2FLKA

Crystal structure of chey in complex with chez(200-214) solved from a f432 crystal grown in caps (ph 10.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2flkA00
4F11A 2JB9A 4L4UA 4EYOA 1AB5A 1JYEA 4JA2A 3BRQA 5CHYA 4Z4GA 2PMCA 1QQAA 3G85A 1ISSA 4DN6A 3Q15C 3O1JC 4P98A 1ZGZA 3QLUC 1LBIA 3D02A 3UUGA 2E4YA 5KC8A 4IMJB 1Z17A 1FSPA 3EGCA 4LE1A 3NHMA 7ABPA 3CS3A 3F73A 1ZGGA 1FFWA 1NXWA 4YV7A 1ABFA 3BBLA 2HQRA 5KWSA 3O2JA 1EWVA 3RVPA 4OBBA 3O2QB 1APBA 3MM4A 2LBPA 2FLWA 2E4UA 2MSLA 3Q9SA 5EWLA 1GLGA 1SXIA 4RKRA 1AB6A 3CTPA 2PUAA 1RPJA 1DC8A 2FN9A 5CNMA 5TPWB 3GV0A 3ILYA 4EGSA 4Y9TA 4XXHA 1Z16A 1GCAA 4DADA 1CYEA 1NXVA 1E6KA 1U8TA 2R47A 3T95A 3NHZA 4MS4A 4N03A 3LUJA 1GCGA 5HM6A 3LMKA 1JWLA 4MR8B 2E4VA 3LTEA 1SRRA 2JBAA 5TPZA 1RNLA 3GRCA 1DZ3A 4TMYA 4OATA 4ZPJA 1USKA 4RDCA 2FKAA 1DP4A 3HJFA 1CEYA 1NXXA 5FWYA 3H6GA 1TM2A 1Z25A 1DCMA 2YHAA 3HSYA 1ZN2A 3TB6A 1JFSA 3HEBA 3RVNA 2I6FA 5CNIA 2X7XA 4G97A 4EVQA 3O74A 1JDPA 2HPHA 5IUJC 4M88A 2FN8A 3QEMA 4WZZA 2QR3A 2B4AA 3E3MA 3HO1A 1C4WA 4YWHA 4G0ZA 1RZRA 1EWKA 4JB0A 4RK7A 5HKOA 3W9SA 4MRMB 3EQZA 4OLAA 1KGSA 4EVRA 4N0PA 2FQYA 3JS5A 3CHYA 4MYRA 1DCFA 3KLNA 3N6VA 2A9QA 5FBKA 3CZCA 4MGEA 3G1WA 3OLZA 5HQJA 4RWEA 4WUTA 5JNRA 1DRKA 4KREA 1PHRA 2RJOA 1A2OA 4XLTA 1URPA 3HUTA 1ZY2A 3VNBA 2AYZA 1GUDA 3DZDA 4MS1B 1OXKB 5GQSA 3EAFA 2L17A 1USIA 4TN5A 3UK0A 4KVFA 1U04A 3N0XA 3TO5A 3H5TA 2H3HA 1M2FA 4XFKA 3BILA 3EDCA 5JNWA 1JDNA 2L18A 3GT7A 3JVDA 4D6YA 2WB4A 1YTUA 5EWJA 1PNTA 2R4QA 5C5EA 4NV3A 4WXMA 3N75A 3I09A 2QW1A 2FMHA 4KK3A 2IPLA 1L5YA 4IF4A 1DBWA 3IP5A 4ZMRA 5ABPA 2M98A 2KYRA 5GOTA 3IP9A 4JASB 2NT4A 3EODA 3MA0A 4MR9B 1QMPA 5JS1A 1NY5A 5EWMA 2NZUG 1M2EA 4IILA 1QKKA 4EVSA 3HM9A 2FMIA 4HNQA 1YVUA 4LZLA 3ILHA 3KKEA 1LJUA 4KK4A 1BVHA 1ZITA 2MYTA 3H1FA 3MQ4A 1LK0A 3JTEA 4KV7A 3I5AA 3IPAA 3HCWA 2PAFA 4G0PA 4N0QA 1PNRA 2WWVD 5DLEA 5KI6A 4RXTA 3M9XA 3CNBA 4F8JA 1Z26A 3FGZA 3Q41A 3QELA 4G0MA 1D5WA 3JVIA 4RXUA 1P2FA 2HQBA 5PNTA 3OQMA 3GL9A 3P9YA 2FVYA 3CU5A 4LE2A 5IULC 5KQLA 3SQNA 1ISRA 4Z4EA 2MYPA 3RVRA 4F12A 5IUNC 2XDYA 1EAYA 1NXPA 2PUFA 2YHBA 2VK2A 2IKSA 3KG2A 5D2CA 1Z12A 2DRIA 2FQXA 3O1HB 1VRVA 4YCSA 1RXEA 2QVGA 4QPJC 4S04A 5KQGA 1Z18A 1TMYA 3EJWA 3OQOA 2LIVA 2AYXA 5EWJB 1DBQA 2R25B 4FE4A 5IUKC 3M6MD 4E7PA 3O2SB 1JL3A 4W5RA 2PE5A 3M9WA 3KYJB 1JBEA 1Z2DA 3KTOA 3KJXA 4LRQA 3KCNA 2FMKA 4RK6A 4LX8A 1JH9A 4RK4A 2GWRA 4G86A 4MS3A 1Z13A 4UHJA 4O1HA 3SAJA 2PUBA 2QU7A 3IDOA 5FWXB 3DLBA 2RGYA 2PUCA 1BDJA 1B00A 1ZVVA 4FE7A 4YLEA 4MQFA 4RXMA 4N41A 2IYNA 3A10A 2FTKE 4MR7A 3IP6A 1A0OA 3FFWA 4Z0NA 5TQ2B 3S99A 2B1JA 3CRNA 3A3KA 5TQJA 1PEYA 2MYUA 1S8NA 4F3TA 2HQOA 2HJ9A 3GBPA 4L85A 2FQWA 2H0AA 2E4XA 4G0OA 4JB2A 3A0UA 1ZH4A 3I42A 3L6UA 1QP4A 4GPAA 4KFCA 1YS6A 3C6QA 4P1ZA 5DGCA 5KC9A 3N8IA 4Q6WA 1QO0D 3F6PA 3OO1A 3EULA 4JOQA 4Z9AA 4EYKA 3IP7A 3VNAA 3E61A 3OLXA 2WJWA 3NNDA 2PJUA 3N53A 5B3JC 2PUDA 4Z9BA 1E6LA 2VYCA 1H9CA 2PLNA 4IMIB 3H5IA 4PICA 5JNUA 4IRXA 5EWLB 1SD5A 1P6UA 4H60A 1BA2A 4YS6A 3H5VA 4XAQA 5KQPA 3O21A 2RJNA 4Q6BA 4QYWA 4N47A 1EHCA 1TVMA 4RY8A 5HSGA 2JK1A 2VUHB 5I4CA 1ZDMA 2MSKA 4F06A 2W42A 3RVSA 4NCAA 1YK0A 3RVLA 6ABPA 2PL9A 3RVMA 3T6KA 1ZAYA 3LUGA 4MS4B 2GX6A 4Z4HA 1W25A 4MQEA 4FB4A 1L5ZA 1BDHA 3SNKA 2JVKA 3HDGA 2JBAB 1M5UA 4OG2A 2QZJA 1YS7A 4CBVA 5BQ3A 1QQBA 1YMVA 4HNSA 4YRZA 5FWYB 2N9UA 4ETMA 1FFGA 2P9HA 2PUEA 3RVKA 2E4WA 3H1EA 3RVQA 1DJMA 2F8TA 3HDVA 3HZHA 4Z4CA 3O1IC 5IEBA 4ETNA 1W9HA 3QEMB 2JCGA 2JVIA 1D4ZA 4KPYA 3K9CA 3DGEC 4MLCA 3D8UA 1DC7A 4ML3A 4XASA 3RVOA 4S05A 2QXYA 4H3HB 3Q7SA 4RK5A 5BRAA 2OENG 1DCKA 3OO0A 2JRLA 3RH0A 5BR1A 3QLVC 4W5NA 5IBQA 1K68A 1ZH2A 2LPMA 5T3YA 4G0QA 5E3JA 4DQDA 4QYMA 1F4VA 1P6QA 2WRZA 4YP9A 5TPWA 1K66A 3GYBA 2QVCA 4HYEA 3HXMA 1USGA 5F64A 1NXSA 3C3WA 3HK2A 5DKFA 4Z4IA 4RV5A 2V0NA 2IPNA 4QICA 2JVJA 1XHFA 3JPWA 2IDMA 2IPAB 4Q7EA 2A9OA 3OLVA 1BDIA 3MMNA 3H5WA 4O1IA 3H6HA 2FEKA 3SG0A 3T38A 1SXHA 4RK0A 1VLZA 3LUAA 4MLDA 4EYGA 1KRWA 1BAPA 4ZYLA 2A9RA 1FQWA 3OM1A 4KQCA 3TD9A 1HEYA 1R8JA 3QLTA 4E7OA 2GI4A 1RZRD 4GNRA 2CWDA 2WJAA 3HS3A 3JPYA 3CG4A 3OMXA 5ED4A 2ZWMA 1KMIY 3RVJA 1YIOA 2QV0A 3FMVA 1MAVA 3MIZA 2GKGA 3IPCA 2VUIB 1Z2EA 4PE5B 3CZ5A 2PL1A 1QP0A 4LE0A 3RQIA 1DG9A 4OTZA 5EWMB 2MYNA 3LFTA 5T7BA 4LDAA 4MRMA 4NQRA 4RU1A 2PUGA 4W5QA 2CHEA 1P8AA 4RY0A 2ID9A 4JAVC 3QK7A 4W5TA 2FXIA 5B3JA 3SM9A 4MAAA 4PEVA 1TLFA 3MF4A 3FFTA 4YO7A 4PZ0A 3OQNA 4G0XA 2E4ZA 1PEAA 3TX6A 5IEJA 1RXIA 3Q7TA 4W5OA 2ZAYA 4WT7A 2QSJA 3LKVA 1NATA 3B2NA 5IC5A 3NNNA 4ZJPA 9ABPA 3N0RA 1FFSA 3OLWA 1YK1A 1Y1LA 2NUBA 3DBIA 3QELB 3K4HA 4HNRA 4TLMB 3MYYA 1D2AA 1WETA 2NT3A 5JNVA 4EUKA 4EYQA 2PKXA 3LUFA 4MS1A 4D74A 1EWTA 2NZVG 1D1QA 3JY6A 3H5LA 3QEKA 2FEPA 1T34A 4YR7A 2Q5CA 3I45A 1I3CA 1NTRA 1TJYA 4IGAA 4Z4FA 3OLYA 4RSMA 1QPZA 1JF8A 5KQMA 4WWHA 4KNYA 3FFXA 5TQ0A 5FBHA 3C3KA 3O75A 2RDMA 4N76A 1JHZA 1SXGA 3GWGA 2IOYA 1LJLA 1D1PA 2A9PA 3HV2A 2TMYA 3KHTA 4RS3A 4TLLB 3H1GA 1ABEA 4WXEA 1QNLA 1PUXA 3EQ2A 4NCBA 2IPMA 1M5TA 2R48A 4MR9A 4MS3B 2FMFA 3FDFA 4D6XA 1JFTA 3DLHA 5BRJA 1CHNA 2BGGA 3CFYA 1LBHA 3DGFC 1XHEA 2FSPA 1E6MA 1Z15A 4RZSA 4MQFB 1J56A 1DBPA 3SY8A 1ZESA 8ABPA 3QX8A 4MR7B 4NICA 2P4UA 4RK1A 3KYIB 3OMWA 4RKQA 2FW0A 5JNSA 3LOPA 1MB3A 3KLOA 3R0JA 3QLVA 2LUOA 2MSWA 3LUKA 1A04A 1U0SY 2CHFA 5CNJA 1U2QA 1ZHHA 4YGXB 3ROTA 4B09A 4EY3A 2LP4Y 2M1ZA 2HSGA 2WY2D 1E2BA 3CLKA 4LDZA 4PYRA 1XWWA 3Q7RA 1QP7A 4ZMSA 3TMYA 4RY9A 3H5OA 3BREA 1OXBB 1UDRA 2ID7A 3UKJA 1NXTA 4JP1A 5IX8A 2O20A 1KRXA 3HVRA 5TE9A 3KS9A 3F6CA 4ETIA 6CHYA 3QX9A 1YMUA 4KRFA 2CD7A 1QO0A 1F51E 5TQ0B 4KMRA 3A0RB 2FEWB 3CG0A 3F7NA 3HUUA 2F8SA 1MB0A 1JFVA 3NNSA 3LUCA 1NXOA 2L2QA 3LUHA 4G0YA 4KZKA 5DTEA 3C3MA 4KQ9A 2J48A 5TPZD 5JNTA 1IIBA 4Z99A 5FWXA 1MVOA 3OM0A 3CKMA 3GBVA 1MIHA 1DRJA 3BRSA 2WMYA 1VKRA 4H3KB 4MPTA 1JLKA 5TQ2A 1EFAA 3QLUA 3ROFA 2OQRA 3LKBA 2GBPA 3LUDA 4MR8A 1VPWA 2L19A 1JX6A 4XARA 3C97A 3KSMA 3N0WA 3GA5A 5CNKA 4MQEB 5JS2A 2FLKA 3URMA 5C5CA 3T8YA 3H75A 3L49A 4O5AA 4UHKA 5DCLA 3NBMA 4OLBA 1GUBA 1JYFA 1U2PA 1C0EA
chains in the Genus database with same CATH superfamily
5K3EA 4AYXA 1QVVA 3DJYA 1JYEA 1Q2UA 4OHMA 1QIDA 1ZI8A 1WHTB 2X58A 1XTSA 4RH1A 3ZQ4A 1F2UB 2FG5A 4NONA 1QQAA 3LCJA 3R8FA 3JWEA 3IOYA 2Z3ZA 3CX8A 2A3NA 1QIGA 1AQUA 1ZMXA 2QRMA 4KQGA 2HMUA 1KQ3A 2CXSA 4P31A 2H9YA 3C5EA 3I39X 3P2OA 1VBFA 5BSHA 4GD3Q 4I1IA 4CMEC 4BGEA 3W8FA 1F3OA 1F0KA 1TZJA 2J9FB 4UZFA 4BBAA 5L7TA 5IWCA 4ICIA 4O1MA 3TK1A 4ESOA 4F3YA 1VHJA 2MSLA 1JSZA 2PLAA 3Q3JB 1BJTA 4MUMA 3BCHA 2JAPA 3JAKA 3LECA 3PCTA 1AB6A 2FRDA 2QDXA 1DC8A 2VAXA 4CV0A 2YRXA 4F3RA 1BS9A 2G40A 4YDRA 3L0OA 2B7LA 4H1WA 2WM3A 3AHIA 1W5EA 4Y9TA 3WK7A 2DUNA 1G8JA 1FX0A 3B20A 3CJTA 3IV7A 3VNSA 3VPBA 2GCPA 3ORYA 1WDKA 3ETGA 1LY1A 3ICCA 3L7YA 1R5BA 2IHUA 3BC1A 3QEOA 2XUAA 3C39A 4I8XA 4PZCA 5TXGA 3ZDAA 3AH8A 3K1AA 3GT0A 1XCPA 4DR5B 3IEXA 3WRXC 3A3YA 4OATA 4ZPJA 5EMKA 2J1LA 5FPHA 3T1TA 2CVPA 2UVDA 3MRTA 5AKIA 3WMEA 4CCAA 4RPCA 2DFDA 2YHAA 3GAAA 4MKHA 2MT9A 2BH9A 4BEVA 1YJ8A 3ABRB 3H2IA 3AL2A 2QNBA 4P2GA 4U8GA 1D6NA 1E79A 4EG4A 3DOCA 4DQUA 5CFZA 5DNVA 4ABTA 1EGMB 3DLAA 3AEZA 4NG5A 1XK6A 4LJSA 3IT3A 3A1SA 4QARA 4E94A 5E1DA 1UWCA 5FV4A 3PLAE 2WVHA 3PFGA 4QOHA 1U3WA 3KJIA 2B4AA 2R8YA 2VPZA 3CF2A 3KPJA 4PLHA 4YWHA 1S8OA 2YX1A 2ZDHA 2C20A 3REOA 2DLCX 4RTRA 5DHSA 5K05A 2PSJA 4M38A 1RM4A 3L43A 3OZGA 5AJHA 2EXXA 2FFAA 2H9AA 4H0NA 4WCFB 4AJKA 4OLAA 4PCUA 1TGYA 2VDMB 4YALA 1G2IA 4RIIA 3ENQA 4YCDA 3U9LA 1PNQA 3IODA 3KKKA 3KL4A 2G82A 1QV7A 2CXHA 2QSYA 4NHOA 4BFSA 3ACBA 5CEFA 1N4DA 4OV6B 1XCLA 1XDDA 2PLFA 4NMMA 5ILQA 1H4QA 1XAJA 3LW8A 1J8DA 2FPIA 1E92A 3KNZA 2OCIA 3JASA 4AKEA 1UP4A 4B45A 1NN5A 4QOSA 4DW8A 2NW6A 3CUSA 1E9EA 3UJPA 2PMBA 1BH6A 2IV2X 2YFQA 3BK2A 2QROA 2REXB 3V4PB 4IZ6A 2A57A 1RPAA 2O8FA 1J2UA 1RAFA 2QUZA 3H5TA 2QL6A 1MG0A 1N2EA 3CF4G 1Q50A 4AY2A 4WOCA 3DBHA 5EZ5A 4N4AA 3VO2A 1X7ZB 3N6XA 4JEMA 3PDIB 2GXSA 3C6ZA 1R5NA 4L22A 2BFOA 4M87A 1PDOA 2VOEA 4JBWA 4OHYA 4NV3A 1TYZA 3RFUA 3P5BA 1B1CA 1J6UA 1LI7A 3MOSA 2ETVA 3GFFA 4L7VA 4QUEA 4HK4A 1L5YA 4BWVA 1U1IA 5CT6A 1E7SA 4TSFA 3SBDA 4K0RA 3A4VA 3ODGA 1PWXA 2X7HA 3PQ8A 5LZ8A 1B6RA 3GGDA 3VR1A 1FJHA 2HJVA 3GCDA 4PLVA 4AECA 4DYHA 3EIFA 4MW1A 1OBFO 3N3BC 1FUYB 1L5SA 1YVDA 2ATCA 4CKCA 3PS9A 1KYVA 2RGXA 3JAWB 5SYNA 1QORA 2WJ6A 4INPA 4KH0A 3S0JA 3VPCA 2SNIE 3HKDA 4TXMA 1H6AA 4LW8A 2B5WA 2HRQA 3O82A 4RC9A 4CR6A 1A76A 2R8PA 1RRKA 1L7RA 1Q5PA 1RWNA 3S8MA 2CFIA 2W6OA 1W8IA 3THWA 4R1OA 2DFKB 1N5IA 3P9QA 4KV7A 1CQIB 3PPYA 4KR0A 4QG3A 2QUJA 4HS4A 5GM1A 5LOVF 1PGQA 1P4HA 5KYXB 4AXXA 1FNNA 3OE1A 1P1JA 2GKSA 2Y05A 3FZNA 1SD2A 8OHMA 2R86A 5KTYA 3NYRA 3VAYA 4HNAB 2K6GA 3MCUA 1G8YA 4JR2A 4EB6B 1G2OA 1XGKA 1KTIA 3VI4B 3OQMA 4PINA 3FHCB 7YASA 2FUCA 1OXVA 2D5BA 1SWWA 3WGHA 1RHMA 3BB4A 5P8WA 4DCPA 4C3OB 2XDYA 1NXPA 1JHOA 4QAJA 1PWYE 3CLRC 4F4DA 1BJKA 1U2EA 1AN0A 1A7KA 2FE4A 1DNPA 1K5GA 1Z12A 2E49A 5FTWA 1T8PA 1YS9A 3ZBTA 5B1SA 2HJSA 4QELA 5D1HA 2V7QA 1VRVA 1QYDA 4JLBA 5EIAA 2ZVDA 1O3YA 2Z4SA 3EJWA 1H94A 3B9BA 3ENNA 4GH5A 3GJYA 1JB1A 3WL3A 5LYJB 4OMFG 4I4IA 3ZE8A 4A0RA 2VZ0A 4J16C 1KFKB 4RJKA 4TTSA 2VP0A 2NV2B 1NBMD 2FHPA 3LUBA 4DY4A 4RK4A 4YRKA 4B6PA 4UHJA 5FX2A 2W2PA 2PS9A 3HLYA 2D1SA 5HF9A 4C2AA 3LHFA 2OO5C 4PQEA 1ULUA 2OD2A 2QD4A 2P77A 4N40A 3DDZX 1KOFA 5THQA 2FTKE 4BQSA 4D4HA 3ZDCA 3ET4A 3LT1A 4ZAXA 5T57A 1VIAA 1FDSA 1OJ7A 2Z3VA 4G23A 1P2VA 3V8QA 3ZNPA 3TRHA 1CRWG 1E5TA 2REQA 4C4RA 4G0UA 1F7UA 2YW9A 2LCIA 5EUBA 1E1RA 3JQ8B 3PHGA 5IBCA 1THMA 2PQ2A 5J4VA 2OXRA 3TMKA 2XF2A 3I34X 3TW8B 4NCJA 1AKWA 4IIDA 3WR5A 1BO6A 3C6QA 3GAFA 4ZHQB 3LXRA 2REOA 2H00A 5ESDA 1U1GA 3TTWA 2ZZNA 3DL7A 4EJFA 3SS8A 1L1RA 1UPBA 2GF2A 2A92A 3R5SA 3OCXA 4J3JA 2C2XA 3EJ6A 1YKFA 2R62A 4RLQA 1T4BA 4RF3A 4L6IA 1TA9A 4YUYA 2VPTA 3STTA 2BT4A 2CHQA 5HYVA 1ZBQA 1U2SA 4HSGA 2UZ1B 1M1YE 1IPEA 1HKUA 4M0LA 5SZHB 2BFWA 1U63A 1MRZA 2WLSA 2QD5A 5EMNA 1MJHA 3FUXA 1WNFA 3PC8A 4QOJA 1R37A 3ER9A 4LRYA 4DB4A 1K89A 2WSBA 1ZC3A 3DCYA 4I1VA 1QYWA 1TKBA 2V45A 4GX5A 4X8HA 1O0CA 4NMXB 3H5VA 5AJXA 5BY2A 2QJOA 5HA5A 4CETA 7REQB 3UG6A 1Z28A 2VHUA 3SJCA 4RY8A 2H5JA 2JK1A 4CYMA 1GRCA 3N7TA 4DMKA 3R09A 3LDAA 3H8SA 1ZMRA 1OGIA 4YJFA 5LNK6 4EA8A 6ABPA 4WL0A 2WJ4A 1HDYA 3PPXA 2IV7A 1HO3A 4BGUA 1LLUA 2GEBA 1RW4A 4HFRA 3VJRA 5DRTA 4FBGA 5CFNA 2JIOA 1ZNXA 1W25A 3CW9A 1RYDA 2C9CA 1J2TA 4RJJA 4Y2RA 3RPEA 3V32A 3WGNA 4ALLA 2AE1A 1GDDA 2DHRA 2JAQA 2PY6A 3H2BA 4XM2A 4AUEA 4RX1A 4RDXA 2NU8A 4C76A 3IA7A 1TYDE 1I7PA 2ODPA 4NV1A 2P9HA 2ZBUA 1KOJA 4X8OA 1W36D 3CH4B 3ZGXA 1F20A 2GTHA 1GRQA 1X1DA 2EL7A 4BNJA 1FVFA 4I9HA 1WHTA 1U81A 1IJBA 2JGJA 2X5NA 1F2UA 4QDOA 3WVNA 4AO7A 4F38A 2AH5A 4Z4CA 3D43A 4AICA 4IY1A 3SQLA 1SH7A 2Q0XA 1NPYA 3BZUA 1RRGA 2Y99A 4V3BA 1K2VN 2ZUEA 3H65A 3CLUD 3W5DA 2EFDB 3E5RA 3OD1A 4TT3D 2VAWA 4JWTA 4H3HB 1GQOA 1X0VA 5HKKA 1JAZA 1UKVY 2J9FA 3QU9A 2ZSJA 4ZJYA 2AF4C 4V24A 4FFRA 3SZMA 4F7DA 5DHUA 4G5XA 1P9OA 4EMUA 1TAUA 3O7WA 3DH0A 5AW5A 3KVOA 3TFQA 3X1XA 1XTTA 3AUJB 2BVNA 4P92A 5JDCC 1U9YA 4R5MA 4C1NA 3L6OO 4M9SA 4H0CA 1A4RA 4MW7A 1XTBA 3RFTA 4GYJA 1R4MB 5DISB 1K6XA 1U9IC 1ZN9A 4FYKA 4R9RA 4RAOA 3RVDA 3O8RA 3GNQA 3ETCA 2ZI4A 1NMYA 3AVWA 2IPAB 4IAOA 4PANA 3ESZA 3M8KA 3ZWYA 1RXCA 4BV8A 3M3HA 4FBLA 4GOLD 2NVBA 2PZ8A 2VNSA 3KB6A 1L7VC 4P2BA 1N34B 3GYGA 1V26A 1OAOC 1DFHA 1QCCA 1ZISA 5AUQA 4F5ZA 1Q1AA 2O1EA 1ULTA 5EJAA 1ZO8A 2YZ7A 3QLTA 4E7OA 3R0ZA 1TPZA 5CXQA 2V6BA 1X94A 3O84A 2R7AA 1R0WA 1ZK1A 1IK4A 2BMJA 2P2LA 3LQYA 1Z4QA 1F6WA 2P90A 3F6RA 1LNZA 1RM3A 5B1YA 1JXMA 3BGWA 4H31A 3T7EA 2VWGA 5CHEA 4GFDA 4AX4A 3IMCA 3OKFA 3R7DA 2MYNA 3IAS6 2B83A 2OVBA 4KJZA 4WCFA 2DY0A 1SKQA 2V0GA 1TQDA 3AKCA 2OK7A 1E2NA 4AK9A 3CNQS 1Y4ZA 4HN4B 1TLFA 1U99A 3GJ6A 1T4CB 2BW0A 3PICA 3U0VA 1C30B 1UZUA 5ARDA 3T06B 1ICIA 2D06A 2DEUA 3E7XA 4BKQA 3H11B 1F8GA 2WP0A 1YU6A 2CXRA 2VYVD 3O95A 5DGHA 2ST1A 3FPAA 1Z37A 1CY7A 2D1RA 2QL9A 3FX2A 5CVCA 3B2NA 4JGGA 5D85A 5H3LA 4Q9DA 1XK7A 4GGOA 3MOGA 1QPBA 1SB8A 2WF7A 2ZKIA 3PSHA 3PYXA 1UDAA 2ZTSA 4MV0A 4PXYA 2RBKA 1Y0BA 2IZZA 1LBTA 2Y1EA 3EXEB 5AKKA 4ZEMA 1D1QA 4CGZA 3GB9A 2PX3A 1YDWA 1VHDA 2QE7A 2DSTA 2YV4A 1UJMA 1X7ZA 1Y1TA 2E6KA 3DDSA 2ZPAA 3PDIA 4FR2A 3T5CA 4CL3A 2W9XA 4B43A 3BMQB 3GNTA 1XEWX 5DNDA 1PIWA 2C4NA 5NLLA 1VYTA 2EZ8A 1B76A 1WPQA 4E22A 2Q2WA 1O87A 1UXIA 3NVAA 5AM4A 1CTQA 5AESA 2OR3A 1BDMA 4IUDS 1N9GB 1I3OA 1BDBA 2DQZA 5EE5B 1JPNA 3RU9A 2GJSA 3EZ9A 3U7GA 1FLVA 1TCVA 3HV2A 4YQYA 5E9QA 3ONDA 2Z9DA 1U7PA 5FJJA 3R8CA 4ND3A 3WKEA 4PN3A 4JFAA 5FUXA 4JSYA 1XWFA 2I2DA 5CM8B 1XRSB 1QIIA 3JAWA 3LY5A 4KAAA 1XVUA 3AK4A 4MS3B 3ADCA 2MR5A 3SQWA 4NK5A 1E2GA 4PC2A 1YBAA 2HIGA 3CFYA 3Q9LA 4X6YA 1FYEA 4BEBA 1I6LA 1LS1A 1T2EA 3RSLA 3R6TA 4A0SA 3IV9A 3OD5A 1N33B 3HXTA 4IEFB 2HK9A 1FLAA 1GSIA 2OBLA 4P4GA 4YLGA 1CQIA 1LF0A 1PR0A 1ADYA 2F90A 2QYSA 3HCFA 4RENA 4RE5A 5AUNB 4XKJA 5HTKA 2GVNA 1DXOA 3ZHCA 5BYAA 1AKRA 2B9VA 3MELA 5KYXA 4ZODA 4KBYA 2VJQA 5H9VA 1JDZA 1MENA 3E35A 4AKSA 1IBRA 2GPWA 4DV3B 3PHJA 4N8EA 1U0SY 4O4IF 4PY2A 3R41A 2NYRA 3CZ9A 4HNAA 1J70A 1RC8A 3IMGA 3HB9A 4IHAA 1T4DA 4C7MA 3LLCA 2ORWA 1YIDA 3NI2A 3NBAA 4OGLA 5KNDD 1XJ5A 1ZLYA 3LY9A 3MC1A 4L6AA 2ZK7A 1M83A 3I1YA 3LRPA 4ZV7A 4RTMA 4L07A 1UBUS 1ZOLA 1KP2A 1S3SA 5IN4A 1U1FA 4D8XA 1SBCA 2R85A 3QFTA 2O20A 4JP1A 4EHJA 5ITSA 4JMPA 5JAIA 1E6UA 1JDTA 1VI6A 2BUCA 3HRIA 4U9UA 4D3XA 3ZWXA 2MIIA 3NHKA 4I1SA 4M7RA 5LYJA 4WKCA 3KTDA 1PJLA 4FCVA 4KN9S 4X92A 3WP1B 3RSFA 2FOXA 1VL6A 3LUCA 4EO4A 5JU6A 2P6PA 1FF9A 4JCCA 1IIBA 1JG7A 1Y8AA 3DAOA 3A1WA 3FYUB 3IAHA 5IBRA 1U3DA 2EHJA 3EYWA 3OLQA 3ZE7A 3D3KA 1MVOA 4EFMA 4KX5A 1IL0A 2JGEA 1BEUB 4P32A 3FSGA 3HSKA 4H3KB 3SYRA 2BBSA 2ZI5A 1L8QA 4LJ9A 1DTEA 2EFJA 3A28A 2PO7A 3BHJA 4R1NA 3UK2A 3D4BA 4X3PA 3SZUA 5BNFA 2H63A 4ZVLA 4TWRA 4DNXA 3DCJA 1X7YB 1NULA 5HCNA 1QUEA 2D1FA 3S2FA 1BKYA 1G1AA 4IJQA 3VNQA 4LZNA 3JWJA 1Z0JA 3DMNA 3JQ8A 4P8RA 5E1MA 4PNEA 3IL2A 3TW8A 1Z4LA 4BLVA 5I9TA 5KZMB 4OLBA 1L5KA 1RACA 2IYTA 1IE3A 1K6JA 1QYXA 1WL8A 4GOXA 3ZE2B 1QCZA 2P65A 2QN2A 4ZHQA 3K15A 4Q7KA 4Z4GA 4KQJA 4LWZA 3A6KA 2PMCA 2QM3A 1Q3TA 4F3CA 1JZQA 1ISSA 1GGFA 1W29A 5IS2A 2J45A 2XHEA 5JZBA 4E12A 2QD2A 2H51A 4KPEC 2YIJA 1RWWA 2UZ1A 1P74A 3RJTA 2VNAA 2G4CA 2XKKA 2YZGA 1ABFA 3BBLA 3MCVA 2C4HA 3AL0C 3P9CA 4BMNA 1O94D 1Y5IA 2IP1A 1OFGA 2R97A 5IH3A 3TLAA 1HNZB 1XZIA 2QT1A 1IH8A 2X6RA 4XUEA 2HCTA 3LQQA 3GLIE 4HGRA 5K6AA 3A9VA 1Q0UA 1TADA 3G0GA 4LXGA 7REQA 4M1TA 5LQMA 2LE0A 4TKUB 3TR6A 2BJWA 4HRVA 5AO9A 5AM3A 5JXIA 2HR1A 1BTOA 2UXCB 1YB4A 3LVRE 3NCHA 4PQFA 3L01A 2CB9A 3DNMA 4PFKA 4CFSA 4DHWA 2O3UA 1ZMBA 2ATXA 1B7GO 3FVTA 2QR5A 1I7NA 5KHLB 3MTIA 1W2GA 3IEPA 4WUVA 1QFYA 1OBHA 2WAOA 3GFOA 4HG2A 2G70A 4UU7A 4HQOA 4TMYA 1PYDA 2FKAA 2BFBB 3FTQA 3DMGA 3KJGA 1PBTA 3I6QA 4KACA 4D3ZA 1G6Q1 2BI4A 3D4PA 5B58C 1VLJA 1X2BA 3U17A 3F96A 4MEBA 3LBIA 3PUXA 4HFNA 2PGOA 2RFLA 1CU1A 1UZNA 3FJOA 3PGXA 4ZYTA 2HNBA 3JQQA 2DKOA 3IUJA 4DCGA 5L6LB 4MV5A 1O6FA 3OFNA 4AZ3B 1GDHA 1CRQA 2C59A 4UU1A 4D9GA 3S68A 1NWCA 3H17A 5HE8A 2H1RA 1UKEA 3N0TA 4RK7A 1JUDA 5EESA 1YFKA 3EXAA 3HJAA 5EIXA 3EQZA 2AJCA 3FGOA 5DP1A 3TNJA 3VZPA 3KSUA 1KS9A 4PLTA 4YA6A 1XZFA 3R6GA 3G7NA 1D6SA 1ZD5A 2LW7A 1K0UA 3CHYA 3KUUA 5KKAA 5GONB 2TECE 2QTLA 3UWPA 4XRRA 2AVDA 1W7AA 2R7MA 5EJMA 2P91A 1L5QA 3KPUA 1LRJA 1Z7BA 1S02A 1SQFA 4XCXA 5G2OA 1R4MA 2Q1UA 4EMTA 1HDIA 4JMLA 4QDTA 1E9DA 4I4NA 3FBGA 4US0R 4Y0VA 3IPXA 2O07A 4U7HA 1ZY2A 5HKLA 1P0IA 4MWCA 3SEQA 4M7OA 4KU4A 1F8YA 3UK0A 1A8IA 1Z3CA 1C9EA 1G5RA 1WB4A 4TVBA 1T10A 3T0GA 2J0SA 5BYBA 4Q9AA 1JQ5A 1TUEA 2GERA 2O2XA 4A6EA 3AF4A 4ZAWA 4AFNA 2Y6UA 5KWEA 3EDCA 4TUYB 1UK9A 2G28A 4W9NA 3HBMA 4D6YA 2JA1A 2O52A 3F67A 1A9QA 3B1ZA 4DXDA 1QRTA 3SZ3A 1N6RA 2ZB8A 4J9UE 2OCAA 3R3ZA 3D8SA 4GR9A 1JPVA 2WUDA 1ZK3A 2ZUWA 4I0WB 5C8VA 4ZMRA 1SXJE 3CJQA 1Y3CE 3X43A 1XAGA 3BIOA 3IP9A 4RA6B 1TK3A 1OGJA 1RRVA 4HMPA 5CT4A 5CDFE 4N7RA 2I99A 3OG9A 4FSDA 1Q1BA 4JJFA 2QU8A 4UZEA 4MVJA 4PF1A 4M1QA 3IBFA 3D7MA 4BE9A 2D7DA 5FKJA 4G65A 5E3HA 3AR7A 3I8OA 1T4CA 5F35A 1BVHA 1O95C 4LKOA 1C30A 3GUYA 4ZYWA 1NJGA 3X1ZA 3H11A 4RTKA 1T5TA 2I8CA 3D8NA 4PG7A 5I4IA 2B8JA 1A9YA 2EGUA 3IURA 4ZOQI 2XTJA 1N57A 4LJ4A 2IEBA 4ND7A 1P17A 1JEAA 1BS2A 1THTA 3QVLA 2VRWA 3HCBA 4HEJA 1YRAA 1P2BA 1V9LA 3EZLA 3ADDA 3GFBA 5I7VA 3VMFA 4TMWA 1U2DC 1V5GA 3FNFA 2PD6A 3EXEA 2C54A 1SG6A 4TSKA 3H18A 4DAEA 2P9QA 3PJGA 4FT4A 4GRAA 3PPWA 4XVHA 3Q3IA 3PF9A 3RVRA 4JSTA 4F12A 5MN5A 5CH3A 1XHLA 3PA8A 4PS0A 5JC8A 1XQ1A 2ZTUA 2HEIA 4QO7A 2YY5A 3EGOA 3QOXA 1GUFA 4EEKA 5ALKA 3BMQA 2O0KA 2QN3A 5AT1A 4J03A 3I53A 2NVUB 4CKWB 2PGAA 1L7QA 3PTZA 4TLDA 2OXFA 5GADl 3EXHB 3RJMA 3TNLA 4GZ3A 1UFKA 4F6LA 4EATA 4JQZA 5KQRA 1N9GA 2DT5A 4ND5A 5H4HA 4YV1A 4EY4A 4MVJI 4N8DA 4UNRA 3KTOA 2L69A 2ZP1A 5AKLA 1VYUA 2IH5A 3WQSB 3OUUA 1VCOA 1YZUA 5T64A 1IPHA 4TN1A 5AM0A 3INNA 3NP7A 4MS3A 1ISJA 3VBEA 4DEVA 4ARIA 1I5OA 3PC2A 1RWKA 3DB1A 3P96A 5L6MB 3RS7A 2IWRA 3ZD9A 4BZXA 4QEZA 2CMDA 1R6TA 3U26A 4FUTA 4CTKA 4DQXA 2A94A 3HLTA 2DETA 5JSUA 1TCAA 1ZJYA 1G1MA 1LJ8A 2H0RA 5DEOA 4BQNA 4RVDA 3A3NA 5LZ9A 2VCYA 4LF9B 2Q8NA 2FB9A 2GXQA 3C8MA 4LDNA 4D82A 2DG2A 1R1DA 4W4TA 5BPFA 2YZMA 3GBPA 4FZJA 4AL4A 4N9QA 4L85A 4P4NA 4UBLA 1V3TA 3QIVA 4JLAA 1N5KA 5CD9A 5J4KA 2N75A 3U4AA 3G8AA 2JCYA 3NM4A 3QLJA 1QU3A 3GUZA 4UNPA 2DPMA 2F67A 3DW1X 5B2EA 1QQTA 5DGCA 5HDQA 3F4KA 2P7HA 4YRNA 4PZUA 1NW7A 4MV8A 3RUAA 4ZIRB 1SU4A 5EXEA 5B3LA 2JGKA 3LQKA 1HBJA 5IDVA 4XI9A 5B3JC 4R01A 2GNAA 3EX7C 1W36B 1NLFA 1CF2O 3Q3GE 4PLPA 3FETA 3I23A 3NOQA 4KR3A 3I9LA 1HYEA 4WH0A 1PYOA 3ZDYB 3H5IA 2W22A 5KREA 1E2KA 2XD9A 1TL7C 1EVYA 2JHCA 4N48A 2AG0A 2NQ8A 4KWTA 4S3MA 3BTOA 3PF8A 4NAHA 1E5XA 5F7JA 1E7WA 2VPXA 4FW9A 3C6YA 3V1LA 4DLNA 3ZE9A 1SD5A 2O0HA 3DBLB 3DZJA 3PUZA 3FYUA 2ZS7A 4FEGA 4RVCA 2ZUBA 4XAQA 4FDAA 4ZAGA 3HA2A 4UJ3A 2Q1WA 3CR3C 3IBTA 2I1LA 1TVMA 1BOOA 2ADMA 3FNIA 2HEGA 3GLQA 4RS4A 3ZGVA 2Q3EA 1PJTA 3ECAA 4Y1RB 2AFVA 3FIJA 5AXDA 4DABA 4ZYZA 2CKMA 5AICA 1USUA 2XZDA 4M98A 2IK8A 2I8LA 3KAJA 4TXNA 1Y42X 4WZBE 2ZB7A 4QGFA 1RSZA 1C2TA 4Y7DA 4IIHA 1X7YA 4L5AA 5LDHA 5FA6A 2G5PA 1K5DA 1BROA 3SHQA 1LW7A 5BSMA 1QGDA 1YS7A 2IZ6A 2C9OA 2W6JA 3W6ZA 3RAEC 2HL6A 3PNPA 1HNWB 5D51S 1FFGA 2VH2A 2ZANA 1L4EA 4HZUB 3H13A 4XX0B 4JXXA 2PX8A 4TS9A 3DE5X 3DVAB 2X2EA 2YWHA 4RKFA 4Q9LA 2B3DA 1Z6ZA 4IHQA 1CSEE 2RGEA 4QBKA 5KU7A 2AOXA 1IN1A 2I91A 3PQFA 2B92A 1YS4A 5C1PA 1E7YA 4WI1A 3DHVA 1PR9A 4IIYA 4NCIA 3ER8A 1GR1A 3DV2A 1HDEA 2HDNB 3USCS 3TLMA 3AJRA 2Q5QA 2DPXA 1GV1A 2VXCA 3Q7SA 4EB8A 2JJ8A 3HBAA 4DG5A 3ND9A 1CJKC 5JD4A 1KI8A 1ONOA 1L2TA 5FJIA 4DXAA 1UP7A 2RGRA 3P7MA 1M8JA 1T2AA 5DT2A 3L84A 4HYQA 1U4SA 4TKUA 5IVHA 2TMDA 3JCZA 1K66A 2QPAA 2O05A 4G5YA 4MGYR 1J1ZA 1F48A 4S2EA 1FE8A 1XLVA 5IJ9B 2X6TA 1D2GA 1DX4A 5MFZA 3QKUA 2R00C 3T9DA 3MZ0A 2W98A 4B6JA 3E5NA 1NR1A 2PN1A 4ZAVA 3WRWA 4ZDJA 1EFHA 2A9OA 2PSFA 4N65A 4LI0A 2Q6LA 3P9SA 3SXJA 4CNQA 5TMPA 2YICA 4WOPA 4BU0A 1XBTA 1F0PA 3NO4A 4R7GA 1CDOA 4LF5B 1ZVMA 4YONB 3MCZA 1UADA 2BFBA 1NBIA 1R3UA 4GM1A 4MYSA 2WZDA 4O2AB 2PZEA 5JWOA 3VHLB 5K0SA 1ADGA 1FW6A 4C2TA 2QN6A 1LI4A 1N6NA 2OL4A 4KSCA 5DN6D 4GI5A 2AG1A 1FXWA 2I5PO 3HS3A 4JIMA 3UMYA 1CULC 1W4AA 1J23A 1TTHA 3CG4A 2FPLA 4KDRA 4N82A 4NBSA 5TVGA 1ADBA 1HT3A 3RHZA 2RH8A 3X1DA 3BH0A 3OTQA 3AMVA 4AZ3A 3IPCA 1F06A 4CW7A 5HWSA 2B1IA 3WAJA 4EUEA 1HTWA 4M8SA 4ZCSA 1J8MF 4IHJB 5I4KA 3R3YA 1GU1A 2OGZA 1DG9A 1DIRA 4LZJA 1VQ1A 3N39C 2B4KA 3A37A 1P8AA 3BWBA 1SCDA 3G23A 3G2MA 1HE1C 2Z0MA 3O5AA 4OVKA 4DS3A 5KTTA 1DRWA 4N3GA 3SM9A 4R16A 4P0PB 3WLHA 5GONA 5IVIA 1VPVA 1YZGA 1V25A 1TK2A 4ZOCA 2B4RO 4P0TA 2Y1KA 1PAUA 5FYDA 3V2UA 2BFEB 3OQNA 2W90A 3EZFA 4F46A 2Q27A 4DKJA 3UY4A 1OD6A 4MKZA 3AYZB 4ZA2A 1T9HA 1XKQA 2ZB2A 3BE8A 3BMOB 1W581 4EECA 1S4QA 4YMGA 4FOSA 1SCKA 3UUWA 2Y1FA 3AHFA 2XQGA 4B76A 3TL2A 4NZ9A 1YK1A 1U0BB 1QRUA 4FEEA 4AZSA 3K4HA 4W1PA 2ES4A 1IIRA 1D2AA 3FTEA 5CYFA 4XWAA 3LUFA 1E99A 4MO2A 3W3AD 1JSXA 3OKAA 4GZMA 2DFLA 3JY6A 2DPGA 4P3KA 3H5LA 3S81A 3EVEA 4HUTA 1SBZA 3JQBA 3HJCA 5FUBA 4YVFA 1DFIA 3QM1A 3U09A 4IGAA 2XF8A 4LBVA 3ESDA 4TUYA 4L9WA 4RSMA 3LLMA 3UWMA 2BN4A 3DMPA 3KPVA 4OOFA 1MC1A 3INTA 3ITDA 3GJ0A 4WFKA 1ACMA 2X7JA 5CURA 3EEBA 1PL7A 3N5CA 3I76A 2RDMA 2PFKA 3A05A 2VXYA 1RJFA 4DLKA 4L50A 5DHAA 2IPOA 3D59A 1CY2A 1GGKA 3WV4A 4TLLB 3GNSA 1T2FA 4PZLA 4Q39A 5B7QA 1SIOA 3LT0A 4RA6A 4WXEA 4MHTA 2YYZA 4GDFA 5AM2A 5CU7A 1LLFA 6REQB 2VBIA 1R6UA 2ZU0C 5YASA 1DUIA 2WYOA 1FUKA 4MLPA 5CJ2A 5F3WB 2AGVA 1Z07A 4MQFB 2OFOA 3UKOA 1EIZA 2UYHA 2YMLA 4ZU6X 4C4TA 2P4UA 1PJSA 4DLWA 2IQIA 1P6XA 1JKMA 3ANXA 3GDGA 2WSYB 1IU9A 2X77A 3EIXA 3MXOA 4HMQA 5D1NA 1D2CA 3ROXA 3BERA 4J6FA 3CM0A 5CP8A 1LRLA 4MUHA 1ZHHA 4B09A 5LLDA 1E3MA 1OX4B 2BZGA 2ZR7A 3R0IA 4K9SA 1U9ZA 3BA1A 1I14A 4PC3A 4OIFA 2IS4A 4PHHA 3KSBC 2GEFA 2RHRA 3BMCB 4AQYB 3QF7A 2ECOA 4R0VA 2B69A 2VHVA 3TOVA 3VU1A 4ZI3A 4DJ5X 4W5WA 1YI0A 1G60A 3FB4A 2W6PA 4LQDA 5KO2A 3F6CA 5FBRB 2NVUA 3OZIA 4YT5A 4DV1B 4CKWA 1WQ3A 4QU8A 3I62A 3EXHA 3NJ4A 3G8YA 3T94A 1U8FO 5DP2A 3JZFA 3AZQA 1Z2PX 1KU6A 1MB0A 2N47A 3LLSA 4WACA 5BNTA 4AY4A 3LUHA 2FW6A 3HRHA 2GJKA 3N58A 4HAVA 4PVCA 1MX1A 3IHKA 4P53A 1SC3A 4Y2YA 3WYFA 1EUCB 2WU3A 1HFEL 1M6YA 4OAOA 4Q34A 5EXPA 2JHGA 4IF6A 2V7PA 2XQFA 4KGZA 1M7BA 4LTDA 3VH3A 3ZD8A 1VYVA 2OD9A 2JLSA 2Q7XA 4MA4A 4Q12A 4ER0A 1NJFA 2D00A 1H5NA 4MHOA 2IV3A 3WJ1A 5C7LO 1B2RA 1FU4A 2P11A 2ASVA 3GX1A 4UVGA 3SC3A 1M67A 2PX4A 1WDWB 3WNZA 5JZSA 5CNKA 1Q22A 1ZUD1 4XWYA 3CUYA 3FLEA 5B2FA 3IXQA 4O4LB 5AXAA 3TNFA 1VGVA 3H75A 4YRRA 3K0HA 1NDUA 5ALFA 1Z7WA 2IHNA 4XWGA 2X8BA 1RS0A 3RE1A 3PZRA 1PE0A 1HK7A 4GX1A 2JB9A 4BMOB 3Q40A 1GL9B 1ZEJA 2HXSA 1SXJC 3CVOA 3LT5A 5CHYA 4HAYA 4ZIRA 3GGCA 4BU1A 4W8GA 1WF3A 4IUYA 1XZAA 5DM1A 3IX7A 4DN6A 3ZLJA 3EB9A 2F8MA 3KM0A 4C21A 2SCUB 2C5LA 2IYAA 3T5DA 5KC8A 1ML4A 3B5EA 1Y4AE 2X9GA 4KQIA 2VT6A 3QKIA 3A1CA 5C46F 3QEAZ 3DVQX 4V1CB 3NTXA 1QRRA 4MWDA 3IMFA 4OJMX 4FFLA 3LFUA 1KYYA 3WKCA 4WOKA 4MO9A 3D5TA 4EELA 1X9IA 4NBUA 1XYGA 2FPPB 2JI6A 5BWLA 4M54A 2I4RA 1U9CA 2LBPA 2E87A 3CH7A 4AMUA 4H1VA 4IV5A 3BN3A 1UWKA 1T0UA 1L8LA 1XQXA 1YKSA 1NVKA 3DBLA 1T2CA 5EIOA 5JHHB 4TT3A 1LDNA 1E1DA 4RFSB 4HWOA 2Q7DA 3UC9A 4BNKA 4FK8A 2PUAA 2XYHA 2IYLD 3L7OA 4Y1RA 3ZLTA 1JHPA 4FHZA 2AFHB 5DW0A 1DAMA 1Z16A 1WVMA 3NHJA 1P9NA 3BCSA 4LDQA 1E6KA 1ZCZA 4DADA 4GMKA 2GBLA 5FPYA 1HYHA 4YRCA 2P79A 2B5OA 3EXG1 3HHPA 4XW2A 5M7EA 1GUZA 1Q21A 1JWLA 4JITA 1O0BA 4HPJB 3L0DA 2Q99A 2AJBA 4UOQA 5EY5B 4B3DA 4DL9A 5GZ1A 5IF3A 2QHXA 3HJHA 2EIXA 4YRDA 3VX3A 2WDPA 4C0LA 2AV6A 4ZVPA 3GLGB 5EJIA 1UKZA 2I2WA 3W5AA 4RWZA 1EA7A 1KK2A 1C9MA 1PKXA 2AN9A 2J09A 2QW0X 2ZYWX 3HFGA 4HZUA 1WHSB 4NECA 3P5SA 4XEHA 4XX0A 1YB7A 3VDQA 3DVAA 3WJ7A 5CNIA 2V58A 4X24A 2K2QB 3ZV6A 3QG5A 5HRCA 1QGED 3RM3A 1JS1X 4IJVA 1BRMA 1WXQA 1SB9A 3FH0A 1GPBA 3WLLA 2VR1A 3R7FA 3RYHB 2FR8A 3NXKA 2X8LA 5EMMA 1JVBA 4QSMA 5IDYA 1ZM2A 1Z4MA 2B2CA 1VSBA 1MA3A 3K4PA 1LZLA 2J4FA 3KEOA 4TXHA 3U3RA 1EFPB 2ODTX 3C3PA 1J20A 4C2BA 1HE8B 4MAFA 1KGSA 5FIUA 2VQEB 4MWEA 3SZLA 2ZIFA 1JG1A 3OCUA 4GXQA 1IHOA 4FTWA 2PZMA 3KV1A 4LQLA 5EJGA 3V7WA 2B8EA 3MMZA 3V34A 2FJUA 3BF8A 3V8VA 5KKNB 1VL2A 4OLJA 2H4HA 1QM5A 3LYAA 3EZXA 5FO1A 1R9NA 5IJ9A 5G40A 4BMDA 1GPJA 2PXHA 1DRKA 5KBYA 2P3QA 1GEEA 4P84A 2GBGA 4EY5A 2H7YA 3M5CA 4NPCA 3MBOA 1XD2B 1RU3A 1XCGB 4OXKA 4X90A 3UATA 1RXWA 1WW8A 4CIXA 3ZYZA 1YJBA 4DF3A 3E15A 3LVQE 2VYVA 5AKHA 5CB8A 3MJHA 4OCZA 1XA3A 2RK6A 2XWQA 5HNKA 2QN8A 1RKQA 3F8SA 4I9NA 1TCCA 4O2AA 2C1ZA 4FYVA 4XFKA 4ZYXA 2ZUTA 5IHXA 3RJ9A 2RCNA 2OHHA 1UBKS 3JVDA 2JC3A 4TWZA 4H3VA 3UMGA 3N86A 5DMHA 1SCBA 1LB1B 2CL5A 1ISFA 4WXMA 4G84A 3GH3A 4M1EA 3OF3A 1RI2A 1I8TA 4CHTA 5JO0A 1GEGA 3EVCA 3FGNA 1UL1X 2C9YA 4XVUA 4MW4A 1GR0A 1P39A 3WLQA 3VR4H 4NBVA 3PX3A 3U3XA 2GCEA 2M98A 4IHJA 4IEIA 5JRZA 3Q1KA 1AXRA 1GZ7A 5ECDA 4ESHA 2DULA 3EODA 4OBXA 2FWMX 4RELA 2I6UA 1RKBA 2WQ7A 3PHHA 4R1LA 2NZUG 3A9RA 4D9EA 1Z6AA 2PFGA 5C8ZA 5IYZA 1QK3A 1MTOA 2POCA 1JI0A 4A0GA 5ULLA 4ZVTA 2QBYB 2Z2JA 4XQ9A 2WTMA 3IOBA 2O2JA 2O8FB 1K8XB 1QQ5A 2IYOA 2JAWA 3KVVA 4PX9A 4LJYA 2BFEA 3QTTA 4LRWA 4P36A 2XB8A 1KSJA 3KKPA 1UJCA 4UNIA 3TLCA 1KMCA 3BMOA 1JR3D 1E2EA 3PPIA 4KXLA 3NC4A 4AURA 4ALMA 4Z7QB 4I3HA 4C0XA 4TWJA 3PD7A 2GETA 4ALJA 4YIKA 1K7CA 2FPOA 5AVKA 4OAQA 3WSTA 5HILA 3PQ6A 3A6EA 4G0MA 3JVIA 4B9AA 3QPBA 4ESVA 3G7SA 5E4FA 2OZPA 1W35A 3EIQA 5KQLA 1T43A 3ZHVA 1CDEA 1SG9A 4EKEA 1XPUA 5B37A 4PX3A 1CEQA 1CY8A 4RTQA 5FB3A 1JH8A 2RBEA 4EFDA 3OT5A 1VCHA 3GR6A 4H08A 5MF6A 4N5IX 5IM4F 1KDZA 4X65B 2N0SA 1LX7A 3BHIA 1D1TA 3LXUX 3OQOA 3I0ZA 2WFLB 2VUUA 3I72A 1JHDA 2OBMA 2G1KA 2XQKA 1QH9A 1GWNA 4K6KA 3RUDA 4DHEA 2WR8A 5CFQA 3GFGA 1P9WA 4L4YA 1JBEA 4ZT7A 3BXXA 3UMFA 4C6RA 1B1AA 1ESCA 1XE3A 3KUKA 4RK6A 3C70A 3TZCA 3W8EA 6REQA 4P86A 2AT1A 3TQHA 3T3IA 1JLMA 2AF3C 3H7IA 2PO5A 1JKXA 1B00A 3ESBA 5E0OA 5E7QA 2ARKA 5A9RA 3S1SA 4MQFA 1DDOA 3MVEA 5JYBA 3ZGYA 1XTUA 3CPHA 4CU5A 3TIXB 1H5QA 1KVTA 4MI1A 5D3KA 5T8KC 2GCIA 1RE0A 3LVBA 4Z8XA 2BFNA 3CEAA 3JVVA 4F97A 1Q0TA 5FHRA 2A5GA 5F7OA 5CGQB 3TPZA 5KOYA 1LSUA 1IQPA 5JFTA 4BTLA 4B74A 4U6NA 4BQEA 1XD9A 3F9RA 1UBOS 3Q10A 1BVUA 5FP0A 2G1PA 2CUZA 3O3NB 2FR0A 4ZT3A 1OX4A 3DOEA 3S2YA 4HXGA 2KW5A 4RD1A 1L3BA 1MX5A 3CO0S 3GJ5A 4E4TA 3ILVA 3N8IA 2XGGA 2OCKA 3AO0B 1E3QA 3BMCA 5I8ZA 1QTQA 3KTFA 5G53C 2J3QA 4AY6A 3FPLA 3HB7A 2N1BA 3OLXA 5K7SA 3PU6A 2A86A 2BF7A 4YJ3F 1K86A 2N1MA 3EIHA 3EMDA 2Z3WA 2FA9A 3N2KB 3GC6A 4MRVA 4E46A 1A82A 1F4LA 4NOJA 2PX5A 4ZVQA 3BJEA 1IXSB 3EMVA 1L3CA 2VFAA 3V7FA 5JNUA 1ZIPA 4G4SP 5JZVA 4BNGA 1K27A 2UUBB 4A26A 4UXJA 3IRUA 4BJ6A 3DZCA 1CY1A 2GESA 2QRLA 3P9RA 1EUCA 3M6XA 4FU0A 2G5GX 3G5AA 1NRXA 4OYHA 3GCXA 1BVRA 3BJZA 1OI7A 1ZR2A 1O94A 2XMGA 3LOUA 4MUKA 2NNLD 3J80A 2FH5B 3AJAA 1CY0A 1S1CA 4U0KA 3RVMA 3VZBA 1I1OA 2UUAB 4PR3A 5TJ9A 4D2IA 2VJAA 3ESYA 3S2UA 4UKDA 1N2GA 1GZVA 4A2WA 2AQHA 1SBTA 3ME5A 1UXGA 4O4LA 4O4JF 2QZSA 1QUFA 3BAFA 5DNYB 5C8XA 1KQOA 1XYYA 1X7GA 1MXHA 2O23A 4MLZA 3V1UA 5L3VA 4ONEA 4XTCS 4M9RA 2P8SA 1JP7A 3FVRA 1PK8A 5CPFA 5H83A 3EQ8A 3V3TA 2F1JA 3UPTA 3WTBA 2J07A 4BO4A 3HE3A 3EF0A 3P0RA 2D6FA 2JKVA 5CA0F 1DJMA 5ALHA 4C88A 1I10A 2FPUA 2FSSA 2X14A 3O1IC 4WOJA 4ETNA 2XGMA 1SCUB 2IHBA 3O4IA 5LBUA 2SCUA 1MEEA 5J58A 1DJQA 1XSEA 5JS8A 4LMPA 3HLKA 5BUSA 4E2YA 1P5HA 3DT6A 3RVOA 3D8UA 4BGVA 4V1CA 3L79A 1IBCA 4P33A 1P33A 5K0LA 3UICA 1OI3A 3MJFA 1YZYA 1Z0AA 2I1VB 3HVJA 3ZVNA 2QGFA 1DIOB 3SFVA 2EL9A 3QBDA 2FPPA 4F86A 1K7EB 2EOAA 1U4OA 3ZY3A 1AGPA 2JNWA 3FOWA 2NSHA 3PC4A 4FKBA 4IV0A 4MWOA 1Y6QA 1GPKA 1DEKA 2PT5A 4HAIA 4W5NA 4MWZA 1L5MA 3RC1A 2AOTB 4RFSA 5BSFA 5JBIA 3I2GA 3RC7A 3ROZA 1OFUA 4DPLA 1GG5A 4N5NA 4PWYA 1L5GB 5L3RA 1ZJ5A 4EHHA 1I94B 5JI2E 1KQNA 3RUFA 5GIOE 1X2EA 2AFHA 3ISTA 1EFTA 2GHQA 4NPAA 4ZKEA 5TY0A 5E9AA 3I9OA 1GKLA 1EFRA 1PJQA 4Z3KA 3FCXA 4QRDA 4ZJUA 1ENOA 1KAQA 2EW8A 2VQSA 2YL2A 4FE3A 3TZLA 1YF3A 2OLKA 4W9RA 4LBZA 4HBZA 4OH7A 3SX4A 4INAA 3UWSA 4F1JA 6YASA 2WLTA 3GLGA 5FQNA 2BH2A 1ONBA 1KI9A 1XVIA 1OIWA 4JBYA 3RYIB 1VJTA 2ODQA 1H22A 1XEWY 3F2IA 1G8KA 1U2TA 1X1BA 4BO7A 4YY3B 2CSUA 1WHSA 1V5FA 3LFHA 3WX0A 2CWDA 1K6IA 5JH7B 4MXDA 5KTMA 1WMEA 5D00A 4TS4A 4V1CI 3EW7A 1XMOB 3ULKA 1Z8NA 1WULS 1UINA 2XQIA 5J2UB 3WMWA 3RYHA 2GM5A 1ZCAA 2Z5GA 3VC7A 1Y4SA 2FWJA 5I8PA 2XQVA 5DPMA 4KXFB 1QP0A 3FOBA 1KDVA 4ZVRA 3SJZA 4RJ2A 2W2TA 1AA9A 5C5IA 5GJBA 1EFPA 3ON5A 2YNMD 1FSFA 1G5HA 1OYWA 3LPNA 4H7HA 4IWNA 4PG8A 5CB4B 5T7BA 3C48A 1FS4A 3O4RA 3DD1A 3DZ8A 1N2HA 1CFZA 4UQPA 4W99A 4EB0A 5KNCD 1HXHA 3IUSA 3EZ2A 1I6MA 3L7CA 4GECA 4ZGBA 3A1TA 4BVBA 1U9JA 1XMIA 3EY4A 1B0ZA 4DV0B 3ADKA 3FYCA 1RXIA 4IJ6A 1OC4A 3VDNB 4EPYA 5JIBA 4XWTA 1V6SA 4B83A 4ZJPA 1SD1A 3E22B 1EX7A 3E53A 4HDKB 3W5IA 3ICQB 1XD2A 3TLYA 3ZCQA 3U5ZB 2F17A 2W2XA 2H57A 5I7RA 2WNHA 4CM7A 1UM8A 1MW8X 1H2YA 2G9RA 4XVRA 2ORYA 4UE6A 4L3VA 3GOQA 4JJKA 2AL7A 4Q7MB 4V0MA 5LP1A 3IMKA 4A36A 4I6GA 2I3BA 2BAGA 3WWYA 2H3EA 3TECE 5HF8A 3MBKA 3WLSA 1K9VF 1YZVA 4REMA 1FDRA 4MYUA 2Z4TA 3ANTA 1V6CA 4RIHA 3LA8A 5FYQA 1Z0ZA 4A8JC 2ZJ7A 4LHXA 3QUQA 1ZHFA 2DQSA 4YJGB 2ZT7A 1YFZA 2GTIA 3Q11A 4GGPA 4PLGA 3U3DA 3PENA 1LJLA 2V4MA 1IG3A 5KCZA 1GXSB 3ODPA 3MTBA 3KHKA 4B3TB 1QNLA 2PV0A 4IVQA 7ADHA 1ZM9A 1H1TA 3LX6A 3HB5X 3R24A 3HFRA 2JKZA 3L9XA 4QUJA 3ET5A 1FFCA 4YAWA 4B35A 4RW0A 2FU5C 1VKNA 2QBYA 2ATEA 4B82A 1FTGA 1WS6A 4YI3A 2ZWOA 3I9V6 5EMLA 1WWKA 1RJDA 4GI1A 4HX5A 4RD3A 5BSKA 4KX3A 2IZOA 4KW7A 1C1HA 2TRSB 3BZWA 3S2SA 3SS9X 4EGJA 1R15A 4AU1A 4MUIA 4YP1A 3VU3A 3DL2A 4C5AA 4JKOA 1V7CA 1GM5A 3LHIA 2R8XA 3CZPA 3VKUA 3LUKA 2Q6VA 3BSSA 2OWDA 1EE9A 3ROTA 1WEHA 2XEDA 3GIDA 2M1ZA 3AHEA 4DNPA 3W7BA 4RSRA 2D0IA 1TQ8A 2BCJQ 1H85A 5FLEX 5DIZA 1CJBA 2YBDA 3TMYA 1DAPA 3W6PA 2MR6A 3CX4A 5JCZA 5C51B 1O9HA 5SZJA 5AJZA 1TK9A 2VWHA 1YJXA 2D3WA 5CFOA 4LF6B 1JEOA 1Z6PA 1K1EA 2O3QA 4Y30A 1YFJA 1I2MA 1NUPA 2XNJA 3LGXA 4LC0A 2VF4X 5FTMA 4AG5A 3T0FA 2CNKA 2J32A 4S1NA 5AFSA 3KPWA 4JOBA 2Z8YA 3IHWA 5LA6F 1BX1A 1T5SA 2WFLA 5LMNB 2J7KA 4C4ZA 3NBQA 5JSYA 3M33A 1C29B 4KMRA 2WV7A 4PTLA 3IQDB 2W0MA 4BZWA 5A1TA 2C0QA 3WDLA 3VOSA 1XLTC 4R1SA 5KDOA 2AX4A 3R0QA 4BX8A 2GGSA 4H77A 5KOJB 3WYDA 4QFDA 1AH2A 4LJAA 3WB2A 2F1HA 3U3KA 3SF8B 2FPGB 3ZS8A 2Q49A 5F1YA 5DTRA 4A2PA 1VL0A 2JCXA 1NIPA 2JJYA 1VKRA 2EYUA 2KLBA 1NYRA 4I6JA 4UZSA 4KCGA 2WE7A 1TZKA 2L19A 2JKYA 3IOCA 3EEQA 1RQGA 4QJ4A 1D09A 3E05A 5B1HA 3SIWA 2VZ9A 3REQB 2HK7A 4DIKA 2B61A 1NW9B 4MDEA 3AIOA 4CIYA 1AO3A 4L7QA 1WCIB 4JI2B 1PJBA 3GRRA 3OIFA 2E5WA 4GBED 4RLSA 1RAHA 1TCUA 1WA5A 2BHNA 2ZBQA 5THKA 4DMCA 3D4OA 1FLNA 3EPPA 3SHOA 1C3XA 3U13A 3ZNOA 2PUTA 1GAWA 4DJAA 5LU8A 1ULHA 2JD2A 1Y1QA 2Y0BA 3CJRA 3GJTA 4OKSA 3KQHA 1LBIA 4KUEA 3KZCA 3BFVA 4J0CA 3FOAA 1F2DA 1QU2A 2BMAA 5FI1B 4DCTA 1XZBA 3EBOA 3N2KA 4G5SA 5IRCD 3CS3A 5AUPB 2QJRA 3OJEA 3PG5A 1R9GA 3IC5A 4HSEA 1NXWA 4P22A 3AVQA 4DTCA 3B3QA 4OUDB 2FOIA 2J6IA 3A3PA 3I2IA 4OP2A 3RVPA 2HPVA 1XTJA 3B8HA 2XI4A 3EHDA 1K75A 3OT1B 2ZRHA 1G5QA 4FFVA 3TEFA 3GLKA 3KQQA 4MYDA 4MX8A 1PSDA 1SK9A 1WY5A 1ZA2A 1AD2A 1ZCJA 3P20A 2AQ8A 3FWHA 2E1RA 3GD7A 4HXFB 2X4IA 4EIWA 1SXIA 5A3RA 1T3HA 3UHJA 2O8VA 3BH6A 3GRAA 5TPWB 1XJCA 5FOWA 2AR9A 3LK7A 3N8KA 2FGKA 3OFJA 3N5KA 4KL8S 5G0WA 4ENPA 2QM0A 5DWDA 1FFHA 1ZD3A 2RHDA 3NHZA 1CZKA 2GD1O 3NX4A 1OXTA 2E4VA 3E9CA 3P4XA 2BZ1A 3A4NA 5TPZA 1KERA 4R40A 4NG4A 5LLSA 3ZGNA 1NRWA 4EYSA 2PG3A 1YTLA 1Z56C 1X1EA 2JIQA 4L5CA 4FX2A 1E7MA 3QUCA 4Q1FA 1J09A 5DZSA 1WIWA 1SZCA 1ZX1A 4BN0A 3O8OB 2R6FA 3EEYA 3MIIA 1ISGA 4OFBA 4C5BA 1HT0A 1LDYA 1GPMA 4UAVA 3R7AA 3V4RA 3HDJA 2FN8A 1E62A 1SCUA 3Q2KA 3J81A 3A4LA 5IMSA 5ED4A 4QNNA 5DN6A 4HNVA 2PR7A 3F3SA 2FPWA 5AR1A 5BSGA 3MJEA 4D8WA 4G0ZA 1Z88A 1QMGA 1P0PA 3AW8A 4JQOA 4N7JA 4ND1A 5EGSA 2IXGA 1P4JA 5HGXA 2NAPA 4KR6A 1KMNA 1YR6A 2W2KB 4C4YA 3PEFA 5IFLA 1CP3A 2XUPA 1S2DA 3T7RA 2C8LA 4ECEA 1LDGA 2AOTA 4LMRA 3KLNA 3UGJA 2G8LA 5KNLA 3CVVA 1RWOA 2YUIA 1W1WA 4L0MA 5TEVA 1AY0A 1X86B 2CF6A 5HJEA 5DX1A 1YGYA 4IOJA 2PBFA 4UUQA 3K0CC 5J2TF 1VLQA 1Y7PA 1VPDA 4UVIA 4D3DA 3KSZO 4RFLA 1SCJA 3OX4A 2FSIA 2PMKA 2PQ6A 3HPRA 2YVQA 3HVUA 3KWFA 4RQBA 2AG8A 3WGJA 5A4FS 1TNDA 1XNQB 2HT6A 2I87A 2ONCA 1Y1RA 2V6FA 3ZHSA 2EV9A 4X1OA 4E31A 3MPOA 2H3HA 5ALJA 1P9LA 1M2FA 3RYIA 3FNGA 5JT1A 3KCQA 1C3VA 1UFQA 2G36A 2H08A 2V6GA 3FHOA 4LC9A 1YCHA 4XYMA 4BFTA 4D41A 5JNWA 3B6MA 3SQDA 3WJAA 3TVDA 2UKDA 2YWGA 3TQCA 3W3AA 1H2BA 1Z73A 2R6GA 4Y6GB 1E2UA 3EC2A 3QU5A 1BE1A 4P38A 5F4BA 5JH7A 3NXSA 4PZ9A 5KYKA 3LUPA 2JLVA 5J2UA 1CNFA 5CDHA 4Q21A 4F92B 1OX5A 3QYAA 3GWZA 4EZEA 2I33A 1DWOA 1KFEB 1ISMA 2QN1A 3D64A 3H2JA 4OP3A 5U4XA 3K6KA 5KX5B 4I08A 5A0VA 3TIFA 4FXPA 1SIUA 1X9HA 3GOHA 3ADOA 3WIEA 1KZ1A 1Z6YA 3K5IA 3JD1A 1MEOA 3F3MA 3RHSA 2IUFA 1HQKA 4E2XA 2C9ZA 2ANBA 2W71A 5C1DA 4UUAA 4YXFA 2MYTA 4X6LA 3ZU4A 2ZJ6A 1H2WA 3QTLA 3V9AA 3RLIA 4F5YA 1AUPA 3ZHZA 2IBTA 3FLBA 2HJGA 1JILA 3KWMA 3W78A 2OHVA 3IP1A 5CCBA 2PYDA 1S2LA 2WAAA 4QRIA 3E22A 4HDKA 4TLEA 4KE9A 3RTGA 1EDBA 3INGA 3WQRA 2AOVA 3MTEA 2FSVA 1CZHA 3GL9A 3KFXA 3QPVA 3A9TA 2F1IA 1ZH8A 4RGBA 3IDSA 1KEWA 4DMFA 4XGQA 5B1DA 5IJ0B 1UEJA 3IBSA 2EWMA 3SQNA 2PU7A 4XYGA 4KB5A 4K8RB 4DIEA 5LXTB 4UTVA 4C0JA 4TV9B 3PEWA 3R9KA 3FDJA 4NJEB 1CNEA 3GEMA 3KG2A 4NE7A 3O3MB 3RV4A 4E0BA 1HRDA 1IOZA 4K1LA 3UHPA 4S04A 1RQPA 1M76A 3Q7PA 3EPRA 4ZVMA 5SICE 2FP4B 4MP8A 1C5KA 4IR7A 2C2ZA 4WEQA 1NW5A 4RZHA 5EWJB 4CRWB 1ZI6A 3BE5A 3YASA 1HL3A 4LRTB 2Q2VA 1GXSA 3X2FA 3P8ZA 4LRQA 1SZPA 4PFJA 4V0KA 3KCNA 3WLEA 5CXUA 2FMKA 1KC3A 1COWD 5CTAA 1W75A 2HV9A 3Q3EA 3TQSA 4YBZA 3ELYA 3F3YA 3WQHA 2QU7A 2LNDA 2CUKA 3QWFA 4N3CA 4JUIA 1P80A 3L41A 4WFJA 4R69A 3RKRA 4AS3A 2Q5JA 3QXSA 3AF1A 4TRJA 3LC1O 1C3JA 4X8MA 2PGLA 3DP9A 1PZEA 2NUPB 1CG6A 2QJFA 4KDEA 1Y4UA 3SHWA 1QSGA 2JHFA 2OLJA 3L8GA 2X1HA 2HQOA 1T3SA 1ZVKA 5DM0A 3N2GB 4H16A 2Z8XA 3B6IA 3CX7A 2IYVA 4FGSA 1T0BA 3H04A 2P9ZA 4G0OA 2IL1A 3HWWA 4FFNA 1OBVA 4C06A 2PRSA 4HLCA 5G0VA 4CIDA 2FW1A 3L92A 3EGXB 3K92A 3QY0A 1CUSA 4F0JA 2QUHA 4I55F 1E98A 3C45A 3QVOA 1PR3A 1I0IA 4Q6WA 5DO9A 5BYJA 1WSBA 3EULA 5EXSA 5JFGA 1IK6A 1HRKA 4I9UA 5TS2A 2XMCA 2HA5A 5CYPA 4L08A 3NNDA 5LB4A 3OURA 5KVCA 4HVTA 4MIOA 3ZTYA 2OAQ1 2XVYA 5AVWA 1NDQA 4IRMA 1ECPA 2C1XA 3H86A 4N3NA 4BP1A 4ENSA 4RQTA 3U56A 3QW2A 3U44B 3OECA 3GPIA 4JYBA 3W05A 3MXTA 3NHRA 1GG2A 1A1VA 1J06A 2ZBFA 1FXUA 3EVAA 2ZWIA 2ZBGA 3S7TA 4LOKA 4IRXA 4EKIA 1UAGA 3NHSA 2D1QA 2XMZA 1MPXA 2QTNA 1BA2A 1EXVA 1I2BA 4CODB 3LCCA 5KOJA 2ZJ8A 4D98A 3NYQA 4AJ2A 1U2ZA 4B7CA 1I6WA 4R7ZA 1ZM4A 4YCAA 5BV1A 5MN4A 3SF8A 2FPGA 3JR7A 4WZAB 3EISA 2WQ6A 2X9QA 3CPJB 3RVSA 2JLZA 4HEA1 2ZCJA 3HO8A 3B1JA 3H16A 1QR6A 2DCUA 2CD9A 3LI2A 3RS9A 3VYRB 1ZAYA 3L8HA 1BDHA 2PWAA 5DHFA 1X7HA 4M49A 3I9MA 4FMCF 3N74A 4RF4A 4NYJQ 4UBOA 3R6LA 4UJ5A 3REQA 3U9SA 3WISA 1U7UA 2C7VA 5ETJA 1WCIA 4QBGB 3RTAA 1L4NA 1GARA 3ZTWA 1QZUA 3OM9A 5AK4A 4DLLA 1QAOA 4Z7NB 1K3UB 3T3NA 2WT4A 4WK0B 5TJHA 4F2DA 2CZGA 4G1UC 2OUKA 4TTPA 3RTBA 5JEEA 1XTKA 4MQUA 2O54A 2A0UA 2PRJA 3E9EA 5ECWA 1TUBB 2OBXA 2BE7A 2VHCA 3MLBA 1ECFA 3BL8A 2GAOA 1I3KA 3PXXA 1M1XB 2VDNB 4BNHA 1Z68A 4ML3A 2W00A 2XMRA 2GDJA 1BGVA 3TEJA 2QK4A 4OUDA 3TFWA 5D5PA 2Q0QA 4LCEA 3OT1A 4UREA 1YA4A 5DBEX 3WLOA 2AEMA 1H6CA 1OILA 4Y2JA 1M0EA 1VJDA 1K68A 1TD9A 4MQMA 2QTMA 4OD0A 4Z0HO 4DDKA 1KEEA 2VP3A 3E9QA 4L74A 2WMDA 2Z9CA 3A70A 1TT7A 4L73A 4XDZA 4QYMA 4R1MA 4B31A 4Y1EA 1ETHA 3HP4A 5TPWA 2GKOA 1VLLA 4ZOLB 1GNRA 4RPHA 3VVCA 1FMFA 2JK0A 4YAOA 1BDIA 1G64A 1JG6A 4QECA 1RIFA 3ZX5A 2O2ZA 3MJDA 1CB0A 3KB2A 1V0JA 2CCJA 1NVEA 2AHOA 3N07A 3NT4A 4L5YA 3Q98A 4PAMA 4X3CA 4MLDA 3OQVA 1PD0A 4IGFA 2H4ZA 3ZVRA 2ZUDA 3OM1A 4IRUB 2Y3IA 2CMHA 4Q47A 1FFYA 1DKLA 3O8OA 1UCFA 2EEZA 4NS4A 2WJAA 4LY6A 4PXAA 3WXBA 5JAHA 4DV7B 3E5HA 4YMUA 3BFPA 3EUFA 4JBIA 2AB0A 1LX6A 4E6EA 2XWSA 1HE3A 5A4JA 2BSAA 4TT8A 1CUEA 2GKGA 2N3ZA 1YNSA 3O4JA 3PCXA 3Q3HA 1MMFB 5K0TA 1TOAA 2F48A 1VJCA 2G63A 4RJIA 3SVTA 4XGRA 4MA0A 4J0KA 4F4FA 3I5YA 2B21A 1PQPA 2OZLB 1XN1A 1MC5A 3K2QA 5BN4B 1ZINA 2HQ1A 2FJPA 3HHEA 4MUGA 2QX6A 4MEJA 2X4GA 5EYPB 1U7DA 2FPKA 2W2KA 2Z2KA 3FG9A 2G1JA 1XIVA 4KH1A 4QQNA 2J5QA 4AP5A 4J1TC 4BGIA 1B26A 2EU8A 3NDPA 4PZ0A 4AMZA 1VE7A 2GBIA 4G1FA 3I61A 4JS0A 1KYXA 1NBOA 1IXRC 4UMEA 1ORIA 2LV8A 3U4IA 4F4UA 4NMWA 4BIIA 3V2GA 5IC5A 1DQRA 5IW8A 3OLWA 1R4NB 3OFKA 3UQYS 5JCOC 1OWOA 2PMDA 4Y0NA 2M2IA 2C2GA 4NBKA 3RDPA 2LZ0A 4IJUA 1XPRA 1TTTA 3BDAA 2GXUA 3UMBA 2ROQA 4LOLA 1SO8A 3EDRA 3L8CA 1ILWA 4GP7A 4RM2A 4JROA 5HM8A 2VUTA 5K9ZA 2VOJA 4B3HA 4BNYA 4WGFA 5ALPA 5HUHA 1KR5A 4DUZB 1S3IA 2DUJA 2I76A 2YWEA 2GJAA 4IV8A 1R8XA 2HF7A 1TJYA 4DV4B 1I13A 2GT1A 5AVZA 3UV6A 1T1JA 3F78A 5BSVA 3TXYA 5ITWA 3EPLA 2VJYA 2BDUA 1UBSB 5EIWA 1NG9A 4YMWA 5FBHA 5JJKA 4M8IA 2ILTA 4CMHA 3PQ7A 1EVIA 3RWMB 1ZJWA 2FUG1 2OC4A 4WSOA 3NOXA 1JQAA 1DQZA 3DVSX 1JRLA 4X00A 3K53A 5ENDA 2TMYA 2ZE5A 5CB6A 4GBGA 2TYSB 4WXPA 3VO8A 4AJEA 4RIEA 4WRRA 3WYBA 5KX5A 1PHPA 1DO2A 3O8LA 4IOMA 4ZRMA 2JEYA 1YV9A 1S9HA 1P4AA 4M83A 3P2KA 4OQXA 1CHNA 3LHKA 2D5LA 2R4UA 4CNBA 5DGIA 3ZW8A 3AEKB 1Z15A 3R6DA 5DBFA 4C3VA 2X0EA 3FTNA 4HTAA 5CVTA 2QTZA 3OWXA 5LQRA 2IEIA 4U7GA 3S55A 1QBGA 2C5AA 1NUUA 3BMNB 3VZQA 3NBKA 5JNSA 4OM7A 1NC3A 2O2IA 4AP6A 2Q4BA 4UPVA 5JV5A 1Y1SA 2CHFA 2HKIA 1TAHA 3STHA 5C8YB 1IMJA 4EY3A 3HCPA 4PZPA 4DEYA 1RRPA 1QDUA 1P29A 1XNJA 2PPVA 2XUQA 4MRRA 2C0CA 2YHSA 3B38A 4RQAA 5E9JA 5F21A 3T5TA 1OXMA 2O59A 3NTUA 3RCBA 3W5HA 1RTTA 4RY9A 2PEYA 2VP6A 2WVAA 2C29D 1VE9A 4TV9A 4ZOBA 3O90A 3A1UA 3SZRA 1GA6A 2V7BA 4NJEA 2YKGA 1EP3B 3RTEA 3VFDA 1UOPA 3OUZA 1KXZA 1QQ7A 2HHCA 1QOQB 2CE7A 1IN6A 2OA0A 4HD8A 3IQEA 2FP4A 4BO3A 4KRFA 1SURA 1H05A 3LNCA 3KQTA 2E21A 3W5UA 2CXPA 4L8FA 1MD9A 4BE7B 4Z7JA 3N2NA 4KAXA 3W2EA 4EA9A 3MINB 4YP7A 5J5CA 3LPDA 2XKJE 4JXZA 4EG7A 5B55A 1JW9B 2F55A 5CK4A 2EKQA 3B6EA 5H4GA 4II3A 1OUMA 1W4ZA 2HA2A 3HUDA 4GM0A 2CJPA 4RHTA 4UUMA 2Y92A 2RG7A 3AIKA 1Z63A 3DLPX 2GEUA 2FZLA 1NMEA 1R16A 2CFTA 4TLAA 1MT0A 2IC5A 2FZWA 2NUPA 4KR2A 4FFBB 1FU7A 4Q9JA 1ZWLA 3PKIA 5FI3A 3W06A 2MSDB 1DRUA 3N2GA 3KJEA 3URMA 1J2RA 1H6BA 1I1NA 1VCMA 1MBZA 2ISQA 1O5IA 3DV0B 3JATB 4JBGA 4M6WB 5GP1A 4BO8A 1FUEA 5EKSA 3NBMA 1K7SN 3TRDA 1SKBA 5IWAB 5A04A 1J8YF 3RS8A 4BX3A 4DV2B 3EGXA 4XVCA 2HHHB 1V95A 4UC0A 2VDKB 2C5SA 3LL4A 1XMVA 4I7EA 5KYGA 2W48A 4XGIA 1P81A 1X1RA 1P0CA 1YBMA 1OAAA 1ZGZA 4JLSA 3EARA 4U63A 3CWZA 4BTVA 2JG3A 3TAUA 1NKSA 3AETB 4EJSC 4OLHA 2Q5FA 3UANA 3U44A 5DN9A 3BPSA 3B78A 3R6WA 4YCNA 2ZYUX 2P3LA 4N5MA 4CZ2A 4JLOA 4PZAA 1IMOA 3CN7A 3IP3A 2FLWA 5FV7A 4ZDIA 5IZCA 4DCUA 4EEZA 2H4FA 1KNQA 1FDTA 1F14A 3WNQA 1P4GA 5J1SB 2XCQA 3ZV7A 2FF5A 5ALOA 4XIFA 3ROPA 1MJGA 2TSYB 3SIRA 4S0XA 5CNMA 1NT2A 3Q85A 1NONA 4WZAA 4EGSA 1KJJA 3RIMA 1NP3A 1HE2A 2Q62A 3T12A 4B3BA 1EZZA 2XXAB 2AWNA 2I55A 2J3KA 3LIIA 4NC9A 4ARSA 5EPEA 2COEA 4MRSA 3RC9A 3NJ8A 5BV8A 4RVFA 5A3QA 3AUYA 4ZYYA 4WFIA 2BDEA 2B6NA 4M46A 4A16A 3B85A 3QVXA 2OSVA 1SVWA 5K8VA 5J43A 4LDJA 1TM2A 3CYFA 4L2IB 1LSOA 1PBNA 3PEYA 3TB6A 1ZN2A 1EVEA 1ZK0A 2Y1OA 2JA2A 3AESB 2GLTA 3HABA 5E0KB 5AW8A 1E3IA 1YRYE 3SYTA 4WEOA 3HP7A 2QLNA 1EUQA 3CLRD 2XCUA 4OHVA 2Q9BA 1S9DA 2PU5A 4M88A 1L9XA 1O7JA 4PGAA 2B37A 4IIFA 1TUBA 4L6CA 2QAGB 5AKJA 5FT9A 3WK5A 3CNNA 4HL6A 1LPMA 3NZEA 2A8YA 2OBFA 5EQFA 1H69A 5KSWB 1BCSB 1KNXA 4B6EA 1DEHA 1XZGA 4J3FA 4HO1X 4Q4HB 2JFBA 1XCBA 3DM9B 1CS0B 3OIYA 1ULBA 2OCXA 4OUKX 3DOOA 4EEXA 5CDTA 1B4DA 1P45A 5IM5A 5F3DA 1U8ZA 4E13A 4BKMA 4B46A 4D4IA 3AY6A 4LYGA 2HA0A 4BMSA 1QIKA 3PFIA 4PRZA 1B3RA 1W0KD 2I8AA 2XGSA 1CCWA 2YW2A 4X6XA 4CM4B 1RCUA 2O6LA 1OBCA 2XJ9A 2XUHA 2A9FA 2B82A 4IQ4A 4YROA 4E5PA 5IH7A 2O7QA 3HG7A 4HB2A 1VMKA 2FDXA 4P34A 3RRXA 2QTAA 3OLZA 4ZOLA 3VYTB 3OOEA 2O50A 5KNCA 4Z6KA 1B8UA 1SCQA 3RGWS 4IGIA 3DBRA 5HRUA 2PK3A 3AP2A 3GUUA 4H7EA 3TQTA 3ZD6A 2O7RA 4Q1EA 2OCGA 2XBLA 3DZDA 3CLSC 1N8KA 4AKGA 4J94A 4R8MA 1WF6A 4TWBA 4R7TA 4F3KA 3KOOA 2NUTB 4Z86A 3VXKA 1TW2A 5FNVF 3S2GA 4A8TA 4AN0A 4LKRA 1KZ7B 5AW1A 1KY3A 1M2JA 4WY5A 3GCWA 1ZBDA 4X85A 3R9WA 1L1EA 5BXQC 4QUGA 3HKEB 3VBCA 4EBFA 2EP5A 2XE7A 4OXRA 5EQJB 3TMAA 1KJIA 1R6BX 2VPYA 3KB1A 4K05A 3IP5A 1A97A 1O77A 1KPGA 1QB7A 4J4TA 1NJ2A 3PXCX 3DFUA 4C87A 5JYEA 2P1RA 3OJXA 2NT4A 2WDZA 3GRYA 2OZLA 4KWCA 1TZMA 1GCUA 2IVZA 3LPLA 5BN4A 3QF4B 1IXYA 5AQ1A 2C4KA 1SVNA 3C1OA 2G0TA 2C84A 5EYPA 1JEQA 4ZDKA 1FMCA 2PTHA 2RBGA 4PQGA 1PO7A 1CVLA 3KKEA 1Z5PA 2ZDGA 5EJ6A 4R2MA 2JIMA 1M1ZA 4RL6A 3VR3D 8AT1A 2BL4A 4R2HA 3NIWA 3B52X 1SU6A 3HCWA 4EI8A 4K9RA 1KMQA 1M72A 1THZA 2OV2A 4URUR 3BJMA 3H19A 1JAXA 3U4HA 2QP4A 3WGYA 3KQPA 4A0HA 3QHAA 1R4NA 4EI7A 3NEAA 3L93A 3ONFA 4YGYA 4RJTA 2CT8A 4BNFA 1P18A 3MJ4A 2J9ZB 4LGMA 4XGNA 1BMTA 5ANRB 4EMSA 1DSSG 1NSFA 1GTG1 1MFPA 3HA3A 3ND5A 4AZ0B 3BSFA 4IGKA 4Z2YA 1YR7A 3VU9A 4MVYA 4B2IA 5ALVA 1I7DA 3DLTA 2HJRA 3GCGA 3DC2A 3MQFA 4PFSA 2FETA 5EE1A 3ROQA 3JQ9C 4E4YA 2Q1SA 1SVMA 4UBKA 4IZOA 2AR0A 2PGDA 2QVGA 4QQKA 2CLOB 1Z18A 2DHDA 3A9CA 3U1VA 2FFRA 4OBEA 1HM5A 4GEGA 4FE4A 5KMGB 5BOSB 2BI8A 3X1WA 2GUGA 1GPDG 5T4EA 4W5RA 1FDUA 1Q14A 3SBEA 4DR1B 1W94A 1SU8A 2QN9A 2XWPA 1I2DA 4R6XA 4EQ6B 3W34A 2ZM5A 1YZ3A 2G7ZA 5BV0A 5DTMA 4E6PA 1P1BA 1HA3A 1T36B 2PZLA 3FAZA 4JODA 4O1HA 5GZ6A 4EARA 1C1YA 1AC5A 1BXRA 4R51A 2JASA 3AEKA 3OSUA 3W2IA 1WPRA 3VJLA 3HR4A 3WJ2A 3L0YA 3OESA 4CTNA 4RHFA 1U5BB 1J42A 4UU0A 3DONA 3SD7A 2O7SA 3H9QA 5M5BA 2VK1A 2ZUCA 3K30A 3K8QA 3N1UA 3F5MA 4Q3NA 4X91A 1MHTA 1YQUA 1L4GA 3BMNA 1NVBA 5HZMA 1D0VA 1EX6A 2QRVB 1Q6YA 2QRZA 5L45A 2YXDA 5CDGA 4IW3B 1UK7A 1ABBA 2I4NA 5AMXA 3D9QX 3A0UA 4OHKA 5C8YA 3SJBA 5CBPB 1XNHA 1Y7TA 2O8EB 4PHCA 3AIIA 2ZITA 1FNMA 4KFCA 3DHNA 3OPQA 2WYUA 3JYPA 1JZSA 5DDIP 5ICFA 1DE0A 2O8DA 4I66A 3BGVA 4JOQA 5JSKA 4C0WA 1TZCA 3VNAA 1AS0A 2J5XA 2OY0A 5JPCA 5AJWA 2Z1MA 2CLDX 2NM0A 3S28A 2FHSA 4IFEA 4LF4B 1DHRA 1Q83A 5KYWB 1V3QE 4TLCA 3BBPA 3MINA 4D4GA 4B85A 5JXHA 2Z