4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
molecule keywords Esterase B
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
4HAIA 5JZ9A 3H2IA 1ODSA 2G4LA 5AI6A 1XLWA 4B7ZA 4U2FA 2JBWA 5E4JA 2B9VA 2GBIA 2RI6A 1EH5A 1VJ5A 2HRRA 1DTEA 4YX9A 3QVMA 5AK4A 1CLEA 1T4MA 1H2XA 2WTMA 4TVKA 4FFVA 2JGFA 1QONA 1ZI8A 1Q0ZA 3L1JA 2VAXA 1XZMA 1CUAA 4F0JA 2OCKA 1MPXA 3DNMA 2HU8A 2XUKA 6YASA 5HK9A 3O9MA 5AP9A 1N5MA 3DOHA 5EGNA 4AQDA 2R11A 1Z68A 1DWOA 3TJMA 1LPMA 2AJBA 3CCBA 1R9MA 4H7FA 2JGKA 2R8BA 4UBKA 4ZI5A 1U4NA 2OLEA 2PBLA 1EVQA 5ALNA 3R3UA 5AI5A 3BF8A 3I2IA 3C43A 1HQDA 4Q82A 4ITVA 4I4CA 2XE4A 4B85A 4B9AA 3FLBA 1CUGA 4JNCA 4BAUA 3CN7A 1IVYA 1XZIA 5FPQA 3OTQA 2ZYHA 5ALOA 4RE5A 2XQKA 4QDUA 1QFMA 2ZSIA 3H2JA 3H2GA 1U65A 4ZXFA 1E8NA 1ORVA 4FOLA 5JADA 2FJPA 3G9ZA 4BP9A 3D5EA 3C87A 3RARA 4W63A 2XUHA 4X91A 1P0QA 5BV7A 4MQLA 4B0OA 2H9YA 1BS9A 4OUKX 4DMCA 1IUOA 2O2GA 2PSDA 3WK6A 4DSAA 1X2BA 3ZLTA 4QEKA 3EQ8A 3F98A 2BFNA 2PL5A 2QUAA 3GUUA 3TRDA 2YXPX 5D7BA 3GBSA 1THTA 4F21A 2WSLA 4UHCA 1YB7A 4J3JA 3QBJA 1IZ8A 2O2HA 1YS1X 4Y2XA 5CRIA 3QH4A 3I6MA 5AICA 2CJPA 2K2QB 3ESCA 5E4YA 3O95A 5ALPA 3W9BA 2CZQA 5K3EA 4IH9A 4ZGBA 1FJ2A 1YA4A 4S0XA 2WU4A 5AKLA 4AZ0A 3FSGA 2OCLA 4E15A 3O4HA 2HDWA 3FVTA 1YAHA 1MX9A 1CRLA 2QJRA 2VTVA 1D07A 2VJBA 3ZPXA 4CCYB 2WQZA 4FKBA 3ESAA 1YR2A 4NZZA 1E8DA 2I3ZA 3ANSA 2XUDA 5YASA 2CB9A 1LPPA 1SCIA 1TCAA 4H0CA 3AZOA 3D4LA 2QR5A 2BCEA 5ALXA 3CXUA 1EX9A 2PU7A 1F6WA 4EZIA 5HFNA 2QJWA 3BDIA 5FDFA 1UXOA 1ORWA 3PFBA 1VXOA 5HF9A 4XIIA 3IBTA 2GBCA 4WFIA 1XRQA 1CFJA 3STTA 1ETHA 3JWEA 3K6KA 1G66A 1ZI9A 3W2TA 4BC0A 1GT6A 4KAFA 4E14A 1JFRA 5BWBA 1A88A 4DIUA 1MT3A 2AJDA 3AUKA 1ACLA 4QDZA 1DINA 4CI9A 2XUJA 3D2AA 1CR6A 3WK5A 2ES4A 5CXUA 2WUGA 3IVMA 4AO8A 3S8YA 1GKLA 3OM8A 4PSCA 1XLUA 5BOVA 5K3CA 3R41A 4P08A 3LIIA 4X85A 5AM5A 2DHEA 3VJKA 3L1IA 4CG3A 1EHYA 4KAJA 2XMDA 2OQVA 5K3BA 1XZHA 4GI1A 5DNWA 5ALRA 2CMFA 1QO9A 1BCSA 3HZOA 4OU5A 1L7RA 3O0DA 1CUUA 5DYYA 1QIGA 4UBMA 1BU8A 4F60A 4BAZA 4JH0A 5AKEA 1A8QA 1A8SA 1VXRA 5EIEA 4MEBA 4IHAA 3WYNA 3STVA 5AOCA 2C0QA 3FVRA 1JJIA 4DNOA 5JATA 2QRUA 3ED1A 5JAOA 5ALQA 3G0DA 3I2GA 3UMJA 4XWGA 2JGLA 3DS8A 1EXWA 5CXXA 4GLBA 3BIWA 2J3QA 5AM0A 4NS4A 2HFJA 3QM1A 4OYYA 4DMFA 1LLFA 3VXKA 4BVLA 4L72A 4DNQA 3ESBA 1F0NA 3H19A 1CUJA 2OGTA 4J0HA 2X8BA 4KRXA 4U2GA 5CT8A 5LZ2A 3IUJA 2RHWA 5JAHA 4BZZA 2ZJ6A 4GW3A 2EEPA 4NMWA 2GZRA 2W6CX 2OGSA 3W05A 1VA4A 4CCYA 3WKCA 7YASA 4KRYA 2BKLA 4H7IA 5CBKA 2GYWA 3PE6A 3TEJA 2GBGA 2BAGA 1DQYA 4BTVA 3H17A 2VT6A 5JARA 2WJ6A 1JT2A 3VJMA 4Y7DA 2QZPA 2JF0A 5ALDA 1YASA 1XRRA 1BCRA 2DHDA 1H2ZA 2OG1A 3GA7A 4Z49A 5FV4A 5CMLA 2XUPA 3VDXA 1YSCA 4B0PA 4FNGA 1TCCA 3C6YA 3IURA 4RPCA 5FLKA 1TIBA 3RM3A 3OC0A 1XZDA 2CKMA 5AM3A 4P9NA 4AZ3A 3WZLA 3E4DA 5DNUA 3ZLUA 5ESRA 4X7BA 5AI4A 5LKAA 1K63A 5AI8A 1UZAA 3AIKA 4EUSA 3G8YA 1XFDA 1XQWA 4E11A 3VJLA 5EIAA 2O2IA 2YYSA 4KYVA 1B41A 1QIJA 2Z8ZA 2C5FA 1J1IA 4A5SA 3KWJA 4MYDA 3LIPA 2V98A 2Z5GA 2WUFA 4J0JA 4CIBA 4EY8A 3WZMA 1EK2A 3S2ZA 5HQ3A 2C0PA 2XQGA 3WK4A 1LZKA 4ARBA 1KU6A 4AN0A 1QIDA 1XZAA 3M81A 4GECA 3BJRA 3SK0A 2DQYA 3ILSA 4MWTA 5HF5A 1CUZA 3O4JA 1MNQA 3KWFA 1XZBA 5AOAA 3IIIA 1NX9A 5LZ5A 4B80A 3PI6A 5EFZA 5K3DA 1DT3A 2H7YA 2ZJ7A 1K5PA 1AMNA 4FWBA 2D5LA 2RHTA 1DX6A 4N8SA 1YA8A 1XKLA 3E3AA 5ALKA 4HXEB 1USWA 4LXIA 4J0CA 3EBLA 1WHTA 3C6ZA 3WK9A 5ALJA 3G9XA 1JJBA 3MUNA 2YH2A 3AFIA 4KJXA 1WCYA 1W1IA 4E46A 1RYYA 3RK4A 5JD4A 3R3YA 1HL7A 1ZICA 4HTAA 3STUA 4LHEA 3C8DA 4DNPA 3I1IA 5A2GA 3HACA 3AIMA 2AJ8A 5A71A 4Y2JA 3X3HA 4G4JA 2WKWA 4Q3KA 1JU4A 3JYHA 1OILA 3KD2A 2H7XA 4H7DA 4AB1A 2C7BA 3BF7A 2WILA 1VKHA 5AHXA 1C7JA 1MNAA 4BB0A 5ALHA 5ALLA 5JASA 1HPLA 1ZOIA 1ZD3A 4I19A 4OB7A 1CUBA 2XMGA 4MEAA 4OD0A 3DYIA 3N2ZB 2XUOA 1EDBA 2HFKA 2VA9A 5T4FA 3GROA 2HU7A 2WJ3A 5HQ3B 1UKBA 1SC9A 5JYCA 3M83A 1QLWA 4QNNA 3WKAA 1WM1A 1GPNA 4Y2SA 4B84A 5AKIA 5AO9A 3UUFA 5IKXA 3V1MA 2WIFA 2QM0A 4GWLA 1ZIYA 4MXDA 2NW6A 4X00A 3YASA 5ALTA 3AJAA 1VE7A 1AX9A 1WHSA 2ZSHA 1YB6A 2PSJA 1MU0A 3W06A 1EB8A 4DGQA 5ALYA 4OPMA 4DTCA 3G0GA 2XB6A 4P93A 3HJUA 2QS9A 1L7AA 1THGA 2QUBA 5A7FA 3QYJA 1MN6A 4FDMA 3DLTA 3U1TA 4WFJA 4X71A 1ZJ4A 4N5HX 4W1RA 1EDDA 4CG1A 1QGED 4LKOA 3FYUB 3HEAA 4V2IA 4LYEA 2WIDA 4X93A 4BE4A 5AIBA 2XMRA 2WIKA 1K8QA 3DCNA 4FTWA 4EA6A 4OSEA 5FRDA 4PSDA 5HKBA 3FSGD 3HRHA 4BRSA 1GZ7A 2Z8XA 2LIPA 4DMHA 2VJAA 3D0KA 3EQ9A 3A2MA 3QMWA 5EHQA 2HA5A 1DU4A 3LLCA 4HXFB 3IDAA 2X5XA 3WIOA 3WK7A 4L0CA 3HC7A 5J3JA 3DQZA 3HABA 4I3FA 4FHZA 4KE6A 2PVSA 1AGYA 2HIHA 3R3ZA 2ZVDA 3IB3A 1QIKA 4H7HA 2WG0A 1BEEA 2BGRA 3OPMA 4Y2VA 5T4HA 4C87A 5A62A 1QTRA 3AILA 1JU3A 4AO7A 4H18A 3QITA 1ZD4A 1QIEA 2H7CA 2WFLB 2WG2A 4BATA 3G0IA 1R3DA 3VVMA 3H2HA 1CUFA 1Y37A 4UFPA 4KR0A 2WG1A 1PV1A 2Y6UA 1LBSA 4LYDA 4WY8A 2ZYIA 1OXMA 3WL5A 4KAAA 1AKNA 2AXEA 3D2BA 4UHBA 1MJ5A 1T2NA 3QPDA 4XX1A 1ZGCA 2Y2UA 3F97A 2JGIA 3W9UA 2I78A 2RIPA 2VATA 5AKXA 1ZD5A 2ZYSA 3PF8A 4EHBA 2WM2A 1DWPA 4B82A 4IO0A 5HF6A 1IUNA 4UHHA 5I7UA 4ZRDA 5LP1A 2JEZA 5CH5A 1C4XA 2QTBA 1CVLA 2XUAA 4EY6A 4EY5A 3OG9A 1UOOA 2XLCA 4IH4A 3KOOA 3EF3A 4AO6A 4MJ3A 1W75A 3I2HA 1HDEA 1MAAA 1WB4A 4PW0A 4J0IA 5AK6A 1W4LA 1GPLA 1FSSA 2V9ZA 3I1YA 1CQWA 4G4GA 3GZJA 1ODCA 1CPYA 1RWQA 4X94A 1VOTA 2ZJFA 2XUFA 3DL4A 4KACA 2OCGA 2WFZA 4OU4A 5LZ9A 4FFWA 3GELA 3H0CA 2DHCA 1VE6A 3I6YA 4JEIA 4FLMA 5K3FB 3V1LA 4X6UA 5KBYA 5HK8A 4YASA 2HADA 3H2KA 3FYUA 2RONA 2FJ0A 3B5EA 4IH1A 4A23A 1F0PA 3R0VA 4X97A 4KE8A 3MGAA 4OYLA 1LPNA 3KDAA 4RE6A 2P8SA 3AZQA 4H7KA 2PPLA 1QOZA 2VJCA 3QMMA 3A2LA 2PUJA 4FBLA 4B81A 3G0CA 3FCYA 5CT6A 2BGNA 5C81A 3FBWA 3WA7A 1VZ3A 4TGLA 2WLSA 4BE9A 2JIDA 4RNCA 4BVKA 1CUWA 3FNBA 5LZ7A 1EINA 2GBFA 4X95A 3ZV7A 2HA6A 2WFMA 4A16A 3F96A 5AI0A 3WLAA 4N5IX 1NU6A 4UBNA 5D3ZA 5FKJA 5HFAA 1UWCA 5LYYA 2G5PA 1L7QA 4W1PA 2PU5A 3EQ7A 3I6ZA 3DDUA 4FLFA 1BRTA 5DTIA 3CN9A 3I28A 3C6XA 4ZV9A 1ACJA 2XMSA 3LP5A 4K6GA 2Q0XA 4OB8A 4BVJA 1BN7A 4BCDA 2FX5A 4K6KA 5LZ4A 2WHRA 1CUEA 2XT0A 1UKCA 2B20A 5FXMA 4H7EA 5T4EA 5ALVA 4J0KA 1GPKA 1KEZA 1UK8A 4JYMA 1TAHA 1IZ7A 1N8SA 4AMYA 5C8VA 4W1QA 3BDVA 4FNMA 4K2AA 2HRQA 4AX4A 1EB9A 3BL8A 3C5VA 2GYUA 2V97A 3V48A 4G5XA 5AK5A 4TPKA 3DOIA 1IUPA 2HA0A 5D6OA 5H3HA 1EI9A 1CV2A 4UBLA 3D7RA 1GKKA 1Q84A 5AM2A 2HM7A 4UHDA 3DKRA 3NWOA 4Y9SA 1ZGBA 5T4BA 1QFSA 3K2IA 5SYMA 4U2CA 3DJYA 4H77A 1G4HA 2VSQA 2XMCA 1E5TA 5CT4A 3WIBA 4X92A 4UHFA 2XUIA 1GQSA 3CCCA 4HS9A 3EIOA 3JW8A 3M3DA 1LPOA 4J0GA 2HHAA 1UOQA 5K3AA 1MTZA 3O9VA 4C4XA 3DKKA 3I2KA 2C4HA 1W6RA 1CUXA 3WKBA 5F4ZA 2BUAA 3G0BA 4ZV7A 3H1AA 3WL8A 5DWDA 1E3QA 3TGLA 4JYPA 3IULA 1ZIXA 1E8MA 2QVBA 2XUQA 1QE3A 3T4UA 1H2YA 3H04A 3B12A 3C45A 2OPHA 4UBOA 3WI7A 2WUEA 3HXKA 2HL6A 1JJFA 5ALIA 5JALA 1YCDA 4WCVA 5LKRA 4NVRA 5CURA 5EHNA 3SX4A 4XJVA 2B4KA 5BWCA 3STXA 2OQIA 2O7VA 3V1KA 4BCCA 5A7GA 1TK3A 2FUKA 1AQLA 4O08A 1LPAB 5C8ZA 1R1DA 2GZSA 1IMJA 1TRHA 2CBGA 2W22A 4DMKA 3WWCA 1K4YA 2RGUA 3W04A 1UT6A 3MVEA 4BDSA 1XZCA 1N1MA 2IIVA 2WIGA 4WDRA 1G5FA 4M0MA 3WMRA 3QPCA 1EVEA 3L1HA 2CEKA 4J7AA 2OAGA 3NUZA 4PO3X 1Q0RA 1Y7HA 2WTNA 3O4IA 4X90A 4G1FA 3LS2A 4Q05A 2PSFA 5DTJA 3ZLVA 4IQ4A 2EDAA 4MWSA 1ZD2P 3LCRA 1JMYA 3FLAA 1R50A 2QT9A 3ICVA 4J03A 3PICA 3BWXA 2Y2VA 2XMZA 2CUTA 4P92A 5ALUA 4DM7A 4Y2YA 5ALSA 2DR0A 1J06A 4H7JA 1XZJA 2E3JA 4OB6A 3DYVA 3O4GA 2C5GA 3IUQA 1CUCA 3K9BA 3WL6A 3VISA 1I6WA 5AJHA 5DYTA 1PFQA 5AK3A 3BXPA 3WKEA 4ETWA 5AKHA 3FLEA 5IH7A 4LXHA 3PF9A 3U0VA 5SYNA 1MAHA 1LNSA 1XZEA 4JUIA 4ZREA 1QJ4A 3BE8A 1R4ZA 2HA2A 2DFPA 4GXNA 4EB0A 5CH8A 5FPPA 5CT5A 5HCUA 1ISPA 1W76A 5AM4A 1X2EA 4G9EA 5EHXA 5JIBA 1QIIA 3N0TA 3C8HA 1XZFA 4ZWNA 2J4CA 4C6HA 2QMQA 5JANA 3G02A 1CQZA 1KU0A 4PF1A 2G5TA 1QZ3A 3FYTA 3UUEA 1BE0A 3R3WA 4HRYA 5AIAA 4PNZA 5DYWA 5LLSA 1VLQA 4BP8A 3IA2A 1E66A 5JAPA 1UK9A 2Z3ZA 5A7HA 3WK8A 1FFEA 3STWA 5FOQA 4GBGA 2UZ0A 4Q3OA 1G42A 1FFBA 4BYMA 4N8EA 3HLKA 1E89A 3OOSA 2WHPB 1JKMA 2X76A 4G9GA 2JEYA 5DLPA 1CIJA 1H2WA 1SCKA 4DNFA 1XQXA 3AINA 3PUIA 3QPAA 4WFKA 3KXPA 3DD5A 3ANTA 5JZBA 1CUHA 1H22A 4HZGA 2VQ6A 4CIAA 2I3DA 1CUSA 4MYSA 1GGVA 4M0EA 1GXSA 3F67A 4B83A 3DL7A 1WOMA 3R3VA 3I2FA 1P0IA 3FAKA 5HKAA 4N8DA 4B6GA 1A7UA 4AXBA 4G8CA 3WWPA 4Q1VA 4F5ZA 5K5EA 2JGMA 4KEAA 5DNVA 4PSUA 1PJAA 2YASA 1ZI6A 2PM8A 2PKYX 4FLEA 1VA5A 1AURA 5K3FA 4YK7A 1CEXA 2XI4A 1SFRA 3T52A 1HKHA 4C01A 4INZA 4WY5A 1Q83A 3F9CA 4BRZA 1UOPA 1QIMA 1XZKA 1SCQA 5AKJA 3G9UA 4BCBA 1YS2X 4GDMA 1TKRA 3FCXA 1P0PA 2HA3A 4X6YA 1OCEA 5ALZA 3B3QA 1MO2A 4MQMA 1O6GA 4Q34A 5I8PA 2PX6A 2XQIA 1HLGA 3AZPA 4KE7A 5JD6A 1H23A 2B61A 5FP0A 2WFLA 3WL7A 3QZUA 5CW2A 5CT9A 2OXEA 1LGYA 2AJLI 3NGMA 3AIOA 4FBMA 4G8DA 1AC5A 4UPDA 1WPRA 5JAUA 4UBIA 2HU5A 4C89A 4QA9A 1M33A 2AJCA 5EIHA 1XKTA 1XRMA 2WJ4A 4W1SA 1MX1A 1B6GA 1TCBA 1X70A 5JD5A 4ROTA 2ACKA 5KREA 3E0XA 3WJ2A 1C7IA 1W52X 4KE9A 5CH3A 4CFSA 3HSSA 2WUDA 2I03A 1XQVA 1YAJA 4G4IA 5HF8A 4PV7A 3F8SA 1QO7A 3WYDA 4CG2A 2V96A 2HA4A 2Y1KA 4UFOA 1J2EA 3BJMA 1NU8A 5EI5A 5AM1A 3SWWA 5AI9A 4EY4A 1FFCA 3PDCA 1BROA 4HVTA 1R9NA 2WU3A 5ALEA 4HRXA 1EDEA 1XRPA 2IITA 1DWQA 1JI3A 1EA5A 2QOEA 4GHWA 5FUMA 4Q3LA 3P2MA 3D59A 4U2EA 5LIPA 1XRLA 1QTIA 4AMZA 1XLVA 2PSHA 4H35A 4CCWA 4BBZA 3G9TA 5ALWA 5IVDA 3WA6A 2OAEA 2ROQA 3DEAA 3IUNA 2XQJA 3FYUC 5DJ5A 1LPSA 1FFAA 4QZVA 5IVHA 3WWDA 5JZSA 3SC2A 1FFDA 2VT7A 4DLNA 5KWJA 2XMQA 3VVLA 3C6BA 4BTLA 2BUBA 1GQRA 1QIFA 1WB6A 1MX5A 3ZWQA 1DT5A 3FOBA 3G7NA 1BEZA 1SOMA 4YPVA 1UK6A 4B9EA 2DQZA 1LPBB 4EBBA 1XRNA 3A70A 2XDWA 3FWHA 4QDXA 3PFCA 2XMBA 1VZ2A 1ZJ5A 2Z3WA 5C8XA 4XVCA 3M82A 1O6FA 4QDOA 1EK1A 4C4ZA 4K5QA 4D9JA 2QXUA 3QMVA 4EY7A 3RKSA 3HI4A 2RAUA 2PUHA 4HXGA 4BDTA 3NOXA 2BJHA 4QDTA 4QLAA 5EHZA 2JGEA 2H1IA 4Y2PA 1HBJA 2ACEA 2VAVA 3V9AA 2WHPA 2WIJA 5ALGA 1CUYA 2C58A 3D3NA 4QWWA 2EDCA 4BC1A 1WB5A 2XQFA 1UFOA 4Y2RA 4QLOA 1TQHA 4DYHA 3GFFA 2GYVA 2VF2A 1UK7A 4DSZA 2G63A 5KWIA 3H1BA 2J4FA 2O7RA 5CTAA 3C70A 5I9IA 3C5WP 5AKGA 4J0DA 1DQZA 1XQYA 2XUGA 4U2DA 5C7YA 1DX4A 4LXGA 3D2CA 1J07A 2DSNA 4C88A 5IVIA 1CUVA 1RP1A 3ZI7A 5D3KA 3E1GA 3VKFA 1U2EA 4FMPA 4G8BA 2PSEA 4GEGA 4L3WA 3HYSA 4QWMA 5ALFA 4UFNA 2VJDA 2JGJA 4RGYA 4X6XA 3WQHA 4WDQA 4L9AA 2VEOA 1QIHA 3WKDA 2IX9A 5AOBA 1U8EA 1LZLA 2OCIA 2BUCA 1K6EA 4M0FA 4W9RA 5ISMA 1BN6A 3WWOA 5ALMA 5AKKA 1S8OA 3ESDA 3WJ1A 3R40A 3Q0TA 2WHQA 4U2BA 2ZYRA 5IVKA 1WPXA 1XZLA 4Y2TA 4PQEA 1Y7IA 3A2NA 3IUMA 4WJLA 2HA7A 3A6ZA 1CUDA 5E2IA 1R88A 2Y6VA 4LIPD 4C4YA 4Y2UA 3ICWA 4BAGA 3PUHA 1A8UA 2J3DA 3MUOA 4UUQA 3H18A 3RLIA 3I2JA 5E4TA 1P0MA 2D0DA 3V1NA 5HZGA 3Q8WA 1F8UA 1AZWA 1ODTC 3KSRA 2ONCA 2XLBA 1AUOA 2DCMA 3BIXA 1LBTA 3R3XA 1XROA 5AKZA 4OCZA 2QXTA 3STYA 5LZ8A 4UBJA 4AN1A 2ORYA 1N5RA 2OGZA 5A6VA 1UKAA 4X3CA 3OURA 4UHEA 1JMKC 4BZWA 4Y2QA 4K6HA 5AH0A 1CUIA 1XZGA 4ARAA 5AKYA 3WWEA 2ECFA 4QE3A 2QKYA
chains in the Genus database with same CATH superfamily
3JY6A 1NONA 3VHXA 4MVJI 2ZJ2A 3IP5A 1N1DA 1BO6A 2WVGA 3R4CA 2OORA 4ZOLB 4EJSC 5BY2A 2O3SA 5JG7A 4BL5A 4DQVA 4ABYA 3QKSB 4U7GA 3TMKA 3QHAA 1T9ZA 4B7ZA 4AS1A 3VR4H 2NPFA 4MAAA 3BAFA 4RA6B 2XNDD 4U2FA 1K8XB 1NLZA 2JBWA 2C82A 5DCYA 3U3DA 4E2FA 1U1GA 2WZDA 3TZKA 4ALNA 2YCLA 3U16A 1Q74A 3KKEA 3O90A 4Z0PA 1KQFA 2HCRA 4D3SA 3KVYA 4M21A 2IP1A 1QGUA 3DXFA 3QVMA 1KPGA 4UVHA 1SVNA 4MLPA 1XALA 5CNJA 1AF7A 1C7FA 1GRCA 1UWLA 1Y7PA 1Z9BA 2J3MA 3A04A 3CU5A 1KI8A 3SS9X 3VAAA 3ZK8A 5IDWA 3QOYA 2BHTA 4TKZA 1S2LA 3DUWA 1M1NA 1JSCA 1SU4A 3W9SA 4EI2A 3A1EA 4FFVA 4DV2B 4D9IA 3QBVA 2NO1A 3N6VA 4Q21A 1QONA 2XDQA 4B3DA 1NN5A 2XNSA 4ZODA 1ZJWA 1Q0ZA 4OKSA 4YJGA 3VZBA 1JIJA 1UPXA 3W5CA 5J2UF 3GJ3A 1XZMA 1VL1A 4IGKA 1G5PA 3AHEA 4E4RA 1UC8A 5H1YA 3OKFA 4PHFA 3DNMA 2H07A 5TMEA 1RP7A 4WK4B 4BWVA 3EWAA 1NYLA 4GICA 2HK9A 3ZDZB 3H65A 4KN9S 4C9BA 1BXGA 2AG5A 2SHKA 5A02A 4RSGA 3TRFA 1XBTA 4H0NA 2FKNA 5M04A 4TWZA 2HRDA 3SYNA 2EFEB 3ZQUA 3E8XA 4DLZA 4MRSA 4TT3A 1C30A 4BQFA 3BRQA 3B51X 1W5EA 1I01A 2IZZA 2V3WA 3RTEA 1ESDA 3LYAA 1Z68A 2JJYA 1L7MA 1NJSA 1PHPA 3VZSA 1U8UA 1Z63A 4EGSA 2OFPA 1DWOA 3TJMA 5F9FA 4AT1A 5FAXA 2IPLA 1XDBA 2AJBA 2VQDA 2XZDA 4OIFA 1D2NA 3WLMA 3QF4B 3K35A 1ETUA 4HDKB 3IEIA 1GSIA 3K16A 2BGGA 4TMFA 3LMKA 2ODBA 4H7FA 4KQFA 1N5JA 5DBIA 3L84A 2Q0QA 5B2FA 3CG4A 3H5IA 2YZ2A 2WICA 4ZI5A 1U4NA 2OLEA 3EVNA 3FN4A 4FZJA 5AI5A 5ICSA 3PQ6A 4YRTA 1XZPA 1AUXA 2IY7A 4ZCIA 1KP2A 2DFNA 2WOJA 2ZRGA 5H3CA 3SMQA 2FN3A 1JXMA 2X1LA 4MVJF 1KZ1A 1E2JA 1U7WA 3K0FB 1N92A 1Z07A 1XVAA 2NTNA 4Q82A 4ZAVA 1BD3A 4JJEA 3C3JA 1U0JA 3Q3CA 4D4LA 3ILYA 1M5RA 1C4OA 4EITA 2B83A 4EW2A 1SUEA 2JFVA 2QW0X 3VYUB 1CUGA 4M46A 2IU3A 3LO8A 2LDBA 1YR7A 3ZE1B 5FPQA 3PHBE 2ZYHA 3FMIA 3K3PA 4U63A 5JPIA 2QNRA 1TL7C 4EK9A 4KPFC 3SYLA 3FCCA 5JVDF 3UAGA 5KYUB 2ZSIA 1OX5A 5JY6A 3PSAA 4XYMA 1LI5A 3ZJ4A 3H2GA 4ZA2A 5HGXA 5BN1A 1FRZA 1EWKA 1A50B 1PKXA 2NXWA 3EGEA 4TYPA 1W5SA 4W5RA 1EBFA 2LNDA 5EJ9A 1MEJA 2OV6A 5J47A 1OU0A 1ORVA 1POWA 2CW5A 3PCTA 2DVMA 3NCTA 3RVPA 4F6CA 4IEEA 3PC6A 3N75A 5JADA 5DW0A 3IQEA 2AF4C 1XDWA 2A5FA 3LT0A 3Q7IA 1Z4JA 4AN4A 4F6RB 5CDYA 1VGQA 4XRRA 1QK4A 3MWLA 4FFNA 1P2BA 3U37A 4ID3A 2H9AA 3LVRE 3GEMA 3C6QA 4W63A 4NK5A 3I45A 2X5JO 1MJFA 1VYHA 4HDQB 4FFPA 1A9XA 1BFKA 1JEQA 2MSDB 4X91A 1RRGA 4PLPA 2PZEA 3Q4GA 4J4BA 5JTUA 4MQLA 2H9YA 4RD4A 4NBNA 3QVWA 1UDRA 3BSSA 5C32A 4EIWA 3SY8A 1S6YA 3TDKA 4IDEA 4O2AA 1KEPA 3JQ8A 3KEOA 2PSDA 2G8NA 4KC0A 4EW6A 4TRMA 4DWWA 1GAWA 2GZMA 4UEWA 4XW2A 2O5CA 4KWIA 1RLIA 1UOEA 4RH3A 2BFNA 2PL5A 3HUTA 1RLOA 1H6AA 1OA1A 3OECA 2GM9A 2NLOA 2ZIGA 1QR2A 2BRUC 3F0TA 2QGNA 4JJKA 5H4HA 2VA8A 3REOA 4ZDKA 1WETA 3E2PA 2D1YA 4MWEA 1M8FA 3ELDA 3JWPA 2YXPX 4G0XA 2IHKA 1JPVA 1R6XA 4MROA 3WLHA 5JNLA 5LD2B 4N12A 1OI2A 4J94A 1IEVA 3R23A 4D4IA 4CF5A 4PAGA 3IQHX 4YRPA 3WRWA 2WSLA 3RWBA 1M6NA 3WMGA 1JJAA 2VBGA 5EMJA 5B3AA 5CLLA 2UDPA 2GJAA 4BNIA 4EEKA 1IZ8A 3TIFA 2O2HA 4W8OA 4ND6A 1IDN1 1E3SA 3QH4A 3F2IA 3I6MA 3GLTA 4GP7A 5AICA 3VZDA 2FW6A 3ETGA 5D5HA 1RU3A 1XYGA 3MQFA 1QPBA 1I36A 2GS9A 2K2QB 5E4YA 1ZNWA 3WYEA 1R0RE 4R05A 5JE8A 4H9GA 1QHXA 1H1LB 1BCRB 1NKVA 1R6UA 1LDEA 2IPMA 3GXOA 4TWBA 2GJ8A 1DJNA 4UNIA 4BGVA 1PT9A 1ZBDA 3AETB 2XYVA 3KALA 1EVLA 5DGDA 4YJGB 5G0VA 5ER9A 2CZQA 3HEBA 3ZH2A 3VI3B 4CGYA 1G1AA 3BZBA 4Q4CA 2A67A 4LECA 1XP8A 5K3EA 5FH9A 4FEYA 1YA4A 1ZEMA 2QN6A 3NVDA 4LSZA 1TX4B 5I7RA 5K7SA 3OBIA 1PX2A 3I01A 3NRCA 4Z3OA 5DU2A 4R1QA 2P2YA 1M1ZA 2HDWA 2V9PA 1KKUA 4KIJA 3WYCA 1AZLA 2A6PA 3IAM1 2VTVA 4UM9B 3OCJA 5DTEA 3JATA 4MQFA 2VJBA 4YCJA 4M8IA 1IBRA 3BB3A 3T06B 4UXIA 4QQ8A 4PG8A 2Z2IA 3UXMA 1FP7A 2ZDQA 4RK7A 4A2PA 4YRBA 1Z47A 4FKBA 5DK4A 3OLXA 3FHJA 3ES9A 1U7DA 3MB5A 3SOZA 2IS2A 5JXJA 3SZUA 2OBBA 4JQYA 4HB2A 5CU7A 3MWJA 2P4SA 4JNKA 1ONNA 1Y1SA 1DUSA 2I3ZA 1Z6ZA 4MLDA 3ANSA 2BFDB 4Q47A 2XD9A 3QQPA 2UUPA 2ZYAA 5YASA 2CB9A 3WXMA 2ZRFA 4RELA 4JOBA 1ILWA 2MR5A 1YQEA 2PT7A 2VWGA 3CCFA 3ZEAA 4CEHA 2GBLC 3GMIA 2JIRA 3TECE 2A5DA 5IDYA 2XE6A 3GARA 4LQDA 3UC9A 1ZA2A 3EK2A 4FGLA 1PYGA 2HWXA 1VRCA 1JMVA 1O89A 1MDBA 5ALXA 3H4VA 4RA6A 3CXUA 2BMDA 2GN9A 5EP3A 4EGCB 4ER5A 5EKSA 5E7JA 2OOSA 2J3JA 1F6WA 1VG1A 3HO6A 2P2CA 3QU4A 1X7ZA 4V0MA 1YFKA 2DX7A 1CDDA 1ELOA 5TQ0B 2QJWA 3BDIA 1OPRA 2AE2A 3DG9A 3HE3A 1JHDA 3HKDB 3V6MA 4Z86A 2Q4RA 4G25A 5TF0A 3PFBA 1DZ3A 1KORA 2RC5A 1VXOA 3RSCA 4ZN6A 2MSNA 1RM3A 4FEEA 4IV0A 4WFIA 2FQYA 2C2BA 1XRQA 1CFJA 3NHPA 2HIAA 3SJAA 2HN9A 2R97A 4X1YA 2UUBB 1ZIDA 2RKBA 3TLGB 1KVUA 1Z26A 4AY4A 3OIWA 1WXGA 3QU5A 1W85A 2W98A 1YL6A 1THMA 2PHZA 3K8OE 2C3MA 1TJYA 1V16B 1GNTA 4NDZA 3F8WA 5JCXA 3JQGA 1F0YA 3O4VA 3LL4A 2FW1A 4QAJA 1SVUA 2RGNA 3DF7A 1VG0B 1A88A 4DIUA 4C06A 4EECA 5IZCA 1PS0A 3HXQA 3DHEA 1AJEA 1C3JA 1VPWA 1DZIA 3E4CA 2ZI9A 3DV0A 5JTTA 2C78A 1DG1G 2AJDA 2LV8A 1IOVA 2EGUA 4RH0A 1IBLB 4NARA 1FTYA 1Q17A 1GRQA 2PMDA 1U1FA 1X80A 2G88A 3OVMA 1LC3A 4QDZA 3D2AA 4Q39A 5JFGA 3CF6R 1QV6A 1V9SA 3VTFA 3HKEB 5CXUA 2OQ2A 3EA4A 1A3CA 3R77A 1LFAA 1J7KA 1XKXA 2D1SA 2ID8A 4NS1A 4AO8A 1HORA 1RTKA 3DMPA 1CDOA 2QI9F 3KKOA 1P2VA 1J97A 4K87A 4B81A 1XLUA 1SKBA 2J1LA 4PYLA 2FV8A 5K3CA 1YGYA 4HDKA 4P08A 4GOOD 1TEVA 1LCIA 2QY9A 2I2AA 2VP4A 1QLJA 4OLHA 4X85A 2EFHB 2AG1A 5AM5A 4DQXA 1J1UA 4KQ2A 4G67A 2ZTMA 2EF1A 1K8ZB 1Z4MA 3R5TA 4JBHA 4UOQA 1PZMA 4I9HA 1EHYA 3G1WA 3PR2B 4KAJA 2Q6IA 3G17A 1TXGA 3L0DA 4HO1X 4I1YA 1IPHA 4MB6A 4NAVA 4HQFA 5K3BA 5K8IA 2QZ9A 3CG0A 4AG6A 5ALRA 3TGPA 3CKYA 2D1RA 5BSMA 3UW1A 5ADVA 5IAOA 1BCSA 3L4BA 3HFGA 1W0KD 4OU5A 5I5EA 1L7RA 3W8DA 3GGPA 3NC4A 4EF6A 2R00A 2IHZA 2DKFA 2NV2B 4CFZA 3QTTA 4A0RA 2IXEA 4G1EB 1SKYB 1KGSA 4DMUB 5BVHA 2LD4A 5IHXA 1U02A 3ZN2A 1X7YA 4F60A 1DJQA 1QUEA 2DUMA 3LV8A 4JH0A 4XDGA 3WGVA 2GD1O 2OO5A 5LMZA 3EDCA 4ZDWA 3RTAA 3OZXA 3RQSA 5EIEA 4IWXA 2BKUA 2GTPA 1UEXC 1NN1A 3EXFA 2QBYA 1ZSYA 4JV5B 1ZUIA 2AV6A 5EERA 4W5TA 2YXDA 5CW1A 3E3LA 1PE0A 5K09A 4C3VA 3GDOA 3F73A 4JZYA 5DGXA 3FVRA 4RC9A 1XA3A 2RG1A 3AM4A 1CNFA 1KVRA 1WUJS 3OIDA 3WYFA 1VCNA 4CIVA 2V7QA 3LQFA 3NKFA 3C3DA 3S2UA 5JAOA 5CBPB 1RXVA 2V3CC 1ISJA 3I2GA 3L0ZA 4UM5A 1D04A 4XWGA 2GDZA 1B74A 4EATA 2DTEA 1GYQA 4IQFA 1ZJ6A 1MR3F 1LUAA 4GLBA 3AY6A 3IAEA 3VH1A 1I1OA 1TEZA 5SZJA 1TMYA 4TV9A 1U3FA 3LC2O 1AUPA 4NS4A 3ZE9A 4OHVA 2WJVA 4E2XA 2RGRA 1FU7A 3ESXA 1P60A 3EARA 1JPNA 4J43A 2RE8A 1YU9A 2HFJA 1NVVQ 4NAHA 4D0SA 2BLNA 2GBLA 3BTOA 4IILA 1IPEA 3I9LA 2NU8A 4AKHA 2UUAB 4RDHA 3RIXA 5C2JB 1LLFA 3SEQA 1RPZA 3AF4A 2DYKA 2VL7A 2XY4A 4MIYA 1TTHA 2P6MA 2ISQA 4PC7A 3JVIA 4AKGA 4PLZA 3U3XA 2GZ2A 1ZUNA 3HY3A 1ULHA 3WQSB 1PJ4A 2AN1A 2CJYA 5ICGA 2Z5FA 1CUJA 1VHJA 3NBUA 1K66A 1T5LA 4DZTA 3FTPA 4O2RA 3PGVA 3T0GA 4HJRA 3LLSA 2Y05A 4RFSA 2XZTA 1WTAA 3H9QA 3KSAC 2JHPA 4JLWA 3URKA 1VHWA 2OOKA 3MYRA 3MTDA 1C0EA 5BP7A 1E3WB 5CVJA 3QBEA 2YZ7A 3G49A 1WKBA 3MC1A 2NADA 1HOTA 1L7OA 1O9HA 2YMLA 3GMSA 2FP3A 4KDEA 4GW3A 3HV2A 3MK31 1OB5A 1QCYA 1RHJA 3S99A 3RIGA 1PBNA 1FW6A 3GZTB 3IO5A 3D6VA 4WAUA 2Z0MA 3N2LA 4AY2A 3CGWA 3CW2A 3DTVB 3A10A 4X84A 3LXMA 4AZWA 1JL3A 1IBKB 1SXGA 3QJ5A 2HMSA 1N5IA 5ECYA 4ACBA 3AWDA 4P7KA 3RGWS 4KRYA 1IY0A 1UM9A 3T94A 3AKZA 4V2UA 1L4MA 1TZKA 4E3ZA 2C4UA 4XJTA 4RESA 3HV0A 1IN7A 1P29A 1G7CA 1NSYA 1Y8QA 2OLKA 4OQLA 4R98A 2Z57A 4BUZA 4DLYA 2GVNA 2KSQA 4JFAA 2XCLA 1PBTA 5GOZA 1J7JA 3HCAA 4ND8B 4OHZA 1ISRA 3LBHA 5FI3A 1CDZA 2GA8A 2VT6A 5JARA 1RXCA 1AKTA 5KC8A 3GD5A 4LXXA 1JALA 3C5HA 4GPBA 5FJJA 3U49A 1W36B 2BPOA 1T6XA 4DJJA 1LEHA 3QW4B 1RR6A 5ALDA 1Q91A 1SCDA 3CWCA 1BD4A 2O5VA 2QR2A 4BLSA 4E6PA 3AVWA 3ERCA 3WGTA 4Z6KA 3CLRC 1U81A 3Q1LA 3V3TA 3DBVO 1C9KA 1H2HA 4P2BA 4Z49A 1M76A 3LZDA 2GO7A 3DPIA 5CMLA 3B8EA 1P9OA 1F06A 6ABPA 4JP5A 3WIDA 1GQOA 3LUFA 2BHLA 3SIPA 4EVRA 5I45A 3IL2A 5KSZA 3UANA 4D0RA 3DOJA 2H0QA 2AK2A 4L6AA 1TCCA 4I81A 3C6YA 3H05A 3IURA 4OM8A 5ITWA 3KVOA 4RPCA 5FNVA 1K3UB 4JBNA 1HDRA 4E5UA 5K20A 3GFGA 2H4FA 4UAGA 3I5UA 3IT3A 3PQ8A 1T35A 1DKQA 4V0SA 4XYBA 5K8CA 3DLHA 5IJ9B 1ZRMA 4RBNA 4JAVC 2TMKA 4S1PA 4JQZA 4AF7A 3VNAA 2ZTUA 4IMIB 5DNUA 4M76B 5DF1A 1NGSA 1ACMA 2X4DA 3E0QA 4XQ0A 1NXXA 3LDAA 4PLTA 1SVWA 3OHSX 2XBUA 1PR4A 4IXNA 3U7GA 2R4UA 4Y2GA 3SQLA 4EW3A 4EUSA 2XOKA 5F1KA 3RVQA 2P2DA 3CUUA 2GN0A 1Y9JA 3G8YA 1X15A 1XQWA 2YICA 1GTL1 3RRNA 4NXNB 1JAHA 4RHTA 5EIAA 2O2IA 1PG5A 2JJ1D 1PQWA 4QPNA 2P4EA 5EYPB 5B1IA 1P61B 4UOEA 2D5BA 4KYVA 3TTVA 2K5UA 4F4IA 5JY1A 3I62A 1T9GS 4R41A 5IAAA 2DTXA 1CY1A 2QP3A 1YZLA 4QJ5A 3THYA 1QIJA 1GCUA 1KOJA 1Z29A 2Y68A 1E6MA 2F8LA 2YYYA 1WJGA 1GHTA 1N5LA 1OFVA 4R68A 3GH3A 1HKUA 5ICEA 1BNCA 3MTGA 4NU5A 2VDWA 4C07A 1HT1E 4JB3A 2YJ3A 521PA 5H8WA 4P32A 2IV3A 1UPCA 3LPAA 1PL0A 3DEIA 2XVYA 4HPWA 2VP6A 4L16A 4LDQA 4OQZA 3WZMA 3L7MA 2CFIA 2QG9A 2AUMA 4GGOA 3RODA 4A8JC 4UXHA 5KTOA 5IM4F 4ZFNA 3DMYA 2VP9A 4GE3A 3HU1A 5BW4A 1PDWA 3UT6A 4E5YA 3PU6A 4DM3A 1QIDA 2YWCA 2GJ4A 3CW8X 4GECA 2EP8A 4DLXA 4DUPA 3V4PB 2IW3A 2G9UA 5L9AA 4BY9E 2FEKA 5HF5A 4K9DA 4CE6A 5CVTA 3O4JA 4D3ZA 3R9XB 1MNQA 4RZXA 1OQAA 3MTIA 3N8NA 4C4RA 3UGQA 3IIIA 4XCQA 1I2CA 1XDDA 2IHBA 2E4VA 3AXSA 3COYA 4RIIA 2AEMA 5DMHA 5EFZA 5K3DA 2Q8NA 1DAEA 3ENZA 4UTRA 3GVHA 1AMNA 4CT5A 3QSYA 5C7LO 1ZS9A 4FWTA 5L7YA 1R0SA 2RHTA 3I34X 4EUNA 4NCBA 1DC4A 3QWIA 1IC6A 1J0BA 1IDOA 3NBMA 1G8MA 3H4MA 1XKLA 3F9IA 1V9LA 2EJTA 3E3AA 1YVEI 4PZ9A 2IEYA 3ASVA 4LN1A 5F4BA 4IFBA 4LBYA 1YQXA 4EMUA 2CN1A 2CL0X 2FPIA 2VDWB 4IG9A 3D6TB 1U1EA 2VUUA 3OEHA 4NBUA 4RVCA 3F6YA 4BIIA 3C6ZA 4H17A 1I4DD 3ZHBA 1ZFNA 4ZCTA 5B58C 2VQ3A 2HZBA 1YQGA 1OTYA 2ZDGA 1L3IA 5DBEX 3AFIA 4W82A 4QFDA 2ACWA 2FWNA 1W1IA 3R0QA 4O4IB 2CL6X 3R7FA 4U7JA 3RTGA 1HWYA 1RYYA 4IFIA 1ISMA 1DAMA 5JD4A 2P5UA 1JKJA 1WUYA 2G09A 4OV6B 4B8ZA 2ZYUX 4CIYA 3UW3A 5JSFA 1VI2A 2OM2A 3STUA 4ES6A 1ZNXA 1WO8A 2ZT5A 4YJFB 1RWNA 3C8DA 4IIDA 4DNPA 1II9A 1VG9B 3GJZA 3PA6A 3KB1A 3VKUA 4DDTA 1WMDA 1DPFA 2D1FA 1AKWA 3F7TA 4P4GA 3E3OA 4WJZA 3FMOB 1WX1A 3N9IA 3ZE0B 4G4JA 1MFZA 3ZYZA 4KQIA 1OPXA 3NTQA 4CIDA 5HS4A 4Q3KA 4LRTB 3UPDA 5COBA 1ZN8A 4G65A 4EEZA 4HDNB 2WJPA 3LC0A 3RBZA 4OXXA 1T13A 3HB4X 4BJ3A 3R2JA 4M7PA 3BZUA 3IP3A 2E5LB 5DTQA 1PR9A 2ICAA 4Z1MD 3ZR4B 1NXQA 3EUEA 2J8ZA 5COAA 2GRUA 2CZCA 3BC1A 1G2PA 1SZDA 4EKGA 1Z7WA 1CR2A 2G7ZA 4HATA 4KP7A 1KR2A 1V0JA 3BF7A 4N0QA 2P1DA 4QUJA 1GTZA 2ZJZA 4OHRA 2G1KA 5IJ0A 1P2SA 1R4NA 3I12A 3HYTA 2DSTA 3HJFA 3MIZA 2GXAA 3AU9A 1PW7A 5E0OA 4AG3A 2GAOA 1KQ3A 4V38A 5JASA 3EASA 1PD0A 4WKNA 5DSXA 4GT1A 5JWHA 3DEKA 2TMGA 4R3UC 2BGUA 4I19A 4OB7A 1JS1X 1W2GA 2XKBA 3H6GA 1L8AA 1FNDA 1JRLA 1Z56C 3IPCA 3LUBA 3N2ZB 4JUDX 4UC0A 3FVWA 4OSOA 4IVQA 3D81A 5T4FA 1DC7A 4DV3B 3BJEA 1BGVA 3G8CA 4NI5A 1GL3A 2R4TA 2WJ3A 3TD6A 1MF7A 1X94A 3ZVLA 3SC2B 1Q6ZA 4NX2A 1XA0A 3QFHA 2FUG6 2A9FA 2YS6A 5JYCA 3M83A 1Z45A 1VBNA 4WGFA 2B8JA 1EP1B 4W8GA 2GAFA 4QNNA 4DWOA 1BX3A 2CMDA 5K51A 1B73A 2QAIA 1GPNA 3AJ8A 3AOEC 1X7XB 1NJ6A 3IRVA 1Z0IA 5AKIA 4B84A 4ZDIA 2NZ2A 5FUQA 1P2DA 4WXYB 3EC1A 1LSOA 3MJDA 4YGXB 2GK6A 2VRNA 5IKXA 3LVFO 3V1MA 2JKVA 2QM0A 4BQIA 4N01A 5BUCA 1G5TA 4HZUA 3L1VA 1I6KA 4JI4B 2AN3A 4X00A 3GFVA 1TW3A 3SN6A 3YASA 3I09A 5ALTA 4ZT2A 3AJAA 1VE7A 2LKCA 4IQ0A 4TTQA 5EJAA 4BLQA 1WHSA 1NUHA 2AOWA 1P77A 3AY7A 3BSYA 1O03A 1Q0UA 1MB4A 1UMBA 4QOSA 1MU0A 2COEA 3RSSA 1EVJA 2AD1A 3RHZA 1W44A 3W06A 3L8ZA 3H1GA 1L4KA 3GA0A 1A2BA 3O8OA 1Y34E 2AL7A 2WUWE 3KIPA 3G0GA 3H5TA 2NU6A 4KGDA 4OPMA 1GDDA 4WX2B 5FJIA 3PQ2A 4EUHA 1YZKA 2PV0A 1XWWA 1TD1A 2YYAA 1TUIA 5CDUA 2GPTA 4X64B 1M2OA 3DFIA 3EODA 4IJQA 3S4YA 2QUBA 1W9HA 2ZUBA 3PENA 2G9QA 3BMCB 3LFHA 1MN6A 4FDMA 2A57A 1HYBA 3EZNA 5SICE 3OD5A 3P9SA 3G82C 2IYWA 3FETA 3OCWA 5CVVA 3U1TA 4AZTA 2XMPA 2VYVA 3JSAA 4M9XA 1OI7A 4X71A 2PLWA 1Z0KA 2LCFA 2NSLA 3BJZA 3ETEA 1X9HA 2XNJA 1EDDA 3OPYA 4CG1A 4YRNA 2BT4A 2EKBA 3L1KA 3DTNA 2HXSA 5KMGA 4BUCA 1NI5A 2OB2A 1BQEA 1TZ2A 2YC4C 1NHGA 4GG1A 1OY1A 2GFQA 2VWQA 1SCAA 2FA9A 3ISJA 1LU9A 4JR2A 4KSYA 4V2IA 4YXFA 5TJHA 4DR2B 1OIXA 2HX1A 4RWZA 1B3BA 1FYDA 4X93A 4XOIA 1DCMA 1SWVA 4BE4A 2OZLB 2Q3JA 5AIBA 1ULSA 1Y6FA 4PINA 1K8QA 3DCNA 4I3HA 4JOQA 1E3LA 5JDCC 1MO6A 4OSEA 3RHTA 2XCOA 3O92A 4IZIA 3CPHA 2YWHA 5IU6A 1B8VA 3L4KA 3B6JA 4PSDA 5HKBA 2AT1A 2W2XA 4BB5A 4ETNA 3E9RA 1S9HA 1RE0A 1RRKA 5LP6B 3KQPA 2K7FA 2A7XA 2G80A 2W6IA 3WGMA 5F3RA 3KHTA 1Y3DE 4JIMA 3A2MA 2Q4OA 4Q9NA 1T3SA 2X9LA 1TM1E 2Z30A 4GLJA 2X13A 1X1RA 2CNOA 3PIRA 4HD8A 1ADJA 4ZQFA 2YFHA 1HEYA 1Z8NA 1C1DA 4F38A 4HXFB 6PFKA 2NMVA 3PEUA 4BWGA 3AV3A 2FLVA 2X58A 3LPDA 4JITA 5AW0A 3KJZA 1UR5A 1P33A 2GI4A 1SUPA 4UPVA 2VQSA 3K5PA 3E48A 2O7SA 3B3AA 3HXPA 2VXOA 3RASA 4EKIA 5TQ2A 5BWLA 1RMYA 4LUCA 1D0SA 1TAQA 3EIUA 4BYGA 1SELA 1R27A 4FR2A 4QJBA 3L4EA 2O6HA 3S5JA 4EABA 5LYJB 4CKWA 4AD8A 1JDPA 4MMYB 2QYHA 2HY7A 4OBEA 4TT8A 3EXHB 4UAVA 3PEWA 1E62A 1FW8A 2QB5A 2QL7A 1P2TA 5I4IA 2VPTA 4INPA 3RDPA 4OFZA 2WKSA 3JPWA 4YH1A 1AKUA 2I2FA 4GR4A 4PQYA 2DULA 3C48A 6Q21A 1AGYA 2HIHA 3H7AA 4HRAA 4X3OA 2R5NA 4GXRA 1PZHA 1D5WA 4L07A 2ZVDA 1T10A 1OFUX 3OEYA 5DBFA 5LQMA 4H7HA 4OQ4A 4WXPA 3GLIE 1N1GA 2HSDA 1VIDA 3IPLA 1NLUA 5C18A 4Y2VA 1J49A 5A62A 2NYRA 1WP4A 3KELA 4E1AA 1I7DA 3UO8B 2XITA 1SQ5A 3E15A 4H31A 3UJ7A 3QELB 1H3FA 4YO7A 5E95A 4DLBA 3G1UA 1FSPA 1AGNA 1LSUA 2Q1UA 2PANA 1T2DA 4OEHA 3JASB 3HRKA 3ITNA 1Z7YA 1WF3A 1SCUB 3QITA 3A9CA 3P1JA 1KMHA 1O87A 2ZS8A 2JDID 5BV2P 3UXHA 5JEDA 1NE7A 1NRXA 2Q49A 2H8GA 3D6MA 4R8RA 1RHRA 2W90A 2PZFA 3L7YA 5REQB 3JD1A 2R6R1 4BO0A 4CM8B 3CLSC 3RS8A 3WLKX 1NT2A 4KN8A 5KNDH 1R3DA 2O1EA 3RVOA 4LFCB 4EG6A 1R6TA 3CRMA 3LCJA 2ZUDA 2A5YB 4YCNA 5EYPA 1D1PA 2MSEB 3CRZA 4PG5A 3VNUA 4Q7MB 2EYUA 2AOUB 1ZCAA 4OBWA 3KV1A 1PR0A 1YO6A 1RKXA 3FW1A 4PYIA 1TNDA 1SD2A 2GHQA 1ZXLA 4P6VF 3SXUA 5LQAA 4CR6A 3N5CA 1QAMA 1T25A 1XDGA 4G5YA 5A5DA 3WL5A 3KQWA 4KAAA 3ORYA 2PUAA 4DE5A 5LN1A 3ZZMA 5IEJA 3H5OA 3T5MA 1OKKD 3BULA 4XX1A 2PPVA 3GDWA 1HE2A 1RS0A 1W47A 2XWBF 1EX1A 1KEVA 3QKSA 1PQUA 2I78A 3AUAA 1RYDA 2P68A 5AKXA 5EJ8A 1BJKA 4LYFA 3AG6A 2OA0A 1SQGA 1FDSA 3CWZA 2DMRA 5TRTA 3UN1A 5LSAA 3IRUA 1XDZA 5JSYA 1FNMA 3EGXB 4IUCS 1DWPA 3JYNA 5K0SA 1KQGA 3U60B 3VZQA 4KR2A 1MW9X 3GFTA 1JBEA 4D8WA 2AOXA 3I9V6 1IUNA 4FHFA 5EXEA 4CLRA 1EUQA 2HJRA 2VJKA 4O4JA 3VYTB 4BNLA 4UHHA 4BKQA 1SHTX 1WZ2A 3PX3A 4B17A 3U39A 4CF3A 4DTCA 2Q3DA 3VRHA 1MVOA 2AQIA 1A0OA 2YXLA 4LXTA 2O05A 3QRWA 1K86A 3D0QA 4RD3A 4DPLA 4LWQA 5BMVA 3C97A 2HJHA 2OYSA 2H1FA 4M1TA 2OESA 2QTBA 4IZOA 3VSAA 2W2MA 1SXHA 2XUAA 4GZ3A 2ZTHA 3SLGA 1U7OA 2VDQB 2QUIA 1N1EA 3D02A 3KJGA 3NRJA 2HOQA 3TIIA 1YBHA 3OG9A 4CMCA 3GAFA 3RVJA 1BOOA 3NHRA 3D8UA 4RS3A 4H1VA 3KOOA 1Y4DE 3ONEA 1NATA 4C76A 1NJ1A 3C3BA 4AO6A 1SUIA 3NU1A 5AJXA 4F72A 3C41J 2H17A 3MT8A 2OHGA 3EZFA 4HDAA 4J0IA 1VLZA 1FFWA 2GK4A 4RJ2A 4TTTS 5E8JA 1SOVA 3ZCUA 1GPLA 4FMDB 2V9ZA 2A86A 3V46A 2RJNA 4BJ5A 3A1UA 3PJDA 5FTJA 1MG5A 3GZJA 4YCBA 5KU7A 2OENG 1ODCA 1GARA 3E5MA 1EEHA 2DQ4A 3TSOA 1CPYA 4GIBA 3UMRA 1RWQA 3FI9A 1TU0A 3VH4A 2I7VA 2XNCA 1ITZA 3DVSX 1DG3A 1VOTA 4X94A 5EJ2A 2XUFA 2WD7B 1NPDA 2IQIA 3A1NA 3SSAA 3JR7A 4KACA 4KREA 4M0KA 4QM6A 3BK7A 4EG0A 1WMEA 1J2UA 2WFZA 2IUUA 4YMVA 4OU4A 5B6IA 2D5AA 4M36A 2WWXA 3ESRA 4MAFA 1XX6A 4YJ3A 2NP7A 4TKLA 1JVNA 1SIWA 1XP5A 4FT2A 4INJA 4MO9A 1HDGO 2QP4A 2ONJA 4OI0A 1E1CA 2IS1A 4ALJA 2LUOA 1K3FA 1M54A 3I6YA 5DM0A 2XQVA 3HDHA 3FDZA 5FA8A 5JJ5A 3TPFA 3TAHA 2ZSJA 1SKMA 3N05A 2SBTA 2R6GA 3ZGVA 2IOFK 4IRUB 5HM8A 3H2KA 3REQA 2FJ0A 4IH1A 1AK9A 5HILA 4W6QA 1OV4A 2EX0A 4O2BF 1WPQA 1L8QA 3S0JA 2NWQA 3DONA 4QD3A 4WCFB 3ABIA 4IQGA 2ZR8A 4Z8XA 2GTIA 3QGMA 4LNUB 4C05A 4LF6B 4CEJA 1Z33A 4RE6A 3PWSA 3TLBA 3WLRA 3AZQA 4EI9A 4BPBA 5KYXA 3NHJA 1IEXA 4F2HA 2VJCA 4UOZA 1UT5A 2R7NA 1R9JA 2ZB2A 1GFZA 5CDSA 1DCTA 3JAWA 2YXEA 1KSHA 1Z2DA 1V45E 4DREA 2PZGA 2YV1A 4H15A 5JXIA 2F8TA 1L5RA 2ZR9A 5EZ5A 3E03A 2BHRA 5KQGA 4YJ2A 4G0NA 2HJWA 3AESA 4YFVA 3FCYA 3GZNA 2XBLA 5K2MA 2OV2A 3HY4A 3PEEA 1AHHA 4JP2A 5D1HA 4DF3A 2W42A 5IW8A 2WLSA 4ZJPA 1ZA1A 1FCJA 2FEAA 2ZRKA 1VIVA 4ISBA 4QGBA 1RTTA 4Y9UA 2VRWA 4RNCA 3GEBA 2JLUA 2XXBA 2O5EA 2JCVA 3SVZA 4KYUA 4X95A 5LPNA 1CEEA 5C51B 1FK8A 2WFMA 3UMGA 5EWLA 3KQTA 1AO0A 1DEKA 1E1QD 1WZNA 3F96A 4FDVA 1Y3CE 3ONVA 3P20A 4EPRA 5A0VA 1PFYA 3FBTA 3L06A 5JCOC 1UP6A 1N3BA 5BSEA 5GPBA 5GVRA 1F17A 2WAYA 4B3IA 3B38A 3P9KA 3VPFA 3CVOA 4MKXA 4RJKA 1A72A 1L7QA 1Y9EA 3Q6IA 4R0VA 4C0WA 4DQLA 1Y6RA 1NUTA 4QO8A 1EFHA 4QSHA 1K68A 3SU8A 5BXQC 4Z53A 1ZU4A 4UCFA 4ZC8A 3DDUA 3LI2A 3PCRB 5IC4A 1ZK4A 4L2IB 3B5JA 3G2HA 3KL4A 2XNHA 1CQJA 1OFGA 4RPIA 5K1ZA 3TDMA 3FHCB 1K7XB 4Z9AA 3GFSA 4P4TA 3ROFA 1LTQA 3C6XA 3CHYA 5HJ2A 1F9EA 3OQHA 2MCFA 1ACJA 5K6RA 2XMSA 1ENOA 1GZ4A 3LP5A 1N8KA 2VDNB 3DE2X 2M9MA 2ONYA 4UHJA 5C7OO 2HT6A 3EG5A 1CKEA 1UEIA 2FFHA 2W7TA 3K9LA 4K6GA 4CMHA 4EHKA 3ZU3A 1W87A 2P78A 1IOLA 1EBBA 4IV8A 4BVJA 3A7EA 4HAWA 3SKYA 4BCDA 4K6KA 4HYTA 2NV6A 2ZB4A 3GDGA 3KETA 3ICQB 4IS3A 1W7AA 1MO4A 3ZHQA 4K8OA 4DRXA 2KI5A 2QRGA 3M6XA 3IALA 3OO0A 3QVGA 3Q3GE 3FOEC 3BEDA 1YQWA 2ZIWB 4JX8A 1EUCB 3ILVA 4O2LA 1SM4A 2BTOA 3HZZA 3EVBA 4H7EA 3U6BA 1XTTA 1YFJA 2XXAA 4XDYA 1RYHA 4NZOA 1IOZA 3DLPX 4EAAA 5CIWA 4TRRA 5JJBA 3KD3A 1KY4A 1U3TA 1YE5A 2A92A 2WTBA 3C1OA 4BP3A 3EFOA 2FW8A 3CVJA 4B6PA 1IN5A 3I8OA 1B00A 1B2RA 2IDZA 2GZAA 3MERA 1IZ7A 4BGEA 1N8SA 3A1VA 1I3LA 3ICPA 2Q45A 2DEUA 2XIQA 4FNMA 5I7HA 5DVZA 1DO0A 3TLCA 1H4QA 1ZUHA 2NUAA 4Q3BA 2GYUA 4OJQA 5CPFA 2MYNA 1RADA 3B7WA 2QUZA 3DBRA 4HLCA 2IJGX 4YPFA 1JZTA 4FUTA 2D0IA 1JTEA 4MV8A 1Y9ZA 2Q1TA 3CYFA 2CMHA 3I4CA 4CM3A 8LDHA 1HYHA 5FORA 5JFTA 1FMFA 2DE0X 2FPRA 3T41A 2UYCA 4UZEA 4JN6B 1ZH6A 5KQSA 4HGOA 4RVNA 3T54A 1NKTA 3GGDA 3VU1A 3VJRA 1GKKA 1YQUA 3B6ZA 4A6PA 3UCFA 2ZR7A 1K5GA 3KNZA 3ND5A 3NWOA 3ELBA 1ZGBA 1LY1A 4Y9SA 4YREA 4DQDA 1M34A 1YOVA 5P8WA 1JQLB 1ONPA 4PICA 3RLFA 1UUFA 1EQ2A 3A2KA 4JQOA 3K2IA 3PL5A 4LSGA 2CNWA 1XT6A 3N8HA 1ODIA 1CY7A 4O0MA 2VHZA 2QRHA 2ENUA 2WF9A 2WSYB 3IQFA 4H77A 5LM3A 3Q5GA 1G4HA 2JLRA 2XMCA 1GU0A 3P4YA 2NV0A 1O08A 2XT6A 5CT4A 3T7KA 3W7BA 4P34A 5I4CA 3P45A 4EX6A 3ADBA 4UHFA 5DKFA 3U62A 1MRZA 7MDHA 5EE3A 3M3DA 3A8TA 1YHNA 4RQAA 5BOSA 1Z6TA 4GQIA 2C97A 2GZ1A 5K4GA 2V59A 2WKQA 1E9RA 1LX6A 2Y1DA 5NLLA 4DXAA 5JWRA 3C0KA 2A5GA 1PT8A 5D00A 5KVAA 1HDZA 1OLSA 4G5QA 2ANCA 1E1NA 1QJCA 4Y6GB 5FA5A 1DFHA 4EPTA 4IZ6A 4NE2A 4JQSA 4R9VA 4S1WA 5L4SA 4B3SB 4MV4A 4ZQBA 3BGDA 1UC5B 2ZRCA 4FEGA 3CR3C 4IIHA 1VCOA 1DAFA 4QFCA 3WKBA 1M7GA 3ITEA 5F4ZA 2Q8QA 3RBAA 4X61A 2BCGY 5IAJA 4MR7A 3RS4A 1KKMA 2RHMA 3PUKA 2IYRA 4ZV7A 3RC3A 1YZHA 3D7MA 3D7SA 5L3SB 3H83A 2IYFA 1JHQA 2W6JA 1Y1KE 2H2HA 3JQBC 1P2UA 2BBSA 3LX5A 4DNXA 4S2EA 1Y8ZA 1SC3A 1P44A 1Z5OA 2QTTA 1MZPA 4L75A 1QVZA 1S3IA 1EG2A 5B5SA 3SS7X 4Q9KA 4GBED 2Z4SA 2J5QA 2JD1A 1XTZA 4DV5B 4WLEA 4GLFA 3L9XA 2V03A 2R25B 3U40A 4ZVQA 3PUJA 4MHTA 1YQTA 2OPHA 5BR8B 2C4MA 1FZTA 5FTKA 1DIRA 2JHGA 2HL6A 2WPDD 4MJ7A 1EWRA 5CYOA 1C1YA 1DIOB 1TZCA 3I9V1 2ODNA 1Q0SA 4JLDA 4L0QA 3E2MA 2PZKA 5LKRA 1PSWA 5CURA 4UNPA 4GUAA 3BVPA 5EHNA 3SG0A 5GM1A 2VLBA 4ZVVA 3PKJA 3SX4A 5BWCA 1N7GA 4DAEA 3STXA 2Y0EA 1MB2A 2BR3A 1RI4A 1KIMA 2O06A 5LA6F 3TQCA 1IN8A 1Z88A 2ZWIA 4EF4A 1J42A 4WBNB 1P1CA 1RM0A 5D84A 4Z3KA 3QKIA 4U7HA 4F9GA 1MHTA 4NXMB 1LBIA 1TK3A 1NVUQ 1DQSA 2W6MA 3AHCA 4NYMR 2CY0A 2FWJA 1M2NA 5G0SA 3UTDA 5JYEA 2WKPA 2R8XA 3MQ4A 3QE4A 4TLCA 3R0IA 3H5AA 2NIPA 3MQ2A 1ATIA 1AQLA 4LQCA 4PC2A 4MYCA 3G5AA 5EIBD 3L04A 1FMTA 4CQMD 2GEKA 4DIFA 3HJRA 1A5TA 5TGTA 4ASUA 2W22A 2GSWA 4ENQA 5FULA 1E1DA 1BFUA 1T8TA 3Q6MA 4N7MA 2ZBVA 4GOKA 3U3MA 1XMSA 2BBTA 2SKDA 4I50B 3OICA 5GM2A 3KOYA 2B8WA 2IIVA 3ESYA 2WIGA 3EQ2A 4PBSA 4EPWA 1QDLB 2O07A 3I9FA 3LY5A 1UBTS 2ZSDA 4FN4A 1G5FA 4JBWA 3BSFA 5KYVA 3WMRA 3W79A 2E82A 3BKWA 4W4TA 4GRDA 1FQKA 1GGHA 2FPGB 1HRDA 1UBKS 3X2EA 4ENRA 3UMSA 3JQFC 5E6RA 2CEKA 1UZMA 1OWPA 2FRVA 4KPUB 4MVWA 3LY9A 3IKLA 2BGJA 4REMA 3TG2A 3CURA 3DDZX 2BH2A 5FI0B 1Q19A 4FSHA 2NZWA 4FDAA 3MG9A 3K8ZA 3T1OA 2I9KA 1Q7GA 2P0AA 4IMPA 4EKEA 1W8IA 1FUIA 4BMOB 3P2OA 3JQAD 1ZVJA 3ID6C 3NUZA 3WAGA 1QFYA 3UAXA 3TQFA 3A4MA 4NMLA 1XD2B 2ZYDA 1SXJB 2XH8A 4G1MB 2IYNA 4RAOA 4ZAFA 1W0CA 5EINA 1GTG1 2FWPA 3SJUA 5IULC 1DDGA 3FPEA 5DTJA 3ZLVA 2JIBA 2G4VA 1I9CA 2BELA 3M6AA 4IQ4A 4RZ2A 4Y6OA 1YULA 1EQUA 4GMFA 1KYIA 3FLAA 1QHNA 3G3EA 2C9ZA 5A3SA 2VUSA 4B4WA 4BNJA 1AA9A 3GPBA 4YXWD 2C5AA 3K70B 3PICA 1QGDA 3PZRA 4TN5A 1JPJA 1NVBA 3BH0A 2CNNA 2BMAA 2PH5A 1JAXA 1IBCA 3F1LA 3ROZA 3VR5A 2O8EB 1XEFA 1ZDMA 1Y4UA 2XMZA 5TJ9A 5FT9A 3ZHCA 5ALUA 2GFHA 1PEDA 1XHEA 4AICA 1SCUA 2VXCA 4Y2YA 4ZT7A 1S8FA 1PEYA 3BKXA 5ALSA 3TLJA 3BRCA 1J90A 1Z0UA 2EL9A 3NHAA 3ZI0A 5KX5B 4L7QA 4LJKA 3AONB 2DUWA 1P39A 5EJFA 1C30B 2B4RO 2C5GA 1N0UA 2XD4A 1PR5A 3K1YA 4J1NA 2W6ID 3VNVA 2VDKB 1BTOA 4M8KA 2LDXA 3C7DB 5DLEA 2Q5CA 3D1JA 3SYRA 1FBNA 2ZJOA 1W4BA 5F9MA 4M0UA 2WLTA 3CFYA 3VISA 3QF4A 3E9EA 4U8GA 9GPBA 4WOPA 1RM4A 3W7VA 5I3ZA 4H1WA 5TMPA 3LRXA 3VI4B 1P80A 1ZZEA 3OTIA 3RIEA 3ZK7A 3DW1X 2O8FA 1FJXA 4WZBB 4PS0A 4B7CA 2XCIA 4ETWA 3PDUA 2X14A 5LNK1 1U11A 3FLEA 1OFUA 2NVOA 3NANA 3DEHA 5K45A 3JALA 5PGMA 1QQAA 4ZEOA 2O2SA 4D3DA 1U3DA 4LDJA 2RGNC 4YMTA 1XZEA 2BSXA 2G0AA 2O48X 1GPWB 3A58B 3EYAA 3H0KA 4JVSB 4LWPA 4PIVA 4R1SA 1FBTA 5GMOA 2P11A 1PQYA 3GEGA 5K8JB 4GXNA 5KYNA 4BVFA 6NULA 4JJ7A 4LPSA 5CH8A 5FPPA 3HDGA 1JQAA 4HDNA 4QPZA 1DJMA 2IT1A 1JA0A 5GIPE 1F51E 2WAAA 1GZ6A 1WU7A 4PNPA 5HCUA 1FLAA 4JGGA 1O94C 1W76A 2YNMD 2HDHA 2YWGA 3OC6A 3GLSA 2RD2A 2EFGA 3O8LA 4EG1A 1SPXA 4RANA 2F43B 4HEJA 5DHTA 3ZWNA 5JIBA 1E94E 1KRXA 1PNTA 1XMJA 2DRIA 5FOTA 5EUMA 1BC5A 2YYZA 2AJTA 3E2IA 3VPAA 3KQKA 1KI3A 3C3EA 4HZIA 2J0UB 4V24A 3WGLA 2VPIA 4KYIB 5B4UA 1RMQA 2GCIA 4YJFA 1BXRB 3RQIA 5KYTA 4AJ4A 2AKEA 3JQDA 1FYEA 1VPEA 1ZMXA 3LY7A 3LH5A 1Y33E 4WCFA 1GSHA 3U3OA 5IMSA 1O0CA 3TAXA 3G02A 3VR2A 2WE8A 3OU7A 3CISA 4IHJA 3QEKA 4EWLA 2QJOA 2NXJA 3OZEA 1Y3AA 4G37A 2XAAA 1Y8RA 4D02A 1JHPA 3MJHA 3RIMA 1H6BA 1KVQA 2G1AA 2H52A 2J6CA 1RT9A 3R3WA 4HRYA 1H5NA 2QLMA 4N7RA 4BFWA 3RAFC 3EOBI 3N7AA 4TMYA 5GONB 5ADUS 2OCPA 5DYWA 1PK7A 1SKQA 4JJ4A 3MUFA 1DEOA 4BP8A 2QU8A 3BD9A 4JWTA 2HLDA 5AD1A 1SGWA 5LA6B 1E66A 1NBMA 2BTQB 4CF4A 1T43A 2B1GA 4UEJA 4XUGB 1TUEA 2EU8A 3VSCA 1U0EA 1XCOA 3PQEA 4NYMQ 4DEXA 1HYEA 5JNRA 1YRYE 1FFEA 3D43A 1JLKA 3KSUA 3L9WA 2C2OA 3BAZA 4FZ5A 5EEHA 4GBGA 3Q72A 4KMSA 4QHYA 2IUYA 2YIMA 1Q44A 4OAQA 3NDJA 3SYMA 3TSCA 4ZYVA 2E87A 3LUKA 5JS8A 5C80A 2BR5A 5EUBA 3RYIA 4BVGA 5BYKA 4MIKA 2UZ4A 3GVXA 1EGHA 2Z9DA 4L1KA 4W5HA 2CXRA 2RGAA 1KFCB 2Z2KA 4KQJA 4AMUA 4D5EA 1E89A 1NHWA 1FVFA 1WB9A 1MA0A 2C4KA 5JMTA 3CNNA 1KDTA 1K88A 1Q2XA 4CKCA 4CL2A 2H16A 5DLPA 4CG0A 4D4KA 1CIJA 1H2WA 1NRWA 1MBZA 1SCKA 3E22A 2BGLA 2H92A 2Q5HA 3VX3A 1EIWA 3GIWA 4ER3A 3ZNQA 4KO2S 1JFVA 1XQXA 3AINA 4F93B 3PUIA 4JODA 1GPYA 1NI4B 4S1OA 3COZA 4WFKA 5BNTA 3OUTA 2BMWA 3UWPA 1YS6A 3GJ4A 1V1JA 1PSZA 1TZJA 5JZBA 1ATZA 4A0FA 4CI0B 2PN1A 2QRVA 3JTEA 2RC6A 5IXJA 1Q7CA 2RAVA 4WHMA 4NNOA 4TQ9A 4CIAA 1IJBA 4FD3A 3L07A 2P35A 5E9JA 3IP8A 4D0GA 2I6UA 1GXSA 2REQB 3S1AA 2P4UA 1NV8A 1KMNA 1YQ9A 1XEAA 3AP1A 4B83A 1JSXA 3BMQA 1O95D 4WLUA 2FE4A 3NLLA 2IBTA 1WXXA 3DL7A 3VUEA 1ZVMA 4D0NA 4GM1A 1DXQA 3W3ZB 1MMFB 5K0EA 5HKAA 4IAOA 1O57A 4GOMD 4N8DA 1QU3A 4ZJYA 3TQHA 2ONZA 5C53B 1D2RA 3U4AA 3RUHA 4AXBA 4L8YA 4TOIA 4G07A 3WOVA 2O2EA 1GPMA 1L5FA 2AFIB 2JGMA 4KEAA 5DNVA 3MWKA 1PJAA 1Z8HA 3AVOA 4LI0A 1J9EA 2XJ9A 2YASA 2Q3EA 1ZI6A 1SURA 1VSBA 3IKJA 4H6XA 4LJ5A 4YALA 3TSAA 3NHWA 4FLEA 3R9KA 2O2CA 4BO3A 1AURA 5HZKA 5L6MB 5LMUB 1JGTA 4KLCA 5EQFA 4KQ9A 1T0HB 1IJKA 3KLBA 3ZBUA 4CL3A 2XI4A 4R40A 1SJ9A 2P5YA 3DXYA 3T52A 2G07A 2JHAA 2H5EA 5KINB 3HYRA 4G97A 1XLTC 4C7MA 2A9OA 1RC1A 1RI1A 3ANXA 4TLBA 3ZKWB 4DY4A 5BN3A 2J0VA 1LF5A 4WY5A 4JI0B 5D5PA 3AY3A 1Q83A 2G06A 1RNLA 1ZHFA 2LZ0A 1AV6A 3Q8XB 1MC8A 4GM4A 3P2YA 3F9CA 3PYMA 4BRZA 1EM8B 2WIAA 3A9SA 2NVUB 2VS1A 1QIMA 2RAPA 2ZT6A 5JNVA 4KIUA 5JQGF 1MB9A 4M7WA 3FUWA 1RJDA 2HI0A 2G71A 3ZE2B 2QX8A 4PZZA 4YRMA 3ORHA 1C5KA 5AKJA 5EWMA 3WE7A 4N0MA 3OLZA 1TKRA 3ORQA 4IJWA 3QWAA 3WDLA 3FCXA 4JP1A 2KBEA 1FXSA 1GWNA 1A7AA 1ABEA 2UVDA 3O4FA 4O4JF 1L5SA 4N47A 2Q4DA 4CKCB 1H9BA 1NZDA 4PPNA 1OCEA 3GMDA 5ALZA 1VLVA 5HMMA 2WFAA 3V4SA 3K9QO 4S1NA 3VYWA 5CB4F 1WRBA 5ENZA 1MO2A 5I8PA 1DELA 1EFRD 2PX6A 1XUOA 5IT4A 2QAJA 3RFXA 4FSXA 2PTHA 4QREA 1G9XA 1ZQ1A 4KE7A 5BYAA 3L8HA 3KZXA 1MA3A 3A1FA 2DHRA 1WKVA 4FMBB 3W2IA 3K8QA 5DX8A 5IDQA 4HN4B 3FOWA 2YRFA 4PVCA 3QZUA 5CW2A 4R3NA 2OXEA 5CT9A 5EZSA 2ZB8A 1LGYA 1OWNA 2AJLI 4LYGA 3GIDA 3OX1A 3TK1A 3QEMB 1ZVVA 4B3JA 2IS4A 4WKBA 2M6LA 2XTMA 4R2HA 5H4GA 2QXYA 3IPYA 4MQEA 4KXMA 4FBMA 2RBEA 1TYAE 2ZRBA 1AC5A 4M6WB 5TT0A 3MWFA 1OLUA 3EZ6A 3PHJA 1RJFA 2BFEA 1JIUA 1WPRA 3K6SB 4R9UC 3JAMA 1YHZA 1CS0A 2VJNA 3T4XA 3ED5A 3G88A 1PJSA 1SC6A 1ORTA 4KQEA 4LX8A 5CK4A 2PJZA 3QU2A 1K8YB 1Q6YA 4KYTA 3MHPA 4G89A 3K73O 2WSSA 4FYMA 4V0LA 2VYQA 4Q1FA 4DUYB 1Z06A 4MCHA 5FAKA 4UBIA 4RD2A 4YP9A 3TXYA 2GZ3A 2VQEB 2H5IA 1C0KA 4MK4A 1E0JA 3CLRD 1BMFD 4AW9A 3IFSA 5L3RA 2FW0A 2Q5QA 2TS1A 3STHA 4IXWA 4BQNA 2EQ5A 1OT3A 1BWPA 4UHKA 2WIBA 1FVXA 3A7DA 3FKJA 4ZVKA 1X7DA 1FIUA 4JJIA 1FYWA 3MJFA 5TE9A 3DAPA 4LI3X 2CUNA 2G1PA 3SZMA 1TYBE 2FSVC 1CZUA 4EG8A 5EIHA 4BZPA 1GAXA 1FFXB 4YBZA 1YK1A 3SSMA 3MCWA 3ER9A 4UNNA 1SUWA 1EM8A 4BMCA 4QUIA 3X1YA 1GZVA 4LHSA 2ZE8A 2E6KA 1UIMA 1N0WA 4EDHA 3DV0B 5K0CA 2BM1A 1V9CA 2IC5A 3LWNA 5KREA 4QXPA 1I33A 5KNCH 3HA2A 1W52X 3J81A 3GN2A 3MBOA 4ZVUA 4ZGWA 5CH3A 5EWMB 1R6AA 1KZYC 1WMBA 4KR6A 2VAWA 1XQVA 1Z5ZA 2QE7D 5F7XA 4BUJA 3RSOA 1NVGA 1FU4A 4QVIA 4N7BA 1ULTA 2BF7A 2EVWX 4HOYA 5GZ6A 4Z1OA 2GWHA 3T61A 6LDHA 3C5EA 3QUCA 3GUZA 3IJPA 1I3MA 2C1ZA 3RHFA 2ZRHA 5K2OA 2F3SA 1XMPA 1UPTA 2V96A 3EJWA 2XYGA 3L8GA 3ZHYA 1WDMA 5F35A 5H16A 1DMSA 2GLXA 3HR4A 5CB8A 2OGWA 3DF9A 3IELA 2PZLA 2XA2A 2Y1KA 1GNLA 1ZSVA 3H97A 4HGNA 4UFOA 5EE1A 3G1TA 3NKLA 4FKZA 2H2IA 5HIMA 4RZQA 1Z2EA 3P0JA 3C74A 4YFYA 2W11A 3JWHA 2IHTA 4XASA 1AH2A 4CNBA 2VDMB 1P0CA 4OUDA 1W4RA 5LNK6 1ND6A 1BROA 1N6OA 1R9NA 1DTSA 2SICE 2WU3A 3JYLA 1GXSB 2REQA 3NAZA 3QIVA 4CXMA 4BLTA 2ZCVA 3KLNA 2JCSA 4D4HA 4X6LA 4XH9B 2PRZA 2X4LA 5AHOA 1N4DA 4QUDA 1YC2A 5M2QA 1XJ5A 4TTIA 4W5JA 5DCLA 4YCSA 3RIHA 1EEXB 1Z39A 2GTHA 2FK7A 1CRWG 4FWIB 4C4OA 3QLJA 1VSVA 3CF4A 2W2OA 1P7ZA 1EA5A 5CHEA 2HLPA 5D8DA 3U9LA 3IQIX 4C1BA 3GJ7A 3QKRB 3ZY5A 4GHWA 1QB7A 4Q3LA 4I3GA 1PCXA 1GZ3A 3U7JA 1QQ7A 3ZCXA 4B3HA 4MCIA 3D59A 3FRHA 2QSUA 1LV8A 3C8ZA 3B1ZA 1OR8A 4KZPA 1MJNA 4KQKA 3OCYA 2Y99A 5LL6P 3GJ6A 1ZNZA 1PJCA 1I2ZA 4JBLA 1GLNA 4XIFA 4AMZA 2W2KA 4W5NA 3ADDA 1TFRA 2IY8A 4BBZA 2GMWA 2YMPA 3G9TA 4LRWA 4XFJA 2NAFA 1XELA 3X1WA 4O63O 2FUEA 3PNYA 5CM2Z 1M2HA 4CLXA 3EZLA 1OFHA 3ROTA 3IJ5A 5HQJA 4E2ZA 1OLSB 5H81A 1USIA 1YZTA 1NBAA 3OOJA 3IUNA 3N5KA 4ZQCB 3WLOA 3UPUA 3NC1C 2H4WA 4QZVA 2IL1A 3Q85A 5IVHA 1EP3B 2EX1A 4HJXA 1KZ7B 4UU1A 5MN4A 1B93A 2CYCA 3V8PA 3S6JA 1NVXQ 2QJTA 3FDJA 1CB7A 1FZQA 4HLUA 4MS1A 2NPIA 3MS7A 4OAOA 3VVLA 4DLNA 3P4XA 1UFKA 2O1XA 2QP9X 3B7GA 4KFSA 4R8MA 4E5NA 2BP7B 2WV7A 3DZ8A 4OQEA 1YRLA 1HZZC 1P7YA 1GQRA 3TB4A 4V03A 5BWOA 1IE3A 1JZSA 2GCOA 1MX5A 2C1EA 2BN4A 1YFZA 2WM3A 3VTAA 3Q8MA 4R6XA 1OYOA 3FOBA 4DUGD 3ICEA 3GC6A 4CTNA 2YX1A 5LA6A 1T2CA 1NBME 4IIVA 5ILQA 3S2YA 3TQSA 3VH3A 4I7EA 4E0BA 4W9NA 1BKDR 1RHQA 4OX9B 4JCOA 5FWDA 3T7EA 3OUZA 1M75A 2Z2XA 1JHOA 4QDXA 3KG2A 4MPTA 4CTOA 1EJ0A 1LX7A 3O3NB 3BL5A 2D5IA 4KFCA 3Q7RA 2F90A 1AOXA 3BICA 4LZPA 3BHMA 5JPCA 4D9BA 3M82A 1O6FA 4QDOA 4QLAA 3C3MA 5HKLA 4D42A 3HJHA 4RPGA 1E2EA 2H4JA 4Q9JA 1CZRA 5L4LA 4Q9HA 1S96A 4EY7A 1J00A 1M1YB 2D8AA 1QORA 4QC2A 3ZWXA 4L78A 5J4HA 4NWIA 2YL2A 3VZPA 1MVNA 2FWRA 1U3WA 3ZDXB 2F43A 4OYHA 4WL0A 3FYSA 2QSJA 1ISIA 4GYKA 4HAOA 2JJ2A 3IJRA 4MGYR 1VGRA 4QDTA 5KIAA 2YNMA 2O7NA 2HHLA 2JZNA 2R86A 2VN8A 3JATB 4I6GA 2VYVD 4JDUA 4MQFB 3RSGA 4EB8A 4QYXA 2OILA 2H1IA 2IDJA 1D8TA 3CRVA 3SD7A 2B35A 5K99A 2VAVA 3T3DA 3V9AA 3NOVA 3RFFA 2R5WA 5SY4A 2NSHA 2Q4BA 2WHPA 4BFTA 1XZ8A 4BNDA 1BZYA 3CH4B 2Y27A 1POXA 3EY4A 3CT4A 1XJQA 4ALIA 4NPAA 3B3JA 4DDHA 3C3CA 2G82A 4NFLA 1XWFA 4RLHA 1VLJA 3G6KA 3QU7A 3GOHA 1DOZA 4QWWA 5D87A 5TPWB 2BLLA 5IP5A 5KOHA 4J9UE 1G4UR 4UE3S 1FDVA 2ZQZA 3AV0B 4MYTA 3DWFA 3FWPA 3WNDA 4DLTA 4Y2RA 4FYHA 4GLLA 4QLOA 4XD7A 1YZNA 4F9FA 3D3EA 2A0YA 2VF7A 3GFFA 3IEKA 4C6SA 4DYHA 5K6TA 2X9QA 4A0SA 1PT5A 1LW6E 2A1TR 4OHBA 5J5CA 2W48A 3NYIA 3IPRA 1EHIA 2AIRA 3FUVA 4JHXA 2VF2A 2B1QA 1X8LA 2HK6A 4I66A 1X9IA 4A91A 2BBWA 1O9GA 2AMJA 2V5VA 3NIGB 3O6VA 3HG7A 1Q16A 2W9XA 2FG5A 3PJEA 1GQYA 1P4JA 2CLOB 1L2TA 3GGCA 4K9OA 3TTXA 3ADKA 3G0OA 1DMRA 4G0UA 3C70A 1PS8A 2W4QA 1TUGA 4MV1A 5CFNA 1VBMA 4ZZ3A 5AVKA 5JYBA 4EMBA 4J0DA 3KKNA 2VHVA 4KR9A 1CK4A 1YB1A 3SJZA 1ODKA 1NTRA 3DMDA 8ADHA 3M6LA 3AUTA 4KJZA 4MQBA 4U6SA 3VTKA 4LXGA 2F4NA 1QYWA 4DA8A 4LXYA 1J07A 4C0JA 4XXHA 2Q7XA 4C88A 5HHTA 5LBTA 3BMOA 3IAXA 4RLSA 1CP2A 4L57A 3WR5A 2F00A 2F8MA 3WP0A 2Y4NA 1K75A 3VKFA 1U2EA 5A4DA 2O0LA 1IG0A 2DFLA 3KP1A 3NS7A 4FMPA 2PSEA 4PC6A 5D6OA 4LF9B 1PV2A 3BOSA 3DP9A 1KI9A 1WCV1 4IV5A 2AC4A 3U4QB 4DG8A 7REQA 1QCCA 4I5EA 2DXIA 1R0WA 1ZC4A 2QAGB 5C7IO 3DAGA 1CJTC 1I1NA 4AI6A 4ABTA 721PA 1LNQA 1IQPA 3B9PA 5G02A 1QNLA 1IZZA 2D2FA 2VDUE 5TEVA 3T95A 5ITZA 2RGDA 4JB0A 5JI2E 1TQ6A 1FU8A 2OB1A 5AOBA 2OT3B 2OZPA 1K6XA 3HNOA 1S2MA 1OB2A 1DCKA 5L3ZA 2H1SA 1VBKA 5FTNA 3HXLA 3ZLJA 2YFYA 1G8JA 1DIHA 2OZLA 2Q0HA 4HLUC 1HDIA 5E3HA 2IYVA 4M0FA 4G85A 4N7JA 3T7SA 3TBFA 3BIFA 4XVRA 4OI1A 4YRFA 1UDCA 1WHTB 2PBFA 3GYBA 2EHDA 4RF4A 4CLEA 5D3MA 2ZUEA 1T3TA 3N74A 1FNBA 4JLMA 3G2KA 3RVSA 1I7QB 3LGAA 4BVHA 5AKKA 2O0MA 4D5GA 3ESDA 1DC6A 1VHTA 3B13B 3HJTA 1ZMRA 2EF0A 3R40A 3Q0TA 5G0TA 5HEKA 5TXGA 3TNYA 2P9GA 2PUVA 2WHQA 4NBTA 5TQVA 2DFKB 3WGNA 1P1BA 1IY9A 2VHQA 5LMNB 4DLRA 1I2AA 3JV7A 2MIIA 1KJQA 2L0XA 3RS0A 1X8JA 3LBIA 4M0DA 2X0EA 4DLAA 3VR1A 3X1MA 1XZLA 1LVGA 2Q6KA 4Q3EA 1G8HA 4KXNA 2P7HA 4P3NA 1D9XA 3ROPA 2AC2A 4DR4B 4GKKB 4CL0A 3QUTA 4WJLA 2QIPA 2W6ZA 4LZLA 4POAA 3K70C 2HA7A 2QTAA 3A6ZA 3K15A 4MCJA 1CUDA 5KO2A 3GQVA 4JSYA 1VGVA 3ROEA 3WO1A 3KX2A 1C7ZA 4Y2UA 1U9ZA 1ZOOA 2CJFA 3F78A 1DSSG