4LHXA

Crystal structure of nucleotide-free rab8:rabin8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 53
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhxA00
2G0TA 1XMSA 2WOJA 2WJIA 1X3SA 1R6BX 1SVWA 2V1XA 4FMDB 4BASA 4XVUA 1V5WA 1QHHA 4GPTA 3V9PA 3HYTA 4PANA 3Q7PA 3ETLA 3QEOA 3WMFA 2W00A 5TVKA 1Z6AA 2FFBA 2ZRLA 3IIMA 5JZVA 1E79A 4TL7A 4ZKDA 4Q1BA 3WNCA 4LHXA 2CVHA 1FTNA 2FJUA 4NYJR 1KSHA 1X86B 2BBSA 1QHNA 2YOGA 1NG9A 4DKXA 1DARA 4DLRA 5JS8A 3CH4B 1MR3F 1XRJA 1YQTA 3K0FA 2ZR0A 4UNSA 5KDLA 2WJJA 2ZSFA 4PQFA 3HJNA 5KSYA 2MSEB 1SXJA 2D2EA 1FUKA 4L9SA 4QBGB 3X1WA 5CLLA 4LHYA 2VEDA 4KSBA 3K9LA 2FPMA 4UXIA 2O8EA 2YNMA 2IEZA 1YZGA 4NE2A 4D0NA 1PJRA 5JWOA 2B6HA 1F6BA 2CMKA 4M9ZA 1E0AA 4JT4A 3GFOA 5FH9A 1X8KA 1DADA 4UNQA 2JLZA 1N3BA 5GJWC 4B3CA 2XNDD 4HDOB 3AGPA 4F38A 2V7QD 1TU3A 1AKYA 4AIIA 1KI7A 5CIQA 3X1YA 1PZNA 2FMXA 1KY3A 4F7WA 2MSCB 3LA6A 1T8UA 4JLPA 2E87A 5E7MA 3CNLA 5JSZA 2ZRAA 1UEIA 2P3SA 2ZANA 3LW8A 4JMPA 5E7IA 1JEEA 4IOLA 2F7SA 1K8RA 4JVMA 4KFRA 4Q19A 4OI1A 3U44A 1HY3A 3MWJA 2ZRNA 4PO8A 4OHWA 1OH6A 4L16A 4YMTA 3B1YA 3KQLA 1UDXA 5EXSA 1FUUA 4PX9A 2W83A 1XTIA 4V0ME 1XD2A 3IILA 2OSBA 1BOFA 3MWLA 3GLIE 2OFWA 4BLSA 3L82B 1A1VA 2ZR7A 1UBGA 4PTLA 1K5DA 1RRPA 4XD7A 5F2EA 2AWOA 4IRUB 4AG6A 5IHPA 5JCZA 3KQUA 3LQRA 3FHTA 5JWRA 5DYIA 4NDZA 1W4AA 2WWYA 1ZJ6A 4OJKA 5EE3A 3FOZA 1AN0A 4JJZA 1BYUA 3ZD6A 2GZDA 5JJIA 1E1RA 3PUWA 2FOLA 2DFTA 2J7PA 1CR2A 2Z5FA 1XU4A 4EJSC 1ZC3A 1IXZA 4GOJA 3I32A 2C9OA 4RCYA 1KOFA 2FEMA 2DFNA 2NQ2C 1XTKA 4RY2A 3LVRE 1IN8A 5TDHA 2VBCA 3EZ6A 4DC9A 1QHHB 3EZ7A 4I1SA 2QQ0A 4OYHA 4Q7JB 1T5IA 3NIBA 4D26A 4M21A 1H8HD 1RW4A 4HAVA 4HSEA 1W49A 4TYYA 1DELA 1IJFA 1QG2A 1Q3HA 1CP2A 1RYHA 1VHTA 2Q3FA 2YINC 4KU4A 1MKYA 1NI3A 2CDNA 3RSLA 1S3GA 4B34A 3AVXA 3KL4A 3UPUA 4CEHB 1KK3A 4C0QC 2QPOA 3R9WA 4BLRA 1UKYA 1Z6TA 2A5DA 3HU2A 3C41J 4FCVA 1N25A 1XMJA 3BIFA 3KQKA 1R0WA 3U6KA 4HLCA 4B43A 1Q21A 4IVPA 1XDBA 5G3YA 4B47A 1KGDA 1EFRA 4D0LB 1OYYA 1QHIA 2RGGA 1G5RA 5TARA 3WYFA 5HKKA 1VTKA 1II0A 2NPIA 3BWDD 2FFHA 1IN6A 1XNJA 1IM2A 1Z6GA 2JCSA 3ECCA 4IW3B 2OUKA 4Q9KA 1L2TA 2ZE6A 1PLKA 4U00A 4ACAA 4G5RA 4M2LA 3QF4B 1E2MA 2FZ4A 1XPRA 2IYSA 2V4ZA 2P6RA 2ECKA 1E9BA 1ZNWA 2PZGA 2J0QA 1GRQA 3EXAA 4JSTA 2ZSEA 1RRFA 5HCNA 5EE0A 5IK2D 1E3MA 3TVDA 1RKBA 2ZUDA 4LY6A 1E2KA 3FTQA 4PQYA 4EUNA 2G77B 3PR1A 4LBVA 1GL6A 2VF8A 1BS1A 4LYHA 3SBEA 4DLVA 1VIAA 1YZNA 3GLIB 2AHOA 1BKDR 1ZM7A 3CR8A 1GILA 4JVSB 2QRNA 3TW4A 5F9FA 2ODEA 4A6XA 5KPDA 1U2RA 1W47A 4XVRA 4Q4AB 4RKEA 3K9HA 1KK1A 1XJ0A 2VPPA 3KKNA 1X8JA 3GLFA 3KXLA 1A2KC 1R5BA 2BWJA 1AS0A 4DLUA 3QSYA 2DPXA 2W6IA 1Z6XA 2F43B 2BVNA 2BJVA 5FOUA 3LBNA 2VHCA 4ZO4A 5SZJA 3TGPA 1D2NA 2DBYA 3OE7A 2P65A 1FL9A 3MSXA 4BFXA 3V4RA 3CPEA 5L3QB 2WWHA 3DEFA 2CE7A 3U6BA 2QSZA 4S2EA 1L7VC 4M8NE 5HZHA 4IVQA 2RGCA 2XB2A 4JS0A 2PH1A 3AM1A 3TR0A 4U7DA 1F48A 2P2LA 4M1TA 4XOIA 2JJ2D 1G20E 3ZYCA 4UQOA 2RH5A 2R6CA 4DDWA 1Q1ZA 3QXSA 5E95A 1KSFX 3UWOA 2VIIA 3C14C 1CJMA 3ONWA 3DKVA 3SJAA 1EFHA 3TAHA 4OJQA 1VMAA 3BB1A 2FSIA 4BFSA 1E4YA 1G8HA 1SVKA 3O47A 5LD2B 1WF3A 3CIOA 3CBQA 1NLYA 5JEEA 3K53A 4Q7LA 5KUTA 2VHTA 1YZTA 4Q47A 5DI9A 5JHGB 2VHJA 4HYYA 5AUOB 2A5JA 1H8ED 4DDUA 2IUSA 2K5UA 3C4JA 2GJ9A 3AF4A 3U7GA 2QGNA 2QAGB 3AB3A 1KTVA 3IEVA 4B33A 1X8LA 3Q3JB 2ZRFA 3FDIA 2ZSDA 1EX7A 4QHSA 1XXHA 5EP3A 3TAUA 1D8TA 4L8GA 4KO8A 5JFGA 3NBFA 1XCMA 3WP1B 3AGQA 2Z0MA 4Z51A 3BGWA 2O8EB 3ADDA 4IJMA 4DDVA 5AUPB 2BMJA 3SHFA 721PA 1MH1A 2YC2C 3PJRA 2IYLD 1A7JA 2WWXA 4H1VA 4HZUB 3KKMA 3TMKA 1EFCA 3F8TA 5FL3A 3UIEA 2ZAOA 3FMPB 4AC9A 3AF2A 5KNCA 1QBKC 4DSUA 1NRJB 3GJ5A 3U5ZB 2WSSA 2QPAA 1XX6A 3LD9A 3W8RA 3GJXC 1SVOA 5EP2A 3TW8B 2Z4SA 2AK3A 2AL7A 1U9IC 1AJEA 1OH5A 2C78A 3AEZA 1DOAA 4BWYA 1W7AA 4MUAA 2RMKA 2QORA 4RD2A 1TQ6A 2WPDD 2ZI9A 2O8CA 2XTZA 1VCIA 1XF9A 4TQ9A 4M53A 1CR1A 2EVWX 5H68A 5J40A 1E2FA 2PEZA 4RSGA 1E69A 2LWIA 2OLJA 2GILA 5K8UA 4D4MA 3RSOA 1E1QD 2IUTA 3GFPA 3T1VA 1EWQA 4G5OA 1XEWX 4DVGA 121PA 1ZCBA 2I1VB 3B9QA 3IPXA 1OXXK 3NC1C 1JALA 4B3DA 4HUQB 1ELOA 2BBOA 2NO1A 1CJVC 1ZCAA 3EZ9A 4ARZB 4JJKA 4QOSA 2OXRA 2KSQA 2VP6A 2RGAA 4XH9B 1KK2A 1G3IA 1X6VA 3OHMA 4DLYA 2CBZA 4LC1A 2JLUA 4AYWA 4B73A 3WBKA 5KU1A 3A1VA 4LV6A 2QMHA 2PLRA 4P32A 1XCGB 1PVOA 4PAMA 4EKDA 3MRSA 1OIVA 2TMKA 5CM9C 3ZGXA 3M1IA 2JA1A 4R98A 4P3YA 2AN9A 4UXJA 1RRCA 5AR1A 1JNYA 2FU5C 5TXGA 1COWD 4BLPA 1O87A 5GADl 2EFGA 1IY1A 2CNWD 3CLVA 4RZ3A 4O3MA 2N42A 3AF3A 5JJKA 3VR3A 3G82C 2BCGY 4JL5A 4WW0A 3PITA 2J0SA 3H2YA 1CF4A 3KB1A 2MSDB 5FBRB 2ZRDA 2PMKA 1TAGA 2JLVA 1G3UA 3X2SA 4M1SA 4A0FA 5AWFC 4E09A 1ZIPA 3GP8A 2GCOB 2ORVA 3K09A 5FPSA 2ZYTX 4QJ3A 5L3SB 1ZNZA 4AI6A 4JBWA 4JLDA 1DAHA 1E2JA 4F93B 4PC2A 2FX3A 2NOAA 3PUZA 1LFDB 3EC1A 3DKPA 4LDJA 1Y63A 2DHRA 3K0EA 3X1ZA 2ZI4A 1S8FA 3O8BA 1W5TA 1OJLA 2DCUA 2HF8A 3L8YA 3E5HA 3QKTA 4B2IA 2E9SA 4R71A 5CB6A 2HV8A 2UVQA 3AKEA 4BQSA 3U61B 1MABA 1XCPA 3U7FB 3OEED 4Q00A 2NO9A 4GFDA 2PJRA 5FTNA 3EARA 1UJ2A 4MA4A 1UPTA 4CYMA 1KMQA 4IFEA 1DTSA 2PX3A 4G5SA 4EPRA 3EX7C 3O8CA 2IYWA 4UJ3A 3LRPA 1XTSA 3OEHA 4ZI2A 3EAQA 3ASYA 3FFBA 4LJ9A 4YMVA 2VHUA 3R9IA 4DHEA 3CF0A 1QRAA 5E7JA 3ZIAA 3F0TA 4O2LA 4MYUA 1G3RA 2REOA 4I1VA 2WOOA 5JWHA 2QL6A 5GJVC 4LBYA 1LVGA 1OFIA 1LNZA 3C8UA 4D4LA 1XPUA 5D3MA 3DL0A 1TADA 2FFAA 2IK8A 4PPNA 3BS4A 2EW1A 3O8RA 1QHXA 2QTFA 3VX4A 1JJVA 3K0SA 4ZPXA 4M4SA 2IWRA 3ZJYA 5KSZA 1MRNA 2Z6VA 4QGGA 3K1JA 4PR0A 2NIPA 4ASUA 3QKRB 2HCBA 1IQPA 3R9XA 5FTLA 4C2TA 2MMGA 1D9ZA 1Q1QA 4OI2A 2HEIA 3EWAA 4ZDIA 3P20A 3L0PA 2BIFA 2JIZA 2KB0A 5BYJA 3GJ4A 1SKYE 1TQ2A 2YZ2A 4IDQA 1TX4B 1SXJC 1XEWY 3KXKA 4B44A 4A15A 3LBHA 4TYPA 3SC3A 2FV8A 1ODFA 1SGWA 1KI8A 1SHKA 1AQYA 1XZPA 3W90A 3ICQB 1R10A 3OEEA 1VCOA 1AGRA 2OV2A 4ACBA 3OFNA 2Q3HA 3SNHA 4JLVA 3EPKA 3U3RA 4PO1A 1CULC 1CLUA 2OM2A 2CCGA 4LOAA 4B3XA 2UZ3A 2J7PD 2QP3A 2G3YA 5FFMA 4B76A 1KNXA 4HAUA 2WWWA 4Q7KA 4OQFA 2QROA 3GLHE 4Q9IA 1LF5A 1Z0KA 1FNNA 4TSFA 4D81A 1UDWA 4OKSA 4RJLA 2FSGA 2GBLC 1NLZA 2SHKA 2JJ2A 4MRNA 1YJ5A 2AXNA 4GI7A 4Q5IA 4KBFA 1Z28A 4U5XA 3TLXA 3N5CA 3RWOA 2W2TA 2CNWA 3QXCA 4OQMA 3TSWA 2AX4A 2IWHA 4FW9A 1TEVA 2QQEA 4FI3C 4YDHB 4MKIA 2GRJA 1NBME 3EIQA 4HEJA 1FPMA 2ZI7A 1R8QA 2DFLA 3GLHB 3RRMA 1FQJA 3TK1A 1U94A 4B3FX 1WRBA 4YQFA 3VNVA 2GZHA 2W6ID 3PQCA 2D2FA 4JL8A 4PO9A 2ZRKA 2AD5A 1IHUA 2ODNA 3GEIA 4HAXA 4TLAA 1HTWA 1YZKA 2ZROA 5G3ZA 1LV7A 4Y0VA 2YOFA 2A7QA 3T15A 3VKHA 1GIAA 5FOVA 2D7DA 1S9DA 1P72A 3FB4A 3NBYC 4WAUA 4PAOA 4WXRA 2XNDA 4IDOA 3KTAA 1OFTA 4BZQA 1HURA 2P0EA 4TSFD 4DLZA 1X1RA 4NPHA 4Q1FA 2W0MA 3FMOB 2EU8A 3V4FA 2QPTA 4WZAE 2OCPA 3BBPA 1I4DD 4MYCA 1C4OA 1KJYA 3CRVA 1E1QA 2J9RA 4GBMA 4QNMA 1TEXA 3C5HA 4IXMA 3LBIA 1NNEA 4KFUA 3RANA 1DAIA 1U8YA 4MRPA 4ABYA 1R0XA 1ZYUA 4C0SA 2XSZA 5DI3B 1ZUHA 2PBRA 2YWGA 2QA5A 3WNBA 1Z2AA 2O8DB 4LJ5A 3D3QA 1Q1BA 4A92A 4N1AA 3V00A 3QKRA 2O8FB 5FUVA 3QKSA 4HAYA 1JBKA 4BFZA 1G8YA 1NY5A 3ADCA 3TSOA 1OPXA 3PXGA 1E79D 4XVQA 4HUQA 4EFLA 5UKDA 2WMNB 1T9HA 1IOZA 1Z47A 3QE0A 5CYOA 2ZU0C 2J1LA 1R8SA 2Q3MA 3NTUA 221PA 1RE0A 3TRFA 2CL6X 1OIWA 2DYKA 1Q57A 4OQNA 2IS2A 4F4JA 3K70D 3U2QA 3ZZTA 2GAOA 4EPXA 4HLQB 2OILA 5EJEA 5J4KA 1P61B 4E03A 3I61A 2V1UA 5L3VA 2VSOA 2GXQA 1ZBDA 3KKQA 5EUQB 2JLSA 3A4MA 4FMDF 1ZNXA 1UAAA 4EDHA 1VG8A 1UKVY 1NMYA 4MRVA 4Q03A 2QT0A 3VR5A 2D4HA 3ADBA 4WXPA 1D5CA 3ASZA 4Q4JA 2R2AA 5H1YA 4LJ8A 1R0YA 3JZAA 3AH8A 1TTTA 3DMNA 4N0DA 1KAGA 3RWMB 3ZVMA 1H8HA 4Q1DA 1OKKD 4GOKA 3I5XA 1N5LA 1R5NA 4PQRA 3VHLB 1L4YA 1II8A 1N6HA 3OAAA 4Z1MA 1G3MA 2OAP1 5FPYA 3THXB 2OG2A 4IOKA 1HYQA 2BM1A 1N6KA 1VIYA 1CR4A 4FCTA 2FWRA 2ZU6A 4DSNA 1EWRA 4P4TA 4AKEA 1XD8A 4S35A 3T1QA 2Q9AA 4BE7B 5HR5A 1NJFA 1UKEA 1ZM3A 1IBRA 2YWHA 2YV5A 3CM0A 4LV5B 4MYTA 1WDTA 1KK0A 1NKTA 2ZUCA 2PZFA 4RZ2A 4P33A 4M0LA 3NH6A 3I73A 3QPVA 2F1IA 3PUVA 2PT5A 2X77A 2ZEJA 4HAZA 4UNPA 2GAAA 4O2RA 2WTUA 3CUEF 2R44A 4JT2A 2NO6A 2HJGA 1SKYB 4JLBA 4CEJA 2ZJBA 3A37A 3QG1A 4DSTA 3H4MA 4A8JB 4DXAA 2J0UB 1LB1B 1US8B 1DVRA 2OO7A 3VQTA 4LX0A 1DO0A 4NMMA 2GKSA 1Z07A 4W5HA 5B64A 5FR2A 3FVQA 5KDOA 1OYWA 4LUCA 1NIPA 3K09C 2WIBA 2FGKA 2J0VA 4RKFA 4KI0A 2IX3A 3FWYA 5AUQA 4EFMA 4M1YA 2NZ8A 1W46A 4A1FA 2XGJA 3SFVA 4A2QA 3W8NA 3FFAA 4OHYA 1T3LA 2DWOA 2ANCA 3AP1A 2QP4A 5TY0A 5BN5A 1S0UA 1TQDA 3QKSB 5FTJA 4AY2A 1XJQA 5J47A 3DVLA 4UJ5A 2XTMA 5EUMA 2VO1A 2JLWA 4JKIA 4BGDA 4I81A 1G7CA 3W3ZB 4QBIA 1F2UB 3KKOA 3QKUA 2GDJA 3A4NA 2JDID 2REBA 4TMXA 1AZTA 2R6AA 1ZINA 3THXA 1NKSA 1Z29A 3MJHA 5LPNA 1BO6A 4M22A 2CK3A 4ILEA 1KDRA 3B2EA 3P26A 3AF0A 5H70A 1J8YF 2NO0A 1IY0A 4HLDA 1M34E 3MFYA 4UNRA 2WICA 1OB2A 1F2TB 3B1ZA 1P9NA 5CJ2A 5G53C 1E9DA 3CNNA 4PPFA 5CLQA 4QM7A 2H92A 2D74A 1YR8A 1TMKA 4LYFA 1TQ4A 4GZLA 2QEQA 2ZI3A 2B8WA 1W4BA 3I72A 4TT3A 2CEAA 4CEJB 2NZJA 1U8AA 4V0LA 2XNSA 1U0HC 3THYB 3B60A 3IIJA 4GT1A 3U7EB 3UKDA 5GVSA 2ZI5A 5L8VA 4W9MC 5HE9A 2D3WA 2XJ9A 2C03A 4BZPA 4C4PA 5A5GA 2AK2A 1GITA 2YYZA 5C1BA 4C0AC 2FSFA 1U98A 5HE8A 1D6JA 4IHQA 4NKRA 3OESA 3NG1A 1JECA 1WXQA 3A8TA 2CHGA 2JJ1D 2WSSD 4Z8YA 1XD9A 4Q4HB 1LTQA 3QEJA 1RC8A 4TL8A 2IS1A 3SEAA 4JYCA 3P4YA 4A0HA 1GDDA 3DDCA 4URUR 1UBCA 2ZS9A 2ZRMA 4LBWA 3QBVA 1AS2A 5EP4A 4NP6A 3RS5A 2GEUA 2IYUA 2ATVA 2VP2A 3AKCA 1P9WA 3OIWA 2QAJA 3AKDA 3BRWD 4QBHA 2ZS8A 1I4TD 3REFA 1M7BA 1CBUA 1P73A 2CK3D 3EIEA 3R8FA 2P67A 2ODWA 2JGNA 2ZJ2A 5EXPA 1F3OA 1E2EA 1N0VC 1Q44A 3UATA 1TNDA 4P0TA 2QTHA 5FL7D 3W9YA 4BFVA 4TYWA 1JXOA 3QG5A 4OBEA 5P21A 2RGNA 4ITRC 3TE6A 4QHYA 3GJ8A 5JBQA 1V43A 2IYQA 4TLEA 2ZVPX 4FMCF 4TZ6A 2QY9A 2IHBA 3M6AA 1E99A 3TUJC 3GLGE 1NN3A 3KFXA 3EWSA 4M9SA 2IS4A 3W5JA 3QOFA 1P3JA 4Q4JB 3NXSA 4Q48A 2ZJYA 1PUJA 3DZ8A 3KUCA 1E9AA 2QAGA 1W5SA 1J99A 2GEVA 4TLCA 1LW7A 1XEXB 3HPRA 4F4CA 3TQFA 3F3YA 2ZR9A 1GNRA 5SZIA 3LX8A 3RC8A 2EWWA 2HYIC 3LW7A 3PFIA 3SJCA 4KFSA 1SVSA 4LPKA 1NIJA 1G19A 4B6FA 2ZAMA 4RD1A 1Z0JA 2ZM5A 2ASEA 1KSJA 4FCWA 2Q0HA 1IN7A 1MOZA 1FMLA 2KI5A 2QENA 2VF7A 1Z63A 3FHCB 3ZZUA 3SYKA 4FN5A 1NVVR 4HB3A 4LWZA 4DT1A 3FMFA 5KOYA 4YXWA 4L15A 1D2MA 3MLEA 5AK0A 1OHHD 1VPLA 2FH5B 4N3NA 2GJKA 1W2GA 3E1SA 4C0BA 1M7HA 3PEVA 4FIDA 3WHKA 4DB4A 3ZD7A 1YZLA 1Z5ZA 2AKAB 2ZRBA 4PC3A 3UG6A 2BJWA 2IYYA 1N5JA 3EZ2A 1OXTA 2Z83A 5AJXA 1Q22A 4CW7A 3IO5A 1IN5A 3T5GA 3TSZA 1MRSA 1EGAA 2HF9A 2Q21A 1W36C 3LLUA 1ZU4A 1J70A 1E0SA 2QGZA 3CH5A 4KJZA 5EXTA 2BMDA 4Q02A 1KO7A 1S1CA 2A5GA 1Y3AA 2H7VA 1AGPA 3FE2A 2QI9C 2FDCA 1CS4C 5SZHB 3SYNA 4DSOA 1G5PA 3LY5A 3KFVA 4Q4HA 3EPJA 2G88A 4CF7A 4GDFA 2YKGA 1SHZA 1XZQA 3AVYA 5EZ6B 4EIWA 4JLAA 2B7BA 3FGNA 1R5OA 1EXMA 4RZUA 2H8KA 3HP1A 1OE0A 1W0KA 4URWR 4DUGD 1T91A 2X8AA 4QL3A 2H57A 1Q1EA 1AM4D 1GWNA 1OSNA 4G0NA 4UKDA 1M1YE 1DAGA 2R62A 5JLJA 3U4QA 3RAPR 4QKQA 1KZ7B 2C95A 4QC2A 3DM5A 4TWZA 4KV9A 3VKGA 1BYIA 1MV5A 5EP1A 1IAQA 1RFLA 5DN6D 3IQWA 1Z0IA 1P5ZB 2QBYB 4Q7MB 4L4UA 5GJBA 1J7KA 3PUYA 4Q18A 4PSKA 2FEOA 2ZRCA 3T5DA 1GKUB 3HR7A 4BLQA 1DS6A 1TU4A 2HUPA 4CZ2A 4B35A 1AK2A 4A0GA 3CZQA 2QMUA 4JBYA 3ZVLA 2IYTA 4JBXA 3L8ZA 1NL3A 5DLQC 2R6GA 3RC3A 2XSZD 4CT4B 1NN5A 1IJEA 5CDFE 5JJLA 1MO5A 2DR3A 2PL3A 4RZXA 1ONBA 2PX0A 4V03A 3VR1A 1S1MA 3EA5A 4TT3D 4EAQA 2RGDA 2RAPA 5BXQC 2J59A 1WE2A 3BAFA 2VP5A 3ND8A 4G5GA 2FPLA 1G4AE 2V9PA 3WRYC 2EFEB 3DZDA 4TQAA 4AURA 2F1HA 2ZRJA 4YONB 4EJSA 1MT0A 1XB2A 1SXJB 1KDTA 4NL4H 3T12A 4EJSB 4C2UA 3AVWA 1H65A 3GLGA 1FOEB 3IO3A 3K0CA 3O8DA 3K0AB 4NZYA 5DYGA 2QM8A 4TMTA 5KNBA 4JLKA 3QNUA 2WSMA 3RRZA 1QF9A 1T0HB 6Q21A 1OXVA 4TYQA 2UKDA 3DOFA 3SQWA 3PG5A 4EQ6B 4HZIA 2WAXA 2LKCA 3NKVA 4RFSB 3ZS8A 3AP3A 3EA0A 2H18A 3RS0A 1EFTA 2GETA 4MGZR 2O0JA 1IXRC 1SZPA 4PZYA 1QHSA 3A1TA 4BUJA 4US0R 5KO2A 1BMFA 1KYIA 3IIKA 1NN1A 1WP9A 5KTYA 4QM6A 1E2GA 5C4GB 2JAQA 3E2IA 4DDTA 2ONJA 1A2BA 1NG1A 2ERXA 3LO5A 4NCIA 1DAEA 3U3JA 3KXIA 2DWPA 1JEDA 1G7SA 3B7GA 3PEWA 3CF6R 5AJZA 5JRZA 5KHOC 2ZSAA 2OESA 4URVR 4OL0A 3TUIC 1TUIA 2D62A 5FOSA 3LVQE 1DEKA 1S96A 2B8TA 3BC1A 5DHFA 3H0KA 4F92B 2EFCB 2C2HA 4Q4AA 4PHGA 2XZLA 2NO7A 3LFUA 2JLXA 1YU9A 2EFDB 3TJZA 3AUYA 2XZPA 1RPZA 1OH7A 1VKJA 4PFSA 4Q21A 3UG7A 5J5CA 5DGXA 2IUUA 4TTQA 4ZDWA 2X1VA 2GCOA 4Q9JA 4KITB 1YKSA 1JXMA 2IYZA 3TQCA 4A6PA 3SHWA 2ZSBA 2QZ4A 5TV2A 4C7OA 3K0AA 2C8VA 3ICEA 3K9GA 4JYBA 2V7QA 2HYDA 2PLFA 2F3RA 2VHQA 1P4SA 2WBLC 1WCV1 2ZE7A 4XTRA 4BZXA 4BECA 2WJHA 2IYXA 3PIRA 1QHGA 4H1UA 1OKKA 2OCYC 4K81B 1KMHA 1JQJC 4POAA 4I1OA 4A0RA 3RYTC 2J5XA 2GF9A 4NCKA 3HU3A 2BMEA 1BH2A 4Q01A 3EPLA 4PHHA 1W36B 4MYHA 2QSYA 1XXHE 4HUTA 3VFDA 2HJVA 1ZD8A 4QJ5A 4OHVA 3ZQ6A 1ZUNB 2RKOA 3GFTA 3IBGA 4V02A 1S2MA 2W6JA 2OBNA 3A58B 3MUFA 4P4SB 2WJVA 1SKQA 3U7HB 3WNDA 4B48A 1IXSB 2ZYVX 3H84A 5FTKA 4EPWA 3IKJA 1E2HA 4O0MA 5DN6A 2ZITA 4HDQB 4II7A 5EQTA 1CIPA 2AFHE 3KB2A 5CDFA 4QBFA 4OI0A 2O8BB 2ZVQX 4IDHA 1LS6A 1GTVA 3Q5DA 1DAMA 2RGBA 1P62B 5J4YA 4CVNA 1HQYE 2DWQA 1OFHA 1NF3A 3CF2A 3SQXA 4I4LA 3L0IB 4WBSA 4FWTA 5C18A 1GKIA 3H1TA 5CK4A 4TQUS 2ZIAA 2H1LA 3DMDA 4D6PA 3SJBA 3ZQJA 4OHXA 1CJTC 2PT7A 4JLOA 1Z22A 2HXSA 1OW3B 1DPFA 2OFXA 3R7WB 1CJUC 1W0JD 3A4LA 521PA 1M8PA 3R20A 2NGRA 1G8GA 2QBYA 2XAUA 2ZREA 1P75A 3AVQA 2BOVA 3ZVRA 3VX3A 3IEUA 1KI4A 1OV4A 3P27A 4MDFA 1E6CA 1MO3A 2JLRA 2CHQA 3FMIA 1C1YA 3BK7A 2YC4C 1CKEA 3CKLA 4B75A 4BFWA 3D7MA 3JVUA 3NH9A 3K9NA 1US8A 3B85A 4KAXA 3OIUA 2V6IA 1N6IA 4J0QA 2XITA 2Z43A 3S1AB 4C30A 4JVLA 1Z83A 4DCTA 2KJQA 4TL6A 4KVAA 4IEEA 2GXAA 2P6UA 2QE7D 5J4VA 3THWA 1G17A 5JI3E 1A5TA 4LYJA 2O5VA 1SQ5A 1ZC4A 2BCJQ 1ZW6A 3WRXC 1T5LA 4X8MA 3K8YA 4D2IA 3FYHA 2ORWA 4DLXA 1VCNA 1ZNYA 2O8FA 3EG5A 4E22A 1T4GA 1Z6YA 3Q9LA 1VYVA 2Q9BA 2V54A 1XXHB 2BMFA 1N2CE 2RHMA 3CR7A 5TMPA 1XTRA 1JAHA 2CVFA 1TF5A 3ADKA 4JLJA 1KKLA 3BD9A 3TBKA 1FQKA 4BEBA 3NVAA 3IDQA 5KPJA 2JEOA 3E70C 4E07A 4XJXA 4HZUA 3NBXX 3LWNA 3BE4A 3REGA 3HR8A 2EQBA 4Z1MD 1FX0A 3P32A 4LCBA 3G0HA 1E2PA 1KY2A 1XJCA 2GBLA 2V55B 3KDSE 1XBTA 5FPHA 3SOPA 1JPJA 1KDOA 4TTRA 2GHIA 2BDTA 2LCFA 2IS6A 2FZLA 2BV3A 3K0CC 2ZPTX 2QT1A 4LGMA 4M1KA 3WP0A 3TNFA 1FP6A 4KLZA 2YOHA 1K5GA 5FL7A 3THOA 2A78A 4HI0E 3A6PC 1XD2B 4PC7A 4URXR 2CL7X 2LKDA 2XX3A 3OZXA 2WPDA 4LI0A 4MDEA 1CR0A 2GCNA 3QVUA 3N2IA 3NC0C 3WYAA 4GOXA 3BJIC 1Z8FA 4HB2A 1JAIA 1E4VA 1VYUA 2IL1A 4DCNA 1OB5A 3ZZ0A 1KO1A 3KJIA 3WHLA 1KO8A 2VQSA 3NBZC 3X1DA 2ONKA 4V0KA 1I2MA 1ZM9A 3AF1A 1R4AA 2IA5A 3LDAA 2ZRIA 2C77A 1GRRA 3SYLA 3I92A 3LXRA 4OK6A 1UF9A 3A1WA 3AKYA 3BXZA 5DNYB 3U3MA 1W2HA 2WWFA 3RNLA 5B30A 4D25A 2G1KA 1PV4A 4C0HA 3RRYA 1FNMA 3GLHA 4NYJQ 2HLDA 3Q72A 5JEDA 3AVOA 3UK6A 5A0FA 1ZM4A 2CLCX 1U0LA 2FE4A 4P4UA 3UANA 1L4UA 2PCJA 4JKYA 4YDSA 3L0OA 4C3ZA 2CJWB 2IYRA 3LV8A 1E96A 1ZM2A 3BFVA 4LPSA 4G1UC 1G7RA 1IONA 1KI2A 1HT2E 3EASA 3GJ3A 3GJ0A 1YZUA 1E9CA 5FUWA 1LS1A 1NBMA 2NTYC 2QM7A 1Q12A 5KNDA 1XMVA 2XOKD 3U3KA 1W4CA 4KFTA 5DISB 1JR3D 2F1RA 2ZYWX 3B82A 4GNKA 4LJAA 1ESNA 1NVXQ 3RABA 5CITA 2O8BA 2UZIR 2OLKA 4FWIB 1F5NA 1KO5A 2WWIA 3F5FA 4JLNA 4XWOA 3QXXA 2GK7A 5BQ5A 1HV8A 3Q8XB 4B71A 1Z3IX 2J7KA 4NYIQ 2J45A 5F3WB 2AD1A 1Z0FA 4Z54A 4PHFA 4CGZA 3QUSA 2IW3A 3AVVA 5B58C 3B5JA 4Q1CA 1KI1A 1P60A 3VR6A 1T3HA 2VLIA 2VP0A 1HT1E 2VTKA 4BFTA 3GJ7A 2C99A 1DO2A 3LAWA 3NWJA 1E2DA 2IBMA 4MGYR 2JLYA 3A1SA 2W58A 1C9KA 3TVTA 3VMFA 1KZGB 2CL0X 3WBJA 3EIHA 1EK0A 4PAQA 3KJEA 2ZJZA 3CRQA 2OBLA 4PXAA 4WA7A 4A8JA 2QMOA 4TTPA 3BORA 3T1TA 2PCLA 4BRWA 1W1WA 2A5YB 4OQXA 2QAGC 1HQCA 2VP9A 2N46A 3D31A 4GMDA 4M1WA 4X8OA 2C5LA 3RVBA 5J4HA 4ZCMA 4DCVA 5HPYB 3I1FA 1LF0A 4ON9A 5JI2E 1G64A 4LV8B 2D7CA 1N6NA 4HAWA 3K70C 3I8SA 1E0KA 1LY1A 4GMXA 1MO6A 4HATA 4IVRA 4QXAA 1KI3A 4TN1A 4KHZA 2RB4A 4LC0A 4Q9LA 3VR4A 4B74A 3IPYA 5CK5A 2P5SA 1AIPA 2V6JA 4LHZA 3RLFA 3I5YA 1JR3A 2HCJB 2GJ8A 5AJVB 3VU9A 4XWKA 2ZXUA 3VU9B 3AP2A 3OAAD 2QN6A 1T3SA 4ZV4A 1NBMD 4ARZA 5B57C 1KJZA 1RJ9A 4MUBA 1G291 5G40A 5C46F 5CB8A 3GEHA 2ZETA 4CDGA 1JR6A 2RGEA 2R65A 5B2ZA 1GL7A 4DEYA 1WA5A 1KAOA 2F55A 2B92A 3UWKA 2CCJA 4GSYA 4KLNA 3GLFE 1FMJA 4DEXA 5ANRB 5BN4A 2B21A 3MG9A 1KIMA 3QQ5A 3U44B 3LH5A 4UNNA 2GJSA 4I99A 3W5IA 2W0SA 5FBVB 1VG1A 4P4SA 1G6HA 3RS3A 1XWIA 1X1SA 3RRNA 4DCSA 1XTJA 2L0XA 2WIAA 4FMBB 5BW8A 5HZKA 3FKQA 1SXJE 4RD3A 4BEJA 2JJ1A 2CHVA 2Q9CA 3B78A 3ZVNA 4CRWB 2N1BA 1GKYA 2A2ZA 4Q9HA 4DIDA 8OHMA 1R0ZA 3SZRA 2GXSA 3SI7A 1ZU5A 5KYKA 1EX6A 3GD7A 1YRBA 1Z08A 2ZUBA 3CNOA 5L3SA 2GZAA 1TF7A 3AVTA 4XIGS 2X2EA 1JI0A 1G21E 4DB2A 2C9CA 4QJ4A 2WAYA 2NMVA 1E98A 2D06A 3PCRB 4LYAA 5DO9A 3OIVA 2AXPA 4RD0A 1KSGA 4ZDJA 4RFSA 5IDVA 2VRWA 3I4LA 1S9HA 1D9XA 3I8XA 2QUZA 1B23P 3OEHD 5CJPA 2F9LA 4C0LA 5E3HA 1N0WA 4LK2A 1GFIA 3IHLA 2CLSA 3GPLA 1RYFA 3JZMA 3TH5A 3B1VA 3RS4A 1T0JB 3CPJB 4D0GA 4AYTA 3GMTA 4OHZA 3QXJA 4L5BA 5CYPA 2ORIA 4LZZA 1N6PA 4V0MA 2ZS7A 4WZ6A 3SDZA 4XTCS 2NG1A 3GLIA 2IEYA 1SVMA 2R6DA 5E4FA 3T35A 4EPVA 2P6NA 1GRNA 2O52A 5LB2A 2YWFA 1J2JA 1YR6A 1D2EA 4PPGA 3W6OA 1YE8A 1PLJA 2CLDX 4WZBE 2G9NA 2AKYA 3AQ4A 3CONA 5FPTA 1P2TA 4M1MA 3WXMA 3BERA 1R2QA 4TMWA 1ZD1A 4UXHA 5D3MB 4ZCLA 1T6NA 3SN6A 1FFHA 2RHDA 2C9YA 5DI3A 1GNPA 2I4IA 5JCPA 4QGHA 2G0NA 4JLMA 1NVUQ 3GQBA 3QF7A 4NYMR 5DE3A 2IT1A 4NU0A 1ZD9A 4X8LA 5K8LA 1FTSA 3LX5A 5BN3A 1F2UA 3N2EA 2BC9A 4B3GA 5F9HA 4ZDKA 5IRCD 4DZZA 2ZTSA 3ND9A 4IDNA 2C04A 2AR7A 2DY1A 1TF2A 1G1MA 2HXYA 1UM8A 1U9IA 1HH4A 2IHYA 1RZ3A 3IUYA 1NVWQ 1BMFD 1FX0B 3RHFA 5JS7A 4IEIA 4Z8XA 4W7SA 3C5CA 2Y8EA 1N6OA 2IF0A 2FG5A 2GTPA 3UXMA 2WVJA 3VNUA 2FF7A 2YWEA 2H16A 3T06B 1N0UA 3PEUA 2KBEA 5LBIA 2WV9A 4ZCIA 1XPOA 1WMSA 3CRW1 2GESA 1W0JA 2BKUA 4NYIR 2VSFA 2OCBA 5FBWB 3BB3A 5A4JA 5EE9A 1DG3A 3Q7QA 2G1JA 1QG4A 3QPWA 2GXUA 3QENA 5BWMA 4C0KA 2EWVA 5DHAA 2P5TB 3AUXA 1DAKA 1E9EA 1Q3TA 4JZKA 2IXGA 2F9MA 5J4LA 4RVCA 2QRZA 1S4QA 1M2OB 4CEIA 1FZQA 621PA 5CM8B 1E9SA 1HA3A 1XEXA 4WIAA 4MQBA 3GLGB 1NP6A 1XEFA 4BPBA 1J8MF 1DG1G 1SULA 2ZE8A 4B2LA 4DCUA 1E2QA 1NSFA 1UADA 3W6NA 3WY9A 3HPQA 1W48A 3HDTA 4W5WA 4PSAA 2ANBA 1W0KD 4YMSA 4US2R 4YMWA 1WBDA 3KZ1E 2YVUA 5M04A 4MKHA 2W6JD 1QZXA 2ZJAA 2ZE5A 5KSOA 1VDZA 5KDDA 5HKKD 2J41A 1QVRA 1QDEA 2A3RA 2VP4A 4NBSA 4A9AA 2FGJA 5FOWA 4IXNA 4RD6A 4LJ4A 3KJGA 2AFIE 2GA8A 4EPYA 2JLQA 3NEYA 4AKHA 1ANKA 1G4UR 1F2TA 4DRZA 4KVGA 3IBYA 2W2VA 3CRMA 2FPKA 3HWSA 2OE2A 4TLBA 2ZJ8A 4W5JA 4QGFA 2J0UA 1NY6A 1YVDA 2ZJOA 3QIAA 4YLGA 5D3QA 2ZI6A 3GLFB 1J90A 4ZIRB 4O25A 1ZVQA 3QJYA 1YZQA 4NCNA 4ZIRA 1ZAKA 3KKPA 2QTVB 5L3RA 1ETUA 2F43A 1F60A 3AVPA 2VA8A 5K8TA 1P9RA 4F91B 4R2HA 5FI0B 1IN4A 3G5UA 1L8QA 3FKSA 1KDPA 3K70B 5KSPA 1VG0B 5L3QA 5FTMA 1XMIA 2FFQA 3ZH9B 5LB4A 4FINA 1HE8B 2REXB 3J81k 2IXEA 1UEJA 3ZDQA 3CX7A 4US1R 5SZKB 1W4RA 3KJHA 3IGFA 1UKZA 1QHYA 2VL7A 1MABB 3BFXA 4DLSA 1KKMA 2HT1A 1KMHB 1PUIA 1Q20A 3Q5EA 5JMTA 1U8ZA 1OXUA 1R7RA 3CRRA 4DBLC 4YMUA 4A2PA 4PPQA 1Q0UA 4ZKEA 1G5TA 1G7TA 4Q66C 1CRPA 1B0UA 5C4MA 1GNQA 3P4XA 3MAAC 2IC5A 4V0NA 1Z0AA 3L43A 4N0EA 3MD0A 4KXFB 1GVNB 5JECA 3DOEA 4M1OA 4NONA 1KNQA 2JASA 4D82A 3CWQA 2R8RA 4AK9A 4MGKR 4BLTA 1RVDA 1JJ7A 3QI2A 2O8CB 3EPHA 2RCNA 2XEXA 3AVUA 5DSZA 1G3QA 4KODA 2QE7A 5FUYA 4GZMA 821PA 1N6RA 2I3BA 1U90A 2WZQA 5K8IA 2F1JA 3BH0A 1E2NA 2MMCA 3DHWC 3EZFA 1U99A 4U02A 2R9VA 3A36A 1GP2A 5CIWA 2NPFA 1GG2A 1II9A 2XTNA 1GL9B 1TPZA 2GK6A 5FBLB 1NVVQ 1KI9A 5FOXA 1M7GA 2A5FA 2A9KA 3PV0A 4MKFA 3OFND 3R7WA 3SS8A 3NEJA 1NJGA 1SXJD 5HCIA 4ASUD 4EPTA 1AZSC 1NN0A 4P31A 1K6MA 5FUXA 3I62A 2C96A 3D8BA 1XTQA 1VYTA 2H5EA 4DT1B 1AQUA 4QGAA 2C98A 2OZEA 4ERNA 1YRAA 5IK2A 2KBFA 2J3EA 4G5QA 2BM0A 4BLOA 2BEJA 2H17A 4B3BA 3IQXA 1UBFA 2JIZD 1Z0DA 3KTAB 1YR9A 4R9UC 2CJWA 5JSZB 2ODBA 3N70A 4MGIR 4H9GA 5IF9A 1CXZA 2PJZA 3JVVA 4Q4LA 1YHNA 2BHRA 4PHTA 2CE2X 4DLWA 2G83A 5FBQB 3ZIAD 2WWGA 2XJ4A 4RFVA 1NMZA 2WJGA 3BOSA 1CJKC 3B1WA 5F98A 2Q6TA 4CEIB 4PC6A 1E32A 1GAJA 1DBSA 2OXCA 3SJZA 1GSIA 1AA9A 4IOJA 3SFZA 3VR2A 5GJCA 1N5KA 2PEYA 2JJ8A 1UBEA 1HUQA 4HLUC 1NLFA 4TMKA 3KQNA 2X2FA 4MH0R 3WYGA 3CWZA 3IHWA 1EESA 5FPKA 2OEPA 3FPAA 3L2OB 3T61A 2BBTA 4HB0A 4K8OA 3U3OA 2GF0A 1T8TA 2R6FA 4XSHA 4E5UA 2EFHB 4A36A 4G01B 4G3XA 4PZZA 5FOTA 3KQHA 2WKRA 2VSXA 3RS7A 5AJYA 1AKEA 3B9PA 4AKGA 4HLUA 1HEIA 4D4KA 1VG9B 1E1RD 3CO5A 4X8HA 3VHXA 4DLTA 1KHTA 3GCGA 2GWHA 3SR0A 4KCGA 2ATXA 5BYKA 2KE5A 2JDIA 3W6PA 1G8FA 4TYNA 1WB9A 1E2IA 2ZRHA 2OFOA 1ZP6A 3NDPA 1MO4A 4XD7D 1N5IA 1OT3A 2JATA 1TL7C 1XP8A 2WKQA 3SE0A 1I2DA 1SVIA 4LJ6A 5GVRA 4ESHA 4TLDA 4DWJA 4L9WA 2GVDC 4R2IA 1JPNA 4PC1A 4XWAA 1CU1A 3BB4A 4NTZA 3PEYA 4QG7A 3THWB 3DPUA 2RGXA 3K0FB 4Q1EA 3EW9A 1OF1A 2O8DA 4LBZA 2AWNA 5LDDC 4R7ZA 3A1UA 1W36D 4WVFA 4OK5A 1DE0A 1G8PA 4WOPA 3VTKA 1U81A 3RDPA 1E2LA 5DIFA 4C7OB 1FW6A 3QBTA 4Y0AA 5HTKA 1ZMXA 1NSTA 4KYIB 1COWA 3CW2A 4HB4A 4JL6A 4AG5A 4GP6A 1AS3A 1JQLB 3FHOA 3OIYA 1YR7A 5AJWA 3P1JA 1G6OA 3MMPA 3C15C 4YC7A 1M6NA 2ZRPA 3M4YA 3QF4A 1G16A 3QPUA 5EE1A 4AKIA 1RIFA 4RCZA 1JB1A 1P2SA 3TR5A 1OXSC 2W2XA 3MGCA 1O3YA 3KX2A 3DO6A 4NCHA 4CT5A 1VECA 3QXHA 5EZ5A 2V8OA 2HT6A 4QHTA 1ZUIA 2IXFA 2WMOB 3M0EA 4BFYA 4TZ0A 4A4DA 2FN4A 4FD2A 3LXXA 1NMXA 4NCJA 2GCPA 3CX8A 3LNCA 4JSYA 1BIFA 1ESMA 1G41A 1P2UA 1KO4A 1I4LD 2QU8A 2FSHA 3S1AA 1UFQA 3B13B 4MKGA 4ZI3A 2B7CA 2XOKA 4AD8A 4CEHA 3CX6A 4MRRA 1VCMA 3L0SA 4IOMA 5FI1B 2E1RA 3LLMA 4AWXA 4D80A 3T34A 4KYUA 1E9RA 4TMZA 2FNAA 4MITA 4RD4A 2YJTD 2IF2A 4F4IA 3D6TB 2XXAA 2VYFA 3UMSA 2CCKA 1OIXA 4LHVA 1OFUX 3PUXA 2XXAB 1EG7A 3HU1A 4IDPA 5FR1A 1II8B 4MRSA 5TB5A 4HDCA 1ZRHA 4I1UA 4NHOA 4OI4A 2O0KA 4CIDA 3UMFA 4QRHA 5DH9A 2HLDD 1U0JA 5ELXA 1KI6A 3H86A 1GUAA 1CRQA 5JRJA 3U4QB 1WBBA 1EFRD 4EFNA 1PLLA 4C0JA 3Q85A 3PVSA 3B8HA 4B32A 4KSCA 3T1OA 2GEDA 5G41A 2QP9X 5IT5A 3CPHA 3MJRA 2QNRA 2DFKB 1Z06A 3C16C 4DUGA 2HDNB 2OAQ1 3UMRA 3BH6A 3HYRA 2J46A 1M74A 4D4JA 2OT3B 2DB3A 1H8EA 3WMEA 4K46A 4TL9A 421PA 2F3TA 3PENA 4B6EA 4URZR 2YHSA 2PZEA 3X1XA 3VAAA 1QVAA 4FXPA 2FA9A 4GRAA 4OQLA 3C7KA 1ZIOA 2XB4A 2A30A 2VH5R 4YXWD 1XFAA 3VKWA 2BBWA 1P6XA 4B2PA 4KBGA 3LQQA 1A4RA 3GEEA 4PSVA 3U60B 4NH0A 4NYMQ 2XZOA 1OLOA 2ZYUX 4IFBA 3BFKA 2GVZC 4OK3A 1EFUA 2BKEA 1GOTA 2CXXA 4QFMA 4JVNA 1G9XA 5JHHB 1OH8A 3MWKA 1WQ1R 3NDBB 1OHHA 1S3SA 2WJYA 1KI6B 5AUNB 1CEEA 3QVVA 5C2JB 3WMGA 5H8WA 2GNOA 2GJAA 2PMDA 2J87A 1FP7A 2I1QA 2G6BA 2OHFA 4FMCB 3CB4A 4AYXA 2ZJ5A 3NHBA 1E0JA 4JIMA 4M9QA 2QMEA 2Z4RA 3AV0B 4URYR 3ZS9A 3MCAA 3OE7D 3EC2A 3GJ6A 1GM5A 3SU8A 3B1XA 4C9BA 1CTQA 3CZPA 3MWYW 1SVLA 4A8JC 2WKPA 2X19A 4QNRA 1RRGA 4Q1AA 4BRUA 2BEKA 2OBMA 3THYA 1KJWA 2F6RA 3FKSD 4GP7A 3TIFA 4LJYA 2WM9B 4XSGA 3TKLA 4M9XA 3QY0A 2IYVA 2KWIA 4LRWA 1IY2A 1E9FA 4BFUA 3DM9B 3I3SR 1A82A 3KUDA 2ZQ5A 2ZRGA 1E94E 2EYUA 4A82A 4GL2A 1P2VA 4PZLA 2EYQA 3RS2A 4DIEA 1Z2CA 2ERYA 2QG6A 4A2WA 1DAFA 1G18A 5LD2C 1HE1C 1GZSA 4IKEA 4DJTA 3B6EA 1TUEA 3W3AA 4LHWA 4TMVA 3SBDA 2OCAA 4LJ7A 3NHAA 5EXXA 3R8CA 2V3CC 3OF5A 3ZLJA 4ESVA 4V0OA 4LSGA 3W34A 4EQ6A 1N6LA 5EE5B 1VHLA 3BH7A 3TUZC 1RJ9B 1JR3E 2WHXA 2O0HA 1W44A 2RGNC 1P7CA
chains in the Genus database with same CATH superfamily
1V11A 1XMSA 1ZXXA 3LQ2A 4E1BA 4F8EA 1R6BX 4EYKA 2VH1A 1M2VB 4ZT2A 2PUBA 4RH1A 3GMIA 4GPTA 4OMUA 4EA8A 1PU2A 2HNKA 1CY2A 1ZLXA 2E89A 2NW6A 2AFRA 3HYTA 3H11A 3WMWA 4N7BA 5BMVF 3C85A 2PGJA 2W00A 3AEYA 3Q2KA 4K0RA 3WMFA 1CY4A 2ZRLA 4PZDA 3U4DA 1E79A 4ZI7F 5FYDA 5KQRA 3R1IA 2CVHA 4B31A 3B3QA 1U11A 1FTNA 1B43A 5DFAA 1KSHA 2YOGA 3A0RB 4DKXA 1KZ4A 3FDFA 5JS8A 3GB9A 3M3PA 3GRUA 4EGFA 2QIPA 3GBPA 4W9RA 1VDMA 3FH0A 5JAHA 3DOJA 2ZJ3A 2CNDA 3PNBA 1NA5A 4UNSA 3GVXA 3EWIA 3FWHA 3JY6A 3KZVA 2GLTA 4TTTS 4J4BA 4BVBA 3GUVA 4X6UA 3ORQA 3M34A 3WGZA 4GPIB 3TD2A 2ONZA 5CLLA 3DZJA 1D4ZA 1TQHA 1JIIA 4LHYA 5J1SB 2LTAA 2Q5JA 4UXIA 2O8EA 3HDJA 4O63O 1RJDA 9ABPA 1I80A 8LDHA 1F6BA 3F97A 2ZSUA 2J9ZB 1WPQA 4HTAA 2OWEA 1XDDA 2VA9A 2YDXA 4X41A 4CCYA 3HCWA 3QOXA 1DADA 4CCYB 2WNHA 3CTPA 3D7LA 1D09A 3N2KA 1CVLA 4RA6A 4UNQA 3ZH2A 3VNQA 1CUSA 2VQFB 1GAWA 1HFJA 1TAQA 2FRVA 1EINA 1PDWA 2GPJA 2V7QD 4HZGA 4Q7EA 4BMXA 4IFTA 5CIQA 1JG3A 4PSCA 1H9BA 1ZK2A 5AJHA 3VR4D 3W05A 1ZA2A 1T8UA 4F5YA 1GZ7A 1Y7TA 1BCRA 3SKYA 3UY4A 1RI2A 4X1YB 2JGAA 5T41A 1IPHA 1UEIA 4X1YA 1QYIA 3QVOA 1UFKA 4KFRA 3RD5A 2JGFA 2WUWE 4WGGA 2C31A 5C51B 2C1ZA 3MWJA 3DQPA 4AJPA 1OH6A 4XEHA 2YJ5A 2AMYA 4YMTA 3L6CA 3F9IA 2LP4Y 4XM2A 3HKCA 1LSJA 1UJ6A 4RZQA 2Z8YA 5LUBA 1J42A 3U7QB 2J8ZA 2CV2A 1ZEJA 3BWMA 4XLTA 2VNKA 4KDEA 2OFWA 3L82B 2H85A 2CFCA 2HBZA 2P2NA 3ONDA 2AKEA 1UBGA 2AG8A 3NANA 2MIIA 1NBHA 4FSHA 3B5EA 2EARA 4K2HA 3ZCVA 2JJMA 3OZGA 1CUEA 4X1IB 3W5VA 1VPWA 2WWYA 3A25A 5DM2A 3ZCXA 2OQIA 4AIRA 4JJZA 4LF8B 4A8TA 3WZMA 3SX2A 4AJ4A 3ZD6A 2A58A 3HN6A 1EVKA 5LA6B 3S99A 2UXCB 2GZDA 4TKVB 1HNWB 4HDAA 5TPWA 1N7HA 3PUWA 2JFNA 4AZSA 1XNRB 5IDXA 1H9AA 2XNJA 2FOLA 2J7PA 3PLNA 4ZN6A 2X5KO 4LNAA 2D0OB 1F9AA 1U63A 4GOJA 3WISA 3W5BA 3H04A 1YB7A 2C9OA 4FFNA 4KGDA 1KOFA 4D9IA 1JPVA 2DFNA 5CT9A 1CUIA 2B0JA 5AW7A 4WCFA 1YBAA 1DJOA 3BXGA 3OQPA 5LLSA 4ZAWA 1GTJ1 1XTKA 2JCGA 4UUAA 3LVRE 1JJIA 2O3RA 3I45A 1MH9A 4WKGA 2QTZA 3L7KA 3EN0A 2NV2B 3GRFA 1OLUB 3IUQA 4DC9A 3BZBA 5DLYA 1Y89A 3BL5A 1W8IA 1MW9X 3PA8A 2QQ0A 2Z56A 3PXAA 4MW4A 4Q7JB 4GGOA 2IOFA 3NIBA 4D26A 3GK3A 4X6LA 1CJCA 4ANFA 1RW4A 4D9FA 2GBFA 3M6FA 1F4VA 1W49A 1EBUA 5ALOA 4ZZ2A 1PJ3A 4TYYA 2XZDA 3WQSB 2SKEA 3A3YA 1BGXT 1Q3HA 2Q1WA 2YFKA 4WFIA 3VAZA 4EQZA 1NI3A 5KKAA 4DL9A 3AVXA 1KK3A 2JIPA 2QPOA 4RMJA 3SC2A 1PZMA 5LXTB 5LMUB 1UKYA 3PTLA 1I1NA 4FCVA 1H93A 4QLBA 4QT4A 1V1RA 2Y1XA 5AP9A 3BTOA 2FFJA 1ACJA 2VPXA 3MWFA 4XKJA 2IDKA 3CC8A 1T6BY 4MWCA 1S8OA 5BOSB 1JA0A 1RWKA 1WSDA 5G3YA 4B47A 1KGDA 1UPBA 1NUSA 4RH3A 4K28A 2RGGA 4C87A 4B4WA 4ETIA 5HKKA 4Y2RA 2WA2A 2Y3IA 5I9NA 2WWTA 3PJEA 4LZWA 3OM1A 1IHPA 1NULA 2E7ZA 4GZ5A 4J75A 1QLJA 1YHYA 1IN6A 4REOA 1IM2A 5KYUA 2OUKA 1KU0A 2Y1EA 1H69A 2WNIA 1IY9A 4UCFA 4UOZA 3ZEIA 3QF4B 5D86A 1E2MA 1XRSB 3MS2A 3OPXA 3ACBA 1ZO8A 1EYZA 3LK6A 1XYYA 2NU8B 4GRDA 1EUQA 4FN4A 4RXUA 3AM5A 4FLEA 3AG5A 3UJPA 4JSTA 1L1RA 3HHPA 4RGQA 1RRFA 1LBSA 2Z3VA 3URKA 1K8XB 1E3MA 4DC0A 2ZJ6A 3OQBA 2X1HA 1RKBA 2FMFA 5CCDA 4YRBA 1E2KA 3T7EA 4EUNA 2G77B 3PR1A 4LYHA 1GL6A 3ZWMA 5EJ5A 4G8DA 2QUIA 1VIAA 1YZNA 3WYBA 4ZICA 2AHOA 2HKIA 3CR8A 4LWOA 1QGOA 4OKNA 2QRNA 4QQKA 3OU7A 4P4NA 4CKEA 3E22A 3O1HB 4CKEB 2HK8A 1G6Q1 4UEQA 3R2JA 4UVHA 1C9DB 3ZK8A 3N1UA 4Q4AB 3UBTA 4LDPA 2VPPA 1X8JA 1XMQB 1VYHA 4EX7A 3KQYA 5CMLA 4EDFA 2BWJA 2UUBB 2GM5A 4ZVKA 5I9SA 2XGOA 5FV7A 3O95A 4NMXB 1YHZA 3NHZA 3EXFB 1Z6XA 2F43B 2OBYA 2BJVA 5J2TB 5FOUA 1W85B 5T4HA 5DF1A 3M4JA 4ZO4A 2LBPA 1U3CA 2Q45A 2Y1DA 4P7JA 2AGVA 1FFYA 3ETEA 3OIGA 2CFOA 5EWLA 3EBPA 5FJIA 3V4RA 2YTZA 3DE2X 3GH3A 3CPEA 4HEHA 3WIUA 1E7RA 1WULS 2EKPA 2AYXA 1PJSA 4RYDA 2VQ6A 1C0EA 2XBUA 4ZHQA 2Y9MB 4YMLA 2XCQA 1WD7A 1SCUB 4IEFB 3IP3A 1VL8A 4J49A 3G88A 1JFVA 3KPJA 4U7DA 1RQLA 1SCUA 3FHLA 1G20E 1LLQA 3IJRA 2JHFA 3G0DA 5F52A 4CMCA 2G5GX 3J81A 4X66B 1IFXA 1L3BA 2PV7A 2RE8A 1KSFX 2Y0BA 4TXNA 3AR7A 2A14A 5FEUA 3IDSA 4EHHA 3PPWA 4CETA 1N9GA 2AVDA 4BRSA 4ZXFA 3S2SA 3O2QB 1RBMA 1IDOA 2JD2A 3ZV4A 1H2ZA 1C3OB 2VI5A 3I5MA 1KA9H 1Z4MA 4BFSA 1JEQA 4IG4A 2FRDA 1EX1A 4ISBA 2R751 1PYGA 3CIOA 3RUIA 3WGVA 1JIVA 4CMGA 3CBQA 5KC9A 5KUTA 2VHTA 1VL6A 3WMXA 1FU4A 4A7PA 1GRCA 1UPXA 2D1FA 1E6WA 3K9BA 1T13A 1UODA 3NTXA 4DDUA 2LVBA 3A6ZA 5LQCA 3VJRA 1FPQA 1X7YB 3AF4A 3U7GA 4UCWA 4O1HA 1Y9ZA 3DLCA 3STWA 4N41A 3JARB 1OWOA 3OLYA 1KTVA 5HFJA 4B33A 1X8LA 3U0BA 2WWVD 4GIBA 1I7DA 4U7TB 1N2OA 1QG6A 1O57A 4D5GA 3TAUA 4WZBA 1ECPA 4IMRA 3TZLA 3OQHA 1VLQA 3WL3A 1Z26A 3NBFA 4UHFA 1Z4KA 1VGRA 2Z0MA 3DH0A 5ERYA 1U5AA 1ILWA 4N3BA 4Q05A 4R9NA 1T36A 3E5NA 4RSMA 1A2QA 4WCDA 3SHFA 1CUJA 2YC2C 1Z16A 5TNXA 1Q0TA 2XOEA 2WWXA 3NBAA 1YACA 1HT0A 3KKMA 3S2YA 4L5CA 2Y4NA 3TMKA 4F38A 1RWXA 4KMRA 4J7AA 1JMKC 4L8WB 2ZAOA 2FRDC 3ABIA 4RKRA 5BORA 1N2HA 4OSOA 1JDBC 1ZKMA 2VJKA 3P2JA 5E9JA 1BS9A 1RT9A 3MWEB 2GAJA 3CCFA 3GJ5A 3KWMA 2ZYHA 3W8RA 4YT4A 4MVJD 3GJXC 2R1VA 3HBMA 1DTWA 2C57A 2J6HA 3TW8B 3VDNB 1U9IC 3OOJA 5U4QA 1OH5A 3E23A 1W7AA 2YFYA 3K9CA 1FDSA 2WLTA 4P3NA 2RMKA 3V8EA 4ZTBA 1U7ZA 3G23A 3IAS1 3CSUA 3KWJA 5FF9A 5FO1A 3S27A 3KUXA 1W6UA 1XRLA 2ZI9A 2OD9A 3S44A 1VCIA 5SV2A 3ED5A 2EVWX 1CR1A 1UJ5A 1JX6A 2BR5A 1XDGA 2BY4A 3HSYA 1VP9A 3ND6A 4BNUA 4ZYLA 3IE0A 3FI9A 3MT8A 2RHGB 3GRKA 1LQ2A 5LMZA 5EKUA 2FN9A 3LCUA 5K8UA 3NW9A 4GVPA 1MFZA 2R3SA 3AIMA 4KC0A 1XLTA 3O1LA 4JBHA 3GT0A 2A0KA 1QVVA 3B9QA 1WZEA 5EIWA 2X8JA 3FYUC 3OUTA 1IVSA 5CB4A 1ONOA 2NUBA 4QQRA 2AC7A 1IM8A 1TK2A 4OGWA 4E2XA 3EZ9A 3RVSA 4ARZB 2LRHA 4FNGA 2RGAA 1SG9A 4MINA 3OHMA 1T4CA 3EVZA 3IIEA 4NE7A 4LC1A 2YH2A 2XLCA 4RANA 3TDKA 3VH3A 4AYWA 3E9CA 4BQPA 1FS4A 2ZM6B 3W5AA 1FE8A 3UJHA 1H2AS 4CLEA 2G17A 3FSJX 3IHTA 3I28A 4N65A 4OATA 4BKQA 3BWCA 2GZMA 4FKBA 5EJFA 4XIFA 1PVOA 1WEHA 4CG2A 3MRSA 1OIVA 1R4MA 4NU8X 5CM9C 3ZGXA 2OECA 2QR3A 3UV7A 4R98A 4GMKA 1RRCA 3SVLA 1G21B 2P2GA 1LTHR 4GICA 3P94A 1EHCA 2JI4A 3IMKA 1WKVA 1IY1A 2CNWD 4YWHA 4ALIA 3ETGA 4DCMA 5I4IA 2N42A 4Z0NA 3RRXA 3HLYA 3G82C 2LD4A 1MEOA 2W4IA 1MP0A 2C54A 2XYQA 3HYLA 4QE3A 2I2DA 3H2YA 3KB1A 2NXJA 4ZZ1A 5FBRB 5ENZA 4GZ3A 4JQYA 4P98A 5CG2A 1TAGA 3ON5A 1G3UA 3X2SA 4EL0A 4C3OB 4YPFA 5FNVF 5DYTA 5LA6F 3W5DA 1QM5A 5JH7B 1H0RA 5EHNA 5AWFC 4IAOA 2JEZA 3HI6A 4Q39A 4ZHQF 1DXQA 2P9TA 2PO7A 3ZHSA 3GP8A 1Z0SA 2EL7A 1LDBA 3M8KA 2JH9A 1Z68A 4F4UA 1L3CA 4IM7A 3AR3A 3IA2A 1WABA 1FB5A 1VA4A 1IZ0A 3BMQA 3EVDA 4GXNA 4NS4A 4PC2A 4R1TA 4BMVA 1SBYA 1LFDB 4HDMB 5LL6P 3F3SA 5LM3A 4LDJA 5A1TA 1DHTA 2ZI4A 3G5LA 1XQWA 1WXHA 1BG6A 2IOYA 5FI5A 1W5TA 1JHYA 4F9FA 4OX9B 2UVQA 3KZXA 3WICA 3D6AA 1B3RA 4BJ3A 2P2SA 1BDJA 4HSGA 1FJ2A 3OX1A 4H77A 2NO9A 1JFTA 3DYVA 4LWQA 4GFDA 2PJRA 2A9QA 3FRIA 1UJ2A 2CMGA 4Y67A 1X3LA 1W94A 2Q0QA 1C1DB 4IFEA 2JAHA 1JJFA 2JZNA 1X87A 4F21A 1EFKA 1EDBA 1JUDA 1TDJA 4O0LA 1GAEO 2JI7A 1PHRA 4Z7JA 2F4VB 1QIIA 3LP5A 3LRPA 1YCHA 4R8LA 4U6QA 3EWNA 3EAQA 3SWWA 4NZZA 2PGXA 4YMVA 2IHVA 3BMCB 1E3WA 2QRPA 2YXEA 3R9IA 3TGLA 1R66A 2WI8A 4ETNA 3R4VA 2FZWA 4JJ4A 4FDUA 4O2LA 1TTQB 3RFVA 4OGGA 2FKNA 4PICA 1AD2A 1O9BA 2IDMA 4PPYA 4DXDA 4KXMA 4BYGA 1E3TA 2QL6A 1HXHA 2PX2A 5GJVC 5CXXA 1LNZA 4I9UA 1XPUA 2R79A 3DL0A 5DNWA 2HQSA 2FFAA 3NYIA 3ZHUA 2BZ1A 3D5EA 1O77A 3VX4A 3MYRA 2ZB7A 3HZHA 1XJ5A 4MUHA 1QC5B 1PJLA 3ZJYA 4KBYA 2PAAA 1OR8A 1SCQA 1MRNA 1ZJZA 2XGSA 3JWPA 5KSZA 1BZYA 2FPGB 4PR0A 1DGQA 2M6LA 2NIPA 2ZLBA 4RVDA 1UM9B 3HGTA 2AUMA 2EDCA 4UBOA 4QXMA 4LZPA 4Q12A 1D9ZA 1Q1QA 1T4BA 3D4OA 4X71A 3GNTA 4CFYA 4FFBA 1XKTA 2BIFA 1GYPA 3L0PA 2JIZA 2QKYA 4TS9A 1HG1A 1EK6A 2YZ2A 3AU9A 4X95A 1TX4B 2E4VA 1N3IA 2ZT8A 4PONA 2Y92A 3D6HA 4B44A 3LBHA 3KWFA 4H6PA 2BN4A 1SGWA 1XZPA 3RG8A 4BN4A 1AQYA 2R00A 4KXXA 3ICQB 1IEWA 1U0OC 3DBVO 1Q17A 3IC5A 4MSUA 1VCOA 5CEEA 1RXWA 1E5DA 2K87A 4IX9A 5L4LA 3OFNA 1EDOA 5K45A 1KE1A 3ZE7A 4PO1A 1JNXX 3DEIA 3T9CA 4XR9A 3G9UA 1QBGA 3EZYA 4MEAA 1A7KA 1B16A 2J7PD 3OCZA 2VYQA 3H5AA 3N7TA 4LMRA 4Y30A 2ZOSA 5BSTA 3OCXA 1DIOB 1YUNA 1KNXA 3KDPA 3UH1A 2YWXA 4N6NA 3PHCA 2IZ7A 3AHDA 3E61A 4HAUA 4U2FA 5D84A 4BP3A 4F8JA 4ER3A 5BWCA 1H0KA 1EVYA 3A9VA 3PDWA 1CEYA 4N82A 4R9SA 2QROA 4L57A 4NOKA 4Q9IA 3VHRA 4TZTA 3IDAA 4D81A 5I45A 2RSLA 4E33A 3R24A 1U9YA 4XDHA 1Q0RA 2WF9A 1P7PA 1T25A 1QONA 5KYWA 4JITA 4V3BA 3KP1A 1GTZA 4MRNA 1YJ5A 2AXNA 3AHHA 4X1IA 4O2BB 4BKRA 5ILGA 4F5WA 5B7PA 3OG9A 4U7WA 4Q5IA 2QN1A 4ZU1X 5T6MA 4Y6PA 2H2GA 3TLXA 3BX1A 4CKCA 3VBEA 1KYQA 2W2TA 4X3PA 4EI9A 1GPH1 4NY1A 3C3XA 3AR5A 1TEVA 4KI7A 4YDHB 3TKAA 2GRJA 3DULA 5MFPA 2Q1XA 1NBME 3Q98A 3IS3A 4HEJA 3KG2A 4IZHA 2VBFA 3FZEA 3QTBA 2P41A 2R85A 4NJMB 1LI4A 1QGUB 1XUOA 4XGIA 10MHA 1NI4B 2JEYA 3CLTC 4BP8A 3GLHB 3O75A 3RRMA 2O0MA 4ZOQI 3TK1A 4B3FX 1LRJA 2PRJA 1KVQA 2YCLA 5H82A 1QQBA 2W6ID 2HDHA 3WK5A 3NAMA 4FXOA 3U4QA 4EGCB 2AD5A 1E6UA 2ODNA 3GEIA 3CY6A 2VZLA 1YZKA 3HABA 3JZIA 1KVTA 1CUYA 2YQZA 1KVUA 2A7QA 1IJKA 1CFJA 2H5IA 1GIAA 2O1SA 2YOFA 3OU6A 5FOVA 3ZTYA 4CIVA 3T1YB 2IW1A 1IPFA 1OFTA 4ZAYA 4FD3A 1M75A 3R3UA 3G5AA 4JEMA 3EXG2 4TSFD 4BO4A 1NYLA 4LVCA 4DLZA 3E9RA 2W0MA 5KNLA 1MQAA 4NCAA 4MYCA 3JYLA 2CLOB 1VGQA 4GPD1 5AVOA 1C4OA 4CM8B 1D7OA 1LDMA 2OAGA 4Y2JA 1PDVA 4QNMA 1DKPA 1UOOA 4IFIA 1WNTA 1NNEA 2I55A 3JAKB 4KFUA 3PLAE 1BVRA 2CDRA 4NJEA 1C7ZA 2IRWA 3W4KA 4ABYA 1N2SA 3S7TA 4HXYA 4IF4A 1BFKA 1G2QA 2Y76A 3KPUA 2MOKA 5DI3B 4TUYA 2QA5A 1L5WA 4CG1A 4CMAA 1ODLA 5A7GA 5A7HA 1DB3A 5C31A 2XVXA 3D8TA 2IPXA 4N1AA 5CVCA 1AXGA 3V00A 3S28A 5FUVA 4EKNB 4KR3A 2BFCB 4BFZA 4BO6A 1NY5A 3ZHZA 5MFZA 4M1EA 1OPXA 3CWCA 4HNSA 2BONA 3ADCA 2BHTA 2TSYB 2ZKIA 5EMLA 3SHTA 5KI6A 2ZPUA 3HB4X 1NNI1 2PR2A 3KQWA 4XVQA 3T6KA 3V4LA 5J58A 2UXBB 4M86A 2WMNB 5LUAA 1Z47A 4HY3A 4RZSA 2VNJA 4UPEA 4XOUA 4WINA 2PLWA 4C3UA 3ICVA 1R8SA 5DOZA 3TOXA 4RY8A 2OC4A 5IJZA 2UAGA 1RZUA 2EXXA 4IIJB 4DJJA 3DMFA 1DKNA 4IIJF 4OQNA 4QOGA 2PKXA 3BJRA 3URMA 4F4JA 3NX4A 3U2QA 4HLQB 2OILA 1CUBA 2V7BA 1N2GA 2FMIA 2PMCA 3IP1A 4WNCA 1P9OA 3UUFA 3PUJA 1WETA 4HN4B 4YIKA 3SHQA 2V1UA 3T99A 5EUQB 1ORDA 3WQRA 1JDSA 1NYQA 3L8FA 4Y8VA 3ZDXB 1ICEA 1OX4A 5B4VA 4EDHA 3EQ7A 1AQJA 1VG8A 4MP8A 4YJ2F 1T8PA 3PI7A 1WSAA 4L51A 3NKLA 1NJ2A 4QGSA 2HSWA 4YV0A 1GUFA 2R2AA 5ADWA 2B94A 3FVWA 1JF8A 4ZJUA 1ZGAA 4OYYA 2FEXA 3O8QA 1IUOA 3VYTB 3T3PB 2MT9A 5AI9A 4B45A 1SKBA 3WLRA 1KAGA 4K03A 4NZOA 4ZK6A 3VOAA 5KQSA 3ZVMA 1LLDA 2B2CA 1KEKA 1T0UA 3I5XA 3HN7A 2YN4A 3IAEA 4ARCA 4Z1MA 3DWFA 1A71A 3E7PA 2CB0A 2OAP1 1SA0B 1HYQA 1NFRA 4FI3F 1QCDA 2Q41A 3IQHX 4G5FA 1LC3A 4O4IF 5EEGA 4Z9XA 1S2NA 1WSWA 3C0KA 4LQDA 5IAJA 3IVMA 4RIFA 1AVTA 1EWRA 4P4TA 1EEXB 4DLNA 3TWOA 1U5BB 1RYEA 3ZDAA 2G67A 1EZ1A 1N8KA 2YWHA 3X1JA 4CDMA 4Y6GB 1ISPA 1NKTA 2AUNA 2DKNA 2PZFA 4P33A 4TS3A 2PV0A 3I73A 4Y0NA 3R5TA 1L4FA 1OX6A 2J9XB 2PG3A 2R47A 5AD1A 1P0PA 1LX7A 1S89A 2D5AA 1DV2A 1IUKA 2PT5A 3CMMA 5JVDB 4ER0A 4KDCA 1IM5A 5HZMA 1V2GA 5ALRA 4Y9TA 2NO6A 2VT2A 4KACA 4EY3A 2HPAA 5FLYA 1M1YB 2O48X 1G21A 4OEHA 4DXAA 1LB1B 3AR8A 4WOKA 4I4TB 2PS3A 2YXNA 2JARA 3FOBA 3SF0A 1IZZA 2GKSA 5IF3A 4KWCA 5B64A 5FR2A 1XZGA 3FVQA 4TV8B 5KDOA 4LDQA 3RLIA 1OYWA 1CY0A 2COKA 1T6XA 1WZCA 2H1VA 2C88A 1NQTA 2BUAA 3ICWA 4MS3B 4YP1A 3A0UA 3Q11A 2AW5A 4MIOA 1TZ2A 4FVTA 1Y8QA 1AQNA 4K86A 5EZYF 4BN0A 4PIVA 1X1TA 4RAOA 4JBLA 4OYRA 3V1NA 2PYZA 3SFVA 1JHAA 3BWVA 3ORRA 4OGLA 1PL6A 4AP6A 3FFAA 2LCQA 4OHYA 4IGKA 3O83A 3LECA 2QP4A 5HNKA 4ABTA 4LMBA 4TV9B 1BCSB 5U4XA 5I01A 1AH2A 5FTJA 3OC0A 3VC3A 3U4CA 2QUKA 4J94A 4IWXA 2D13A 4LZLA 2JLWA 4TM8A 4S05A 2GUGA 1MPXA 4IICA 5A5FA 3ILYA 4MMZB 4QBIA 3W3ZB 4I46A 2REBA 4TMXA 3K6SA 1VCHA 4TSRA 4CMIB 2X8BA 3G9TA 3HB5X 1M0SA 3I1IA 3MJHA 4M22A 2WVHA 1QKKA 1HDOA 3KB8A 2BZGA 4Z4IA 3VPHA 3ZUGA 5H70A 1ZN8A 2NO0A 1IY0A 1K6JA 5ETJA 3V4ZA 1M34E 1PSZA 1XQYA 3GLKA 2J9FB 1O0BA 1O5TA 2WICA 4EF5A 3B1ZA 1E9DA 4NQZA 5CBPB 4EZBA 2HLNA 4QM7A 1ZH4A 4JFRA 1CG6A 4GAEA 4Y9RA 3KVOA 1AHHA 2QEQA 5CFQA 1WBJB 5C3MA 4QYXA 3DSRA 3B52X 4GLJA 1B1CA 1F38A 4JIGA 2VXYA 4A23A 1LI5A 4EF4A 2L2QA 2E4ZA 4RESA 3BN3A 2VQEB 3GR6A 3QMMA 3U7EB 1DG9A 1PJ2A 3DMPA 2CVPA 4ZCSA 3TTYA 2XJ9A 2VSNA 2I8LA 3JALA 2E5FA 3MT0A 1N2BA 3ZD9A 3T0FA 3H9EO 1JDPA 1UXKA 2AK2A 5IW8A 4C0AC 4AX8A 4MQ6A 2AFIB 3RROA 1W73A 2IGBA 4ZXPA 3JAMA 2F90A 1WXQA 2XDWA 2XA9A 1ILEA 1TIPA 2ZGVA 2GBIA 1O6FA 2YYSA 5I7UA 5KNBH 3GRYA 4JHLA 1RC8A 1UBTS 4TL8A 3KM0A 2BDEA 1AUOA 1ZNQO 3KD2A 1G4HA 5E1MA 3ZY2A 4URUR 1KJ8A 2PSHA 2C5BA 2QTMA 3I6QA 1SC3A 2NNLD 5EP4A 3RS5A 3UJ7A 5KJFA 1LLFA 1QIEA 2ATVA 4HX9A 5EA2A 1TMOA 2ETVA 2XMGA 4HQ6A 3AKDA 4G8JA 4QBHA 2R6JA 5B53A 1QKJA 1QGUA 5K9ZA 5KNDH 2CK3D 1MC4A 4I50A 2BKLA 2WYVA 1F3OA 2G9QA 3IQIX 4DR4B 1N0VC 3H2KA 5BURA 4DWOA 3W0LB 5AIBA 1QO0A 4ZQBA 3I5AA 1KYZA 1Z3CA 1I5RA 4OLAA 3R6DA 2HF2A 4TYWA 3ICPA 2BGIA 3A4YA 7ABPA 1Y9JA 3AZPA 2RGNA 3O8LA 1DC4A 3HKEA 1HE4A 2ZVPX 5JC8A 3Q3CA 1Z18A 2IHBA 3COWA 1KEUA 2ZB4A 3RRFA 3PHHA 5F7JA 2D1YA 2V7TA 5JFOA 4RTMA 4LWPA 5F23A 2IS4A 4M0KA 5IASA 1E8DA 4D8VA 1P3JA 3NXSA 1DWQA 5SICE 1AHNA 4F4HA 3PEFA 1E9AA 2JKVA 1CNFA 4GS5A 3CZCA 1IMOA 4MB0A 4NVRA 5A3VA 1XEXB 3QVXA 3UXYA 4FHEA 3F3YA 4ZOEA 3EXHA 5SZIA 4EUHA 2EFYA 1VJRA 2F67A 2LR0A 3PT5A 4HGPA 9LDBA 3FHJA 2D1RA 2Q49A 4ZAZA 1UXGA 1IPEA 3NGMA 1UEXC 1DFGA 5IVIA 3SJCA 3QX7A 5F3WB 4B6FA 4QDUA 3KSZO 4CN9A 1SUEA 1Z0JA 1TA4A 1X92A 4DS3A 1Y6GA 1Y98A 3TPFA 1IN7A 1Z63A 2QENA 4XB1A 4G37A 2C84A 2IDJA 4J0FA 4E32A 4MS1B 4HB3A 3UV6A 4QOIA 3PR3A 3G7SA 1AQIA 2H0QA 3FMFA 4JGBA 3LGSA 5CNJA 1IN1A 1XZDA 3FGOA 3N75A 1OHHD 3RSQA 3B1FA 2GJKA 1VPEA 1W2GA 1DNPA 2N75A 3E1SA 3OEYA 4C0BA 3CHYA 4FIDA 4KK4A 4CIXA 3OZUA 4KPFC 2AKAB 4TN5A 4DNXA 4F3CA 1OA1A 4FYYA 3VKVA 1L6IA 2GK3A 4GLOA 2BJWA 4CV3A 2YN2A 1OXTA 2ZBDA 2HGSA 4EHBA 4N12A 1EM6A 2HWYA 1XRNA 1QGZA 3DGFC 2EIHA 3PPYA 1Q22A 4AJLA 5JZMA 2RBEA 4HYTA 2EW2A 3SHOA 5B1HA 3G5TA 1MRSA 1ZXBA 3DBLB 2PRSA 1ZU4A 3H8JA 1C9MA 4S24A 2VR1A 4BMYA 4HVCA 1G63A 1ZOPA 2OCGA 1TW2A 5H4GA 1BWRA 3ESBA 2H7VA 3A10A 1AGPA 2ZR8A 4NWIA 2FDCA 1X9IA 2JAUA 5JATA 4LX8A 3QE3A 4DSOA 4MWGA 4MWSA 4X3OA 1TECE 3TEJA 4H0CA 2SKCA 4Q4HA 4Z2YA 4CF7A 4FOLA 3E8MA 4GO1A 4PG4A 4RVNA 2YKGA 5ERGB 2BUBA 3HUDA 5EZ6B 3LOPA 3DE0X 1RKVA 1W5EA 2C5GA 2JBHA 3AJDA 3DTVD 3X3HA 5BW4A 2RD2A 3ZN2A 4AY4A 1N36B 1T91A 4DYHA 3OU2A 4QPNA 2NLOA 2H57A 1F12A 3QVMA 2EP7A 4F6RA 3PWSA 1VLVA 4EY7A 4B7XA 1KZ7B 2C95A 3NPAA 1T2EA 1T35A 1IAQA 1RFLA 1NE7A 4JQSA 4KQHA 1CW2B 3ZE1B 3VA7A 2JCXA 2TRSB 2A1TS 2PIAA 3VC1A 5JADA 2BKXA 4E2YA 3OLCX 4XE5A 3PUYA 5EHGA 4Q18A 2ZRCA 3F7TA 1W59A 1TU4A 4D74A 1V8FA 4L85A 4B35A 3H13A 6REQB 1WOYA 1MOPA 4QJIA 4Q4DA 3L3BA 1FVOA 3P9NA 3VDRA 2OXIA 2XSZD 5F9FA 3R3YA 4RL6A 1DZIA 2H29A 5FA5A 5JJLA 3ZDZB 2AN1A 1JB9A 4BZWA 3DDOA 3AR2A 1S1MA 1DJPA 2OO5A 4GOMD 4HG2A 2RGDA 2RAPA 5BXQC 3N0RA 4H3SA 2HBQA 1Q95A 4ERXA 1U04A 4BCCA 1Y8QB 3BFJA 1G4AE 3H1FA 4DMHA 3PDIB 1SU7A 2PZJA 5EIBD 4TQAA 2C5FA 4A3SA 1RHRA 1U28C 2BGUA 3W6ZA 1ORWA 5LR6A 1KDTA 4PAGA 2G82A 3VTAA 2PTGA 3LKZA 1XO1A 3TX2A 5KNBA 3HKDA 1H3EA 2HX1A 2NT3A 2QM8A 3T7CA 5MGNA 5ALDA 4QXPA 2BFWA 1QF9A 1BXKA 3CO0S 4QUKA 5K8VA 3BJMA 3HGQA 2UKDA 4K26A 2I7TA 1AKQA 2OK7A 3PG5A 3VZSA 3G79A 3IOYA 3P97A 1BU5A 2WAXA 3ZS8A 3ZY6A 4X7RA 1X7XB 1YUMA 2FPXA 2H18A 2ZZNA 4NBLA 1JDVA 5HTOA 1MD9A 3CEAA 4MGZR 1ZK0A 1VLZA 3GFRA 5I48A 4DR7B 3UT5B 4ND2A 5KTYA 1XOIA 2GZRA 1HI9A 3M4ZA 4CMBA 1LH0A 3PF9A 8MHTA 2JAQA 3BRQA 1Q7CA 4KLRA 3O3MB 4GX2A 5TGDA 3LO5A 4NCIA 1RXVA 1S2LA 1VI2A 1NW8A 1CWUA 3B7GA 5HIKA 4Y1FA 4G09A 5ALPA 2WPNA 1P2FA 3AHEA 1TCVA 3CF6R 1X7ZA 1K92A 2CDAA 2FP4A 5AT1A 3OJXA 4CMJA 2H2HA 4RENA 3CUTA 2ZB3A 1TUIA 3OZVA 1J20A 3LHKA 4MQLA 3TUIC 2D62A 1MA0A 3OKAA 1FEZA 5DHFA 4F92B 1HMYA 2C2HA 1CNMA 5BNFA 4YX9A 2JLXA 1XCOA 1ES9A 3W1VA 1P74A 3HVJA 2X4IA 4KPYA 3ZHTA 2BM8A 4PFSA 4AICA 4MUEA 1NKVA 3H83A 4B0PA 3UG7A 4Y2GA 3FNBA 3AETB 4R69A 3JQCA 5ALTA 2X1VA 4LDZA 2PH5A 4Q9JA 3ZZ1A 4KITB 3OOEA 3I0MA 1C9JA 1PUXA 2ZSBA 1I0IA 4XCVA 5EYPB 1JTEA 1PTJC 3QLUC 3ZWKA 2C8VA 1ECFA 2C2BA 1B6RA 4M89A 4N9QA 3AERB 3QU5A 4MKZA 2PLFA 4H7JA 2VHQA 4KQ2A 4X45A 3NZEA 4XTRA 4E6PA 4CMEA 5I51A 1O96B 2WJHA 2IYXA 2OVBA 3PIRA 5E6SB 2JH8A 3L7LA 2YR0A 4V0RA 4HD8A 4GXQA 1CVIA 3MJVA 5DKFA 2QTNA 2HFKA 3N2KB 4UATA 2H3EA 5MN5A 1YS4A 2IZ1A 2C1EA 1FBTA 1P2BA 3M6IA 2X9NA 1WOMA 2HTFA 4R6WA 2W90A 3ZTTA 1PO7A 2IGTA 3QE4A 4PHHA 2G7ZA 4B8WA 1ZD4A 4BNFA 4O4JA 4OQMA 1I3OA 4OHOA 4HUTA 3VFDA 1DC6A 5C8XA 2JJQA 4H31A 4KREA 3FWZA 4OHVA 1I6MA 4TTIA 1ZUNB 3RBZA 3SAJA 3ZQ6A 1XZHA 4UBNA 4AF8A 4C7VA 1UMCB 5IBRA 1TKBA 2TYSB 4KTVE 4MVJP 3GPIA 3GXBA 1FFXA 3OF3A 2WD8A 3OJEA 4KIFA 5FLKA 3UWPA 4FDLA 3WNDA 2CKMA 2AEEA 1KDVA 4J1TA 1ZQ1A 4B48A 3KTFA 2XA2A 3IQZA 3H84A 4QJBA 1M2EA 4O4HA 1FUEA 3K0KA 5FTKA 5LC1A 5LNK1 2M32A 3IKJA 3P0IA 3S68A 1FYFA 1HTTA 4CI9A 5IC4A 2O05A 3DAPA 3JQRA 2W5UA 1JHMA 3M82A 4QEZA 1CIPA 4H3KB 3ENZA 4AY3A 2ZVQX 2C9ZA 4FLFA 3WKAA 2VBGA 1QFYA 2RGBA 2X5NA 3AL2A 3CN9A 3WL5A 1AUVA 1DKOA 3FETA 5HBRA 5EVJA 4WTOA 4CVNA 2AQIA 2DWQA 1RZRD 1NF3A 2PXXA 3SQXA 3L0IB 4FWTA 3DDNA 3H19A 1TC2A 1YFZA 5CK4A 1B76A 1QGED 4D6PA 5IABA 3ZQJA 2X4LA 4OHXA 2QVGA 2DR2A 2HXSA 1DPFA 2OFXA 4MV1A 1CHDA 1W0JD 2EOAA 521PA 1M8PA 2NTVA 3TI9A 3IEIA 3AI7A 1ORRA 2XAUA 2ZWAA 1K8ZB 5KJ1A 1QJ4A 2NU9A 5CYGA 3INTA 3V7WA 1FQWA 2NZYA 1YGYA 1NQWA 3ZBQA 2KLHA 1XR3A 1XQ1A 2JLRA 1M67A 1O9GA 4QTZA 4Q1VA 2ACKA 2G70A 2H1IA 1T8RA 3FCSB 3CKLA 1UKCA 5BUZA 1US8A 3B85A 3VO8A 4E4TA 4C89A 4J0QA 2XITA 4YGYA 2ZCUA 3T7SA 4JVLA 1Z83A 1SU4A 2W8BA 3MGKA 4I7EA 5EI5A 4RS3A 2G08A 4GVLA 2WVGA 3SC2B 4ZCRA 4XXHA 2IX9A 4I5FA 1FFBA 1W85A 2B78A 1NF8A 5L95A 4YRNA 1ZC4A 3GT4A 4FGWA 3CINA 1ZW6A 2X0IA 4CR8A 4R1UA 4PU0A 2JLBA 5AXCA 3CX3A 2ORWA 3OD1A 2PSJA 4DLXA 3DO5A 3DBIA 2I6TA 1ZNYA 2JC3A 2RCYA 1ESZA 4YECA 4EA6A 5AW6A 4HNAB 1K8QA 1YKGA 3I2FA 2VRBA 3CR7A 4NPAA 3TTVA 2W2NA 1YTUA 1JAHA 1GV1A 3FYSA 5FBHA 1UFVA 3ADKA 1J9EA 1V47A 3BD9A 1VRWA 1FQKA 5C3UA 4BEBA 5BNWA 2VKQA 4O59O 5KJCA 4MVJH 2EQAA 4R1PA 3I83A 4KAAA 2JFVA 4XJXA 5JMOA 1MENA 1ISMA 3LWNA 1U9JA 3NBXX 3I05A 5ER6A 4EYEA 1U0FA 3C8MA 2NU8A 2DJIA 4KR9A 1XSEA 3GL9A 3P32A 1E2PA 4MW9A 2ZIFA 4KO1S 4MA5A 3IV7A 4XRGA 1KQOA 1RXCA 3SOPA 2Q2WA 4R0NA