4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase B
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
4W1SA 1EI9A 4XVCA 4B9EA 1W75A 2DQZA 4PSCA 5FP0A 3VXKA 4EY8A 7YASA 4M0EA 1EDBA 1TKRA 3O9MA 5ALLA 4U2GA 2QUAA 5HQ3B 1FFEA 1IUPA 3BJRA 4ZV9A 3IUNA 1A88A 4HAIA 1LZLA 1QFMA 1LZKA 3QYJA 4FNGA 5CH3A 3G0DA 2BUBA 1LPBB 4BC0A 1VJ5A 3QITA 2IITA 3AZOA 1E5TA 5E4TA 3SX4A 2PX6A 5ALVA 3IA2A 5ALUA 3O9VA 1QIIA 4B6GA 4K6KA 5DWDA 2EDAA 4FNMA 4X71A 2ZVDA 3MGAA 4X97A 3R40A 3STWA 1NX9A 4FBMA 4Y9SA 2WIFA 4BAZA 5AICA 3ICWA 4YPVA 3SC2A 1P0MA 1RYYA 3WMRA 1CR6A 3HLKA 5JZSA 2G5PA 4Q34A 2OAGA 1JFRA 2YYSA 5ALEA 5LZ9A 2NW6A 4H7DA 5ALDA 1GXSA 1P0IA 1BS9A 2X5XA 3H2HA 2XMGA 2WFLB 3AIMA 5DNVA 4J0IA 1XROA 3OOSA 1ZGCA 2FJ0A 4WFKA 4AO8A 4RE6A 2VT7A 2H7CA 4QWMA 4B82A 4AO6A 3C43A 5C81A 2O7RA 5AKGA 4DMFA 1IUNA 3G0IA 4GI1A 3QH4A 3BJMA 1HPLA 3LCRA 2XUPA 1AKNA 1XZFA 2GZRA 3C70A 3PFBA 4C87A 3PUIA 5CTAA 1CUCA 2HHAA 2RHTA 3OG9A 1EA5A 2QKYA 2JGIA 2ES4A 4N5IX 3QPDA 5DJ5A 1VXRA 1F6WA 2C58A 1AC5A 3R41A 3F9CA 3S8YA 5K3EA 4HS9A 1NU8A 2B20A 4U2EA 2ZJ7A 4U2DA 4Q3LA 1UWCA 2AJ8A 1K4YA 1GKKA 4H18A 1THGA 1YSCA 5AKEA 3WKEA 5LZ5A 4F0JA 4Y2RA 5AOCA 3ICVA 4MQMA 3TGLA 5JYCA 3HJUA 3A2MA 3I2GA 3E1GA 1PJAA 2ONCA 1JU4A 1DT5A 4I19A 2RIPA 1MPXA 1UK7A 4BP8A 1EDDA 5BV7A 1XZEA 4W1PA 2BUAA 1XZIA 3ZWQA 5CH5A 1LPMA 3H17A 2D5LA 1TCBA 4PSUA 3KOOA 4UBNA 1CUDA 1JU3A 2IIVA 2CEKA 2ZYIA 3R3ZA 2Q0XA 3STUA 4Y2JA 2QXUA 5AM5A 1CUJA 3FBWA 4B81A 4XWGA 4DMHA 1F0NA 5HQ3A 3G7NA 1GZ7A 2QZPA 2WUFA 5D6OA 1FFDA 2O2IA 2OG1A 5K3CA 5ISMA 2EDCA 4B9AA 1W52X 1XLUA 5AM1A 3G9TA 4KE9A 4UBKA 1BEZA 4DTCA 3MUOA 4UHHA 4Q3KA 3IULA 3KD2A 1VKHA 4DMCA 5JD5A 1T2NA 1DWOA 3F96A 5I8PA 2PSEA 4GLBA 1QZ3A 1QONA 1A8UA 2ECFA 4X94A 4B7ZA 3M83A 3S2ZA 2Y2VA 3RARA 4DGQA 1UZAA 4Y2YA 3WJ2A 3ESBA 4J0HA 2I78A 3OURA 4GBGA 5A6VA 3W9UA 2V9ZA 1XZJA 2R8BA 5AM0A 1VLQA 5EI5A 1EX9A 1CUIA 5FUMA 1CUUA 2VQ6A 1XFDA 1YA4A 4OB8A 2GBCA 2O2GA 4AZ0A 1JJIA 2DQYA 4WDQA 1J1IA 2XQGA 3O95A 4G4GA 3W04A 1HDEA 3P2MA 3VVLA 2WFLA 5JAOA 3ANTA 4J7AA 3IDAA 4BDSA 3WYNA 5LZ4A 1TCCA 2CKMA 4KYVA 5DTIA 4OPMA 5LKAA 3M82A 1BCSA 5DYTA 3LP5A 4C01A 4GHWA 1H22A 1SCIA 1LBSA 2ZJ6A 4FMPA 1XRLA 4B0PA 3QZUA 2O7VA 1EXWA 4CI9A 3KDAA 1XZGA 4OU5A 1Y37A 2VJBA 3ANSA 3Q8WA 1GT6A 3A2LA 5K3AA 4BATA 2QR5A 4X95A 1QJ4A 3WK9A 1QIGA 3FVTA 2XUIA 4HXFB 1MAAA 1CRLA 3AZQA 3V48A 1E8DA 5LLSA 5AKIA 1EB9A 2XQIA 4B80A 4OU4A 2J3QA 1BCRA 4IH4A 1FSSA 3B3QA 4Z49A 2ZSIA 4DNQA 3WL8A 1ACLA 3H1BA 3QPAA 2C5FA 1CQZA 1QLWA 3H04A 4OYLA 2V97A 1ZD2P 2ORYA 3BL8A 3GUUA 4U2BA 1CUWA 3F97A 2HL6A 4C4XA 2BKLA 3I1YA 3QPCA 4H7KA 1AGYA 2VAVA 1YASA 5CURA 5AI8A 4V2IA 2QMQA 4ZGBA 3ESDA 3GFFA 4ITVA 2Z8XA 3G8YA 1VZ3A 4BYMA 3DQZA 4KE7A 1K8QA 1ZI9A 2DHCA 2VSQA 2Y6VA 4Y2SA 2Z8ZA 2XUHA 3K2IA 4G8BA 3N0TA 1Q84A 2XUJA 4TVKA 1QO9A 4OUKX 4M0MA 3OC0A 2HDWA 4X6UA 3PUHA 3RK4A 1N5RA 1ZICA 4NZZA 3DYIA 3HRHA 3EBLA 5HCUA 3BDVA 5E4JA 1GPLA 2VATA 2OQIA 4JNCA 1CUEA 1H2WA 4UBLA 5KWIA 5FRDA 1ZD4A 4FDMA 4AX4A 1JMKC 1QFSA 3I6YA 1ZI6A 2D0DA 5YASA 4J0CA 2FX5A 4W63A 5EHZA 4G5XA 5ALIA 2J3DA 3GA7A 3HI4A 4EB0A 5AI5A 3KXPA 1UK8A 1IZ8A 2GYVA 1QIMA 1AUOA 5IVKA 3C6XA 2H7XA 1ZD5A 2DCMA 1PV1A 3PFCA 2WJ4A 2PSJA 1VXOA 3VJLA 3FVRA 4X7BA 3H18A 5IKXA 3LIPA 2PSHA 5AI4A 1EINA 4FTWA 3N2ZB 4RGYA 4EY6A 5SYMA 4KJXA 5CMLA 4UBMA 5ALMA 1X70A 1F8UA 4KACA 1UOOA 1B41A 3ESCA 5AK4A 3BIXA 1ACJA 3CN7A 5FPPA 3WKDA 3KWJA 3DD5A 4MXDA 3DKKA 2HA6A 1R3DA 4ZXFA 2QXTA 4BVKA 5HF6A 5HF5A 1LNSA 1UOPA 4LHEA 2Z3WA 4FLFA 4DSAA 5CT4A 1KEZA 3WWEA 5ALOA 1E8MA 3DL7A 4YX9A 4PV7A 3STYA 5AKLA 1XZHA 2PUHA 3WA6A 2OXEA 3PICA 1QTRA 2AJCA 4NVRA 5BOVA 2VJAA 4B0OA 4E11A 1IVYA 4DNOA 1WB6A 4C6HA 4ZI5A 2X76A 3O0DA 2WSLA 4YASA 2WUGA 1W1IA 3X3HA 2WFZA 4H0CA 2HU8A 3F98A 4L3WA 5DTJA 4AMZA 2ZYSA 3UUFA 2ZYRA 3AILA 1E89A 2BGNA 1O6GA 2WTNA 1YS1X 4Y2TA 2VTVA 4BZZA 3QMWA 4C89A 1BE0A 4KAJA 2QUBA 3FYUB 4YK7A 1ODTC 1FJ2A 1QO7A 4EY5A 4IH9A 1JJFA 1X2BA 3E3AA 3AZPA 4JH0A 4EBBA 1CPYA 1HQDA 2HA3A 4AN0A 4JYPA 5HF9A 2XMSA 2B4KA 4BCCA 1W4LA 3DCNA 5AI9A 3FYTA 1K5PA 4N5HX 5ALGA 1JJBA 1GPNA 4HZGA 2QJWA 1R9MA 4S0XA 3U0VA 4F5ZA 1UKAA 2VJDA 2J4FA 4AN1A 4J0DA 3H19A 3WKCA 4AMYA 1XQXA 2OQVA 2Y2UA 2XUQA 1XQWA 2Y6UA 4KE6A 2RI6A 5T4HA 3IIIA 3WWDA 4RPCA 4UHDA 3I2JA 4BBZA 5LKRA 5HK9A 2PKYX 4AB1A 2WIDA 1E8NA 2LIPA 1SCKA 5FDFA 2AXEA 1XZAA 3IUJA 2HIHA 1KU0A 1WHSA 4G4IA 4L9AA 5DYWA 1VE7A 1XZCA 5AKKA 1QIEA 1YR2A 3H2JA 1K63A 1N5MA 3SK0A 4B83A 4LYEA 1WB5A 1CLEA 2XMQA 2XQFA 1DWPA 2GBFA 3BF7A 2I03A 3I1IA 3WK6A 3VVMA 3CN9A 2OGZA 3GROA 5KREA 3PE6A 5A62A 5IVIA 4CG1A 4ROTA 3I6MA 2BGRA 3WIBA 3G9UA 4WY8A 1HBJA 5ESRA 3VJKA 1XKTA 4Q3OA 5AI6A 2BCEA 5DNUA 2OAEA 4C4ZA 1K6EA 1ZIYA 1XRQA 2DHDA 5ALQA 1MNAA 1P0PA 3WYDA 3EQ8A 4MWTA 5FV4A 1CQWA 1U2EA 5JAPA 3G9XA 3UMJA 2RAUA 3KSRA 4N8SA 2W6CX 2XE4A 5CT5A 5JD6A 1ODCA 1DX6A 5DYYA 4MEBA 1QIFA 4HXGA 1JI3A 4A16A 4QNNA 2CB9A 3VISA 1TAHA 3MVEA 3G0GA 4GEGA 2WILA 4CFSA 5AI0A 3IUMA 5CT8A 2XB6A 2ZJFA 4I3FA 2CBGA 3WZMA 5HKAA 4CCYB 3R3VA 4EHBA 4A5SA 1R1DA 2XUDA 3DYVA 5CW2A 2WU4A 3CCBA 4QDOA 2OGTA 3DNMA 2BUCA 4P92A 5JZ9A 1MX1A 3R0VA 2JGEA 2RGUA 5AHXA 1UK6A 1ODSA 1CUYA 1L7AA 1E3QA 3WLAA 1EK1A 1XKLA 1KU6A 4MYSA 3FYUA 5JIBA 2CJPA 3IUQA 1GKLA 4DYHA 1DQYA 3WL6A 3D4LA 1P0QA 1QIHA 1MNQA 5AM3A 4F60A 2YASA 3V1NA 1Y7IA 1IMJA 4LIPD 4BRSA 1ORVA 2XUFA 2WHPB 2WHRA 4WCVA 3I2KA 4HXEB 2JEZA 2OCGA 4W1QA 1I6WA 2QRUA 1CV2A 1Y7HA 4G4JA 3IB3A 1HLGA 1Q0RA 5JARA 4KRXA 5LZ2A 4X91A 1J06A 2WU3A 4W9RA 5F4ZA 2X8BA 4IO0A 4BCBA 2PPLA 2BJHA 4GXNA 1DINA 2G63A 1TCAA 4Y2VA 4DM7A 5CXUA 3D59A 3DOHA 5K3BA 2HA0A 5K5EA 3V9AA 2VA9A 1OILA 3PDCA 1R50A 4X00A 1X2EA 3TJMA 1YS2X 1IUOA 3C5WP 1ZJ5A 4K2AA 1TQHA 5D3ZA 2QT9A 2CUTA 3O4JA 1CIJA 1ZOIA 2YH2A 2XMBA 5AH0A 4OB6A 1ZJ4A 2OLEA 4UHBA 4IHAA 3ZLUA 2G5TA 1T4MA 3IURA 3STTA 4BB0A 4JYMA 2GYUA 1EB8A 4BZWA 3FWHA 3JW8A 1BN6A 1GGVA 1CUSA 4OSEA 4K6HA 2V98A 2CZQA 4ZRDA 4GECA 5LZ8A 3QBJA 4XJVA 1C7IA 4ZWNA 3WK7A 3QMVA 2K2QB 1GQRA 1R88A 3DKRA 4B84A 4JUIA 1DWQA 5ALZA 3QMMA 1SOMA 3C6BA 4Y2PA 5AKHA 4BTVA 3SWWA 1YB7A 5A7GA 2HA7A 4WFIA 5K3DA 3D3NA 1XRNA 1C4XA 4H7JA 1CUAA 3GELA 5JAUA 4DNPA 2HRRA 4AXBA 2WTMA 5CXXA 3WK5A 2B9VA 5JAHA 1HKHA 5JATA 4Q1VA 4INZA 2XMZA 4CCYA 3H2IA 3A6ZA 4MQLA 4AO7A 3V1LA 3H2GA 5C8ZA 1UFOA 4P93A 1ZD3A 5KBYA 3O4GA 1G42A 3R3YA 4QLAA 3WKAA 3BE8A 4K6GA 4BVJA 1VE6A 4X6XA 3RLIA 2JGKA 4G1FA 1U8EA 2OCLA 5AOBA 1USWA 4UHFA 1XRPA 1G4HA 2DHEA 5JASA 2IX9A 1DT3A 1FFBA 2PBLA 2OCKA 3C8DA 4H77A 1L7RA 3NUZA 5T4EA 4XIIA 3TEJA 2C7BA 3C5VA 3EQ9A 5C7YA 4X93A 4J0GA 1H2YA 5DLPA 1BEEA 1CVLA 4N8DA 4CG3A 4J3JA 5HF8A 1LBTA 5AM4A 3D2AA 1S8OA 2WIKA 1AZWA 1BROA 2WHPA 5ALHA 5HKBA 3Q0TA 4X92A 5A2GA 3WQHA 1EVEA 4UFPA 5ALFA 1F0PA 2VT6A 1R4ZA 1PFQA 4RE5A 3TRDA 4BDTA 5ALKA 2RHWA 5LP1A 5I7UA 1XZBA 3CXUA 3W06A 4FOLA 4L72A 2H7YA 5CRIA 1CEXA 4UBOA 4ARAA 4O08A 4U2FA 5AK3A 2JBWA 1G66A 2H9YA 3FLBA 1H23A 3B5EA 5J3JA 3I28A 4BC1A 2XMRA 2FJPA 3IBTA 4TPKA 1AMNA 2PUJA 4ZV7A 3G0CA 1MAHA 1ZI8A 3FLEA 4Y2XA 1AX9A 1QTIA 3A70A 5A7HA 3NGMA 4G9GA 1CFJA 3M81A 3FYUC 4BTLA 3W9BA 5DNWA 3HSSA 2GYWA 4PO3X 5BWCA 2QTBA 3BIWA 2PM8A 4Y2QA 1YB6A 3WK8A 3DL4A 1H2ZA 4U2CA 1UOQA 2WG0A 4LXHA 2WUDA 5HZGA 3I2IA 3K9BA 4AZ3A 5D7BA 3MUNA 4LXIA 1W76A 4GW3A 1QIKA 1GQSA 1ORWA 4AQDA 4OCZA 1XLWA 1R9NA 2DR0A 2XLCA 1DU4A 5EIHA 1IZ7A 4HRYA 5I9IA 1BN7A 3IVMA 2HFJA 1WPXA 1MX5A 1E66A 4MWSA 3ZV7A 1XRMA 3WJ1A 2WKWA 1ZIXA 3QVMA 3H0CA 4K5QA 4BAGA 4UFNA 4KAFA 1DQZA 3O4HA 1JKMA 1DX4A 3WWCA 2WM2A 4ETWA 3WI7A 4OYYA 3D7RA 3FOBA 4X85A 4QZVA 5BWBA 1UXOA 2J4CA 1CUFA 1FFAA 3UUEA 1AURA 5JALA 4WJLA 2C5GA 4BAUA 3H1AA 2QM0A 5FKJA 2WFMA 3STXA 2ACKA 3OPMA 3DDUA 2CMFA 4BCDA 2WIJA 4KRYA 5HK8A 4WFJA 2JGLA 4C4YA 4CCWA 4F21A 1WHTA 1MU0A 3WL5A 3YASA 4Y7DA 4EA6A 4DLNA 5AM2A 4UBJA 3RKSA 2WJ6A 1XRRA 4J0KA 3ZLVA 4BP9A 4NS4A 4FHZA 1XQVA 5ALTA 4CG2A 3DLTA 1Q0ZA 3RM3A 4BE4A 5CH8A 1JMYA 4A23A 4QEKA 3HABA 1JT2A 2PL5A 4ZREA 4H7IA 3WZLA 3WK4A 4ARBA 1LGYA 2W22A 1FFCA 3ZI7A 1A7UA 2AJDA 4HTAA 3QM1A 1WM1A 3VDXA 2AJBA 2VAXA 1U4NA 4FKBA 1BRTA 4QDUA 5T4BA 3JYHA 4UFOA 1G5FA 1J2EA 4H35A 2UZ0A 4J03A 3VJMA 2P8SA 3DEAA 4FLMA 4H7EA 2JGFA 4KR0A 1LPNA 2XQJA 1W6RA 1RP1A 3D0KA 1CUZA 4DIUA 2ZYHA 2WHQA 4EUSA 5CT9A 5AK5A 3ED1A 1EVQA 2Z3ZA 3C8HA 3D5EA 3NOXA 3K6KA 5LIPA 4WY5A 5ALPA 3HC7A 2JF0A 1J07A 5C8XA 5EFZA 3I2FA 3R3XA 4B85A 3F8SA 2HM7A 2ROQA 5T4FA 4QA9A 2B61A 1LLFA 2XI4A 5AIBA 3GBSA 4XX1A 3AIKA 3AFIA 2JIDA 4N8EA 4PNZA 2C0PA 2OPHA 2XMDA 1LPSA 3T52A 3L1HA 3VKFA 1MTZA 1XZKA 1VZ2A 3HZOA 2XMCA 2HU7A 4G8CA 1NU6A 1VA5A 1QE3A 4IQ4A 5FLKA 3FNBA 5AO9A 2QS9A 3I6ZA 5JANA 4BRZA 5AKJA 4PW0A 4QDTA 5K3FB 4QWWA 4I4CA 3OM8A 1MT3A 1XZMA 4C88A 1L7QA 3FSGD 3V1KA 2C4HA 2GBGA 3O4IA 2RONA 3FAKA 3HYSA 2VF2A 5HFAA 3PF9A 1CUBA 1D07A 2PU7A 4NMWA 1Q83A 1YA8A 1WB4A 1QIJA 2C0QA 4X6YA 3W05A 1ETHA 4IH1A 4BVLA 1CUXA 2XQKA 2G4LA 2HA4A 1OXMA 2HFKA 3G9ZA 4Q05A 4OB7A 3DJYA 2XT0A 4MYDA 1MO2A 2E3JA 3LIIA 5H3HA 4LXGA 4UPDA 2PSFA 3U1TA 1N8SA 2XDWA 1M33A 1XQYA 4EY4A 1MJ5A 3LLCA 5AK6A 4UHEA 2WLSA 3NWOA 1WCYA 4KAAA 3AINA 3AIOA 1U65A 3PI6A 5E2IA 5AKYA 4QDZA 3WIOA 5AP9A 5FPQA 5LZ7A 1THTA 4FFWA 2V96A 2JGJA 1C7JA 5C8VA 5ALXA 4UHCA 3HEAA 4Y2UA 1ZGBA 1UK9A 1UT6A 2DSNA 3C45A 5ALSA 1YAHA 3WL7A 2XUOA 4D9JA 1A8SA 3G0BA 1TRHA 1XZDA 3GZJA 4E15A 4HRXA 5IVHA 3E4DA 3CCCA 3R3WA 1CUVA 1LPOA 4X90A 3EQ7A 1CUGA 1YCDA 4PQEA 5D3KA 1TK3A 3FCXA 4DSZA 2QOEA 4GDMA 4JEIA 4KEAA 4OD0A 3L1IA 2XLBA 5ALYA 3W2TA 4E46A 1OCEA 1TIBA 3L1JA 5EGNA 2I3ZA 2OCIA 4P9NA 2EEPA 2XUGA 4M0FA 2PVSA 3C6YA 1A8QA 5FXMA 5A71A 4KE8A 5EHQA 5EHNA 1QIDA 2WQZA 4EY7A 2GBIA 3ZPXA 3AJAA 5SYNA 3WWPA 5EIEA 4LKOA 3LS2A 3ZLTA 4MJ3A 2FUKA 5IVDA 5A7FA 1QOZA 3HXKA 5KWJA 1VA4A 3R3UA 3EIOA 4QE3A 4WDRA 5CBKA 5JD4A 1EHYA 4HVTA 4RNCA 3G02A 3I2HA 3KWFA 3ILSA 4H7HA 3C6ZA 4Q82A 3HACA 1LPAB 2H1IA 1ISPA 2VEOA 3D2CA 3V1MA 4UBIA 5LYYA 4MEAA 4TGLA 2Z5GA 3BF8A 5AKXA 2YXPX 2HADA 2Y1KA 5AIAA 1LPPA 2HA5A 4BE9A 5JADA 3D2BA 2WUEA 4J0JA 1XZLA 4FBLA 1MN6A 3DS8A 5FOQA 4EZIA 3M3DA 3DOIA 2GZSA 2WG2A 1H2XA 2BFNA 4PF1A 4FWBA 1DTEA 3EF3A 4CIAA 2HU5A 1YAJA 3JWEA 4UUQA 3A2NA 2I3DA 4PSDA 4QDXA 2QVBA 1EDEA 4CIBA 3ESAA 4P08A 1EH5A 4LYDA 4FFVA 1VOTA 2O2HA 5E4YA 5K3FA 2WJ3A 1B6GA 5JZBA 2XUKA 5CT6A 3F67A 1EK2A 5IH7A 3FLAA 2XUAA 4DNFA 3AUKA 5EHXA 1BU8A 6YASA 2BAGA 5ALRA 3T4UA 5AOAA 5EIAA 3BXPA 3WKBA 1CUHA 5ALWA 3STVA 3WWOA 3PF8A 2ACEA 2JGMA 3BDIA 2OGSA 2ZSHA 4G8DA 4QLOA 1HL7A 1AQLA 3WA7A 3OTQA 1QGED 2DFPA 3E0XA 1Z68A 1GPKA 1N1MA 4X3CA 1WOMA 1WPRA 1SCQA 3BWXA 2VJCA 3FSGA 2AJLI 1XLVA 2JEYA 4G9EA 4W1RA 5AKZA 5ALJA 3H2KA 2WIGA 4FLEA 1SFRA 3B12A 2WG1A 2R11A 1RWQA 3FCYA 4DMKA 5ALNA 1UKCA 4GWLA 1SC9A 1O6FA 1UKBA 2PSDA 2QJRA 2HA2A 4E14A 4L0CA 5HFNA 5AJHA 3C87A 4H7FA 1MX9A 2PU5A 2HRQA
chains in the Genus database with same CATH superfamily
2HMTA 3N8KA 3U9TA 1HZZC 1TW3A 2NZVG 4OKSA 4GBMA 2QY6A 5GM2A 4F12A 2J59A 1T91A 3OJ0A 4MMYB 1FSGA 3T9EA 4B76A 2BE7A 4L15A 4URXR 4XX0B 3RRNA 2X0RA 2VYCA 1IN7A 1ZN7A 4CEIA 4GKAA 4QD3A 1FDIA 5CB8A 1SZPA 1FDWA 3FBGA 3HYTA 4I50F 2O2DA 4JBWA 4C08A 3WE7A 2CYAA 4LJ5A 4MPJA 5DM4A 5FP0A 4O4LA 2WD8A 7YASA 3HFSA 3DFMA 1WMBA 3EC1A 3O9MA 1MHTA 4GR5A 3LH5A 3EZNA 2BSXA 4EA9A 2FPUA 2BL4A 1RQPA 2XE6A 3DVLA 5IDYA 5D51S 1FFEA 1ISSA 2FEWB 3BJRA 4QYIB 4F4FA 2W6JA 3OT1B 2X13A 3KAPA 4IKEA 2BP7A 2FF7A 3B8HA 1R4MB 4HAIA 1SCBA 4RJKA 3G6KA 4E2WA 4DLSA 2IF0A 3B53X 3GI1A 4K9SA 2WNHA 3KJFA 2EOAA 4PGFA 4CIAA 4GWGA 2OTCA 3EXHC 5CGZA 3B2QA 1T0HB 2QQ5A 4JX8A 4OHUA 2EJWA 3PENA 3BIOA 4DG8A 4DS3A 3ZNQA 2BKVA 2ODNA 1BS1A 4BC0A 4ZZ3A 1GPUA 1NAIA 3QITA 3T5PA 3K2BA 4E5PA 2IITA 5LBIA 5J5CA 4NYJQ 2PNJA 3NHUA 5E4TA 4H27A 4FHCA 3PEYA 1OREA 2G25A 5JFOA 3FJ1A 3FETA 4LJSA 4KIGA 5DIZA 3RVBA 2JLQA 2EG9A 3IBSA 3D5QA 4V2UA 5EZSA 3QQPA 2Q28A 3MF4A 2AX3A 4EFLA 3N2NA 2CXPA 4FOOA 3AM3A 4HWRA 6LDHA 5KOIA 4NESA 5TMPA 2PUDA 1L5HA 1UP7A 2QTMA 3HWX1 4OGFA 2GF9A 3F5SA 3HPRA 4TVBA 1QH0A 3SYLA 3ZK9A 4DV3B 2OYRA 4GGMX 8OHMA 1F8FA 1O7JA 3LRPA 5I7OA 1ZGJA 1UDBA 3UJ3X 1XNRB 2AE2A 2HF9A 4GKBA 4X1IA 3JD2A 1YK1A 2M98A 4G24A 2F3PA 5DWDA 5F4BA 3JD1A 1VLMA 3OPYI 3MGAA 5REQA 5EIBC 2D3TA 3AGPA 3DMPA 2ABWA 4FBMA 3RHZA 4CG0A 2WIFA 1Z6XA 3PHCA 1JXOA 4Z2AA 4IINA 4I5DA 1U0TA 3LL7A 5JYEA 2EU8A 1PN3A 2R7LA 2YFHA 3VR3D 1ORIA 3IMCA 2DYKA 2P4UA 4DRYA 5HE9A 2R60A 3SC2A 2WJAA 1EFLA 1RYYA 3MT0A 1P80A 4R9NA 4YO7A 3L4KA 1I1HA 2CXTA 3HA3A 5F52A 2Q1SA 2G5PA 4FU0A 4E31A 4D42A 4Q34A 3FPFA 3VO1A 2MTBA 1M1XB 4OQEA 4G85A 5LSAA 3ANYB 3TOXA 1RLOA 1TZKA 4K2HA 1AKUA 4YC7A 3QUSA 2V5VA 3BD8A 1K7EB 2FF5A 3UNXA 1PT8A 5BQPA 2R7NA 1PCXA 3E7FA 4TL7A 5ALEA 5LZ9A 2NW6A 3K73O 3R7FA 2BCJQ 2BH9A 4OJMX 3B1FA 3B38A 5MGNA 1DJPA 4P5EA 1GXSA 2L82A 1NT4A 1BS9A 1W1UA 4CF5A 2GAIA 1NFQA 2DWOA 2P0AA 4F2WA 2WW8A 1NULA 2XMGA 1RWKA 4BLOA 3I72A 4JKOA 2IBTA 1RRPA 1PZFA 1C81A 2CLEB 4RWEA 4U39A 1IPHA 4H7PA 1XROA 1DAHA 3DMTC 3T4XA 2IUEA 4OHZA 3S27A 5KNDA 2QYSA 2FJ0A 3CX3A 3W9YA 2NXWA 2R4UA 4BJ3A 4C0BA 1DJQA 1XTSA 5SY9A 2VZEA 4DCVA 3HE3A 2H7CA 1ODIA 1W73A 2OENG 3HKBB 4QWMA 4XM0A 5HILA 3TZCA 5DTRA 4YAFA 1ZX1A 4IRXA 4B09A 3C43A 4D8WA 1VBMA 1P3JA 1PL8A 2O7RA 3AI7A 3PTZA 1LVHA 1KJZA 1XYGA 3WBJA 3ZE2B 3H11A 3G0IA 1SBCA 3R7SA 2Z1MA 1FX0B 3LCRA 4YR9A 1EXDA 5F9FA 1QLJA 1KTIA 3QP9A 3DBRA 1YUMA 4X1OA 2VPWA 5FULA 4LK2A 3LXRA 4C87A 5CTAA 3MINA 3K05A 121PA 1UINA 5I51A 4F5WA 2A1UB 4MKXA 3JALB 5CA1F 4O2BA 4QL3A 3V80A 16PKA 1J99A 5TF0A 2R1VA 1WDMA 3RTAA 3TW0A 1XTTA 4IHJF 3RBXA 4N5IX 1TEZA 3N58A 2AXPA 3DUWA 1PEYA 4A3SA 5DJ5A 4G0OA 1JKXA 2W5UA 3D6UA 4FCCA 4CLRB 1VXRA 4EJ0A 1GZHB 1F4PA 2YVLA 3I01M 3P5BA 2VK8A 4HRAA 1AC5A 5IN5A 4M1QA 4B2PA 2Q99A 3T7KA 1WSWA 3UJAA 2RGCA 1OE0A 4BX8A 3UG6A 3S8YA 1XRSB 3GCDA 1IXZA 4NBNA 4TTVA 1EFRA 2B20A 4BQPA 4NOKA 1OWPA 2MOKA 2ZRAA 1RVDA 5FADA 3TZHA 3KKQA 4L2IB 7REQB 4U2EA 3OEWA 1TM3E 4TT3D 4BVGA 3KOXA 4MV8A 5L4NA 3BE4A 3K6JA 2AJ8A 3RREA 3DW1X 1SZDA 4H18A 1DKQA 3H5OA 3ENVA 1BCRB 1X3LA 5KYUA 3H97A 3QVUA 2HF2A 4HOYA 1IEVA 4Q03A 1OH7A 3AOGA 4OJKA 3HBAA 1QFXA 1X7WA 3MW8A 2O20A 3PNKA 4Y2RA 4F0JA 3IP5A 5AOCA 1S9HA 2QORA 4KZPA 4O5OA 3U1VA 4A8JB 3EGEA 1R8QA 4LTDA 3QHAA 4EGCB 4NENB 3QW4B 5BN4A 3TGLA 2I4TA 4LMAA 4K8RB 3T5CA 3NBAA 4Y30A 4ZI7F 3SVZA 4EGAA 3HJUA 1O54A 1KA9H 2BEVB 1KFCB 2VLBA 4L5CA 3PVSA 5FIUA 1D3AA 2VPPA 1OH6A 1C1XB 3E1GA 3BCSA 3GCWA 1MFZA 3LQKA 1ZSYA 4OK6A 3L1VA 1GG5A 1RLMA 1WCIB 2PR7A 2ZB3A 1OGYA 4J76A 4CF6A 4DC9A 5KOHB 4RPHA 3L0BA 2RHHA 2BBWA 1PHPA 2NVUA 5DASA 2RIPA 3OTWA 3LBIA 1YB2A 9ABPA 3QVGB 3CY6A 4ZVRA 1EDDA 2AVNA 5EXDA 5CJPA 5JLAA 5C4GB 1PQUA 4D99A 4ARIA 2AG8A 1KWGA 2RKWA 5FFFA 3IEVA 4M7PA 1YR7A 2DUUA 4KMSA 2XKKA 1XYYA 1Z3CA 2VTDA 5CYGA 5HKOA 4G5FA 4RTMA 1RADA 4JVMA 2I2FA 3GO4A 2JHAA 2JFOA 3SPXA 3B3AA 5CH5A 1BD4A 3H17A 3RG8A 3TGWA 1R8JA 2Q3LA 3C5HA 3U3OA 5DM60 5KNCA 1B14A 3C15C 3I76A 2DCUA 3ZHQA 4UZEA 4BQEA 2WF6A 1JU3A 3MJVA 3KE9A 5BUQA 4KNYA 3DLPX 3U16A 3UA4A 2CEKA 4MPDA 4O6VA 3ROZA 1EP9A 5K7SA 3X1MA 3VPDA 2QLMA 1PSWA 2C4UA 2PRSA 2Z1DA 4G41A 4MYHA 4Q00A 4BB5A 2QXUA 1Q0TA 2JW5A 1L4NA 1EFPA 4IMPA 1WEHA 1CUJA 1W5EA 4K9DA 4Q39A 1AV7A 5FOXA 4EI7A 3NTQA 2WYHA 1I5EA 4WCFC 1E2FA 3HU1A 5CIWA 4I5IA 5HQ3A 1I13A 2NZ2A 3I5YA 1KI1A 1JNYA 3G7NA 3ESRA 4OQZA 1GZ7A 1MAWA 1VL8A 2OC9A 2QZPA 3EODA 3WDSA 2XXAB 4QARA 4IIVA 1ZJJA 3RC3A 2RK3A 1HT2E 3KYDB 1JBEA 4L76A 1E3LA 1II0A 2NQ8A 3R7WA 3TQTA 2P91A 1Y82A 1K97A 1Y6FA 3DDSA 2YJZA 4XPIB 3S81A 1ENOA 3HYLA 3QHQA 2R9VA 1NUUA 1GITA 2YN4A 4ECAA 4BO5A 3Q5GA 3AHIA 1GN9A 1PQYA 1Z2OX 2OAQ1 4KE9A 4OK5A 4RHEA 5F2NA 3AEUB 4JASB 3GDHA 1OFIA 1RI3A 4MLDA 4UHHA 5EPUA 1N6NA 1W88B 5BSRA 2OVFA 2ASVA 3MEQA 1FQJA 1NKVA 2R6GA 2ERXA 2JRCA 4P54A 4Q3KA 3P9PA 2CVOA 4A8HA 1I3MA 3TSAA 1QAQA 1JIJA 2OKGA 3IULA 4C5BA 4KCGA 5JD5A 1EDOA 4MQFA 2C8JA 2Q1YA 5J43A 3AF4A 1DEHA 2QD4A 4ZTUB 2C3UA 1IOVA 5LP6B 3CE9A 1A8UA 2BM8A 3B1WA 3GMDA 3ON5A 4D7AA 2Q0QA 1IK4A 3ESYA 1FP1D 3ZE6A 4C0WA 3KJQA 3S2ZA 4O0LA 1PT9A 3UF0A 4JIGA 2JAXA 2ZBRA 4Y6PA 3RARA 4Y2YA 1O1YA 4U7WA 3QXSA 4FVTA 2O5EA 2FSPA 1GPYA 1EBFA 2J5KA 3HVJA 1IWPB 3ESBA 1TM2A 3GUYA 3T7CA 4J0HA 5DEIA 3BL5A 4F3RA 3LWNA 1CD5A 1NBEA 2HEIA 3JXEA 2B92A 3KR1A 4RLHA 1IM5A 1X80B 2JVJA 2IIBA 2WPNA 3JQ7B 3Q10A 3R77A 4H1VA 4J9VA 4IZ6A 1QVRA 4WOPA 4PINA 5G53C 5LLTA 3L8HA 2QTAA 3KCQA 3G1TA 3OWOA 3ZCXA 4N7BA 1EP1B 5FJIA 3OTOB 2EZUA 4R2HA 4R6XA 3O73A 5JNRA 3ZY5A 1CUIA 1QCCA 2HCJB 1YDWA 1RRMA 2DHQA 2JB9A 1LVGA 4N0PA 1AKVA 3UWSA 3LWDA 3RAGA 2IDMA 5JHGB 3O7WA 3K1AA 3H3FA 3UUWA 3GJ0A 5AESA 4P4LA 2O8EB 4XWYA 1O97C 4AZ0A 1JJIA 1RKVA 4XUEA 5LD2B 3IVGA 2C7PA 4X66B 1M6YA 2AN4A 3DB2A 1YZGA 5EERA 2NPOA 3ETHA 1BMDA 1HDCA 4EFKA 4YRKA 2ODWA 2YN0A 5IXJA 1EGHA 5AR1A 3GUCA 2C96A 2JAUA 4RVGA 2WFLA 3I58A 4MPPA 4YJ3A 3EEYA 2ZXFA 1H1LB 3OIGA 1OZGA 3A10A 2O0HA 1DKMA 1RWBA 3DTVD 1P7WA 3IDAA 3RRYA 4BDSA 3D6FA 4HVLA 5LZ4A 1JQEA 1NOIA 1G8KA 1KR5A 1DC3A 2VJOA 4M86A 1BCSA 3F5QA 3O1IC 4P7GA 4PC2A 1PJRA 2CVHA 3UATA 3VDNB 1H22A 5IASA 3MIIA 3HDJA 4X1YB 3IBCA 2CNNA 1Z6AA 4RSHA 4BNTA 5FPSA 1H3FA 5JR3A 3T61A 4FMPA 3TINA 2QP9X 2QGNA 3KOWA 2BI8A 3D3KA 4HMPA 4Y7CA 4NABA 4BTEA 3V2IA 4ECEA 3MCTA 4JP3A 3BXXA 3C3EA 3EDCA 5KWSA 4GKVA 3DOUA 1T9BA 2Q5JA 4GR4A 2O7VA 4FFNA 4QYSA 4ZAZA 2ZI9A 4D3SA 5C8YF 1VSUA 3FNHA 3D54D 3D7NA 3RWOA 4PLWA 5HJ7A 4TUYB 4GPD1 1UJNA 1YDEA 2R66A 5SYAA 1E20A 1SA0A 4IXWA 4MUNA 1UQUA 3CKYA 3C74A 5TQ0B 1PZNA 2CYCA 3U4IA 3CCFA 4K3UA 4AULA 4CKZA 1CY2A 4YYZA 2QHXA 2GM9A 5F77A 1RYHA 3FCAA 4BATA 2F8LA 1X19A 3NZEA 1WXHA 3EXAA 4I14A 4BBJA 1VGRA 2F8SA 1IOWA 1MABB 4WUTA 3WBBA 3AL2A 2IYNA 1WZNA 1SC3A 2PS9A 4YRMA 1SK9A 1JIVA 1QRRA 3P9RA 2UV8A 3FVTA 3PKJA 4R2IA 3NHAA 1Z13A 4ILEA 2I1QA 5AJTA 3TQIA 3O8DA 1XCGB 3CEJA 3QUAA 1MAAA 1G9XA 2BFDA 3E35A 2LKDA 1T9GR 4FR0A 4U7GA 3UC5A 4YRCA 4FKMA 4I50A 3ROXA 1G8HA 1OR8A 4DV6B 3SJ7A 4HX5A 2J3QA 5A4MS 4J1SA 1BOOA 1FDOA 3VC2A 5HJ5A 1VSVA 2C5LA 1FSSA 3WLIA 2CJYA 3TDNA 5B30A 2IS6A 4OX9B 2B1JA 2YWEA 3BHJA 2P9FA 4PG8A 3IHWA 1X7GA 4JYBA 4TXLA 4AWXA 1RZRA 4D8YA 3WL8A 4WXPA 1Y1LA 3EHDA 3H2BA 5IU6A 4JP2A 2CHGA 4Q4DA 4TLEA 1IVSA 3EGDA 1H4TA 2H5EA 4NPAA 4Z51A 1X1EA 3UB4A 2L19A 4PE5B 4TL6A 4EARA 2JJ8A 5KNBD 1QANA 1N3BA 1ZUWA 3IKMB 4MW2A 3LU1A 1YONA 3GUUA 4Q47A 1YJ8A 4TRNA 4RFLA 3F97A 1Z37A 2BRUC 3L6DA 4CGZA 4C4XA 3CURA 1WUHS 3I1YA 4W5JA 3HI6A 3IPCA 1M6NA 1V5GA 1YZNA 2PZKA 3DV0B 4UNQA 4DG5A 1GGKA 4H7KA 1OFUA 3L7NA 2B6HA 4DSNA 4DUGD 3BB1A 2CB0A 3JYPA 1V11A 4ZI2A 1HR0B 4V2IA 4ZGBA 1VRVA 2JIPA 1AA9A 2ZOSA 4FD3A 3SI7A 3GLVA 1EZ1A 1H0KA 4EZEA 1TU0A 5KPDA 2AFHB 1VBNA 3GLFA 4LFAB 1XPUA 2GNOA 1QYIA 1AY0A 2P9CA 3HEMA 1U3FA 4HG2A 4YV0A 1JLRA 2VNIA 1UKEA 2C4VA 2DUJA 1YQGA 2WB4A 3CXRA 4Q1CA 1MFPA 3DDZX 1UBRS 1VI5A 1LTKA 3IHLA 3C48A 3DQZA 3O5AA 4ZXPA 4KE7A 2ZVPX 5EJIA 1TPZA 3T7TA 3C7AA 4G4SO 3MGBA 1QWSA 4S2EA 1LNZA 1SG6A 2B82A 4ENVA 2DHCA 1L7NA 1WXXA 3TLCA 3FZEA 3K1YA 4Z7NB 4Y2SA 1XEWY 5AVQA 2CLFB 1RKQA 1ZOLA 4MIEA 1N32B 3K2IA 3WLOA 4DLVA 4EO7A 4FINA 3HXMA 1UJ4A 1U80A 3LT4A 4O4HB 3D0OA 3VSCA 2XUJA 4TVKA 2YYYA 1ZH6A 1QOPB 4RACA 2VR1A 4C3VA 1I9CA 3OWHA 3F73A 1RRVA 1WMDA 2BEWA 3NFRA 3IQFA 1MXHA 3G7UA 4JCOA 4OQQA 2XSZA 3Q15C 3GRKA 4FYMA 4X6UA 1G4UR 1N5RA 1HA3A 1KHHA 1D7AA 1ZICA 4YGYA 5A4AA 4NZZA 1ZU4A 1SELA 2Y1OA 1PGNA 3ZKWB 1UKVY 3CKLA 1G20A 2EKLA 3EBLA 5DF1A 3T3EA 5CFRA 5E4JA 5JH7B 4GE0A 1NMYA 5J2TB 1ULZA 2AL7A 1QHGA 2OQIA 3BMQA 1O77A 1NBIA 4DCNA 1N2CA 2C95A 1L3CA 3LBAA 4RYDA 1H2WA 2Q07A 1MO6A 1DC8A 2Q1UA 4UBLA 4GLFA 4AZTA 2BMEA 2XVAA 4AKEA 2X42A 3EY4A 4ZVSA 3CVYA 4NXMB 4H31A 3C3PA 5LBUA 2PXCA 3A36A 3IILA 4R1OA 4RSGA 4K05A 4CETA 5INTA 4URWR 3KNZA 1TYDE 4CCAA 3AEXA 4MCHA 3PHBE 1ZI6A 5YASA 4DWWA 5U1PA 4J6EA 1WHSB 2V8OA 3NBFA 2GK4A 2FX5A 4W63A 2QZZA 4Z99A 1DXOA 4BFXA 2E87A 2G6TA 2J3DA 2FQXA 1CVIA 1V6CA 1XU9A 3GA7A 4C03A 2JCSA 5KSZA 3BG5A 4XYBA 4QOIA 2IOFK 4BVBA 2B2CA 4LSWA 4LHYA 4CMGA 5IJAA 1L7OA 3B85A 1P5ZB 4FGUA 5I01A 3K72B 3A1DA 4YJFB 1BEUB 2PL1A 5D1HA 4CZ2A 1EMDA 8GPBA 1ZD5A 1YI0A 3LVRE 4RIHA 5CVTA 2HYIC 1RHJA 3I92A 2DCMA 2OEPA 2YNMC 3EIXA 4MIKA 1SD2A 3H0EA 4W7IA 1PV1A 2NOAA 4L75A 5GINE 3FUUA 1IY1A 1EG7A 2GO7A 1NX6A 1RYFA 3VJLA 2QTGA 4HUQA 2AVDA 3RRXA 4DR4B 5CA1A 3ANXA 3LQ4A 3QIVA 3SKYA 3LZDA 4O3FA 1M72A 5EZYF 4X7BA 1ESZA 1ZKMA 1Z0SA 4HNUA 3H18A 1UOEA 2W2NA 1DP4A 2ZAGA 3ROPA 3UXMA 3W2EA 4IHJA 4J0QA 4JC5A 4F2DA 4Z53A 5GM1A 3JAWB 3TSYA 4F5DA 4BO0A 5CDGA 1MRNA 4GL2A 4ZKEA 4EKGA 2JFQA 4CM8A 3I9OA 1EUCA 1PJCA 4MW1A 2OXIA 4PPGA 5DGTA 3WB1A 3DNFA 3P2JA 4MWDA 5K8CA 5EPOA 1X42A 3ZHYA 1LKZA 5SYMA 4KJXA 5CMLA 1FFSA 2QMYA 1WXQA 3FTQA 3KAJA 4RSRA 3OA0A 3B1YA 1E60A 1X70A 1F8UA 5CHYA 5ALMA 3OZBA 5B1YA 4KACA 3TWOA 2YXDA 3UJ7A 5DNYB 1V5EA 4BLRA 2WMDA 3GNTA 4IOLA 1PR6A 3AUYA 5LB4A 4MZXA 1RC8A 2IHNA 1QF6A 3LDUA 1VE3A 1ENYA 1VE5A 1NW8A 2IRWA 3EVTA 3ESCA 4FW8A 1JZSA 3WFZA 3NOQA 5AK4A 1ZDMA 2QMEA 1WXFA 1P61B 5FPPA 3SXJA 3KWJA 3QOYA 4A6DA 1WZIA 1RMTA 2R6JA 3RYHA 5HKKA 4O02B 3SM3A 3KTAB 1GIAA 1R3DA 5AHKA 1XN1A 1J20A 3F3KA 1N2XA 1GTG1 4TKLA 3Q7IA 3B6KA 2V58A 4URVR 2P9ZA 2HH9A 2N42A 1O9HA 4JJFA 5EE5B 1JKFA 3TRFA 3AETB 4ZI7A 1LNSA 1P18A 1UOPA 2EW2A 2NO4A 2HMWA 1LD3A 2X9VA 3FZGA 1C3XA 4LHEA 4GOXA 5I45A 1FTQA 3S4YA 2CJWB 4KQ2A 3UKOA 2FQQA 1ORHA 1SBIA 3IO5A 4R8SA 1ETUA 4HEQA 3UC9A 3VUEA 1FXWF 3B9BA 3DZDA 3N8IA 4YRBA 2QX9A 4TMFA 1N8NA 2BHLA 1R9JA 1ORDA 2L2QA 4MICA 4CKEA 2VXCA 3E5RA 3HU3A 4LF6B 2PUHA 5EJ2A 2RB4A 3FKSD 1LQUA 3SYTA 3O3NB 3AKCA 2KBEA 5ER9A 3N87A 3HM9A 5L51A 4W5OA 2IXGA 1GJRA 1N92A 4G5HA 5FI0B 4J16A 4EUFA 3RS7A 2CNWA 4Z3KA 1QE0A 1R64A 1YKSA 3U4AA 3ZWBA 1FFXB 3DTVA 4H6PA 2RSLA 4HDKB 3WGMA 1U9YA 1JDNA 3NIWA 1GUZA 2EJVA 4QVGA 3QEAZ 4XE5A 5NLLA 3WY9A 3ZIAD 5H9WA 3UGKA 4J07A 2BBSA 4HFNA 2W4IA 4GP7A 1SUEA 1Z5NA 1QU3A 1SCUB 3LSTA 2A4MA 3VU9B 3JQAD 5LQSA 3EEOA 3U3XA 3C7DB 3EN0A 1A8HA 3RTCA 1JBQA 1D6JA 4IG4A 1JHDA 3CBGA 4I55F 1JHYA 1QF9A 4US0R 1P1IA 2OD9A 6GPBA 3DAOA 3KS9A 4KI0A 5U4QA 3NEAA 4RFSB 2EL9A 4GBED 1RI4A 2ZYRA 4NKRA 4NP6A 4NPCA 1Q14A 2H1VA 1QYVA 4HSGA 2Z4SA 1EVJA 1O6GA 2OZPA 1HY3A 1TO2E 1YS1X 2BT4A 2JI4A 1LV8A 2B8NA 2KI5A 2PS0A 1E0AA 2X2FA 2YMPA 4DARA 1WDLA 4YJ2B 2BE9A 5ILOA 4MQ5A 2QUBA 2J8ZA 1G8FA 2B99A 1EZZA 1TKAA 3PFKA 2HSDA 2DXIA 1FJ2A 1NMEA 3CNBA 3NDIA 2HRQA 1UJBA 4KN6A 4BGUA 2HF8A 4IH9A 2HQBA 1NXPA 4XDGA 1OTYA 5CX4A 3HBNA 4AFNA 4L0DA 1VBFA 2A94A 3E3AA 2VDPB 4YT5A 3SDBA 3WYCA 4MP3A 4DLYA 4LJ9A 5E7MA 5BXQC 4LJYA 4R3UC 1CPYA 1E6EA 2VHYA 3R5SA 3MYRA 5C5IA 1HXHA 4DQ0A 4BJ6A 4JLAA 4JYPA 4LV5B 5HF9A 4C29A 4YCCA 5FHRA 1T8RA 2I87A 5HFJA 3ZE0B 2PKWA 1YB5A 4KP7A 4LPKA 2JBHA 1W34A 1WW2A 5J4KA 3FYTA 1K5PA 1YD7A 3BWMA 3QVOA 4LOHA 1X0XA 4GWKA 3ZBPA 2ZDHA 3K96A 4WA8A 1YMVA 1JJBA 3F46A 4AYWA 3I9V6 2XIQA 3SMVA 2H9AA 1WQ3A 4QFBA 5DKFA 1WABA 2C7GA 3ODGA 4P4UA 5KYNA 5B7NA 2QZ4A 1OX4B 3ZHRA 1P9LA 1O03A 3KJEA 4B2YA 3U0VA 3DQQA 4MQUA 4BUZA 1N2EA 2OUIA 4HH1A 3OX1A 2J4FA 1U7WA 4JZKA 3TDMA 4AN1A 1I6KA 4J0DA 5DT2A 3ZDQA 2XZPA 3CPJB 3G5UA 2G5CA 1MV8A 4JT4A 2OO7A 3OBIA 1L1FA 1IIBA 1DRJA 4H6VA 5LOVB 2QYTA 5DHUA 4AMYA 2OQVA 3D8NA 1JHUA 4CJXA 4B47A 3DP9A 3V4OA 4KE6A 4PAMA 1MO4A 4GVXA 3FTDA 3IIIA 4AECA 1Z8NA 5AXCA 4E5VA 4YPFA 4UULA 3WWDA 4BVHA 3TDKA 2UVPB 3MGKA 3ZWOA 1P1HA 1UXJA 4TTJA 3WMEA 3N6RA 3WQSB 3DMGA 2C2YA 4JSRA 2QVXX 2XIJA 4BZQA 4Y6LA 2RHOA 4CVNA 2B7LA 2R25B 2AMVA 2ZVJA 3I2JA 4P98A 4LJ6A 3CJRA 2BZ0A 3OJOA 4RELA 4TT8A 2W4QA 3ZEIA 4EF4A 3L07A 4KMMA 4U1RA 4F2HA 2Q3FA 1WB9A 2PKYX 1KK1A 5JDIA 1V7QA 2FLWA 1KVUA 3AVOA 3BGVA 1UODA 3KOYA 3OQIB 2LIPA 2IXTA 3QUBA 4I08A 2J09A 2IKSA 4PBRA 2QTVB 4TZKA 1K7SN 4TWAA 5L3ZA 5FDFA 1XZAA 1AS3A 2G1PA 1YI8A 4O0MA 3RYTC 3I53A 4A0RA 3IUJA 3N07A 3DOJA 5BNTA 2CNKA 2JGRA 2GT1A 4G4IA 1G5QA 4WNAA 4MA4A 2GPTA 3CSUA 4MAFA 5KCMA 5LYJF 3ZXUB 2R4QA 4KXFB 3GEDA 1Z6TA 3H6HA 1QIEA 5J59A 1PTJA 1H66A 1V6AA 5G1NA 1T8TA 1U2TA 2OHVA 2ZBEA 2O1EA 3NT4A 1CVRA 1OLSA 3PWTA 3B48A 3SJZA 4EVQA 4KB5A 2D5BA 4HATA 3IXQA 2E37A 2BFMA 4FX5A 3N0WA 1DJOA 2C92A 1CLEA 2PZBA 2XMQA 4RJTA 2C9CA 1NW6A 2ZI3A 3FHOA 4O2LA 1K7CA 1JR3A 3KOUA 4PC3A 1RWOA 5FQNA 3LYUA 3DFZA 4GQBA 5HCNA 3TW8A 5K0BA 1DO0A 5C8YA 4XEHA 1AV6A 1UDWA 4N9QA 3PPWA 2H85A 4A2PA 1ZVVA 5BWNA 1QP0A 4U7FA 3BF7A 1U1IA 3I1IA 4P6VF 3WK6A 5CIQA 2XVZA 3GROA 4JITA 2OBMA 1GSHA 4LDZA 3R8XA 1DDIA 3WNVA 2Z98A 3GRAA 1GV0A 1ZIOA 4LMBA 4OF4A 5GY7A 3T6KA 4EY3A 2W0MA 3GDWA 1MAUA 1PUXA 5A62A 1K8YB 4JQSA 1JILA 4CDGA 1PYGA 4QTYA 3AU9A 4CMIB 1AKTA 1UBCA 3DEZA 5H4HA 1U28C 4HPWA 5LQJA 3WIBA 1O6BA 3NHRA 5K2MA 5COAA 1I33A 4G4SP 1QHEA 1RT9A 1CIPA 2A0WA 2BGIA 1NW9B 5ESRA 1XKTA 1P6XA 1M7BA 2XDYA 2Z04A 1D2RA 1D4AA 2JJ2D 2ZJ4A 3I04A 4NMXB 4Q3OA 4XAQA 2UYYA 4YRLA 2A9JA 4OBWA 1WUJS 4UAUA 3H5TA 3U17A 2H5IA 3A6DA 4YLYA 1P77A 5KB3A 5EJ4A 3GNLA 3N0VA 4J2HA 5D5HA 1R74A 1G8YA 4C4ZA 1GAXA 3UKDA 1ZIYA 1GSIA 2DHDA 4R7GA 4FHGA 3PGVA 5E8RA 2VTKA 1L7EA 2XGMA 3HSKA 4P3YA 5EIFA 1UMDB 5DTEA 1WLYA 1YOVA 3EQ8A 3AYZB 3KQVA 4HYTA 2GPJA 5T5QA 3SF8B 3L49A 5AVSA 5FV4A 2VJKA 2G0NA 1A9OA 4RHYA 1Y1SA 4RZUA 3RD5A 1FLVA 3HKDB 2D0OB 3CZRA 4DIEA 2ZJ8A 3ACCA 3ZCVA 4B48A 1NNI1 4FQ7A 2F1OA 2I2WA 1EG2A 2OG2A 1MQSA 1NA5A 1ZJ6A 3EPRA 3HHPA 2II6A 1PEKE 2XE4A 1WMEA 3NV9A 4MRMA 4A0SA 2ZIFA 5DU2A 1ODCA 4GBJA 4BN0A 5EL0A 4HLQB 1Z3IX 2QUIA 1QIFA 4HXGA 3DF9A 4A16A 1DUIA 2PX4A 2CB9A 1RU3A 3M5PA 4KO1S 1CZRA 4RMJA 1TAHA 1U2GA 2W2MA 3IAEA 3L7LA 4DGSA 2H1FA 1SVKA 3DOCA 2WILA 3GJ3A 2O7SA 4CFSA 2VBGA 1LI5A 4P53A 2GFHA 4JJKA 1NN5A 2C4MA 4PLCA 2C4TA 4ZI3A 1WRBA 2UVQA 2V3VA 1NC3A 3VU1A 2IGTA 4OHBA 5LA6B 2V1UA 2ZJFA 4I3FA 4EO4A 2IBMA 4EVIA 2GN2A 1E4EB 3A31A 3HJGA 2QD3A 2C3OA 2ZRFA 1JSLA 3FPCA 3R3VA 4M1EA 5CLHA 4AG3A 1SQ0A 2GEVA 3OLCX 4EG4A 5A4JA 3PNYA 5K0EA 2WU4A 3PDJA 3VC7A 2LUOA 1SVIA 2DG2A 1VFPA 3CCBA 4KXVA 1WBDA 1Q7GA 3HDQA 5M7EA 4QDOA 2NT3A 3HP1A 4KQKA 3L8EA 1U9IC 3IH5A 2ZYVX 2J30A 3DZIA 2QN6A 3MRVA 3RAPR 4RGQA 1I94B 5F98A 1DJNA 1KEEA 2GN9A 2QMHA 1C5KA 1Q1ZA 3KQHA 1KR2A 1FRZA 4YUZA 4C9BA 4E30A 2QAIA 1ODSA 3E2PA 3NV7A 4TZTA 3CGWA 3A3YA 2HMVA 4KO2S 3T1QA 2BFBB 3BM5A 3GJ5A 4UXHA 1VSBA 1WZ2A 3FF4A 3WB0A 1WSDA 2X5JO 1ZMBA 1GCIA 1DBVO 1E61A 2EBHX 5BW4A 1U5AA 3GFQA 3AOEC 3PPIA 5DLQC 3ZD7A 3ZNOA 3D4IA 4DCTA 2QN2A 2CGEA 4MCJA 4K9QA 1HEYA 1Q20A 2QT0A 2OV4A 1DKLA 2ZFUA 2ZRGA 3NNDA 1JG4A 4E09A 1KNQA 4XM2A 3T5DA 5LD2C 1L7PA 3M34A 3IUQA 4NLLA 3V2GA 5L53A 2AFIA 2IYFA 4J2OA 2GRJA 3ZXIA 1KARA 4NZYA 3FWYA 2HSWA 2GK7A 4NCXA 5DP2A 3ZNNA 1QGZA 3CPHA 2P1RA 3KLBA 4R69A 4DR6B 3ZIAA 1JBKA 1L1EA 3I9NA 3ORQA 4QBIA 1JEQB 4B44A 3SSAA 4RH0A 3EARA 4BGVA 2R79A 3AEQA 1VLHA 1BSVA 5JMPA 1VSTA 4JKIA 2XY4A 4LFBB 4LIPD 1GA6A 4BJ1A 4KR6A 1P72A 1P1JA 5BXYA 1KZ6A 1U3DA 1IOZA 2PG3A 3QEMB 4FFPA 5EWJA 1ORVA 3NRCA 1ZRHA 3ETDA 4XB6B 1E1QA 2WHRA 2XTNA 5BQOA 3TLYA 3ZGNA 3O3MB 1U8XX 1U9ZA 2G71A 1IZZA 1VSQA 3NRBA 4REOA 4CKWA 3FCUB 3UQZA 3BB4A 4JJ8A 3RJMA 1P17A 4KR7A 1DJMA 2DT5A 1DAGA 3AUXA 3MT7A 3RU2A 4PLHA 1ATIA 4IJ5A 4MHOA 5EEHA 4ZHSA 2OHJA 3CUSA 1QUFA 5E9JA 3IBGA 4YROA 4HXEB 4QGGA 2XYQA 3TOSA 2A7QA 3IOCA 5HXAA 1EJ0A 1W19A 4OL0A 3ZE9A 2B8JA 2C3YA 1PW7A 4D56A 3LX8A 1X92A 4A26A 3FOFC 3KM0A 2XYGA 5EZYA 3IB3A 3UUGA 1JRLA 1F2UB 4HBGA 1HNWB 2QAJA 1DG3A 4ANFA 1QH8A 1BJRE 2HLHA 3OLWA 1X39A 4FIZA 4GX5A 4LCBA 2WU3A 5LMZA 4W9RA 3TKYA 2FEOA 2J08A 2X8BA 3TUIC 3NALA 2Q9CA 3FYHA 3BSWA 3LPNA 1U2DA 1N6PA 4PC7A 1QSGA 1QQ7A 3F47A 1PZXA 4LZOA 1KETA 2ZS7A 4Y1FA 1DIRA 4ZJPA 3I83A 3TZEA 5EFOA 4U9HS 4Q9IA 1GAQA 4GXNA 1OX6A 2Q5LA 1G8GA 2D2VA 5IKEA 1PX2A 3NR2A 2ZXUA 1TCAA 3S7ZA 5GAJA 5GONB 3KL2A 3KT3A 3P4UA 4KRFA 4CF7A 2OWDA 3QVWA 1DV2A 1GNQA 1P39A 2YYAA 3IYLW 3I45A 3CVJA 4Y2VA 2W2VA 1U11A 4U9IS 1T4CA 3S5JA 4C3OB 2GI4A 2JHCA 1UBHS 3J80A 3COSA 4AMVA 1X9HA 4MWCA 3KQKA 5JSHA 1EFVA 8ABPA 4RZHA 3QKWA 2VA9A 1OILA 3PDCA 2IXBA 4TQ9A 4BWFB 3KZVA 5GGXA 2PGOA 4DV4B 2H5JA 2JD2A 1ZXBA 3TJMA 4KHPB 1IUOA 1O0CA 3KEOA 1E6LA 1Z4NA 2Q8QA 1IHUA 4PS1A 2CNLA 3MWKA 3E1SA 2QNRA 4JA0A 1XWIA 1TQHA 3A1TA 3Q7PA 4E1BA 3BTOA 2XVMA 3FDZA 3I04M 3OTGA 4JLWA 4QSHA 4HQRA 1JDJA 3VU3A 1AK2A 1ONPA 5LPNA 1P2UA 2JLBA 2XPCA 5G4KB 4ESHA 1ZQ9A 2F8TA 3FFXA 2AXQA 3L7IA 4FR5A 1CQIA 1FXWA 4OQYA 4PG5A 2BYTA 2XMBA 3G7SA 3MWEB 3NP7A 4FUTA 4OB6A 4UMVA 5C53B 1L4EA 1JFVA 2VA8A 4WZAA 4B4WA 1R6DA 1R6VA 1PJBA 2ONKA 4Q3NA 2G0AA 3KSBC 2QPAA 5CX1B 5CVEA 1QVVA 1XFAA 2FPLA 1TZJA 2F48A 4EJSC 5BVHB 2XNCA 3IURA 2VNAA 3KQQA 3IE1A 1ZITA 1NBWB 1Y5IA 1A9TA 4PONA 2X0FA 4DB4A 4R1LA 3N7AA 3WO0A 1ZNQO 1ZC4A 3GFRA 4R01A 4DXHA 2O0KA 3TTVA 3TM5A 4ND7A 3U19A 4MS3B 1XJ0A 4Z4GA 5FTJA 2B7CA 3K9QO 3IMEA 4KX3A 1Z0FA 4I5FA 3ZWPA 1OYWA 1P2SA 2XB4A 5IWCA 1II8B 2FHSA 2ZEJA 3KYBA 2BONA 4MDHA 4PBTA 1V2HE 3ER9A 5ERXA 2REQA 3LBFA 3ZE7A 4ID3A 3FFAA 4XRGA 2V98A 5LQUA 2NUAB 1M1ZA 4ZRDA 2XE7A 3NHZA 1GPDG 1TKBA 3OUTA 4I55A 4UQOA 4XJVA 2WTBA 1G8AA 4ZWNA 1OIWA 3BE5A 4YONB 4IMIB 5KQRA 1U0NA 2K2QB 4NIMA 3S1AA 1SU4A 2DGDA 4RORA 3R6TA 2LCQA 4TTQA 4NICA 1C80A 1U8AA 4YCMA 1AMOA 2RHLA 3QFTA 3LBYA 2O8VA 2CDBA 4ND5A 4R84A 1AUPA 1WDWB 1LDYA 1PFGA 1YB1A 2Q4EA 2HHJA 2IYQA 2NN3C 2Y77A 3QWBA 5AVRA 3SWWA 3UAGA 1A5ZA 1QB8A 2H2WA 5CFMA 3HLYA 2O1SA 1YVPA 4G1EB 5H3LA 2ZQZA 4A2QA 2QRZA 3C7TA 4N76A 3D3NA 1XRNA 3CZ9A 3ZVKA 5EKTA 2Q9UA 4F3TA 1KRXA 1OXXK 2UYCA 2IGBA 2Q5CA 1H5QA 1SVLA 1CUAA 2G76A 3G79A 1IATA 3GELA 1LQ2A 1H6BA 5JAUA 2CLDX 3TLKA 1K3FA 5HZMA 5K0LA 2ZJ0A 1CY7A 3VZBA 1NJ1A 1W5FA 2WTMA 1UAAA 3QUQA 3WK5A 2B9VA 3QNMA 3DCYA 1WBBA 4E5YA 4NFSA 1M1YE 3K16A 5BSVA 5FBVB 3HP4A 3GEPA 4PO9A 4XFJA 2HC9A 4HLUA 4B2LA 3LQ1A 3NC1C 1VPTA 1FZQA 4BL5A 3FJOA 4IR7A 3Q9UA 4O33A 1FF9A 3GJ8A 1QM5A 5KS2A 1SXHA 3D9QX 1XPRA 4LJRA 4II7A 3PLAE 2Q9AA 1TMKA 2QMOA 3OP4A 4IJ6A 1UFOA 2RHCA 4MTLA 4MB2A 3WIUA 2Z57A 3LVFO 1FFHA 3IP8A 3IESA 3R3YA 4QLAA 4IVPA 3G5AA 2BFPA 3K9GA 4ZO8A 2AI3A 3TQQA 4B2IA 3BFVA 3GRVA 2C31A 3HY3A 4C76A 1XXHB 2D3WA 4F9GA 2LBPA 2I99A 2PMDA 3M49A 3PFWO 1P3Y1 4IW3B 2GZAA 4IY1A 3EIUA 3RLIA 2ZT8A 4X45A 1RQRA 1YS6A 2WR8A 2B94A 3R5TA 4XR9A 4EX7A 4XGNA 3ZOZA 2C9DA 4S3MA 4BMSA 4YV1A 5JY6A 1XRPA 1G4HA 4RHCA 4IWNA 3BFJA 1NI4B 3G6WA 2DHEA 4NRDA 2IX9A 3RASA 3QOWA 5JASA 3R9XA 2PBLA 3DLIA 4NOLA 3C3BA 4HV4A 4G67A 4AW9A 4BNIA 5KYWA 2AG5A 1B8VA 3EMBA 2O54A 1F9EA 1CS0A 3OFSA 5K45A 2VBIA 1EFCA 1E32A 3UT5B 3C3JA 5L3SB 2C7BA 2VH5R 3D8TA 2WJIA 2Z2IA 4JHXA 3C5VA 1E1RD 3M4JA 4NU8X 5D6NA 3T3PB 1B15A 4UEJA 5C7YA 4J0GA 4L5JA 4LQ4A 1Y3IA 5NULA 1K2VN 3FFBA 1E6CA 1KNXA 1BEEA 2X7HA 521PA 4QODA 1L5KA 1ULSA 1NI5A 3PITA 4PCUA 2OA0A 1S02A 4TOIA 2HWUA 5HF8A 3USES 4KO8A 4CM4A 4GX1A 1YE8A 5D86A 1WULS 1YL7A 2I6TA 2BM9A 2PUBA 3MRSA 1JAZA 4N01A 3P1JA 1S4MA 2B4RO 2O2SA 4FD2A 4CN8A 5LYJA 2GD0A 2JIOA 3QELB 2WHPA 3N3AC 3ZDEA 5HKBA 4NAUA 3DZGA 3IHTA 3Q0TA 4Z3OA 2VPIA 3EASA 4X92A 1OSNA 1RJDA 3WQHA 4DAOA 1IB0A 2HOQA 1EVEA 4EW3A 1X8JA 1YIDA 3PUXA 1C9JA 3C39A 3CINA 2I6UA 4S1TA 3AVXA 1CY0A 2ZT6A 1GVNB 2R7MA 5EXPA 4E4RA 2A7XA 1R4ZA 5GGYA 4C3ZA 3EJ6A 3MWGA 5CYOA 5DWVA 4PVDA 1O5TA 3D8BA 1SNYA 3ZWWA 3NS7A 4RE5A 2CW5A 4BLSA 4MPTA 3BQMB 1J2RA 5LWHA 1SOUA 1KVSA 1DOAA 1ZJZA 2PUWA 5I7UA 3BGIA 3K9LA 4I4TF 3R75A 4HDAA 2FP4A 3RH0A 1ULAA 4YJHA 1QK3A 2UZ1A 3GAMA 1I0IA 3VNAA 3DJFA 5EP2A 4CKCA 1Y8CA 4AJNA 5KYXA 1BQ3A 2A1TS 5TARA 3TD6A 3BE6A 4L72A 1ONNA 1P5RA 4GOJA 4K9PA 5CPBA 3T15A 4B87A 3BGOS 4CFZA 1M5RA 2ZROA 4FGZA 4N0DA 4R1PA 4ARAA 1W44A 4OKNA 2I3BA 1T9HA 3NC4A 4JI4B 2CXXA 1WDTA 4ZMRA 1ZR2A 2ZUVA 1G66A 1YR8A 5T8KC 3ET5A 3RFUA 1KK0A 4RY9A 3GFBA 2DPYA 1J1ZA 1H23A 4UW9A 5IC4A 4JD5A 2LXNA 3JS5A 3PK0A 2HJRA 4OFZA 3FAZA 3TBKA 4LJ8A 3I28A 1SQ6A 1UJMA 4BC1A 2XV1A 3D6AA 3T7RA 1SBHA 2YVAA 2FJPA 2OD7A 4TPKA 1Z47A 3PHLA 3CW8X 4ITRC 4B46A 4EM6A 1FFYA 1BDHA 3GT3A 4RK1A 5CDUA 2BSAA 4ZV7A 1CRQA 4XB1A 2REXB 2D0PB 5DOVA 4AT1A 5E38A 2QM8A 5F9HA 4EKDA 1M6EX 1PJ4A 4AK9A 3AP1A 4AP6A 4JEHA 1AX9A 4IEEA 4RDCA 3VDMA 1BMFA 1RQLA 1XMVA 2XGSA 2XX3A 3HCNA 3PNSA 3NGMA 1GZ5A 2VSFA 3O38A 1CEYA 3REQA 2L42A 2ZK7A 1T3TA 1NNLA 2H4JA 3UCFA 4R1SA 1NGSA 2VPZA 2R00C 3MJ4A 2VJLA 3Q41A 1TIPA 4YECA 5IYZF 3RHFA 4WINA 3DVAB 3IBFA 3EWNA 4RSMA 1R3UA 4NDZA 2P2ZA 2VJMA 3HSSA 3JTEA 2VHXA 3GRPA 5BWCA 5IMSA 2ZZKA 3TLGB 3TTTA 2ZM6B 2F55A 1XIVA 2WYVA 4Y2QA 5BWLA 1SUSA 4MTCA 3LFUA 5AYVA 3Q7RA 4BP1A 3FD8A 5FAXA 2JI8A 3LT2A 4LXHA 1ABBA 4MQEA 4I6JA 3UPTA 1RRFA 4CU5A 2FG5A 2HT6A 3IUPA 5BURA 5WRFA 4KK3A 2CHFA 1A5TA 3GCGA 2A67A 3I2IA 4TS9A 2D06A 3FIUA 3K9BA 5LUAA 1YJQA 1S4QA 1Z0IA 1HDXA 2O2EA 1KZYC 5D7BA 4C1BA 4DA7A 1D09A 1FQOA 3BBLA 1GZDA 1W76A 2D74A 4GW3A 5B12A 5JNUA 1JPJA 1IY2A 1QIKA 1DO2A 2XGGA 1OIXA 1NQWA 4AQDA 2NU8A 2PX5A 1Z07A 1GD1O 1V1MA 1Y9AA 4V3CA 4NAHA 5L7YA 4MRAA 4IDFA 2FFRA 3RBZA 4QPNA 4CEHA 2CK3A 3MC1A 2R86A 5CCDA 4LQDA 1GUFA 3TEFA 5EOVA 5EIHA 3GJQA 3HJHA 2FFBA 2NTYC 4KOAA 3SS7X 4AWBA 1QFYA 3H9EO 2D2XA 1M2OA 4RL6A 4G0VA 4KTVE 2WWHA 5FCDA 5I9IA 1AM4D 1BN7A 1NR5A 3UAXA 5B57C 3OKPA 1ISFA 1MX5A 2WPDD 3OJWA 4ZO4A 4IJQA 2I1WA 3N8HA 4QUKA 3ZV7A 4BNYA 4O4IF 4OH1A 1NNEA 1CQPA 3VH3A 4PRLA 4Q4CA 2WKWA 1IPEA 2QBYA 3I30X 1HEIA 4KDFA 3RVQA 2Y05A 4EDFA 1MJFA 5GJWC 4UFNA 4BQIA 4QICA 3L46A 3T0FA 5CK4A 3TJRA 2P2NA 1R0RE 3BEOA 1KO8A 1CG6A 2D7CA 3OFVA 4Q7LA 3RHTA 4RQUA 2COKA 1K4KA 3EH1A 1R7RA 3O4HA 1XE3A 2MSWA 5TVKA 4C6TB 3JU3A 1PWYE 1ZW6A 2R8YA 1JKMA 2WQ7A 4KIWA 1NJ2A 2WB2A 1H94A 5HYVA 3IEIA 4KXWA 1Z0DA 4EW2A 2ZM5A 3TN7A 2GPAA 1IM8A 4N5NA 5K8LA 3ST7A 3A58B 3WI7A 3BXGA 3HJTA 4UDNA 2F8MA 3D7RA 3DWIA 4OJQA 1D0VA 3D64A 4QZVA 3ROEA 2P2GA 4HXYA 3T95A 3E6AA 3EULA 3O74A 1LBEA 4KXYA 4LF9B 1FFAA 1E2PA 5COBA 3UUEA 1UT8A 2AOVA 2VPXA 2DECA 1AURA 3A1SA 4WJLA 4HNAA 3EFOB 4LGYA 1U3CA 2C5GA 4BAUA 2FVYA 3DTYA 2QM0A 1R9GA 1V7CA 2JDID 2WFMA 2X6RA 3TVTA 1Z5ZA 3DBOB 3EZ9A 1M2KA 1RKBA 3EYAA 2OZEA 2Y71A 3OIFA 4TXNA 1X7XA 3HJAA 4XLTA 4XVRA 3NHJA 4BNLA 1GAJA 3BICA 3BMNB 4WOJA 5FFMA 4URUR 1RQ2A 2C29D 2WYIA 3P2YA 1EU1A 4M3NA 2FMIA 4MJ7A 5CUQA 4BCDA 4BFLA 2PZLA 4BN4A 1CJKC 4EHNA 1C0IA 3QFFA 4QPDA 3N0RA 5HK8A 3I5UA 3ISTA 4CCWA 1QKJA 1O6ZA 4F21A 3ZG6A 4DR5B 4C7JA 1P0FA 1WHTA 1C2TA 1R5NA 1K5GA 1KO1A 1P5JA 3FROA 3V8NA 1RM0A 4DLNA 2O06A 3HHEA 4DIFA 2ZS8A 2KQUA 3IJ5A 1TAUA 3I09A 1L5SA 3NORA 1UAYA 2WJ6A 3KFXA 4CLHA 4QVIA 1PQWA 4G97A 1E3MA 1OX5A 4F4UA 3BMOB 3SEZA 3D3WB 3JTMA 4BP9A 3WLQA 3ADOA 2XKJE 3IDZA 1ML4A 1C9DB 2YJ5A 3VTKA 2A57A 4ARUA 4BE4A 3ABOB 5MFPA 2GTHA 2IA5A 3DT8A 4YCNA 1GARA 3F4BA 2VDLB 1LTHR 4OYRA 4DY4A 2ZJ2A 4ZREA 2VCYA 4P34A 4WVLA 2AOTB 3L8CA 4JYZA 3NB0A 1WNTA 1PF7E 2ISCA 4I4IA 4IIJF 2OK7A 1Y63A 2ONYA 5CFQA 4ZZIA 4MI3A 1A7UA 3DE3X 3M4XA 2IP2A 7MHTA 1OOEA 2JCXA 4KTTE 1E2KA 4GX0A 4TMWA 2BHRA 1UPCA 1Z29A 2PKEA 4FT2A 4JLKA 4YRFA 5JD3A 1Q95A 2VDNB 2H92A 3AYXB 3U3MA 2J6BA 4B6OA 1OWLA 4JQCA 3EFEA 3H4TA 4IYJA 1CEEA 1Z0AA 1M8GA 3IPYA 4FKBA 1DX9A 2ODPA 4QELA 5A0TA 3NM6B 4UFOA 1TECE 3HCPA 4R8KA 1UWKA 4V1CA 1TB4A 2NZUG 3IAM1 4M76B 5G0TA 4BASA 1FP4B 1PYDA 2VYNA 3C7KA 3IOYA 3OP1A 3A9WA 1SIUA 4KLNA 3KL4A 1Q12A 1J8DA 4CMAA 4W7HA 1M34B 2HXSA 1P73A 1V16B 3EA4A 2DWPA 3BK1A 4DIUA 2W2QA 4F84A 1THZA 2X0KA 3EBOA 5BR7A 4RHTA 2C1EA 1NASA 4GMXA 4MEJA 1Q3HA 2O8DA 1NVKA 2CLLB 5FA8A 4MRSA 3QBDA 1HH4A 2FW7A 5GJCA 5IAKA 1CXZA 2CNBA 1QG0A 1LFAA 1SUPA 4BUCA 3LWZA 5MN5A 2QIPA 3D5EA 3PEFA 3NOXA 2NU9A 2Q4TA 3ZU6A 5FUVA 3O8LA 5D3MA 1Y3HA 2CMHA 4BLUA 3K6KA 4NULA 3CMCO 3N5CA 4PYRA 2P5YA 4X1KB 1BNCA 4LTMA 3SE0A 4D96A 5DI3B 4D79A 2JJMA 2GPBA 3ILVA 1M6VA 3C3DA 5EFZA 4IV0A 1I51A 3UANA 3COJA 1RJGA 1T3GA 4BNVA 4PZ0A 3QKRA 4K6OA 4AKHA 2FGKA 3EZXA 4MV7A 3GBPA 1H0RA 1K7YA 1SOVA 1Q57A 2PMEA 2DKNA 2R1TB 2Z4RA 3RVDA 5CP8A 1JIKA 2VJYA 1Z7BA 3V4PB 3W90A 1QV9A 4PM4A 5KVSA 3DE2X 3CUTA 2B61A 5A4IS 1LLFA 2ZR8A 3FPSA 3RYFA 5AIBA 1LQTA 4REQB 4WLNA 3TIGA 1YZFA 1ZLYA 2C99A 4XX1A 4MI6A 1E3SA 1GGEA 5E9QA 3WIVA 1E9SA 3ZWNA 2P4HX 4RA9A 1T2FA 2L0XA 4N8EA 5CAEB 4ZV4A 2OPHA 2Q3MA 2Y1CA 2H5LA 3C8MA 4M37A 3RVRA 3KHTA 3GLIA 4HN4B 1ECBA 4YACA 3VKFA 3DCJA 2IV2X 5JQGF 1D4OA 3OPXA 5DGIA 1XZKA 1DCTA 2QAGB 2ZCUA 5GQSA 3FNEA 3GL9A 1W6UA 1MQ9A 1R6UA 3OD1A 3BSSA 3AXSA 1POWA 1Y42X 4YALA 4IV8A 1QE3A 1DDGA 1SC6A 3CSDA 4MVJG 4X65B 5GV7A 1HZZA 3P52A 3L3BA 2YJTD 3BYZA 3DA8A 1BHQ1 3AB3A 1D1TA 4QG7A 5FB3A 3WMXA 1B76A 2Y67A 4M89A 4DSTA 5FWYA 2HUNA 2HHHB 2R7KA 1TRKA 1U6IA 3MXTA 4YMGA 1TLLA 2GAOA 4BFVA 2I71A 2Z6QA 3AG6A 3B6EA 1AQYA 3O8QA 3UMFA 3A9VA 5K3FB 1JG3A 2HF7A 4QWWA 4I4CA 3OM8A 5EHIA 1XEFA 2EG5A 4CQNA 3VBCA 4NTZA 1U1DA 3MA0A 4B45A 3NPMA 4HC4A 2NSDA 3VTAA 4BBAA 3SJBA 3CQ9A 2C2XA 1M75A 3HJCA 2NNWB 3IQEA 3KZ1E 1XEXA 1PS8A 3LGXA 4KXQA 4LC0A 4CLOA 3ABQB 3ZWXA 4G6ZA 4DCJA 3HP7A 4F1JA 3UYLA 4U02A 3OJXA 4B4KA 2ZUTA 4DLLA 1LBHA 3O4IA 3C14C 2FI1A 4UAVA 1W5TA 3PC7A 2RONA 1WW3A 3LXXA 4FHDA 3URMA 4D9MA 1QXSA 5KNDH 3WRYA 4G5GA 2HU2A 3EXHA 3V4FA 4YJGA 5BOSB 4J7CA 2OFPA 3PF9A 1MRZA 1WZEA 4DA6A 4ZODA 2Y1FA 2W6PA 4AROA 1I1OA 3GDGA 1RHRA 4EMTA 3N5KA 1OPRA 2PU7A 3R09A 3TVYA 3C4JA 4ZHQB 1Q83A 1MT0A 2PJZA 3EOBI 3MOIA 2I66A 2VK2A 1FNBA 1MENA 1TCUA 2C0QA 3FCCA 4X6YA 3SJUA 4CODB 4BRWA 3ER6A 2Z6AA 3IVRA 1KJIA 3PGXA 4UNIA 4COKA 2D1TA 1CUXA 1ZMTA 5U4XA 2G4LA 3DKIA 1OXMA 2DX7A 2HR1A 1OXBB 3E9ZA 1VIYA 3QG5A 4OB7A 2XOKD 4WE3A 4NCIA 3QE9Y 3EW7A 3W8DA 1PFYA 2PGLA 2XT0A 3DJYA 3HNRA 3SU8A 2JGNA 2ZLBA 4IGAA 2E3JA 5C3UA 3AM1A 2CDAA 1Z2DA 4R40A 3HCFA 1CE8A 5TY0A 4P8RA 3ZIUA 1IXSB 4OBBA 5TXGA 2PSFA 2R85A 3E2IA 3ZQ6A 4E7OA 4IBOA 1TTQB 5FI5A 2GH1A 4W6QA 2SCUA 1N8SA 3T9CA 1NUPA 2PRZA 4D9BA 1CCWA 4GXRA 3INRA 2XDWA 3OZGA 1JKJA 2OORC 1JKIA 2PX0A 4HDOB 1VGQA 3WGHA 1E64A 3UBTA 4UTNA 1DAKA 4EKIA 1KMHB 2Z6UA 1DHRA 1GG2A 3KP1A 3P9QA 4KYTA 4EYKA 4RH3A 3OQOA 3DOFA 1EJ2A 1U5CA 4BNKA 2XADA 1G7TA 3CZPA 3LLCA 4KLCA 3LLUA 3MM4A 1Z75A 4W99A 1UFQA 3QWFA 4NARA 4Y67A 5A9TA 1LSSA 1JXAA 4GLOA 4HJRA 4IFTA 3AINA 4KAAA 1RRGA 3VHXA 1YHNA 3AIOA 3B1JA 4JLSA 1S1CA 5ECDA 4ZCRA 4S05A 1B2LA 4PZZA 2HPHA 4Y1GA 4J6FA 3EVCA 4UTPA 5AVYA 5JAMA 1Y6GA 1I4WA 2W9XA 5AKYA 1J39A 1Y1TA 2ZWVA 1G5TA 2V4ZA 3WIOA 1E5VA 9ATCA 3ONFA 1APBA 3JQGB 4TWZA 5LZ7A 1THTA 1WKCA 1Y8QB 3EBPA 5FR1A 3TFQA 1P45A 3EAQA 1V96A 1CY6A 1JHPA 3QI2A 2X77A 3RS4A 4PS0A 2VSOA 3TSWA 5KJFA 1N77A 5DCUA 3LY9A 3RQSA 2VSNA 4I4TA 2C07A 1PAUA 4Y2HA 4PX9A 5IZCC 2Y1DA 5DCWA 2C2MA 2IUSA 4M8NE 4CLXA 4Y2UA 3X0DA 4FILA 5CDFE 1UK9A 3WYBA 2RARA 3IKVA 1AT1A 1KI6B 1JZQA 2DSNA 2AQKA 2LGJA 1W8IA 2JK0A 5DIFA 3V5NA 2XNJA 3WL7A 1MZVA 4OHFA 1F6BA 3G0BA 4LVUA 3DMTA 3AUAA 2Y27A 4AJ1A 3ONDA 3AESA 4HRXA 3F74A 4CV0A 4WACA 1B3RA 1BXGA 3QLUC 1YR3A 3HZHA 4LRUA 2H31A 3E4DA 1KFEB 3UJCA 3R3WA 1ZVJA 3WSWA 3LM8A 4X90A 3TNYA 1GPWB 5G40A 2POQX 3CF6R 5DBGA 4F9TA 1QR6A 2X1VA 1E0DA 2EGUA 1C3JA 4INJA 3FCXA 2NO7A 2CY0A 4I1IA 5EMLA 3O8RA 3U3JA 1MC5A 2QOEA 1JFFB 1RFLA 2X7XA 1GNVA 3L92A 4L73A 1KVRA 4D4HA 5KNCH 1DUSA 1LW7A 2QL9A 5BSTA 3NDJA 4ENPA 3QY0A 1QP4A 2PTGA 3KTOA 3SEFA 2QYHA 3K6RA 3JSAA 2RB5A 3WMGA 3TLMA 1MJGA 2ZW9A 4DEYA 1I2BA 4MROA 5H68A 5H82A 2W2OA 1OXTA 2FN9A 3BX1A 2PLRA 4Q3EA 2Q21A 1M54A 1PVOA 2G67A 5FXMA 3VR0A 1KJQA 4RLSA 4D92A 5EJ5A 4C0KA 2IUTA 3QEBZ 5IYZA 3K53A 5KVCA 2IY8A 2WQZA 1R6AA 3DF7A 4PG4A 1PFVA 3AJAA 3K0BA 1DQSA 1L4UA 2BGUA 1GCAA 3EUFA 4B40A 1U0HC 4GAEA 4JB2A 3ZHVA 5J47A 4LKOA 3ZLTA 2ZKLA 3A1UA 1KXJA 3MRTA 3TLXA 4NE9A 1M76A 2WT9A 3O90A 1AU9A 1T35A 1P9NA 2PT5A 4JBHA 2MINA 3O8NA 4UTZA 1QOZA 2K7ZA 4LVNA 3X2SA 5A7FA 3OH8A 1KWKA 5KWJA 4D57A 2RKOA 3OEYA 1OFGA 4JR1A 4HPXB 3F6SA 5CBKA 4FONA 2XNDA 2WJPA 2Y8EA 1LV7A 1J8VA 1NJ5A 1MAVA 4AMBA 1RBQA 3E4CA 1RJ9A 2R65A 4B33A 1NNUA 1JEEA 1Y80A 5T57A 4MW7A 5AVWA 2PX2A 1T5SA 2GVDC 5LQAA 1IBLB 1RVV1 2FOIA 3Q9LA 2JIQA 3C85A 4D41A 5I3ZA 5IABA 2WSYB 3C6ZA 1U7DA 3HACA 3M4NA 2VEOA 3DBIA 5MN6A 2P5TB 4UM9D 5JRZA 1CDZA 3J81A 4TLBA 2ZCJA 4QYTA 4PAOA 4HR7A 3TRJA 2ZULA 5A4DA 5AKXA 1RHQA 1RAIA 2BEUB 4K9MA 4ZEOA 3D2BA 2WUEA 3AHCA 2V5UA 3EK2A 2BFFB 3FYCA 3I2YX 4O4IA 1MN6A 2AG6A 2JZNA 3E8SA 3FM9A 5BW6B 5KYVA 3W4JA 1X8XA 4JHLA 1N5DA 1P0CA 1PX0A 5FOQA 5LU9A 3FCSB 4YEDA 5I9LA 4EQ6B 3BRCA 3BILA 4ITUA 2A2ZA 5A9RA 2C83A 2MSLA 4PF1A 1OT5A 3LSYA 4FE3A 2HQSA 5CLJA 1PBNA 1RWPA 2NQ2C 3H5NA 4D81A 1Y1RA 2O8BA 2DULA 4RU1A 3RS5A 3JWEA 3FPJA 4G36A 4PQYA 4UUQA 1A50B 1CNMA 3A2NA 2I3DA 4Q4HA 2C9OA 4DBLC 2D62A 3UMVA 1VECA 1YVDA 1VLJA 3OOJA 1MHPA 4QDXA 3EXIA 1SXPA 1J9ZA 4AG6A 5FBWB 1UBSB 1M2HA 2ZRKA 3OQJA 1GVHA 1E5LA 1MA0A 2O2HA 3OOHA 2A9RA 4NQZA 4NWIA 3GG9A 4JC4A 2XYRA 1BTOA 1OLOA 4FE4A 4CTKA 5DBFA 4FUQA 3A4TA 3MT8A 1VKOA 5JECA 5K4GA 4BFYA 1A9XA 1RJWA 4WCFA 4I46A 1ZVKA 2PMCA 3MB5A 4N18A 4LZZA 2IYAA 3AUKA 5JWHA 1CJUC 3A04A 3EVEA 2VC2B 1SCDA 1NL3A 3DKVA 4DLKA 1S3SA 1IJFA 1V3TA 3ORYA 3HGMA 4CMHA 1E2UA 1KGDA 1NLMA 1P7ZA 2FLVA 2G1UA 4KBYA 3T4UA 3EC2A 2ATXA 3HCCA 5AOAA 2JVKA 3GRCA 4LQCA 1ORTA 1RYNA 4KLAA 3AVQA 2J07A 3RQIA 3TKLA 1NMXA 5FTLA 4GP9A 4KNVA 1A9SA 1L8QA 4URFA 3N2LA 5KTTA 1ISHA 3U7QB 3NLLA 3WKBA 5ED0A 1FMLA 3KBBA 4IDQA 5BO5A 3U09A 4Y2GA 1T9DA 4TTPA 1GPBA 5ALWA 3JAKB 3AR8A 3RRBA 3Q7EA 3STVA 3WWOA 4BMYA 4CL2A 1C9YA 4BKUA