YALA 1KK0A 1A8QA 3IRUA 5EWJB 2BKLA 4B6OA 2GQ0A 3V46A 3KETA 2EKQA 1P0MA 1M0WA 5JJ5A 4TMKA 2IYRA 1R3UA 5KOJB 1C1XB 2Y1CA 4ZZ3A 3RWOA 3W9SA 3ESQA 3DMDA 5HTOA 4KO4S 3WK8A 1T4GA 2OCLA 3BE4A 3K9NA 5JU6A 2P7HA 3B70A 3OY2A 1L4MA 1NVEA 3D3NA 4P4TA 1XVVA 1DCFA 2ZUBA 4DLKA 4JI0B 1E3LA 1WMDA 1DQYA 3W8RA 1TUIA 3G82C 2IEZA 3O1LA 1IY0A 3NM4A 1GJRA 4JR2A 5ES3A 3AIKA 1Q92A 1Y1LA 2VSQA 3RYTC 4PTLA 1IBLB 1E7MA 4JSRA 1QFYA 2BHSA 3ORSA 2YMPA 3OX1A 2J0UB 3AB3A 3CONA 4P98A 5AFSA 3IUPA 1K3FA 1DBRA 1ODIA 2Z08A 4L74A 5FJJA 3VC7A 1MEEA 1EQAA 4OL0A 1RLMA 3AY0A 3LUHA 4C3OB 3HFJA 4YLGA 3GAZA 1MF7A 3T7IA 2ENWA 2DM6A 2GM3A 2PZMA 4CVNA 3HXMA 3FBTA 4R05A 3OT1B 4NAUA 1CUIA 4EFNA 4CKWA 1QRSA 5J4YA 3BSFA 3HWX1 2JGLA 4GR9A 3ASZA 4LBWA 3CE6A 2FPIA 1JBEA 4K3VA 3AZQA 3IL2A 2PBFA 1UOOA 2NTNA 4CLOB 1ZY2A 1DG1G 1E9RA 3KM0A 4KXLA 3U0VA 3ASUA 1EH5A 3SVLA 2ODQA 1GXSA 3QEMA 4M7PA 2AOXA 4KZKA 5EKSA 4FYXA 4IGIA 1USGA 3E2PA 1HTWA 1MRZA 4LRTB 4O59O 3TNDA 3UTCA 2O0MA 2D1FA 5DFAA 2AFIE 2QVZX 5CHEA 5G0VA 3RRBA 3DEFA 1NGSA 3Q1LA 2MYTA 4RANA 4IH9A 4BGVA 3O8RA 2OORC 3TI7A 2BGTA 1RAFA 1TVKB 3CMCO 2HB6A 2NSHA 2QYTA 4R8RA 3RIHA 5HM6A 1Z15A 1JHXA 3C3EA 5DJ5A 3T34A 1VJ0A 2OOKA 4BX2A 4CPDA 4JC8A 3L5OA 4IM7A 5GV7A 3ZWPA 3ZE6A 1KH2A 1ZBDA 3ANNA 5AKJA 4BLOA 4V3CA 4A6DA 1QPBA 1CE8B 3SHQA 1I2MA 1XTRA 4L8WB 2C2MA 2AR9A 4NX2A 4KFUA 2GO7A 3W6OA 1G9TA 1HE3A 2HLPA 2I2DA 5IYZA 3FYDA 2F17A 1Q0TA 2HQOA 1J56A 2YJZA 4I5FA 4H0CA 2JLQA 2UZ1B 5JZBA 3ZE8A 1YJXA 1P3DA 3GUCA 1K1EA 1MB2A 3P45A 2XRZA 4XYBA 2X3YA 3H4MA 4GS5A 5EL0A 4I5DA 5JYEA 3W7VA 1V8BA 2PSEA 4J0JA 4FLEA 4B80A 1O94C 3DOEA 3LCRA 5JNTA 1JLMA 2FFBA 2O8DA 1NF3A 8ADHA 3Q3IA 5A7HA 3PGXA 1KRWA 1XPJA 4GNKA 4D2IA 2PZLA 1LRKA 4ZT5A 3UMSA 4UMEA 3W3ZB 4XGKA 4TKMA 4JJ8A 1W0JA 4F2HA 3GELA 3T5GA 4DADA 2OWDA 3RSGA 1CK4A 4IHKA 4E03A 4EB8A 4U6QA 5JAZA 3MYYA 3LGAA 1P7CA 3BL5A 3BD9A 1GAXA 3DKPA 1GPJA 4R98A 5C5EA 2IYFA 4KGDA 4DXAA 4N5DA 1MOSA 5B2ZA 4LOJA 3RHFA 3ABIA 4OYLA 5IT4A 3R75A 3VFDA 1UMCA 3LT5A 1PNRA 4KQIA 4FQ8A 3SNHA 5JSQA 3U4QA 5KTPA 4XRGA 3BFPA 1MV5A 1CYEA 1SXIA 2C4MA 3EH2A 3MEQA 1N33B 3OZDA 4ZOBA 1F06A 3UK2A 1ZUNB 1XDGA 3K9LA 3ILYA 1I0LA 2O2XA 5L7YA 5KDDA 6REQB 2IOFA 3NWBA 3TSCA 3FIJA 1IXYA 3L9XA 2HI0A 2V98A 2VBFA 3ERCA 1Z5PA 1PK8A 2YJGA 4WL0A 3UUGA 2P78A 2LDBA 3ESRA 4O4HA 3KQPA 3Q9UA 2FEXA 2GJAA 3GMDA 2IV2X 3CZMA 2X13A 5JLAA 5K6RA 1QAQA 4BLPA 5KQPA 1L4EA 1B26A 2H4YA 2NU7A 4YYEA 2P8SA 2ZATA 3C6KA 2VF8A 3PXBA 4NRDA 3LCVB 1IK4A 1XP8A 2J9ZB 1TVCA 4P8RA 4RIIA 1DV1A 1HT1E 4RPLA 1JHZA 1TCUA 1QORA 2WSBA 3QZUA 1JLHA 5ALRA 1Y5LA 1JEYA 1DKNA 3SJCA 2UKDA 3HJRA 4RU1A 4MIYA 4O4JA 1O08A 2AQKA 3CX8A 3GQVA 4G25A 1FTWA 1ZO8A 1VMIA 4TN5A 1E7RA 5AOVA 1JU4A 1QMPA 3CRZA 3R5KA 4MI1A 3VTZA 3A6ZA 2KLHA 1E2UA 2QTAA 2Y77A 1NN0A 4J7XA 4D3XA 4ZYXA 2HU7A 1PJ8A 1KR5A 2VNKA 3NHFA 4Y2YA 5E4YA 1UJ6A 4RD3A 3IIKA 4OHWA 3DB1A 3OOEA 2Z3WA 4JUCA 4MRAA 5F2NA 3F7MA 1R12A 3ACBA 4L85A 1JGTA 1V8ZA 1TNDA 1KE1A 1PBTA 3EDOA 4W1QA 5NLLA 2PJUA 4CNBA 1L5LA 2PJRA 4A16A 4H4EA 5EJEA 2NQTA 4RZUA 5E9QA 2XQKA 5EGSA 3ANLA 5BQFA 1F5NA 5IVKA 3KYDB 4DWWA 1IOVA 4GO1A 4ZI7F 4MVJF 3W5UA 2LDXA 2VJQA 4PBRA 1E20A 4CIDA 4PX3A 4ZEOA 5A2QA 1LLQA 1Q0SA 3OCJA 5EFZA 1KDVA 3V8BA 3RANA 3IPAA 4BEJA 1KU6A 1OU4A 1O5OA 1P31A 2PUTA 4FE4A 4L51A 4ZALA 4BNYA 2R66A 2W5UA 4HFMA 2QV7A 2ZSBA 2OCPA 4GYYA 4HWKA 1MRSA 3O4VA 4GBED 4ENPA 1N1DA 2Y66A 4INZA 3MIIA 1THMA 2OZKA 3TSWA 3V32A 1BXZA 1IWBB 1EGHA 3LWZA 3VR2A 1F0KA 4L07A 1G60A 1L4KA 2NAPA 4WADA 1VXOA 4YTEA 1NUUA 1MA3A 3M33A 4H77A 4NLLA 3BHNA 3AJ9A 3DF7A 4PQRA 4C7JA 4DHEA 5KYUA 1XRPA 3OFSA 4KK4A 4Q9KA 3CRMA 1FTNA 2AZMA 4R8MA 4FFMA 4GZ3A 2CVPA 5DBIA 2WBLC 3RVOA 1NVWQ 2JZOA 3V1LA 2A6PA 3BTUA 5KYUB 3OPYI 4HLUA 4L0QA 4LTNA 3PA6A 4PLGA 2HDWA 4JNKA 4IIVA 3PE4A 2IYEA 1JFVA 1R8YA 1FLVA 3F8WA 4L2IA 4HQKA 5CW1A 1Q7CA 3P5SA 4FI3C 5K7SA 4JL5A 1XOIA 2OEPA 3EZ2A 3FFWA 1KZHA 4DW8A 3GFQA 3STHA 4B0PA 2GNPA 2QD5A 4A1FA 1QLJA 5BNWA 8MHTA 1M9NA 4RKWA 3A6KA 2QL6A 4LRSB 5KOYA 4RTMA 3P4UA 1ST3A 2OORA 3AW8A 5DKFA 2ZE6A 2IA5A 2ANBA 3FHLA 4FOLA 4F3CA 3VKGA 2IX9A 1Y5MA 1NA5A 3AESA 4FHFA 1TQ4A 1I1OA 1KI6A 1KYVA 5EI5A 1P61B 2FPIB 3ACCA 5GP1A 1J9EA 4FOOA 2O7VA 2QMEA 4FTWA 1PEKE 3R3ZA 2IDKA 4NECA 5DI9A 2TECE 3DE5X 3RBVA 3U7RA 3OOJA 3SXUA 4FKZA 5CB6A 3EUEA 1K6XA 4OXYA 1GXSB 2HSDA 3U5ZB 2X77A 1Y3FE 4MGHA 3TXYA 1XMXA 1E94E 5D8DA 5F51A 1KI3A 2VJKA 5A0VA 2Y71A 4UJ3A 1LSSA 1PWHA 2FGJA 2B6HA 1GTRA 3RIEA 3TLAA 4JI5B 1ZJYA 1WU8A 2B3TA 3I83A 4I14A 5DTEA 2DBZA 5JHHB 3ND8A 4G5YA 2EDAA 1P1IA 1X1TA 2DTXA 2YR0A 3AP3A 4Y3UA 4ZOLA 5DP1A 3ZK8A 2JLRA 5C2JB 4Z4IA 4NU0A 2RHJA 2A9KA 1GVNB 2OV3A 4GT1A 1HT3A 4IMPA 4X54A 2OYRA 3T1NA 1C81A 1CZNA 4CTKA 3QELA 1PZNA 2GT1A 4IZIA 3T0FA 4ECAA 3JALB 4Z51A 4EYSA 2V8BA 4ALKA 5I7VA 4W7HA 2HA5A 4J1NA 2F1IA 4BPRA 4CF6A 4RA6A 1T24A 2VDQB 4YV0A 3STVA 3UHFA 5IYZB 3ONDA 1J25A 2B1IA 4LWZA 2HU2A 1Q2XA 2B83A 4Y18A 2BFMA 4YWHA 3SXPA 2P9JA 2UYCA 1W85A 4B7ZA 3FYUA 1LBEA 4MRSA 5FO1A 3OCXA 4D98A 4J1QA 4RNCA 1FLAA 2ECOA 1BQEA 1HMYA 3DWFA 3JY6A 3PITA 4Q9NA 3RTGA 1JXQA 1LS1A 1SZPA 1FE8A 4KKVA 4UBMA 2XWQA 3IBFA 4EHJA 4KB5A 1IQPA 3VPFA 2VDPB 1CQPA 2UYOA 5K3FA 2O8DB 4JC0A 4AUMA 2PX5A 5FX2A 5DHQA 3A4NA 1N77A 1N78A 4V0QA 4G86A 1IMOA 1UKVY 1ZJJA 2V96A 3KG2A 2CWWA 3OCCA 4IF4A 1TTPB 1VMKA 4NYIR 1TZJA 4RHCA 4XVQA 3ANXA 3SP1A 3ZV6A 4A73A 3OOYA 4MRRA 4YUZA 4ZU1X 1RW4A 4HB0A 3J7AC 1BXGA 4HAIA 2PMBA 4HGNA 1M5RA 5FLKA 3DBOB 1K98A 2HJWA 2HT6A 1S3SA 2BFEA 1IHOA 2YY7A 2OO7A 2Q8NA 1L1FA 4GR5A 1LNZA 1ZM3A 4PPQA 3ZNPA 5AK0A 2EWVA 2CLCX 2R85A 1V6AA 1UMCB 2B5VA 4WH0A 3WGJA 3ZIAA 3P26A 4EFLA 8AT1A 5LP1A 4EA7A 1J8FA 1AXEA 2EFHB 2HCJB 2WJPA 1F8FA 3TRIA 2PSJA 1BN7A 2FZLA 1B74A 1DX6A 4MI3A 3FCXA 2K2WA 3KZXA 4YB8A 3NU1A 1XTKA 4QGFA 3RAFC 3C7CB 4WLEA 4CKCB 4LX8A 1GPYA 3E3MA 1ZVMA 4LWOA 1TPZA 1GUAA 2AE2A 4LDZA 4QUDA 3LDGA 1U4SA 2I78A 1SGWA 4MA4A 4UUOA 3GP5A 3RS3A 1VGRA 3V1MA 3WYFA 4AUNA 2L0XA 1VFNA 1HQDA 2WF9A 1WHTB 1FNDA 3E58A 2VYVA 2QJTA 2WLSA 1UWLA 1ECGA 3M1LA 1ZISA 3Q5GA 4JL6A 4KO2S 2V4MA 4NZ9A 1HOXA 3V33A 3VDRA 1EFPA 1NW8A 1K88A 2NXJA 2X0IA 1D4FA 3QNMA 3PNKA 2FSUA 5DMXA 3BSYA 3O2JA 3IQWA 1LDNA 3RS5A 4EHNA 4ZGBA 2CV0A 1LTHR 3O7MA 3WB9A 4B81A 3K73O 4H4CA 4UUNA 1VLQA 3AI7A 1JEYB 4LDJA 1NVDA 3DZGA 2A5JA 3FNIA 3OQIA 3TUIC 2E21A 1JT2A 1ZUD1 1RXYA 2O06A 2GA9A 3RARA 1XB2A 4G09A 2YQ5A 2X1VA 1K5DA 1PFKA 1U7ZA 1H4SA 5CLFA 2SBTA 5E7JA 3H2ZA 4DLRA 1CPYA 1Q7BA 2W7TA 1OB5A 2FN3A 1OLUA 1Z6TA 4AJIA 5BSVA 3T9DA 1VGQA 2FHPA 4RM2A 1YCDA 3K5PA 1OXBB 1SR8A 2IEIA 3Q6IA 3R3XA 4JVOA 1RYYA 3RSHA 3TJRA 4LG1A 4ZYYA 1X2EA 3I8SA 2LCQA 4DDVA 2EC5A 5TV2A 1YKSA 3DPIA 4OX9Y 4J6FA 3MGCA 3ZLUA 1VRCA 1FU4A 5H83A 2O14A 1FYWA 3EDMA 3FTDA 2H08A 3N2IA 4D25A 2AZTA 2QM7A 1GRNA 4EPTA 5F33A 1P3Y1 1RKXA 3ID6C 3LFUA 1UEXC 5IBQA 4PSKA 3L4BC 4ND8A 2ZXFA 3BH7A 2H9IA 2X40A 4Z0NA 3WLEA 2ZI3A 4DLLA 1YQTA 4I6GA 1WB5A 4PYKA 3T7JA 1FRVA 2GBFA 5LZ2A 1VJTA 2XDWA 4WKPA 1NW6A 4MWSA 1KTVA 2ZB8A 4O2AA 4N0EA 3TLCA 4FHCA 4Z86A 2YXEA 1XKLA 2PS3A 2VH1A 1M1ZA 3BE6A 3EW7A 3GDFA 1XZJA 4Q24A 1H5UA 2WJGA 3MB5A 4DV3B 4AJ9A 1XTQA 5U4QA 4P38A 5AKIA 1OXXK 3IDOA 4WOKA 4ND7A 2NT4A 2QJOA 4OHMA 3P9RA 3N2KB 2VEOA 1U63A 2AV6A 3FPKA 3ISJA 4FGKA 3A4TA 2HF7A 1BE6A 1MC8A 1D3AA 1YULA 2CMKA 3FVRA 5GVRA 3TZEA 4A8PA 4CQMB 4X95A 4ENTA 4U7DA 4BNDA 2EJUA 1W6RA 2GX6A 2O1SA 2OM6A 1T8PA 2XYPA 3K5HA 3SEAA 4EUKA 5FWXA 3TVDA 2CYCA 4D92A 1CP2A 1I2BA 1QK3A 1X7ZA 5C5DA 5C7OO 1T2EA 1BYUA 2GEKA 3OX4A 4IV5A 2K7FA 2ODEA 2QXUA 2QTNA 3E1GA 2V7UA 3B9QA 3M5WA 4FKBA 1A5TA 3OMLA 3A7DA 3AF1A 5I5GA 5EZQA 1XXLA 3AESB 2ERYA 3BL6A 1DC3A 4ZKEA 1KI6B 1U2ZA 3JR7A 1CDOA 5F9MA 4D8VA 2D5BA 5JI3E 1KO5A 1EXVA 4O2RA 1MQAA 4NZZA 3HA3A 3VA7A 3PHIA 1NV8A 1R88A 3SXUB 1ZM7A 4ME6A 4N3GA 2ID4A 1JA9A 3UJ6A 3WRYA 1ENOA 1H2EA 5DK4A 4AS2A 4CHGA 3Q8MA 1WMEA 1G0OA 1VPVA 3BAZA 1IBSA 1BVYF 4WEQA 4QGSA 5HUQA 3LBAA 4FNAA 1XF9A 4PANA 5GJVC 1PZGA 4DC0A 1W9MA 2B4KA 1I4DD 3ENNA 4FFPA 2OLEA 4YRAA 2LV8A 5LUBA 3ZV4A 2FUG1 3OPYA 1QQ7A 1RFLA 4A0QA 2YNMC 4MEAA 2C1ZA 3BHMA 1ISSA 2VHVA 4AZ3A 4FC7A 3HKCA 3P9KA 3AW9A 2A67A 3RLIA 4DMKA 1EB9A 1SD1A 1P9LA 1ATIA 1W48A 5DM1A 3BXXA 3TGWA 2ZZMA 2VPWA 3MSXA 4MRNA 4WA7A 1X92A 4Y30A 1CY6A 1XU7A 3OOSA 3EPHA 1Y81A 2VZ8A 2YWCA 3LO8A 3SCZA 1QP7A 1NMXA 3ROEA 2VNIA 4F3NA 3FMFA 3M6VA 4X91A 5D1HA 2CF5A 1ML4A 3ANYB 1XE3A 1MX1A 4RF3A 1W49A 5TB5A 5I7UA 3T06B 4UBLA 4XD7A 4Y9UA 2NUAB 3SZMA 1CTQA 1H2YA 3IEMA 4M60A 3RS2A