4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
molecule keywords Esterase B
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
4BB0A 1PFQA 2VJBA 3D4LA 3STXA 2VAXA 4QWMA 1EA5A 1K4YA 5ALWA 5DYYA 4ZXFA 3WMRA 2XQKA 4C87A 1CQWA 3E3AA 3D0KA 1L7QA 1B41A 1JKMA 4FLMA 4AN0A 2GYVA 3ICWA 2HRRA 2XMDA 1DQZA 3SWWA 3V1LA 4PW0A 3ZWQA 3H1BA 1ZICA 4X3CA 3PUIA 3DCNA 5HCUA 2QJWA 2Z3ZA 3ESCA 2OGZA 2XMCA 4OCZA 4KE8A 2K2QB 3V1KA 4N5IX 1BU8A 4LKOA 1HKHA 1CRLA 1XZGA 3WKCA 2EDAA 4OU5A 1GXSA 1ORVA 3F97A 2QRUA 2IITA 2RONA 3C5VA 5LKRA 3M83A 2V9ZA 1ZD3A 3H2KA 1N5RA 4GDMA 3EF3A 4P93A 5A71A 4HXEB 1X2EA 4S0XA 1Y7IA 1ZJ4A 1WHSA 1Q83A 3HEAA 1MO2A 3K6KA 4FKBA 5AI6A 3G9TA 4PNZA 5ALNA 5AI9A 2DHEA 5T4BA 1QONA 1PV1A 4G1FA 5AM4A 4EY4A 2GBCA 1XZFA 3H0CA 4FTWA 1U65A 2PSFA 3V48A 4IO0A 1LPSA 3DKRA 2PUJA 3A2NA 3VVLA 1UKAA 3JYHA 2PPLA 3SK0A 5I8PA 5EHZA 2R8BA 1J06A 1XRMA 1GGVA 1VE6A 4BVKA 4UHCA 5CT6A 3HSSA 2BUBA 4FBLA 1G5FA 3H2JA 5FDFA 2DHDA 1N5MA 3C8HA 1K63A 4LYEA 5AKHA 1D07A 3L1IA 3ZLTA 5JATA 1UOQA 4E15A 2ZSIA 5AOAA 4RE6A 3JWEA 4J0JA 4DNFA 1QTRA 5K5EA 4M0FA 1VA5A 4X7BA 1ZGBA 2YH2A 4QDTA 2QTBA 3FBWA 5JANA 3PF8A 2PSEA 1GKKA 4K6KA 2FX5A 2XT0A 4L0CA 2WFZA 5ALDA 5J3JA 4OU4A 2WG1A 4M0EA 4QDOA 3S2ZA 3L1JA 1H2YA 1Q0RA 2C58A 4W1RA 5C8XA 2XUFA 4FNGA 4LXHA 1HBJA 4B85A 3EIOA 4E11A 2WIFA 1DT3A 3WWOA 1CUZA 1A8UA 3ZI7A 2YASA 2R11A 2XUGA 1R88A 1XZIA 2V97A 3DL4A 4A23A 1SC9A 3I2HA 3Q0TA 2BFNA 2JIDA 2HA3A 5HF9A 5AKLA 1JFRA 4X91A 4EB0A 4WY8A 2WHRA 4KE7A 1LPAB 5JADA 5EIHA 2VTVA 3BDVA 1QE3A 1JMYA 3I6YA 3H2GA 2VEOA 4DSZA 5JALA 3VXKA 1T2NA 2JGMA 1UK6A 5ALSA 4CI9A 4KYVA 3FYUA 2RI6A 3KDAA 3GFFA 1ZOIA 1XFDA 1TCBA 2XMBA 3R3XA 5K3CA 4H7EA 3OM8A 3S8YA 5KWIA 4DYHA 1CVLA 3LIPA 5FPPA 5CH3A 1YA8A 2X5XA 4UHDA 2WU4A 5IVDA 5EHQA 4BC1A 5BWCA 2AJLI 1XQXA 3WYDA 4N8DA 3FLBA 3AIMA 3AFIA 3DEAA 2C7BA 1CUVA 4TPKA 1G4HA 4C01A 1LPOA 1MAHA 3IBTA 4AMZA 3IIIA 1C7IA 3FSGA 5AKKA 2W6CX 3M82A 1JT2A 5AM3A 5CH5A 4HXGA 3W05A 5DYTA 2P8SA 2QMQA 3RARA 4BP9A 1XLWA 1XZMA 4E46A 1XZDA 4MQMA 5HKBA 3R41A 5ALFA 1GQSA 3L1HA 2O2HA 4CIAA 2JGKA 5DJ5A 1EVEA 3RM3A 4FLEA 2ACEA 1JI3A 4HS9A 1XZLA 2QXUA 5A2GA 1QTIA 2X8BA 2HM7A 4BBZA 3WA6A 7YASA 5AKYA 2XI4A 2IIVA 1AZWA 3WL6A 5DNVA 1QIJA 2XMSA 2CB9A 5HFAA 5BOVA 3GZJA 3D2CA 1GPKA 3DNMA 3WK6A 4BAZA 3QPCA 4H7JA 1CUFA 4K6HA 1IZ8A 2DR0A 4FOLA 4J0CA 1YS1X 1JJIA 3HXKA 2QXTA 2CKMA 1G42A 1ZGCA 1HL7A 1MJ5A 2ONCA 1S8OA 3KWFA 1XRQA 3IUQA 1Z68A 1XZJA 4UFPA 5EGNA 5EIEA 1YR2A 3IDAA 3BF7A 4I4CA 2QUBA 1L7AA 2QOEA 2QJRA 2Y6VA 2AJ8A 2ECFA 1A7UA 2VT7A 3DS8A 2XUOA 1ISPA 2XE4A 4B81A 2B4KA 3C87A 2AJDA 1ACJA 1NU8A 1CR6A 1WOMA 2G5TA 2XUPA 4H7IA 3FVRA 5AM1A 4WCVA 4X90A 4B0PA 5CH8A 5AM5A 1BEZA 2PUHA 3WKEA 3IULA 1IVYA 1RP1A 5EHNA 5ALZA 1CV2A 5FPQA 5JD4A 4PSDA 2AJBA 5EIAA 3C70A 3G0IA 5T4HA 1UOPA 3H18A 5A62A 4QWWA 5E4TA 5AICA 4Y2RA 1DWQA 4QEKA 3H17A 5T4FA 4UBKA 4WJLA 1H23A 4C88A 5IVHA 1KU0A 1R4ZA 3AZOA 2OCLA 4MYDA 3PDCA 2HIHA 2WFLA 1LBTA 3H1AA 4QZVA 3DD5A 3O4GA 1DWOA 3F98A 1F0NA 4KEAA 3STVA 3UUFA 1NU6A 3PFBA 1GT6A 4GECA 3M81A 5CW2A 2W22A 3G02A 2HL6A 2O2GA 2J4CA 3IA2A 5HK9A 1CUIA 3ICVA 5AK5A 3F67A 3U0VA 2O7VA 2GZSA 1E8DA 4WDRA 1XKTA 5FV4A 4LIPD 5CURA 1C7JA 2HADA 3N0TA 2HU5A 5K3BA 4X95A 3PICA 5AOCA 4BDSA 3FLAA 1IUNA 1YB7A 3A2LA 5JAHA 5FUMA 1EDBA 2JEYA 2X76A 1YASA 2PU7A 3O0DA 3CN7A 2GBGA 4ZREA 3LCRA 4H7FA 5CTAA 2WTNA 3STWA 1OXMA 4MWTA 1SCIA 4DNQA 2VJCA 1EK1A 2XQGA 5ALEA 4JUIA 1VZ2A 1XZCA 1HPLA 2OG1A 5DTIA 4BTVA 3BJRA 2XMGA 4DNOA 3R3WA 3LP5A 1QIKA 3FYTA 4J0GA 4U2DA 1LPBB 5JASA 2XLCA 2WKWA 5ALHA 1MX5A 1XKLA 4DTCA 4UBNA 4BC0A 2ZYHA 5ALMA 1R3DA 2VQ6A 5LZ7A 5IKXA 1SCKA 2ZJFA 2XUDA 5LZ5A 4N8SA 2XUKA 2XDWA 4Y2JA 5CT5A 1AQLA 3WWEA 1I6WA 2QM0A 1ODSA 2XMRA 5ALGA 4XJVA 3AZPA 4WFJA 2WHQA 2WG2A 2BGRA 1X2BA 1AKNA 1YAJA 5AIAA 2XUIA 5K3DA 1AURA 3LS2A 2DQZA 3OTQA 5IVIA 3NOXA 1KU6A 3AJAA 3G8YA 4GHWA 1K5PA 2XUHA 4BZZA 4BCBA 1DWPA 1CUJA 1CUCA 1JU4A 3FCXA 3JW8A 5ALPA 5AK3A 1CIJA 3W9UA 3TRDA 1UFOA 2Z3WA 4Q34A 3QYJA 4FNMA 3A6ZA 4B80A 1O6FA 4G4IA 3HJUA 1QZ3A 2WILA 3O9VA 2B61A 1OILA 3WZLA 1W1IA 5D3KA 1QLWA 4DIUA 4DSAA 1XQYA 5A7FA 4KAFA 4C6HA 5AKZA 3E0XA 3R3UA 2HFKA 3DJYA 2RHWA 1E89A 3ESAA 5EHXA 1AGYA 3WKAA 2ZJ7A 1CUGA 3WJ2A 1J1IA 2BKLA 3BWXA 3KD2A 4J0IA 4UHHA 1VXRA 1VOTA 2PVSA 4AXBA 5AI0A 4RPCA 5ALUA 1IMJA 1E66A 2VT6A 1ODCA 2RGUA 4YK7A 1GPLA 4AO7A 1BE0A 2JF0A 3V9AA 3WK7A 3BE8A 4KE9A 3CCBA 5ALJA 4UHFA 4AX4A 2ACKA 5BWBA 5K3AA 2GBFA 2G5PA 1M33A 3HLKA 1JU3A 4WFIA 1U2EA 3TEJA 5A7GA 3FOBA 4EHBA 3D2BA 1UXOA 3C5WP 1MPXA 1UKBA 4J7AA 1FFEA 4J0HA 4ROTA 4W1SA 4GXNA 3V1MA 3D5EA 4Y2PA 1CUUA 3WL5A 5SYNA 3ILSA 5YASA 2PM8A 4X00A 4Q3KA 3GA7A 1WB5A 1ZIYA 4GBGA 4C4XA 5HF8A 2IX9A 4U2GA 1WHTA 3C45A 3C6YA 1MAAA 3QMVA 3LLCA 3DL7A 4EA6A 4QE3A 2CMFA 2B20A 4W1PA 1ZI9A 3EQ7A 1YB6A 4DMFA 2G63A 2XLBA 4Y9SA 1LZKA 3OURA 4C4YA 2I03A 5T4EA 1TKRA 4X85A 1QFSA 1CUYA 3WQHA 4OB7A 2OQVA 3WWPA 5AKJA 4FFVA 1NX9A 3VVMA 4F21A 1EINA 1XROA 2PSHA 4KE6A 5ALYA 2ORYA 1DX6A 1FFAA 3BDIA 4KAJA 4PSUA 3KXPA 1Y7HA 4KJXA 2H9YA 1CPYA 4M0MA 2CBGA 2DSNA 4Z49A 4DMHA 4AZ3A 4GEGA 3I2KA 5K3EA 2QR5A 4MYSA 2QKYA 5FOQA 3FSGD 4PF1A 2ZYSA 3IVMA 4MJ3A 3HZOA 1MNQA 2EDCA 2H7YA 3IUNA 2WLSA 4F0JA 1LBSA 1MU0A 2CJPA 4X97A 4UPDA 1MN6A 4FBMA 5JZBA 3G0DA 3R3VA 4X93A 1YSCA 2WIKA 1J07A 4HXFB 4P92A 4LXIA 2I3ZA 1ETHA 4UBOA 1BN6A 5CXUA 2GZRA 1R9MA 4KRYA 2JBWA 3IURA 3CCCA 3AINA 3HACA 4ZWNA 1XZBA 1H22A 2BCEA 4DNPA 1W52X 1CUAA 1MT3A 2PU5A 3I6MA 1EH5A 4MEBA 3C6BA 4C4ZA 1QGED 2WFMA 5LZ8A 5AIBA 2OAEA 4HAIA 5LIPA 3G0CA 4H7DA 1K8QA 5D6OA 2CZQA 1CEXA 4L72A 4W9RA 1CUBA 3V1NA 4BAUA 3I2GA 3WK4A 4X6XA 2C5FA 4L9AA 5E2IA 3R3ZA 4CCYA 3BIWA 3DOHA 2J3DA 4RGYA 1CFJA 4GW3A 3G0BA 3QPDA 1WCYA 4O08A 1ZIXA 1X70A 5BV7A 3WI7A 1UWCA 3G7NA 5AKGA 1EK2A 4BATA 3ZPXA 4ZGBA 1EHYA 3WIOA 4IQ4A 4AO6A 3VJMA 2QS9A 2OGSA 3M3DA 2JGIA 4NZZA 1W76A 1RYYA 4BCDA 4RE5A 3I6ZA 4U2FA 4G9EA 4B84A 1UZAA 5JZ9A 3F9CA 1E3QA 1VXOA 1DU4A 1XZKA 2Y2UA 5AKEA 5LP1A 4KAAA 3QITA 3PE6A 1GKLA 5CT4A 3QM1A 2XB6A 1O6GA 5JD5A 3HABA 4X94A 5I7UA 4X71A 4DLNA 2OCIA 3OOSA 3R3YA 2JGLA 3TGLA 3GELA 1IUOA 5CT8A 1QFMA 4EUSA 4DMKA 2YXPX 4G8BA 2CUTA 3KWJA 4FWBA 2OCKA 4N5HX 4UBLA 2C0PA 1G66A 5D7BA 5CRIA 2C4HA 4CIBA 4EBBA 3AIKA 4G4GA 1EB8A 3VKFA 5ALTA 4JYMA 4GI1A 4H77A 4EZIA 1XRNA 3W06A 2PL5A 4X6YA 3RLIA 2AXEA 3G0GA 4OPMA 5HFNA 4PO3X 3PF9A 5AM2A 3LIIA 1TCCA 4BVLA 1LPNA 1LGYA 4BZWA 2Y1KA 4FMPA 3QH4A 2WM2A 2WIDA 4Y2YA 1BRTA 5ALRA 2JEZA 3WYNA 4BE4A 2B9VA 2DQYA 1UOOA 5CMLA 1YAHA 5H3HA 4AQDA 3T52A 5CXXA 3DYVA 4H35A 4ZI5A 4BCCA 1YCDA 4Y2SA 3ZV7A 4HRYA 5FRDA 1B6GA 1U4NA 3ZLUA 1ZD2P 1THTA 1A88A 5K3FB 4IH4A 5HQ3A 3E1GA 3WLAA 5JIBA 5KBYA 4K6GA 2HA6A 4D9JA 3AILA 3K9BA 4Y2TA 3AZQA 1ODTC 5ESRA 1E8NA 3I1YA 2G4LA 5LZ9A 1ZJ5A 2WQZA 2OQIA 3I2IA 1BROA 4ITVA 4H0CA 3WK5A 3QPAA 4J3JA 1VJ5A 1MX9A 2D0DA 2WUFA 5ALLA 2OGTA 4YPVA 1BN7A 3MUOA 1E8MA 5FLKA 4Q1VA 4ARAA 3BL8A 4J0KA 1JJBA 3X3HA 1QO9A 3EBLA 3H2HA 3RKSA 6YASA 5I9IA 3UUEA 2VATA 3FAKA 4HRXA 1Q84A 1FFCA 4TVKA 5ALIA 3U1TA 4B7ZA 1XRPA 5AI8A 3BXPA 4WDQA 2QT9A 5KREA 3DQZA 4HVTA 4BDTA 5D3ZA 2Q0XA 2J3QA 4N8EA 1BCRA 2WJ3A 1J2EA 3HC7A 4UBMA 1XQWA 2E3JA 1TK3A 3FVTA 4F5ZA 3G9ZA 2RIPA 4A5SA 5LZ2A 4CFSA 3HI4A 1TRHA 3FNBA 3STTA 4BE9A 5CT9A 4INZA 1CUXA 4QA9A 4E14A 1HDEA 2VSQA 3NWOA 4G8CA 4WY5A 5HF6A 4B0OA 2WUDA 3C6XA 1TIBA 5DTJA 4UFNA 3N2ZB 2ZYIA 1L7RA 2EEPA 3MGAA 4PV7A 1T4MA 1MTZA 4Y2QA 1P0QA 2WHPA 3MUNA 1TCAA 4W63A 1EXWA 2HU8A 3OC0A 2LIPA 1DT5A 4JNCA 3W04A 4Y2VA 2WU3A 1YS2X 3G9UA 5JD6A 5HF5A 1FFDA 2GYUA 4CG3A 3O9MA 1ZI8A 4L3WA 4Y2UA 4J03A 4G8DA 1QIEA 4JYPA 4QNNA 1XLUA 5JAPA 4A16A 4GLBA 4QDXA 2HA5A 3FWHA 5AHXA 4UHBA 5AP9A 1LPMA 3MVEA 2XUJA 1BS9A 3DLTA 2OLEA 3T4UA 1XRLA 5AK6A 4LXGA 1CLEA 3F8SA 2PSDA 3B12A 3KOOA 4OUKX 1SCQA 3QMWA 4H7HA 1FFBA 5AJHA 2V98A 1UK7A 4KRXA 1WB4A 4ETWA 4B83A 4IH1A 3FYUC 4B82A 3ED1A 3WIBA 5ALQA 3Q8WA 4LYDA 1QIGA 2HA0A 1ORWA 1IUPA 5AKIA 3O4HA 4AN1A 5F4ZA 1VA4A 1RWQA 3STYA 3A2MA 2HRQA 4IHAA 4OYLA 2XMZA 4B9AA 1ZI6A 2ROQA 3I1IA 3OG9A 5JAOA 4F60A 4AB1A 1WPRA 4BAGA 1EX9A 4AMYA 2Z8ZA 1QOZA 2PKYX 4OD0A 2QUAA 2JGJA 3B3QA 3UMJA 1TQHA 4BTLA 3ESDA 4NS4A 1BCSA 2Y6UA 1VLQA 5AH0A 4CCYB 5DLPA 2HFJA 5AM0A 3I28A 1XLVA 5JAUA 2JGEA 5K3FA 1W75A 2UZ0A 4PQEA 4AO8A 5LLSA 2VA9A 3VJLA 4CCWA 5C81A 1XZEA 4W1QA 2FJPA 2HHAA 5AO9A 2DFPA 3DYIA 4C89A 5HZGA 2HA7A 4I19A 3WKBA 3WL7A 5IH7A 1W6RA 1SFRA 1R9NA 3EQ9A 1R1DA 5C7YA 3WJ1A 4MEAA 5LZ4A 3DOIA 4EY6A 5DYWA 3H2IA 3WWDA 2DCMA 2AJCA 3A70A 3DDUA 4XX1A 3WK9A 4DMCA 4JH0A 5E4YA 4ZV9A 1VE7A 5CBKA 1DINA 3O95A 5KWJA 4H18A 2JGFA 5ALKA 4Y2XA 1QIHA 4ARBA 1WB6A 3C6ZA 5A6VA 3HRHA 1JMKC 1QIIA 5ALOA 4KR0A 5ALXA 2HA2A 2Y2VA 1C4XA 3SC2A 4V2IA 1LZLA 2BJHA 5E4JA 4U2BA 4G9GA 5FKJA 4H7KA 4Q3LA 2V96A 1H2ZA 1DTEA 4UBJA 5EI5A 3DKKA 5AOBA 1LPPA 4TGLA 4MQLA 3I2FA 2PBLA 4PSCA 2XQFA 4EY5A 2XUQA 3FYUB 4HTAA 1CUSA 3K2IA 4DGQA 1JJFA 2QVBA 2HA4A 1FSSA 4XVCA 1UK8A 3EQ8A 1HQDA 4QLOA 3FCYA 4UBIA 2BUCA 3W2TA 3WKDA 5JYCA 3AUKA 1GQRA 2XMQA 5A7HA 4XWGA 1R50A 2GBIA 3ANSA 2PX6A 4UUQA 1F6WA 4ZRDA 1VKHA 2NW6A 2HU7A 4U2EA 5FP0A 4UHEA 2C0QA 3H04A 3F96A 4KACA 1QIFA 1DX4A 3TJMA 3D3NA 1E5TA 3R40A 5AKXA 4WFKA 3VDXA 1F8UA 3GBSA 2WTMA 3R0VA 2CEKA 3IB3A 5LYYA 1P0MA 1N1MA 2WIGA 1P0IA 1QJ4A 4FHZA 3WZMA 4G5XA 4QDUA 4LHEA 1USWA 3YASA 4G4JA 1XZHA 4Q3OA 2WSLA 5DNWA 4OB6A 2ZVDA 2VJDA 1FJ2A 2VAVA 3O4IA 1ACLA 5LKAA 1PJAA 4HZGA 3WK8A 4K5QA 1HLGA 3OPMA 3QZUA 3BF8A 4OSEA 2OPHA 1Y37A 4XIIA 3VISA 3PI6A 4AZ0A 3WA7A 3NUZA 3BIXA 2WFLB 1ZD5A 2XQJA 1P0PA 5AK4A 4OB8A 5FXMA 5AI4A 2H7CA 3ZLVA 3O4JA 5HKAA 1A8QA 5AI5A 2BUAA 2O7RA 3QVMA 4JEIA 2FJ0A 1UT6A 3CN9A 1MNAA 3QMMA 1THGA 4FFWA 2ES4A 1WPXA 4MWSA 3HYSA 4Y7DA 1AUOA 1K6EA 2XUAA 4Q05A 1GZ7A 1UKCA 5JZSA 3FLEA 1WM1A 2O2IA 1LNSA 5DWDA 2BGNA 1BEEA 1DQYA 4QDZA 4NVRA 1EDDA 4BRSA 2OAGA 4P08A 3AIOA 4BVJA 1A8SA 1AC5A 2J4FA 4CG1A 1U8EA 5DNUA 5SYMA 4YASA 1TAHA 2H1IA 1SOMA 4NMWA 2ZJ6A 5C8VA 4ZV7A 2XQIA 4B9EA 1ZD4A 4I3FA 2I3DA 5IVKA 4IH9A 3KSRA 4DM7A 1MX1A 4FLFA 1KEZA 1IZ7A 1CUDA 3SX4A 3GUUA 1YA4A 2WUGA 5C8ZA 1QO7A 4BYMA 1VZ3A 1N8SA 3CXUA 1H2WA 4FDMA 4BP8A 1EDEA 2GYWA 4J0DA 1CUEA 2H7XA 2VF2A 2QZPA 2Z8XA 1EB9A 2WJ6A 1CQZA 4GWLA 4X6UA 2YYSA 5ALVA 4P9NA 1AMNA 3C8DA 1XZAA 2Z5GA 4CG2A 3IUJA 2RHTA 4K2AA 3ESBA 3WWCA 2WJ4A 2WUEA 1LLFA 2D5LA 4BRZA 2VJAA 1F0PA 3PUHA 4YX9A 3STUA 2ZYRA 1QIDA 2HDWA 3D2AA 3PFCA 5JARA 4RNCA 5EFZA 4Q82A 1XQVA 2OXEA 5HK8A 4X92A 1CUWA 2C5GA 3GROA 2BAGA 2PSJA 1W4LA 3D7RA 3IUMA 1AX9A 1EI9A 2DHCA 3I2JA 4B6GA 1OCEA 3W9BA 2FUKA 4OYYA 1GPNA 3RK4A 4MXDA 3NGMA 4UFOA 4QLAA 2RAUA 2ZSHA 2I78A 3BJMA 4EY7A 1QIMA 3H19A 3P2MA 1UK9A 2OCGA 2WHPB 3QBJA 1H2XA 3ANTA 1Q0ZA 2WG0A 3E4DA 3WL8A 4U2CA 3B5EA 1EVQA 2WIJA 5HQ3B 3VJKA 1CUHA 1XRRA 3C43A 4EY8A 5ISMA 3G9XA 3D59A
chains in the Genus database with same CATH superfamily
3RU3A 4L02A 4M0CA 5F73A 3V4LA 4BB0A 1TEXA 3QRWA 2RGCA 2CCKA 2VYNA 2VJBA 2LE0A 4I50B 3CO5A 4FW9A 2H57A 5A5EA 4WD3A 3C4JA 2IPLA 1WIWA 2A9KA 3NC0C 3E3OA 3WMRA 1NDUA 1Q21A 1WCIB 2XMPA 2XQKA 3VZDA 4JLWA 3HCBA 4N3GA 4Q7QA 1O08A 2VP3A 4Q4AB 1S3FA 5IAJA 1GJRA 4AP6A 4DQVA 1NXPA 1HT0A 4FMCB 3BB1A 4F6CA 4Z4CA 1EXMA 2W5UA 2X8WA 5KPDA 1Z4KA 4NZOA 1FSPA 3FNQA 2R87A 2ZJ1A 4NTZA 3G3EA 3CH6A 5C7IO 4MVJH 2YYYA 2BM8A 3CNHA 5D1NA 1R10A 1O94D 2H4JA 1ULTA 2HRRA 3IPAA 3GMTA 5FNZA 3PIIA 4U5QA 3WISA 2IUTA 1KJ8A 2RJOA 5KX5A 1BHO1 1LDMA 2EKQA 2LDXA 3W3AD 3V1LA 5BR1A 3AVWA 3I76A 3UATA 3TUZC 1SZDA 4PW0A 1AE1A 2VG8A 3CNLA 4J2HA 4PBRA 3ZWQA 3U4QA 4IP0A 4R16A 4UHKA 2WWVD 3LYUA 2PZLA 2B1IA 1GDTA 1ZICA 5TNXA 5JTUA 2HT1A 3IXLA 5IYZA 3BRWD 5HCUA 4OYHA 2Z3ZA 3ZE2B 5JECA 5E1DA 3ESCA 1DVRA 3P32A 2XB2A 3JVDA 1OFTA 1AKUA 4KE8A 4UM7A 5TQ0B 1DNPA 3JYPA 4N3AA 1XP5A 2K2QB 2NNWB 3LC2O 4II2A 4PY2A 2IZ0A 4EQ6B 3NH9A 4N5IX 5KQLA 4RDHA 1BU8A 3VC2A 4BN4A 4YJ2F 3IR7A 1JVSA 3VDRA 4AY2A 3WHLA 4F72A 4O59O 4AZ0B 4B5LA 5ES3A 4K7JA 2HHCA 4F9EA 1XZGA 2H16A 4R84A 3E27A 1NJFA 4Z53A 1E2QA 1L7EA 1I10A 1Y4UA 2FZKA 4TMKA 4KV7A 3ORYA 3TUIC 4OU5A 3ND6A 3K2BA 3TKLA 4DLYA 2IZ6A 2PX5A 3RJ9A 1Y4DE 1VHDA 3ZX5A 1JH8A 5K8JB 5B58T 2QLBA 1JXQA 5I9SA 1QHYA 1WBDA 5A9SA 2CNDA 1IZ9A 1RWXA 1FDUA 1X7HA 2CDAA 1VJ1A 3M83A 1BJTA 3V4OA 3ZNQA 1DRJA 5JH7B 1ZD3A 3AVTA 4HGOA 1U1FA 4LDZA 4GDMA 3NWEA 3EF3A 4KW7A 1EDOA 1FP7A 2CSXA 3A28A 4Z8YA 1RRKA 4JSTA 3GYBA 1ZOOA 3UJAA 4A6XA 3CFYA 1V6SA 2YX1A 1DEOA 3FPHA 1WUHS 2GAAA 2WRZA 4PTLA 2ID7A 4FYMA 5L40A 4KLCA 4MNTA 1Y7IA 1S0UA 4FE7A 1KO8A 3VSBA 2A0YA 2I5PO 5KKCA 2ET6A 4CKBA 3R6DA 1CF2O 4HAYA 4UUBA 4D74A 5AI6A 3G9TA 3IKMB 2OESA 5GZ1A 4YI5A 1A72A 4YPOA 1ZW1A 5AI9A 3QE9Y 2IHVA 5EKSA 1IYZA 5T4BA 2ZAGA 2QTTA 1IY0A 1GCUA 3LQ1A 4EJSB 4HRVA 1PV1A 4MVJG 1QZZA 1CZLA 2OCDA 1M6YA 2J7PA 3PFKA 4ND3A 1AO3A 1YE3A 4X8MA 2I2FA 4EY4A 4PAMA 2GBCA 3O8BA 3KP1A 1JHOA 1VGRA 2VXCA 3OU7A 2GN0A 4EB6A 4ACAA 3E18A 4PIMA 3S81A 3H0CA 4FTWA 1U65A 3FF1A 3QENA 4RMGA 5JYDA 1ECCA 3F3YA 1AKTA 5F9MA 1TU3A 5EMHA 5I8PA 1PS9A 3WB0A 4KTVE 4UMEA 4NS1A 1TECE 4Y9TA 1OTYA 3EOBI 1VE6A 3IPYA 4R8MA 1PDVA 3SZ3A 1L5HA 2MMCA 1G3UA 4G4SO 3SD7A 4CLDA 3OZUA 4RMJA 3UICA 5LQRA 4LF6B 1XYGA 5BV1A 5JNSA 3J7TA 3HSSA 5A9RA 1UBFA 2CVZA 3AHFA 4F7WA 2AMYA 2G77B 4GX5A 2EX0A 2BISA 4UEJA 1FZTA 1X77A 4TRJA 4TLMB 5TT0A 5FDFA 3HB1A 1ZRNA 4HNSA 1SD5A 3T5CA 3L2OB 2IP2A 4OUDA 3PGMA 4J7CA 2YINC 1D07A 3NWBA 3QG5A 4EPXA 4H1UA 2Y8EA 3HNOA 4OTZA 2MSLA 2TMKA 1G6OA 1UOQA 4UW9A 5FOVA 2ZSIA 1YQGA 3OPNA 3Q2OA 1H9BA 1PQPA 3CX6A 4C0QC 4NLLA 1YR3A 3TIGA 4DNFA 1QTRA 4ZEVA 5EJFA 3IEVA 1J70A 3P0RA 5K5EA 3Q98A 5KYKA 2GZDA 3LGSA 3RASA 1G55A 4X7BA 5LFAA 2FVXA 1Z39A 4ZI3A 2NO7A 2QTBA 5JANA 3LTNC 1N5OX 2R8EA 4ECAA 2PSEA 1GFIA 3D64A 2VBCA 3NBAA 4J76A 1VLJA 3HH8A 3HB9A 3TOZA 3HCPA 1ONNA 1SHUX 2EX1A 4EVSA 3D3EA 5BSMA 3IPXA 5ALDA 3WGMA 5K8UA 3Q7TA 4ZVOA 3TAUA 4OHFA 1VI6A 2OMEA 3TM5A 4OU4A 1YQEA 2WG1A 4P31A 4QDOA 4ZI7A 1H2YA 1PEYA 4NNOA 4E70A 5HQJA 3D6MA 5C52B 1NLYA 2C58A 1NM5A 3TEMA 4QG3A 2A5DA 2WWFA 2JFHA 5K3OA 2WV9A 4N3CA 4BQRA 4EFMA 1JXOA 4RGQA 4WK0B 1DAKA 1R0KA 2HV8A 4GI7A 4K1LA 1KI6B 1HBJA 1JQBA 3RVSA 4LZAA 1MO3A 1NA5A 4EZEA 1SXJC 4ZCRA 5CBPB 2BCJQ 1APBA 2R1TB 1DT3A 5KYYB 5IJZA 2VDOB 2WP0A 2AG8A 4GYYA 2CL5A 5K0JA 1A8HA 2NMVA 5DIFA 1L5OA 1OXKB 4YUAA 5CAEA 3U7HB 2NYVA 4IOMA 4TSFD 1ZUNB 1SU4A 4RX1A 3EHEA 1RMYA 2WD9A 2XNSA 1R88A 3EVGA 3F9RA 3QNUA 4KXYA 4RKYA 4LTMA 3UC5A 1W2GA 2VLIA 3PE3A 3MMNA 2JIDA 3P9SA 4A8PA 2HA3A 1DTSA 3IQEA 4IFEA 4NJMA 3IQFA 5E9AA 3DZGA 3CX7A 1JFRA 2D3WA 2GPTA 3QA3E 3FWNA 4X91A 2E85A 4ZAYA 4CM8B 1E96A 1OXVA 1UBSB 1YS7A 1T9BA 2JRLA 3UH0A 1HSZA 5JADA 3LY8A 1Z5ZA 5FFFA 4H1VA 5EIHA 2JARA 2IW3A 3OT4A 1FIUA 3X44A 3BDVA 3H9EO 5CXSA 4IR7A 2VJOA 4TVBA 2IXBA 2JGDB 1B43A 5JALA 1YZQA 4TUYF 2YWCA 1MC1A 1Q2UA 4CI9A 2YIVX 3PBKA 3V8MA 1I24A 3D6AA 2ENWA 3VAZA 4F84A 2ZXUA 4LXUA 2VHWA 1K9VF 4C05A 1U7ZA 3KDAA 3H1GA 3RS2A 1LD3A 1TCBA 2ZBGA 1ZESA 3PHJA 3QHPA 3V7WA 1SVUA 1YHYA 3BRSA 4PRYA 5IZCA 3CS3A 4FGZA 4MGEA 1IN4A 1JQ5A 1YK1A 3S8YA 4U0JA 5BN4A 2R00C 1USUA 1OKKD 3LT5A 4EMSA 1JYFA 1JDJA 5CH3A 3TIXB 4B8ZA 1IOVA 1KRWA 1P5ZB 3TW8B 1RQPA 2VKTA 3VMMA 3ZGVA 2R0QC 2A92A 4TT3D 5EPUA 4RC9A 2LDBA 4BFVA 4RTNA 2C3UA 1T9HA 5GOZA 4LE1A 3SX0A 3ORQA 3VKVA 4DRXB 2WU4A 1G18A 4P5EA 4C08A 4IWYA 5IVDA 1QR2A 2VK4A 3BL6A 1XD2A 3EIWA 3EUFA 1P9RA 3FOZA 1XQXA 1N3BA 3RIHA 5KVVA 3JAKB 5DLEA 3AM1A 2XH8A 4PYOA 2JLCA 1ZMTA 2OKCA 2OVFA 1DAFA 3AIMA 1ZN7A 2MHCA 4MVJF 3GIWA 5TARA 1B4DA 5BNIA 1G6HA 1UIMA 1US8A 2W2QA 4BZXA 1JMVA 4LGYA 1IDN1 4IINA 3EXFA 9LDBA 5AVWA 4DQLA 1JEOA 5EKUA 1NLMA 1TMKA 2GEDA 2HJRA 1LPOA 4BO0A 1H8EA 2B7CA 4UDOA 1NPYA 2PYIA 3M5WA 1Z7EA 4F3NA 4BECA 1JIJA 4EUNA 2GMWA 2F8SA 5J2TB 4YN3A 1HI9A 2W6CX 3ILHA 2OV4A 3CGWA 3ONVA 1XUOA 2ZB8A 1FW6A 5EZ5A 3RGGA 4DNXA 1TMYA 5KNBA 1T9GR 1NBWB 3KEQA 2AOTA 2IV7A 4RXMA 4Z2AA 2QW0X 5I45A 1LDGA 4Z3OA 5BQXA 1C8VB 4PQYA 4F86A 1B3RA 3ABIA 1ULUA 3HUEA 4EQ6A 1A95A 1TK2A 2GA8A 4MQFA 1KWGA 5DF1A 2OT3B 2LIVA 2Q27A 1ENZA 5BW6B 5CK4A 1UZMA 1JBKA 1QUFA 2ZFUA 4CV2A 1U7DA 4YWHA 3KUCA 3KTDA 1ZNWA 5JPIA 1DAGA 3EMVA 3IOMA 2X7JA 4NULA 3KIPA 1NC1A 1Q7EA 3H9GA 1N57A 3K9GA 1QK4A 2JFPA 3BKXA 1I9CA 1KTVA 1RQRA 3Q3GE 4IGIA 4MKZA 5ALFA 3V8EA 3OZCA 4B73A 4I14A 3R9WA 1D5CA 3AXTA 2JGKA 4GPBA 4DSNA 3OAAD 5F3DA 3OFKA 4D41A 3LV8A 1YJQA 4KLZA 5L7WA 3F4KA 3RG2A 4ANFA 4XEHA 3VDNB 2NUPB 4RD0A 3NPMA 3FJYA 4NPHA 2V0NA 4MJLA 2WF6A 3F3SA 3SI7A 1LTHR 4RPGA 5F2OA 3BICA 4KUGA 4NXNB 3LF1A 1XZLA 3E5MA 1YCFA 2QXUA 3M1AA 5ECGC 1UBMS 2WYUA 3FUTA 4J1SA 3UOWA 1BQ3A 2EP8A 4TWZA 1Z2AA 3GCWA 3Q3JB 4FE4A 1JHVA 3H6GA 2C4VA 1NN3A 3HI6A 3WP1B 1J22A 2QDKA 3JSAA 3PLNA 1IH8A 4F1KA 3G79A 3OM1A 3IMEA 2CXSA 3AF0A 3WL6A 1C2TA 2EERA 3JYNA 2IUFA 4UD6A 1Z0FA 1WSBA 4EGCB 2ECOA 3U09A 4TTAA 2XMSA 2X19A 4PAGA 2CB9A 4TSFA 1ZH2A 1JDZA 3CHYA 1QVVA 4RZ3A 4WT7A 4J1TA 1E2IA 4WZZA 3TLGA 3J80A 1DBIA 3PFWO 2D5BA 3SC2A 4B74A 5J4YA 3PEFA 4B46A 4L07A 4DCNA 2ZITA 3GZJA 1N3LA 1GPKA 4JLBA 3CRQA 2VRCD 3BMQA 1M2EA 4NDZA 4NPCA 3T12A 4B2IA 4QUAA 4BN0A 2P2SA 1R8SA 4HUQB 2ONJA 1Q3KA 4K6HA 4KWTA 1Z2NX 1IZ8A 3MERA 1D2GA 3LPDA 3WYEA 4GYJA 2QW8A 2FSFA 3F6RA 1ZZGA 3W3AA 1C8KA 2K7ZA 2XHZA 2EEZA 1P5HA 2ZRIA 4XXHA 5HXAA 3B3JA 3VR0A 5JROA 1U9CA 5F35A 4MR7B 2CKMA 5KJFA 1Z5GA 4UPVA 1W44A 1G42A 3W3AH 3I3OA 3JRXA 4ZVKA 1PWZA 2NU7A 3E9EA 4UAVA 5ERYA 3ENVA 2WEKA 4EI8A 4MDEA 3ZHXA 2H65A 1CYDA 4CL8A 4ALJA 5TJ9A 2ONCA 3ESRA 4JHXA 3A4YA 1S8OA 3KYDB 4I99A 3BRQA 4FC6A 1RYDA 4C7OB 5BVHB 3IUQA 3OQPA 4KHZA 3HU1A 1BE8A 2QTHA 3KNZA 4MS1A 4U9HS 5EQDA 3K4HA 1I2MA 2PPVA 4I4NA 5EGNA 3JQEA 3FPLA 4N0QA 2FPGB 2V7UA 5K8TA 4CEJB 4YGYA 2I3BA 1JEQB 3FF4A 5D51S 2NU6A 3WYCA 3ZCTA 1I7DA 1C3XA 1DOZA 2BEVB 3QP9A 4Q1BA 1EE1A 3NW9A 4GWGA 1Z6YA 1L7AA 5FOSA 1Z4NA 2PS9A 1ECFA 1G9SA 2ZAIA 1KQPA 1Y0BA 2ECFA 2Y1GA 3Q8MA 3AONB 5A4KA 4DJ5X 4DG5A 2CVFA 2XE4A 3UKDA 1J0DA 3EOZA 2GWRA 4KKVA 2JVKA 3T61A 4BMOB 2O19A 3GB9A 4HK4A 3TSZA 2O52A 3MGGA 4YVFA 4YQYA 4CMEC 2EFJA 3BA1A 1ACJA 1AOXA 1NU8A 3NZEA 1WMBA 1WOMA 3O8OB 3QQPA 4NBVA 5KNDD 4AUNA 1T4CA 5FBRB 4YMWA 4ABYA 1OLSA 4OHWA 4DC9A 4F04A 3FPJA 4M86A 3U4DA 3MWYW 2QMUA 4IIDA 5AM1A 4WCVA 2ZANA 5FHQA 1Q22A 2JAPA 4B3RB 3D8BA 3IR5A 2C2OA 2CHFA 2WK1A 4GBJA 4DCPA 1BEZA 1J5PA 1Y5IA 1EZ1A 1A8PA 2W0MA 2AXNA 3CEHA 3OPQA 4G0NA 4G5GA 4PHTA 1T6YA 1M6VB 3ZXXA 3FHLA 3PIDA 7ABPA 1FJHA 2FF7A 3MCWA 1FUEA 1BKDR 2XGSA 4P3XA 1W59A 3NI2A 4D1YA 4ZK6A 4RVDA 3LHSA 5EHNA 2ZYGA 2OM2A 1PT9A 3D3KA 3LA6A 1DRWA 4R4JA 2D1YA 3DTNA 4QTTB 3VU0A 4FOSA 4R5MA 3VC3A 5LP6A 2D6FA 1UMCB 2YY7A 4AT1A 3LUJA 5EIAA 4JC0A 1JV2B 1UM8A 3G0IA 1TX4B 3KYBA 3NTOA 2C94A 3K0AA 3FFWA 3UIEA 3H18A 5EMMA 1EJBA 1PG0A 1DKPA 2L42A 3Q3VA 5E9WA 5A62A 4RULA 2ZRBA 4QWWA 3RKUA 5E4TA 1RRCA 2ZPTX 1U5BB 2IYVA 1TPZA 2RG7A 4M7OA 3ESYA 4G63A 3ZBTA 3GVHA 5CA0B 3QNMA 5KOHB 3N74A 4B33A 5JH7F 3WYBA 4CHTA 2HBQA 4GL2A 3H17A 3JALA 4HYTA 3V1TC 5DTRA 4UBKA 3BTVA 1H23A 3O4VA 3ZD9A 4WJLA 4ABTA 3N8NA 4C88A 4A8HA 1KU0A 4MV8A 4CU5A 3VGPA 3PDCA 1C9MA 1Z35A 3B7GA 5F51A 1GGNA 2HIHA 2BM1A 2Q28A 2WFLA 3ZW7A 4DDHA 1S3SA 4Q1AA 3B1YA 1TU4A 1A9PA 3F98A 1F5NA 3IEMA 3TLAA 1NFRA 3PQ5A 3JAWA 2QB5A 2ONKA 2DSTA 2FPIA 3OMLA 3Q6NA 4ZT7A 3SF8A 1GT6A 3BYZA 1M2KA 1J1ZA 3PL1A 1OWNA 4GECA 1ZM9A 2D0OB 1U81A 4MI6A 2VF8A 1JYEA 3ZY3A 5BURA 2OENG 1P60A 1D8AA 2DWCA 4TLCA 5HBGA 1Z6XA 3PC7A 4MKRA 2HL6A 2O2GA 5TPWB 4P0PB 2C8KA 1NXVA 5KDDA 4L8YA 5AK5A 1KVQA 3F67A 3NETA 1XU7A 3TCXB 5JCJD 1Z82A 2DM6A 2OD2A 4ASUD 2PT5A 1YRHA 4LIPD 5CURA 3HZHA 3F74A 3N0TA 5DNCA 2E5FA 1E1LA 1G21E 2VDQB 3DE3X 2E82A 3UJNA 2QNIA 4X95A 3T4PA 4IGKA 2HMVA 2ZS9A 4ESOA 1YB7A 2D0PB 5C32A 2ZCVA 3ASVA 3S1AA 1HE8B 3K5PA 3URKA 5A3QA 3GRUA 3AQIA 1KZ6A 2B4QA 5BSUA 4KJZA 4BGVA 5FUMA 3SHOA 1C7ZA 1YASA 2PU7A 3EXG1 4GZ6A 1N3IA 3A1VA 4MARA 1UFQA 1BFUA 2JH3A 4UVHA 5DNAA 1KQNA 4IYJA 5A3SA 4K03A 2YWGA 5TC4A 4CKYA 1JDPA 3U4AA 3EAFA 4H7FA 4I9UA 1FY2A 2W6NA 3OSZA 4MRAA 2BSAA 1BVRA 2HLDA 4O4JF 3H5TA 1COWA 1PFVA 4J4TA 1OXMA 3STWA 4CLRA 1T2UA 4MEJA 3DLAA 1JDNA 1KI3A 5TS3A 4UULA 2P9ZA 4PGHA 2CDCA 3FM9A 1ZM2A 3KEGA 1WQ3A 1G8KA 4YAWA 2P78A 3HJCA 4YPFA 1NMXA 5KJ6A 1IXRC 3HJHA 2IY7A 2J6CA 4YP9A 2DFLA 1NZFA 3BJRA 3KXKA 4YDSA 3FNEA 5LXTF 3R6LA 4DNOA 1KZ9A 4CTNA 3LP5A 1QIKA 4Z7JA 4AKIA 3MJRA 2FR8A 1H94A 4NAUA 4V0LA 3DPIA 1TTQB 3RSHA 1PFUA 3PB3A 2F62A 1YC5A 4HNQA 1DOAA 1KYXA 2CNOA 2J3EA 1UP7A 3URMA 1JQDA 2R48A 1LSJA 3QKWA 4KC0A 1R0BA 4GM4A 2P65A 3KJEA 2ID8A 4S1TA 4UREA 1S1MA 1Q6ZA 2O5VA 3O8QB 4G1EB 4Q0MA 1XKLA 3WB1A 5MHTA 2GPYA 2H29A 4DBVO 3VYSB 2SBTA 1R3DA 4HLNA 4X9XA 3KQVA 1XFAA 2APJA 5LZ7A 1JJAA 4KQWA 1JL3A 3AUSA 1WD5A 4C30A 4AUKA 4AZ3B 2CBXA 1OAKA 1LKZA 1AIPA 3CF2A 5LZ5A 4CQJA 1TM3E 5GM1A 1WXIA 5IFLA 2YZNA 2MYNA 1TZKA 2C2BA 2NXCA 3EXAA 1MVLA 3F78A 3GLRA 1P9LA 4LZZA 1GPUA 4IDQA 3T9BA 4CTKA 4MRSA 2PUVA 3UUWA 3RIYA 1WUYA 1NF9A 2WJZB 2VTKA 2Y0CA 3WWEA 1C7QA 4BIMA 2GWHA 5IT5A 1N1DA 3RVDA 2C9YA 5LQNA 3VSDA 2Q2OA 2H17A 4YTEA 2ZZMA 5CFNA 1AY0A 4KQCA 1EWYA 4BVFA 1F4PA 3SZMA 3TLCA 3OIFA 3AZPA 5JHGB 4XD7D 4MRMA 4PZDA 3AKCA 4CN9A 2SNIE 1QCDA 4YS6A 2FH5B 2VJMA 4CR7A 5C8YF 3M1LA 1M67A 2DMRA 2BGRA 2JD0A 3UK0A 4O2AF 4OAOA 5BSVA 1X2BA 3D4BA 1CR0A 2IYLD 3MB5A 3DGFC 1W29A 2UUAB 1IJFA 3X1DA 2FQWA 4ZHQA 5JDIA 4QTZA 3WMGA 5K3DA 3VR4H 3LS2A 3FTCA 3NAZA 5DP2A 4KR9A 5NULA 4IVNA 3ZJ5A 1TW2A 5BPHA 1QNFA 4FJ2A 3LGXA 1ZGAA 4FSDA 1KK0A 1X7XB 1VIAA 4MR9A 4NFHA 3D6FA 2W6PA 1F12A 1LWOA 2JZCA 5AQ1A 3N39C 3QWFA 4BNWA 4N48A 1L4YA 2EFHB 5J59A 1KGDA 3B60A 4RY2A 3JW8A 3UJCA 1KDPA 2H5EA 2HF7A 4S1VA 4RZ2A 3OUTA 2XGJA 3RFFA 2ZVQX 4Q4CA 4KDFA 2O7NA 2IXTA 1SKUA 1G8PA 3DB2A 5LQDA 4AN4A 3LYLA 1UFOA 2F48A 2G9UA 4J3NA 3RRJA 1SXQA 4B6RA 1V35A 2Z3WA 3JVVA 1RHRA 3QYJA 1VRVA 3ZGNA 4DUGD 5LQAA 3KE8A 4HNAB 2QE7D 4N0EA 4B3CA 4XVQA 3BB3A 4KREA 3RT1A 4HNTA 4E33A 3SOPA 1JLLB 1ZH6A 2FE4A 5ITZB 5L3SA 2CNKA 1YUBA 3NIDB 4X84A 4EPWA 3HJUA 2O20A 1PHPA 2RGNA 4F1WA 4I9NA 3COVA 3SYRA 2H2IA 1H1LB 4KZKA 4MS3A 1MC5A 2FPLA 2B61A 4PPNA 4UJ3A 4X60A 1XMIA 2FQQA 3SGLA 3OWHA 3ZH9B 1J5EB 1LNZA 2BFPA 3K72B 3MW8A 1OILA 3L5OA 4UUOA 1BGVA 1TYZA 2ODPA 2RG1A 2EC5A 4LNUA 3RW9A 1W1IA 4MQ6A 1QGUB 3FTEA 5A04A 2XXBA 2EW8A 4Q00A 1QLWA 3PIRA 4DIUA 2Z04A 3HXTA 3TL2A 2ZI3A 1DIRA 1IXZA 521PA 2EKLA 4KAFA 1G21B 4EL5A 1AF4A 3IVGA 4P3NA 5CLLA 1U2DA 5LM3A 5JR3A 2OXIA 3VPAA 4ZMBA 2IDJA 3ETCA 3BM5A 3M5CA 1JDTA 2GPWA 3MAGA 2YW9A 3DJYA 4JYZA 4QKQA 1RPAA 2RHWA 3DFZA 4R5HA 1LCIA 1VYUA 3U4MA 3KQKA 1TPYA 4YA6A 2JFUA 2ZKIA 3BHJA 2K4MA 4YREA 3DB1A 4DS3A 4KNWA 3D8HA 5IK2A 3QEAZ 1QAQA 3BCRA 4KKXB 2XXAB 3G8CA 1T34A 1GUFA 1HT3A 3B2QA 3OSUA 1GQ2A 4LBZA 4LZNA 4QASA 3WJ2A 1J1IA 3BWXA 2Z4TA 4GC5A 1AQUA 1W5TA 2PVSA 1ZG3A 4AXBA 4OA5A 2FWIA 1E2FA 2DTXA 3KPJA 3HDGA 2AG0A 2J08A 3LE8A 1M66A 4RPCA 1LVHA 4EVRA 3ZV3A 4YAUA 1ISGA 4JJIA 1XKQA 2ZRJA 3G8AA 2WVAA 3FGOA 3KXLA 4QUEA 1VDMA 3P9ZA 4FCTA 5EE0A 3U3XA 2X1LA 1O89A 3GFVA 4QU5A 3WV4A 1SA0B 3LY7A 3IFSA 4TXNA 1FP6A 3F7MA 1P77A 3CKKA 2FFBA 1JHZA 2RGUA 4WSOA 4CMIB 3L7OA 5J9FA 4BQPA 5JAMA 4GD3Q 4GX2A 1OGYA 4BGUA 3NP9A 5C4GB 3F2IA 3JQAA 4BYGA 1H4SA 2JF0A 3PGVA 3RYHB 4HEJA 1V9CA 4PZAA 1WAMA 5BNFA 4DZRA 4PO1A 4RADA 4R2MA 3KDPA 4AJIA 1G63A 1G8FA 3KZMA 2G5PA 2ZETA 1ZCFA 4B6PA 3O0TA 4ZV4A 3HLKA 3I61A 4LJ6A 3UPDA 3NC4A 2B1QA 3Q85A 3TLXA 3AUUA 1U7XA 1KMQA 2VUUA 2WABA 5ERXA 4Q01A 4RD2A 2DR3A 2RHGB 2YJTD 4GH5A 3TEJA 3W1WA 4MV0A 4PRLA 2AOUB 1IPFA 2XWBF 4EHBA 3SSAA 1EGQA 4ZK2A 3MM4A 1U0FA 4DLLA 5GGYA 3J81A 2QAGB 3GUYA 1K97A 2ZBVA 3ASYA 2JFNA 3R74A 4J0HA 4O4HA 2NOAA 3GK3A 1GUBA 3LFHA 1HORA 3PK0A 4NHEA 4OMFG 1HRDA 2XYHA 3B7WA 3PITA 4PX3A 3T7KA 1GR1A 3WL5A 1RPZA 3CLRC 1RD4A 4AJ2A 3EXHC 3WQQA 2UUBB 1GGJA 2AE1A 3ISJA 5T3YA 2CC2A 4KO3S 1NLZA 4Q3KA 3WAJA 3IHWA 2JFZA 3WS7A 3AERB 1ZIYA 3LU1A 3ZN2A 4GBGA 4D0LB 3DVSX 5FI3A 3CVOA 3R7WA 1WHSB 4FR5A 2PMBA 4OH1A 3MF4A 4RJKA 5HRCA 1T1SA 1E3EA 4GSYA 1LB1B 3IBGA 3L1UA 1CDEA 3OESA 1QDUA 3OPYB 1OF1A 3C45A 4QYMA 1EJ0A 4YCAA 4AQYB 2CWDA 4Y2GA 2C7GA 2BEUA 1ZRSA 2W2KA 2RAPA 1QH8B 3FMGA 2IUUA 2UYQA 4JJGA 1IBRA 4C3UA 3AR3A 3ZIUA 2GBLC 1I2DA 2QSYA 3V2GA 3OLQA 1BHQ1 2AEJA 5L3VA 2DPMA 2B20A 1RCTE 2XEXA 4FHGA 4UNIA 1A9YA 1GNSA 4PRZA 4O25A 1DKRA 4GPZA 2WU8A 3KQOA 4MRRA 3ROPA 1H2BA 1L5VA 2M9MA 2P6PA 2QX8A 3AGPA 3F3MA 3PS9A 1V43A 1UJ2A 2HCJB 3LDHA 2COKA 1AQ6A 4URYR 2XLBA 1KXJA 2DYKA 4Y9SA 5AYVA 3U40A 1LZKA 4LA4A 1RXVA 1JG1A 4NAHA 2RFLA 3HO1A 3FCSB 1DADA 4LVOA 1PKXA 1SVWA 3GT7A 3FTPA 4FJ0A 4GLFA 3OFND 4KIUA 4Q5IA 5JMTA 9ABPA 3GAMA 4MLZA 5C46F 1OIVA 4S2EA 2AG1A 3LK7A 1BAPA 2WYVA 5F5LA 2GJKA 4UM8B 4UVEA 2EVWX 5JSHA 1KQFA 5GQSA 4QBIA 3ZX4A 4Z4IA 2Q9UA 2HSZA 5AKJA 4AY5A 1P1RA 3JQBC 2W43A 3PGA1 4N7MA 5IT4A 1FUUA 4DV3B 2H5JA 1KEUA 2J33A 4HWRA 5JE8A 3VVMA 2G4VA 3PXEA 4F21A 1SN7A 3PTAA 3DOUA 3BFPA 1Y5NA 2XKAA 2FOLA 2C8JA 5ALYA 3G5TA 1SC6A 2ORYA 1DXHA 1UXGA 5B2FA 4V38A 4DWWA 4Z6KA 1P7ZA 1HFWA 2AN9A 2C5HA 1WPQA 1ZN8A 2H9YA 4XIGS 1MRSA 1Q1QA 3CT6A 3KJGA 4PGMA 3FNGA 3PKIA 4DV1B 3ZKAA 3B1ZA 4YJ3B 2VPQA 1GZ6A 2CBGA 4LFBB 1ZNQO 2G9QA 1NUSA 1ISRA 3ENZA 4MB2A 1YCGA 1SBHA 2XUZA 1FTWA 4AZ3A 3E48A 4GEGA 4MHOA 2DPGA 2VSXA 3FXAA 3L7NA 4HH4A 4P34A 4QJIA 3G23A 1E4OA 1H65A 2FUG1 3CZ5A 4OQMA 1W73A 2QR5A 2QKYA 4XJXA 2JHAA 5DT9A 2WY2D 1KMMA 3VQTA 5FOQA 1TLFA 1HQYE 1VSQA 2VJMB 5DM1A 2HJVA 2DZDA 5HIIA 3G49A 1EJ6A 2JANA 3HZOA 1I3CA 1SM4A 1GKYA 1PWEA 3HMQA 3IUNA 4QU8A 2L18A 4LZJA 1X19A 3G8BA 5HFJA 3SY8A 4BO9A 3GLHA 3FPAA 4MLPA 4UCWA 1HC7A 4PVCA 3F1KA 4Y1RB 5L51A 1A9OA 4X97A 1M1NA 4NI5A 5HM8A 1TZMA 1XBTA 1MN6A 2JW5A 2VPWA 5BT9A 3ZS8A 4C4OA 4A15A 4TLLB 3G0DA 3R3VA 2X4DA 3UKOA 3Q9UA 4LOAA 1JF8A 1YSCA 2M32A 5LA6F 1P6UA 2C2MA 5ESWA 1J07A 2GSWA 2GT1A 3U6KA 3MUFA 4HXFB 4ZKEA 1E2UA 4P92A 3M6LA 4ZQCB 1PZHA 2X9NA 3WICA 4BKUA 5K8CA 2OILA 3VDQA 1ETHA 2YZMA 2R7LA 1QMGA 1OWMA 4OXYA 4V0MA 4OAPA 4MO2A 5F9HA 1BN6A 3HR8A 3IAFA 2REQB 3B8EA 3GX1A 3OF5A 5GV7A 3SQLA 1R9MA 3G2JA 1VJDA 3WRXA 1RDFA 3SVLA 1P45A 3H8JA 1I0IA 4TXMA 3DQQA 3GWZA 5J43A 2OV2A 2XSZA 5FWNA 1L4GA 1AV7A 1PYDA 3ELBA 3A6PC 3RK0A 5HCIA 1QF6A 2P41A 4ZWNA 2BP7A 1H22A 2FF5A 2RHOA 3EIXA 4LHVA 1EWRA 1AKQA 5BT8A 2MSDB 1K3TA 1ZU5A 4IHJF 1EHIA 4FFNA 4B17A 4E1VA 2V0GA 1LK5A 1HL3A 4KAXA 5CYGA 1MT3A 2PLAA 4QD3A 4BLWA 4DIFA 3PP8A 3EEIA 3QLVA 4RTPA 3C3EA 3C74A 1Z07A 3D6VA 3EE6A 1Z6QA 3KU4A 2AKEA 2IYZA 3KHUA 4MEBA 1H0KA 3C6BA 1KOLA 3I9OA 5T64A 5BUSA 3E2PA 4G67A 3T1NA 4KV9A 4QJ4A 1WO8A 3R5SA 4KOEC 3W90A 2WFMA 4XW2A 1NSTA 4M1ZA 3VOTA 4ER3A 4MAFA 3TR5A 4M8NE 3OUUA 1K8QA 1JTFA 4CKWB 4CV3A 4E08A 2PMFA 2D5AA 4R40A 1DJQA 3BMCA 4L72A 3TZBA 1B8VA 3UKJA 1HDZA 4BNYA 3HXQA 1J7KA 3UMFA 1OGJA 3ACCA 4HX2A 4ZO9A 1NT2A 3TL6A 4BAUA 3ZV5A 4LZLA 4XQGA 4NL4H 4OX9B 1EEXB 3B6IA 3SQNA 2J7KA 3OJXA 4EHKA 1I1QB 2ASVA 5BSFA 2YOGA 3BIOA 4B6JA 1QVWA 3LBYA 1D2HA 2JCBA 3AY7A 4H0FA 1XB2A 1XEFA 4CCYA 4N03A 4UOZA 2HXGA 3BIWA 3ENWA 3GRAA 3VOBA 4E5UA 2POQX 4AJLA 1VDZA 2J3DA 3SCZA 2GM9A 2ZBDA 2XAUA 4X5OA 3N70A 2WFAA 4GRAA 2J09A 2C3OA 3HJAA 2WQ7A 3DFKA 3QPDA 4IHJB 1WCYA 2AEEA 4B6SA 3DEYX 5KWVA 2HHLA 1DDIA 3PC6A 4CT4B 4JXZA 1ODJA 3WI7A 1XMXA 2JIOA 1II0A 1UWCA 2RC6A 3COWA 3ORHA 4XUDA 4HX9A 3QKUA 1YJCA 4I1UA 1HNXB 3HCWA 1P2UA 3LQ4A 2ZSJA 3QU5A 5H82A 3WGTA 3COYA 1SVLA 4BATA 4ZGBA 4D3FA 2BLNA 3GOHA 4WNAA 3Q11A 4GSKA 4CMAA 2VF4X 1E0JA 1WU7A 3VJMA 3AY0A 3ZU2A 1DJLA 3DBLA 3H4IA 4HH3C 1QB7A 2CHGA 2J7PD 4TKMA 2CF5A 3A58B 1VLHA 4M7WA 4AY3A 4MYRA 1PTKA 3D7LA 1KDYA 2VN8A 3SDZA 2JGIA 3QKRA 3L6DA 3WNBA 3STHA 4MZXA 1L5HB 1W76A 1UBOS 4O4JB 4AG3A 2ODQA 4UTVA 3A1DA 4G9EA 3D54D 3OZVA 2YY5A 1I4EB 4HR7A 2I6TA 1ZIDA 3W9SA 2ZR8A 1YR9A 2BGUA 2VJYA 3AVQA 3HYRA 1M10A 5JZ9A 1G20A 3F9CA 1XV5A 4X20A 1K8YB 1NWCA 2H4FA 1BVUA 1NW8A 2Z8YM 4LWPA 1FBTA 2VP4A 3LRPA 4XEUA 4I4IA 5FPSA 5LP1A 3JQ9C 2G83A 2V1XA 4IOJA 2P9FA 1GAJA 3I45A 4FMDB 1NTRA 1H5NA 1P29A 2I1WA 5P21A 1C1DB 3ZEAA 5K03A 4UKDA 2PZ8A 3R7FA 4C03A 3M4ZA 2RH8A 4FHFA 5CT4A 3V4PB 2XB6A 2A8YA 1UDBA 5EHGA 4C20A 1GN8A 3NXKA 1E94E 5JD5A 4RZXA 4X94A 1EAMA 3TQSA 4QQ8A 1J8QA 3NS7A 1RM3A 1U7PA 3IP3A 2QAGA 3QVTA 4NPAA 5FBQB 1HDYA 4RDXA 1Z7GA 4GM1A 2QN2A 3BHMA 2YMPA 1M2HA 1OMOA 3OE7A 3MTEA 4LV6A 1EK5A 2OCIA 3SBDA 2J5XA 3OOSA 3ZIAD 2JG3A 2XB9A 3GEPA 1SHLA 2BDUA 2WD7B 2W48A 4DUPA 1IQ0A 1V8BA 1AU9A 1OWLA 2CY0A 3E22B 3UT5A 3LLMA 4HDNA 1YQTA 2QAIA 1DTWA 2F1OA 3N3AC 4RL4A 5BYBA 2K6GA 3RYTC 1O9HA 1ULBA 2I66A 1CBUA 2PJRA 2ZQ5A 3WV5A 1KDTA 3HE3A 4YT2A 3QVLA 3CTMA 3Q1LA 1I0ZA 4HTFB 3BWMA 1YR8A 1LK7A 2IWHA 2QRKA 2VKQA 4Q18A 5AVSA 1X87A 2DQKA 4XAQA 4MCIA 1SOWA 1QRSA 4Z0PA 2NXWA 4JLKA 1OAOA 2YXPX 4P35A 3TW4A 2CUTA 2Y1WA 4W5WA 4ICIA 1BDMA 6GPBA 1KYTA 1NN1A 3PQ8A 2P2ZA 2OCKA 1AZLA 4DLTA 2AYXA 4GOXA 4YALA 1FL9A 3D3QA 4BVHA 4MCJA 5BVGB 2DUNA 5EE5B 1Q16A 2NVWA 2CVPA 3DKIA 4POOA 4BY9E 1EFKA 2WLTA 1H69A 5CRIA 2RGXA 2YR0A 1Q0TA 3KDSE 4BGIA 5KYUB 4EBBA 1YZVA 3ZYCA 3KLNA 1DARA 3X1XA 5KVCA 4DR7B 4UZSA 4AF7A 2IH2A 3IS3A 1STOA 3OZEA 1N0WA 4A2QA 16PKA 1QTQA 2CNLA 3KUKA 3OLCX 2DLCX 1LXCA 2X0DA 1HUQA 1ICEA 4M37A 1PJ3A 3WFIA 1G60A 4DRYA 4ZI2A 1XRNA 5GM2A 4A7PA 4D6YA 3ODGA 4C2BA 2HEGA 1ZD8A 2Q6OA 4UDXX 4DA7A 3RLIA 2FFAA 2EJBA 3GGDA 3G0GA 1M1YE 4U3JB 1GKIA 1KP9A 1S2NA 2QL5A 4JZYA 1IUKA 1P9OA 4DIKA 4NYJQ 1SXJB 3MRSA 4AS2A 4U39A 4DQ0A 2G82A 5AM2A 4RK7A 3A32A 1MEJA 3WHKA 1G5IA 1LPNA 3UK2A 1IBMB 5LLDA 3C7TA 3Q0IA 3U0BA 2QX9A 2WWXA 1M8GA 1HYBA 4CG0A 4BZWA 3OTIA 4FMPA 3ZE6A 4OX9Y 3E9RA 1N2CB 5CEJA 3KAJA 3IA7A 1HDIA 4NABA 1BRTA 1GGHA 3EDOA 3WIEA 2A0WA 4DA0A 2JEZA 1RWBA 1FVHA 1Q14A 2P6MA 3WYNA 4CODB 4IW3B 4ARZA 1CF9A 1G17A 1P75A 2Y3IA 3T41A 4AS3A 1XT6A 5EPEA 5LN1A 4PO8A 4MKFA 4AQDA 3GLUA 1CG6A 2DGDA 5CXXA 1SK9A 3P5SA 4E94A 4YV2A 1BWQA 2WIBA 2GNOA 4DIBA 4E22A 1NVKA 1PVDA 1YCDA 4Y2SA 4WBSA 3OLVA 4TLBA 2NU8B 1ECBA 1X3SA 2DPHA 2P6UA 3HB7A 1OX4A 5EE3A 2UZAA 5TMEA 4RENA 4C6RA 5EJ9A 3A6JA 1ZXBA 1SVNA 1VHLA 2ZEJA 3B3GA 4IH4A 4ZO7A 5E7MA 5DH9A 5K3FB 1Y3AA 2R47A 4G25A 3E1GA 4M8LA 2ZDHA 1QV6A 2NU9B 3R7AA 3FPFA 3WLAA 5DTMA 4A1OA 1L9XA 4C0HA 4NOKA 3O1HB 1RKBA 3UTDA 4X45A 3AZQA 3GP5A 1ODTC 1QHFA 4GLOA 1NI4B 1E8NA 2E87A 2ZPUA 1Y7LA 2X6QA 3EXG2 3HTXA 1G3RA 4PU0A 2XSZD 2WQZA 3KKMA 4J1QA 3QVOA 1P72A 3BG5A 3LX4A 2OQIA 3I2IA 3QU9A 1GNVA 2D8AA 4V24A 3UMVA 2JH9A 1TAQA 3RS0A 4NE9A 3WK5A 4RXTA 3HA2A 1DEXA 1UC9A 1DEAA 1DCMA 4RA6B 1ZDMA 3VA7A 2HK7A 2QM3A 3QPAA 5DWQA 3CSUA 4LI0A 4R3WA 4B47A 4PWYA 2ZSUA 1VJ5A 3AKEA 1GT91 4JOBA 1AB6A 2BVNA 4TWBA 2WUFA 1F3LA 1QPZA 2Q0QA 4RQBA 1J0BA 1USKA 4Q15A 5EQJB 4EGQA 2C7VA 5ADWA 4KQXA 4D7AA 2FPKA 1NP3A 5FQOA 3OBIA 5I4BA 4UAGA 3O3CA 5J5AA 1W0KD 5FLKA 3GLGA 4ARAA 3BL8A 1OY1A 3FFAA 3X3HA 4CLOB 4JI4B 4RL6A 2JBHA 3FNIA 4BGDA 5HMMA 3EWAA 2R6HA 2ZRFA 3CR3C 3G68A 4OMCA 1S4QA 2HXYA 1C0EA 4C2TA 2VATA 3HKEB 3K94A 2EW2A 2I3AA 1JFSA 2EIHA 4HRXA 1QQAA 4R6WA 1VLVA 3HUTA 3KZ1E 5FORA 3WYGA 1N6OA 4CV1A 4TVSA 1SHZA 3D4PA 4GE3A 2HPHA 3R76A 3S5UA 3W6UA 1RTKA 3U1TA 1NV8A 4ZCLA 4B7ZA 4GKJB 2I4MA 3GG9A 3E1SA 2ZS8A 1LY1A 2MR5A 1J56A 1GG9A 3DVRX 3L4BA 4WDQA 3D8TA 1UKZA 1ADJA 3CKMA 4IUBS 5D3ZA 2YWDA 1NW9B 4CXMA 2ZJ4A 2QVGA 5BQPA 3RTEA 2B69A 3T3NA 5F2KA 3CLSC 2NTVA 1RWNA 3W2GA 2IBTA 1M34B 3Q5GA 1ZP6A 1CZNA 4F5ZA 5DSZA 4H3KB 3G9ZA 4X0EA 3GFPA 4PO9A 2ZJ3A 5D01A 4IFIA 3OI7A 3B38A 4DQUA 2FGKA 2B98A 4A5SA 4HO1X 1NNUA 2FHPA 3QFTA 3HNRA 4N41A 2VFAA 1CZUA 1U8UA 1Z7WA 4H6WA 5LOVA 1F8XA 5F33A 4B3MB 2C1ZA 3ENNA 4EG4A 1AO0A 1TRHA 1X1TA 5KDOA 4TTSA 5AJTA 2ERXA 3H9CA 1NW5A 221PA 3JQGA 4XVHA 1P62B 3BWDD 2VDLB 5L95A 3K6SA 4ZYXA 1W85A 1QGYA 1NMQA 3B2EA 3OIUA 3AM3A 5CNKA 1CUXA 4K87A 1EFRD 4G8CA 4MVXA 4RD1A 2F8LA 3DSRA 1IONA 5H4GA 3U5TA 4OXNA 2DERA 2VJKA 4IQ8A 2OXCA 5B7NA 1M0EA 1JEDA 1TIBA 4AJJA 1E1MA 5GP1A 3EPJA 2FV8A 2QD2A 1KSHA 3TCKA 4PYQA 3N2ZB 4PYMA 3USES 3GJQA 1LS6A 3C3XA 1KYQA 3K2QA 4DPMA 2ESRA 2ZUCA 1U8TA 5JSZB 2IUEA 4PAQA 3UT6A 1BD4A 1Z0AA 5EXPA 5B64A 2P75A 2WHPA 4WZAB 4C29A 2R4QA 1TCAA 1O97D 3MUNA 4FINA 1U7OA 3DT6A 2HU8A 3LJKA 3PWZA 1FBNA 2Y1XA 5JYEA 1T1EA 2LIPA 4RJ2A 1YGYA 2BJVA 1IRIA 3R9IA 2H1FA 2Q7OE 3W04A 1YFJA 4CEJA 4ZVLA 1IM2A 2AT1A 1K3FA 2JIMA 2Q45A 1QLHA 3PC4A 1U0JA 1YS2X 4EB8A 1C9JA 2PZBA 3KR0A 1SPBS 2MINB 1SURA 1Z0JA 5JD6A 4M1MA 1OH7A 3FX2A 3Q10A 2NTNA 2EG9A 3GCXA 5LBUA 2H07A 1G20B 1RLTA 3AR7A 3EEFA 1AK1A 4E15A 3HSKA 3QVJA 1K5HA 1FU4A 3ICPA 3OJEA 1KAGA 4JVNA 1I3OA 1OTXA 3UJ7A 4Y2UA 2HQRA 2HO5A 2A58A 3H3XA 2M1XA 4J0EA 1PTJA 1QIEA 1TFUA 4UHJA 3ZHSA 3E23A 3MMZA 3LQRA 4HP8A 4J16C 4Q6BA 4RGBA 3ZWWA 3Q9NA 4CU2A 3M89A 4LY9A 3UM9A 4DG9A 5CCXA 4KPGA 2RI1A 4TN1A 4KHPB 2E6UX 3MGKA 3NHWA 2A9VA 3L7AA 3M2TA 3NFYA 4LHZA 4S2UA 4TXHA 3GP3A 3DDSA 3TMYA 1T4CB 4WHMA 1WZUA 1OYOA 2OBYA 3FWHA 1U90A 4MWOA 2GKGA 3MIZA 4GP7A 4UHBA 4WKBA 3JTEA 5AP9A 2UXBB 1IAVA 1DEKA 4XB2A 1XTSA 5I8WA 4ZTBA 1BS9A 2H06A 2H54A 4X62B 3B9RA 2CL0X 3MYYA 3MNFA 2OLEA 4B2LA 3T4UA 5AK6A 1DHRA 4DL9A 4BXOA 1F7UA 5B6IA 3IERA 2FWRA 4KXFB 5CG1A 3BL5A 3MRVA 3QVGB 3OU6A 3I9V1 2JB9A 4X63A 5LUBA 3V7NA 3UT5B 1PQ4A 5ARCA 3DCIA 3E8SA 3WGLA 4OQDA 1WP4A 1HK7A 1KZ4A 1E1QD 1FXSA 4C4RA 3QMWA 4HRAA 2L69A 4KO8A 3T38A 1UR5A 1UK7A 3NANA 3HCDA 3ON5A 4B83A 2YN2A 1VG0B 4IH1A 3J7AC 1XEXA 4P7BA 3PPYA 4LC0A 4A6EA 3K9HA 3RAPR 4L5IA 5ALQA 3ZDZB 4DT1B 3KZCA 5JOQA 3OFSA 3ZCVA 5JAIA 1LX7A 1V45E 3HDQA 1U99A 3K3PA 3C24A 3PQ3A 3TLJA 1MQSA 2XB8A 4W8OA 1I9GA 3D6HA 4KXMA 5F7ZA 4BUCA 4MPPA 1GHTA 4LFCB 1YS9A 2YV2A 3KKEA 5IJ0B 4ER6A 4M53A 1JAXA 4BL5A 1SUEA 1CHDA 2Q6LA 4QIHA 1T2FA 4C4TA 2X3FA 4G01B 4JJFA 3P0EA 2JD2A 2VUTA 4LOKA 2PZAA 2ZDQA 3V1YA 1FNNA 4K6CA 5JAQA 4YJ2A 5H70A 3NHBA 2XMZA 4F2GA 2IIPA 3ICOA 4AJOA 3FGNA 5DOVA 2P2DA 1WSAA 3N2KB 4XPZA 4MX8A 1WXGA 1IBSA 1D4OA 4CQMD 3UWKA 4S1OA 2FPPB 3I1IA 2PFGA 5DM0A 3U3RA 4D80A 4HHEA 4IV8A 4DWVA 5DM70 2H1OA 2Z09A 2RDMA 3M0EA 4HSGA 3FWZA 4CM3A 3LUCA 3PR3A 1BDBA 1V9LA 1V37A 3D1LA 1QWOA 4AB1A 1KKLA 1RYMA 4O4IA 3VZBA 2FPRA 2Q5IA 5SZJA 2F59A 2FLWA 2VZ9A 4UCQA 3JQ7A 1RI4A 4UTXA 2PDAA 2B3DA 2REBA 2CXRA 3B48A 3IT3A 5H1YA 5FA8A 2JGJA 1FW8A 4P7JA 4A73A 3L7JA 1SVOA 4JGIA 1R0ZA 3MJSA 1TQHA 3UMJA 2F67A 3AEYA 3O7MA 4K46A 5K51A 4M7RA 4IQ0A 3U3ZA 2V3CC 4MV5A 2OHJA 3BD8A 4NS4A 1TI7A 1BCSA 1XELA 1F48A 1AHIA 2P9YA 2Y6UA 3MS4A 3Q12A 4FB5A 1FFYA 4JSYA 5AH0A 2WSBA 2P8JA 3KVRA 1JEEA 3AQ4A 4U2KA 3S1AB 3GDGA 3UUGA 3EGWA 5LYJF 1L4EA 4FBGA 3CGGA 3I28A 4NMHA 3Q7EA 5JDCC 2W11A 3RVOA 4KN8A 1W75A 3DTVB 2OP1A 3LOUA 2A9JA 3PVSA 4UNNA 1SXPA 4REQB 2C00A 2UZ0A 5G0UA 4DA9A 3PC2A 5LLSA 3VC1A 3WLPA 1Y1RA 1P9NA 2ZULA 3A31A 1REQB 1CQPA 4LDAA 1U94A 1JN0A 1M2OB 1EMDA 3DFUA 2CFTA 2F7SA 2P9HA 1A4UA 1XZEA 3O74A 1Z6TA 2C2GA 4L73A 4OY3A 5H68A 4DHWA 1SKAA 5CPFA 4WPGA 2HHAA 3VPSA 2HYDA 4CEIB 1WY5A 2HJWA 2BF4A 1J2UA 1Z8NA 5KOIA 4CQNA 4QSHA 2O0HA 3ZWOA 3NYRA 1P4JA 1AXRA 5ELMA 4C89A 2VQEB 1ATIA 1VBKA 4M0UA 3GRZA 1M2JA 2BGIA 5DHTA 4XUEA 4Z7NB 3BSWA 1L1EA 1QK5A 3NCHA 3QUCA 1W9MA 4J6EA 1UT8A 4R2KA 3WKBA 4CM9D 4A10A 3OLZA 3QV1A 3ZKWA 4INPA 4CM1A 3EQ9A 1PBNA 1R1DA 4EP1A 2EFYA 1J0XO 3IAM1 5GONB 3T3HA 3WJ1A 1ZA2A 4MEAA 1U3FA 2WAMA 4WKCA 1N8TA 3CO0S 1YULA 1J39A 2OCBA 3HCOA 3OFVA 4ALLA 4E1BA 3PZRA 1X74A 1A5AB 3ZHVA 1Y5RA 2VHXA 3KQWA 4BNMA 2KI5A 3H2IA 4Z51A 1JSLA 2BFFB 2C96A 4WOCA 5LP6F 2DCMA 2AJCA 3PC8A 4IRXA 4Y8VA 3ZZMA 1T0PA 4CF4A 4DCSA 3WADA 3V8PA 2X0KA 5U4XA 4ZV9A 1VE7A 2O1WA 3TZKA 3D7KA 1Q57A 3FAZA 3OP4A 4YUXA 3GEEA 2FP4A 2IL1A 3O95A 3DMTA 1XCLA 1E5DA 1XRJA 1W0JA 2JGFA 4GI5A 3S7TA 1ZR4A 4CEHB 1ICIA 2OHFA 4Y2XA 721PA 5CG2A 4EOGA 1JHUA 1I8TA 4EJMA 4OMDA 4LI3X 3ZCSA 4MGYR 3H9UA 3HBNA 2B8JA 5CP8A 5GGXA 3G82C 2BR3A 3HRHA 1Q11A 3JD2A 5ICSA 3Q7SA 2IZOA 1YJAA 4HAOA 4AKTA 3SICE 2NSYA 4UEWA 3E9QA 3VHRA 2G0NA 2PA3A 5ED4A 2DLDA 4KR0A 3OF3A 4Q37A 2OLKA 2BE7A 2I4NA 2Y2VA 4L8VA 1C4XA 1SCDA 2J3IA 4V2IA 1KI1A 1Q0HA 2EQ5A 2O3UA 5DHRA 5TRTA 1UP6A 5EXSA 3SDSA 1V7PC 1YVUA 2V7QA 1U9YA 1TK9A 4QARA 4BKPA 3KOYA 4CIYA 3WGUA 3BWCA 1D6MA 2QAJA 4YAKA 4OJYA 2JCXA 4A8TA 1KIMA 2IU4A 3MEQA 4MV4A 3MCAA 1CP2A 1GPYA 2DWUA 2W6JA 1W85B 3FWKA 1N6NA 3P9NA 2XA1A 4D4GA 2FSIA 4DE5A 4MPDA 5AW5A 3ZY4A 3FNHA 3INRA 1DTEA 3MAJA 1H8HD 4UBJA 3H7AA 1JP7A 2F4NA 5EI5A 4DJAA 4LJ5A 3LC1O 1GPJA 1P7PA 3QXJA 3WLMA 4ZT5A 2GKSA 5FWXB 1DS6A 2XB4A 4YDRA 2D5IA 1IEWA 1R4AA 2VPIA 4C7MA 3VYWA 2PBLA 1DRUA 4PSCA 1SO8A 5EEHA 2Q3FA 2I8AA 1N9GA 2AR7A 5HMLA 4UTZA 2JBAB 4Q02A 3PHIA 3EBOA 3UJDA 2XZDA 4RY8A 5EHIA 5EKTA 2QT1A 3O26A 5KS2A 3DHEA 3JZAA 5KHLB 2N46A 4RZUA 3ENKA 3TG8A 3RIEA 4BVGA 3P2EA 2R1ZA 4AD8A 3PJDA 1CUSA 1OWOA 2HV9A 1XD8A 2SKCA 1SH7A 3CC8A 4Q12A 4YFYA 1VCMA 3CPEA 4FUTA 4XM0A 2QVBA 3MINA 1GITA 5B3JA 1OT3A 5KTTA 1L0BA 3AUXA 4JROA 3TAHA 4HUTA 1CXZA 3PDWA 5TVGA 1LFDB 3FRHA 3M4XA 1WUKS 2C5LA 3MTBA 3WRXC 4ZVSA 4MRPA 2GYYA 2YBDA 4LWQA 1GUDA 1ITZA 3EQ8A 1OLUA 5I7FA 1ONBA 3FCYA 1EG7A 1EGAA 2BUCA 1AG9A 3ITDA 3ND9A 4XWWA 4NDNE 4YP5A 3AG5A 3L0OA 5B53A 4B3XA 3K5HA 5DX8A 5T41A 1EUDA 4L8WB 4DDVA 4R31A 2XMQA 1E9AA 3RAEC 1BOOA 1R7RA 2FXIA 5A7HA 4IIFA 1R2QA 4EA7A 3ABQB 5SYAA 3VJRA 5HR5A 5EZYB 1JG4A 3T7CA 5CDGA 1Y6FA 1RJDA 3SIRA 3GWGA 4AYTA 3HY6A 3ECSA 1XCOA 3ZVMA 1E9FA 1F38A 3ML1A 3UG6A 5IXJA 4QBKA 1C8BA 5EUQB 1F6WA 4ISCA 4HN9A 3JARA 2YYZA 2BD0A 5G40A 2CJFA 3RYFB 3I9MA 3O3OB 2NW6A 2HU7A 3F4LA 1QB8A 5FP0A 4UHEA 3AWIA 1N1EA 2CXQA 4KPFC 3IVRA 2CHUA 4FGUA 4S3MA 2YYAA 3V4SA 4OGKA 3EPHA 1UMDB 2HJHA 4KACA 3GMIA 5KQSA 1QIFA 2I6SA 4Q9AA 5HGJA 2D1TA 4X1KB 4PXAA 3RDPA 3KCNA 1E5TA 1ZISA 4EW2A 3L1VA 3K1YA 4ZCIA 3DZFA 3VR6A 1EG2A 2GM5A 1ES9A 1EUYA 2ZE5A 3V2IA 3IHKA 4CMHA 2OXFA 1KP2A 3IB3A 5LYYA 1XEXB 4CLXA 1T5BA 4O5AA 3ZHZA 2IW1A 2VIIA 1LVGA 4AJKA 2FETA 5KMGA 3PFGA 2E1PA 1DJPA 3VPGA 1R64A 3HFSA 1NURA 1M1YA 2AFRA 2R2AA 3L82B 3OCYA 1N2IA 4DJEC 4CTJA 2WAXA 2RKOA 1B0AA 4G81A 4YBRA 5DMHA 1ZD9A 4OB6A 4ZALA 2QRVB 3H4TA 4TTJA 3RTBA 1ZM7A 3TRHA 1USVA 1R8YA 1YVEI 1PJSA 2GHQA 5JVDB 1P4GA 1H3FA 2IEDA 4GI2A 1QKKA 3QQ5A 1E2KA 3QEMB 3OEHD 3EEQA 3O4IA 3RC7A 3RR2A 4CPDA 1F4LA 3NBFA 3HSYA 2PKCA 3CPHA 1JHMA 3OOYA 3QKIA 4FDAA 3K1AA 2CL7X 2FMXA 5COBA 1NVBA 3H84A 1MHTA 3ZXYA 2IIBA 5E0KB 1KY5A 1Y37A 4N3NA 4KFCA 3IQWA 1VBFA 1F8YA 1OAOC 3PPVA 3EB9A 3IUBA 3A4TA 1RKXA 3UMSA 3CUUA 1U9ZA 2GXQA 3K9QO 1KOJA 2QT0A 3VUFA 4QRIA 4WESA 4E3ZA 5AW0A 4LCBA 4NZYA 2H1RA 4Z0TA 4K9QA 4PFJA 4Z9AA 3I6QA 2XTMA 4F4HA 3T5PA 4LG1A 3TLZA 1V1RA 5FWAA 3EVBA 4LYFA 1TGYA 1XTKA 2JJ2A 3ZLVA 2OA0A 4B75A 1A8QA 5LB2A 2R6ZA 5F23A 3KZVA 2J5BA 3NBUA 2IYUA 4GOMD 2F3PA 2I4RA 1YZLA 4B7UA 1NXWA 3QVMA 4KIJA 4NYJR 4JEIA 1CY4A 3UJ3X 2PXHA 3DMYA 1JE1A 9ATCA 1DC8A 2DBYA 1WY7A 2FJ0A 5A9TA 2O59A 1MNAA 3EGXB 3N53A 1E58A 1PZEA 2PUGA 2ES4A 2QAGC 1JAHA 2P0YA 1G3QA 2HPZA 4KO4S 1QHSA 4LK3A 4XGKA 2GNPA 5AJYA 1XNQB 4OH7A 1AUOA 4FS3A 2EHDA 3JAKA 1K6EA 5H5JA 5DI9A 1YRLA 2ZZKA 3CRRA 2ILVA 3HYTA 2UU9B 3UHOA 5DLYA 1KIFA 1UZUA 2L0XA 3FLEA 2B1GA 2ZE7A 4A36A 1WABA 1D2RA 1ZAKA 3PXGA 1E4YA 5IPFA 1RFGE 1MGPA 4G86A 2FUEA 2OAQ1 3CZ4A 4HGNA 1LNSA 1NR7A 1WV0A 4R0MA 2ZSKA 2ZS7A 1KARA 4MWZA 2VDWB 1BEEA 2AI2A 2IDMA 2VJPA 4OJTA 2YDYA 3CISA 4P32A 4BKMA 4W5TA 3RUAA 4BFZA 1DQYA 4GMDA 3MIIA 3AHEA 4JMPA 1L1FA 5LYJB 3BXHA 2ZI5A 4BLQA 4MGZR 1EUQA 3ROZA 3WK8A 4E7OA 3V80A 1QX4A 4CMJA 5L6LB 1B15A 3U44B 1PVOA 1Q1AA 1DKQA 1P7CA 1X39A 4BVJA 3AIOA 2PLFA 2H2HA 2GI4A 4V2UA 5D3MB 3UT0A 3O75A 2G1UA 4QHYA 4WZBE 5KC9A 6ADHA 1RYZA 4G2TA 4CG1A 1U8EA 3BFVA 1NVEA 4I81A 1GCIA 3E7PA 5DNUA 3FGPA 4YASA 4BJHB 4LZWA 1KJ9A 4NU6A 1TXGA 3PPXA 2ZBUA 1LJ8A 2ORIA 4B4KA 5C8DA 1EDZA 2QLNA 1G7TA 2ZJ6A 3A1TA 2A57A 2F1IA 3G2QA 3TRJA 5BWNA 4B9EA 2G9ZA 4ZVPA 1ZSYA 1BIFA 3K15A 2ZYDA 3GLVA 3B6EA 7MDHA 4US0R 2XF2A 5G0WA 2HH9A 4D9BA 3TR0A 2I3DA 2DX7A 4OOFA 3IHTA 3MK31 4G24A 1VHQA 3M6MD 4L7QA 4MKGA 4D8TA 5EHZA 1QYDA 2JI8A 2YWHA 3OQIB 3BXZA 5DN6D 1YJ8A 1HZJA 2XRFA 1FFXA 3AM4A 2O8EA 4UATA 1QYVA 5G2OA 1TTTA 3GUUA 4M54A 3WRWA 4ZXPA 1H6CA 2OORC 3HL0A 1CK4A 3U3MA 1MR3F 1MQ9A 4YCDA 1CHNA 1UBNA 3GXBA 5IUJC 5BO5A 3CXUA 4MZDA 3VBCA 2CXOA 2EW1A 3A9TA 8ATCA 4J2TA 4AJ4A 1GSIA 2Q5EA 4D9IA 1AS3A 1E4EA 4HWTA 5J47A 1C0LA 4F56A 1R18A 3NHMA 1KEPA 1U8YA 3AC0A 2ZUBA 1B1CA 1IY9A 1ACMA 1D6SA 4AY6A 3BXOA 4ND2A 1BWRA 2CXNA 4GWLA 1XJ5A 1YDMA 2LKCA 2NPIA 2OQ2A 1LW7A 2NUAA 1I7PA 2WZBA 3LO8A 3IX7A 2QJFA 1N36B 4ZYWA 1NVVQ 1V11B 3GJ0A 3N0RA 2E4WA 3FI0A 2CK3D 2JLXA 1GM5A 4PC3A 3CU5A 1SQ0A 2PL3A 3N2EA 5KSOA 3QGMA 5I3CA 1KO5A 2DQSA 1DCKA 1O87A 3ESBA 1G9XA 3WWCA 4W5OA 1Q0PA 3D31A 4RS3A 2V59A 3QX8A 1ZNXA 2ZT8A 4ZYUA 4HDOB 3RPEA 2VJAA 3DFIA 4I1OA 1D1TA 3MWKA 2YFQA 1LLCA 1CQJA 1UFVA 2QR2A 1WR8A 1NMSA 1X1EA 2MTBA 3EH2A 4HV4A 3T1HB 2II6A 1QIDA 1YQQA 4OA8A 2D7JA 2IYSA 1UBJS 1GNPA 4UNSA 2BMDA 2PS1A 3SG0A 3HHPA 4ILKA 4GMHA 5E38A 1SC3A 1XCMA 3EIFA 4HFNA 1K6JA 2BZ1A 2PD6A 1VRWA 3PSAA 3UK6A 3C3PA 4NICA 1HLFA 5HK8A 3NNSA 3RFUA 2EWMA 5IW8A 4UTPA 5A3JA 3RRXA 3D43A 1P0CA 3DWIA 3DNPA 3L4JA 1XL1A 2GZ3A 2V3WA 2ZYWX 1JDBB 1M6NA 2A7XA 1WMAA 4MKIA 4NQZA 4W1SA 2YJ5A 2HRDA 3AHDA 3D7RA 1P5FA 1IJBA 2JLRA 3GN2A 3BXFA 3D8NA 4U9UA