4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase B
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
2C4HA 4MEBA 3T52A 3G8YA 2V97A 3CXUA 4BAGA 1LZKA 4GXNA 2J4FA 1HL7A 5ALNA 2PL5A 2VAVA 5AH0A 1VA5A 2XMBA 4DIUA 2V9ZA 1ORVA 3IUMA 4AN0A 2QT9A 4GW3A 2WFZA 2WIFA 1CUEA 4ARBA 5EGNA 4QE3A 5JZSA 3UUFA 5HCUA 4MQLA 4MXDA 3QBJA 5CT5A 4FLEA 3WQHA 4HVTA 3H2IA 4H0CA 4KJXA 1E8MA 1HKHA 4WY8A 4Y2VA 4EZIA 2WG0A 3C6YA 2RAUA 1OILA 3A2NA 1ZJ4A 2OXEA 3WK8A 1G5FA 4EUSA 5JD4A 3CCCA 1CUAA 4FKBA 5BWCA 4DMFA 3AINA 4X92A 4E15A 4QDZA 1P0IA 3IURA 1CR6A 4OYYA 2H7CA 2PX6A 3H1BA 1QIKA 3R41A 4X95A 1TAHA 4UHBA 4NMWA 5FDFA 2HRRA 1UK8A 4BAZA 2XUDA 4J7AA 1HLGA 1AC5A 2VAXA 1GKLA 1ZJ5A 4M0EA 1ZIXA 4J0GA 1DWOA 4BTLA 4BC1A 4LIPD 4K5QA 5K3FA 1ORWA 3RARA 2JGKA 1W52X 2VQ6A 3O4HA 3JYHA 1QJ4A 1VXOA 4WFKA 5ALRA 4X6XA 3AJAA 4OYLA 3D0KA 1GXSA 3D5EA 3I2FA 4OB7A 4WDQA 1JU4A 1EK1A 3IDAA 4X93A 5EFZA 5LP1A 2WUFA 1QO9A 1E5TA 3WKEA 4AX4A 1JJBA 3W05A 3FLAA 3K9BA 1EA5A 3LIIA 2PPLA 5JD6A 3WJ1A 5AK3A 5HK9A 1SFRA 5YASA 2PU7A 4KE8A 5E4TA 4W1SA 1AMNA 4XJVA 3WMRA 3C70A 1XZJA 3EQ8A 1XQVA 3I2IA 4QDTA 5EHZA 4GWLA 2ZYHA 3ESBA 2CUTA 2XLBA 5AOAA 5DTIA 1MO2A 2WHPA 5ALXA 3DDUA 3RK4A 2ROQA 2QUBA 3ZI7A 4NZZA 1XZKA 5C8XA 3GBSA 4H7DA 1XLWA 4C88A 2O2IA 1QIEA 3V1KA 1C7IA 1AGYA 5C81A 3SC2A 3AZPA 2HFJA 3A2MA 1QIMA 2CBGA 3QH4A 2YH2A 1EINA 2EDCA 3FYTA 4IH9A 3L1HA 4KAAA 4LKOA 3G0CA 1T2NA 1E8NA 4QWMA 1MN6A 1QZ3A 5IVKA 4P93A 4W9RA 4EY4A 2VA9A 3H04A 1R9MA 4U2DA 3RKSA 3HLKA 1TCCA 2GYVA 2JGLA 2ACKA 3FSGD 3DNMA 5AP9A 2OQVA 5AK4A 5ALDA 1CUZA 1YAHA 5ALOA 1HDEA 3Q0TA 1R50A 4H7FA 4B81A 3M81A 3QPAA 4FFWA 2HM7A 5HFNA 3AIKA 3FYUA 4Q1VA 2HIHA 3WL8A 4DMKA 3BXPA 2PUJA 5AIBA 4G9EA 1Q83A 3ZLTA 4DGQA 3AILA 5E4JA 1BN7A 3DS8A 2JGMA 5K3DA 2BCEA 3IUNA 5ALQA 4MYDA 4LXIA 5LKRA 2XQIA 1EK2A 4L0CA 2VJAA 2XLCA 3IA2A 4C01A 2AXEA 1F0PA 2PVSA 3PICA 2WFLA 5JZ9A 4CG3A 3QMWA 4MWTA 4H7JA 4A5SA 3DKRA 2OG1A 1ZD5A 4JYMA 4GHWA 3V1NA 1TCAA 2WJ3A 3O4GA 1CEXA 2RHWA 4OUKX 2CJPA 5T4EA 2C5FA 2YASA 4KACA 2QMQA 4OB8A 5CH3A 1QIDA 3W9BA 1AUOA 4IH1A 2OPHA 5AI0A 2WFMA 2ZJ6A 4BC0A 3FLEA 1IZ7A 1TK3A 1WPRA 2X8BA 4U2FA 2HA2A 2DSNA 3CN9A 3H2HA 1YSCA 4EBBA 2VF2A 4L9AA 1BE0A 3ZLVA 4CG2A 1Q0ZA 1P0QA 2XUFA 4HXEB 5ALGA 4DM7A 1R88A 2D5LA 1DWPA 4PV7A 5D6OA 4WFJA 5CXUA 1VZ2A 4OU5A 3HC7A 4Y2TA 1W6RA 1UK7A 2ZYIA 3ICWA 2AJLI 2BAGA 3V1MA 1BN6A 4BZWA 1TKRA 2QTBA 4AB1A 1XZDA 1YS2X 1WB4A 2WIJA 4Q3OA 4KRYA 1WPXA 3A2LA 2WUGA 3FCXA 3IULA 1C4XA 1DU4A 3LLCA 5AKYA 2D0DA 1USWA 4KYVA 2XUHA 4WDRA 4BP9A 4CIBA 1AQLA 4JUIA 3DYVA 2OCKA 4BE9A 5EIHA 3W9UA 1IZ8A 1A8QA 1E8DA 5IH7A 5KBYA 4PO3X 5IKXA 1GQRA 5FV4A 2PBLA 5FKJA 3K6KA 1AX9A 1LPPA 2DHDA 1GPLA 4E11A 4BYMA 4RPCA 4P9NA 2XI4A 1LLFA 2JEYA 4QWWA 3S8YA 3QYJA 5CH8A 1UK9A 4X3CA 1WB6A 4Q34A 3ANSA 4AO7A 4JNCA 3U0VA 2Z8ZA 4X6UA 4M0MA 2WTNA 4PF1A 2RHTA 6YASA 1LNSA 2C0QA 4KE7A 3W04A 3I28A 5KREA 1BEEA 5AI8A 5ESRA 1XRLA 5FPQA 3UMJA 1GGVA 4P92A 3IB3A 3OM8A 1TRHA 3EBLA 2WU4A 1YR2A 4DNFA 5I9IA 3MUNA 5C7YA 4RNCA 5IVIA 3G0BA 4S0XA 1J07A 1GKKA 3DCNA 2WTMA 4FNGA 2VJCA 3HEAA 3OC0A 4J0DA 3G02A 5EHQA 3Q8WA 2XUQA 1B41A 1CUXA 3C45A 4A23A 4BE4A 2J4CA 2R8BA 3AZOA 3TJMA 1MJ5A 4UHFA 3ESCA 3BIXA 5AM4A 2JIDA 1CUBA 4FBLA 2CEKA 4FOLA 5ALZA 2ECFA 1JJIA 2I3DA 2XB6A 5FLKA 1SCIA 2WIDA 2O2HA 2PU5A 1CFJA 2BUAA 3DD5A 4BDTA 3STYA 3BF7A 1W4LA 4AMYA 1AURA 4AQDA 4WJLA 2W6CX 5JZBA 3WL6A 1YASA 5DWDA 3ED1A 4BRSA 4DNPA 2RI6A 3KD2A 2DQZA 1IUOA 4N5HX 1XZCA 2WILA 4J0CA 3I2GA 2I03A 2OLEA 3D3NA 5DNUA 3WLAA 1HPLA 4EHBA 2G5TA 4PQEA 3IUJA 3E3AA 3KSRA 2RONA 4B7ZA 3C87A 5AKGA 2HA7A 1K6EA 1VE7A 3WK6A 4BB0A 3I6YA 5AK5A 3WK7A 4G4IA 4X91A 3HI4A 1I6WA 4E46A 3CCBA 2IIVA 5FRDA 2EDAA 4RE6A 2QVBA 2ZJ7A 3LCRA 1MX9A 5JAHA 3ZV7A 2H7XA 3WKCA 2QM0A 3WKAA 3NWOA 4KR0A 1X70A 4Q3KA 1N8SA 3HYSA 2WSLA 1IUPA 3DLTA 4AXBA 3S2ZA 5LZ5A 1WOMA 4IHAA 1EXWA 4AZ3A 3ESDA 1JMYA 3QZUA 3WIOA 3R0VA 3M82A 2XMSA 4X6YA 3QPDA 1RP1A 1G66A 1H22A 4FMPA 5ALKA 3R3UA 1KU0A 1H2ZA 5DTJA 2AJCA 4UBOA 3SK0A 3BF8A 4TPKA 4BVJA 4YX9A 5AICA 4C87A 2ONCA 4G8DA 2J3QA 1ZD3A 1EVQA 1BS9A 1XZGA 3R40A 3W2TA 2Z3ZA 4K6HA 2AJDA 3RM3A 1K4YA 5DYYA 1H23A 5C8ZA 4F5ZA 5CT4A 5LYYA 3WYDA 3AIOA 4HZGA 3WK9A 3DQZA 3DYIA 1ZD4A 4TVKA 3WKDA 4UFNA 1QIIA 2QUAA 4ZREA 4QDXA 5BV7A 4C89A 4DSAA 1FFDA 1MAAA 1WHTA 5AI9A 3GA7A 4GI1A 5AM5A 2O2GA 2HU5A 2V96A 1J1IA 1YAJA 2FJ0A 3HZOA 1X2EA 1UXOA 1X2BA 5CH5A 5AM3A 2RIPA 1Q0RA 3I2HA 1H2YA 3QITA 4RE5A 1Z68A 3WWEA 4X71A 4BCDA 4I3FA 5JIBA 4W1PA 1ETHA 4HAIA 2GYWA 4D9JA 2DQYA 2XE4A 5LKAA 1P0PA 1R4ZA 3OTQA 4EY5A 4W63A 3NOXA 4DTCA 4Q3LA 1YA4A 3ZPXA 3ICVA 4C4YA 3DOHA 1EDEA 2R11A 4G4JA 1P0MA 1CQWA 1SC9A 3AFIA 3DEAA 2QJWA 1PV1A 3MGAA 3ESAA 1VJ5A 1YA8A 3FAKA 2ZVDA 3HRHA 4KE9A 1XLUA 1XQWA 4MJ3A 3RLIA 1JU3A 4BDSA 1DWQA 4G1FA 5AI5A 1L7RA 3HJUA 2HHAA 1ZI9A 2DR0A 2DHEA 3M3DA 3F96A 1ZIYA 3VJLA 4KAFA 5AOBA 3SX4A 2WQZA 4BZZA 5CT6A 4ITVA 3C8DA 7YASA 1VOTA 2ZSIA 1XZFA 1YS1X 2XUJA 3I6ZA 3VDXA 3NGMA 5IVDA 4X90A 2XQKA 1QIHA 3PUHA 4XX1A 3I2KA 2VT7A 1HQDA 4I19A 4YPVA 3BDVA 1CLEA 5JALA 2C7BA 3OOSA 1GPKA 2XQGA 2DHCA 3FNBA 4UHCA 1W1IA 3C6BA 3WI7A 1VLQA 4B83A 2QRUA 4GEGA 5AHXA 5K3AA 1NU8A 2GZSA 4DLNA 2CKMA 3STVA 3K2IA 1IMJA 1LPMA 3PFCA 4UUQA 5ALMA 4J0KA 1CIJA 3AUKA 4LXHA 5FPPA 3H18A 1XRPA 1DT3A 1N5MA 5A71A 1CUHA 3G0GA 5DNVA 3WA7A 2HFKA 2Q0XA 2HADA 1E66A 2PSHA 4UHEA 1NU6A 4WFIA 4UBJA 1BROA 2Y6VA 5DLPA 2WHRA 1QE3A 3I2JA 2WG1A 2G5PA 3I6MA 3FSGA 1OCEA 5ALTA 5F4ZA 3V1LA 2O7RA 4O08A 4Y2XA 5A7HA 2JGIA 4KE6A 4UHDA 1CUSA 4W1QA 5AM0A 5D7BA 4X00A 3M83A 1LGYA 3BDIA 3QVMA 1CUFA 4EA6A 3E1GA 5EIAA 1WCYA 3GZJA 2XDWA 5AKZA 4B85A 1QIGA 3A6ZA 4FFVA 3QPCA 1O6FA 1DINA 3E4DA 1E3QA 1XROA 2HU7A 2HA5A 4I4CA 5EIEA 1MNAA 5AM2A 3EQ7A 3PF8A 5SYMA 3O9VA 3F98A 1ODSA 1UZAA 3ANTA 5JAUA 3O4JA 1Q84A 3BL8A 1BEZA 3HSSA 1ACLA 3WZMA 1IUNA 1W75A 1KEZA 2BFNA 4QEKA 2Y6UA 2WU3A 1H2WA 2Y1KA 5A62A 3FVRA 4TGLA 4G4GA 4FDMA 3VJKA 1VXRA 1XRMA 5JYCA 4EY8A 1XZLA 3MUOA 4BATA 5J3JA 4K6GA 1N1MA 1VZ3A 4C4ZA 4ZV7A 1Y7HA 4U2GA 3VVMA 3FCYA 3GUUA 5ALFA 4DMHA 5LZ4A 2GBFA 3KWJA 3BJMA 4K2AA 1RYYA 4QLAA 4X7BA 3C6XA 1MAHA 1MX1A 1G42A 3ILSA 1QO7A 2YYSA 4G8BA 3WWCA 1U8EA 4INZA 3YASA 1F6WA 4ROTA 2HA6A 3EF3A 1CUYA 4BP8A 2QZPA 1QONA 5AI4A 5CT9A 3FYUC 3IBTA 1K63A 3LIPA 5HF6A 5EHXA 1CV2A 4P08A 3WWOA 5DJ5A 2GZRA 3GFFA 4QDOA 4QLOA 4Y2UA 5SYNA 3WK4A 2E3JA 2HL6A 5CT8A 3VXKA 4MWSA 1CUJA 1CPYA 3V9AA 5T4FA 1SOMA 3KOOA 5I7UA 5ALHA 1J2EA 4AO8A 3PFBA 4N8SA 3DOIA 4A16A 1WB5A 2H1IA 4OCZA 2UZ0A 4KAJA 1FFAA 4FTWA 3V48A 1N5RA 1THGA 1LPSA 3DL7A 2LIPA 3TEJA 2VTVA 5E4YA 3ZLUA 2XUGA 2VJBA 1XRRA 4BBZA 2XUIA 5K5EA 2X76A 5AIAA 3WKBA 4CCWA 4N5IX 4ZI5A 4CIAA 5ALUA 4DNOA 4MQMA 1ZICA 2IX9A 5K3CA 5BOVA 1LPAB 1XFDA 5AOCA 4ZRDA 2HA4A 3FWHA 1QTIA 1CUCA 1HBJA 5LZ2A 1W76A 4PSCA 4AMZA 2HDWA 3R3VA 4HRXA 1DTEA 3PE6A 4FNMA 4YASA 1GQSA 3LS2A 3EQ9A 3H0CA 1DT5A 1FFEA 3X3HA 4Y2SA 2K2QB 1SCKA 2B9VA 3D2CA 1TCBA 4WY5A 4UFOA 5AKLA 2ZYSA 1EVEA 3VKFA 3MVEA 4U2CA 5AKJA 2BUCA 1CUWA 3KWFA 3D4LA 3STXA 2WLSA 4Y7DA 1DX4A 5HQ3B 3HACA 1UT6A 2QJRA 5ALLA 1ZI8A 4CCYB 1MPXA 4B9EA 3NUZA 4IO0A 4U2EA 4B0PA 2XMGA 5FP0A 5FXMA 3H2JA 5KWJA 4Y2YA 1K5PA 1XRNA 1BRTA 2WM2A 1ZGBA 2XMCA 2OQIA 5D3KA 3G9XA 4PNZA 2DCMA 1LBTA 2OAEA 2ZJFA 3C6ZA 2XUOA 3BE8A 5IVHA 1R3DA 1F8UA 5LZ7A 3KXPA 2HA3A 4L72A 5CW2A 3WIBA 1MX5A 4IH4A 4X94A 2JEZA 4FLFA 2QOEA 5AKEA 1UOPA 4UBNA 4UBMA 3G9TA 5HK8A 3B5EA 4Y2JA 4HTAA 3FBWA 4XVCA 3G9ZA 3WWPA 1XLVA 3PUIA 4Q82A 1QIJA 3DJYA 4YK7A 2J3DA 4LYDA 3WWDA 4XIIA 3CN7A 4LXGA 1D07A 2PKYX 4F60A 3WJ2A 1UK6A 1B6GA 1C7JA 1EB9A 3W06A 5CXXA 2XT0A 4UBIA 1KU6A 3C5VA 2VEOA 2C58A 1XKTA 3O95A 4UPDA 2PM8A 2Y2UA 4H7EA 4EY6A 4J0JA 5DNWA 1SCQA 4B6GA 2QR5A 5JATA 5H3HA 5A2GA 1S8OA 3T4UA 3GELA 2FX5A 3R3ZA 2QXTA 3N0TA 2XMRA 1EDDA 2CMFA 1FFCA 5CURA 2WJ4A 1L7QA 2PSFA 1LPOA 4IQ4A 1AKNA 4ZXFA 1EB8A 4U2BA 3SWWA 5FUMA 2WKWA 2QXUA 3TRDA 2XQFA 3L1JA 1QIFA 2PSEA 4UHHA 5FOQA 5K3FB 1F0NA 2YXPX 4HS9A 1EH5A 1FJ2A 2GYUA 2OGZA 4M0FA 3QMMA 4OSEA 4UBKA 3OURA 3DKKA 4J3JA 5AKXA 3A70A 5HF9A 3PF9A 4CI9A 4H7HA 2I78A 2XQJA 4J0IA 5CRIA 5AI6A 4DSZA 2VSQA 5ALWA 1J06A 1LPBB 2XMDA 2JGFA 2WIKA 3G7NA 2ORYA 3F67A 2HA0A 3WZLA 1JT2A 2OAGA 1QGED 5CTAA 4ARAA 2V98A 3AZQA 5K3EA 5LZ9A 3R3YA 1TIBA 1XZHA 4N8DA 3OG9A 3D59A 1VE6A 2WIGA 5LLSA 4AO6A 2BKLA 3O4IA 1RWQA 4QNNA 1EI9A 3C5WP 5A7FA 4UBLA 4OD0A 1UOOA 5AKIA 1MU0A 1UKBA 4GLBA 2VT6A 3C43A 4GBGA 5D3ZA 2IITA 2WHPB 2B4KA 1A88A 5DYWA 1XZBA 4FHZA 1VKHA 2P8SA 1ZOIA 4DMCA 3STUA 2JGJA 3IVMA 4QZVA 1U65A 4ZGBA 3KDAA 2RGUA 4LYEA 1FFBA 1LPNA 4E14A 2VATA 5HF5A 1UWCA 2PUHA 1Y7IA 5ALEA 1EX9A 4FBMA 4H35A 1VA4A 1ACJA 2BJHA 4B0OA 2B61A 1T4MA 1GZ7A 1XQYA 1A8UA 3QM1A 2QS9A 4Y2RA 5A6VA 3WL5A 2WG2A 1YB6A 1DQZA 2BGRA 1QFMA 3D7RA 4G9GA 2Z8XA 3N2ZB 5LIPA 4B84A 2ACEA 4J03A 1QFSA 4F0JA 5EHNA 4C6HA 1L7AA 2I3ZA 1GT6A 1Y37A 4H18A 4H77A 3TGLA 1H2XA 3JW8A 1A7UA 2QKYA 1YCDA 2GBGA 4OU4A 2CB9A 2NW6A 3FYUB 1XZIA 4Y2PA 2PSDA 2B20A 3E0XA 1EHYA 1BCSA 3L1IA 4RGYA 2X5XA 5AKKA 5AO9A 1DX6A 1CVLA 5HFAA 2Y2VA 3O9MA 5JANA 3STTA 3PDCA 4ZWNA 3I1IA 1CUDA 3WA6A 4KEAA 5AK6A 4BCCA 3H17A 4AN1A 4Y2QA 1PJAA 4B9AA 5ALYA 2XUPA 1LZLA 4L3WA 1JKMA 1CRLA 3F97A 1BU8A 4ETWA 2WFLB 4J0HA 5JAOA 2FUKA 3F9CA 1QTRA 4DNQA 3I1YA 2ZSHA 2GBIA 3P2MA 3B12A 4Y9SA 3HXKA 5JAPA 5E2IA 3STWA 5ALJA 2HRQA 1CUIA 5JADA 2WJ6A 2WUEA 2DFPA 2VJDA 2Z5GA 1ODCA 3FVTA 5AKHA 1CUUA 5HKBA 1UKAA 5BWBA 2BUBA 3C8HA 2OGSA 5CMLA 1ODTC 4XWGA 5C8VA 4H7IA 3G0IA 1MT3A 4NVRA 4LHEA 1QLWA 1WHSA 3UUEA 2H9YA 4AZ0A 4EY7A 3LP5A 5ALPA 1NX9A 5HF8A 3GROA 5K3BA 1ZD2P 4DYHA 3BIWA 1GPNA 1UFOA 1K8QA 4QA9A 2BGNA 4MEAA 3G9UA 1EDBA 1R1DA 2JGEA 1JFRA 1ZGCA 3IUQA 3F8SA 5KWIA 1XZMA 3QMVA 5T4BA 3R3XA 5JASA 4BRZA 5ALVA 4JH0A 4G8CA 4PW0A 3BJRA 3DL4A 4BVKA 4V2IA 4Q05A 3VJMA 1CQZA 2OCGA 1MTZA 2WUDA 2HU8A 2JF0A 3R3WA 1UOQA 1MNQA 4BTVA 4CFSA 1XKLA 1AZWA 1QOZA 4BCBA 1XZEA 2C0PA 1JMKC 4HXFB 2Z3WA 1G4HA 1TQHA 2JBWA 3D2BA 3H19A 1JI3A 5LZ8A 1M33A 4X85A 4CG1A 4BVLA 4NS4A 4HXGA 2ES4A 1XZAA 4K6KA 4PSDA 1UKCA 1U4NA 4Z49A 5ALSA 1YB7A 5EI5A 1OXMA 5T4HA 1DQYA 4JYPA 3D2AA 3AIMA 4WCVA 5AJHA 3FOBA 1CUVA 5AM1A 2FJPA 3VISA 3WL7A 3G0DA 3H2GA 5ALIA 2GBCA 4KRXA 4QDUA 1E89A 5DYTA 5I8PA 2PSJA 1LBSA 4G5XA 1WM1A 4FWBA 2OCIA 2AJBA 3B3QA 2G4LA 2ZYRA 5HQ3A 4B80A 4GECA 1A8SA 3H2KA 1JJFA 4CCYA 4MYSA 1U2EA 5HZGA 4UFPA 2G63A 1R9NA 2XMQA 1XRQA 4HRYA 4F21A 4BAUA 1PFQA 3BWXA 1THTA 4GDMA 4H7KA 3HABA 4OPMA 4OB6A 1XQXA 3VVLA 2OGTA 2AJ8A 4B82A 2EEPA 3H1AA 2C5GA 3FLBA 4EB0A 3WYNA 1BCRA 4JEIA 2XUAA 2H7YA 3EIOA 4ZV9A 3OPMA 5ISMA 5CBKA 4C4XA 1FSSA 3O0DA 5HKAA 1ZI6A 1O6GA 4FLMA 2OCLA 2WHQA 2XMZA 4W1RA 1CUGA 3IIIA 1ISPA 5JD5A 4X97A 2W22A 2XUKA 4PSUA 3ZWQA 5JARA 1IVYA 5A7GA 4N8EA 3U1TA 3PI6A 3JWEA 2O7VA 2CZQA 3WK5A
chains in the Genus database with same CATH superfamily
1J09A 4DJEC 4MEBA 2IF0A 1GZ4A 1XCBA 3MWYW 1NOKA 2WFAA 3H9UA 1H0HA 3GP3A 3WO0A 4BX3A 2WA2A 1KZ6A 1K6JA 2O52A 4LBYA 4UZFA 2VZEA 3RHTA 4B5LA 5IYZA 1BFDA 2YBDA 3H83A 3PDIB 3STHA 1O7JA 5HM8A 2FYTA 3OOEA 4GXNA 4ESEA 1HL7A 5ALNA 2BGUA 2PL5A 4E31A 1QHYA 4B3FX 4TMXA 4HNVA 1Z2DA 3H86A 3GHYA 3GL9A 1X80B 3UWMA 5KHLB 3ISVA 3CNNA 4DIUA 2PGDA 2V9ZA 4XD7D 2IUTA 2R7MA 3L4JA 3MGBA 4Y0AA 3AKCA 2WFZA 4FFRA 4GW3A 4QOEA 3VKVA 4AFNA 4BKOA 5K45A 1DEKA 1IATA 5FLXA 4N5DA 4MVJI 1KQNA 2QTAA 1WIWA 3UV7A 1HFKA 1PS0A 2FA9A 2I1LA 2MINA 5EWLB 5GWXA 1FS6A 4FCTA 4ML3A 1FX1A 1J23A 1Y3BE 1W36B 2Q4TA 1I6MA 3PWTA 4L5JA 4L4SA 1EZ1A 5KDLA 1G20B 1PFKA 1C4WA 4GP7A 4WLEA 4B6SA 5KNLA 1IULA 3ICPA 4U7DA 1S9DA 2EFEB 4KSCA 4UOQA 5JNSA 3TG8A 3RUFA 1T91A 4KX3A 3TEMA 4AUEA 5KAPA 5DNAA 2F3RA 4P34A 2ONKA 4PX9A 1T8UA 1ODLA 1QVAA 1RWOA 5E0OA 1F1JA 1ABEA 1C7ZA 2IIPA 1P1KA 3AHGA 3HWRA 2HSEA 1XTBA 3MRXA 4M4SA 4XQEA 1NPTO 1LX6A 2Q6IA 4LRYA 2A33A 1HKHA 3DQQA 4ON9A 4WY8A 4EZIA 1BEUB 3OQNA 4D4LA 1R0WA 4IUDS 4OP3A 1LRJA 5EZQA 3UMCA 5LLTA 1NZJA 2W83A 2ZTLA 3L6OO 1W19A 2BZSA 5I9MA 4XFDA 3TNFA 1HYQA 3NHRA 5E1DA 4KMMA 3WNVA 3D8UA 3EK2A 4EUSA 1C7EA 4KPYA 5JD4A 2Y4NA 5CM2Z 5MN4A 1AS3A 1H94A 2QR3A 5EEHA 5BWCA 1VTKA 4S05A 2CBZA 1GUZA 2VOEA 3NCHA 4E15A 4QDZA 1KDVA 1L7NA 2PBFA 4P31A 5EJMA 3TXXA 2ORED 2FK8A 1GRRA 5FNVA 5KVAA 4KXFB 1PQUA 4HAUA 4FMDB 2Q2WA 3H1BA 1N57A 1NL3A 2AN9A 4X95A 1KQGA 2QMZA 3M2PA 2YWBA 3C85A 3GLHE 2QORA 2ZRPA 4R8RA 4CDNA 4BQIA 4PPQA 2HRRA 2ETXA 3BQMB 4U6QA 2X2OA 5AQEA 4IDHA 4Y6OA 3DVAA 4J4TA 4DSNA 4UTOA 2C61A 1HLGA 1UC9A 4KPUA 1WMFA 3DR5A 2Q4OA 2VAXA 1UBJS 1YVUA 1ZIXA 4JROA 2OXFA 4DILA 1NVAA 4V03A 5KQPA 1DC6A 2FEPA 4R3WA 3ISJA 1LY1A 2A0KA 3VO9A 4LIPD 3FSRA 1TFUA 1S01A 1I4WA 4Q1CA 5SZIA 4F4HA 4DG8A 2GZMA 3LWZA 4CMIA 1OLSA 2ZIGA 4NHEA 2JD2A 1SKYB 1THMA 4O02B 1IJEA 2V6BA 4YJ3B 1CNFA 1KAEA 2BZGA 4HH3C 5AW5A 3SICE 3ZEIA 4DF3A 4BMCA 2XRZA 2OVFA 2KYRA 3ABSB 3DH0A 4OQQA 5SZHB 1VXOA 2LRHA 1U3WA 1ZAKA 3C3EA 3FDZB 5DBFA 1L5GB 4EDHA 3T3PB 1YBHA 4BMOB 3O73A 1Y8CA 2X5OA 1TIKA 2KSQA 3RFCA 3VH2A 3KUXA 2ZI9A 1VMEA 4QJBA 3C4JA 4YGYA 1SC4A 4JZYA 2QRMA 4QC2A 4TXHA 1FNSA 4DV0B 2CHFA 4NFSA 4XPIA 5E6SA 1Z16A 1EK1A 2X86A 4P3XA 4AWXA 4EUKA 2EC5A 1DQNA 2LXNA 4X93A 1NP7A 3DF9A 2GSWA 4BUCA 3SEAA 3SFTA 3IDFA 4WBNF 1XZPA 3CF2A 2CLMB 4L75A 3U17A 3HY4A 4LY9A 4KO8A 2F62A 5GP1A 3B6KA 1P7CA 1M2OA 1JJBA 1RMYA 1NLYA 3G0OA 1O54A 3TM5A 3W05A 2M6KA 3JRWA 2ZITA 3MWDA 5CNKA 4RS3A 1OVGA 2Y0DA 2I99A 1A9ZA 1JDBC 2YMPA 3GLRA 4F9TA 5IFKA 3HU1A 1UZUA 4DUGA 1SU6A 1C5KA 3KYIB 3LIIA 4HHEA 5AK3A 4ETNA 1HQCA 4AYWA 1NKVA 2PCJA 4C7BA 4MGYR 4KE8A 3GN2A 4NU8X 2P3SA 1FFXA 3KG2A 3PR2B 4W1SA 3MYRA 4PC7A 1OFGA 1OA1A 3WMRA 3DO6A 3VNAA 5BUCA 2DPMA 6ABPA 2HI0A 2PYZA 1I1NA 3IGFA 5HMLA 4F38A 4KKXB 4PY2A 5JC1A 5EHZA 4M0CA 1B16A 3MWEA 4QGHA 3R23A 1F2TA 3WNDA 5JV5A 2C7VA 1J97A 2VHYA 4HX5A 1ZJYA 2CUTA 2XLBA 1WEHA 2XWSA 1GSHA 3ED5A 4EUFA 5ALXA 3A6PC 4J29A 1O87A 4EJSB 3HDQA 1CY0A 3NPAA 3ZI7A 4DCSA 3U1BA 3L0ZA 4NZZA 2DUWA 1G9TA 1KGDA 2FFHA 4IRMA 4NWIA 1I5OA 1LDEA 4JUAA 1ZR4A 4DR4B 3DO5A 2VJNA 3R2JA 4H3KB 4V24A 4BLTA 1DRWA 3ZWMA 4C88A 4F6RA 3B9QA 4EFMA 1PGOA 4Q19A 2ANBA 4MUJA 3PT5A 1G41A 4MW6A 2JL1A 3OLQA 2RHMA 4ED9A 1USKA 3MS2A 4AROA 2HUPA 4R84A 1C7IA 1CS0B 3MN1A 5JCJA 4B3TB 4G97A 1E63A 2IEDA 4QU8A 3A2MA 3P0EA 3PNMA 2IHUA 3K1AA 4KODA 4G0OA 1NTRA 3H4TA 3WBKA 4AJKA 3T1TA 4YJFA 3JQ7A 4E70A 4BV8A 3G6WA 1AD2A 3FYTA 4LKOA 3G0CA 4FT4A 3CLRD 4HDNB 3SZMA 1LD3A 3GGPA 2GZAA 1MN6A 1K3TA 2D4HA 3QPBA 4P93A 1XD9A 3IS3A 2YJNA 1F20A 2VA9A 5HKLA 1R6AA 1OIWA 3N5CA 1FA9A 1GPH1 1MIOB 2I4MA 4RANA 4ASUA 1UFRA 5KKNB 3P0RA 2PIAA 3EGXA 3OC6A 2P2NA 3O3OB 5CFRA 3SC2B 2A5DA 5E6UB 1ZAYA 4M8LA 2JGLA 4OHPA 3G2NA 3EVDA 3EQ2A 3QF4B 3HO1A 1TYBE 2QAJA 1WD7A 4JJ4A 1JWLA 2NXNA 5HX7A 1UXJA 5HDBB 4PCVA 3FSGD 1HRKA 3DNMA 2OXRA 3FCSB 3H8JA 4IKPA 4LV8B 4UDNA 1UZLA 2QRGA 1CUZA 1S2OA 1ZUIA 2B78A 2GHQA 3IAAA 4P8RA 1RAIA 4IVRA 2ICAA 2Q1YA 1HDEA 3K0HA 3Q0TA 1C1DB 3IPCA 2JAXA 5TR9A 1C30A 3PQFA 3BRQA 4HZUA 1QQTA 4B81A 2Y68A 5B3LA 1KEKA 4QREA 3QVLA 4FFWA 1YS9A 4FI3F 3OIWA 4MRPA 5JNRA 3WDLA 3QUCA 3ETCA 3CLSC 4O25A 1KDZA 3AIKA 1G18A 1FW6A 1U1DA 2I6GA 5IVPA 4Q1VA 3L4EA 3R7BA 5DWVA 3U19A 2HJVA 4ID3A 4KH0A 3WL8A 5MFPA 5AIBA 1V1RB 3PHJA 3VGJA 1E2NA 4DGQA 3QPVA 1GSIA 1P1BA 2VNSA 1II8A 3A4IA 5E4JA 1HE8B 5B6JA 4BUJA 3DFFA 3JRNA 2Q0SA 1TADA 1KDRA 1RM0A 1KQOA 1RHUA 2C2HA 2OZEA 2PTHA 3BE4A 4QUDA 3OJ0A 4WN9B 4HQ0A 5B7GA 2K5UA 4YT5A 4BECA 4OOEA 4J2OA 2J6CA 5DSZA 1Y1SA 3ECSA 2GWRA 1XTUA 3AVUA 3JQBC 2BEKA 2JLAA 5G0VA 3J80A 2V9PA 3B3JA 4HX2A 1R12A 5DHSA 5T7BA 2XQIA 1AK9A 4L0CA 1Q1QA 4A73A 2VJAA 4OHZA 4MR7B 4DSUA 4BX9A 2VDOB 3F2IA 4HGQA 4C01A 3AWIA 3TR6A 4XB2A 1H2RS 3GU3A 5TE9A 3LNTA 1F0PA 2RGNC 2PVSA 3C3YA 5I7WA 4JV5B 4FMCF 4QFBA 4CG3A 5AJZA 2VK4A 2BE7A 3QMWA 1YL5A 4R2IA 4MWTA 4ZALA 3WP0A 2N75A 2PGLA 2P69A 1OXBB 1U7ZA 4NOLA 1NTOA 3V1NA 2HWYA 2PUTA 2WJ3A 2Y1OA 3M6UA 4RH3A 1SQ6A 3N2NA 1XB2A 2EZTA 5BOSA 5HKKA 3CMCO 3EFHA 1TQDA 1GPDG 2CJPA 2F6RA 3FUVA 4ID9A 4JLSA 3I2YX 2W2XA 5CNIA 1MR3F 2QMQA 3MUEA 4ZAXA 3H3FA 3H2SA 1HZJA 4IRUB 2OV2A 4DCJA 2QBYA 1O6ZA 5KUTA 3IQXA 4JS0A 4TMKA 4JGBA 1C80A 1IE3A 2QX7A 2GN6A 3B3GA 3G7SA 3VR5A 4Z3OA 1ZMXA 4GGOA 1Z56C 2OORA 3TSCA 1WW3A 3KELA 1N7JA 5GGXA 1PK7A 3L79A 1UT8A 2ZIUB 1KQFA 1CT9A 5JI3E 2BEJA 2QMEA 4CU2A 4D4KA 3E7XA 4OK5A 4ND5A 2ABWA 4L22A 4TV9B 3M5WA 3UEOA 3I5YA 2G9NA 1SJ9A 2EKZA 2QT0A 3QU9A 2DUUA 1BW9A 2J45A 4PRKA 4FYJA 1JV2B 1JEYA 1YU6A 4Z7QB 3MLAA 2PWPA 3CN9A 3H2HA 1WMSA 3Q87B 4EBBA 1JEDA 4V38A 4L9AA 1LNZA 1BE0A 1HO3A 4WZ6A 3ZBTA 3ZZMA 1Q0ZA 1T1JA 2JFZA 3CX8A 5AOVA 1BXGB 5EP2A 3RK0A 3TTTA 4P22A 3UAYA 5CG1A 4DMGA 3PVCA 1SVNA 3ROFA 4EGAA 4ZYLA 1GUBA 2OHXA 1RBMA 1UZMA 4N7MA 4DMMA 4WTOA 4XWKA 1R88A 2ZROA 3L1KA 4PV7A 5IASA 2MU1A 2GVNA 1P2UA 2NV6A 3IFSA 4XQ9A 2NO6A 3EDOA 1VZ2A 2GCEA 2B8JA 4PG5A 4DQLA 4FBGA 1JIIA 2H07A 2BGMA 1XF9A 5JSFA 2IQIA 1LSOA 5JXJA 5I7AA 1NF8A 4KR3A 1OU4A 1W6RA 3FVQA 3UANA 1SGWA 4FJ1A 3RIHA 4OA5A 3IVGA 1O57A 2XBUA 4FILA 3H11B 3ICWA 3ND7A 1LW6E 2AJLI 4FOSA 2OYCA 4ER6A 2WJVA 1JDUA 3PP8A 4O33A 5KTPA 2PZGA 1FX0A 1X1QA 2RAVA 1JR3A 4G25A 3CV3A 4KU4A 4PHFA 2IEZA 4OY3A 2GASA 1SXJE 4PX3A 4WCFC 2OA0A 3TIIA 1E6LA 3U0BA 2ETVA 1WB4A 4JHLA 2Q9AA 2JEOA 2WIJA 2Q21A 4Q3OA 4RF5A 4BO2A 1ILEA 1WPXA 2P68A 3LZDA 4GR4A 2Z8YA 4NESA 5CP8A 4RK7A 3IULA 4TSFA 1F06A 1H6CA 5AKYA 1UDXA 1Y0BA 3GR6A 1YQUA 1G8KA 3A0RB 1Y9JA 4KYVA 1OIVA 1BHSA 1XYGA 3LVQE 4K6MA 5EXTA 1DBRA 4HG2A 4CIBA 1AQLA 5JAMA 1MVNA 2ZKIA 5IAOA 1JDNA 2PUCA 3OCWA 5FJJA 2I8LA 3CO0S 4A2WA 3IHKA 4HLUC 2ZIAA 4M8IA 5DCWA 5C5EA 4TX1A 3JASA 4ECAA 4F4JA 2C8LA 2X15A 4EVRA 1QKKA 3MXOA 4U2KA 3RS9A 4P7KA 3SIPA 1J8VA 1GAQA 1W0CA 2F3TA 3EAGA 5FEUA 1LLCA 1LNQA 4PO3X 1QCCA 3KKZA 3Q7SA 2G07A 3DBHB 2ISCA 4X61A 5JJKA 4FOPA 5IKXA 1Z5GA 1GQRA 1D1PA 4QICA 5FV4A 4P4UA 4WACA 4YHBA 3PKZA 1L4NA 1RDFA 2GETA 1A5SB 1NPYA 4WASA 5EXDA 3K6KA 5FKJA 3ZHUA 3N2KA 3QKRB 3U81A 4QT4A 1PKEA 1T35A 3WB9A 3ZCQA 2VDPB 1T43A 4Z54A 1U6JA 4RGVA 2DHDA 1YT5A 2ZRAA 3L49A 4HB3A 4M6WB 4PG7A 3U4AA 4LHYA 2DQKA 1GO2A 4OUDA 3VAYA 1HV8A 3R9XA 1D2RA 4RPCA 3FTQA 2Q1SA 1Y5LA 4CL3A 1GARA 3UXMA 1YB2A 2EYQA 2JIOA 4YA6A 3QYJA 3I61A 5CW1A 5KTYA 1KJZA 3GA0A 4GBMA 4GMXA 1MVOA 5L6MB 1ZJWA 2DUNA 5K01A 4X3CA 3ICQB 3JQ9A 1RWNA 4F91B 4Q34A 1PD0A 3HCDA 1E7MA 3NWPA 1ZA2A 4Q18A 3ZD8A 2H2FA 1ADCA 3JVVA 3QKSB 3WIVA 5LQCA 3R20A 3SR3A 4AJNA 1LBIA 4X6UA 1WXWA 1Y34E 4QNRA 3N2GA 1P2TA 2DFTA 3R4CA 3T3HA 5F3RA 2RHTA 4O4LB 4W5JA 3D6VA 1LNSA 3W2EA 6YASA 3W04A 1PBTA 1AKWA 5KREA 3CFYA 2DETA 2Q9CA 4L27A 4O2BB 3GGCA 5HUQA 5AVUA 1F60A 1Z88A 5AI8A 3TVYA 4EFNA 1HT3A 5DN6A 1YRAA 4TS1A 2APJA 3W1VA 3J81A 3O74A 1TM4E 2AQ8A 1ZHFA 2FQYA 2NM0A 1MC1A 1XC7A 4PXYA 2BD0A 1E1QD 1XYYA 2YWHA 3CRMA 1IDN1 3AX6A 3REFA 1TRHA 3S2YA 3TB6A 5I48A 2FB9A 2FLKA 4LVCA 2IVFA 2WU4A 4J1TA 1SCUA 2Z08A 2X2EA 2QQGA 4NMXB 1KPHA 4DNFA 3D7SA 4QPZA 3MW8A 4RNCA 3JVEA 3DZDA 2XT6A 1SXIA 5DHUA 1J07A 1GKKA 2EG5A 2IY8A 3DW3X 3UJ8A 3WBJA 1EDZA 1D4OA 4OEHA 4CLRB 2FN8A 3VNVA 4FNGA 2C3YA 4Q4HA 2VJCA 2VKQA 1U1FA 4EGQA 1J4AA 2AOXA 4RIEA 4Y6QA 4J0DA 3OMWA 5ELMA 2X8AA 1H3FA 3G02A 4BTEA 4LFAB 4Q01A 1ZDMA 3G5AA 3Q8WA 2XUQA 4M83A 2NVWA 2IPMA 1B41A 1M5TA 1NQOA 4EYKA 2J4CA 3F3YA 4Q7QA 4G5FA 1K9SA 5FPHA 2WD9A 1QWSA 2ONJA 1WRBA 4HV4A 1AH2A 2PRKA 3KJGA 3MD0A 4WA7A 3FOEC 3BIXA 3ONWA 3GNTA 5D1HA 3DO8A 2ODPA 5KVQA 4KCGA 5T5QA 3ZV5A 4A10A 5BW8A 4LXUA 1Q2UA 2G76A 1CUBA 2FFJA 3JQ8A 4FBLA 4M76B 3TMAA 5LU8A 2JLCA 2HRDA 4FOLA 1JG1A 1QZZA 3BREA 5LDHA 4BV9A 5EA2A 2DY1A 3ZW7A 2I3DA 5K0LA 4MO2A 1X7ZA 2CCKA 1SCIA 5BMOA 3ILYA 3ANNA 3CB2A 1N9KA 2VF8A 5AXDA 3SVZA 3FUUA 3K2BA 3STYA 1Z33A 2IPLA 2VIIA 4Q3EA 4IKOA 1P2DA 1TZCA 2PZFA 4KUEA 4HEHA 4E5UA 1W4BA 4KTTE 4W8OA 3RS3A 1PFVA 2WMYA 4GNRA 3T95A 4RA9A 4XEHA 4IS2A 4TMVA 1RI5A 3WISA 2BH9A 1G21A 2AK3A 2Z1NA 5P21A 1MHPA 5JZBA 4RORA 4I1YA 5B1HA 4KQ9A 4DJAA 4PXAA 1VCHA 4D57A 3AB3A 3KWLA 3TLKA 2ATCA 1IY1A 1UPAA 3ENVA 4MGHA 5A3VA 2WPDA 3PXUA 1LRLA 4X1YA 4D7AA 3VNQA 3HDTA 5K0SA 1E96A 1FU8A 4FD2A 5E6RA 1YRLA 1KBQA 5F4BA 4DNPA 3OU7A 3KD2A 2RGXA 1N6KA 5REQA 1IL0A 3SKXA 4UXJA 3RKRA 2CVZA 2A1IA 5J47A 5HS4A 1IUOA 4CEJB 3INNA 3FTEA 5EP1A 1EX1A 4TV9F 3GK3A 4D25A 1SURA 821PA 3MIZA 1L8LA 4J0CA 2VHQA 2CFCA 3NWJA 2P5YA 2ZPUA 2A84A 2YWJA 1C3XA 2PMWB 4R8SA 5E8RA 4TL8A 1WVIA 4CQMB 3AVTA 4FT2A 4FPXA 3I8XA 4QU0A 2B0JA 4I9GA 3BMQB 1Y3FE 4EHBA 4CG0A 4GZLA 4M53A 2I2BA 2VXOA 3OQIB 4NRDA 3OHPA 3KSRA 1FUEA 4BQQA 5G2OA 3W6PA 1C1HA 1WULS 3AK4A 3G1UA 3PDIA 1Z0SA 4IY1A 4B2LA 2FMFA 3C5CA 1BDHA 3WK6A 2E21A 2D0PB 2YIMA 1V37A 4PZYA 3QE9Y 4BB0A 2IOHA 3W2FA 1X80A 1BVYF 2ISSD 3NORA 3I6YA 5TV2A 3MJVA 3UOAB 3MCVA 2QTCA 3TVTA 3WK7A 5JAIA 2VJQA 2E5WA 4HAXA 3HR4A 2NUBA 4WXYB 4C0XA 4EUNA 4EECA 4INJA 4QAQA 4YCCA 1E6WA 3D8SA 3EOBI 4BNMA 5EWLA 5GOTA 3LC0A 4HUJA 1AHPA 4OK3A 4QG3A 4QD3A 1XCMA 2BFWA 1R2QA 3R9WA 1F1BA 1G20A 3LCRA 3BFXA 2CK3A 2W43A 1MX9A 3L02A 2PRIA 5F7ZA 1JDBB 3DXXA 3W7VA 5JAHA 4K7JA 4KN9S 4NS1A 5K3SA 4LQ4A 4QG7A 4UU1A 5BQXA 4NMMA 1BQ3A 3QBEA 2ZI7A 4NNJA 1KKUA 1D4ZA 2R6JA 2A9OA 2QM7A 3CNBA 5ERYA 1EK0A 5A4JA 2OZKA 1U2DA 2NADA 5EESA 3F6PA 1QG4A 4RFVA 1Z5NA 3FNGA 3ZBUA 4HUTA 4EHJA 3HA5A 3HDGA 1MC8A 1KFCB 2IU4A 1RYNA 1N8SA 4QGBA 1I3CA 3ZDFA 2C42A 2J07A 3VNSA 3ZWXA 3GOQA 4CLHA 1CJUC 4GOMD 1F4VA 1U0GA 1PTKA 1L5ZA 1Z4PX 4DQ0A 3K6JA 3PCRB 3UHOA 5SICE 4CT0A 2NZ2A 3RD5A 5ESWA 4IZ6A 2G1AA 3BTVA 1TT7A 4LHXA 4F3CA 2ZXFA 5F23A 4CNQA 1BOFA 1QPBA 1E2KA 1Q16A 3BXEA 5ITWA 5L3SA 2PA0A 4G0VA 1KAOA 3M4JA 1JHDA 4JFRA 2A0XA 1JMYA 4Y6RA 3RV4A 3P4XA 4FEGA 3HZZA 3KHTA 4JVOA 3BH7A 3PDHA 4V1CB 1G19A 2XF8A 2XTJA 4X6YA 5HZMA 2ZI4A 1RP1A 3OZDA 3C14C 3JD3A 4B1FA 1RBZA 2Q50A 1G66A 2EEZA 2CLLB 2QZ4A 2ZWOA 1B0UA 3P96A 3OKAA 3R5HA 4FUTA 1OI7A 3R3UA 2Z56A 1ISIA 4KMSA 5FUVA 5B4VA 1FF9A 3GWZA 4H3VA 1KU0A 2VUHB 3FCOA 3LUHA 3P2OA 3NETA 2HNKA 4KBFA 4YP7A 3LTEA 4BWFB 2VCHA 3SQXA 5DTJA 3B1YA 4BEJA 3LH5A 2V3WA 1IN6A 3BF8A 1KORA 1SBHA 3ZEAA 2ZIZA 4AI6A 3DNFA 3EASA 5FOTA 4JR2A 4BV2A 3MTGA 3L41A 1ZD3A 4PYKA 4G2NA 4FHCA 4DYVA 5KC9A 1E61A 2R2GA 3QXXA 4GL4A 1BS9A 1KK2A 4YRCA 3L8MA 4YI3A 1B74A 3JXEA 2JHFA 4YMWA 1XIVA 3LPLA 2MSDB 3HYLA 2O50A 3QFTA 4GQAA 4MHOA 1U7OA 1GL6A 3NFRA 2HGSA 5DYYA 1DBPA 5LCXA 2XMPA 1HNNA 5I8WA 3K9GA 5DASA 4FYYA 2ZJ4A 1C2TA 4DSTA 5LYYA 1YTUA 1I7PA 3CKLA 2NWQA 3H8WA 1M10A 2IDKA 3HXPA 2RIRA 1WWKA 4RA6B 4AJLA 1EIWA 3AIOA 2DBQA 4L4RA 3WNQA 3FDZA 1TUIA 1Z6QA 4DUPA 5IDQA 4FW8A 4IDOA 1MRSA 3DQZA 2I7TA 3P20A 1OH5A 2QY9A 4TVKA 4ZJPA 6PFKA 1L9XA 3ISTA 3WKDA 1H4SA 1YZYA 3KRTA 1NWCA 4TZTA 5CDFE 2HCJB 1V4VA 3QKIA 1U98A 1K8XB 1T1EA 1U0FA 3PGKA 2X7XA 4ERNA 1Z82A 1ZK2A 4QDXA 2CL5A 3NCTA 1TLTA 4GPD1 4TTIA 2DWPA 4I99A 4C89A 1KF0A 3VYSB 1Y3IA 1Z83A 4BFVA 1PR3A 5H7XA 2RHOA 1EESA 4X60A 3GA7A 2YIVX 1ND5A 3EG5A 3GJ5A 1ADFA 4GX0A 1Y5RA 2PKQO 3WMGA 4JYAB 2VQEB 2A5JA 1KY5A 4WECA 2O8DB 2Q3DA 2BMAA 1RXUA 1TUEA 1YZTA 3PNQA 1TXGA 1G3RA 3GUCA 2FJ0A 3KEFA 4GLLA 2R1TB 4RHYA 4CETA 2H9AA 1X2BA 2WF9A 3HXLA 3PHCA 2CFRA 2I2AA 5CH5A 1WCXA 3R5KA 2O1SA 5CJ2A 3KB8A 3AF0A 4AS1A 1JEQB 1J5XA 1N2BA 4RE5A 1V3QE 2EBHX 4PBTA 4X71A 4YAKA 5C7LO 3E9EA 5BW6B 3F3SA 4RD1A 2GN0A 1J7KA 1DUIA 4W7HA 5EWMB 3TG2A 4G4SP 1A5TA 2ZYDA 1BC5A 1E7WA 2GYWA 4HAIA 2DQYA 2XE4A 3UPDA 5LKAA 2R84A 3OZGA 3EMBA 3HCCA 3VTZA 2P2DA 3ST7A 4KLCA 5KYWB 1Z39A 3C74A 5GIPE 4X7RA 4OXYA 3UPUA 2WM3A 3BDAA 3OUZA 4FDLA 5C46F 5FL7D 5T67A 5KC8A 1KOLA 4RV5A 1PL0A 1JX6A 4EJSA 3WGKA 3AEXA 4EY5A 3HADA 3NOXA 2WZDA 5UKDA 4D74A 1UM9B 3EC1A 1MGOA 1I2DA 5BSRA 4D56A 2WD7B 1SHLA 2M6SA 3ZDRA 4CQJA 4KFUA 5I7RA 2Z2KA 3IB6A 2WNIA 1Y6GA 1S2DA 2DYKA 4FJ2A 1EBBA 3R3HA 3O8OB 4ONEA 1MABB 3A1VA 4HN9A 4I2VA 2R11A 3WLPA 4G4JA 2OWEA 1CS0A 4TS4A 2WJHA 4X7MA 3VX3A 1CQWA 4Z2AA 2Y0PA 1SC9A 3DEAA 1NKSA 2JATA 3BA6A 1R27A 3B6EA 3F5FA 4O4IF 1GUFA 4Y1RA 5TPZA 4NBNA 5TS2A 2WYWA 5E0KB 4AJ1A 2G28A 1WP4A 1BX1A 1V7QA 2D7JA 3DAOA 4JA0A 1YA8A 3KK0A 4G5OA 2ZUUA 4XVQA 2B25A 3VZBA 4KQXA 4Y8VA 4C76A 5FWYB 5CXQA 5DNYB 1DAGA 3A6HA 4YNBA 4HDNA 4XEUA 1E32A 4N40A 2O19A 4YLYA 3CINA 4KR2A 1HE1C 3VYUB 5JZMA 3JWIA 3D3KA 2Z58A 3EIHA 3CVXA 4IIYA 4NICA 4BDSA 1K7XB 1WW8A 4Z7JA 1JIQA 1UBEA 3EQZA 2QZJA 3IERA 1MIOA 2R9VA 3U26A 2TMKA 3WYBA 1XJ5A 4K9NA 3UC9A 4C30A 1NJ5A 3GLFE 2VUTA 3L4SO 3SM3A 2P1DA 2XVZA 3FTFA 1FUYB 5E6UA 4HQFA 3SHVA 1RD4A 2ECKA 2OBBA 2DHEA 3GQBA 3QF4A 3FFBA 3K0BA 4MRSA 4PCUA 2C20A 1J0BA 5FF9A 4CV3A 1VIMA 2QLBA 4YCLA 4AG3A 3IXMA 3PV0A 3SBDA 4IQ0A 1ZIYA 3C7CB 4UM8B 1SKYE 1NX6A 5C1DA 5KYXB 1MV5A 1T8TA 1TMOA 1MJGA 3LQ1A 3ORSA 4ZIRB 1UODA 3E5MA 3EXEB 1RWWA 1Y1KE 3M6FA 4M21A 1ZYUA 4PLCA 5AOBA 3WRYC 4RDXA 1KI9A 1C1DA 3DEYX 3FTNA 2WQZA 4ZYUA 5LFAA 4ITVA 3LC2O 2ATEA 1KO8A 2JK0A 4IXMA 1UPFA 5D7NA 1Y9EA 2V54A 1FQJA 2PZKA 3LDFA 1I9GA 2NO0A 7YASA 2YJ5A 3WDKA 3WAJA 4U1RA 3LGAA 5H81A 4CXMA 1X1CA 1QR6A 1YS1X 2A5FA 1NNLA 2P27A 3T7JA 4CV0A 5BWOA 4US0R 4WCFB 1HMPA 1CJSA 3VDQA 3LQKA 3O2NA 1GL7A 2X2FA 3IBYA 4GL2A 5IVDA 1DXHA 4PVDA 3HZHA 1QIHA 3CR7A 1IU9A 3PUHA 2IOFK 1COWD 2FZKA 1VECA 3Q72A 4JLPA 4WN9A 2ZTUA 1APBA 4YPVA 5DK6A 1Z0KA 1ZRSA 3BDVA 1JHXA 2H2DA 3O7WA 3T38A 5BQPA 1T9ZA 4B3CA 3FROA 3KJIA 4YP5A 1V96A 2PUAA 3F1KA 1TKCA 1QE5A 2IHBA 4C7MA 4EG3A 3ZDYB 2DHCA 2VP2A 1Z4OA 4H16A 3K31A 4Q7KA 5J4LA 5EJ5A 1YIAA 5CNMA 2QPTA 3BSYA 2PXAA 2Q07A 2PS1A 3FNBA 3MTEA 3P5BA 4MWCA 5DHAA 5FEMA 5KNBH 3TDNA 5FTWA 1N6IA 2AVDA 3U40A 3U7QB 1J0XO 1VIVA 1YJBA 3KHKA 1EP9A 2YN2A 3WI7A 1A04A 5EC8A 3PC6A 2HMVA 3PZRA 4K6CA 1N77A 4AS2A 4ND8B 4DKJA 3NRJA 5EQJB 1BGXT 4WXPA 3CC8A 5CVJA 5AR1A 1ZU4A 1F2VA 1WVMA 5DI3B 2F59A 5AHXA 3IALA 4P3OA 4A2QA 3OE7A 4ZFNA 1QYXA 4LOKA 5IJZA 1NU8A 2QL7A 3QMPA 4FDUA 4MHSA 3UIEA 4XLZA 2ZJ0A 2FWNA 3ZQ4A 3GXOA 3THRA 2IXAA 2WEKA 2ZAGA 3K2IA 1JTFA 1LPMA 3FMFA 1SUBA 3A27A 4HDKA 1JWAB 1P4JA 4HN2A 4NU0A 3V7YA 5KOIA 2P1RA 4J0KA 3HHPA 1CIJA 2IOFA 4U3JB 1TVKB 3AUKA 4AMGA 3UNXA 3C3MA 3H18A 3W1EA 1IBLB 2C96A 1NSFA 5DBOA 1DEOA 4GYJA 1N5MA 3RSOA 2WE8A 3GFVA 3M6LA 4JDUA 3G0GA 5MFZA 3IUEA 4RADA 1LK0A 2DFLA 2KBFA 3WA7A 1RZ3A 4K9PA 3C7AA 4RKEA 3K73O 1CZKA 3V2IA 4Z7OB 3SJCA 4IXWA 4TV9A 2HADA 1LBEA 3GGSA 4WXHA 3QOYA 2XSZD 4RH1A 1RYFA 1G8HA 1BWRA 2BP7B 3KKMA 1DKRA 2EYUA 4Q1BA 4C4RA 1P3DA 3VR6A 4DLPA 2A30A 3SYMA 1WCWA 1O1YA 2V7VA 1BXGA 2E37A 4UCWA 1J0CA 4ZC1A 3WHIA 2H29A 1NKTA 3OZ7A 1IY2A 1HSZA 1W30A 2JLQA 4YBRA 4F04A 5TMEA 1CHDA 3W6UA 1O4VA 2P67A 2AFHE 2ZS8A 3FSGA 2X0FA 3T41A 1EXMA 1YI8A 4GD3Q 4ND3A 1GR1A 4R69A 4LK3A 4OMDA 1V3TA 3USCS 2VK8A 2W4MA 3LX5A 3UG6A 4AUMA 5BQOA 4MTLA 2IS4A 2H1RA 4X65B 2J9FB 3SXPA 4A82A 5AM0A 3CLHA 3K0AB 1XJCA 3ASVA 3KQVA 5D7BA 1VPWA 3H11A 5F7XA 1UJNA 4X00A 1B8OA 3M83A 3U9TA 4E7PA 3TAXA 2PX4A 3GLQA 2JH8A 4V0RA 4Q4JB 3RS2A 1P1RA 4KFRA 1PHPA 1D5CA 1O0CA 3OT5A 2IDZA 4RMJA 4L4XA 2G1PA 3JQDA 1BCSB 2C84A 2VHEA 2QD5A 3E1GA 2Z8YM 2J1LA 4FD3A 4FYKA 3GRVA 1IHOA 1U7HA 3S68A 2YHIB 4LXQA 1Q6YA 1TYAE 4QGAA 2VSYA 1WCYA 2V55B 3DL0A 3GZJA 1JJVA 3OKPA 3WGQA 2PFGA 4B85A 1QIGA 2ZYVX 4F9EA 3A6ZA 3UO8B 2E4XA 3MTQA 4B2IA 3FLMA 5I4KA 4AJ4A 2DZDA 3OFND 1DINA 4AN4A 1G16A 4LAFA 4DC1A 5C5CA 4RTRA 2FZWA 4WMLA 3E3MA 3WG9A 3AU8A 3IMGA 2BGGA 2LIVA 1RYMA 2NUTB 3KE8A 3BD8A 1QMGA 4RZHA 5JPCA 4F8JA 1D6MA 2I3BA 3U3OA 2G4CA 3B8EA 2J5RA 2VSFA 3EEIA 4BQRA 1L5LA 2P6OA 4GZ3A 3D7MA 4D0LB 1TF7A 3PF8A 1Q0LA 1M1NA 4P4LA 1YBVA 2W2TA 1W49A 4A15A 1DXQA 3F98A 3O8QB 4URZR 4GPIB 1SWWA 2J3JA 3DBHA 4HQNA 3ZTWA 1ODSA 4JJAA 3BTUA 5B58T 3OEED 4N7JA 3EVBA 1Q84A 3KQPA 1QO0A 1JE0A 3FPSA 1R16A 4EQ6B 5FFMA 2COUA 2C1EA 1PFUA 3PNYA 3CNQS 3QKRA 2GJ8A 4KG7A 4G1MB 2M1XA 5F7OA 4EEXA 3EMDA 5EJ4A 2JANA 1L4KA 2B69A 3IDOA 4FJ0A 1O0BA 1VPVA 2Y6UA 2WU3A 1WU7A 1ODKA 3EOAI 5K0ZA 1RNLA 4JITA 3BH0A 3EDRA 4PVCA 4TGLA 4IX9A 4FDMA 2VYNA 4FCWA 3NBMA 3WL4A 3HPQA 3VJKA 8LDHA 1F12A 1AF4A 1VXRA 2ZEJA 3DAHA 3ECAA 2CYCA 3QHQA 4PLFA 3GLGE 5AXBA 1QQBA 2O8FB 1OI4A 1NN3A 1YZ3A 1X9HA 2C2BA 1OX4B 4NE7A 1WDKA 1NJ8A 4K2HA 3W4KA 4BLVA 2QE6A 4TT3D 5BSMA 5EE9A 4MB6A 1N1MA 1VZ3A 3QKSA 4PYLA 5IC6A 2OZLB 4C4ZA 4DL9A 4FQ8A 2VA8A 3GT3A 3KLOA 3AVWA 1ECLA 1Y7HA 4GM1A 1HDGO 3HMKA 3QLVA 4MMXB 4IDAA 4MV1A 2W2MA 4ZT6A 4UTNA 4JP8A 3DUFB 1DOZA 4JXJA 4O4LA 2WWYA 5BSWA 1GTZA 4KQJA 1EFHA 4DMHA 3PUJA 1K8ZB 4MV5A 4KX5A 2NU9B 3RSSA 3SN6A 5A5VA 2GBFA 5CHYA 7MHTA 1GT91 3KWJA 3T06B 5KOJB 3BJMA 3TFOA 1DIAA 2BEUA 3AUFA 1N0WA 1RRMA 1ST3A 3HHEA 4O2BA 4P4GA 4V0OA 3C6XA 1KJ9A 1CULC 4HGYA 4OF4A 2AWOA 4IOLA 3PHIA 3PQDA 4HC4A 1T26A 3PYXA 4PLWA 1WHSB 5K4GA 1G6Q1 1X1EA 2YYSA 3AI1A 2E4AA 3O1JC 4G8BA 4OP2A 1Q92A 4UEKA 3WWCA 1N2GA 1U8EA 4BFUA 4INZA 3YASA 5BWMA 1QCYA 1JPJA 4EI9A 2Z09A 3VPBA 1QVWA 1E3TA 2J67A 3C3AA 3ZQ6A 4ZYTA 5DBHX 3UGKA 4BP8A 3TRIA 5FO0A 4OHRA 1O95D 4NFYA 1KJIA 3LQFA 1YQQA 1K63A 1P6XA 1RXYA 4CLRA 1ISMA 1F14A 3KJQA 4DDWA 2E1RA 3LIPA 2GEJA 1I51A 1VI6A 3E35A 3ORFA 1ENZA 1SKBA 3RAJA 3OUUA 1FBTA 4KHZA 1HR0B 3FRHA 5K0BA 2XX3A 4IRXA 1IONA 2BN4A 1CV2A 1Z2CA 2FPSA 4JSTA 2B4YA 2MR6A 2HBYA 2OCPA 3HCPA 4FSDA 4Z9XA 3OECA 3PD7A 4CM9A 2IWHA 1NVEA 1FDTA 4GKAA 2A0YA 4KVZA 4QLOA 4EB3A 3VZRA 1K4MA 2BJVA 4B3HA 3AEKB 5SYNA 2E3JA 4D2IA 5CVEA 3RFUA 5BYKA 3CY6A 5CT8A 3VXKA 2CMHA 1VJCA 4MWSA 2VG8A 3K9WA 4XGQA 3UBMA 4E88A 4M9CA 3WQBA 5HWSA 5BQ5A 1AKTA 2FN4A 4GSKA 1YD7A 4OIFA 4AJOA 1NXSA 1CF4A 4IS3A 4HQKA 1SK9A 3KV1A 1VDZA 3ETEA 3G2HA 3K1JA 4W6QA 5ALHA 2RGYA 5KQRA 1J2EA 4JQOA 1TYEB 2BKEA 3HWWA 3IMEA 4UVIA 3LCVB 4NBVA 5ILQA 2H1IA 1MMFB 1AKMA 4OQXA 2ZLBA 2QN7A 3PENA 3T4XA 3C8UA 3A1FA 1FFAA 2R5NA 2IPXA 4GKVA 3K9QO 1YACA 4GFDA 1N5RA 2FWAA 2X9QA 1B2RA 3T35A 2C4NA 5J1SB 3V32A 1SHJA 1QH8B 1T9DA 2OHVA 7REQB 2GZHA 1TO2E 2LIPA 3D5QA 2LUOA 3KYCB 3TEJA 2IHNA 2Q3LA 2I4OA 3LPDA 4OAOA 2VTVA 4FIDA 1QF6A 4J90A 5CBPB 3JWHA 3CH4B 4YFVA 1VRCA 3KIPA 3R44A 4IJKA 1Z06A 4UM7A 3PTAA 1G38A 3UMSA 2QL6A 2JAOA 3MMSA 1ZMTA 4D4HA 1L7XA 1P9LA 3ANXA 2O4CA 3GLUA 4RKRA 5AIAA 5LP6F 4CEJA 3ZCXA 2H0AA 2WSBA 1HETA 4BLRA 3A4MA 1EA7A 5AJYA 1H1DA 1QFXA 1ZWKA 2O05A 2R4UA 4JCCA 1W581 3ZY2A 4BS9A 4EKYA 4O3MA 1ZICA 2Z9BA 3M9XA 3K94A 5KZMB 4CQMA 1SVLA 2YX1A 2EZUA 2Z4TA 4AL4A 4QO7A 2C29D 2XEXA 1DSSG 2NPFA 5F77A 3BMQA 2XWPA 1P4GA 2UVQA 5A4MS 2GO7A 3FWHA 1SB8A 4ZRDA 1QWOA 4YMSA 5ELXA 3KVNA 3OQIA 3OQVA 3G8BA 5KNDD 4DCUA 3O1LA 2B35A 5LM3A 3R3VA 3ZVRA 2HMYB 4X7PA 2AFVA 4A26A 4B7XA 1P60A 4P82A 5ED0A 3L77A 2P9CA 2YV2A 4BJHB 1AIPA 5EERA 2HC9A 2VBGA 1B93A 1GQSA 2WYUA 3TAHA 4CU5A 3TN7A 2AC4A 1W46A 3EQ9A 5HCIA 2B99A 1R6XA 1FFEA 4X24A 1CXZA 3MHPA 3R5FA 1KKLA 1OWLA 4H7PA 4URHA 2B9VA 1U3DA 1RJGA 4GE3A 2A5YB 4M1YA 4Y98A 3D2CA 1TCBA 2WAXA 4WY5A 4BVEA 1I7SB 4D92A 1Y6QA 2ZYSA 2VUIB 1NC1A 3COSA 3G2MA 4UEWA 1T4CB 3FB4A 3P9CA 2QN6A 5E3IA 3KWFA 3O03A 3D4LA 3PHLA 1VL2A 3KTFA 3LUJA 1CJTC 3IUBA 3STXA 4HLNA 4Y7DA 1TEVA 2BM1A 4YLGA 1DADA 1KVQA 2NXCA 2Q4DA 3OP1A 3U3XA 1G8FA 1DX4A 2IYRA 3PPYA 3VV2A 2RB4A 1ULUA 1T1IA 3A4LA 4WKCA 3GAFA 1Z4LA 3HACA 3OZVA 2NZYA 3S55A 4Z7NB 1X7WA 1UT6A 3EX7C 3KD3A 3OCUA 1N6OA 2J6BA 3I8SA 1ZIDA 1E4YA 2A86A 1S02A 2NU6B 2UDPA 4NCIA 3VNRA 3GEEA 1Z8DA 3IQDB 1IQUA 4L5CA 2UUCB 1ZQ9A 4K88A 2FVXA 2OMEA 2XJ4A 2B83A 2HLNA 3FM9A 5F35A 1YS6A 2W90A 3EXAA 3VH4A 5JWOA 1K5PA 4NCNA 3DDCA 2O3UA 4RYDA 4B4UA 2IU3A 4CTJA 2OV8A 5KJFA 4MA4A 3D9QX 4I3HA 3CWCA 4PNZA 3G5TA 5ES4B 1K5HA 4DIOA 2RCNA 3LDGA 4V1CA 3MWLA 1LBTA 2AD5A 1S6YA 2RB5A 4RZ3A 3C6ZA 4E08A 2XUOA 3H7AA 5IVHA 1PIWA 1VKNA 4LDNA 2OUIA 1R3DA 3GCGA 5FBWB 4FZVA 5H68A 1LRKA 3M33A 2XF2A 3B2NA 3OA0A 3FSEA 1BAPA 1H5QA 1E9SA 4LBZA 3KYDB 3BHMA 4NKRA 4DCTA 2HA3A 1M7HA 3CR8A 3E9MA 4L72A 4I9UA 3GZTB 2OFFA 3U3ZA 2Q7DA 2BIFA 1I14A 1LJUA 5DRYA 4AZVA 3CIOA 2C2OA 3GDOA 4MK4A 4UUAA 4EHNA 3WP1B 4F93B 1HH4A 4FLFA 4D3FA 4RK1A 5BV0A 5I9SA 2QENA 3TIFA 3ZJ5A 2GK6A 3S1AB 2AA3A 4LUCA 4OJNA 4ALMA 1PJSA 8ATCA 3N8IA 2B8NA 4EPWA 1JZTA 1RHRA 3PU6A 3C1UA 3X1MA 4YCSA 3AHIA 1VPDA 4S3MA 3ZYZA 4RL6A 1QHEA 2J3EA 4NK5A 5A0FA 3T5BA 4C2AA 4JDPA 4EB6B 2ZP1A 1M54A 1NE2A 1NQXA 3F7TA 3TRHA 5B6PA 3RR2A 2EL7A 1XX6A 1AKQA 2QGZA 3T5PA 1JKIA 1MJNA 2OC4A 3WMXA 4FZRA 5C7OO 3HVKA 2ZRIA 2R8PA 1D03A 5IC5A 1GUYA 1I33A 4BEVA 3O4FA 4LVNA 1A8HA 1UFKA 4P5PA 2FFRA 2R2AA 3PFGA 1KTIA 4RA6A 1QKIA 2SICE 2IGTA 3NGXA 2VUSA 2CLOB 4Q24A 5GPBA 3LSTA 1CY6A 3SYTA 3TE6A 2ZJ8A 4ZEOA 4HTAA 1OYOA 4M87A 4U6NA 5IJAA 5EIBC 5B1SA 1PAUA 4G0UA 3A9RA 4B6EA 4EG7A 3G9ZA 3WDSA 3WWPA 1XLVA 1U0SY 2QTWB 2FOXA 3GVHA 3USES 4AJPA 1NY6A 1HFJA 2GKGA 3QOXA 4IVNA 2I55A 4D3SA 3GFBA 3N8DA 3K1TA 1Z2OX 2WAMA 1NVGA 3SMVA 1PQPA 1V5FA 1PGJA 3RWOA 4XW2A 1P73A 3WS7A 1A98A 3ZV3A 2FG7C 4L8WB 1KYQA 2R6DA 3PUIA 2KQUA 3VOSA 1FY2A 4UREA 4LYDA 1H42A 3WWDA 2C1ZA 1A69A 2NMVA 4NYMR 3CN7A 1T4DA 4LXGA 1D5WA 2OHFA 4PAQA 2ZR9A 4PHTA 1NHGA 1OGIA 4N9WA 2FDXA 1IQPA 2NTEA 4DUYB 2O8DA 1NBIA 8AT1A 4KSBA 2CFSA 4C1NA 2V45A 1B6GA 1EFPB 1RAAA 2FWBA 5JTUA 1VJDA 2R1TA 4I5IA 3T3OA 1OYYA 4FR2A 2GXQA 3FHJA 3QEJA 2XT0A 4DCCA 1W4RA 4UBIA 4FGLA 2W2VA 3VPXA 1EDOA 4B8WA 1JEQA 1FNNA 3PQEA 1H3EA 3C5VA 3OJOA 4V3BA 2VEOA 3OD5A 3ZVNA 3RAFC 2BFCB 3DPSA 5EWMA 4MQFB 3JQBA 4UNNA 3T5GA 2BL4A 1YR3A 4ILKA 3QVVA 2Q2NA 3O2JA 3BE6A 2BBSA 1VG9B 1SIWA 3O95A 3V8BA 5FX2A 5EE3A 1DI0A 2MHCA 3FGOA 4EELA 1SU7A 1LDYA 4HP8A 3OZIA 2OOSA 2RJOA 5HUJA 4DW8A 4WLFA 2E6UX 4L3OA 2RGNA 1SCJA 3CS3A 3ADKA 1SCQA 3RG8A 3UJAA 1I8TA 3Q6IA 5CA0B 2KI5A 1V8FA 1UM9A 3FFTA 3QK7A 2RE8A 3HJBA 2WD7A 3LQ4A 4TXJA 2VP5A 4D1YA 3T4EA 3NNSA 3L4KA 2CZGA 3P9QA 2KPOA 3UJNA 2IKSA 2ORWA 1Y63A 3N0TA 1JDTA 2GJ4A 1EDDA 2XMRA 1PYDA 5GVRA 3O8OA 2EL9A 1NG9A 4CR8A 3H2BA 4WBXC 5C0OE 2VC2B 2C7RA 3PX3A 2WJ4A 3WYFA 3MRVA 1L7QA 5KKAA 1GAXA 2HF7A 4ZYVA 2ZBFA 2DPHA 2NXJA 1G6KA 3F7NA 3KXLA 4LJRA 3H6HA 2WWTA 3H5AA 2ARKA 2CXUA 5KJCA 1W34A 2NAPA 1I3NA 2QP4A 3BA1A 3PEFA 5FWYA 2IBTA 2VK2A 1C9DB 1CZOA 1M9NA 3G23A 3Q6NA 1TZBA 1PJTA 3AHFA 4TL9A 3K32A 1DBIA 4JJKA 4Y6SA 2OOKA 3RVRA 1VL1A 2E2WA 4IGAA 3W7BA 4C22A 2XQFA 1OSNA 3CNHA 3OF3A 8ABPA 1RLUA 2PSEA 3DOCA 4B47A 4X9XA 2FN3A 4K3VA 4RK0A 4YP6A 3MQ4A 4ZVNA 3AB7A 4HS9A 2GYUA 4XJSA 1NUQA 4X8LA 1RVV1 1RC0A 4OSEA 4CT4B 1MAVA 4J7UA 2FJUA 4UBKA 2NOAA 4YPFA 3WLHA 3PHBE 5L7WA 3OURA 4YTEA 1UMDB 3DKKA 2WE7A 4AX8A 2XNDD 2H4JA 4GPBA 5AKXA 3DDHA 4CM8A 4WNYA 3TS1A 2PUEA 3K1ZA 3H1GA 3PF9A 1KWGA 3FHOA 4CW7A 4I0WB 1SD1A 5F73A 2Q41A 2ZWVA 3C7DB 2I78A 2XQJA 2BFOA 1BX3A 3KWMA 3P7MA 1BKDR 3IOYA 4YIKA 2GN2A 4YO8A 5ALWA 2CLFB 5DDIP 3WA6A 2OV6A 4ZIRA 5KYXA 4RSMA 4JFAA 1CZNA 1GXSB 3CLVA 3EXEA 4I55B 3HBLA 4M98A 2C57A 5IF3A 1SHKA 2XMDA 4J7XA 3IKVA 3T0IA 3ZWOA 2F8LA 1VMIA 1G7CA 3I76A 1UINA 1PCXA 1OPRA 2WIKA 3KPWA 3THSA 3UGTA 2IEIA 1IVNA 2PA3A 1NVBA 1L5VA 2A14A 2JAHA 3O8NA 3OJFA 3OZRA 3BCHA 1FXWF 1QGED 2VJMB 3NWBA 1RI1A 1DAMA 1F3OA 2LVBA 3K15A 3O3NB 4MJLA 2FP3A 2MDTA 4CDGA 2JLSA 4CEHB 4IUYA 1R9GA 2X2PA 1VKOA 3MNFA 2BC9A 1TIBA 1KAHA 4WCFA 1XZHA 4QYXA 5CFZA 1NG1A 1TD9A 3L7BA 2VPPA 1J8DA 3OP4A 4QQNA 5K2MA 5SV2A 1KRHA 1VE6A 3D59A 3VDMA 2GN8A 3RANA 1MORA 1PQYA 5KYVA 4EJMA 5LLSA 4MI9A 4I50B 2BTEA 3O4IA 2ZB7A 4GGMX 3BFPA 1ESCA 2G71A 3T15A 3UPTA 3C5WP 5TGZA 3TLXA 4YJ2B 2X4GA 4A1FA 3I23A 2VWPA 3EW7A 4R01A 3SR4A 3A28A 2OSBA 2YHAA 2DVMA 5FR2A 5AVVA 1M2JA 5J2UB 1MU0A 4HLUA 3S3TA 3MTIA 3UATA 1OZ0A 4CFYA 5KSZA 4RXMA 1I6LA 3QWHA 3U7QA 5AUOB 4DA4A 2Q4RA 3A1DA 3C43A 4YWHA 1F6BA 4TRMA 2B4KA 3Q2OA 1P2SA 3FDJA 3L7DA 4BMSA 1FYXA 1IJKA 2XYGA 2W6QA 4BVFA 4TOIA 4ND8A 4RYLA 1JKXA 4MV3A 2B92A 1E9DA 2DPYA 2ZS9A 5DI3A 5FI0B 3RQSA 3HXMA 2VPWA 2ATVA 4Y30A 4FHZA 4DA6A 3JZMA 1POWA 3ICOA 2VXYA 1UFQA 1L3IA 1VYTA 2J08A 2VI5A 5HGXA 1ID8A 2B4RO 3G2IA 3T5CA 3H5LA 1NV8A 2HF8A 4QZVA 1XNRB 2HCBA 1U65A 2GA8A 1YZVA 4AXXA 2PIDA 3DFIA 4Y18A 4R7TA 4ZT3A 1RKVA 1L5NA 3OT1B 4LYEA 4S1WA 1QCZA 2FZLA 4CDRA 4U3JA 1S2GA 1TVKA 4P54A 4TWAA 2QUIA 4EGJA 4DJJA 2EFDB 4TV8F 4TYYA 4PGMA 5DLQC 1NYRA 2EW8A 3EXFB 4ZTBA 1EVIA 2GPSA 4O2AB 4FBMA 4G1EB 1KXZA 4P2BA 4H35A 4RVUA 4A0HA 5EXXA 3RBAA 3I72A 1ACJA 1BYUA 2OM6A 2YJZA 1AKUA 2AR9A 2BJHA 2O2ZA 2Q9BA 2EOAA 2F17A 3JD0A 3L8FA 5IAAA 3ZHZA 5BUSA 1EUQA 3DBIA 4EYSA 4LKRA 3LT2A 5T64A 3OIFA 4WGGA 1VSBA 3KAQA 4D41A 4FE4A 2VNKA 2PGOA 5EJ6A 3OKFA 2BP7A 2AG0A 1D4AA 1U80A 3HGTA 3ZZ0A 4E46A 2OBLA 2Q7XA 2R65A 5KJ6A 1PX0A 1JPUA 1AO3A 4LDAA 3O8CA 3RRBA 1YQ9A 3K9FC 4IDDA 4L5BA 2R4QA 2DWCA 1DAFA 3AVVA 5JS6A 1X8KA 2HSWA 2ACEA 1E0JA 2XWJI 1JYFA 1XMJA 2HH9A 4LDPA 1ISSA 3A1TA 4MGZR 1OLXB 5EINA 5EEGA 2ZBVA 2V0NA 5BMVB 3IX7A 1ULSA 4TLCA 2GSDA 2IQ5A 3T0FA 3TQRA 4EVSA 2XCSB 5JCPA 3E2IA 1KI2A 3MTAA 16PKA 4B8ZA 2VCEA 4M36A 2H5LA 1WXXA 3RU3A 3JW8A 1YV9A 4QUKA 2GBGA 4BWYA 2LP4Y 1BHQ1 2BYTA 2J9FA 3UCXA 4KTVE 5GM2A 2NW6A 4IXTA 4V02A 4WCDA 3V5NA 3NHLA 5HTOA 1JG2A 4XWTA 2C82A 4MMZB 4Q4JA 2X9VA 1IPEA 4MPPA 1UKYA 2O0LA 5AW2A 2NUPB 1DX9A 2W6ZA 4AJ9A 7AT1A 2B94A 1ECGA 1GZ5A 5JPIA 1E60A 2A7XA 2X4DA 1BCSA 2F1IA 2GAFA 4RPJA 3DMYA 3SSNA 3VO2A 1V8ZA 2J48A 3KPUA 3ND5A 2YHIA 2Q1XA 1FNDA 1DVRA 2X1VA 2D7CA 2X5XA 4TTVA 5AKKA 1IRIA 1F38A 5BV8A 1DX6A 1M6VB 4XFJA 1EVJA 3D1LA 3ZTYA 4YYEA 4JLJA 4NJMB 4YJGB 4D9GA 1XKXA 2X41A 2WKQA 3I1IA 5I7VA 1GWNA 4EF6A 4DG9A 2GPTA 1KEPA 2VBIA 1TO6A 3L7CA 3QVGA 5AK6A 3H17A 3GDGA 4K8RB 2NUTA 3MRSA 4C5AA 3H13A 4B9AA 2QN3A 1FMJA 1T9BA 2CXSA 1CQIB 3NHZA 3ODPA 2JH9A 2I2FA 1JKMA 2CJWB 1HURA 4DQUA 5CA0F 4DWVA 2H2WA 2XBMA 1CRLA 1FYWA 1BU8A 1H85A 1XT6A 1YRHA 2WFLB 5E1MA 5ECYA 2PX0A 4BLWA 4UM9B 1B26A 3ZOKA 1I3MA 2FUKA 2ADFA 1YCGA 4IR7A 3CVJA 1V47A 1SHUX 2B1RA 2EKBA 2FRDC 3MWKA 3TO5A 1Y82A 1RW4A 3GH3A 2GJ9A 2IU6A 3L7MA 4V0NA 1IY9A 1M2GA 2GBIA 5EP4A 4EQ6A 3E03A 4B73A 4PBSA 3LX8A 2H3EA 1P5RA 4PZ0A 2WHXA 1MBZA 5JAPA 1DDGA 4AWBA 4W99A 5HP4A 2RK6A 2VSNA 1G0NA 1CP2A 2C9OA 1OW3B 2O07A 1SG9A 1DXOA 3ETHA 3GOHA 3KEMA 3NAMA 4AIRA 5IZ4A 2P2YA 3TZCA 3GLIB 1CUIA 1KARA 3GAZA 2WUEA 3VFDA 4JEHA 4JWKA 3SYRA 2O8FA 1Q1NA 4QJIA 3A3OA 3HYCA 4TQGA 4XJTA 3WGMA 2PE5A 1E9CA 2JCGA 1OX4A 1JEEA 1CUUA 4QX6A 5EQDA 2OC9A 4UHKA 2NYVA 3HBNA 4EQZA 1JFSA 1W4CA 4YH1A 2JGDB 3QLEA 2IYEA 2OZLA 4OKSA 4F72A 4XSGA 4PFQA 2IZ7A 2YWEA 3AQ4A 5FCDA 1KDPA 4U5QA 2XSZA 3GP8A 2KW5A 2VDRB 1SHZA 2V3VA 1U28A 1KI1A 2YHUA 3DUFA 3FTCA 4YAJA 5ILOA 4J16C 4OSPA 1RACA 3V6LA 3WK5A 4PFKA 4F9GA 4JI7B 2NU9A 2RGWA 2W6JA 3AESB 5I47A 4AYXA 4L8VA 2DR2A 5D00A 5KOJA 4LOHA 1KZ9A 2QRJA 2E5LB 4JLBA 3GUYA 1A9YA 2TMDA 3NNNA 2Z4RA 4O2RA 1NURA 1ZD9A 3EDQA 1WHSA 3MB8A 1W87A 3UUEA 2I4LA 2QU8A 3I5MA 5DGTA 1Q20A 4AZ0A 1BOOA 2HJSA 2RGAA 3H8SA 4PG4A 1ZZEA 5CLGA 1HT2E 721PA 1NR7A 1MEEA 1NX9A 1GTG1 1YI0A 3IT1A 4Q9LA 3RTGA 3BXXA 3WL3A 3GROA 1OH6A 4QOIA 2JVJA 3H9JA 3DXYA 2G06A 1E5XA 5K3BA 1JXQA 4S04A 1EP3B 5L95A 1AKRA 4YCBA 5TMDA 2DT5A 3ZHTA 1GPNA 1SAYA 4QA9A 4L16A 4MV4A 1QAQA 2G17A 4D3DA 5CCBA 4NZYA 2BGNA 2GHTA 5DRTA 4ICIA 1ZN9A 5IX8A 4OATA 5E8JA 5EUMA 1JH8A 1YB1A 3BIFA 4NE9A 1I7LA 5U4XA 3RUCA 5H9WA 5L3QA 3B3FA 1JFRA 1OH7A 4MVJD 1B1AA 1C9YA 1QGUB 5F64A 1YK0A 4QYWA 5TQ2B 3WNZA 4DZZA 2RC5A 2EV9A 2QT1A 2G8NA 5INTA 2Q5CA 5J5VA 3KJEA 2XCUA 1LFAA 3S2EA 1OYWA 1U8CB 2QJTA 3AEKA 3BE5A 2YOFA 5T4BA 2PWBA 3UOGA 5HHTA 3R3XA 5CFMA 5HQTA 1W25A 4BRZA 3FJYA 4LRQA 3S7TA 3OFNA 4G8CA 5BP7A 3AOGA 1E9RA 3H5NA 4PW0A 4WZBB 5EUCA 5B57C 2VRBA 4MYUA 4QJ4A 3IC5A 4URYR 1Q3HA 2BGJA 4K9RA 3HK2A 3GUHA 5FUWA 1HDZA 4TM7A 4GSYA 4M8SA 3A1WA 4V3CA 4BEWA 5I7OA 4HFJA 1I7QB 1T3TA 3EZ6A 1XJ0A 3Q7RA 2EVWX 2B1QA 3NV7A 2F3PA 3D6JA 3TZQA 1XSEA 3R3SA 1DL5A 3TRFA 2R1UA 2FOIA 1OQAA 1MTZA 1V26A 3BBPA 4ZPXA 4YDHB 1DIBA 3EF1A 2YDXA 4YJHB 5TX7A 1X8LA 2P30A 3ANMA 5DISB 3USZA 4CE6A 4ER0A 1IOZA 1BXKA 1XA0A 3R3WA 1D3AA 4E5PA 1QH8A 4TVBA 7REQA 4PAWA 4RPLA 1Q0UA 1CY2A 3LCCA 4K9MA 1PEKE 3KYCA 1WBJB 1FP7A 4XOIA 2PGJA 4EDFA 1GQOA 2H11A 3KPYA 4E51A 3CPSA 5CBPA 4N48A 5H5JA 4A36A 1XZEA 4P58A 4QYSA 4YP9A 2D2EA 1L6IA 2ERXA 2VQ3A 1CVRA 4UAUA 3Q9LA 4IDBA 4OH7A 1YHYA 1E3LA 1XNGA 3KPJA 4L0DA 4DLVA 3QGMA 3O90A 1K2WA 3TPCA 1G4HA 1TQHA 2JBWA 1E3DA 2FFQA 3H19A 1OASA 2XH8A 3X1XA 4L1KA 2C1XA 5G4LA 1ULTA 5IJ9A 5H83A 3DM9B 4BVHA 4AWAA 4EIWA 2JFXA 4TT3A 4W4TA 1M33A 3TSZA 1BA2A 3JATB 4AVYA 5HQJA 3U3DA 1VB3A 3BKWA 3BD7A 4GUDA 1FB5A 4HXGA 1TTPB 5IP5A 1SBTA 4C3ZA 4H1HA 2TMGA 1XZAA 3L3BA 5BV2P 1U4NA 2RCYA 4JC4A 2B9EA 4FGZA 2R1VB 5EZ6B 4N54A 3R76A 4CV2A 2C7PA 5JMWA 1S96A 3ZKWB 3PEYA 1I0IA 4G0QA 3UK1A 4K86A 2ACVA 2QIPA 3GA5A 4D9BA 2YTZA 4JWTA 4JYPA 3TIXB 5I01A 1PZGA 3IT0A 1UJBA 1NBOA 2PLAA 1NJGA 1Y6RA 2EJTA 2GTIA 5CUQA 2AXNA 4F85A 3DGEC 3I37X 3SYNA 4KITB 3V4RA 2D5CA 1E2LA 4MDHA 1A5ZA 2NZVG 4GI2A 3PE3A 5L3RA 3S2GA 3ZJVA 1I4LD 4R3NA 3G0DA 3V4PB 5K09A 5ALIA 3EJWA 2W70A 4E5NA 1P62B 3K09A 2QTRA 1T6NA 3LO8A 1UBOS 2JI4A 1R0YA 2O5RA 4ZOAA 3SQOA 4E2YA 2RDMA 1YR8A 4QDUA 1MZVA 2R6ZA 3HA7A 4RPHA 1RAFA 1T4CA 3ZIUA 3QX9A 4QNMA 2ZBPA 3K70D 1QG6A 1QHSA 4FWBA 3D8TA 4ARZB 4C21A 5IKEA 1P1FA 2FAXA 3NTRA 2BM9A 1L7VC 2XODA 1JAYA 1N5KA 3B3QA 1MIHA 3G1WA 3M9LA 5H4HA 3SC6A 4UNIA 5K20A 2ZYRA 1W88B 4MUMA 5LLDA 2BFEB 1JL3A 2R6FA 3JQGB 2C07A 1MC5A 4NDAA 1H66A 1JQEA 3H2KA 2NU6A 4FGJA 4UOEA 1L5FA 1JJFA 2HNBA 2VHJA