4LHXA

Crystal structure of nucleotide-free rab8:rabin8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhxA00
1YHNA 4LHWA 1UKZA 4GSYA 3N2IA 2O0JA 1U8AA 2VSFA 3LH5A 1Q1EA 4AKGA 3B1ZA 4MYUA 1F2UB 4ERNA 1XD2A 1XMSA 1G8YA 3EPLA 1QHHA 4M22A 2GJAA 2P0EA 5JWOA 3CX6A 2ATVA 2X8AA 2ZREA 2AK3A 4GMXA 2F6RA 3KKOA 3U7GA 1N3BA 5KO2A 2ZE6A 4G5QA 4G5RA 3A1TA 1CLUA 1DAMA 2WKRA 3BK7A 3FHTA 1P5ZB 2CMKA 4V02A 3L0OA 5G53C 1KI6B 3M4YA 2JEOA 2ZE5A 5AJYA 2ZQ5A 5JECA 3R9WA 2BMFA 2YYZA 1US8B 3TJZA 1KJYA 1EWQA 2WZQA 3OIWA 4GL2A 3AF2A 1T9HA 1ESMA 3K0EA 1IY1A 2O52A 4PFSA 3W5IA 3OAAD 1WCV1 2DYKA 2GA8A 3TW4A 4BFZA 1QG2A 2EU8A 3B78A 4BLTA 4DLYA 4WW0A 2YJTD 4O3MA 1NLZA 1F6BA 3WRYC 2WJYA 4MITA 4D0NA 3GLIA 2J7PA 1SXJA 1SGWA 1P75A 3T1VA 1G17A 2RCNA 4L4UA 1AZSC 1XNJA 2FDCA 2JLVA 2DB3A 2B8TA 5CJ2A 1NLYA 1PUJA 1ZJ6A 5LB4A 1QHXA 3RAPR 1P73A 1ZNYA 1E9SA 5HCNA 4E07A 4B3GA 4LOAA 4HAVA 1E1RA 3W6NA 5HE8A 1VG0B 5DNYB 3EC2A 4AKHA 1AGRA 4XVQA 1KY3A 1II0A 4MYHA 4Z1MD 2CCJA 3KKNA 3GJ3A 2E1RA 3BRWD 4M1MA 1AQUA 2QQEA 4A36A 3B8HA 1ZC3A 4TTRA 3LX5A 2QORA 4AKEA 3GLIE 2QA5A 2XB2A 2EFCB 1ZAKA 1CR0A 1SXJE 2JDIA 1HYQA 4ZIRA 4ZI3A 3KTAA 1YJ5A 3NBZC 1VYVA 4P4SB 4A8JB 2KBFA 3RANA 2JLYA 2AX4A 2NO7A 4NCKA 2IXEA 2WJJA 2P2LA 5CDFE 1XU4A 4QNMA 5UKDA 1NIPA 5LPNA 2W83A 4LPSA 4WBSA 4G5SA 1BO6A 2HXSA 1GZSA 4D0GA 1ZM4A 3FFAA 4MH0R 3TAHA 2GEUA 4QHYA 3RRZA 3I73A 5JMTA 3H0KA 4GPTA 1GRNA 1FX0B 1M8PA 1LNZA 3TNFA 4A9AA 3THWA 1G1MA 4QGFA 2QZ4A 4YDSA 3EASA 2H5EA 4IW3B 4WZAE 1E2IA 5BWMA 1R7RA 3I92A 2QMUA 5CLQA 4ZO4A 3ICQB 4IXNA 1KJZA 1WP9A 4LYHA 3WBKA 2IYXA 1S8FA 2XX3A 4R9UC 1P2SA 1OXSC 1ANKA 1E98A 2F3RA 2ZANA 3QXCA 3QF7A 1UF9A 3ZIAA 4UNQA 2R65A 3QF4A 4NYMR 1Z6XA 3K0CC 5EXTA 1WQ1R 2IF0A 2LKDA 4N3NA 2GZAA 5FOXA 1VIYA 1L8QA 2A9KA 3PVSA 4FCWA 5J40A 2ZITA 2FGKA 1U99A 2VA8A 1L7VC 1U94A 4GBMA 4QRHA 5HZKA 2OCYC 1G3IA 4NYIQ 3B60A 3OAAA 5AUQA 2DHRA 2FV8A 4D82A 3FMIA 3HYTA 5FBQB 2V1XA 4EJSC 5F3WB 4D4JA 4DLVA 1XD9A 2DY1A 3CNNA 4NZYA 1K5DA 4HZUB 1ZUNB 4PANA 4PO1A 1Q0UA 4JLPA 5GVRA 3E1SA 2ZVPX 1KDTA 3FHCB 1CJMA 3AGQA 3C5HA 2FPKA 4P3YA 4Q4LA 3LV8A 3UMRA 3AM1A 1RRCA 4Q7LA 3GJ5A 1P2VA 1IHUA 3TUJC 1G16A 1X8KA 5TVKA 3A4LA 1QHGA 3FMPB 1I2MA 1Z0FA 4A6PA 2W6ID 3LBNA 1IQPA 1H8HA 2ZSAA 2AL7A 2OLJA 4Z1MA 1U2RA 1S3GA 3L82B 3UWOA 2OEPA 5EP1A 2WAYA 2ORVA 4EQ6B 3PQCA 3ND8A 1Z2CA 1Z5ZA 1CKEA 4Q1EA 5KSOA 2GWHA 2JA1A 3GD7A 2OCBA 4UNNA 3VR3A 3U5ZB 2VP6A 5DN6D 3FE2A 4LHVA 2NQ2C 1XB2A 2CEAA 2BMJA 3EAQA 3M1IA 1XEXB 1ZW6A 1T91A 5JFGA 3PEYA 2IYZA 1E9AA 1WBDA 1K5GA 2ZRGA 4GMDA 2VSXA 4PHTA 4QC2A 3RVBA 4HZIA 1WBBA 1XXHE 4W5HA 4BASA 1MO4A 1P9NA 4KLZA 1DO2A 4RVCA 3EC1A 2KSQA 4I1VA 3Q5EA 3A1VA 4PPFA 4DB4A 1XEFA 2ZU6A 5BXQC 1LS1A 3NKVA 1HQCA 2EFEB 2V7QD 2ZRDA 1S9DA 3KQLA 3NDBB 1EX7A 2ZRLA 3Q72A 2DWOA 3KQKA 1LTQA 2J0UB 2B7BA 3QIAA 3R7WB 4Q9HA 5JRZA 2FX3A 2HJVA 5KHOC 4IFBA 2V55B 4C0KA 4JBYA 4ACAA 3Q7QA 3MD0A 3G82C 4BZQA 2FZLA 3C8UA 4TMKA 3EARA 3MFYA 1W4CA 1E79D 1MR3F 1YR9A 1B23P 2XZLA 2P5TB 3AQ4A 4GI7A 4C0BA 4IDOA 4S2EA 3EA0A 4F4JA 1OH5A 1XEWX 3DZ8A 2BBOA 1CIPA 2OXRA 2GXQA 4B6FA 2VHJA 2G0TA 2A7QA 5C4MA 4NCNA 2VO1A 4EPWA 4R7ZA 3QXHA 3W9YA 1GNPA 4ZV4A 1G41A 4DVGA 2A5GA 4KBFA 2F1RA 2GJ8A 1R4AA 3IPYA 3OIUA 5B2ZA 3KDSE 3QVVA 1NBMD 4U7DA 3DKVA 1HT1E 2Q3HA 4B3CA 4IHQA 4D6PA 3SFVA 2QT1A 1JJVA 1OB2A 5FUVA 4LYJA 1JBKA 4BFUA 1E9CA 3EZ9A 3WHLA 4GOXA 1T8UA 2WPDD 2IS2A 1GUAA 3NC1C 3FKSA 1CJUC 4A15A 4JBXA 4TZ0A 2GJKA 4RD1A 121PA 1G4AE 4DZZA 1G21E 4O0MA 5KYKA 4CEIB 4IJMA 4O25A 4JYBA 2RGDA 5KPJA 2WWGA 4Q9KA 1MO6A 1NF3A 1GKUB 5JZVA 3KQUA 1IJEA 2G83A 2ZVQX 1A1VA 1QHIA 1KOFA 3MLEA 4LCBA 2B92A 2A5DA 4W9MC 1DG1G 1E99A 2I1QA 4OYHA 4QFMA 4D80A 2GRJA 2I1VB 5E3HA 2DBYA 2F9LA 1S3SA 5CYPA 1TX4B 2F1IA 5D3MA 4P4UA 2CE7A 3IQXA 4LJ6A 4QM7A 5HKKD 4G3XA 4RD3A 4WA7A 1AJEA 1W4AA 4CGZA 5F98A 2BM0A 1ZBDA 3F8TA 4JLVA 1QZXA 5TB5A 5H8WA 2QGNA 1GTVA 4TQUS 3ZQ6A 4O2LA 3CB4A 4QBHA 2J59A 1EG7A 1U0LA 2WKPA 3O8BA 4GZLA 2OCPA 1Z6YA 4PAQA 4PHHA 4QOSA 4E09A 3ZZ0A 3TUIC 2DCUA 1II9A 1XMVA 3U4QB 4NMMA 4DUGD 4C0LA 2R44A 4LC0A 5JCZA 1RRPA 3P26A 3TE6A 2C2HA 5K8TA 2V7QA 3IPXA 4POAA 4BPBA 3OESA 2GJSA 4OJKA 1DPFA 3R8CA 4A2QA 4DLRA 5JBQA 3DZDA 4KBGA 4HLDA 1J99A 4QXAA 1VCOA 4B3DA 4PQRA 1UADA 2OAP1 5JCPA 1TQ2A 2OE2A 4DDWA 3W3AA 3VFDA 1JR6A 2N42A 4DCUA 4M4SA 5CM8B 3W5JA 4ARZB 3A1WA 5JWRA 2GCOB 3OEHD 3U44A 1OH6A 4KSBA 3SOPA 3LFUA 4I81A 1YU9A 4I99A 5AJZA 1CEEA 5J4HA 3HU2A 4CZ2A 1X86B 2DWPA 4MGYR 2B21A 2BDTA 1MABB 3R8FA 2EQBA 4LJ5A 2FMXA 3TW8B 2J41A 4Q7MB 2FSFA 3Q8XB 5KDLA 1F5NA 3A6PC 5E95A 3KQNA 3WBJA 4L15A 3W6OA 4RD6A 3EPJA 2CLDX 4XOIA 1KZ7B 4IFEA 4MRNA 4CRWB 5CLLA 2AXPA 1FP6A 2FNAA 1KJWA 4M9QA 1RVDA 1ZIPA 2A5FA 5HR5A 1EGAA 3U3KA 3IIJA 1RKBA 3VKHA 3SE0A 1GG2A 1JR3E 1AKYA 1KK1A 4BRWA 1N5LA 2AD5A 1ETUA 2IXGA 4NU0A 4QGAA 2RKOA 3BGWA 4Q4AB 4C0QC 2ZI7A 3H86A 2I4IA 1OHHD 1JXOA 1VECA 1YE8A 1ZNZA 4B71A 3QJYA 3AVXA 1NG1A 3ZS9A 2N1BA 4CT4B 3GJ4A 2PT7A 4HAUA 2D62A 3MGCA 3WHKA 5CITA 4LJ8A 3BXZA 1FNMA 2FSGA 4DCVA 4TL7A 2D74A 2FEMA 221PA 4TZ6A 1XZPA 2GHIA 3PV0A 5H68A 3CM0A 4MYCA 4LBWA 3DMNA 3W8NA 4NCJA 4QBIA 4PO9A 2VEDA 2VF8A 3GLFA 1D5CA 5A4JA 4Q4JA 2XNSA 1OXXK 4GFDA 4P4TA 1NL3A 5FBWB 4CW7A 3AF4A 1OIXA 2J46A 3BB1A 5DE3A 1OH8A 2J0QA 3FMFA 4NL4H 3K09C 4DUGA 1HT2E 1F2UA 3HPRA 4HLUC 4JLBA 2ZRMA 2O8FA 3QNUA 4M1WA 3QG1A 1TQDA 2X2FA 1RPZA 2F43B 3MAAC 1GL9B 1T5IA 2ZSDA 4G0NA 4H9GA 2R6CA 3U3OA 1HE1C 3ZH9B 2VF7A 1XD8A 2BJVA 2R62A 3FTQA 1F48A 2C78A 2EFGA 3BJIC 3L43A 3I72A 1GILA 2PMKA 5DSZA 3VU9B 3X1ZA 1DAIA 5DI3A 1J90A 2VHTA 3A4NA 2VLIA 3T06B 2OILA 3OEHA 1P4SA 3IGFA 4CYMA 3LD9A 1BMFD 2R6GA 4CEJB 4DEYA 2C8VA 2PZEA 3KFVA 2HJGA 2BBSA 2ZSFA 1DE0A 1KNXA 2NPIA 3TVDA 4N0DA 1GOTA 2BEJA 4NH0A 1NN0A 3NH9A 5E7MA 2FEOA 2VSOA 5JHGB 3EZ6A 4TMZA 3U7EB 3L0SA 1XCGB 3QKSB 3I5YA 3VR1A 1Z0IA 1ZM3A 3A36A 4AKIA 1NVVQ 2ONKA 2GETA 2NIPA 3QPWA 1TF7A 3TAUA 1RJ9A 3FOZA 1R8SA 3ZVRA 1OV4A 1CJVC 3B1WA 4CEHB 3IQWA 1KHTA 4B73A 4LJ9A 3JZAA 5DIFA 1NVUQ 3C41J 5EUQB 3PCRB 2G9NA 5JS7A 3G5UA 4RCYA 1E9RA 3BIFA 1FTSA 4M1TA 5TARA 2IYYA 3AUXA 1X1RA 3MSXA 3QBTA 1GFIA 1MH1A 1OHHA 4JKIA 4JLKA 4G01B 3UATA 4BE7B 2W2VA 4E22A 5JI2E 3B2EA 2VHUA 2D4HA 1G8FA 3A37A 4A2PA 1N6OA 1L2TA 1N25A 1BYUA 4RD2A 3BH0A 4P4SA 3TR5A 1W4RA 2ZYUX 4A8JA 5JSZB 3ZD6A 5KTYA 1UKEA 1OFIA 2HUPA 4HAZA 4AD8A 3OF5A 3TH5A 4ZDJA 3AVYA 2ZJZA 4HB0A 1IY2A 4MDEA 1NY5A 3R9IA 2PX0A 3P4XA 1WXQA 4JLNA 3KJIA 1GNRA 1NIJA 2GBLA 3GQBA 4GP7A 2CJWA 4GZMA 4RD0A 4RCZA 5FOWA 1W0KD 1HH4A 3U7FB 4X8HA 2FG5A 2WJGA 1XJCA 1Q21A 4YMSA 521PA 1E94E 1IXRC 3KXLA 4R98A 3WRXC 3O8DA 2BWJA 2REBA 3QPVA 4V0MA 4UJ5A 4B76A 3MWYW 4DLUA 1Z63A 4PXAA 3L8ZA 4M2LA 3SYNA 2IUSA 4TT3D 1II8A 4FMCF 3ZQJA 3SS8A 2FGJA 4M53A 1T3HA 1CR4A 1EWRA 1U81A 3CRVA 1E0SA 4B75A 1IBRA 4R2IA 1SXJD 5DYIA 4A2WA 4L8GA 2IYSA 3CO5A 4QG7A 2PJRA 2JJ1A 2ANCA 3X2SA 5AWFC 4A92A 2QENA 3THOA 4D0LB 3ADCA 1OPXA 1OXVA 4LSGA 2WWHA 4NBSA 1U9IA 4OKSA 3D3QA 2GXAA 3IBYA 1TNDA 2KI5A 1PZNA 3F5FA 4DHEA 1OH7A 4LYAA 4V0ME 1FQJA 2PLFA 1G7RA 2RGCA 1QVAA 5L3QA 2V3CC 3B1XA 4GP6A 5FBVB 3OIYA 3QKRB 4ESVA 2VP0A 4QHTA 3E5HA 4YONB 4KI0A 4M0LA 2G1KA 2JASA 1E2JA 4HZUA 2EFHB 3QKUA 3VR5A 2G6BA 2J0VA 2J1LA 4NKRA 1LS6A 3D6TB 5IHPA 1N5IA 1G5PA 1N6PA 1OT3A 2FPLA 2OZEA 4G5GA 3TLXA 2PJZA 2XTMA 3H2YA 2B8WA 2QMEA 2WVJA 2YOGA 4HATA 5FPSA 3UXMA 2JLQA 2UVQA 2LCFA 3GJ7A 5JRJA 1E9EA 3QEJA 1JAIA 4JVSB 2XXAB 1UFQA 3VX3A 1Z47A 4JKYA 5AUNB 1OSNA 2R6FA 4MYTA 3T1TA 4KITB 2A30A 1L4YA 4BFXA 1UDXA 1R5NA 2D7CA 3EWAA 2IXFA 4XWOA 2RGNC 3BOSA 3OZXA 3U61B 2FSHA 2W2XA 4U5XA 4HB2A 1G3MA 2C95A 2ZAOA 4OK5A 1IY0A 1AKEA 1PLJA 1G6HA 1T6NA 1RZ3A 1HUQA 1KMHB 4AYXA 8OHMA 3AVWA 2WWXA 1NSFA 5EXSA 4B32A 2PBRA 3D7MA 2A3RA 4I1SA 4IRUB 3PEWA 1PJRA 3DEFA 4AURA 2R9VA 3OHMA 1PV4A 4RJLA 1XPRA 5C18A 1FFHA 1NSTA 2QM7A 2YC4C 1YR6A 2ZROA 4PPQA 2YOHA 1TPZA 3L0PA 3ZIAD 4F91B 1XWIA 1IXZA 4ABYA 4U02A 1EX6A 2IC5A 1W0KA 2ZR0A 4JJKA 5DO9A 2QTHA 1YRBA 4PZYA 3NEJA 5FI0B 4BFYA 3TUZC 3KFXA 2IYWA 5AJXA 5J47A 3QPUA 1WB9A 3A58B 1G6OA 3EWSA 3IO5A 1VCMA 1YVDA 4TT3A 4DJTA 2QG6A 2C5LA 3WY9A 2PZGA 2PLRA 4URXR 1YZTA 2XJ9A 2FZ4A 5DGXA 1HE8B 4PQFA 1NI3A 4US2R 1ZM7A 4S35A 4M21A 3CRMA 2WBLC 3V9PA 4KJZA 2XITA 1J2JA 3O8RA 5CDFA 3QBVA 1XRJA 3MJRA 1HY3A 1KDPA 4EAQA 2HDNB 1KSGA 4LJ7A 1FNNA 2G3YA 1H8HD 1R0YA 3CLVA 4LZZA 3RC3A 3DOEA 2KJQA 4HAXA 3UPUA 1ZU5A 4TYYA 1TF2A 3E70C 1Z28A 3RWOA 3CF2A 1SVKA 5EP2A 1VHLA 1U0JA 5GADl 4QM6A 2YWHA 3BFKA 2ORWA 3BERA 2XZPA 4TLCA 3K0FB 4C7OA 3GPLA 2ZSEA 4HDQB 3T15A 4UXIA 5B58C 3W6PA 2VHCA 2BKEA 2GXUA 2P65A 4Q01A 4TMTA 3X1DA 2FPMA 4LUCA 1G7TA 4MDFA 2Q9CA 2V54A 1KYIA 1OFHA 3I5XA 1BOFA 1G7CA 4Q21A 2J0SA 4PZLA 3W90A 2CL0X 3MUFA 5FUWA 4TN1A 4EJSB 1R8QA 2J9RA 3IIKA 4KHZA 1E69A 5TY0A 1CULC 2YWFA 3BFXA 3HYRA 1EFRD 1JPJA 4TMXA 4ILEA 3UG6A 2VBCA 2ZI9A 1MKYA 2QU8A 5C4GB 3AVOA 4A6XA 1G19A 2IYVA 4URZR 1XPUA 2X19A 4XVRA 4QNRA 4BFSA 3BFVA 2K5UA 2GEDA 1W5TA 1W46A 1CTQA 721PA 3KB2A 4ASUD 1T3LA 2F55A 1Z0KA 2ASEA 2EVWX 3K9HA 4N1AA 2BJWA 5BN5A 5FPYA 1P9RA 1SKQA 3W34A 2XTNA 4A1FA 3IEUA 1P9WA 3N2EA 1ZD1A 4BFVA 1CRQA 1JQJC 3UG7A 2ZR7A 4DLXA 1N6IA 3KKPA 4IXMA 2WJVA 1PLKA 3B7GA 1Q1QA 2MMCA 2YNMA 2UZ3A 4QGGA 2MMGA 3VTKA 1E2QA 2IEZA 3I3SR 4Q7JB 2QY9A 2XB4A 3SJZA 3SYLA 2J45A 4ITRC 3H1TA 3SN6A 4DT1B 5HPYB 4XJXA 2C77A 2ZRFA 1VG8A 1FMJA 1CS4C 3FKSD 4KYIB 4II7A 4UXHA 3CZPA 4M9XA 2ZE8A 1G4UR 1DAKA 2GF9A 3EG5A 1XX6A 4TSFD 3CPHA 2BIFA 3IHWA 1MABA 3OFNA 4C2TA 4RSGA 2XSZD 5EJEA 2CXXA 1IM2A 2AWNA 5BYJA 4YMTA 2ZRKA 3TR0A 1JNYA 2OG2A 1NVWQ 1AS2A 1XXHA 3RC8A 2FFHA 1Z8FA 2NO6A 3W8RA 1W36D 1F2TB 1JALA 3THXA 3NG1A 2WOJA 4QKQA 4LV5B 2IYQA 4OL0A 4FXPA 3GP8A 1E2KA 1SKYB 1RC8A 3AKDA 3S1AB 3KJGA 3NIBA 6Q21A 2DWQA 1ZCBA 3EW9A 2QBYA 3I61A 2ZIAA 3H4MA 5F9FA 5LBIA 1TTTA 2EYQA 4UNRA 4IDQA 1I4DD 3L2OB 1M7BA 4LGMA 3UIEA 1NRJB 1QHNA 3DDCA 1S1MA 1DEKA 3Q7PA 4E03A 4Q4AA 2XTZA 2IBMA 2IA5A 4FD2A 3EXAA 4FI3C 1I2DA 2ZRIA 2DFKB 3U6KA 3K70B 1DAHA 3CRRA 4JT4A 1FW6A 4Q4HA 4C30A 1Q3TA 3SFZA 4HLQB 1H8ED 1TUIA 1CR1A 3AVVA 1EFRA 1XD2B 3LX8A 4A0RA 3KUDA 4C9BA 5FOTA 4C0JA 4AK9A 2W00A 3SU8A 4JLDA 4FMDB 4B6EA 1P62B 1NJGA 3SZRA 4XD7D 5KSZA 1SULA 5DLQC 3SR0A 3UMFA 1AIPA 1XF9A 3PUZA 4Q66C 3AF0A 3FYHA 3NBYC 4ASUA 3EPKA 3AVQA 1W1WA 1JEEA 1LVGA 2LWIA 3MMPA 2WWFA 3RSLA 4TYPA 1PVOA 3AP2A 3MWJA 1JR3D 3DMDA 4HYYA 1SHZA 2JAQA 1JQLB 1ODFA 4IOLA 1CU1A 4BECA 5KDOA 2KE5A 2QAGC 2F43A 5D3QA 3LDAA 5KSPA 1CR2A 2BC9A 1W48A 4BUJA 2CL7X 1OXTA 1OYYA 1OB5A 3GJ6A 3K70C 5FFMA 1SVOA 2ZJOA 4JL6A 5SZHB 4MUBA 3ZJYA 4F4CA 3SJCA 5KSYA 2ZJBA 3SQXA 4NCIA 4US0R 5TMPA 4IOKA 1KO8A 1Z6TA 2ZRJA 1ZYUA 1G8GA 4TLAA 4TYWA 4CEJA 4TSFA 2OESA 4XVUA 2IHYA 1VTKA 5FUYA 5FTKA 1J8YF 4DCTA 3L8YA 2OBMA 1DADA 2OM2A 2ZE7A 5FBLB 4AG5A 2XSZA 3LRPA 2ZUCA 2W6JD 1AZTA 1KIMA 1XTRA 3FHOA 1R6BX 5EXXA 2HYDA 4OI2A 3GLHB 4MRPA 2XOKD 2IHBA 2P5SA 2NG1A 2PH1A 1HTWA 3O8CA 2X2EA 3PITA 3GCGA 2J5XA 1N0UA 1T3SA 3QKSA 1XTQA 3LVQE 2C98A 2O0HA 3LW7A 1E2NA 1NKSA 2Q21A 4B33A 3ZVLA 1N0WA 3AF3A 2JLZA 2HEIA 3B13B 4NDZA 4P0TA 4C2UA 5DHFA 1A2BA 5L3VA 1E9BA 1V43A 5FPKA 1AK2A 1MO3A 1OIVA 2QTFA 1GIAA 1RYHA 4MKGA 4PSAA 2V8OA 5IDVA 1TU3A 4OQMA 3C15C 2VPPA 4DC9A 2IT1A 4R2HA 2HF9A 3KQHA 3NC0C 4M9ZA 1SXJC 2NZJA 4G1UC 2CDNA 3QE0A 4QHSA 3SJBA 2AFIE 3THWB 5F2EA 1H8EA 2ZUDA 2YINC 1LV7A 3IHLA 3UMSA 1JPNA 1W4BA 3SHWA 2QM8A 5JSZA 3BORA 2OBNA 2GZDA 2H1LA 2OCAA 4KLNA 5A5GA 1W47A 2ZRBA 4ZI2A 2YVUA 1Z6AA 4PX9A 3C7KA 4XD7A 2E9SA 3RDPA 2BOVA 2ZRHA 4U00A 2GAAA 5G40A 3NDPA 2VL7A 3RS7A 3Q85A 4MRVA 1E2HA 5FL7A 3ZD7A 5L3SB 4NYJR 2F1HA 4LC1A 2R2AA 4LRWA 4TMWA 4V0LA 4X8OA 2RH5A 3RRNA 3QF4B 2OT3B 3NHBA 3RS3A 4Q1FA 1GSIA 2O8CA 5K8IA 3CR7A 3DM5A 1ZIOA 1FZQA 1JR3A 5JEDA 4B2LA 3HJNA 1IJFA 4JJZA 1G3UA 4OJQA 4IVPA 2YOFA 3GJXC 4IOMA 2AWOA 1P2UA 3ZVNA 4RFVA 3EZ7A 1G3QA 2X77A 1UBGA 2ZUBA 3FPAA 2IUTA 5TXGA 3V4RA 4LPKA 2ZJYA 3U2QA 4BRUA 1U8ZA 2BV3A 3PFIA 1GL7A 2VP9A 3GLGB 2QQ0A 2G88A 1Z07A 1UEJA 1O87A 5FOSA 1ZVQA 3CH5A 3GEHA 4YQFA 5FTLA 2C9YA 4LBVA 3EIHA 3HR7A 4NYMQ 2Z83A 1CF4A 2P6UA 3PEVA 3IEVA 4LK2A 1MRNA 4KV9A 4AC9A 2KWIA 1OW3B 2A2ZA 3FGNA 4GT1A 2QE7A 5BN3A 2WV9A 4FWTA 4TLDA 3VR2A 2GVZC 2W6JA 3CW2A 1GRQA 1AN0A 1EFUA 3FFBA 2XOKA 1JECA 1W2HA 2F1JA 2FOLA 3A1SA 4B2IA 1S9HA 1OXUA 1N0VC 2CE2X 2JLRA 2OLKA 2Q9AA 5H1YA 3T5DA 3KX2A 4PO8A 4MQBA 1ZU4A 2RGAA 2ZI6A 3AH8A 3ZGXA 1X8JA 4N0EA 3UK6A 4PAOA 4Q1AA 1CJTC 1EFHA 3TSWA 1H65A 1KSJA 1E0JA 1P6XA 5EE0A 1GITA 1T0JB 2R8RA 2IYRA 4MRRA 2LKCA 3CPEA 1N6LA 2XXAA 2H57A 5DYGA 2WIAA 5JJKA 2WKQA 4JZKA 5BW8A 4ARZA 2O8DA 1TUEA 1N6NA 3C14C 1YRAA 1E0AA 4RFSB 4ESHA 5AJVB 2Q9BA 4PSVA 5A0FA 2NO1A 4DWJA 1TEXA 3LWNA 3V00A 5JWHA 3NH6A 1NNEA 2GK7A 5GJWC 4JL5A 4BLQA 4DSNA 4D2IA 3F3YA 2ZEJA 4UXJA 4B47A 2XZOA 1FUUA 1K8RA 2BKUA 1WF3A 2DFTA 5DI9A 1KMHA 1XJQA 4JSTA 4Q19A 4RZUA 4ZDKA 2JLWA 1NP6A 4OI4A 4AWXA 4B2PA 1IAQA 4ZKDA 2JJ1D 4D25A 2BHRA 4GOJA 3GFPA 4TMVA 1KI6A 4JVLA 4YDHB 1TQ6A 4RZ2A 1DARA 2OO7A 3WNBA 3GMTA 1J8MF 2WIBA 1US8A 4BZXA 3KJEA 3VKWA 1HEIA 1VDZA 2HCJB 1KMQA 3D8BA 4LV8B 4C0HA 2Z6VA 3AVTA 4B48A 1KO1A 2H18A 2YWGA 5IRCD 1SVWA 3LQRA 2RHDA 3QG5A 3CNLA 3N70A 2JJ8A 1VCNA 1YR8A 4KCGA 4PC2A 3WMGA 3L0IB 3QXXA 2C9OA 4TLEA 2FFAA 4XH9B 2HCBA 4A0FA 5EE9A 1KI8A 2QRZA 2AKAB 1G8HA 3QY0A 1AGPA 2AFHE 5JHHB 3OEED 1MOZA 1A5TA 2ANBA 4OQLA 3K9GA 1KI7A 5CJPA 1XTSA 4JLAA 4CIDA 2CLSA 2ZJAA 5J4LA 1VIAA 2PEZA 3CWQA 4D4MA 1DO0A 3DL0A 4DSTA 2IWRA 5AUOB 3ASZA 3PEUA 1DAFA 5GJBA 3CX8A 3BWDD 5F9HA 5FI1B 5FPHA 3AKEA 5ELXA 4LBYA 1U90A 4URVR 5K8LA 2AD1A 1P61B 4D4LA 3IDQA 1ZNWA 1Z0AA 3K0FA 4KYUA 5D3MB 3K0CA 2ZJ8A 3SJAA 1Q3HA 3EA5A 5G3ZA 2QEQA 2QPAA 4MKIA 2V1UA 3ADBA 3SYKA 1C1YA 5L3RA 5EP3A 4C0AC 1W2GA 2DFLA 3FWYA 1Z06A 2O0KA 1ZNXA 3NEYA 3G0HA 3WYFA 4UNPA 4EJSA 1OJLA 3KZ1E 3KB1A 4JLJA 2OXCA 1Q20A 3SEAA 2QSYA 3IILA 2CLCX 4PHFA 1NMXA 4M1KA 4QJ5A 1FX0A 1OKKD 2GESA 3B82A 4BGDA 4YXWD 5KUTA 4Q1CA 2D2FA 5G41A 3EX7C 3B9QA 2A5JA 4NYIR 1E0KA 2ZI3A 2C03A 2ZYTX 4IDPA 1KAOA 1JJ7A 1YZUA 3BS4A 3K9LA 1AA9A 2Y8EA 2WJIA 3SNHA 1FPMA 3I8SA 1TL7C 2ERYA 1ZM2A 1N5JA 2E87A 2HYIC 4J0QA 4TYNA 3PUXA 1E32A 2QN6A 1XTIA 1QVRA 4OHWA 3U44B 4EIWA 4DCSA 3IBGA 4OHXA 2JJ2D 2QP9X 2EWVA 2ZETA 4QBFA 1D2MA 4XWAA 4LY6A 4KFTA 2BM1A 1K6MA 1NMZA 1S96A 4HI0E 2REXB 1L4UA 1W0JD 2DPXA 5FTJA 4DLWA 4MGIR 3X1XA 3B5JA 1XP8A 1UJ2A 1DOAA 1ZRHA 2PL3A 3PXGA 4ZCIA 1TEVA 2NO9A 1YKSA 3TIFA 2P3SA 2ODWA 2ZYVX 2GEVA 2H16A 4HEJA 3ZS8A 2ODBA 2KBEA 5KU1A 4DT1A 3RNLA 4RZ3A 3BAFA 5FPTA 2BMEA 3HDTA 4ZCLA 2BVNA 4L9WA 4EFLA 2YKGA 3LNCA 3OEEA 5J4YA 1SZPA 1VG1A 1KGDA 2XAUA 4HAYA 4P33A 3CRQA 2P67A 3PIRA 1TMKA 3MCAA 3P32A 4GOKA 4Q00A 4M1YA 4XSHA 2MSCB 4GNKA 5KDDA 3LVRE 3GJ0A 1E2FA 2MSDB 1GDDA 1YZGA 2ZXUA 2OHFA 3RLFA 1F2TA 1R10A 1EK0A 1FTNA 2Q0HA 2DFNA 1M1YE 4EQ6A 1E9FA 4Q7KA 4EPVA 3ZZTA 3BB3A 1IN8A 4M8NE 4TLBA 2EFDB 4IKEA 4EPXA 2QI9C 1NKTA 4B44A 1TADA 4F38A 3SDZA 4XWKA 3O47A 3MG9A 1XEXA 4DXAA 4AG6A 5BQ5A 2R6DA 1KI4A 4W5JA 3ADKA 3GLFB 2GVDC 1VYUA 1D2EA 1GRRA 1DELA 5EUMA 1KKLA 1TU4A 4LDJA 2XEXA 3SBEA 1W49A 2A78A 4HSEA 3T61A 3K0AB 2XNDD 3WXMA 2FH5B 1KO4A 1NN5A 1M2OB 2Q3MA 2C99A 2H7VA 1R0WA 2OFOA 1SKYE 5AK0A 2O8FB 3LAWA 4NPHA 2SHKA 3ZVMA 1OKKA 1E96A 1ONBA 1D2NA 2HLDD 5HTKA 2J0UA 3T34A 4EPTA 4YXWA 3R7WA 3SBDA 4OQXA 2NO0A 3R9XA 3HWSA 1RRGA 3U3MA 1LF0A 3DVLA 4PTLA 4BFTA 3T12A 1NMYA 2JLSA 3LQQA 1GL6A 2PCLA 2QMHA 3BE4A 4JMPA 1Z29A 2O8EB 2QUZA 3VNVA 1GAJA 5HE9A 5DI3B 1ZINA 1WA5A 3T5GA 3B1VA 4Y0AA 3QKTA 2GK6A 3REFA 1V5WA 4BEJA 3BB4A 1P3JA 4ACBA 5TDHA 3OFND 1DG3A 2JJ2A 1E6CA 5FOVA 1IONA 2FN4A 4LHXA 4KFSA 5JEEA 1R2QA 2BEKA 5GVSA 3ICEA 5BN4A 1W0JA 1R0XA 4US1R 5M04A 4WZBE 2CCGA 4RY2A 4BWYA 1UAAA 1YQTA 5H70A 4K81B 3MWLA 1P72A 1UDWA 2GNOA 4D4KA 5FL3A 3LXXA 1YZQA 1G5RA 2IW3A 1NN1A 1Q44A 2VP5A 2O8BB 3P1JA 1EESA 3EIEA 2D7DA 5CM9C 3NXSA 1Q1BA 3LY5A 2ZYWX 3CWZA 4EFMA 3NWJA 1W5SA 4HUQB 1RJ9B 4MKHA 1HURA 2IUUA 5LD2B 3OIVA 3QSYA 1AM4D 3AP1A 3U3JA 1S4QA 1E2MA 3LO5A 4JT2A 3F0TA 2HV8A 1S0UA 3ETLA 3CONA 4ZCMA 3TVTA 4HB3A 3QEOA 1PUIA 4FCTA 4CEIA 2TMKA 4URYR 1W7AA 3NBFA 1XZQA 2PT5A 2B7CA 1FP7A 3GLHA 4B3BA 5FR1A 1KK2A 2YC2C 3OE7D 1BIFA 1U8YA 1XMJA 3CNOA 3TK1A 5E7JA 1T8TA 3IUYA 2AN9A 2PMDA 4PC1A 1N6KA 1YR7A 5J4VA 4YLGA 3X1WA 2G1JA 1MT0A 3T35A 3I62A 2PX3A 2IYUA 3JZMA 4FW9A 2QROA 3U60B 2WWWA 2RGEA 2Z43A 3FDIA 1RIFA 3GJ8A 5IK2D 1OFUX 1OYWA 3SC3A 2KB0A 4V03A 3GLHE 3LXRA 1GP2A 4P31A 3WNCA 1WMSA 3C4JA 1BMFA 2CJWB 4AIIA 1IOZA 2CCKA 1RFLA 3U4QA 4DCNA 1ZCAA 2XNDA 4XSGA 2V4ZA 5KNCA 3KKMA 1JB1A 5JJLA 3KL4A 5LD2C 2ZRCA 5EXPA 3I1FA 3Q9LA 3UANA 1Z0DA 1QG4A 2QAJA 2W0SA 4IVRA 2QGZA 4X8MA 4OI0A 1MV5A 2HLDA 2P6RA 3CRW1 2D2EA 1GKYA 2Z5FA 4WOPA 1II8B 3RS0A 3K8YA 3WYGA 2VRWA 1GVNB 1KZGB 2ECKA 2QMOA 3RWMB 1ZUIA 2VH5R 5L3SA 1ZUHA 2GXSA 3QENA 4URUR 1E4YA 2GCOA 4X8LA 4EFNA 4Q03A 4TL6A 1ELOA 3NHAA 1PLLA 3TSOA 1RRFA 1HA3A 4ZDIA 1W44A 1FMLA 2PZFA 2RGXA 1G9XA 3BD9A 1C9KA 1M7GA 4YMWA 4A8JC 1X1SA 2AXNA 1TQ4A 1KI2A 1RYFA 3PG5A 4I1UA 5E7IA 4AY2A 1KKMA 3AEZA 4BLPA 2BCGY 5EE5B 4M1OA 4LJAA 1MO5A 5L3QB 4DB2A 2ZAMA 4KVAA 1RW4A 4CDGA 1ZD9A 2CVHA 4DBLC 5JS8A 3GLGA 4HB4A 1KDOA 2GBLC 4AYTA 1VCIA 4A0HA 2QP4A 2EWWA 3BBPA 4RD4A 1Z3IX 4O2RA 3VAAA 5ANRB 4B43A 1BKDR 3K09A 3NVAA 1UPTA 4Z51A 1ZD8A 5K8UA 2CHVA 4HLUA 4B74A 3JVVA 1I4TD 4WIAA 1D9ZA 1GWNA 5EP4A 2QAGB 3GFOA 3TBKA 1KNQA 2J87A 1Y3AA 4MRSA 5IF9A 2QPOA 1KO7A 3HU3A 1YZNA 3THYB 4LHYA 1Z0JA 5EE3A 2RHMA 2CVFA 4BFWA 4XTRA 2JIZD 3B85A 4KO8A 2RAPA 5KNDA 3OE7A 4TWZA 1M74A 1NJFA 2JLXA 3GLGE 1EXMA 2A5YB 5J5CA 1E2PA 2AK2A 1AQYA 2N46A 4OI1A 2ZJ2A 1QHHB 4HUTA 2F7SA 1KDRA 1U9IC 5GJCA 5HZHA 3AKCA 4UQOA 1BH2A 2GTPA 4H1VA 1BS1A 1WE2A 4QJ4A 4WXPA 2FWRA 2IYLD 1AS3A 4JSYA 2GJ9A 1YZKA 1R5OA 5FL7D 5J4KA 3QXSA 4DLTA 3K0SA 3IKJA 4PQYA 4NCHA 5CK4A 5IK2A 4Q9JA 2NPFA 1M34E 1UBCA 3QUSA 4PPNA 4YMUA 1E2GA 5CYOA 2C9CA 2ZRNA 4RFSA 4YC7A 3TRFA 1SVMA 2VP4A 1Z6GA 2AHOA 2ZJ5A 3VX4A 2IEYA 2BBWA 2G0NA 2RGBA 1KI9A 1NVXQ 3GFTA 3QXJA 3DKPA 1E2EA 4KU4A 3A8TA 1IXSB 2FFQA 1DBSA 3LA6A 4C3ZA 3LLMA 5GJVC 4L16A 1XPOA 2I3BA 1IN6A 5FBRB 2VP2A 4ZDWA 5FOUA 3P27A 1G7SA 4V0NA 4I1OA 3VU9A 4BLSA 3GLIB 2OUKA 1VG9B 3Q5DA 1SXJB 5C1BA 3ONWA 4KFUA 2FJUA 1NVVR 1DAGA 1OE0A 1VMAA 1IN5A 4HDOB 3TQCA 4QJ3A 5JLJA 1WDTA 1BYIA 2O5VA 3C16C 3CX7A 3UWKA 1UKVY 2QE7D 2CL6X 2UKDA 2FE4A 2G77B 1FL9A 4A0GA 2FF7A 4F93B 3DO6A 3ZDQA 2X1VA 4UNSA 1E2DA 4OQFA 2CK3D 5C2JB 2GZHA 4FINA 1UBFA 5KNBA 4IOJA 1XDBA 2W58A 4UKDA 4C4PA 2H17A 4XTCS 2ODEA 4C0SA 2WWYA 5SZIA 3CIOA 4WXRA 1G3RA 4Z54A 3TKLA 3HR8A 1Q1ZA 4C7OB 2FU5C 4FMDF 3ASYA 5AR1A 4ZIRB 3KTAB 3X1YA 4F92B 3DOFA 5FUXA 1WRBA 4NE2A 4EPYA 2QRNA 2ZPTX 4GRAA 3LBIA 3ZYCA 1D9XA 1P60A 1T0HB 2PEYA 4Q5IA 3B6EA 4CEHA 2NMVA 3RABA 2DR3A 3EZFA 3AKYA 2W6IA 4LHZA 2QPTA 1VHTA 4PHGA 2CNWD 1U98A 5AUPB 3D31A 3KXKA 2ZM5A 4TL8A 5SZJA 2RMKA 2JIZA 3J81k 4IVQA 2ZR9A 3KJHA 2OFXA 4FN5A 5KPDA 1G291 3T1OA 4EDHA 5JJIA 2EW1A 3ADDA 421PA 1TF5A 3QOFA 2VYFA 4QBGB 4MGKR 1DTSA 5AJWA 1Z08A 2XJ4A 5DN6A 2ORIA 1ESNA 4DKXA 1J70A 4BQSA 3VNUA 1DS6A 1U0HC 4PC3A 3WMEA 2GCPA 1SQ5A 3R20A 4QL3A 1NG9A 1F3OA 3U3RA 2ZRAA 4KXFB 4Q9IA 1DAEA 1UBEA 2ZS7A 1B0UA 2GKSA 3LW8A 3BH7A 3IIMA 2OFWA 4DIDA 3U6BA 4CVNA 3UKDA 2J3EA 3AUYA 4F7WA 2IS6A 1HV8A 1CRPA 4RKEA 2GDJA 2WHXA 2WICA 2YV5A 4NTZA 2Z0MA 3LBHA 4CF7A 3K53A 1G5TA 1XTJA 2ZRPA 4LBZA 3WP1B 4AI6A 1E2LA 4I4LA 5DISB 5L8VA 2IS4A 4TTPA 5HCIA 1G64A 1E4VA 2HXYA 3Q3JB 4Q02A 2W0MA 4OK6A 4MGZR 3DHWC 4Q1BA 3RS4A 3CH4B 4W7SA 2HT6A 3B9PA 1E79A 3SHFA 1KI1A 3ZLJA 5CIQA 2ERXA 3VR6A 2RGNA 3RHFA 4D81A 1CBUA 1ZP6A 3PUYA 3A1UA 3VHLB 2F9MA 1QHYA 2FSIA 3CZQA 1EFTA 1UEIA 4HAWA 4MUAA 4BLOA 5B64A 1CP2A 3I32A 4FIDA 1XXHB 2GF0A 2QL6A 2ZTSA 3FB4A 4ON9A 3RYTC 4DSUA 4HLCA 3QKRA 3THXB 4DRZA 1IN7A 1NBMA 4LX0A 5DHAA 2CHQA 2CK3A 3P4YA 4JVMA 4NP6A 2IWHA 1COWD 4DSOA 3CBQA 2YHSA 4E5UA 1KY2A 3AV0B 2QBYB 1CJKC 2F3TA 1Q57A 1VKJA 3QQ5A 2WPDA 4JS0A 3K9NA 4V0OA 5FR2A 3SI7A 1ZC4A 4Y0VA 1LY1A 2UZIR 1T5LA 2WOOA 3M6AA 5P21A 3ZZUA 1FOEB 1R0ZA 4RZXA 4W5WA 2WAXA 4L5BA 5C46F 3MRSA 2FA9A 3WP0A 3REGA 1GM5A 4Q48A 1XTKA 1GNQA 3PUWA 2AR7A 3TSZA 3JVUA 1Z83A 3BC1A 1XCPA 4Q4HB 2GILA 1GKIA 1ZM9A 1M6NA 2CNWA 3WMFA 3CF0A 1QF9A 1NBME 5FTMA 1HQYE 5IT5A 2QT0A 2QSZA 3IO3A 4WVFA 3WNDA 4NHOA 4RKFA 2REOA 1X6VA 2V6JA 3C5CA 1XBTA 4EKDA 4EPRA 1SHKA 1XCMA 2CBZA 2IK8A 2YWEA 4MA4A 5HKKA 1O3YA 2IF2A 2ZS8A 4CT5A 4MKFA 4D26A 1SVSA 3EIQA 4LV6A 4FCVA 4K8OA 1YZLA 1KTVA 2EYUA 4JIMA 3GEEA 4KODA 2ZI5A 3CPJB 1S1CA 3U7HB 5LDDC 2C04A 1UM8A 3A4MA 3K0AA 1CXZA 2WJHA 3NBXX 3DPUA 2HF8A 2NGRA 3VQTA 4IDHA 1DVRA 2R6AA 2WSSD 1IN4A 2ZI4A 2IL1A 4PSKA 4NONA 4AYWA 3W3ZB 1Q12A 3EZ2A 4DDTA 4OK3A 3AB3A 3NTUA 4PC7A 1TAGA 3ND9A 1SVLA 4B35A 1QDEA 4TQAA 4Q9LA 4KFRA 5FTNA 2ZSBA 2OBLA 1UKYA 3GLFE 2O8EA 1LW7A 1Q22A 3TMKA 3PJRA 4JBWA 2IS1A 2L0XA 3RSOA 1N6HA 1KO5A 4Q18A 2HT1A 5EZ5A 1R5BA 1A7JA 2XGJA 3I4LA 4PZZA 1F60A 3TQFA 1EFCA 4K46A 2P6NA 1KSFX 1JAHA 3CF6R 2OSBA 4QGHA 3PUVA 1OIWA 4V0KA 2NZ8A 4M9SA 3BH6A 2WMOB 3AGPA 3CR8A 3FKQA 1E1QD 3FVQA 3VMFA 2BBTA 4PC6A 4JLMA 4LI0A 3KXIA 2ODNA 4FWIB 1W36B 2Q6TA 3ECCA 3KUCA 4FMCB 4JVNA 4LJ4A 1G20E 1XEWY 4JLOA 5KOYA 2QTVB 2O8BA 1A4RA 3DM9B 1LFDB 1E9DA 2J7KA 1NLFA 1JI0A 1COWA 1A2KC 3MWKA 1FQKA 4IDNA 4TL9A 4HUQA 4YMVA 4JYCA 3FMOB 4R71A 3KKQA 1XJ0A 2Z4SA 4URWR 3T1QA 2FFBA 1FUKA 2D06A 2W2TA 3E2IA 2JATA 4EUNA 3K70D 1D8TA 4DDVA 1OF1A 2C96A 2VTKA 2V9PA 4Z8YA 1NY6A 2OV2A 4WZ6A 4ZPXA 4DDUA 2WMNB 4PR0A 2JLUA 2B6HA 3VKGA 1A82A 4UJ3A 2NOAA 2GCNA 4LYFA 1D6JA 5E4FA 5JI3E 3RS2A 1NN3A 1S2MA 2MSEB 1OFTA 2Q3FA 3K1JA 1SVIA 2IYTA 5CB6A 1N2CE 5FH9A 2WWIA 2VQSA 3P20A 2ZS9A 4P32A 1KAGA 3AP3A 3CKLA 1G8PA 4KVGA 3LLUA 2RB4A 1AS0A 2GAOA 4DLSA 4GDFA 4KAXA 2V6IA 5DH9A 2Z4RA 1W36C 4KSCA 1P7CA 5EE1A 2ATXA 1C4OA 5EQTA 2ONJA 1Y63A 1ZMXA 4DIEA 4LJYA 3N5CA 2O8CB 4TYQA 3QVUA 3AVPA 5B57C 1JXMA 4Q47A 4OHZA 2OAQ1 4L9SA 2WSSA 3RRYA 1X3SA 3RRMA 1XFAA 4BZPA 5BYKA 2JCSA 1QBKC 4IEEA 2WM9B 1RE0A 2H8KA 4G5OA 5CIWA 5G3YA 4JL8A 1LF5A 4IEIA 2VIIA 3AVUA 1N6RA 1JEDA 1XMIA 3RS5A 3HP1A 2J7PD 2QNRA 3QI2A 4FMBB 3VR4A 3HU1A 1M7HA 4OQNA 4TQ9A 3PENA 2WTUA 4H1UA 4B3XA 2PCJA 3SQWA 4Q1DA 4NYJQ 2CHGA 1T4GA 1E3MA 2IX3A 1VYTA 2JGNA 1E1RD 2AKYA 2WSMA 4M1SA 2H92A 3MJHA 2QP3A 4XIGS 3EPHA 5CB8A 1Z2AA 2YZ2A 5CK5A 1KSHA 5EZ6B 4DLZA 3CUEF 4ZKEA 1X8LA 1QRAA 3I8XA 4HDCA 3WYAA 4A82A 1I4LD 621PA 3M0EA 4PPGA 1E1QA 1VPLA 3HPQA 4WAUA 4B34A 4F4IA 4TTQA 2D3WA 5SZKB 4B3FX 5B30A 1MRSA 1N5KA 2JDID 4OHYA 3S1AA 4Z8XA 821PA 1QHSA 2BCJQ 2NTYC 1J7KA 4PAMA 1KK3A 1OLOA 3TGPA 4BEBA 2VHQA 3PR1A 1G18A 2QAGA 2RGGA 1KK0A 4LWZA 5LB2A 4OBEA 4DEXA 4OHVA 4A4DA 1KI3A 3V4FA 2ZU0C 3H84A 1Z22A 4Q4JB 3THYA 3B1YA 3GEIA 4BLRA 5TV2A 3VHXA 2BMDA 1P2TA 1LB1B 2O8DB 3AF1A
chains in the Genus database with same CATH superfamily
1GZ6A 4HMOA 2DF8A 2PHZA 1SOAA 5IJ0A 2O0JA 1UKAA 1HMPA 2QI9F 3V8MA 1Q1EA 5EWMB 4D6XA 3B1ZA 1F2UB 2YRXA 3K16A 2XE8A 1DBVO 2YJ4A 3ZQUA 4M22A 5IKEA 5EJ8A 2X4LA 1GQYA 2YHAA 5K7SA 5BMVB 2P0EA 4R54A 1AMUA 1HQDA 3IS3A 2X8AA 4U9HS 3FOBA 1AZLA 1E60A 1KZ4A 3F74A 3KKOA 3SZUA 5B7GA 2C3MA 4OVKA 4G5QA 4ZHQB 4OP2A 1KRWA 3IV9A 4D3YA 3GRUA 1GYPA 1M83A 1IB0A 3DPIA 5CPFA 3CF4G 4MVJE 4R1MA 4O4LB 1IXYA 2POQX 3UT6A 2ZIWB 1UXKA 2RD2A 1PJZA 3M4YA 4UEKA 3T0FA 3UOWA 5A6SA 5IAOA 4OQDA 3UV6A 1A2QA 3TLAA 4A8HA 3ICWA 1CX9B 5D1HA 4DCJA 2ZQ5A 3RYCA 2OV8A 4C22A 1US8B 3NKFA 4FILA 4XSVA 5KWEA 5KX5F 3K0EA 4GZ5A 3ZDAA 1J9EA 2R8XA 2O52A 3DTVA 3T8YA 3U39A 4NQZA 3ZGOA 2R8YA 3UOGA 5LSAA 5CLHA 1B93A 3PA8A 3T5MA 2DPHA 1L4MA 3ZXXA 3UJ6A 4OGLA 1MH9A 3B1KA 5F5XA 2O54A 5TRTA 1A96A 3TW4A 4RVFA 4BFZA 1PJ3A 1QG2A 1WCYA 2EU8A 3MTJA 3D6HA 4WW0A 5EXDA 4BLTA 4EMTA 4O3MA 2XXJA 4MDHA 3DLPX 1QNLA 2J7PA 3EGOA 1JT2A 1P75A 2YXDA 1DCKA 2RCNA 2O07A 2XBLA 1AZSC 3ITKA 4L4UA 3U19A 1OXKB 1XNJA 2IH5A 2FDCA 3CW8X 2DB3A 4N76A 4QGSA 1NV9A 2B8TA 2PX5A 5J59A 2JLVA 1Y5RA 4PVCA 1ZJ6A 3QEMA 1QHXA 4NEGA 4EHBA 1P73A 2GBFA 1VMIA 4HAVA 1RU3A 3W6NA 4CCYB 5JYBA 3FPGA 1JXQA 2OWEA 1VG0B 3TECE 1UXHA 3WGUA 1WB6A 4HDKA 4CG2A 1MLDA 3DW1X 4G97A 1KJIA 1AGRA 4XVQA 1D2GA 1KY3A 3DEIA 3KK0A 4NOKA 2H85A 3NAZA 1L5HA 3CEJA 1OU4A 2VAXA 4MV3A 1U6KA 1RBZA 2Q1SA 3GJ3A 6CHYA 3VO2A 1LEHA 3ZK8A 2QQEA 5REQA 4G5HA 4WA8A 1LK0A 3GLIE 2EFCB 2FF5A 1ZAKA 1CR0A 1LRLA 4I55F 3LC2O 4B7ZA 3EVAA 4ZI3A 3KTAA 1ESZA 3NTRA 2MWMA 3LCRA 3PD7A 1TQ8A 2EXXA 4M0DA 4P4SB 2KBFA 3ZWOA 2IE8A 3FTNA 2IFTA 3IBFA 1EVZA 4CL2A 2PN1A 2NO7A 2H1IA 2IXEA 1IMJA 3WWPA 3R7AA 4YV0A 5CDFE 5ADHA 3GYBA 2NTEA 4C6RA 2XW6A 4G5SA 2XD9A 4O2BA 4M7OA 3QELB 4YY3B 4I9HA 4QA9A 4AS1A 2DHCA 4MH0R 4Z86A 3CLSD 3TAHA 1AXRA 2C4HA 2O6LA 4PV7A 3UFXA 4DM7A 5EKUA 5A3VA 1MAVA 3OEWA 1JQ3A 1KARA 2ZSUA 1UIMA 4UBKA 3AHJA 3HA5A 3OTQA 1LNZA 4P53A 2Z56A 4DPKA 3B6JA 5COQA 1YC2A 1LTHR 1H42A 3MC1A 2JAOA 4LMPA 2AJCA 2RC5A 3UCXA 1XCJA 4PG5A 4QYIB 4ZO4A 5TR9A 5BWMA 1H0HA 2C5GA 1DKUA 7GPBA 3WLEA 4BNIA 2HI0A 3RTBA 4TV8B 3I01M 3PR3A 3DDNA 2CB0A 3L7DA 2IYXA 2XX3A 1D2CA 3F71A 1P2SA 3NC4A 2FN3A 3A2MA 1SBQA 1P77A 1S2IA 1W96A 2R7LA 4PN3A 4JXZA 1C41A 4OX9Y 2XY4A 4EG4A 1EGVB 4QQFA 4YJ2A 3K92A 2F3QA 3M6MD 4UNQA 5ALKA 3QF4A 3BD6A 1Z6XA 1MUUA 2DH5A 1Q0LA 1WQ1R 3EVGA 1E8NA 3K0CC 1M8FA 4AUMA 4EUEA 2I8AA 1JLMA 3ZGZA 4AW9A 4N3NA 5FOXA 4FUTA 2H1WA 5F77A 3BMQA 2IEGA 2Q5IA 2ZITA 4GBMA 4WKGA 1OR8A 1L7VC 3ZGYA 3ZJVA 8AT1A 1Z0UA 4C3UA 4DRYA 1N7HA 5GONB 5KYXB 4RZSA 1G3IA 4F6RA 3B60A 1JKXA 2J48A 3BWVA 1YONA 5FBQB 2I91A 5AW6A 1TCBA 4D4JA 5A1TA 4OCZA 4LFAB 1N9GB 4PHCA 1V1MB 2OMKA 16PKA 1MJGA 3EMDA 4RY0A 4K3VA 3BL8A 4Q3LA 4YLEA 1KDTA 2Y92A 4DA8A 3C5HA 4PGHA 1P17A 2GZSA 4B87A 2YYSA 4CMEA 3LV8A 4ZRNA 2Q5CA 5HRUA 3CH6A 1P8AA 3LWDA 2TRSB 3G0OA 3RFXA 3F90A 4BNDB 3RYHB 3GA7A 1GJRA 2VP3A 4M0MA 4GMKA 1UMCA 4X54A 1QHGA 4EW3A 1I2MA 1Z0FA 4RV4A 3NCTA 4QX6A 2XKAA 2YIMA 3KLMX 3LBNA 1IQPA 1WQ4A 5AESA 2ZSAA 2ZYSA 2ORED 4JJ4A 4DNPA 4HADA 1K6JA 1RWQA 3UWOA 3ANTA 2OEPA 3GR6A 4RTLA 4E46A 5JRJA 3AHIA 3VC3A 2FMFA 2X40A 4H2DA 3B7PA 2ZJFA 2GWHA 1XDUA 2OD9A 3IUQA 5DNAA 2PMWB 3U5ZB 3K8QA 3HBAA 1MQSA 2WUVA 2Z8YM 4LHVA 1B8NA 4NS4A 4JC8A 3BE5A 3EAQA 5B1DA 4XGNA 1T1RA 4ZU1X 1EE1A 2PKEA 3ACDA 3CUUA 1T91A 1Q2XA 2ZBFA 1EFKA 2EZUA 4QATA 2W2LD 1K5GA 1UMKA 4GMDA 4PHTA 4X65B 1WBBA 3IC5A 3GFQA 5FHRA 4BASA 2E4UA 2G07A 4KLZA 2K6GA 1XHLA 1VLVA 3EC1A 2BDEA 3WTCA 4OBWA 1KTIA 4JP3A 4PPFA 2IZ6A 2C82A 1PD1A 1VQ1A 1XEFA 1E58A 3MJFA 4OLFA 4RVOA 1HQCA 4E5NA 1UOEA 4PPYA 2IZ0A 2FRDA 2QU7A 4P38A 5DCYA 3LO8A 3KLBA 1ZISA 4QVKA 1L1FA 1PEDA 2J0UB 2W48A 2B7BA 4QTZA 1L4EA 3ICPA 3QIAA 4GG1A 4ZRMA 2VPYA 1RIIA 1I0IA 3F1KA 3TTYA 3AT1A 4MB6A 2FLVA 1W34A 5A05A 5KHOC 4LRYA 3IT1A 3NVKI 1V5IA 1GUBA 1VLHA 1ATZA 2NUPB 2HMYB 3BMNA 3EOAI 1LLFA 1L8AA 2FR8C 3DCIA 3NT2A 4NVRA 3A1NA 1GZHB 5BXYA 3MD0A 1ZJ5A 3M6FA 4BO4A 4KQGA 2ZT8A 3N8GA 2C2WA 4TMKA 3MFYA 4JR1A 5FWAA 1QKJA 2JHGA 5C1IA 5JNVA 3BSFA 4DY4A 2LRHA 3AQ4A 5EWLA 3SG0A 1KAHA 4RV9A 1IHXA 3EA0A 5A3SA 3AESA 1OZAA 2XCIA 3GXOA 3IMKA 2C1XA 3DZ8A 4LNUA 4NULA 5C4MA 1L5MA 3KZMA 3A6LA 4P82A 4EPWA 4R7ZA 3RC9A 5I7UA 4C08A 3QXHA 3QJ5A 1X9HA 4TTAA 4RF5A 1RI2A 2A5GA 2WAOA 3EBOA 5A5FA 2PXAA 1X7YB 2WAMA 3IPYA 3DYBA 3OIUA 5SV2A 2ZUTA 4YR7A 3KZVA 4OXIA 4MS4A 3DFKA 2C3OA 3DMTC 1R4NA 3ROPA 3SFVA 4YCDA 1YV9A 4LYJA 1QO0D 2OPHA 1WUYA 3WHLA 1UDBA 3EVFA 4GOXA 4MQ6A 1MOQA 1RQLA 3H5NA 2Y05A 4XVHA 5IAAA 4ZJUA 4D41A 4J0HA 4HDNA 4HTFA 3CHYA 3UMCA 2D0IA 3PXBA 4G37A 4TZ0A 1SEVA 3RVOA 121PA 4O0MA 5KZMB 4CEIB 1EFPB 2BGKA 4IJMA 3FDZB 4CLRA 1T43A 2WWGA 5JNRA 2AZMA 2PRYA 1JVSA 1EUDA 1RYMA 3EH1A 1RI5A 3L6UA 3QRWA 4RMIA 5JZVA 2Z9CA 5KTPA 2CLHB 1Y4SA 1M2NA 3JQRA 5B37A 1G4HA 4R81A 3T1NA 4QUHA 2B92A 4MP3A 4BPRA 2AT1A 5LP6F 5AM2A 4AJLA 4W9MC 1KJ8A 4QFMA 2I1QA 4OYHA 2GM9A 4Y2SA 2GRJA 2I1VB 4R2JA 2BLLA 2DBYA 1QE3A 2ZB8A 4CMIA 5I47A 4X66B 1S3SA 3D6AA 5CYPA 4ZQIA 4RM2A 2JIPA 1IB6A 5JG7A 4N5NA 4QM7A 2YL2A 1QCYA 1VKOA 2ECFA 4KWTA 4Q3DA 1B4DA 3IVMA 1LBSA 4WA7A 1W4AA 1H3EA 1YRWA 2JGAA 3F8TA 2WU8A 4O4JA 4Y2YA 5TB5A 3CNQS 1JBQA 3OKCA 1ACLA 1L4BA 5F73A 3ZQ6A 4O2LA 4RYLA 2HCFA 2EG5A 4Z0NA 2W2LA 2X6TA 4L9RA 4AG3A 5A2QA 3KPYA 1EG7A 2VUSA 4PAQA 1Z6YA 1Z2OX 2GN4A 3U4QA 4BQOA 3TUIC 3U4QB 3PEFA 3Q3VA 4NMMA 3V1YA 5JCZA 5I7EA 1RRPA 2W6ZA 3P26A 3TE6A 5ALIA 4FYYA 1CUZA 4F12A 4WH0A 2YIDA 5KJCA 1K98A 1S01A 3OESA 3WLKX 4B7CA 1Q84A 5JBQA 1JFLA 5ALSA 4I5FA 3DXZA 5HUHA 3QFRA 3ND7A 4ENSA 4PQRA 2NXCA 3L8CA 3M3DA 5JCPA 3PPYA 5U4QA 2PX2A 4JI7B 1JR6A 4ZT7A 5ERXA 3HUEA 4DCUA 2HN9A 4YCLA 1SUSA 2CZCA 1NW7A 4M9CA 3L7YA 5JDIC 2WUWE 3W5JA 4C3VA 1XKTA 1XHFA 1XYGA 1V48A 1YULA 2GCOB 1RJDA 4BN0A 3FUVA 5KKCA 4WLUA 4NPAA 1NR7A 2R66A 3ZWCA 2IZ1A 5AJZA 4JYAB 1YU9A 3AZPA 1SVUA 4BMOB 3HU2A 4KIFA 2PH5A 4CZ2A 2VDPB 2DWPA 1HLDA 2B21A 4RO0A 5CA0A 3H1BA 4EX6A 1AN9A 5E6SA 2LP4Y 1NQWA 3EXG2 4D9JA 5C37A 4JU9A 1GSHA 2FSFA 3VJRA 3FPFA 4MKZA 4JBIA 3AMVA 4FNGA 2BI4A 2DEUA 1JT9A 3WBJA 1JJAA 2PR2A 4L15A 4QYXA 1X1AA 1UJ6A 3TINA 4LF6B 3OX2A 5TQ0A 3EPJA 1TZBA 1M2EA 2YWDA 3B53X 5ULLA 3ZCTA 4E5MA 2YH2A 2Q27A 3E3OA 4Q3CA 4MRNA 2CDCA 4N6OA 3G1TA 4Z4FA 1IUNA 1QOPB 1FP6A 2HJSA 1QO0A 1T29A 5LYYA 4M9QA 5D84A 3H5VA 1CQJB 1K7EB 1ZIPA 5KMGB 1EGAA 2FQWA 3IKLA 2WJZB 3IIJA 3VKHA 4RLFA 1A8HA 1GG2A 2FR1A 3GGJA 2UXBB 2NYRA 2J9XB 3BIJA 1GEEA 1RJEA 1XAIA 2C31A 1KVTA 2AD5A 1B1CA 2PS9A 2RKOA 3BGWA 2OG1A 4FZVA 4I6GA 3ABZA 4MUJA 5SY9A 1T4BA 2F8LA 2WUDA 4QELA 3FPEA 1E5LA 3ETDA 1OHHD 1JXOA 3QLVA 4B71A 2AW3A 2QTRA 1NG1A 4MV7A 5LNK1 1AQJA 2I99A 4CT4B 3RGWS 1LPBB 3GJ4A 4F4DA 2PT7A 2FN8A 3WHKA 2GTIA 1ABEA 3MT0A 5CITA 3BXZA 5EJFA 2NXJA 4BWGA 1FW8A 1DQRA 5T4HA 3TSAA 2BI8A 4GKKB 1C9MA 1JSRA 1USGA 221PA 3BZBA 3PFCA 2J6CA 3MINA 2VT6A 2TMGA 3UUEA 3TG8A 5EINA 4NU6A 1O9GA 3R3JA 3W8NA 4RM3A 3EIUA 4ENRA 1E62A 3GLFA 1Z2NX 5A4JA 2HR1A 4KPFC 3EUEA 3OOYA 2XNSA 4P4TA 5FBWB 1DPGA 3D4IA 1SZDA 4ZAZA 1QTRA 4OHBA 4RK1A 2XGOA 1EYZA 3PWTA 1G2OA 2PV7A 1S4MA 2BISA 4K0RA 4W9RA 2I4LA 3O3NB 1WF6A 3M81A 3K09C 1MGPA 1ZR4A 4H7EA 3UN1A 1D3AA 4H35A 2YS6A 1F3LA 3QG1A 1P39A 4CNQA 1TQDA 2KYRA 1VJRA 3RU7A 2F43B 4I55A 1M10A 4ENWA 4BO1A 1EFLA 2C4VA 2XCUA 4H9GA 2R6CA 2ZBVA 3LTNC 4K9LA 3JYNA 3PYXA 4D9HA 1F48A 2FKAA 4WK4B 1O8BA 2PV0A 1OREA 2VCYA 2EFGA 4KMSA 4QGBA 3RHSA 5KOHB 4AP5A 4GKJB 5IC6A 2PMKA 2AOTB 2Z30A 4EVQA 1DWQA 1V37A 4BO0A 2D0DA 1TW2A 2W93A 3X1ZA 3GLRA 3W2HA 1DAIA 3KEOA 3G2IA 3L79A 1VJDA 1I0ZA 3AW9A 4FFPA 5EESA 3A4NA 4BZZA 4Z6KA 1CUUA 3LCMA 1KEUA 3OCUA 4RZHA 3T06B 4CYMA 5C4IA 3O73A 4ZVVA 1VHWA 3D5EA 2ZIZA 1Z7YA 3M7IA 1XTZA 1ESDA 3VH2A 5B1EA 2RHBA 1KKUA 2QTZA 2GN0A 3NTXA 4X00A 5FR2A 1ZH0A 3LT5A 3PXCX 5JNSA 3WKAA 4LQ4A 3RC1A 2G06A 1SK9A 4N0DA 4PNZA 2OBFA 4X7MA 1NVFA 5AHXA 1NN0A 3NH9A 5E3JA 2DTEA 1WW2A 2G8LA 3RJMA 2RHWA 1X15A 3LP6A 2DHDA 3CLRC 4TMZA 2H1HA 4Y7DA 5DM2A 1XCGB 1K5HA 3O2SB 4G0YA 1Z5GA 4TROA 3ZTYA 1RAIA 3T5AA 3I5YA 3VR1A 3I6YA 4A0QA 2Y27A 3I9JA 4PR3A 4Q3OA 2VOJA 1KBQA 3BTSA 3HBMA 1ULZA 5M7EA 2X4GA 1TMYA 2GETA 4DANA 4MTCA 1CNMA 1TF7A 2PVSA 1RPNA 1RJ9A 2RH8A 1R8SA 1SUFA 3N2YA 4AB1A 1V9CA 5A06A 3FOZA 3L6CA 5KKAA 5HJ7A 3BK2A 4K7JA 2P9QA 3S55A 3G9XA 1I51A 3IQWA 5DNDA 4B73A 3JARB 4G81A 4LY3A 1UOOA 1WXWA 3JZAA 3TDKA 3C41J 1GLVA 1NNLA 2G9NA 5JS7A 3B38A 1HGXA 1T4CB 4RCYA 5KEIA 1FTSA 3FLBA 1E9VA 3O4RA 4HNHA 2VWQA 3MSXA 1RCUA 1SH7A 1GFIA 1OHHA 4L95C 4HWPA 4G01B 1DIGA 2W2VA 1DIAA 2JFNA 5A4MS 2K4MA 5JI2E 1VPTA 2HREA 5DRTA 4A2PA 1SCBA 1K06A 2X22A 4H1WA 4ZYVA 1J8VA 4QDZA 2W2OA 3PC8C 3UNXA 5IC4A 3WK6A 3UHJA 1KE1A 4E5VA 3A3PA 3ELBA 3BH0A 3TR5A 3NHRA 4A8JA 3E9QA 1N0IA 1HFEL 3I1IA 5K20A 4FPXA 5J5VA 3KJNA 3MT9A 1TW3A 1O0CA 4LXGA 2HUPA 1SKBA 1E3SA 1IY2A 2FFRA 1NY5A 1H4VB 1IG0A 2ADMA 5BW4A 3P4XA 3IUPA 1WXQA 2P7IA 3KJIA 3O26A 3I5UA 1Y1RA 1NIJA 2FPGB 2CJWA 2W6QA 1QU2A 3AI2A 3DE0X 2RJ3A 3D8RA 4J7XA 1GLNA 4UEQA 3RVKA 2HB6A 4N12A 4Z5XA 1LJ8A 1IXRC 1Y6ZA 5EOVA 4WT7A 7AT1A 3AIOA 3QPVA 1P0CA 3M5PA 4UJ5A 3RW9A 2HHHB 1IPEA 4M2LA 3AYZB 4BZWA 3BTUA 2BZSA 1GPJA 2VT3A 1Y5LA 3LCCA 5DOVA 3H11B 2WD7A 1NXSA 3ZY2A 1U81A 3CRVA 1E0SA 1B8VA 3JALB 4UM8B 3FPSA 1SXJD 2YFQA 5FFFA 3RIMA 4G0MA 1WB5A 2IYSA 4A2WA 2OZLA 3CO5A 3EB9A 3UHPA 2PJRA 3E05A 2EZ9A 1O5TA 1UK7A 5E9QA 2OXIA 5AWFC 5IUKC 3ZPXA 3ZLUA 2HPAA 3T7RA 4D0LB 2ZK7A 3C6YA 5IAGA 3LXUX 4V0SA 3IUNA 1IAVA 1L1RA 5F12A 1U9IA 2OO3A 2VHWA 3TFOA 3IBYA 2WHPA 1TNDA 4INZA 1RADA 3MERA 4RLHA 1PZNA 3PHGA 3OPNA 4Q3KA 5DBGA 4LYAA 2I71A 5B1SA 3NANA 2CVQA 1T34A 3KP1A 2YRWA 2JCVA 4ZCTA 3B1XA 4GP6A 1ZRMA 5A2GA 2HEGA 3IDZA 1WUJS 2PUTA 2IEBA 1ADBA 4D96A 4KI0A 1XWFA 2G1KA 5FWYB 3ES9A 1Y7TA 1Q95A 3PGMA 3AFOA 4K9OA 1KEEB 4LTMA 2EC5A 1LS6A 4IEFB 1P1BA 1G5PA 2Y3IA 2L2QA 2O3QA 4QPJC 3VI3B 2B4RO 1HE3A 3IBSA 3KEFA 3E4CA 1W88B 1UC4B 2QMEA 2QDKA 2WC1A 2YOGA 4RACA 4DG8A 1I33A 1TLLA 5LXTB 2QRKA 1T0IA 2CZGA 5SYMA 2HJRA 2KLBA 10MHA 2XDQA 4XCXA 4ZEXA 4ND1A 1E9EA 2VF5X 1F17A 2Q46A 2HAEA 1U7PA 2P1DA 2XXAB 3VX3A 4IO1A 1U9YA 1Z47A 4JKYA 5AUNB 4UMDA 1PF7E 5IJAA 1FZTA 1OLUB 4EG3A 2QZ9A 4V24A 3QU4A 1ZOPA 2EZTA 2H2WA 3MTIA 4OLAA 2R6HA 4BFXA 4BTLA 3MPOA 1GD1O 1R5NA 3U9LA 2VHEA 3IP7A 4EA9A 3K2IA 1W5FA 3CBGA 3RFCA 5LR6A 2PUFA 4TXJA 2MU1A 3UJ9A 4UE6A 2C95A 3NWEA 4OK5A 3KC2A 1IY0A 5KHAA 2H7XA 2IRWA 3I83A 3AEKB 3IMFA 3KWFA 1PFKA 1PLJA 3CTPA 4KAJA 4W9NC 3OE5A 5B6IA 3AVWA 1YFKA 5ECYA 2PBRA 3COPA 3PZRA 4I1SA 4IRUB 2QTBA 5C9ZA 3DEFA 3TRKA 5LQJA 4AURA 3ER9A 5I9TA 3C1UA 3TZKA 1HDOA 2X6QA 5C18A 3ZVKA 3AF5A 2YC4C 1NSTA 1T5OA 3W1WA 3ZIAD 3OZTA 5CMLA 3FD8A 4F91B 1V11A 2FUEA 3IVRA 4KOAA 2JJMA 4L8WB 4ABYA 1NTOA 3AERA 3G7SA 4GYWA 3VPAA 1QCCA 1RBQA 1WDLA 3ANSA 5BNZA 1Y81A 1ZN8A 5LP6A 4PZYA 2I3ZA 3NEJA 1W5EA 4WADA 3CRZA 2IYWA 3EBLA 3P9CA 3IRVA 1SD2A 2I76A 5IVPA 5B3KA 3QPUA 2E4VA 3SVZA 2CXHA 3SM9A 3A58B 2HMWA 1SC1A 3O3CA 3WWZA 1YVDA 2OXEA 3BWBA 3D6VA 3WY9A 1I6KA 3CINA 1JQKA 4R3WA 3W7BA 4ZHSA 5TQ2A 1YBHA 4URXR 1YZTA 1PYOA 2XJ9A 2FZ4A 3QMMA 4WWHA 4J49A 3S8MA 5KWJA 1OWNA 4RH0A 4PLGA 3TQQA 1ZM7A 4US2R 2ENUA 4M21A 3LUBA 1QP8A 3UO8B 3V9PA 2P69A 4M55A 1TM2A 1C4WA 2PH3A 1J2JA 1AGYA 4IIFA 3QBVA 1XRJA 4WFQA 2QR2A 3T7JA 5B4UA 3I04M 1PR3A 1N5RA 1E77A 3MGBA 4E15A 3HYSA 4EG8A 1R0YA 2EV9A 1Y4ZA 5EIEA 3DGFC 2HO4A 4UW9A 5ED4A 3E70C 1IU9A 1Z28A 3RWOA 1A88A 4QD3A 3GNLA 4MSUA 1KVRA 3K6SA 3PXXA 1MVOA 2PAFA 5G0TA 4P84A 2P0YA 2QV7A 2FTKE 2P9ZA 1V1RB 3WWEA 4HLNA 1HFKA 4ZXFA 4AZTA 1H23A 1NYTA 2ZDQA 5BMVF 1JI3A 1HG1A 4EB0A 4FQ5A 2WIGA 4II2A 4JP2A 3DD5A 2XI4A 3DW3X 3RTDA 2GXUA 4M8IA 1ATIA 3B70A 5JXHA 1ADGA 1D5WA 1G7TA 1YRYE 4LUCA 4NENA 1MX9A 1Z25A 1NHWA 4ZHQF 2ZVJA 3MS2A 3F5SA 1KJ9A 4BO9A 1G2QA 3OM0A 2I22A 1EWVA 2WR8A 3A6FA 1BOFA 4AG6A 2AUNA 1G7CA 1I7LA 2C92A 3NTLA 1DIHA 1OFVA 3WMWA 4E30A 4O4LF 3EE6A 4RPKA 2ZBGA 3H9JA 3ZDDA 1X1CA 2BH2A 1V7ZA 3G9TA 2VTBA 2X5KO 5TY0A 1SHLA 1F1BA 1M2GA 2P7HA 3H83A 3I3OA 1TZ2A 2WSLA 3N9IA 1K0FA 5FLKA 5JDCC 3STVA 5IBCA 5AVXA 2H63A 2P68A 3H9CA 4UUAA 4CDMA 3F8WA 4LF9B 2QTNA 2ZI9A 1EDOA 2QU8A 2RHRA 3AVOA 3H17A 4BV8A 3QU9A 3UC5A 4HX2A 1IOVA 2IYVA 1PN3A 2FQQA 4AECA 1XPUA 4BFSA 3OG9A 4JOBA 4JYMA 4IICA 3ZXSA 2PLNA 3I9KA 1ZHOA 2GEDA 3H6HA 1W46A 3KB2A 4ASUD 4RIGA 2F55A 3DEKA 4KTVE 3OIGA 3PF8A 2EVWX 2IV2X 2BJWA 1CUXA 3LYUA 2JRLA 4Q16A 1P9RA 4HGOA 4IILA 2QVYX 4R6XA 4RVGA 3V8EA 3U9SA 4FIZA 4QRIA 4EHAA 1FXUA 1N4AA 4C03A 3S28A 1O96A 1JQJC 3W5UA 1D04A 4BAUA 5TQVA 3SZLA 4DLXA 1XXLA 1O4VA 2VYQA 2I2WA 2WJVA 1DC6A 3AU9A 3TXXA 3BXOA 1NWHA 3E9CA 5HMMA 2XRFA 3QWBA 3WSVA 4HDRA 5KYWA 1OPRA 4IM7A 1Y8RB 4I5IA 4DRXA 4EKEA 3CVWA 3HHPA 1DX9A 4J1NA 2NZYA 1Q5PA 2ECOA 2QY9A 4EGJA 4CLDA 1KZ6A 4WK2B 3SYLA 3NV7A 4BV3A 1YMUA 1V2GA 2HK9A 3H1TA 4ITRC 4M88A 3UK7A 5JTUA 4XJXA 5AJUA 2C77A 2WQ6A 4ZTZB 4E0BA 1CS4C 2VAVA 4KYIB 4A03A 2EJVA 1E3LA 4PYQA 2NZUG 1DWUA 3WOHA 4RSGA 2IE0A 5A4KA 1XDSA 5ALJA 2ZWVA 2G76A 3IP6A 4OXRA 3Q7IA 1QMGA 3R09A 2I3GA 3A0UA 4M36A 2AYYA 2EKLA 3UGKA 2PUJA 1H85A 2YZGA 3JYHA 1AS2A 1BX3A 1BDIA 3T9FA 2R8OA 3RNOA 3W8RA 3OPYA 3GBVA 3E4DA 5E4JA 5DM0A 5E6UA 4WLOA 3THXA 3JYQA 5A6VA 5CYFA 3ZHXA 2ZJ3A 1S2GA 3QVOA 1VLJA 3C3XA 1WPXA 4JJIA 2HNAA 4NBWA 2RJOA 3CJRA 4Q34A 4MP6A 1WNFA 4Y1FA 4YGXB 3S1AB 4LCEA 3NIBA 5I45A 1VRWA 2DWQA 3I2YX 3I61A 2YZKA 2QW8A 4ZVSA 1UBTS 3TM5A 4LFCB 1MZVA 3EF1A 4UTOA 1QPZA 4IDQA 3L2OB 4TV8F 3UJCA 3T3NA 4YREA 1KAQA 1YA4A 3Q7PA 1C7ZA 1DEKA 3RRXA 4Q4AA 1QH1B 1MB4A 3CY6A 4X24A 2IA5A 3EXAA 4ZCPA 3SSAA 2QLBA 1JH8A 2ZRIA 5GTDA 3U6KA 3K70B 2HPZA 1DAHA 1NKVA 3W9UA 1COZA 1L5FA 3HEAA 3H5AA 2WEKA 1Q3TA 3WG9A 3M5DA 1IZ9A 2X8LA 4AJNA 4HLQB 3HXPA 2Q4TA 2I9PA 3HJTA 3ZK9A 1CR1A 4U8HA 1JHQA 3PTZA 1ZIXA 4FR5A 2QLTA 1UT6A 5HK8A 4WY8A 3FETA 2OD2A 2QXYA 1PEKE 2IOQA 4WINA 5GONF 4QOJA 4LJKA 5BV2P 1WZ2A 2NP6A 2R48A 4U6QA 3RPEA 1IPFA 4A2CA 1ONOA 4B6EA 1NJGA 5K05A 3R9XB 3HVIA 1IBSA 1PQUA 3N8IA 1N75A 5DLQC 4KXVA 3DF7A 1A71A 1HBJA 1XROA 3DOIA 2ZT6A 3DL4A 3SOZA 3G17A 4GGMX 5JMWA 3AF0A 1R0RE 4ES6A 3CRNA 2OCLA 3KKEA 4EMUA 4H0CA 3P2JA 1JHOA 5CJJA 4ASUA 4ZZ3A 5BP7A 3K6KA 5SY4A 3VSCA 5CD9A 3RSLA 1LBQA 3ERCA 4N5MA 3PFNA 3AP2A 3MWJA 3WLNA 3ZHZA 1FTYA 3HVKA 1A7KA 5HEKA 4HYYA 3RU2A 3AM4A 2JAQA 4JU8A 5LM3A 3KSBC 5A7HA 1ODFA 3H8WA 2EBFX 3N74A 1ZR2A 4Y6OA 1JQBA 1G21A 2C59A 3SF8B 3TFWA 5I7HA 4YAUA 3GI1A 1CR2A 3HLTA 1ETHA 3OA2A 4DREA 3N2LA 4GPZA 4ROSA 1G5IA 3S8EA 2BN4A 2J67A 3SDBA 1SBIA 1I24A 1OXTA 1OYYA 1WM1A 3I9NA 4H7PA 1BS2A 1DB3A 3GJ6A 1OB5A 5FFMA 1E4EA 2FW1A 2L82A 2J3KA 2ZJOA 5SZHB 2MT9A 3OJEA 1RP1A 2XB8A 4XX1A 4TV9B 1MJGM 3X2FA 1L7NA 1PW7A 2EQAA 4DSAA 4F86A 2PLAA 3OCCA 4Q9DA 1CQWA 2VNSA 4IOKA 4REQB 5A9RA 1PNRA 1BXRB 1LDMA 2YQ5A 2ZRJA 4RIFA 3ELUA 1UBNA 3MUOA 1VTKA 4P3NA 3DO5A 4Q39A 1NBIA 3IPRA 3L8YA 4C7KA 3RC7A 1DADA 1Z18A 4YQZA 1BVYF 3CF4A 2O19A 2IPMA 1APBA 2QJOA 1DKRA 4K6MA 5BQXA 4FZ3A 1WSDA 1ZY2A 2XOKD 3NDJA 2NG1A 4ABTA 1U0EA 1HTWA 4JB2A 1GGEA 5ICMA 2X2EA 3PITA 5JAMA 3AXSA 2J5XA 4UCQA 2VRBA 5CDGA 1T3SA 3QKSA 3ZHVA 4OLJA 3B5EA 8LDHA 5K01A 2QTVA 3OMXA 2ZSKA 3LUAA 3LW7A 4LNHA 5JY6A 1NKSA 1PFVA 5EVCA 3CUWA 3C3AA 3CG0A 3ZVLA 3B6IA 3DWIA 4PCLA 1GPMA 3RYIA 3D3KA 1O94C 1EP2B 3NU1A 1A2BA 1V43A 2C83A 3OFKA 4LQLA 3WIEA 4I1PA 3VUEA 4HN9A 3I9V6 4PBSA 4ZVTA 4EHNA 1BFDA 4PSAA 5TPWB 1JVBA 3JXEA 1YVPA 1K7YA 3WJAA 1TIPA 1LNQA 4OQMA 4CMBA 1DX4A 4DC9A 1CRLA 2I4OA 2IT1A 1JG2A 2QTCA 3DXFA 2P8JA 4M9ZA 1PJ8A 1SXJC 2NZJA 4G1UC 3WB0A 4EELA 5BVHB 2HDHA 3J81A 1A76A 4QEZA 1RE1A 1BEUB 3QE0A 4MR9B 1DUSA 2BFAA 3JQPA 2XDAA 1IRIA 1U0FA 2QLMA 3Q5GA 2LZ0A 3K7EA 4HDAA 3THWB 2YINC 1FMCA 3IHLA 1WSBA 4JUIA 1JPNA 3D3NA 4Q0MA 1QDLB 3UMSA 3WICA 3ZBPA 1OGIA 1WZIA 4ZTUB 5F76A 1PP4A 5F1PA 5CP8A 4ZI2A 2YVUA 3PSAA 1V3QE 1KE2A 1XTPA 5BQOA 1OLXB 2ZRHA 1Y82A 1TGYA 2Y99A 3MWEB 4HGYA 4YCAA 5GWXA 3U13A 4C7XA 3Q85A 2HH9A 4C4OA 1C9DB 3EVDA 2VDLB 3HKCB 3OZUA 2QUIA 5L3SB 3ZD7A 2AG0A 2F1HA 3GJQA 4DCMA 3C7CB 5EPEA 4KPUB 4G2NA 1O5OA 3IBTA 2RH5A 1BCSB 3GMSA 3RRNA 2B34A 3RS3A 3NHBA 4Q1FA 5ADUS 2X9LA 3PFBA 4IDFA 4OM8A 5AVVA 3CR7A 5JD6A 3DM5A 3O4JA 2BGUA 1YCHA 1JJIA 3V2UA 4B2LA 4KRFA 1G3UA 2QPLA 3ONNA 3D43A 1S2OA 3GUVA 2JPDA 2AWOA 4IF4A 4RFVA 5EWJB 3KKZA 3R5JA 2H4HA 3ZCQA 5DBEX 5DTIA 3V4RA 1NLUA 3NMUF 3U2QA 1FFYA 4AX8A 3PDWA 3KU4A 2FXIA 1YFZA 2VHYA 1GL7A 1FVOA 3PFIA 4Z53A 3V6LA 4X95A 3DZHA 2G88A 2GCEA 1Z07A 1NFRA 4A7PA 5L4LA 4CKCA 3GEHA 1PCXA 1EJ0A 1AOXA 4JUAA 4N3BA 3L77A 4NYMQ 1V4VA 1IEXA 3C8MA 3H6GA 4LK2A 3LNTA 1TK9A 4KV9A 1R9GA 1QORA 3TZCA 2CYBA 1XMQB 1ZOLA 2Q5QA 4WCDA 3RCBA 4FWTA 3H19A 1NPYA 1X7ZA 2C7OA 4OOFA 3L46A 1M34B 1OV6A 2ES4A 2Q0XA 3SKYA 1UZLA 1J2TA 2XOKA 3ZKWB 4FOTA 1JECA 1W2HA 3A1SA 5IJ9A 4G67A 2VNJA 4PYRA 4HV4A 5CLJA 1AQ6A 5KI6A 3FJ1A 2J30A 5F4ZA 5H1YA 1YJQA 3ZGVA 3JD1A 2ZI6A 4FBMA 2A4MA 3O6VA 1X8JA 4N0EA 4U63A 1V0JA 4Q1AA 1CJTC 1H65A 5LQAA 1J07A 3KT8A 4FNMA 5CXUA 2NU6B 4BNWA 3EYWA 1U7HA 2QTTA 1VL0A 1BE1A 4KXUA 1P7ZA 2RGRA 2IYRA 1SBYA 2NTJA 4G0WA 1JLLB 1RC1A 5CU7A 3UY4A 5E38A 2H57A 3ENWA 2RK3A 2V7PA 2HBYA 4XQCA 5JJKA 2WKQA 1CFZA 4B40A 1JW9B 2WFZA 3I05A 5E6RB 1C7FA 4R16A 4FKBA 4KGVA 1TUEA 5FV4A 4KZKA 3GBPA 3CTMA 2FWAA 1Q0TA 4ESHA 5AJVB 5E9WA 5EWMA 4BRSA 2J07A 4ZT4A 2BFOA 4PFQA 2ET6A 1JP7A 3H13A 1TCUA 2OV4A 2NXEA 1THMA 2GK7A 3T95A 2VSNA 4BB6A 1GDTA 4ND5A 4E3ZA 3HGQA 2X1LA 1U7ZA 2ZEJA 4UXJA 1R0KA 3PLAE 1T6YA 2P1RA 2A9JA 3TMYA 3V9AA 1PS0A 2K2QB 1XJQA 4D42A 3GFSA 1BVUA 2PRKA 3E9ZA 4OI4A 4ZHQA 2P9BA 5AW9A 3TWOA 2EQ5A 2JJ1D 2WZDA 3GDWA 1BXKA 4CM3A 2BHRA 4GOJA 4TMVA 5FBZA 4GD3Q 3TTWA 4XPIB 4YDHB 1GCOA 1YOBA 2G5TA 3RTGA 1OTYA 1POWA 1A4IA 2UAGA 2YMQA 5HF5A 4E3WA 4F4IA 1J8MF 3OQPA 2DERA 2LUOA 1US8A 1B3BA 1JILA 4C0HA 1J5PA 1HEIA 1VDZA 1KMQA 4H1HA 7ABPA 2BGJA 2Z6VA 3TAXA 4YT2A 5JV5A 1P3DA 1H5QA 2H18A 2YWGA 3OO0A 5A04A 1OGJA 3GDGA 3MCWA 2V5UA 4NIMA 4N3AA 3SLGA 2R2GA 2PSDA 2VQ6A 3H16A 4CQLA 1R6AA 1T6XA 5EHZA 5I51A 1P5FA 4TLEA 4NZMA 1Y6QA 2B98A 3VR5D 3WQQA 4R1TA 5K6RA 1E1LA 1I0LA 1QIDA 2ZAGA 3QY0A 2GFQA 1AGPA 3BREA 3DVAB 4RJJA 4YCMA 4UDOA 2G9QA 1A5TA 2Q8QA 5LOVB