4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase B
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
4UBJA 5HKAA 4BVKA 1AZWA 5E4TA 3ZLUA 3ESAA 4Q1VA 5FLKA 3HLKA 3I28A 1YB6A 2OCLA 1QTIA 3O4IA 1ZI6A 3OOSA 5EHNA 3ESCA 2BGNA 4ZRDA 3H2KA 1WB4A 4EA6A 3A70A 4L72A 1E66A 3QMWA 2PSJA 5EGNA 3SX4A 4B9EA 5ALFA 4PO3X 3WQHA 4FFVA 1BE0A 2GZSA 3H0CA 3JYHA 5FKJA 3BF8A 1U65A 2GBFA 1BU8A 5K3FA 1XZEA 1CQZA 1THGA 5DTIA 4L3WA 3FAKA 4BZZA 5AM0A 3ESDA 5C8ZA 4FFWA 1DX4A 1UT6A 1UK8A 2PBLA 4J0KA 2BGRA 1LBTA 1XZLA 4Y2PA 4PW0A 1Q0ZA 2EDAA 2EEPA 2VTVA 3PI6A 1Q83A 4Y2JA 5FPQA 3I2IA 3FSGD 1M33A 1QIKA 5LYYA 5HFAA 2RIPA 3H2HA 3EBLA 3RKSA 4OPMA 4HXEB 1QZ3A 4UBKA 3S2ZA 3K6KA 4IH1A 1CUAA 1AQLA 1VJ5A 1JJFA 1BN6A 3O4GA 4GW3A 2XQJA 3QYJA 1GT6A 3AUKA 1EH5A 4F0JA 1ZD5A 2VJBA 4MJ3A 3E0XA 4OSEA 4PSUA 1C7IA 1CUBA 3FNBA 4C6HA 1WOMA 2BUBA 3I6ZA 4JEIA 3AILA 1MO2A 4BE9A 5JARA 5ALIA 1XQVA 4UHDA 4B9AA 1CUXA 4BB0A 5CW2A 2WFLB 5JADA 1XZDA 2XB6A 2ZJ7A 3WK8A 3SWWA 2WIJA 1HKHA 5JYCA 1IMJA 2Y6VA 1UOOA 1LLFA 3F8SA 4BTVA 1C4XA 5FOQA 1H23A 1YA4A 3ZLTA 1JU4A 3WWOA 1N5MA 2R11A 1TQHA 4IHAA 1LGYA 3OTQA 3FBWA 1MX5A 1P0IA 3V1LA 3H04A 3ZWQA 2RHWA 5ALGA 2OG1A 5LKRA 4IH9A 2C5GA 2WG2A 6YASA 4XVCA 3WKDA 4U2DA 3B12A 5IVDA 3F67A 1ZI8A 5HF5A 1ORVA 3O4HA 1EX9A 4BBZA 5JALA 3QZUA 4NS4A 1VKHA 2RAUA 2DR0A 4F60A 2XQIA 3DEAA 2BCEA 1TRHA 1Y7IA 1MTZA 1GPNA 1AUOA 5DNUA 5JAOA 3B3QA 1OCEA 4BP9A 3TEJA 2Y2UA 1ACJA 5KWJA 5DNWA 1ACLA 2Z3ZA 1EB8A 1XZBA 1XRPA 2J3QA 3DKRA 4B81A 2XMBA 3GFFA 5AOCA 5AM3A 4QZVA 3O9MA 3P2MA 3FYUA 4KRYA 5AM4A 4LXIA 2O7VA 2PVSA 5YASA 3I6MA 4Y2XA 5CH3A 5K3AA 4UFOA 4C01A 4MQLA 2B61A 2O7RA 1DWQA 2WFMA 1QGED 1UOQA 1ZIXA 1X70A 4X6XA 1XROA 1QIJA 4OD0A 3WMRA 3ANTA 3O4JA 4KACA 1EA5A 4UHEA 5AK5A 2I03A 3D3NA 5AKKA 4ZXFA 3I2KA 3D7RA 4PF1A 1EINA 3VDXA 4EY5A 1RYYA 3WL6A 4W9RA 3SK0A 2XUPA 5ALRA 1JMYA 2CB9A 4OYYA 5JASA 4RGYA 3AZQA 1K63A 1WB5A 1QIEA 3FWHA 4AZ3A 1EK2A 1XFDA 5LIPA 3DYIA 1UOPA 3DL7A 1YCDA 1XKTA 3ILSA 1H2WA 2PKYX 1LBSA 3OPMA 1ZI9A 1HPLA 3G0GA 3TRDA 1CUIA 4CCYB 3N2ZB 1J2EA 2XLBA 5AI6A 5EIEA 2Y1KA 4QDUA 1BROA 2OXEA 2WILA 2LIPA 4P92A 4CG2A 4IQ4A 1AKNA 1XRQA 2PM8A 2WHPB 3W06A 1XZCA 2RHTA 2QUBA 5AP9A 5FP0A 2PUHA 1L7RA 4DSAA 1W52X 1SCKA 3AFIA 2CJPA 5IVKA 4YASA 4ZREA 1MNAA 2VA9A 1JI3A 1D07A 3D2CA 1VE6A 2DQYA 2W22A 2ORYA 4AMZA 3TGLA 5ALOA 3QBJA 4CG3A 5EFZA 4FNMA 3FOBA 4PNZA 5DJ5A 4N8SA 1CVLA 2G5TA 5LZ5A 3UMJA 1WPRA 4DMFA 5ESRA 1XRNA 2XUHA 3WA6A 2VJAA 2Q0XA 4ZWNA 5AKLA 2WTNA 3H1BA 1EB9A 3M83A 1A8QA 2WJ4A 1VZ3A 3GZJA 3X3HA 3PFBA 1XZHA 2DQZA 2H7CA 4U2FA 1BRTA 2HA2A 5K3FB 4Q3OA 1Q0RA 4BC1A 1ZGCA 2XQGA 5ALKA 4Q82A 1MU0A 3Q8WA 2WUFA 3STYA 3W9BA 3U1TA 1G42A 2PU7A 4FKBA 4LXGA 4AO8A 4DMCA 1BCSA 1R9NA 3KSRA 5FV4A 4X92A 4EBBA 1A8SA 3DL4A 4OB6A 3FLBA 1DT5A 3DOIA 3GA7A 3V1NA 4ITVA 5EHXA 2ZYSA 1ISPA 1KU0A 4UBMA 2VATA 1AC5A 2ZYHA 4IO0A 4BDSA 3R41A 3WI7A 3A2LA 3V1KA 1XZFA 3ZI7A 2J4CA 3STVA 3LP5A 1YAJA 1VXOA 1J06A 4AO6A 3IDAA 3O9VA 1CUZA 5AH0A 4U2CA 1FFCA 2WG0A 1KU6A 3BJMA 2XDWA 5HZGA 3CN7A 3D2BA 2BJHA 3LIIA 3RLIA 5CT4A 1EI9A 3WLAA 5HFNA 4CCYA 2X5XA 5LKAA 3G9ZA 1VZ2A 1K6EA 1YS2X 5D7BA 3WK6A 2BFNA 3T4UA 4BCBA 3R0VA 2CKMA 5I8PA 1TKRA 5ALEA 2HHAA 3O95A 1JJBA 3C5VA 1CUCA 2ZJ6A 4BATA 2X76A 4ROTA 3BF7A 4QDXA 3I6YA 2QXUA 2XUIA 3VJMA 4B83A 5DLPA 4G8CA 1R88A 5HK9A 3MGAA 4QWWA 4B80A 1AURA 4M0FA 4B85A 2C4HA 2DHDA 1OXMA 3IUNA 3A2MA 1YB7A 2ACKA 1Y7HA 2CUTA 5HF9A 3IUQA 1ZD2P 1P0QA 1UKBA 3H17A 4N8DA 1CUVA 2V97A 2QZPA 5JZ9A 3CXUA 4QDTA 4UBOA 5EIHA 4CG1A 3BXPA 4NZZA 4C89A 3T52A 3GROA 1N8SA 2I78A 1W76A 1QIIA 2WSLA 4WY8A 5EHQA 3H2JA 3E3AA 1WPXA 2HA0A 3G0BA 5FRDA 5ALUA 4RPCA 1CUGA 1EK1A 4QWMA 4FOLA 4MQMA 4Z49A 4WY5A 5AJHA 4LYDA 2PL5A 4H18A 2OCGA 3KWFA 1YA8A 3F97A 3WL7A 5HF6A 4J0GA 4UHHA 2AJ8A 1QIGA 1CIJA 2ACEA 3CN9A 3SC2A 2O2IA 5AM2A 3MUNA 1ORWA 2H1IA 2H9YA 5A2GA 3FYTA 2P8SA 2HA7A 1F0NA 4G9GA 4C4YA 5JIBA 3WK4A 1QIFA 3L1HA 2PUJA 1MT3A 3VJLA 1EDBA 5CRIA 2C5FA 1UKCA 1YSCA 1QE3A 3GELA 1PJAA 1SC9A 5JAHA 3FYUB 5DWDA 5ALYA 3PDCA 4H7DA 1RP1A 5AM5A 4LKOA 3MUOA 5I7UA 1VLQA 4UHFA 3KWJA 2ZJFA 3H1AA 4KAFA 5AKXA 1UK9A 4X93A 2XMQA 4UFPA 5CURA 1UK6A 3DS8A 3W05A 4KAJA 3BDIA 4G1FA 3WK5A 4QLOA 3WZMA 3WKAA 4Q34A 4K6KA 1P0PA 2XUGA 4Q3LA 3C8HA 1A8UA 3G0CA 4OU4A 1BCRA 3C43A 2GYWA 2XI4A 2W6CX 2QMQA 4DNPA 4HVTA 4GI1A 2HM7A 3STUA 3LLCA 1LPOA 3OG9A 2AJCA 3AINA 5LLSA 4GXNA 2DHCA 4FTWA 2HA4A 4G8DA 1E3QA 1PFQA 3G7NA 5EIAA 2G4LA 4PSDA 2GZRA 5ALSA 5SYNA 1O6FA 2Y2VA 2VT7A 2QRUA 4WFJA 1LZLA 1XZJA 1W1IA 4U2EA 4MWSA 4H7KA 1UXOA 3PF8A 5ALVA 3HZOA 3R3ZA 1CUHA 4JH0A 1TIBA 2WIFA 4BZWA 3HACA 4CI9A 4X97A 2OGTA 1CUDA 4LIPD 3AZOA 3GUUA 2CEKA 5ALHA 2ECFA 4JNCA 2PSEA 4W1QA 1TCBA 3M82A 1SFRA 4FLMA 4KYVA 5ALJA 1TAHA 2WLSA 1H2XA 5AK3A 2I3DA 1CUSA 5AKIA 1IUPA 3ICWA 5LZ9A 2JGJA 2EDCA 4ETWA 4AQDA 4PQEA 4UPDA 4YK7A 2B20A 1H2YA 4HS9A 2QJRA 5AKYA 4AXBA 2AXEA 3EIOA 2ZYRA 4CIBA 3V48A 2WJ3A 4Y7DA 1TK3A 3FCXA 3TJMA 2Z3WA 2BUCA 2B4KA 1LPPA 1MX9A 1XZAA 3D4LA 3DDUA 4INZA 1ZJ5A 2JBWA 4DNOA 2QVBA 2XMZA 1G66A 2VAXA 1UZAA 4GHWA 4GWLA 1GPLA 1U2EA 3G9XA 3BIXA 1H2ZA 5A7HA 2H7XA 2PSFA 1DU4A 3JWEA 2QS9A 2XUFA 2GYVA 3FYUC 2CZQA 1WM1A 3IUJA 4FNGA 3QH4A 4WFIA 4AO7A 4KR0A 2JGLA 2JGMA 2HRRA 1ZOIA 1HBJA 2ZVDA 4Y9SA 3UUFA 5KWIA 2WJ6A 5AI9A 4MXDA 2OQVA 1DTEA 3DJYA 4GLBA 1GKLA 1FJ2A 3R3XA 4X95A 3KOOA 3B5EA 2XMSA 3C6BA 3FLEA 4AZ0A 2HDWA 2BAGA 4BAZA 5C7YA 4DLNA 3OC0A 4DM7A 4CCWA 3DQZA 5LP1A 5ALPA 3BJRA 3NOXA 3NGMA 1BEZA 1XLUA 1A7UA 1JU3A 4OCZA 4X85A 3QMVA 5IVIA 3I1IA 4J0JA 3HJUA 4C4ZA 2WUDA 1TCCA 3HABA 2BKLA 5EI5A 4H7JA 1GPKA 1QONA 1K5PA 3BIWA 3G9TA 2J3DA 1H22A 2JGIA 1UK7A 2VJDA 1A88A 5E4JA 3A6ZA 5AOAA 1VA4A 3JW8A 1O6GA 1QO9A 5K3CA 5FDFA 2VQ6A 4P93A 3F96A 4EB0A 5LZ8A 1SCQA 5A62A 3U0VA 2QOEA 2RI6A 4Y2SA 4Q3KA 1ZICA 4E11A 2C0PA 3I2HA 3YASA 2PPLA 3EQ7A 4B82A 2OAEA 4Y2TA 3HSSA 1NU6A 2AJLI 1BS9A 5DTJA 3H19A 4J7AA 4H7FA 4UBLA 3DLTA 3VVLA 4BCCA 5AI4A 1GQRA 3H18A 1QTRA 3STTA 2E3JA 2OAGA 1AGYA 2D5LA 4N8EA 4EY6A 4L0CA 2Z5GA 1DINA 1L7QA 3WWCA 3IURA 2WUEA 4E15A 5AKEA 3F98A 4K6GA 2V98A 3BE8A 1LZKA 2OCIA 3QITA 3M3DA 1CV2A 4K5QA 4H7EA 3O0DA 3Q0TA 4X6YA 4F21A 2HA5A 2WIDA 4XIIA 1WHTA 4IH4A 3WWDA 3I2FA 2X8BA 2ROQA 2I3ZA 4AN0A 1NX9A 4CIAA 3RARA 3W04A 3LCRA 1CUJA 1XLWA 5IH7A 3QMMA 2FX5A 4TVKA 3C6YA 3DD5A 4K2AA 2QR5A 5K3DA 1ODSA 5ALWA 5CT5A 2CMFA 4BC0A 3ESBA 4YPVA 1FFBA 3BDVA 4NMWA 4WFKA 1LPMA 4BVLA 5AICA 4DMKA 2QKYA 3AIMA 3C45A 1EDEA 4MEAA 4X94A 4P9NA 1E5TA 1XRLA 3HC7A 1CLEA 4B6GA 3VVMA 4GBGA 3FCYA 2XUDA 2WTMA 2OGZA 1FFDA 2GYUA 2WHRA 4MWTA 4UUQA 5JAUA 3OM8A 4X00A 4X6UA 4J0DA 4X3CA 3I1YA 5K5EA 5ALDA 1UKAA 1ZGBA 4RNCA 4Y2RA 3K9BA 3H2GA 2V96A 5DNVA 1LPSA 4ZV7A 1QOZA 4LYEA 2XUJA 1CR6A 1UFOA 1WHSA 4AB1A 2WIKA 5LZ4A 2WHQA 4ARBA 5IKXA 4JYPA 2UZ0A 5AO9A 3I2GA 5AI5A 1P0MA 3G02A 3WYNA 3PFCA 5E4YA 1UWCA 3DYVA 3WJ2A 1XLVA 5CH8A 3WZLA 4Q05A 4RE5A 1CEXA 4BAUA 1CPYA 1Q84A 5CH5A 5ALXA 3C8DA 4I19A 4U2GA 3E4DA 2YXPX 5JZBA 1R4ZA 1XQXA 2QM0A 4Y2YA 3LIPA 1MAAA 1GQSA 1T2NA 5J3JA 2G5PA 4HAIA 5D6OA 5JANA 2YASA 5JD6A 3BL8A 4BRSA 2GBGA 2VT6A 1E89A 1ODCA 3QPAA 2V9ZA 4W1RA 2JGKA 2OPHA 4LHEA 3ZV7A 1DT3A 5AM1A 1R3DA 3F9CA 3IULA 3AJAA 2HA3A 2DFPA 3PICA 4QA9A 1JMKC 1QIMA 2QJWA 4WJLA 3IB3A 4DNFA 4Y2UA 5ALMA 1KEZA 4EHBA 2DSNA 2HU7A 4I4CA 3VKFA 2XUQA 1E8NA 5JATA 3EF3A 4EY4A 3FSGA 2AJDA 1W4LA 5I9IA 1N1MA 1CUFA 3VJKA 1LPAB 1TCAA 4HXGA 4ARAA 1LPBB 4B7ZA 4P08A 1W6RA 4MYDA 4UHBA 4D9JA 2C58A 2RONA 4KE7A 1B6GA 2B9VA 3WYDA 1ZIYA 2WU4A 1IUNA 2VAVA 4G8BA 3PUIA 3ICVA 4RE6A 4C4XA 1GXSA 1FFEA 4EY8A 5KREA 1J07A 3AIOA 3PUHA 3QM1A 4ZGBA 1HLGA 3R3UA 4QLAA 3WL5A 4OU5A 1J1IA 4FBMA 1U8EA 1CUEA 4BE4A 3WKCA 1JJIA 4J0CA 1QJ4A 1SOMA 3FLAA 3IUMA 1CRLA 3I2JA 4MYSA 3R3YA 3IVMA 2WM2A 4DNQA 2GBIA 3V1MA 1N5RA 1B41A 4MEBA 4DYHA 4QE3A 1QIDA 2HU5A 3STWA 4A23A 4OB7A 4GECA 3DCNA 1YASA 2OLEA 4DGQA 3PF9A 2D0DA 4OB8A 4U2BA 1BEEA 5KBYA 4K6HA 5AKZA 2O2HA 2C7BA 4BAGA 5CXXA 5A6VA 1JFRA 3MVEA 4WCVA 2ONCA 3L1JA 4O08A 4W1SA 2JEZA 1CUWA 4TGLA 2QXTA 1AMNA 4X7BA 4FMPA 2WG1A 4BTLA 5DYWA 4DSZA 2XUKA 3BWXA 5EHZA 1IUOA 1MX1A 3RK4A 4J0IA 4B0PA 2Y6UA 4NVRA 1IZ7A 1EDDA 3D59A 4DMHA 1YAHA 5C81A 5BV7A 4LXHA 1GZ7A 3WWEA 4V2IA 1JT2A 3KDAA 4N5HX 5AOBA 4A16A 1YR2A 2XUOA 1VE7A 4BRZA 3D2AA 4GDMA 4C88A 2VSQA 5HQ3A 5AHXA 2PU5A 1L7AA 2XT0A 3WA7A 1LPNA 4JUIA 5CT6A 1G5FA 3QPCA 4W63A 1G4HA 1XRRA 2JEYA 1SCIA 7YASA 5A71A 1MNQA 5LZ7A 1DWOA 4L9AA 4EZIA 4G4IA 1XKLA 2WKWA 2QUAA 1VOTA 3WK9A 4H35A 3M81A 5AI8A 2BUAA 3WKBA 1QFSA 1GGVA 4M0EA 1XZMA 1NU8A 5JD5A 5IVHA 1ZD4A 4G4JA 4TPKA 3WL8A 1DX6A 3E1GA 4FBLA 4OUKX 4WDQA 4E46A 5T4EA 4BYMA 5C8VA 3AZPA 4UBIA 1F8UA 5AIBA 1ZJ4A 4OYLA 4HZGA 3ZPXA 2JGEA 2IITA 4X90A 3DKKA 5C8XA 2Z8ZA 2PX6A 3L1IA 5AK6A 1XZKA 2XE4A 4X91A 1EHYA 2ZSHA 1CUUA 3G0DA 2ES4A 4C87A 3VXKA 1EVQA 5ALNA 5T4HA 1Z68A 5ALZA 4HXFB 5T4BA 3ED1A 3HI4A 1K4YA 4G5XA 4G9EA 3C70A 1WCYA 3LS2A 4WDRA 1I6WA 1DQYA 4XWGA 1X2BA 2HIHA 3HXKA 1XZGA 5AK4A 4KE8A 4BVJA 1PV1A 3C87A 1FSSA 5DYTA 5H3HA 4ZV9A 2JGFA 1R1DA 5F4ZA 2FJPA 2WU3A 2WFZA 4S0XA 2DCMA 2Z8XA 2HA6A 5FXMA 4G4GA 4AMYA 1ODTC 4KAAA 4H7IA 2IX9A 1R50A 4QEKA 1HL7A 1W75A 5FUMA 3WIBA 2OCKA 4XX1A 4I3FA 1C7JA 1EXWA 3NUZA 1IVYA 2HU8A 2HRQA 3D0KA 2H7YA 1QFMA 3DNMA 3WJ1A 2R8BA 4KE6A 2WFLA 3CCBA 3ANSA 1K8QA 5HF8A 1OILA 1EVEA 4XJVA 2AJBA 2OGSA 2HFKA 1HQDA 1XRMA 2YH2A 4PV7A 1XZIA 4PSCA 4FWBA 1U4NA 4QDZA 4BP8A 3QPDA 2G63A 4FHZA 3S8YA 3C6ZA 4FLEA 4J3JA 3UUEA 4KEAA 3R3VA 4B0OA 2C0QA 3EQ9A 2J4FA 2XMRA 3R3WA 5D3KA 3HEAA 1WB6A 2WQZA 5AKJA 4ZI5A 1X2EA 1CUYA 4BDTA 4UFNA 5JAPA 5CT9A 1QO7A 3WIOA 1Y37A 1XQWA 1THTA 2CBGA 5CBKA 3A2NA 5CT8A 1QLWA 4DIUA 5ISMA 4H7HA 3STXA 4CFSA 2XMDA 3KXPA 2HADA 1DQZA 1LNSA 4J0HA 3K2IA 2XUAA 5FPPA 1CQWA 4BCDA 4QDOA 1T4MA 3C6XA 5LZ2A 3N0TA 5SYMA 5JD4A 4KJXA 1S8OA 2XQKA 2PSDA 2JF0A 2DHEA 2ZSIA 1MPXA 3DOHA 4E14A 4N5IX 5AKGA 3W2TA 4EY7A 4AX4A 1MJ5A 3G0IA 3CCCA 1GKKA 2VEOA 4HRYA 4HTAA 1F6WA 2GBCA 5CTAA 1ETHA 4AN1A 1QIHA 3WKEA 1DWPA 3IIIA 5A7FA 4FLFA 2OQIA 3D5EA 4Y2QA 5ALQA 5ALTA 4M0MA 4EUSA 1VXRA 5HK8A 2XMGA 5AKHA 4YX9A 3VISA 1E8DA 2NW6A 2FUKA 4F5ZA 2O2GA 3G9UA 4JYMA 5K3BA 1IZ8A 4A5SA 2K2QB 5ALLA 5CXUA 3NWOA 3C5WP 1FFAA 2ZYIA 1F0PA 4FDMA 1RWQA 2XMCA 4H77A 4QNNA 4Y2VA 2QTBA 5HKBA 4DTCA 1E8MA 1USWA 4KRXA 2VF2A 2FJ0A 1ZD3A 3RM3A 2YYSA 4UHCA 3IBTA 4J03A 3V9AA 1MN6A 3H2IA 5BOVA 3GBSA 1JKMA 1R9MA 2IIVA 2WUGA 3EQ8A 5AI0A 1XQYA 3KD2A 1MAHA 2XQFA 3HYSA 2HFJA 1VA5A 4GEGA 1YS1X 3PE6A 3WWPA 3IA2A 2WHPA 3WK7A 5AIAA 2XLCA 3FVRA 3QVMA 5BWBA 3HRHA 5DYYA 4H0CA 3R40A 4X71A 4W1PA 2HL6A 1HDEA 5JZSA 2VJCA 3ZLVA 4UBNA 3G8YA 3AIKA 5K3EA 3OURA 2RGUA 5T4FA 4KE9A 5E2IA 2JIDA 2WIGA 5A7GA 5HCUA 4HRXA 1CFJA 1BN7A 5CMLA 5HQ3B 3FVTA 5BWCA 3W9UA 2PSHA 1AX9A 4B84A 5D3ZA 2QT9A
chains in the Genus database with same CATH superfamily
5G41A 1GCIA 1LJUA 2IVZA 3M3HA 4R69A 1ZD8A 3RVDA 4EW3A 2ZQZA 4FOOA 3SLKA 1AZWA 2ZB8A 3BMNA 3COPA 4J4TA 1KL7A 4ZEVA 3ESAA 3CEMA 4OAQA 2HKIA 1FMFA 2H1LA 3U3MA 1J00A 1L4UA 1XPOA 1YB6A 2D74A 1DAIA 1RXVA 1QUFA 4OGFA 3MTQA 4KQ6A 1AGPA 1QGAA 2QRZA 4KJZA 1GTVA 3C3EA 5EVCA 4OFZA 3FDIA 1R2QA 1TMOA 2GN9A 2W98A 2YMQA 3EEYA 2BGNA 2OLJA 1KIMA 3FTCA 3IKJA 3LRPA 1EBBA 2HHJA 1OXKB 1RTTA 3HB7A 2FRXA 3JQAB 3R2JA 2VRWA 4EA6A 1Z0DA 2XHEA 3SNKA 1I5OA 2PSJA 2JIMA 2V5VA 4JCOA 3SX4A 4L2IA 3WQHA 1KPHA 4MVJG 2APJA 4Q1CA 5IJZA 3EOZA 2BTQB 1PJBA 4L4SA 4F5DA 1RJFA 3OOHA 2IYPA 1NE2A 1F2TB 2WAMA 3BF8A 3UC5A 3JWJA 4IHJB 1RM4A 1BU8A 1VGVA 3EIQA 2CVPA 5DPMA 1Z2EA 1FZQA 4G25A 4E32A 4X3PA 4ZN6A 4C5BA 5BN1A 4WJZA 4L3WA 1FB5A 2VQDA 1A95A 3FFTA 4QTYA 1MC8A 1T3TA 2FPUA 3ORSA 1C8KA 1DAOA 1MFZA 4F2DA 4LDAA 4HB3A 3INGA 1JV2B 1E77A 2A92A 2CL5A 2Z58A 3HU1A 2F4VB 2PRJA 1MVNA 2R7KA 1MGPA 4XD2A 2FOXA 2AMYA 3BMXA 2QLBA 2GESA 4LCEA 1QU3A 3DG9A 3M8KA 1OF1A 1NPDA 2ZJOA 2JFXA 3CINA 4FFWA 4MNTA 3R9KA 4OHVA 3RBXA 2PBLA 3HB0A 3EEOA 3GJSA 4TT3D 3LDAA 4A5OA 2HUPA 4DG8A 3U4QB 3B52X 2QPLA 3PVCA 3UV6A 5BV8A 3IT2A 4NDZA 4Y2PA 3IAXA 4ALLA 1IZYA 2C03A 1U2TA 3LGSA 4PW0A 3S1AA 2AOVA 2EDAA 1DIAA 1Y7LA 5LOVB 2EEPA 3QW4B 2ZR7A 3PI6A 1CY6A 3ADOA 5BQPA 3GLGE 1O4VA 3DF7A 3FNIA 2GJ9A 3NBAA 3BWEA 3SI7A 4A3SA 4DQLA 4EFDA 1T1IA 1QE5A 5HFAA 2RIPA 5B7GA 3D64A 1XU7A 4UTXA 2RGXA 2XXJA 2JA2A 5AOVA 1I10A 4ZZIA 3OZVA 3QIVA 2OORC 1QZ3A 3PD1A 4BJHB 3MWFA 2XTJA 1IEWA 3FDZA 2H9IA 3CLUC 1S6YA 3H1TA 3KHKA 3PJDA 4KPUA 4IH1A 1AQLA 1W88A 1JJFA 1A5ZA 2MU1A 2PRKA 4O4HA 3S7TA 3TS1A 3B5JA 4LF5B 2H17A 3QA3E 4RTNA 4MPRA 4QBFA 3I5AA 4CQMB 5FL7A 4CEHA 2HNAA 5C4MA 4KMSA 1PJRA 2ZROA 2AUNA 5CNJA 3J81A 2QU7A 1PEKE 1M1YB 1EH5A 5F9MA 1KVRA 3CPEA 1OFGA 2A86A 1ZD5A 2GCPA 3FHLA 3L79A 4F0JA 4C7OB 2VJBA 1CR2A 3DCYA 5K0TA 3URMA 5TQJA 3G8DA 4ML3A 2ZR9A 1N2IA 3HVKA 2GEKA 1XOIA 1LX6A 4IUCS 5LYJB 4DWWA 4HMPA 2A0YA 4CI0B 1HOXA 3WMFA 2Y76A 4GFDA 1C7IA 1CUBA 4BMPB 4MYCA 4CKZA 1WDKA 2VS1A 1V43A 4JJ7A 2A5LA 1EHCA 3DTVA 5EY5B 2FMKA 2XCIA 2JCYA 3ADPA 4ZO9A 2X6TA 4IJQA 3ET5A 3TEMA 1HXHA 3FF1A 2VJPA 3OE1A 5I9MA 3WGUA 2G67A 1E5DA 1G5IA 4ZALA 1H6DA 1T25A 1H9CA 2VP5A 1W0CA 2E5LB 4MRMA 3ZDDA 4K3VA 3AILA 2VYND 3LPAA 3QNUA 4Y7CA 1CJSA 2AZTA 4KWHA 2V3WA 3I0ZA 2D2XA 4XDZA 1XD2B 1N5IA 2CDRA 3EEQA 3TO5A 3LBHA 4PX5A 3AH8A 1T91A 5ICFA 2BM9A 1IIBA 3JARB 1E0KA 1XQVA 2GOYA 3KHUA 4GSLA 5EG5A 2DERA 1WU8A 2XEXA 1VLHA 2NAFA 1CULC 3MB8A 4C7KA 1HYEA 2ATCA 3O21A 1N0VC 2N3ZA 2IXEA 3IB6A 1V2HE 1TF5A 2G6BA 5DKFA 3L7NA 2I8LA 4GH5A 4LHZA 3BG5A 3QJ5A 2NTYC 4EENA 4F9EA 3R7WB 3R8CA 2O1WA 4N6GA 2WFLB 4B09A 3H9JA 2ADOA 4FZVA 2SKCA 5J2TF 1WMEA 1TGVA 3BXXA 3CV3A 2EG9A 1SAYA 1T8WA 1E0JA 2WIJA 3NV7A 5MHTA 2VC2B 3AHEA 4DDTA 4QODA 3A9VA 1LTKA 1FTSA 2QUHA 4MYRA 1TCVA 4RIIA 1I24A 5JYCA 2FZVA 5HM6A 3EUFA 4CLOB 2JHPA 2AEFA 3K1AA 3LUFA 4I55A 5AW5A 4WBNB 3I9OA 4BN5A 2HXYA 4NPAA 4Q4LA 1DTSA 4HSEA 3FYSA 2O0HA 4I9NA 1KO8A 4PTYA 3RASA 4E7OA 3IDQA 3OUUA 3GFGA 2MIIA 4MQ5A 4LY9A 1D2NA 1NY6A 1ZUWA 4MWOA 4WXEA 4BFWA 4BTVA 4EJSC 4UE6A 3Q7IA 5CFPA 1KERA 3DKVA 1D6SA 1H23A 4FC7A 3E3MA 4UXIA 4KDEA 3CY6A 1ZN2A 3T7DA 4A1OA 4FFBB 5IM4F 1KARA 3WWOA 4Y6PA 1DJOA 1I4LD 2I4LA 5E3IA 1DQPA 4QGAA 4LHYA 1OWOA 2R62A 4ALKA 5FI5A 1VIYA 2OM6A 2WIAA 4GMXA 3W5DA 1P9WA 1TQ4A 3L02A 1JLHA 5IYZA 2CMKA 1KWKA 1NW7A 3TDMA 2P2DA 1TQHA 2FOIA 1GU7A 2C84A 3OFSA 1FBNA 5BQOA 3IT1A 1K92A 3UZUA 2PKQP 4EG5A 5DBFA 5KDDA 3DF9A 3E7PA 3HY4A 3VPCA 1QHIA 3CF2A 3JQAA 1MX5A 1VHQA 2IP2A 3LO8A 1P0IA 3KKEA 2BM1A 3R6LA 4JT2A 4OJYA 1O8BA 2G1KA 2QR2A 2WDPA 3I1JA 4TLEA 4YBZA 2AF4C 3ZWQA 4L4XA 1GSHA 5IM5A 5C7LO 4G26A 1WP4A 2BTQA 3OJLA 1SBIA 1N6HA 3PNMA 4YCDA 2FE1A 1F2TA 1KXZA 1GL9B 4ROSA 5LQCA 3BGIA 2ZZKA 5GV8A 3TUJC 4ZYZA 1K2VN 5BNIA 1BG6A 1VDMA 3ZJTA 1JPJA 4EEXA 4DBZA 2V7BA 1SUEA 1UF9A 5IVDA 5JRDS 4FEAA 2Q4DA 3SZGA 2JASA 5JY6A 2NACA 1ORVA 3O4HA 3QPVA 1EM6A 5HF5A 2P27A 3EVTA 3LPDA 1SUAA 2C57A 3FNGA 5JALA 2FSFA 3QZUA 2C2BA 4NS4A 2DR0A 3ADCA 4TROA 2XQIA 2HCRA 2VN8A 2MSEB 3Q6NA 4QGGA 2NVUB 4D2IA 1U2QA 3OOJA 2JGNA 1ISFA 2X0EA 4E2ZA 1AUOA 4DLWA 4ED9A 5DNUA 4R81A 3HDJA 3UNXA 1LNZA 2EFEB 5KC9A 3N76A 2H18A 3TEJA 1BMFA 2AN9A 2Y2UA 4RD0A 3W8NA 1SCDA 1M75A 5DNWA 5CAEB 1UFQA 4JMPA 5LMNB 2CJXA 2G9ZA 2R00C 2QRVB 4OHRA 1Q2XA 3MFQA 2A59A 4XLTA 3DKRA 1LVUA 1FLVA 1GV1A 2VCYA 2OXRA 3D3EA 4BNDB 3E5MA 2LIVA 2MSLA 2WWTA 3JALB 1UJNA 1IHXA 1TE2A 2WYOA 5IFLA 3OE7D 3L0IB 3P9PA 5GOZA 5AVVA 3KSUA 2O0JA 1FDOA 2R68A 3VU8A 4YRJA 1PGPA 1YB5A 4I5GA 2QNBA 2R84A 3FKJA 3NKFA 4C2AA 4OGWA 1IJKA 1SB9A 1GA4A 1VP3A 2UUOA 2NXJA 3LA8A 4LXTA 4DKJA 4BEWA 4EUEA 4F12A 5C0OE 3KT8A 2TECE 5IDYA 5K6TA 4GC9A 1E3TA 3PX7A 2WTXA 4PYNA 3T0IA 2G9RA 3VUFA 3VZSA 4CQMA 2IYQA 3QE9Y 3N0RA 1QMGA 5EESA 4X41A 3IE1A 5JS6A 1NURA 1QF7A 4ZVUA 1T6BY 1L8QA 1M1YA 2G83A 2W2MA 1GSOA 1R12A 2BZ0A 2FWJA 2PQMA 2WJWA 1E2PA 3C39A 4MQLA 4ZAXA 2FF5A 4IIVA 2J07A 2OA0A 3QGMA 4HZUB 4L02A 4I50A 3R1IA 5F5LA 1W25A 4EO4A 2YINC 4RGQA 2X7XA 2HT1A 3NMUF 1XD9A 3I8XA 4RZ3A 2I67A 4P0PB 2NX2A 3GGOA 3H16A 3G6WA 5TMEA 2PTGA 1P1HA 4ENWA 2ZUCA 1GKUB 5BN5B 3ZIAD 3ANTA 5LYJA 3O4JA 2D62A 1GCOA 4WQMA 2WLTA 2WWVD 4OM7A 4RTLA 2D4HA 4XEUA 1EA5A 1I3NA 4TKUA 4FP9A 2FR0A 4H0FA 4UHEA 5AK5A 2JFZA 1WDTA 4JJFA 5NULA 5LQSA 1I4TD 2GCOB 3QUAA 3R5SA 4DL9A 4F72A 2VBFA 4ZDKA 5H1YA 4DIBA 4RZXA 2FKNA 2QPAA 3LE8A 4JIMA 4OMCA 4IIGA 4LECA 1H1TA 5JNWA 4W9NC 3VDXA 2PMCA 1MFPA 5DH9A 4G0YA 4GR4A 4C6RA 4MS1A 4KITB 2VJKA 1FLDA 2Y8EA 4YJGB 1CYEA 1VLZA 5TLSA 1X13A 3JARA 5DHTA 2XUPA 1HYGA 5ALRA 3E5HA 1J22A 3OD5A 3L82B 2Z9CA 4OYYA 5JASA 4NBRA 1ZR2A 1WB5A 4R1TA 4K9LA 1W93A 3ZDFA 1QIEA 3UG6A 2RJ3A 2ZEJA 3RT7A 2Y1CA 5B12A 3M6VA 5A04A 2QBYA 3LECA 4JLMA 4BNXA 1YCDA 3JRXA 1TW2A 4INJA 3SYLA 3ROTA 3SLRA 1T9HA 4XW2A 4Q15A 1GVHA 3G6KA 4YECA 4NECA 3ADDA 3QE3A 2ASVA 4ZYYA 3MBOA 1AK9A 3EUEA 4IDOA 4BJ6A 2PUAA 4WBNA 4FOSA 3CLTD 4OFXA 3G0GA 2GASA 4Q7MB 1YQQA 5EINA 2DLDA 1C4KA 3RC3A 3WIDA 1OC2A 1RKUA 2FZEA 3AWDA 3TLZA 3ZR4B 3RRYA 3NWPA 1JLMA 1S02A 4EPWA 4YV0A 3TBHA 1N2EA 2PVPA 1BEUB 3ZHOA 1GZ5A 1MOPA 4G1MB 1W5BA 3UMFA 3USZA 1WKCA 5I9SA 6LDHA 2NSJA 4UASA 1ZC4A 2OBNA 2VFAA 2Y1KA 3LX5A 4TTJA 3P8ZA 1BROA 1D0IA 3A9RA 2B4QA 4CMGA 3ZCQA 4MDFA 4LDNA 2I4MA 2WTEA 3ONEA 4MDHA 2AGVA 4D82A 1YJ8A 5JW6A 4N48A 2Q0HA 1CLUA 1VL8A 2BM0A 4F84A 2BGGA 5F5NA 2WILA 1QK5A 2H57A 3BRQA 5EXPA 4GE3A 2BF4A 4CG2A 3MAAC 1PJSA 3I34X 4IQ4A 1Q6YA 5KU1A 1NMZA 3H8WA 1SB8A 1W2HA 2H6EA 4C1BA 4P3PA 4RTQA 2PM8A 2R5FA 3AEKB 1PX2A 4XGQA 4M8IA 2XNDD 5AVRA 1HORA 3FNQA 1XZCA 3P1JA 2IOQA 3RVRA 4S2EA 1EZ4A 2CNWD 5A1TA 3K20A 1ZUIA 4DIFA 1NSTA 2QUBA 2QN9A 3GEIA 3K4HA 2QSUA 3GP8A 1UP4A 4AJIA 1ULUA 3V4OA 4EJ6A 4HQFA 1T36B 2L0XA 2Y9PB 1PDWA 1IQRA 1RLMA 1ZRSA 3N8IA 1SCKA 1SRQA 1UT5A 3NGXA 3NHYA 4NCIA 3GFPA 3IPXA 3X1MA 3HCOA 3MCTA 3TMKA 3OQNA 1O97D 2X0IA 5LA6B 1Z5PA 3O82A 3L8DA 4FZRA 5IVKA 4ZREA 4EZBA 1GPBA 2PMWB 4BP1A 1CQJA 1GNPA 1H8ED 2D2FA 2VA9A 4MWBA 1JIXA 4IIUA 1N3BA 3I12A 4NPCA 1FNSA 4R98A 2ORYA 1HTWA 2FMIA 2X8AA 4JX9A 1V37A 3T38A 3BMOB 3TGLA 1PS9A 1AKQA 3Q3GE 3IQGX 4FJ1A 3SMQA 4ZTUB 2V1XA 3QBJA 2NV2B 3PGLA 3PHJA 3FOBA 3H1GA 1YOVB 3HB9A 2ISCA 2IH2A 2C9OA 4MLPA 1I4WA 1JKIA 4KO2S 1RZVA 3LVQE 3TR5A 4BGUA 3EW7A 5M5BA 3KE9A 4Q4CA 2P0AA 3GGSA 1EQAA 2DUMA 4HH3C 4WXYB 4PANA 4LWOA 1S5PA 2VPYA 3MJDA 3VR1A 5H5JA 1IH8A 5F2OA 4G23A 2HF7A 2O2EA 5ESRA 1ZKMA 3HU5A 3WA6A 5KTNA 3H0KA 2B37A 3OI7A 1WD5A 2WVGA 3JALA 1XUOA 3R0QA 4F9TA 2EFDB 4H60A 4M1TA 3UWSA 3VA7A 1C41A 1QYVA 2BGMA 2GVZC 5AJUA 4E4RA 3M83A 3QHPA 2NXCA 2ZE7A 1CSEE 3VVCA 1XEFA 3ACCA 4B4KA 4M21A 5JXIA 1YZGA 2UDPA 1VZ3A 3NS7A 3OQIA 3LGXA 5GGXA 1SIOA 2QN1A 3MS4A 1E59A 1EM8B 4BMXA 1XZHA 3VYVA 2OM2A 5AW1A 5KO2A 1WETA 2W6ZA 1T4DA 2CDCA 2GKSA 3EVNA 4L08A 4DDMA 2C2KA 1BRTA 2HA2A 1I14A 3K0AB 5E38A 3WBJA 4D46A 2PLFA 3BMQA 1KFKB 4EB8A 1TPYA 1UJMA 2A78A 3GMIA 3TVDA 4DLLA 5BVGA 5BVHB 1I3LA 2XQGA 5ALKA 4PYKA 3ZHXA 1LSUA 4UCQA 1G20E 1T0PA 3W7AA 4B46A 2CKDA 1MU0A 1YK1A 3LPCA 4G84A 4EEKA 3HNOA 5TX7A 1KEEB 1EGQA 4QUEA 3SS8A 3X1ZA 4EUFA 4NNPA 3V1UA 3W9BA 4N41A 1KC1A 4H17A 1H5NA 1G42A 3SGLA 2PU7A 3WZ2A 3M6UA 3K30A 3I8SA 4KQ1A 2ZBVA 2IV7A 1J0XO 3ACBA 5BN5A 2RHGB 3DBIA 5I7HA 4WCFB 4I5IA 3DDCA 2O05A 1O5IA 4NATA 4Q18A 5FADA 3LT4A 5A3QA 3DXZA 3L4BA 3C16C 4FR2A 4LE2A 4F8YA 2YJNA 2P9JA 3UENA 2YJZA 3VU1A 2RAVA 3CRRA 3L4BC 1NJFA 2NPOA 3HBLA 1KETA 5GTDA 1A8SA 3DL4A 4FCVA 3GZTB 4WSOA 1L5KA 3AETB 4B4UA 4D9CA 4ZTZB 4JCCA 5BSTA 5MN5A 2I87A 5F7JA 1DT5A 1EDOA 1I2MA 3G5LA 3RS8A 1EJ6A 2V5UA 1JEJA 3GA7A 4ITVA 5EWLB 3CLSC 5EHXA 3TFWA 4YJGA 5ESDA 4R83A 2A5GA 2R8PA 4E4TA 3PE3A 2PWPA 2Z3VA 3LWNA 2ZW9A 4GWKA 2ZYHA 2Y1WA 4IO0A 4L28A 2POCA 2ZAIA 1UJ6A 2Q21A 1VP9A 4ALIA 3QIAA 2ZJYA 7MDHA 5T57A 3GT7A 1RZ3A 3W78A 3UK6A 1W59A 4ETMA 4XR9A 2HZ7A 1OW3B 2HTEA 4EGFA 2J4CA 4UVHA 2IZ6A 5CX1B 1VXOA 1J06A 4RDIA 3M33A 2HCBA 1J8VA 5REQB 1KJWA 1ZK3A 1PTKA 2PR7A 5AH0A 2ZUUA 4W9MC 2IHNA 3R5TA 1WVGA 2PD6A 3U13A 3OJOA 5B3LA 3QUCA 1KJIA 2V45A 4OIMA 5FBVB 5EWJB 1KU6A 1GQFA 4R5MA 1KNQA 5DHSA 5IAOA 4TXJA 3E35A 2DECA 1DRVA 3G89A 1NPTO 1SXJB 2CFRA 1ZRNA 4PN3A 1OWNA 1CX9B 3RLIA 2O57A 4YV2A 3RVKA 4MMYB 2W2NA 3W5VA 2WD8A 1KY2A 5F3DA 1M74A 3KAPA 2V6GA 5B1IA 1VZ2A 3IVCA 1I7DA 1P5ZB 4JC0A 1K6EA 4K81B 4M4SA 1JA0A 4GI2A 3MTGA 4MYUA 4NQRA 3DEJA 4U7DA 4QPPA 3TZKA 5JOQA 4N5MA 2DEUA 3K92A 1L7MA 3MGKA 3ASYA 3R0VA 3UEOA 1TK9A 3F5SA 5AJZA 3ZDXB 4A2WA 4F4JA 5I8PA 1CZRA 4OH1A 1T35A 3TQHA 4E70A 3C8UA 2HHAA 4O2BB 5JSYA 2QG9A 3DE6X 2YJ3A 4JP5A 2Q7DA 1JJBA 5CG1A 3QVKA 2I2WA 3C5VA 3F9RA 1BHO1 1CUCA 4NWIA 3AEKA 4MVWA 4XAQA 3W5UA 2C61A 2ZJ6A 2FMTA 1S3IA 2O06A 4JGGA 2JHGA 5GIOE 3ODPA 3RS0A 4DCVA 2OGWA 5T64A 4QLBA 1XEWX 1IDN1 4Q4JB 2Y1GA 1TVKB 4AJJA 1KS2A 4RACA 2XUIA 2FU5C 2JKYA 3IOEA 5KWSA 3PDUA 4KU4A 1DRWA 4BX2A 1UCFA 1OFTA 3FTPA 2UVPB 1GNQA 3VJMA 4G8CA 2X2OA 3TB6A 5C3MA 3T5AA 1O0SA 2P0YA 4QWWA 1UR5A 1P61B 3KIPA 2UZ3A 2CXTA 5LA6A 3PWKA 2RKWA 3EQ2A 4YEDA 5MFPA 4D45A 1UBEA 5EWMB 2O2DA 5JBNA 4H4DA 4FOPA 2C9YA 3FFXA 3SDBA 4NJEB 4KZKA 4XXHA 1L8LA 2EZTA 4M83A 4N3NA 2ZP1A 4X20B 1G3UA 3PHLA 5FQNA 3T4XA 3CWCA 3R5KA 2B94A 2P9BA 4LAFA 1YRBA 2ATXA 1ABEA 2JFGA 4H08A 2Z1NA 5CDFA 4O4JA 3FYHA 5HRAA 5J4VA 2AI2A 2VH5R 1YOVA 5HF9A 2GN6A 2F48A 1X3LA 3IUQA 1E79D 2V4MA 4GZ3A 4F96A 2E89A 4P5DA 5EVJA 2RMKA 2Q5HA 4RK5A 1L7OA 4TRNA 3CB2A 4HAWA 4PR0A 5JDIA 2PS0A 4X24A 3L41A 2XOKA 3AVQA 3GEDA 5JDIC 4CG1A 3LC7O 4TTSA 7MHTA 2YZMA 3CMMA 4NZZA 1MXFA 4U5XA 3KHTA 3N2IA 4HADA 5EPOA 5LQRA 1FSGA 1YRHA 2ID8A 2QTHA 1TL7C 3GFQA 2VK1A 3K0KA 2P3SA 1N8SA 3P52A 1ECGA 3R20A 3U39A 4YUYA 4R40A 1JZQA 1DUVG 3CYFA 2HGSA 5BPHA 5K3OA 2NUTA 1DBVO 1V2GA 2WSLA 4BECA 4N0EA 3FNEA 5J40A 2QGZA 1JXMA 5FWYB 1UBHS 3AVPA 3GXBA 2O52A 2C1XA 3I76A 3H2JA 1GR1A 2JATA 1WE2A 3K32A 5EHQA 1ESEA 4FGKA 2XWSA 1BHJA 3RS5A 1WPXA 1EYZA 3S7ZA 3VPAA 4ASUD 2IIQA 3UT5B 5BNZA 2HA0A 5GVRA 4ZEOA 5FTMA 1CUGA 4FOLA 4Z49A 3MOIA 3LW7A 2YV5A 1P9NA 4L1KA 1WX1A 4S05A 3ER6A 1HT1E 3PQEA 3GMTA 4HMOA 3VH4A 1X19A 1XHEA 2OBYA 1E9AA 3KWFA 3N8KA 4A9AA 3R74A 4A8TA 3EXEB 3F97A 3W90A 1BXRB 4UU0A 3WB2A 3S2EA 3GHYA 3ZZNA 5BVHA 5LQDA 4PFQA 1NDHA 4JVNA 2C59A 1JG1A 2LBPA 2WTAA 5DW3A 3DZ8A 1KA9H 1KAMA 2IKQA 1KEEA 3HGMA 1N0UA 3HUTA 4NFHA 1H5QA 2ZUWA 4HQ0A 3JVEA 4DMGA 4NFLA 4ZEXA 4MTLA 2KX7A 3KKLA 4HR7A 5IABA 3CUYA 1DX9A 2I4IA 3PX2A 5BNWA 5K1ZA 5AM2A 3V4FA 5CIYA 1ORWA 1D2GA 1PYOA 4WCFC 1E2HA 2YWCA 2XTNA 5DIZA 3GDHA 1PVDA 3FRHA 4DADA 3RHFA 3QVXA 2IK8A 2FP4B 2I4NA 2I6GA 1N4AA 5K99A 3BB4A 1TB4A 4EI9A 3FRJA 3O8NA 1IONA 1LUAA 3DVSX 2QRJA 2XD4A 5CB4B 1Z0ZA 3DWEX 5AUPB 3L1HA 3VJLA 4KVFA 1P19A 2BFEB 1EDBA 2PMEA 4QTUB 5BOSB 1UKCA 2W0MA 1YJQA 1QE3A 2NOAA 1PJAA 1SC9A 3CX4A 4JX8A 3E15A 3FYUB 4I5DA 2PGJA 2J87A 4DA6A 1B3BA 1ECLA 1X9GA 3ENVA 3HFJA 3Q3VA 4H7DA 2BY4A 1TFRA 5ALYA 4OI0A 3EXFB 1PD0A 2CFOA 4MDYA 5EAIA 1ND5A 1W0JD 3OQJA 1RP1A 4BNUA 4JBIA 4ENVA 1R0ZA 3QY9A 3MN1A 4GMFA 2E4WA 3AI3A 3H5OA 3W7VA 3UT5A 1R6AA 1X1CA 2GHTA 1TVCA 5GJVC 4UZFA 5REQA 1C8VB 3MF4A 4FB5A 4CF6A 2QDXA 3PIDA 1WCXA 3THOA 2ZIXB 4F06A 4ZHQF 5L4NA 3KWJA 2CVQA 3NM5A 2GPSA 5DNAA 3B7GA 4ABYA 4KAFA 4RH1A 3CT6A 5AKXA 4TN5A 4KLCA 3VSDA 1O0BA 1T5DX 4DYDA 4Y1GA 1PL6A 1VG8A 3LI2A 1X7HA 1SXJA 1OQAA 1KSGA 2D13A 1NJ1A 1JPVA 2IVFA 2RHOA 2W37A 3IE0A 3HVUA 1QM5A 3CX6A 5B3AA 1ZPDA 3UJCA 4KAJA 4A7PA 4AY6A 4OA8A 4O1IA 3V1YA 3I42A 4TS9A 1QG6A 5K0GA 1H2EA 4LV5B 3J7TA 4K6KA 4DBVO 4OHYA 1HYBA 2FPRA 2HAEA 2NZXA 3OKFA 4AJEA 1LSSA 5I9LA 2V8OA 1BCRA 1PNVA 1RXSA 3M70A 1V7ZA 4PPQA 3T0FA 4C06A 2IS1A 1HFKA 1PG2A 4BWVA 4D6XA 1SOVA 4W8GA 4ZD6A 4BNTA 1HMYA 3KQHA 3HXMA 1RYDA 1AQNA 3QUSA 3ZWMA 1I36A 4GI1A 2L42A 3Q1KA 4QBGB 3STUA 5FNVA 3FJ1A 3R0JA 4BYGA 1SKBA 4EG0A 4J1QA 5TEWA 3T7JA 2F67A 1Y3BE 3WGMA 3WAGA 2E2WA 2ZAYA 1RMYA 2HJVA 3F4KA 1TVKA 4Q4JA 1XYVA 4HAZA 1LQUA 1T8TA 3AINA 4RVCA 3BC1A 3ESQA 2IE8A 2Y27A 4GXNA 4YUXA 5DYIA 2HA4A 2IYLD 4YRIA 3DT8A 4AC9A 5H9VA 4AZ3B 2MT9A 1TCUA 4L7VA 10MHA 2I0FA 1YR6A 1TM7E 2QD3A 5ALSA 5BYBA 4GBJA 1EUCA 1OFUX 2IOFA 1J2UA 2H0RA 3GBPA 2Q1TA 3IIJA 3LBIA 4A0QA 3I62A 1HE3A 2WKRA 4X8LA 5EWMA 3RS3A 5JWOA 3JAKB 3UOAB 2QMEA 5I9TA 1OXBB 3IAHA 1GL7A 2YV4A 3DE4X 2OV4A 4O4IA 4HDCA 2O19A 3D3WB 2TYSB 2W43A 3QX3A 3S4YA 2YCBA 2VUTA 1IHYA 3VZPA 4DPKA 3BTOA 1F3LA 3LT5A 3EPHA 2PYIA 1SD2A 1Y8RB 3W3AA 3LDGA 1F6BA 1G7CA 1A5TA 1MABA 2G0AA 2NSHA 5GM2A 3V7FA 1CUHA 1XU9A 4E5UA 1FUEA 1MA3A 1TIBA 2GAJA 3JQDA 2ZIEA 3FIUA 3WDKA 1KVQA 2PGNA 2WIFA 3PUJA 1NBWB 4EHNA 3WHIA 1RQXA 3SHWA 2HNKA 4LOAA 1KAOA 2OGTA 2GF0A 2B9EA 3HCCA 1K86A 3K4PA 4US1R 1QV6A 5IAKA 4L5JA 1PW5A 3H7IA 4HMQA 1E9EA 3BIOA 5H0IA 4ARUA 4E6EA 1KJ8A 4M9XA 3AZOA 4BRWA 4PLPA 4R8LA 1EGVB 3FWYA 3W5SA 4RADA 1Y9AA 5ALHA 4TS4A 3VAAA 1E5QA 4EPVA 5IDQA 4RLFA 2NZUG 2ECFA 4J29A 2PSEA 3THXB 4RHUA 1TCBA 3AWIA 4MVJA 1SFRA 1L5SA 1XCMA 3PNPA 1JR3E 4KYVA 4LRWA 3ABOB 5CYPA 4A1FA 2Q6OA 1TAHA 3CR3C 2JAWA 1QE0A 4R1NA 5F1PA 1H2XA 5E1OA 4B3FX 2PKQO 4HYTA 1NW6A 1WV0A 4FIZA 2WA1A 2QL7A 1R16A 4PLYA 2C54A 4QXMA 5B3JA 4R9RA 3GARA 3E81A 3ICWA 5LZ9A 5IF9A 1BS1A 2FFAA 2XYHA 5DOZA 5B3JC 2VPPA 4ETWA 2BFDB 3UFXA 1G38A 1O8CA 4G09A 2Q8PA 3IQZA 2OESA 5IJWA 2B20A 5CVCA 5ADVA 1RYEA 3EXEA 1BXRA 1U1FA 1UP7A 1SC1A 5ESXA 1H2YA 1Q3HA 3SQNA 2V7TA 4CLRA 1UPFA 1YH3A 2VRBA 4XH9B 2XXAB 4Y6SA 1AS3A 3LO5A 1J8FA 3EIOA 1RVDA 3BOSA 2IEYA 3CZPA 2G5CA 3I53A 4GP9A 1G17A 4QEZA 1T4CB 2I66A 4QYWA 1PG5A 2HUNA 4PAMA 4WY2A 5G4KB 2XT9A 3TLGB 3W7BA 1TK3A 5J4HA 5B36A 2ZOSA 1S8NA 1R9JA 2Z3WA 2KLHA 3V8RA 3IFSA 1QH1B 4PG8A 3KYCA 1Z4QA 2X2FA 3V7UA 1OT5A 1MX9A 1VB3A 2QSJA 2GBLC 2CLFB 2LCQA 1QHSA 3I9V1 3KL2A 3CJQA 3HSYA 2PYZA 1E7SA 3VDRA 2FP4A 1VIVA 2CLOB 4FU0A 2EX4A 1Y1RA 4EHKA 2FI1A 3TAUA 3WLSA 5CPFA 5JPCA 5IFKA 4MGKR 3PDIB 3WLKX 1Z5GA 2MWMA 1VFNA 1NQXA 1QDEA 1DDGA 4ND2A 5IARA 4PXAA 4RHEA 3DAFA 2BFEA 5ULLA 3SHTA 1TEZA 3BQNB 4QTXA 2GUGA 3PYXA 1WHTB 2QS9A 2BR3A 4ZFNA 1IM8A 1OWMA 2XUFA 2PO5A 3SD7A 1GGKA 3EXFA 3FYUC 4MVJH 1WM1A 3GJ3A 1V1RA 2P1ZA 4IXWA 2UYQA 1ECPA 1LH0A 2O2SA 4FNGA 1M34E 4PXYA 2XZLA 4B8WA 1UP6A 2OG2A 4YO7A 5I8WA 1XEXA 2I91A 1G6Q1 2OHFA 4OLFA 3F78A 2JGLA 4C3VA 2P41A 1NN3A 1HBJA 1ZOIA 2ZVDA 4Y9SA 2ZIXA 3E2IA 4UAUA 1ISJA 2R6JA 1OA1A 4MQ4A 2WNSA 2OQVA 2AMJA 1U5AA 2E1RA 3N5CA 3IQXA 1N9ZA 1GKLA 1FQOA 3HDHA 1YOBA 2CCJA 3A28A 2WWYA 1LC0A 4IIFA 3JQRA 3R3XA 4UEQA 2QYOA 4X95A 3GGCA 3LXXA 4ZO6A 2WD9A 3C6BA 3W5BA 4WV3A 1BCSB 3ZCTA 2VHYA 1NLZA 4YP6A 4U9IS 2V0NA 2ZI7A 3BXEA 1WXHA 5KYGA 1AHPA 5IT9A 3LRTA 4IOJA 4BAZA 2O2ZA 4TMTA 5C7YA 3BQMB 1JEDA 3ZS9A 1QKIA 4KC0A 5HIAA 3OC0A 3D5TA 5JO9A 5BQXA 3W5AA 5DLQC 1A76A 4LJ8A 3HJBA 2F64A 5K8JB 2REOA 4Q9IA 4B4DA 3BJRA 2GCEA 1X1TA 1MIHA 4EDHA 4ESHA 2Q8QA 3NC0C 1XLUA 4I1RA 1L4HA 2PQ0A 4LDRA 3ZW9A 3RSLA 3TIXB 1L4GA 1JU3A 1ZZEA 4AQ7A 2A5FA 1QQAA 1LF5A 1XL1A 2QIOA 3GJ5A 4YMIA 1XWWA 3GWZA 4CDRA 5CA1F 2MMCA 5JE8A 4KQGA 5TGDA 2MTBA 1YR7A 4IUDS 1SVSA 4X85A 2VTBB 1NR1A 3WRWA 3DMNA 1E9DA 1K7EB 1KEKA 4V0NA 4C7JA 5JH7A 2OC9A 3QEMA 4ZVMA 4X7MA 1TCCA 2JJMA 6Q21A 2BWJA 2EF0A 1TUEA 3HP7A 3L0BA 3C3DA 4H7JA 4TTRA 1IE3A 1QONA 1SCAA 2JLQA 2ZJ3A 4RHCA 1KXJA 2HK6A 4JK3A 2I3GA 4KZPA 5D51S 3ZCPA 5ES3A 2Z6AA 1M2KA 3JVDA 3BWVA 2WUWE 3QXCA 1A88A 2J5QA 2VAWA 1K3TA 3C3AA 3QG5A 4OJKA 3D3WA 1VA4A 1SNYA 1WXXA 4R2JA 3T7RA 3ZWDA 3U19A 3DZGA 3LNCA 3P2YA 3C8MA 1O6GA 3PHBE 4TQUS 1E2BA 1NIJA 3ZNQA 1RI4A 1QO9A 1XN1A 1Y8RA 1V47A 2Q9CA 2IZ5A 2XE8A 1L5ZA 1ULTA 4IGFA 3UFBA 3WGZA 1WHSB 2EIXA 2B30A 2FFJA 3WADA 2DRIA 3IXQA 4MV6A 4C0SA 2CL6X 1HEUA 3QX9A 1QC5A 3OSZA 3F96A 4GZ6A 3SYRA 1XT6A 2XNCA 2QUIA 4EI8A 4TZKA 1IPEA 1SCQA 5TMBA 3TCKA 2QOEA 1X94A 4NCNA 1N6RA 2YRFA 5L3QB 4Q3KA 1NAIA 1RLTA 2A1IA 2OHIA 3PHHA 1RQ7A 1ZFNA 2WVHA 1XXHA 3ZHRA 3THXA 5F1YA 2VK2A 5EJ9A 1HE8B 4JUBA 2C0PA 2X19A 2PPLA 3EQ7A 2ZIAA 3JATB 4M3NA 2OV2A 1E69A 1ZL2A 3O7WA 3R9XB 5JFGA 2I7XA 4Y2TA 1F1JA 2JFBA 3HSSA 2BTOA 3OMXA 4I1UA 3CIOA 4PM4A 3IESA 1NU6A 2V5AA 4LDZA 3WZMA 2AJLI 3K70B 2JH8A 1BS9A 2EP5A 3VR0A 3QELB 3K1YA 3NBFA 4XQEA 5EQTA 5JSKA 4MYHA 3UGJA 1RXYA 2HMVA 1J25A 1JSRA 5JWRA 2PBFA 4NCHA 2ZFUA 1ECFA 3ISTA 2B6NA 3PRYA 3R24A 4YLGA 5JI3E 3ZD6A 1P0CA 1VSQA 3HQ4O 4BCCA 3Q72A 4TXHA 4ARZB 2JAOA 1ZRHA 3UOWA 2C2XA 1GQRA 4B6FA 1FX0A 3KD3A 3D1VA 1ONBA 3OEHA 3GO4A 4TM8A 2ZVPX 2AOWA 5HXAA 1BFDA 1TC2A 4HYQA 2XXAA 5E6UA 4EMBA 3CBQA 3STTA 5HSGA 1AGYA 1LDEA 1NONA 4XM1A 1P2FA 1IDOA 1ZCAA 3DWIA 5C8YB 5TNXA 3TTSA 5IEBA 3KDPA 2DWOA 3TRIA 1E3MA 1A2KC 2ZUSA 4E2YA 1SZCA 1L7QA 4M0CA 1RLIA 2C3PA 4LFBB 2BC9A 2NIPA 4WT7A 1WA5A 3TB4A 1OR8A 2SBTA 3UWMA 3DM9B 2B1RA 4NCJA 4BBPA 1FZTA 4AMVA 3WOVA 3NIWA 2WUEA 4E5VA 1P7YA 1XWIA 2H4XA 1IHPA 2QE7D 1M8FA 2VHTA 3I3SR 3BE8A 1T8YA 3BHNA 3QE4A 3SJ7A 1DBWA 4DG9A 4JC4A 2ZETA 4X6YA 4F21A 1KQPA 3PDIA 3D6TB 5AVQA 1NWHA 1ZCZA 2NU7A 3WLEA 2AC7A 3MUEA 2XBUA 4OQQA 1N2OA 1KR2A 1R3UA 2IUUA 4KKXB 3TQCA 4XIIA 4KXUA 3CGWA 4Z3DA 2C83A 2IPNA 2IYUA 4D41A 3NIDB 4BPRA 3PE4A 4LRSB 1AKMA 1WHTA 4HQNA 4MA5A 1NQVA 2QMHA 3DOUA 2KI5A 3K09A 3WISA 1H9AA 4RQUA 3LTNC 3NATA 4IH4A 2AFVA 4UVEA 2ROQA 4OX9B 2I3ZA 4EA8A 3K09C 1PE0A 4B6QA 1P5FA 3RSHA 2G36A 2P0EA 4MV9A 1MMFB 4XFDA 3BA6A 1YA6A 2C9DA 1CUJA 4YV7A 2CMHA 3B85A 3EBPA 3DFIA 3LQ2A 4FZ5A 3LFTA 3VKGA 1JXAA 2PDAA 1KI2A 1PQ4A 2X1VA 3HKEB 1Q92A 3PZRA 4YIKA 2WV9A 3QMMA 1IQPA 4CMBA 4JBGA 1WLSA 4TVKA 3VYSB 2DBRA 1P2VA 5THKA 2P3LA 5KSZA 2QR5A 4UOQA 5K3DA 1JGTA 1HT2E 1W36B 2R8YA 3B1YA 5DI3B 5ALWA 1HGXA 2YUTA 1EK0A 5IHPA 1KTVA 2ZI4A 1JPUA 1FFBA 1VBFA 4LUCA 2PAFA 1CF4A 3QKWA 1OYWA 4QHTA 3TG8A 3IHWA 4LJ7A 1HY3A 2HQ1A 4DMKA 2HX1A 3VHXA 1UPAA 3I32A 3MWLA 1SEVA 3KVRA 1YBAA 3KLOA 3SFVA 4IRXA 4IM7A 2ZPTX 1EDEA 4G6ZA 4RESA 1VSBA 4X94A 4P9NA 5A05A 4RZUA 4XX0B 1KHTA 2ZTLA 1XRLA 2ID9A 1NBAA 3HC7A 1Z0UA 4P4GA 4FN4A 4EARA 1VG1A 3RT9A 4B6GA 1A82A 1YJAA 1OZFA 2ZYGA 2YN0A 4ZAFA 3U5TA 3TL2A 4YJ3A 3H11A 1GXSB 4TYQA 1QZZA 3NKVA 5DBEX 2WTMA 5DLEA 1TYZA 1FFDA 4TMFA 3R6TA 2AG5A 2Y0CA 3O8DA 4FILA 4YP9A 4OJMX 1Z2AA 3KB1A 1YD7A 3RJZA 2BOVA 3E9CA 4R2LA 2GN2A 4FJ2A 4HL6A 4KOEC 5C37A 3L7BA 2AFIA 3ENWA 2A1TS 3AQIA 1UKAA 2H1FA 3IYLW 3QP9A 4Y1RB 4A82A 2OP1A 1DJQA 2CFSA 4RK0A 5IJAA 4MW0A 3K9BA 5E7IA 1F14A 4F2GA 5BSFA 5BP7A 5CFRA 1A1VA 3H2GA 3SMVA 3MJSA 1UC4B 4KL8S 3FOCA 1U3CA 2ZYDA 2PFGA 1VBKA 1XF9A 1YL5A 4KWEA 2AW5A 3TK1A 3GAFA 3V33A 1V8BA 2RBEA 3VO8A 3ZWVA 3GHHA 1E0SA 1F38A 4M1EA 1YQTA 1FJXA 3MRXA 4JLOA 4M55A 4S12A 3VNVA 1WHSA 4INOA 2F2TA 3CVJA 4YRFA 2BGUA 1A9SA 2ZGVA 3UT6A 4F6LA 3LYAA 1WL8A 3A1SA 1AKRA 4BNIA 4DBLE 4LSGA 4DC0A 2XE7A 4RIEA 3H75A 2IBSA 1F4VA 5FPHA 2R48A 2UZ0A 4TT8A 1IOVA 3T7CA 5FWDA 4AK9A 4DRXB 2I4TA 5LFAA 2J7PA 1IN7A 4GRAA 3PFCA 1EQ2A 3CZCA 4UUOA 5E4YA 5BXYA 1X9IA 2ZRQA 3O93A 3R9WA 1D5WA 1Z0IA 4FYPA 1AH2A 2KLBA 1M1NB 2VDMB 3NXSA 5C3UA 3WLPA 1NRJB 1TPZA 4PC6A 4HWOA 5LSAA 1NJGA 3ANMA 1JYSA 1M1UA 1QVWA 3E58A 3KX2A 2YVLA 1EE1A 4Y9DA 5K3SA 4MRAA 4D3XA 3LX4A 3OPNA 5DNDA 4CL2A 2PMBA 2GD2A 3E8XA 4ZDIA 1X7YB 4GOKA 1ZIOA 2HXGA 3E23A 1Z7YA 1D7AA 1GNSA 4QPDA 5BNTA 1CPYA 1TZBA 3PEUA 4JJ6A 3K70C 2FEOA 3K94A 4LJ5A 3GLGA 5ALXA 3ZBTA 2NUPA 2D3TA 1M3SA 1Z4KA 2HGZA 4G5QA 4IOKA 4U2GA 4JI3B 3UMMA 1YFKA 1XAIA 1H1DA 4NY1A 3AKCA 1Z4PX 2RI1A 3M89A 4ARZA 1O5OA 3OUZA 3WSVA 2B1QA 3PFNA 1TKCA 5DXFA 4YR9A 2ZWIA 1US8A 4J2TA 4RF3A 1R4ZA 1XQXA 2NYUA 5CM9C 4CIVA 5JNRA 3T6KA 4M1ZA 3GBVA 3S3TA 1C3EA 4Z1MA 3O6VA 3NEJA 3QUQA 4LC1A 4EYEA 2R1ZA 3GA0A 1Z8FA 4EATA 3FZQA 2YWDA 1KJZA 2Q4RA 1T2NA 1S9DA 5J3JA 1RYZA 1T43A 4UEWA 4YRCA 5SYAA 2ECOA 2H85A 1OXVA 5PGMA 1Y1LA 4JLSA 5L7TA 3RU2A 1HURA 4J43A 3SEZA 2GRUA 1V7QA 3Q41A 4EB6A 3JRNA 4BRSA 2D1RA 3PLAE 2VT6A 2PZGA 1Q77A 2RBKA 4RFSB 1OJ7A 2Q62A 5KJCA 3ON5A 2BKXA 2DCUA 1NF9A 4EF5A 2JI4A 2FGJA 4AJ4A 3EPRA 4F1JA 5T7BA 5JYBA 1BVYF 2V9ZA 5J5VA 4HNRA 4DQUA 1DKLA 1HQCA 2PH1A 3ZV7A 2G8NA 2X0KA 1QUEA 4N01A 2AKEA 2BP7B 3F9CA 3UH1A 2W00A 2J1LA 3O8OA 1EXDA 2W6OA 2DB3A 4PCVA 1UH5A 5TQ0B 3AEQA 3MXOA 1OXUA 3HBMA 3NBUA 4G4SP 1W4ZA 4PY2A 1Q11A 3IB3A 1SG0A 4NJMB 5DCWA 1ZEJA 3P9CA 421PA 4WJLA 1NASA 4TKMA 3PT5A 1MQAA 5DASA 5AVJA 4X1YB 3B3AA 2JFNA 5HILA 4LDQA 3HJAA 4LGMA 2X1LA 5ED0A 3N0WA 4I4CA 4Q7JB 4MAFA 1CZKA 3E3NA 5FWAA 5JATA 4IJVA 1CK4A 1T5OA 1Z26A 3EF3A 4Q00A 1I1NA 2H48A 3P4YA 4EY4A 2GDZA 3B9BA 2LP4Y 4CEJB 1TM5E 1CNMA 2BEWA 1RWOA 4M46A 5DI3A 4CUJA 4HPWA 1WXIA 4FB4A 4V1CI 1UDWA 3WR5A 4NV1A 5HWSA 1W36C 4IJ5A 2QJOA 2H59A 4WN3A 3M1IA 4P08A 1W6RA 5KYWA 2O2CA 2PMFA 3QF7A 5LQKA 1PD1A 3KJHA 1Y42X 4KOAA 3U3DA 3F7MA 4BV8A 4Z3OA 2CXQA 2QRLA 1PWEA 4EVIA 4DUYB 3DWGA 2B9VA 4FMBB 1ZBDA 4J9UE 3EZNA 2IV3A 1VE3A 4BLRA 1B6TA 2I6UA 3AMVA 3I4CA 2OAQ1 4FBGA 5HIKA 1EGMB 1GFSA 1VC2A 3HB4X 2VAPA 4K9OA 4UU1A 1IUNA 4LYAA 2MYPA 1FPQA 3SBEA 2P9CA 1GXSA 1J8MF 1Y3IA 2EJBA 4F2PA 3WBBA 2Z98A 2VYCA 3ROKA 3U7RA 1GU1A 2YNMD 4GS5A 3TTTA 1S7CA 5NLLA 1ML3A 2CWDA 2IWRA 4HQLA 4F3NA 2COUA 4IVNA 2JJ2D 5KOHA 3QM1A 3DXXA 1QU2A 5TV2A 1SOUA 4ZT3A 1HLGA 3TOSA 1EFVB 4LF4B 3R3UA 1YUBA 2I6TA 3CRW1 4G24A 5D85A 4EZEA 3NDIA 2XCSB 4OU5A 2PKRA 5DGCA 3B3GA 4U3JB 3TNJA 2DFTA 3FPBA 1KBOA 2GXQA 4E13A 5K20A 1KRWA 3L6RA 5B64A 3WJAA 3C1AA 3AYZB 1BRMA 4O3FA 1M2OA 3FVVA 4NMHA 3CVYA 3KKKA 3LY9A 1QG2A 3R3YA 4FFDA 1HKUA 1A97A 2QRKA 3F6RA 3W0LB 4AJKA 3F5QA 3E70C 2ZREA 2R87A 4XYLA 4YRZA 1Z22A 2HPZA 3LKDA 1O6CA 2A33A 4HG2A 3F8TA 1UBOS 1N5RA 1BWQA 4JLKA 1FSZA 3UJHA 4CGYA 3JQFA 4MEBA 3RSQA 4QE3A 1K7YA 1VJ1A 3WS7A 2FQWA 4LVUA 2RGEA 4O25A 1O95A 3NJ4A 1QIDA 5LXTB 1JHZA 2IEGA 2OZVA 4GECA 3SXJA 3M6IA 1JAYA 2P2LA 1K9SA 3AM3A 4QOIA 1LTHR 3AGPA 3D6AA 1H0SA 2CT8A 4UMFA 1QHFA 4MUNA 3C85A 4U0JA 3KS9A 1CRWG 1IPFA 2P2CA 2ZJ8A 3GLSA 2FEKA 2C7BA 2EERA 2H52A 3GDWA 1DC5A 3A1CA 5H80A 1JR3D 4CIXA 4YUZA 4ZYXA 1T2EA 4QGFA 1BYUA 5CXXA 4M22A 1UINA 1II9A 1CE8A 2VSNA 1MH1A 2HMUA 2Z5LA 3C3WA 3MVEA 2WFAA 1YIDA 4IXTA 2DFLA 3L1JA 2QORA 1QZTA 3DV2A 4TTTS 1K6IA 1OLUB 4OIFA 3OPYI 5EHGA 4PQRA 5SY9A 3RVPA 5A9SB 1X7YA 5BW4A 3PR1A 3TOXA 4I4LA 4X7BA 1RC8A 1XCLA 2V7VA 3E18A 3EIXA 4WK6A 3TSAA 3UICA 4E4YA 2VHXA 2RD2A 3WVNA 3JSXA 2WG1A 3UB2A 1GUAA 4QHSA 1NSYA 2JH9A 5CU7A 4C08A 2XUKA 3BWXA 4RMJA 1DTWB 1SD5A 4WA7A 3IOCA 3VR5D 3WQBA 4MGIR 3KTAB 3RK4A 3IXMA 4D5EA 2HWYA 2JIRA 3KK0A 2AW3A 4NVRA 1J8YF 1NQWA 2JFOA 3D4PA 1L5MA 1SO8A 5BMVB 3WO0A 2P1DA 1FVOA 3Q3CA 4TYNA 1EDDA 2IXAA 3C24A 2OENG 4MWCA 1GGMA 3H9EO 4KI0A 4I2NA 4W5NA 1TC1A 2NTEA 4Q7EA 5ICGA 2ST1A 4ENPA 2VZEA 5C81A 1YZYA 4JI0B 1PLJA 4PLWA 3F5DA 4YP1A 4LXHA 4RAOA 3WWEA 1SVMA 2CZCA 1E1QD 3MAJA 3KDAA 3PSAA 2P2ZA 4N5HX 1Y8AA 4RYDA 5AOBA 2O2JA 1YR2A 2I6XA 5KS2A 3FPAA 4B1FA 1AUXA 3OU2A 1U8FO 1ZH2A 3EAQA 1FVHA 1U0RA 1VJCA 4IKOA 3ID6C 1N9KA 2W83A 4TM7A 3W34A 4PZLA 2DX7A 1T3HA 4IILA 4TXNA 5BR8B 1Y8QB 2WINI 3GL9A 2OHHA 3ZDZB 5HQ3A 3OJXA 2ZRCA 1L7AA 2BP7A 1HG1A 2XT0A 3WFIA 4B3IA 4DIDA 3O8CA 1CD5A 1TAUA 3OD1A 5ERGB 4ISBA 1BXGA 2RH8A 2CLKB 3QWHA 4AAYA 3N39C 1R5NA 1RHUA 1G4HA 1BXZA 4N6OA 2QTGA 4YGYA 2R5WA 3PWSA 4PONA 3UWOA 1XKQA 1N5KA 3EWSA 2O5EA 3A11A 2JEYA 3ZV3A 1L3CA 2G82A 3GI1A 2MYUA 4FYKA 5M7EA 1KEWA 3HYCA 3DFUA 2GJKA 4G07A 2GJAA 1DNPA 3I5UA 4P2GA 5ER6A 4GICA 5IX8A 4RD4A 1LVHA 4D98A 3JAMA 2OK7A 1DWOA 5LZ7A 5AMXA 1EFPB 4L9AA 4EZIA 2P3QA 1XKLA 2CW5A 2GDJA 1DV1A 2PG3A 3AEXA 4E0BA 3T12A 2HSJA 4BJ3A 2GXUA 2QUJA 4HJXA 4Z0NA 2E6KA 2EOAA 3KSBC 3SYNA 5L6LB 1Y3AA 2MR6A 3DYBA 2Z9BA 4FKZA 3M81A 3ZQKA 3EW9A 1JDSA 2CBZA 1N2SA 1U6IA 3I52A 1GHTA 3QBTA 5AI8A 5B1HA 1WUKS 1QFSA 4LQCA 3EGIA 3UHOA 1GGVA 3OX4A 2XVZA 3S5UA 4BNMA 4ZZ3A 3H9UA 3LL7A 2ENWA 3OCXA 5IVHA 4EG3A 1LK7A 1QANA 5EXSA 1NBHA 2ATIA 3BS4A 4I4TF 1I5RA 5JBIA 4MRRA 2F8SA 2O59A 5CA0A 3E1GA 3OO1A 4FBLA 4GPBA 3LQYA 5EXTA 3ZH2A 2Q2VA 3LXMA 3NJRA 1LFDB 4WLUA 1DO8A 3AZPA 4FE7A 4ZVTA 2JLYA 3M5DA 2ZUFA 2Q3FA 1FS5A 5AVKA 1F8UA 1M1ZA 4UUBA 4Y8VA 1ZJ4A 3IVGA 4OYLA 2H4ZA 3ZPXA 2NUAB 4TVBA 2KHZA 4UPEA 2JGEA 3GZ4A 4V38A 3ZCXA 1Y48E 4LMBA 4B6RA 4NR0A 1CB0A 1MC4A 4LRYA 1N2GA 1USUA 1S8AA 3LV8A 5AK6A 1BSVA 2IU0A 1XZKA 2LCIA 4G97A 3HCRA 5EYPA 1EHYA 4MJXA 4ARIA 1CUUA 3G0DA 3JWHA 5GONB 1X8JA 2JVJA 2ZDHA 1E2FA 2OEPA 4J1NA 3BD6A 3ENQA 3VXKA 4YXWD 1FK8A 1OIXA 5I7EA 3SG0A 3A6JA 4BNLA 4M9SA 4D4HA 4YN3A 1NR7A 3SFTA 5CG2A 4KW7A 1Z68A 1XMIA 2BFMA 4B43A 2JD1A 1HF3A 4U7GA 5ALZA 1YR8A 5D86A 4Z2AA 5I5EA 1E3DA 4C05A 3OKAA 2XE6A 2L2QA 4M88A 1KK1A 5CVTA 3HI4A 1K4YA 4XPIB 4G9EA 4B2IA 3OOWA 3KFXA 2V0GA 2LGJA 4R51A 1ESCA 2NSDA 2EQ5A 3VJRA 4G2TA 1ZISA 1TA4A 1DQYA 1NAHA 4IDGA 4JJ8A 1EG2A 3EGWA 4KXXA 1ZMTA 4XWGA 1QGDA 4ZRMA 1I3KA 1FNCA 3HI6A 4R5HA 3RUAA 5EJ7A 5JS1A 4P3YA 2FMUA 2GPTA 1ULBA 3L0OA 3AB7A 5J43A 1KDPA 2H4WA 3CSSA 4G3XA 1UKEA 4G5YA 3T94A 1V5EA 2Z4RA 4CKXA 2RARA 1FSSA 4N3AA 3S68A 5DYTA 5A6SA 5TF4A 4ZMBA 4UXHA 3T54A 1JQKA 4C4TA 1PWZA 2H51A 4OI4A 2FJPA 1JG6A 4JDUA 3TOZA 3M9WA 5DISB 1N3YA 3A9TA 4KDFA 3RT1A 4LXYA 4Q3DA 1JFSA 4I4NA 5LMUB 1KF0A 2SNIE 5A9SA 5ENDA 5HKOA 1ODTC 4KAAA 3LVBA 3DEZA 4KXQA 4L4YA 4ND5A 4EBFA 2XCLA 3B51X 4I9UA 3ZDBA 1R50A 2P2NA 4LFCB 4L95C 4QEKA 5AXAA 2OHVA 1E7RA 3PTZA 5BYKA 3AKEA 2RBGA 3EIHA 4ZI7B 1HL7A 3P27A 4JR1A 2PMKA 1PJ4A 4M53A 3ZWYA 4JBYA 3U37A 3NBMA 3Q11A 1JT9A 2CXNA 3BB3A 3FGOA 4GOOD 5EXDA 3T9AA 7REQB 1EKXA 3KTAA 4Q39A 3NNDA 3Q2OA 2DQ4A 1MB3A 4WUTA 2ZE6A 2V3VA 5L4SA 2CNDA 1C7JA 5FBZA 1GA6A 1ISMA 1OFHA 1N5DA 4I6JA 3NUZA 2WSIA 1R0RE 1JE1A 5BMVA 2QWXA 4H3SA 5DTEA 4KH1A 2HRQA 1D2MA 2DY1A 1E1NA 1KRHA 3OQBA 4ITRC 4TZTA 2GEVA 4J3FA 2HYIC 3ENKA 2N1BA 1KY3A 2VT3A 1P0FA 3DNMA 4XYGA 1MG0A 1RQPA 5CJPA 3SEFA 4LYYA 3UAOA 2RHRA 3PQ2A 4P5EA 5HDQA 2VA8A 2QNRA 1C7RA 3CCBA 4OAOA 4CIYA 4AJPA 4P0TA 3WGIA 1P2SA 2FCAA 4IHJF 5G4LA 2PO7A 2VWPA 3D6UA 1KYZA 3OT5A 2IHZA 3BRSA 2J46A 3T1HB 1RWWA 4MP6A 5DRYA 1Y1QA 5CK5A 3GEEA 1JF8A 1EMDA 4AU1A 1WQ1R 2DU8A 2O3JA 2AG8A 3GZNB 2CYCA 3B60A 3QW2A 1T9KA 4UNIA 2B98A 1KBQA 4TXLA 2FOLA 3REQA 2ZJAA 3EA5A 3NHZA 4D42A 3GMDA 1CZNA 3AKDA 2HH9A 2YH2A 2NADA 1SKAA 3DH0A 2OOKA 5IUKC 1DFHA 1D1PA 4OMUA 3GX1A 4PV7A 2FH5B 1AK1A 1XZIA 4Z0HO 4D9HA 4KO3S 4P31A 1DAPA 5DBGA 1DELA 3S8YA 2X41A 2JB9A 1SUPA 2QK4A 3TZLA 4CLEA 2W6ID 4AYXA 4PGFA 3VKUA 5LOVF 2DMRA 4FLEA 2WE8A 4J3JA 3E7FA 3UATA 5L7YA 4RETA 4EKNB 3NTRA 5DCUA 2W2XA 3GEBA 4KEAA 4B3XA 1L6IA 2H65A 3EYAA 3UB3A 1RJEA 2FPWA 2XIQA 4KQMA 5IDXA 1JN0A 3LWBA 3QVTA 5CLGA 3R3WA 1UIMA 2WQZA 3A3NA 4ZI5A 3NIGB 3IMKA 1DC8A 1HRKA 4RGVA 3BE6A 3RV4A 2EARA 2AIRA 3DT9A 4JZKA 4ACBA 4EB3A 1XRSB 3T5DA 4D97A 1PR2A 2YYAA 5AW2A 1QO7A 1L7VC 1U28C 1OBOA 1PNRA 2QM8A 1UC8A 3Q7QA 3PNLA 2G7ZA 1STOA 1THTA 1XA0A 2XTAA 3KOUA 4KYIB 1IY2A 4HDMA 4QM7A 2XNJA 2QTTA 4GQAA 4C1NA 1H9BA 1Z45A 3OO0A 1G2QA 1XJQA 3JTEA 3MTBA 2OB2A 3PFKA 4CNBA 4DRYA 3COJA 1RM0A 2D00A 1LDNA 3GLFA 3NHFA 4HO1X 1ZIDA 1C9EA 4IXNA 3VPDA 1AHHA 3PQ5A 1XE3A 4YRLA 2NQ8A 1C0KA 1R8YA 1NTOA 3N0XA 3ZXUB 4ER6A 1TD1A 3B89A 3MW8A 4LYGA 1CDZA 5CFMA 5IHXA 4O1HA 3E7XA 4IICA 3GD7A 1SELA 1E32A 1CXZA 1FEZA 5AESA 3FX2A 4NSNA 3I4FA 2NUAA 2O8CA 5ILGA 1PFWA 2O1XA 4RY8A 2QPOA 3WLJA 5FI1B 3E9EA 3F7TA 1NW9B 4D26A 4DLPA 2F55A 1HDIA 1U5BA 1UJBA 3K2IA 4GL4A 4CR7A 2NV0A 2VSOA 3NVDA 2XUAA 1OFVA 4KLRA 4TV8F 4I8XA 2D8AA 1RRFA 3WGKA 521PA 4GE0A 5JTUA 2G88A 1C3JA 1T4MA 2JK1A 2RGWA 2YWXA 4B4WA 4JGBA 3IJPA 5LZ2A 1DBSA 1I6MA 1ORTA 2BKVA 3KZKA 4G5OA 5JD4A 1S8OA 3A3OA 4AULA 6PFKA 5KYUB 4XCQA 1YDHA 3GFTA 4FGWA 1RJGA 4IWXA 1G59A 2VH1A 3IBSA 1VIMA 1E1MA 4XEHA 4GPD1 1XTZA 2OWEA 1Y1TA 4GI5A 4P7JA 4E14A 1TOAA 2PYDA 4N5IX 5AKGA 3RI3A 4JAVC 2DETA 4P6VF 4MW1A 1MJ5A 2G1JA 1P7VA 3R8FA 2YBDA 5HKLA 1Y63A 2HLPA 3ONWA 4E5DA 3ILXA 3DAGA 2PGDA 3HDTA 1PL8A 3CCCA 2FW8A 3V6MA 1O96A 2VEOA 1GLNA 3B13B 3EEIA 2FF7A 3PHGA 1MAWA 4HRYA 3AM4A 3IP9A 5EERA 3V42A 5I7FA 3A31A 5LDDC 4OBBA 5FBRB 4O0LA 2O50A 3E3OA 3UAXA 2PD3A 4J8PA 4ALMA 5JEDA 1UJ4A 1QIHA 4K9RA 4UTPA 3WKEA 2AEJA 3G8BA 3K96A 1ZQ1A 5C5EA 1W29A 5DBHX 4O8CA 5CGQB 3RVNA 1KVTA 1PK7A 4DW8A 4WBNF 5A7FA 5C1BA 2RE8A 2ZKLA 3PQDA 3WXMA 3AR9A 3QLUA 4ZOCA 2PUFA 3UAGA 5EJEA 1SPXA 3PXDA 4M0MA 4L07A 3A9CA 4A0GA 4EUSA 3QLUC 4RF4A 1AO3A 1DC6A 1YZKA 3UO8B 1T6NA 2QZ4A 3FNFA 2WIBA 3JVVA 1JZSA 4WFQA 5AKHA 2NZYA 2P11A 1G6KA 2E55A 2XZOA 4CBVA 5EJ6A 5CDTA 2ZBFA 1G2PA 2ZR8A 4F5ZA 1A4RA 1FU8A 1EG7A 2C04A 2XX3A 4D99A 1AZTA 3KLBA 3PV0A 2O6HA 3IBGA 1DC7A 1QPBA 2HBRA 2ZU0C 3TMAA 4HNVA 2W6QA 2C5EA 2HW8A 4A5SA 2D7CA 3RIGA 5JFOA 4LG1A 3BRCA 1QH8B 4MCIA 2F9MA 3NWOA 4PVCA 4ZQEA 5ICSA 1GNVA 5GJBA 7REQA 4JELA 2QROA 1SG9A 2UYGA 3MWEB 1DS6A 1G1AA 3HUUA 3K8ZA 5D00A 1T5TA 3EZLA 3CISA 3IALA 4MZDA 4B0PA 2FZ5A 2HRCA 2WYIA 4JXJA 3A1WA 4ER7A 1G3QA 1R0CA 1K27A 3D6HA 4IXDA 4WZAB 2DUNA 5KTMA 4Y2VA 1P75A 3BB1A 1T5HX 4TSFD 1LB1B 1QZUA 1EUDB 4DTCA 2WP0A 4WUVA 3HA3A 1AUQA 4M8LA 5HIJA 3LYUA 3U3XA 1USWA 4OHKA 5TARA 3SX2A 2FJ0A 4WERA 4CQLA 3HKBB 2AQKA 3OX2A 2AOTB 1OSNA 2X23A 3UA3A 4D3FA 4N3BA 2OD9A 3RM3A 3SPXA 5JZVA 1NOIA 2WYVA 1JHRA 2YYSA 2UVQA 2V9PA 5DGDA 3K6SB 2W71A 3S1LA 1ZK4A 1CBUA 1VL2A 2WU8A 3ZW7A 2ANBA 1E94E 1H0KA 2JBHA 4B2PA 2EYQA 2NO7A 3GZNA 2GN0A 4QXAA 3SHQA 3T35A 1ODKA 3KELA 2ZT6A 4IKPA 4IYRA 5CK4A 1SIUA