4LHXA

Crystal structure of nucleotide-free rab8:rabin8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
175
structure length
175
Chain Sequence
b'KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
molecule tags Protein transport
source organism Homo sapiens
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
total genus 53
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhxA00
1E94E 2J5XA 2G3YA 2ZJ2A 5TVKA 2F55A 5FBLB 3VTKA 5AJWA 2JLVA 2ATVA 3U60B 4P32A 1DAIA 4M21A 2V8OA 4DLTA 3B8HA 2RHDA 2YKGA 2W2XA 3PUYA 4RSGA 2YJTD 3T1VA 3LQRA 2B7CA 2ZRDA 3VR4A 1NN1A 3KQUA 2BIFA 2X2FA 4DSOA 3QKSB 3A58B 2PZGA 3W34A 3P1JA 3EPHA 1MO6A 1KIMA 3EWAA 4A9AA 4HSEA 4GI7A 4F4CA 3D8BA 5AR1A 5FI1B 1GNRA 3I4LA 2HXYA 2WWFA 3FB4A 4Y0VA 1W0JD 2J7PD 4JVNA 4FINA 2R2AA 3W5JA 3GFOA 2NIPA 5JBQA 1UKYA 3TR0A 4QBHA 2ZI5A 2NTYC 3VX4A 1ZW6A 2EFCB 1X8KA 4HLDA 5G40A 5AUPB 4WZAE 2O8EA 3CX8A 2NZJA 5HCIA 3L8ZA 4YMUA 4CEJA 1OLOA 2D2FA 3MWLA 3I5XA 2WJGA 3QKSA 4A0GA 2RGBA 4CW7A 1DO0A 1KSGA 1IJFA 2X1VA 4BRUA 4IRUB 3WHKA 2AFIE 1MR3F 4DLXA 1LW7A 2IYLD 4XWOA 5ELXA 2RB4A 2R6DA 3BB3A 1FTSA 4HB4A 2ZI3A 1PLJA 3IBGA 2B21A 5C2JB 2ONKA 4WZBE 4NMMA 3SN6A 3FMIA 2ORIA 1T3SA 1CR0A 1YVDA 5FR2A 3EXAA 2FZLA 3U7FB 4IOMA 1E98A 3MAAC 4QGFA 4KVAA 1D9ZA 5GJWC 5G3YA 2XGJA 4BFWA 5F2EA 3DM9B 2AWNA 2R62A 1NSFA 1YZNA 2HCJB 5AUNB 3OEHD 3CF0A 3REFA 3MFYA 1VDZA 3B82A 3B1YA 3C16C 1JR3A 4KFTA 3DZDA 4BLRA 3PQCA 1G5RA 2WPDD 2ZRPA 3V9PA 2F3TA 4WIAA 1CS4C 5AJZA 1FP7A 1OXUA 1UEJA 5J47A 5KPJA 3K0CC 2ZIAA 3J81k 2BBWA 2ZUBA 3DKPA 4PPFA 4ESVA 4EPXA 1TTTA 521PA 2V9PA 4QM7A 5BWMA 4B74A 1PLKA 1E1RA 1E79D 2Q0HA 2ZRJA 3AV0B 2ONJA 1CJTC 1GIAA 4FMDF 4LC0A 2QM7A 421PA 2ZEJA 3BAFA 1SKYB 1WRBA 3K53A 3EIQA 2GVZC 3CONA 2ZJ5A 2ZPTX 2AK3A 4PC2A 1XTKA 2W0SA 1KJZA 2HJVA 4FIDA 4ZCMA 2BDTA 2IHBA 3B13B 4C2UA 3AVUA 4BRWA 4MUAA 3VR2A 5KNCA 5FUWA 1RVDA 4S2EA 1Z83A 5A5GA 3CZPA 1SZPA 1GKIA 2ZROA 4TLAA 1CEEA 5IHPA 2QP3A 2NPFA 3QPUA 1GKYA 4Q03A 1ZC4A 4OI1A 4D82A 2RCNA 4X8OA 1VIYA 2AFHE 2GF9A 3H86A 4NYMR 5H70A 5BQ5A 4IOKA 2ZRKA 2WZQA 5J5CA 1R5BA 1ZVQA 4TLDA 3AF3A 1T5LA 4ZKEA 2CCJA 2WMNB 4N0DA 4C0SA 2BJWA 4AK9A 5CITA 2AWOA 2UZIR 2XITA 2VHUA 4Q1CA 4HAXA 4DLYA 1TU4A 2ASEA 3AKDA 4RZ3A 1Y3AA 4JLDA 1P4SA 3VFDA 1XMSA 1R0YA 1VMAA 3DVLA 3FWYA 1G291 3SI7A 2CK3D 2O0HA 3CRMA 2QQEA 3KXIA 3RS7A 4V03A 4DT1A 1WF3A 2V1XA 5KU1A 1SQ5A 3CUEF 1SVMA 3TW8B 2ZVQX 3I32A 2DB3A 3ZYCA 2QPAA 3BE4A 4EPTA 2ZJBA 1DVRA 1UBGA 1II8A 3MWKA 5LDDC 3QQ5A 4RFSB 2BMEA 1KO7A 4XTCS 4P0TA 3AKYA 2HUPA 1G1MA 4DIDA 4TTPA 1AQYA 1TEXA 2EW1A 4JL6A 4R7ZA 4ESHA 1UM8A 2VSOA 1XEWY 3GJ5A 2IW3A 4IDOA 2PJRA 1CU1A 1Q44A 4MRSA 2XSZA 1ZINA 4JLOA 1NKSA 4Q7KA 2C8VA 4NE2A 2GEDA 4PQFA 3SJZA 3U3JA 1EFRA 3L0OA 3CLVA 2H7VA 3UMSA 5H68A 3A37A 1BS1A 2KWIA 4A0FA 4GPTA 1AA9A 3SFZA 5EE5B 3ZGXA 2WWHA 3AQ4A 3MMPA 5B2ZA 4UNRA 4KLZA 1N5LA 2VF7A 5DN6A 4HDOB 4EFNA 1IQPA 2EVWX 5JI2E 4OI2A 3IHLA 5FL3A 1XDBA 2WOOA 2F7SA 2Z4RA 5B64A 2H92A 4DCSA 2QE7A 4HDQB 4JT2A 1C4OA 1BMFD 1FX0B 3QXHA 2CCKA 3LBHA 1G5TA 4YMWA 2XTMA 4M1TA 2IUUA 2ZRGA 3ZVRA 4NYJQ 1J8YF 4CVNA 5IRCD 2A30A 3RDPA 4LJ4A 1KYIA 3NKVA 4LHXA 3I3SR 1S4QA 3CKLA 2JLXA 1FMLA 5EP1A 3SYLA 1N0UA 1Q20A 4RZUA 4TMKA 1ZIOA 4AG6A 2EU8A 3LX5A 4A8JB 5FR1A 1VIAA 4M53A 4BLQA 2GKSA 5KSOA 4OYHA 1N6RA 3NC0C 3U3KA 4DLWA 4IEEA 1ZM4A 2Q3MA 1VG8A 3DEFA 3FMPB 3KB1A 1V43A 1TEVA 2FFAA 4LJ5A 4QC2A 4WZ6A 8OHMA 3A4NA 4DDWA 2P65A 3VQTA 3GCGA 2VSFA 1Z28A 2W2VA 1GVNB 2ZU6A 4M9SA 3B78A 1JAHA 3OHMA 4W5HA 3SYNA 2OLKA 1AJEA 1G8GA 1CR4A 1A1VA 5E7MA 1F2TA 3KKOA 4NYIQ 1DAKA 3ZVLA 4AIIA 4YQFA 2PL3A 2X8AA 5CDFE 1E0AA 2B92A 3TBKA 1YQTA 4C0BA 2WAYA 4ACBA 3DHWC 4DUGD 2WSSD 1KI4A 1NVWQ 4DWJA 4LWZA 1OXTA 2IXGA 2F3RA 2GZAA 1VYUA 2AD1A 4WAUA 2J45A 4HAVA 1RRPA 2BHRA 3ASZA 2FNAA 1CR1A 1P9NA 4POAA 3BXZA 3BS4A 4ON9A 1KNXA 1YR6A 2OEPA 4G3XA 5KSZA 2QORA 3DKVA 4TSFA 3PEWA 3W6PA 5HR5A 3PENA 3RWMB 2WSSA 3GLFB 4F7WA 4IDNA 1GAJA 3HR7A 2ZE7A 1FX0A 4ASUA 1H8ED 4TZ6A 2NO1A 3BBPA 2ZAMA 4L5BA 4GRAA 2QMHA 1Q12A 5EZ6B 2VHTA 1RRCA 3NC1C 4KVGA 1QDEA 4JZKA 4TYQA 1X8LA 3B85A 3E1SA 4NCHA 1VCMA 1E79A 4Q7MB 2XOKA 4IHQA 5KO2A 4V0NA 2GETA 1CJKC 4G01B 4M1OA 4NYJR 1IXZA 1AS3A 1EK0A 2WWXA 2J7PA 3FFAA 2N42A 1KSFX 3TMKA 1FNMA 5F98A 2J0VA 1GZSA 3T34A 2C95A 3B1XA 5FOVA 2EYQA 4HAWA 2JAQA 5J4VA 5L8VA 4Q7LA 3ICQB 3RNLA 2JATA 3IO5A 4G5QA 1DBSA 2RKOA 3GMTA 4D25A 1SVKA 2YC2C 3UMFA 1OFTA 3W6OA 5C46F 4PPQA 3R7WB 4AG5A 4JLNA 2CE2X 4DLSA 3OE7A 2C9CA 1ZYUA 1TMKA 3R8FA 1E9DA 1X86B 1EX6A 1GITA 2ZSAA 2IYTA 2JJ1A 3AVVA 4Q02A 1CBUA 2P67A 5IF9A 1BMFA 4BQSA 3I62A 1HQCA 5KDOA 2J0SA 1IY0A 1Q3HA 4MKFA 3I8XA 2VP2A 1R0XA 3G5UA 3KXLA 3W3AA 4UNNA 4M8NE 3EWSA 5CYPA 5H8WA 5FH9A 3C14C 4MKIA 1JALA 5FBVB 1ESNA 2I4IA 5HPYB 3AP2A 1HY3A 3E70C 5J4KA 5JCPA 3PEYA 4BZPA 3VU9B 3CR8A 3VMFA 2PEZA 1MO4A 5SZJA 2BKEA 1N5KA 2FSFA 3LVQE 4DLZA 1E2EA 4GMXA 3DZ8A 4M1SA 4MGZR 1ODFA 5EXXA 5CJ2A 4TMXA 5DI3A 1JI0A 1UKZA 2JIZA 5AJVB 1R0ZA 1KSJA 1XJ0A 4L16A 3IHWA 1OFIA 1CTQA 1E1RD 1DPFA 1KMQA 2WJHA 3K9LA 3QPWA 2W83A 3QY0A 2QSYA 3KUDA 1LY1A 1XRJA 3GLIA 4FWTA 4B73A 2PCLA 1QF9A 5K8UA 1JEEA 5F9HA 1P61B 4Q9HA 1GILA 5EUMA 1WBDA 2I1QA 3A1TA 3K0SA 1W36C 4HAZA 4V0KA 1JAIA 1DG1G 5DE3A 5DI9A 4KSBA 1E2IA 4Q9LA 4NCNA 2OG2A 2Q9AA 2RH5A 2IBMA 4NCJA 2GBLA 1RRGA 2L0XA 4TTQA 2ODEA 3RS5A 2ZRHA 4QGAA 3QF4B 2ZE8A 3BJIC 4JLAA 3SU8A 2WOJA 1R4AA 2V7QA 1IM2A 4D4MA 3O8RA 3FFBA 2JASA 2NOAA 5CK5A 3RS3A 1QVRA 2RGAA 1FPMA 1VYTA 2C78A 2WKQA 1I4TD 2XZPA 2NO6A 4IDPA 2ZRFA 4EQ6A 4IFBA 1U98A 2BC9A 1H65A 3GJ3A 3PEUA 1UBEA 1TQ6A 3L0IB 4RD1A 2NGRA 1OH6A 2HYIC 1XPOA 4A82A 2PMDA 3CB4A 3HU2A 4RD6A 4V0OA 3QBTA 4B34A 4C0AC 2GHIA 2GA8A 4V0MA 4F4IA 3A4LA 1QHGA 1ZP6A 1E4VA 4Y0AA 5EP4A 3B6EA 3V4RA 1N6KA 1KI7A 3EASA 4RFVA 2OCBA 1CJUC 2XSZD 1SXJE 3EZ6A 4JS0A 4L8GA 3EZ7A 4UXHA 3R8CA 3WNDA 4XWKA 5CDFA 1MOZA 1OF1A 1P5ZB 4MDEA 1QG2A 3M0EA 3QKRB 3ZS9A 4EFMA 4F4JA 5FUXA 4II7A 4UKDA 5B58C 1SVWA 3TAUA 1DAMA 1HT2E 4JLMA 4EKDA 3BD9A 2O8EB 1Z47A 3OE7D 1GNQA 4O25A 4TL6A 4FMCB 1YHNA 1TL7C 1Z6AA 3LAWA 1YZQA 3AUXA 3DL0A 1OH8A 3RHFA 4JBYA 4XOIA 5JWOA 1NLYA 4NYIR 2QI9C 4QNRA 2WJYA 4PC3A 3TK1A 1CIPA 5J4LA 4AKEA 1DG3A 3AVXA 4Q1FA 2IEYA 1RFLA 3K9NA 1NVVQ 2GK7A 1NVVR 1ZM2A 2C5LA 2IYSA 5E7IA 4B2PA 4D0GA 1G8YA 4KAXA 3UG7A 3U4QB 5GJCA 3T5GA 1H8HA 4C0JA 2IYWA 2FJUA 4TN1A 1M7BA 2GRJA 4JVSB 3BIFA 4IEIA 1G8PA 5IK2D 4LCBA 4A6PA 2ZSEA 1P2UA 3D6TB 2RGNA 2OBMA 3OEEA 5KPDA 3W6NA 4AY2A 2GK6A 3F8TA 4V02A 1VG0B 5F9FA 1N6LA 4TMTA 3Q5DA 2O8FB 3VR5A 1CR2A 1FMJA 1WP9A 4LSGA 1QHXA 5AUOB 2GEUA 4Q4JA 1NJFA 1W49A 2OESA 1G17A 3HU3A 1E9EA 1D6JA 3C7KA 5JCZA 1LF0A 1OW3B 2XX3A 2W6IA 4UNSA 1E4YA 1HQYE 3FDIA 5C4GB 3SBEA 3T35A 4DSTA 1NN3A 1T3LA 2FDCA 3U3MA 3LXRA 1TQ4A 1WDTA 3AF2A 3K8YA 1NG9A 2YYZA 1KAGA 4MITA 2NO7A 2CL7X 4PZYA 4KCGA 4CF7A 1E3MA 2Z43A 2WKRA 1M74A 2GJ8A 4HZIA 2WJIA 4NONA 4PSKA 5HTKA 5L3QA 4DT1B 2V1UA 4OJKA 2GXQA 1NL3A 1W44A 4DDVA 2CHGA 1W1WA 3GLHE 4LBVA 1OIXA 1G8FA 1Z0IA 4Q18A 3QKUA 4YXWA 5DYGA 5K8IA 1T6NA 3X1XA 1JBKA 2OV2A 1Z08A 3FGNA 1XCGB 3VR1A 2FU5C 2XNDD 2GAAA 4HATA 2OILA 2P0EA 3W5IA 3F3YA 3B1WA 5FPSA 1RZ3A 3U44B 3G0HA 4ITRC 3A8TA 3ZJYA 1PZNA 3HYTA 2G0TA 2ERXA 4L9SA 2H57A 4KHZA 4OJQA 3IGFA 4TT3D 1ONBA 2FFHA 4OHVA 3CF2A 4R2HA 2EFGA 2GJKA 3EA5A 4D0NA 3GLHA 3QIAA 1M7HA 2AKAB 4LPKA 1N25A 3CW2A 3MUFA 1JR6A 2DWPA 4MRNA 1LS1A 2EFEB 2DWOA 2G77B 1BYIA 5JRZA 2WIBA 1CRQA 1JXMA 1J90A 2CK3A 3DMNA 4DC9A 2GCOA 3OFNA 4P3YA 2JJ1D 3KUCA 1TNDA 2FPKA 4JKYA 5BW8A 2GAOA 4KV9A 3CZQA 4I81A 1KK3A 3K1JA 4H1UA 1FP6A 3SHWA 5EXPA 1KI1A 2RGXA 1XCMA 2PX0A 2QAGC 4Q1AA 3AB3A 1E9AA 1NN5A 1CULC 1VG1A 2PT7A 2QP9X 4BFUA 5DISB 2D62A 4Q66C 1WQ1R 2ZQ5A 4NL4H 5P21A 2FN4A 2OZEA 3BB1A 3WMEA 2QAJA 4CEIA 1G9XA 2ZVPX 2BBSA 4QHTA 4RJLA 3BERA 1V5WA 2O8BB 1IY1A 4QNMA 1SVSA 1AGRA 1XTJA 1ZAKA 1X1RA 3SQXA 1SXJA 4BZXA 1XTIA 2P6NA 3NHAA 3U3OA 4QJ5A 2BCGY 3IIKA 1CF4A 1GOTA 3GLFE 4BLSA 2CLSA 3SHFA 4RD3A 4AKIA 2IF2A 2A5FA 2FF7A 2ERYA 2QGZA 3ZD7A 4QGHA 2F43A 1GSIA 4YLGA 1HV8A 4MGKR 1XNJA 4OL0A 3AF1A 2DY1A 3KQLA 1IHUA 2QG6A 2BMDA 3AVTA 1HUQA 3CH4B 5HZHA 1OIVA 1ZM9A 1LFDB 3LLUA 2A5DA 2ORWA 4PO8A 3RWOA 1ZIPA 2WAXA 4TL7A 2HYDA 1R7RA 3N2IA 1RJ9A 3GEIA 3TSOA 3BWDD 3QKTA 3U6BA 3TRFA 3IPYA 5L3VA 2A5GA 2ZITA 2FSGA 2XEXA 5LBIA 1G21E 2C03A 3P20A 2PLFA 2RHMA 1ZUNB 2F6RA 5GVRA 2IXEA 2REOA 3O47A 4PQRA 3TVTA 2B8TA 3K09C 1ANKA 4RCZA 3EC1A 3ZH9B 4PO1A 1G3RA 2KBEA 1MH1A 1G20E 2FG5A 3H2YA 1U9IA 1VCIA 2K5UA 2WJVA 5JHGB 4C2TA 3LQQA 5EP3A 3PJRA 3QSYA 1KKLA 5KNBA 4LPSA 5CK4A 1RC8A 1II9A 4KYUA 3QXCA 4URYR 2IT1A 3RRYA 2J7KA 3AF4A 4P4UA 4IXMA 1KI6B 3BFKA 2ZUDA 2QTVB 1G19A 3NWJA 5JI3E 1X3SA 5JWHA 4B43A 4ZO4A 4DB2A 5CM9C 3KQKA 2BCJQ 1N6IA 2W00A 1NJGA 1FNNA 4TMWA 1GFIA 3FE2A 3JVVA 1KDTA 1HURA 3Q72A 3RVBA 3SE0A 4CEHA 4PANA 4ARZB 1Q1BA 4OHYA 3VHXA 4JSTA 3IPXA 5SZKB 4KJZA 2YHSA 5FTNA 3SJAA 3KKNA 1P2TA 2JLRA 1ZD1A 4LK2A 1YR7A 3DDCA 3RRMA 4QBIA 4GSYA 2ZU0C 4JJKA 1ZCBA 2RGEA 4HLUA 4FN5A 2OSBA 4M1MA 5FUVA 2YVUA 3TUJC 4OI4A 4OK6A 1EFTA 2FOLA 1B23P 1KI8A 2CL0X 4GZLA 4LBYA 2REXB 3QJYA 2ZE6A 1ZRHA 3GP8A 3BFXA 3MWYW 2ZS7A 1E2MA 2QA5A 4LYHA 1KKMA 3CWZA 2QTHA 1TAGA 4EJSC 4HUQA 2E87A 1N5IA 2EWWA 4TYPA 3U7GA 3I8SA 4B35A 1Q3TA 3SDZA 5JS8A 4ABYA 3IO3A 3PITA 3OF5A 2R9VA 1AK2A 3GPLA 1XD9A 1G3IA 3AP1A 3FHOA 4PSAA 4QKQA 1F5NA 3CRQA 3DOEA 3WRYC 1KHTA 5EJEA 2QZ4A 4ZDIA 5JJKA 4HI0E 1HE8B 1N6OA 4X8LA 1FL9A 4LYFA 5JJLA 2DFTA 4Q5IA 1HA3A 3G82C 2XJ4A 1Z0KA 3CX7A 3Q7PA 4LUCA 4NCIA 3K70C 1DAHA 4PAMA 2IL1A 4FD2A 4IDHA 2V4ZA 4JLVA 1EGAA 1GRQA 2GXSA 3BH6A 4QL3A 1E9CA 2VTKA 3QE0A 3KJEA 4GP7A 1YRBA 2YINC 1G7TA 1O87A 2QAGB 1YKSA 2O5VA 4Z1MD 5J4HA 2J9RA 3BB4A 4CEIB 5FBRB 4LYJA 3OAAD 1I2DA 1QVAA 4D4JA 3PVSA 2Q9BA 1KK0A 4RCYA 2GXAA 1G7SA 4E07A 3I1FA 3FOZA 3L8YA 1NNEA 3AUYA 4LHZA 1EXMA 2ZJAA 1HEIA 3QVUA 2DYKA 3TNFA 2F9LA 1E2DA 4FMCF 5AJXA 821PA 3GEHA 4AKGA 4Z1MA 5C1BA 3KTAB 2YC4C 5HZKA 1PUIA 3RLFA 1P2VA 4K46A 4KITB 4B32A 1N6HA 3DPUA 5FOTA 2ZXUA 3PV0A 4P31A 3SS8A 1VPLA 1W46A 3RSLA 5CM8B 1XXHE 4TL9A 4TQUS 3THXA 3QOFA 5M04A 1X8JA 4U02A 5DN6D 3X2SA 3QEOA 2NZ8A 2XB2A 1G6OA 4Q4AA 2QBYA 1ZNXA 3LVRE 4G1UC 1C9KA 3M1IA 2FFBA 4W7SA 2D74A 1NN0A 4G5SA 3FPAA 2G9NA 2XZOA 2YNMA 1YZGA 5KSYA 4URZR 3U44A 4CZ2A 4AD8A 4S35A 4N1AA 1KMHB 4F38A 2B6HA 2P6UA 1NBMD 2OFWA 1DS6A 4KFRA 1BH2A 4TT3A 4BE7B 4IDQA 2PJZA 4MA4A 2R44A 1AS0A 3SOPA 2G0NA 5FPTA 4B33A 1G64A 2DHRA 3MLEA 2XTZA 3P32A 1F60A 1COWA 1LNZA 1NVXQ 1N2CE 2P3SA 2MMCA 5CLLA 3VR6A 4BEJA 1AN0A 2TMKA 1W36D 3KJHA 1UDWA 3EX7C 4B3GA 1NMYA 1JJ7A 1OHHA 2VYFA 4FMBB 2FV8A 2Z6VA 3CF6R 1GP2A 4ERNA 4BFVA 4NKRA 1GL9B 1KY3A 4RZ2A 1SHKA 4BECA 3BFVA 4JL5A 4M22A 2RGCA 3QPVA 5EP2A 3GLIB 5G53C 1OV4A 1J99A 4DZZA 3P26A 3S1AA 1Z8FA 4LHWA 1OJLA 4BFXA 4GMDA 4LRWA 3WRXC 3EPJA 1NLZA 2O8FA 3ZQJA 2O0KA 4EFLA 1XEWX 2DFNA 3K0AA 4R9UC 3PR1A 1TU3A 2VL7A 1EFCA 2E1RA 2A7QA 3MJHA 4P4SA 1II8B 1SULA 1G4UR 4A8JC 1F2UB 4IXNA 1W0KD 2PZEA 4XVRA 3GLGA 2AK2A 2WBLC 1U0HC 4C0HA 1Z6TA 3OAAA 1L7VC 4ASUD 1T8TA 4A15A 2OT3B 3A36A 2G1KA 1Z6YA 4NH0A 1P73A 4DBLC 1E1QD 1GWNA 3UANA 3PUWA 5IK2A 3OIYA 4KODA 3ZZTA 4EPRA 1DAEA 1W0KA 2Z5FA 3VX3A 3FKSD 1IN8A 2ZRLA 2IYUA 1I4DD 4XJXA 2IYVA 5TARA 1S8FA 1KO8A 4KFSA 4LJ7A 2VEDA 2A5YB 1XZQA 4TLEA 4G5OA 4QRHA 3CR7A 4M9XA 3C15C 1J70A 4UNQA 2Q3HA 4CDGA 1IXRC 4QM6A 4CGZA 3KL4A 3FMFA 1TX4B 2J0UA 5DIFA 4BFTA 4D4LA 2GCNA 2DBYA 4LJ6A 4JT4A 3IIJA 3OIUA 4LI0A 4M1YA 2FEMA 2IS1A 5CYOA 3KKQA 2LWIA 2ZRIA 2C9YA 5DH9A 5DI3B 4DLUA 4BWYA 1Z22A 2UVQA 5K8TA 1YJ5A 1R5NA 121PA 4D80A 2JJ2A 3DOFA 4IJMA 4B3CA 2XXAB 1IN5A 1QRAA 1UEIA 3U61B 1E2FA 3C41J 1MRNA 3WXMA 1GL6A 4M1KA 2JLZA 4G5RA 4US0R 1RRFA 3GEEA 4ILEA 1XMVA 1TQ2A 4O2LA 4FCTA 2RMKA 5EE3A 3K0FA 1W5SA 5H1YA 4XVUA 3O8BA 5DLQC 4EDHA 2W6ID 3TW4A 2KI5A 1E2JA 1S3GA 4IVRA 4QBGB 2AD5A 1OH5A 3B1ZA 1G5PA 1ZM3A 1Q1QA 2PBRA 3HU1A 4RD2A 4Z51A 5CIQA 3GLGB 4NPHA 4DLVA 3WHLA 4ZI3A 5SZIA 3HP1A 3AKEA 3MJRA 4AURA 1JXOA 1HT1E 2NO9A 3R9IA 1AZTA 1FUUA 1SVIA 3ADKA 2O8BA 1GDDA 1T5IA 3B9PA 2D7CA 4TLCA 3GQBA 4A2WA 4M9ZA 1M6NA 4LJ9A 3U2QA 2ZRCA 3RS4A 4PR0A 1QHHA 3QUSA 1DTSA 2F1HA 2G1JA 2C04A 1MO5A 3O8DA 3TJZA 3NH9A 1P72A 2WJJA 1ZMXA 3AVOA 1D2NA 3EC2A 4PHFA 5B57C 2HCBA 4NP6A 1T0HB 1W4RA 2ZS9A 3HPQA 2A5JA 3QXXA 4Z8XA 1EESA 1NG1A 2FPLA 3M6AA 1NLFA 4WXPA 4BEBA 3FHCB 3FMOB 4UJ3A 1E0KA 1E2LA 3RRZA 4PAOA 3PIRA 4EJSB 3R9XA 2J3EA 1P6XA 1XMIA 2FSIA 4F93B 1XEFA 2O8CA 1AKYA 3GLGE 221PA 3NDPA 4U00A 1KZ7B 1JR3E 4PAQA 3SYKA 5CB8A 4QJ3A 4A2QA 4PC7A 1E96A 3RRNA 5HE9A 4YDHB 3CX6A 2OHFA 2Q21A 4F92B 2LKDA 3CNOA 2ZS8A 2O8DB 4EAQA 5FPKA 1ETUA 4N0EA 1BO6A 2LKCA 1P9RA 3EARA 3WNCA 4F91B 2F43B 3ZS8A 3E5HA 2N1BA 4JVMA 4ZDWA 4K8OA 3EZ9A 1SHZA 2OCYC 1MRSA 3FYHA 4Q47A 3VNVA 1E9BA 4D4KA 4V0ME 3NBYC 3CM0A 4QOSA 3CPHA 4O2RA 2QL6A 5DYIA 1FTNA 5CIWA 1ZJ6A 2IYXA 2HF9A 1TUIA 2QE7D 2D3WA 1XXHA 2VP5A 3MG9A 4G0NA 1JPJA 4NCKA 5JEEA 2CHVA 4MDFA 4JYCA 4GOJA 2YZ2A 4EPYA 4GT1A 1XTQA 4PPGA 4DCTA 1T4GA 4OK5A 2FH5B 1Z2CA 4GOKA 5HE8A 1Z6GA 2GILA 3FHTA 4Q4HB 1VG9B 3AGPA 5LD2C 2ODBA 2GEVA 4LJYA 4Q9JA 4HUTA 2ZI4A 4JKIA 2FGJA 4H1VA 2ZTSA 3SFVA 4ZCIA 2O0JA 3BH7A 3N2EA 3SEAA 4BZQA 2JEOA 1XP8A 4HAUA 4HLQB 1E9RA 4NYMQ 3ZDQA 4Q4JB 2X77A 3IDQA 4XSHA 3AP3A 3BORA 2Z4SA 2DFLA 5DGXA 1DEKA 1OH7A 1A82A 5SZHB 1QZXA 3A4MA 3WBJA 2CNWD 1OPXA 3UWOA 5FOSA 3AVQA 3UK6A 2BJVA 4MRVA 2OUKA 3WBKA 3NEJA 5KDDA 4TQAA 2YV5A 3RC8A 2JLQA 1DO2A 3B5JA 1EFRD 2F1IA 3U7EB 5DHAA 1WCV1 2GZDA 2JIZD 3D7MA 3DM5A 4ZV4A 1CLUA 2YWFA 4BUJA 4QFMA 1L4UA 2IWHA 4FI3C 4DSNA 2WICA 4CT5A 1R5OA 3KDSE 2ZJ8A 1LV7A 3CNNA 2NQ2C 4OKSA 2NPIA 1M1YE 3LO5A 3GFTA 3TKLA 5BN3A 2OAP1 4YMSA 3KXKA 4NTZA 3Q3JB 3HJNA 5JZVA 2VSXA 2OCAA 2OBNA 3LDAA 4WBSA 1U8AA 1YZUA 3W8NA 2P6RA 3B9QA 1K5DA 2DFKB 3OIVA 2QMEA 2QROA 3K0CA 5FBWB 4ZDJA 5KTYA 1VHTA 4A0HA 2BBTA 2CL6X 4XSGA 1J7KA 1Q21A 5L3QB 1FW6A 1ZBDA 2CLCX 1UADA 2C99A 3MSXA 2V7QD 3PEVA 1LTQA 3CRRA 1EWQA 3KTAA 1WXQA 1AQUA 2YWHA 2P5SA 4D2IA 3X1YA 4HB3A 1IJEA 2ZR7A 4IOLA 4TLBA 4X8HA 4B76A 4XD7A 1NBME 1T8UA 1QHYA 1UFQA 3PUXA 1YU9A 2KBFA 3NDBB 1XEXA 2QP4A 2YOGA 5FTJA 3ASYA 5E4FA 2H18A 2QENA 4PHGA 4HLCA 3K70B 4US2R 2BBOA 4AWXA 1W4AA 4GOXA 4FMDB 3BOSA 5FOUA 3WY9A 4DEXA 1QHIA 2B8WA 2CJWA 5KSPA 4BLOA 2W2TA 1S1CA 2Z0MA 3ADCA 1DADA 3HYRA 3QVVA 3Q7QA 2VIIA 4E5UA 1PVOA 2F1JA 3ONWA 2FSHA 1J8MF 2A9KA 3VHLB 3DMDA 4WVFA 3X1DA 3VKWA 1JQJC 2GXUA 3AM1A 4TSFD 1X1SA 4MYCA 1F6BA 1XMJA 3K0EA 2CVHA 1Z2AA 2ORVA 3QF4A 2XB4A 3AF0A 3GD7A 4DLRA 2BMJA 2W0MA 3KFXA 4D0LB 1BOFA 2VA8A 4HUQB 1DE0A 4Q7JB 1G18A 4ZKDA 3BK7A 3HR8A 2VBCA 1R2QA 1KDPA 1XJCA 2HF8A 1NSTA 3I92A 2R65A 2A78A 2ZRAA 4MRPA 4W9MC 3KKPA 1Z0DA 1WB9A 3ADDA 2NG1A 5DHFA 1O3YA 4M2LA 4KSCA 2FE4A 5JSZA 1G7RA 3T1QA 1VECA 3QNUA 1M8PA 5HCNA 2BEKA 2OXCA 1M7GA 1XWIA 2ZR9A 3C5CA 2WHXA 3LLMA 3LRPA 2J46A 2DPXA 3QI2A 3WYFA 4B48A 4DXAA 4ZIRB 5E95A 1Q22A 3HPRA 3MGCA 3U4QA 2H8KA 4P33A 1XPUA 5JS7A 3LV8A 1XD8A 4Q00A 4Q9IA 3TE6A 1KOFA 4MH0R 1IN4A 4JVLA 1G8HA 3EZFA 2QMUA 4YONB 3CIOA 3LW7A 1XEXB 1YR8A 3WYGA 5CB6A 2XXAA 1G3UA 2IYRA 4KYIB 3SJCA 2XNSA 3L0PA 3ZLJA 2Q3FA 4W5JA 2ZANA 4WA7A 5EQTA 1OFUX 1Z06A 2R6CA 4H9GA 1AZSC 1P75A 1S1MA 2WVJA 3F0TA 3V4FA 4FXPA 4E03A 2FGKA 2HT6A 3L43A 4XTRA 2ANBA 4DUGA 3ADBA 1GTVA 4CT4B 2QPOA 1XFAA 2GBLC 2IS4A 2J0UB 2FX3A 5FTMA 4DIEA 1E2HA 1F2UA 2ODNA 4E22A 4TMZA 6Q21A 4Q4LA 4ZPXA 1PV4A 3V00A 4U7DA 2P2LA 3QXJA 4P4SB 4A92A 5JRJA 4XIGS 2O52A 3AVWA 2HLDA 1RJ9B 3KX2A 4C7OA 4TYNA 2VP9A 1H8HD 3QF7A 1DAGA 4EIWA 1KDOA 2GF0A 1QHHB 2XAUA 2QM8A 1GM5A 1FZQA 4A4DA 3N5CA 1U94A 4C0KA 3IEVA 4LDJA 5TV2A 1NIJA 1KJYA 1KNQA 5FOXA 2KSQA 1R8SA 2IA5A 1E9SA 1IN6A 4GL2A 3BH0A 1A2BA 3RABA 3B1VA 2AXPA 2GDJA 3Q85A 4LBZA 2IS2A 4DCVA 1E2GA 4MKHA 3AVPA 1C1YA 2GCPA 3C4JA 4M9QA 1K6MA 1W2GA 2I1VB 3P27A 5JSZB 4Q48A 1Z63A 3TUZC 4O0MA 1W5TA 1LVGA 2EWVA 2EFDB 5KUTA 1OB5A 4LGMA 3W9YA 3P4YA 4TL8A 3HWSA 2ZYVX 1E1QA 3SZRA 1XZPA 2ZJZA 3K0FB 4PO9A 1G16A 1US8A 1IAQA 5TMPA 2CCGA 1FFHA 4MYTA 5UKDA 3THOA 4RVCA 1AS2A 2AXNA 3OESA 3AGQA 2MSDB 2AL7A 2ZSDA 3C8UA 1XB2A 5CJPA 4C30A 4BFYA 4LBWA 3K9HA 4I1SA 2ZE5A 2OBLA 3K9GA 3FVQA 3EIEA 1OE0A 4I99A 4YXWD 1KI3A 1N0VC 4A0RA 2ZRMA 1T3HA 1Z5ZA 4YDSA 1Q0UA 1LS6A 1Z0JA 3EA0A 2ZSBA 1ZD8A 2GCOB 4EQ6B 3ZIAD 3U6KA 5C18A 1EWRA 1EFUA 3OEED 3L0SA 2IYYA 5CLQA 1X6VA 2F9MA 5AWFC 5DO9A 4PZZA 1ZC3A 4MUBA 4DB4A 1U0JA 2GVDC 4FCWA 4Q1BA 2VQSA 3LH5A 2EFHB 4WW0A 5BXQC 1WA5A 4DSUA 3RSOA 5KNDA 3QXSA 2OLJA 3LXXA 2RAPA 1A4RA 1K8RA 4A2PA 5LD2B 4US1R 2ODWA 2FPMA 3A6PC 3RS2A 4L15A 2ZSFA 2H16A 4KO8A 3GJ6A 3CRW1 4Q01A 3UXMA 1TADA 4I1VA 4NHOA 5GJVC 1KO4A 1CKEA 2QTFA 1NF3A 3LD9A 4NDZA 2H1LA 5BYKA 4GBMA 1T9HA 3NBZC 1FOEB 1E2PA 1KTVA 3Q5EA 4DKXA 4Q4AB 4UNPA 3EZ2A 2C98A 2FMXA 4D6PA 5J40A 3THYA 2ZM5A 4OQNA 4MGIR 2GTPA 2YOFA 5JHHB 3GLIE 3THXB 721PA 3LBNA 2CVFA 3ETLA 4PQYA 4C0QC 4EPVA 3NBXX 1GRNA 3TVDA 2XNDA 1IBRA 3UPUA 1KK2A 1N3BA 1XJQA 4BLTA 3IILA 3KKMA 1LB1B 3S1AB 1ZUIA 2ZYWX 3IQWA 3LNCA 1QHSA 1XD2B 1MABA 1P62B 3GJ7A 4DDTA 2J59A 3CH5A 1Z0FA 3QKRA 1E0SA 4JLKA 4YC7A 1GL7A 3TSWA 1EG7A 2QBYB 2QSZA 1FUKA 3A1SA 1NBMA 3OZXA 4GDFA 4XH9B 4NU0A 2RGDA 3RS0A 3REGA 1IOZA 2FEOA 2BEJA 2H5EA 2OM2A 2PX3A 2VPPA 1J2JA 4EUNA 5AUQA 4C3ZA 1L4YA 2D2EA 3U5ZB 1P9WA 2AHOA 2IUTA 5FFMA 4JMPA 4RD0A 1W7AA 1XXHB 1M34E 5L3SA 3A1WA 2JA1A 2WKPA 1S9DA 2GNOA 2QRNA 3NH6A 1E6CA 3RANA 2J41A 4IOJA 1W47A 1MT0A 4JSYA 4O3MA 2WWWA 2IC5A 2XJ9A 2D4HA 2QT0A 1NVUQ 1UBFA 3AEZA 4CYMA 1TF5A 5FOWA 3TLXA 3PXGA 2ZI6A 3TAHA 5HKKD 2IX3A 4B47A 1COWD 4ARZA 2OO7A 1NIPA 3IKJA 3MRSA 3L82B 5FTLA 1CXZA 5FL7A 4GFDA 2Q9CA 4OHXA 1D9XA 1DARA 1F48A 2ZUCA 2O8DA 1A7JA 1S0UA 1Y63A 2W58A 1ZUHA 3TIFA 4X8MA 4LJAA 3AKCA 2LCFA 4URVR 5HKKA 4P4TA 5B30A 4PC6A 4I1UA 1TUEA 4OBEA 4B44A 3ZIAA 4B3FX 3THYB 3PFIA 1W48A 1YE8A 2MSCB 2QAGA 1ZCAA 1SXJD 3B60A 3LX8A 2C9OA 4LHYA 2DCUA 1R6BX 1A5TA 3L2OB 1VCOA 1T91A 3ECCA 3KFVA 1JECA 2WM9B 3PUZA 4GP6A 1ZNZA 3IUYA 1D8TA 4UJ5A 4RKEA 1U8YA 5KYKA 2JLUA 1G7CA 5EZ5A 2R6AA 4CRWB 1E2KA 1FQJA 4QGGA 4MYHA 4CEHB 2R8RA 2AN9A 2Z83A 1W36B 2IS6A 4LZZA 1DAFA 2RGGA 4MYUA 3BRWD 1D5CA 1SXJC 2SHKA 2OCPA 4OI0A 2FFQA 1NP6A 2GJSA 4U5XA 1E9FA 1HE1C 3SR0A 2V6IA 3NG1A 2XZLA 1W4BA 3BC1A 1WBBA 1P60A 1E99A 5A4JA 5L3RA 2QY9A 3OFND 1ELOA 2VH5R 4DEYA 3I73A 4KLNA 1Z07A 2XTNA 5KOYA 2HT1A 3QG1A 3THWB 5EE0A 1NI3A 3ICEA 3ND8A 3VR3A 1PLLA 4TYWA 2VHJA 3ND9A 1UF9A 2PMKA 1ZM7A 2W6JA 4AI6A 1U90A 4TYYA 4KBFA 2X19A 1GKUB 1NY6A 2VF8A 3IBYA 3K0AB 5GJBA 1KI6A 2VHCA 4QG7A 4XWAA 1JR3D 2PH1A 3H1TA 3U3RA 1KI9A 3QENA 1UPTA 3VKGA 3WMGA 3IEUA 1OKKD 3K09A 5D3MA 3EPLA 1Q1ZA 4KBGA 2RGNC 1ZNYA 4JLJA 1U9IC 5EE9A 3SBDA 3DO6A 2CXXA 1YZTA 4NZYA 1D2EA 2CMKA 2KJQA 4MKGA 3JZMA 1OYYA 4PHTA 4PFSA 3LW8A 5ANRB 2ZREA 4KFUA 2UZ3A 1DOAA 4HB0A 1N6PA 2FZ4A 1VHLA 5G3ZA 1KJWA 1P2SA 3ZZUA 5JLJA 1XPRA 1CJVC 2HDNB 3WYAA 1UBCA 1G3QA 3D31A 1U81A 5AK0A 2NMVA 2BOVA 2CJWB 1KGDA 2C77A 3LFUA 3UG6A 5IDVA 4M4SA 3WP0A 4LV5B 2BMFA 4JL8A 4PZLA 4AYWA 3NBFA 2Y8EA 4PC1A 2ZJOA 3NVAA 1TF7A 1E69A 4D81A 1KY2A 2FA9A 1G3MA 4N3NA 1HH4A 4Z54A 3NXSA 4DDUA 1I2MA 1ZU5A 1JJVA 3ZQ6A 4CIDA 5EE1A 3MCAA 1B0UA 1G41A 2VLIA 4QXAA 2O8CB 1QHNA 2PEYA 4URUR 4HYYA 1E2QA 1N6NA 2VO1A 5AJYA 5FI0B 4D26A 3CPJB 3H4MA 3PCRB 4LOAA 5K8LA 4QJ4A 4LY6A 1T0JB 3CRVA 1GNPA 1KDRA 3WMFA 2EYUA 4MQBA 4PX9A 5GVSA 2QGNA 3K70D 4HDCA 4ACAA 2ZAOA 2JLWA 3LBIA 4B6FA 621PA 3KQNA 4JLPA 3KZ1E 1F2TB 5DSZA 4ZCLA 3T12A 2BM1A 4E09A 5L3SB 3KJIA 1AGPA 4HAYA 2XOKD 1KO1A 3UIEA 4JYBA 4IVPA 4OQMA 1RPZA 3B2EA 5D3MB 4HZUB 2OAQ1 2MMGA 3T61A 3FKQA 3LY5A 1Z3IX 2JDIA 3EIHA 1OT3A 5LB2A 1ESMA 2ZETA 4OHZA 3TR5A 3UMRA 1RIFA 3IIMA 1RKBA 5F3WB 2UKDA 2ZR0A 3W8RA 4A36A 3NEYA 5GADl 4OQLA 3UATA 5TY0A 2QRZA 2WTUA 1KI2A 5EUQB 4A6XA 2QU8A 1XF9A 1Z6XA 1R10A 2JLSA 2B7BA 4LJ8A 2P5TB 2R6GA 4OQFA 1RW4A 4R71A 2BWJA 4Q4HA 1OXXK 4B2IA 3I5YA 5JMTA 2MSEB 1K5GA 4EPWA 4IKEA 2OXRA 3ZVMA 1VCNA 5JFGA 1SXJB 4IVQA 1US8B 3I61A 5JJIA 5KHOC 2YWGA 3MWJA 1QBKC 1Q1EA 1G6HA 2X2EA 2J0QA 1F3OA 1VYVA 1UAAA 3GJXC 1OFHA 2JGNA 1R8QA 1KAOA 1SKQA 5BN4A 1S96A 1LF5A 2PZFA 1JPNA 4W5WA 4Q1DA 4JJZA 4BASA 1IXSB 2GJAA 3E2IA 2GESA 5JEDA 5E3HA 4Q19A 3R20A 3A1UA 4HB2A 3C5HA 5LPNA 3UKDA 3QEJA 3AVYA 1D2MA 4M0LA 1KO5A 2PT5A 2J87A 2G88A 2HV8A 2KE5A 1ZD9A 2JJ2D 1W0JA 4HZUA 4MRRA 1YR9A 1YRAA 1VKJA 2HLDD 3JZAA 3KB2A 2NO0A 2IYQA 3EPKA 4B71A 2A2ZA 4UXIA 2IYZA 1UKVY 2A3RA 4C0LA 1ZU4A 4RFSA 3GLHB 4M1WA 5EXTA 4B75A 4UXJA 1TQDA 3D3QA 3VU9A 3VKHA 1ZNWA 3GJ8A 2QN6A 1N0WA 1CJMA 4RY2A 2CE7A 4PPNA 5TDHA 4JBWA 3IQXA 4L4UA 2CNWA 1DELA 4XVQA 4KI0A 1IONA 1U8ZA 1MV5A 4WOPA 1UJ2A 4AKHA 3GJ4A 2CHQA 4GNKA 1MO3A 2ZRNA 2JLYA 3T06B 2GWHA 3ZZ0A 3X1WA 2AKYA 1CP2A 1TF2A 1N5JA 2VP6A 3LA6A 4R2IA 1A2KC 1AM4D 3TH5A 1Z29A 2PCJA 3R9WA 2IK8A 4LC1A 2N46A 3X1ZA 3CPEA 4FWIB 4B3DA 2BV3A 2IXFA 1BKDR 1XU4A 2JJ8A 4AYXA 2V6JA 3CWQA 4BLPA 4AC9A 4V0LA 1NMZA 2QUZA 2VHQA 1OYWA 3TQFA 3Q8XB 2QMOA 3OEHA 1GUAA 3PG5A 3P4XA 3NHBA 2WWGA 4DJTA 2G83A 1BIFA 2OFOA 1OXSC 2JCSA 3PUVA 4B2LA 4BFSA 3TGPA 1KZGB 4DCNA 1EX7A 1UKEA 2VP0A 4LYAA 5LB4A 1XD2A 3QBVA 4JIMA 2CBZA 2AX4A 5E7JA 4BPBA 4XD7D 3ZD6A 1VTKA 4A8JA 2EQBA 2F1RA 5DNYB 3TSZA 5D3QA 1NKTA 5C4MA 3FKSA 1W4CA 4TMVA 1OIWA 1PUJA 4HLUC 1OSNA 2WSMA 5FBQB 1GG2A 2REBA 5IT5A 5FL7D 4PTLA 1H8EA 1QG4A 1S2MA 4B3BA 1E2NA 4BGDA 3B7GA 2IWRA 3RAPR 1EFHA 3ZVNA 2ZI7A 4Q1EA 1I4LD 3T1OA 4EJSA 1JEDA 4R98A 1BYUA 3H0KA 1KMHA 3Q9LA 3TUIC 1TPZA 3HDTA 3QG5A 2BKUA 2DR3A 2WWYA 4DRZA 4IW3B 5TB5A 2IHYA 3T5DA 5FPYA 4KU4A 3SC3A 2BVNA 5KDLA 5FUYA 1P7CA 4FW9A 3W90A 4QHYA 1IY2A 3VNUA 2ANCA 4DVGA 3CO5A 1Q57A 4URXR 1SGWA 3A1VA 1S9HA 3EAQA 3KQHA 3U7HB 2ZI9A 1YZKA 2ATXA 1OB2A 1S3SA 2IEZA 4JBXA 1RE0A 4Z8YA 5J4YA 3OIWA 5TXGA 2HXSA 4Q21A 3W3ZB 3SJBA 2WIAA 4C7OB 5BYJA 1HTWA 2YOHA 4NBSA 1JQLB 2DWQA 4UQOA 5A0FA 4A1FA 2H17A 1L2TA 2BM0A 3LWNA 1RYFA 1XTSA 2JDID 1SVLA 2IF0A 2D7DA 2J1LA 3MD0A 4PSVA 5FPHA 4DCUA 1G4AE 1KK1A 1HYQA 4C4PA 4TQ9A 2QPTA 3NTUA 1II0A 1MKYA 3KJGA 4FCVA 1WE2A 3H84A 1AKEA 1JNYA 4MGYR 2AR7A 4KXFB 4QHSA 4Q9KA 3VAAA 4LV6A 2VRWA 5G41A 2ZYUX 4J0QA 2GZHA 2R6FA 3AH8A 2CDNA 2QT1A 2W6JD 4TTRA 3M4YA 1IN7A 4ZI2A 3WNBA 3GFPA 5JECA 3FTQA 4OHWA 2OE2A 2OFXA 3GJ0A 4URWR 4LHVA 2QNRA 4B6EA 3WP1B 1XBTA 1U99A 2ZJYA 3CBQA 4BFZA 4ZIRA 1NMXA 1OKKA 2ECKA 4YMVA 1XTRA 2VP4A 1JB1A 1RYHA 5FTKA 2Q6TA 4TZ0A 1PJRA 4LV8B 1Z0AA 2FWRA 1R0WA 3CNLA 3I72A 4OQXA 1SKYE 2V55B 2GJ9A 4G5GA 3JVUA 3T15A 2CLDX 2ZYTX 4WXRA 3EG5A 4OK3A 4QBFA 1XX6A 2YWEA 1AIPA 4I1OA 3EW9A 4L9WA 4PXAA 3GLFA 3RYTC 2WPDA 1KSHA 4IFEA 1WMSA 2C96A 1OHHD 1OXVA 2WMOB 3SQWA 1CRPA 2QQ0A 1P3JA 2D06A 4K81B 4RD4A 1NY5A 4ZDKA 5JWRA 1SVOA 4JLBA 2ZRBA 4LX0A 3NIBA 1U0LA 1U2RA 4B3XA 3F5FA 5BN5A 2CEAA 5EXSA 1MABB 4AYTA 1W2HA 3O8CA 3TQCA 1UDXA 4RKFA 4DHEA 1M2OB 2IUSA 4CEJB 1L8QA 4C9BA 3RC3A 3BGWA 3N70A 1GRRA 2HJGA 3THWA 3SNHA 3UWKA 4RZXA 1XCPA 2V3CC 2KB0A 3T1TA 1NRJB 4TWZA 4YMTA 2I3BA 1E0JA 1E32A 2PLRA 4PHHA 2G6BA 2HEIA 2WV9A 1FQKA 2WWIA 2V54A 4HEJA 4GZMA 4I4LA 2C2HA 2QEQA 3R7WA 2E9SA 1YZLA
chains in the Genus database with same CATH superfamily
3EY4A 4FEAA 2F55A 5FNVB 2B98A 5FBLB 3WFIA 2R7KA 1NJ2A 4KSYA 2A0YA 1FFGA 1A88A 5AJWA 3ZLVA 4ZZIA 2JLVA 4FDMA 3EVGA 2Y1XA 5TQ0B 3WBFA 4GGPA 2PD4A 3VDRA 2V8OA 1B8UA 4DLTA 5IMSA 3B8HA 2RHDA 1L1RA 1NBEA 2C9DA 3OCYA 1I9CA 3B2QA 3LQRA 4WTOA 5JDCC 2AZMA 3QVKA 4AUNA 1NN1A 2BKVA 4OFXA 2X2FA 1NM5C 2CYBA 3SYMA 4DSOA 3A58B 4I2VA 2Q3BA 1BWSA 4LKOA 2AMYA 1Z6QA 4FCCA 4TT8A 3GUVA 1VI5A 4NJEB 2I2DA 4HSEA 5KTOA 2XB6A 4GI7A 3A70A 1MOQA 3D8BA 4LK3A 2CD9A 1GCAA 3AUJB 3FOEC 1VSVA 2HWWA 2RB5A 2YJ6A 3OX3A 2MJLA 1OH8A 4R3WA 3OT4A 5B1IA 3H5OA 3KVRA 3WLNA 4RV4A 3IA2A 4JJ8A 2R2AA 2QRHA 1B0AA 1Z36A 1EU1A 4JNCA 3RTAA 2Q1XA 4YRTA 3TR0A 4KYVA 3VR4D 4EL0A 1F51E 2VXCA 5AYVA 3VX4A 4NEQA 4HLDA 4XGKA 1X8KA 5G40A 2AOUB 4HDNB 1GEGA 4LFBB 4U63A 1A9TA 1Z35A 3MWLA 4PTZA 5IP5A 3V42A 2PNJA 2WJGA 4BNDB 4EENA 2JCGA 3H5RA 4IGFA 4NAHA 4YRCA 4BRUA 1MR3F 4MVJD 5AIAA 4L8FA 3U9SA 4DLXA 2P2SA 2RB4A 4LJKA 1VJRA 4Y6SA 4FYKA 5JNLA 4P0QB 5AQEA 1FTSA 3DMPA 3JYPA 1ULTA 1AHPA 3RYFA 4RVSA 1LBHA 2SKCA 1C1XB 3IBGA 1I5RA 3FVWA 1ULHA 5C2JB 3F2IA 3ES9A 5B6IA 4WZBE 1IZ0A 4PR3A 4PGHA 4R1PA 1NUTA 3SZOA 5LWHA 1CR0A 5CR9A 1C8LA 3OQNA 1F20A 1YVDA 2YN2A 1UP7A 1V1RB 4N0QA 4QGFA 4UU0A 5PNTA 1C8VB 4KVAA 2XYHA 4PRYA 5JH7F 5G3YA 2XGJA 4MR9A 2J6IA 3DM9B 2AWNA 4BFWA 2HCJB 2R66A 1TQHA 1XKTA 2XEDA 4LOIA 4M0CA 4BP8A 1VDZA 1GPYA 2FP3A 2J5KA 3C16C 2GZ1A 4C7MA 4R8KA 3DZDA 3WR5A 3ONFA 2K6GA 3DOOA 3QBJA 4L4SA 1PRYA 1JIUA 3V9PA 2Q0XA 1NURA 5BUZA 4L74A 1OXUA 3OD1A 3JQAB 2O4UX 2G28A 3DKPA 3KK0A 1ZGBA 3DAYA 4JFAA 3KPVA 4EPXA 1TTTA 2FR8A 521PA 1S5PA 4F2PA 3KETA 2WHQA 5K3AA 5IDYA 3EBPA 1GXSA 1PLKA 3NV9A 1E1RA 1W30A 2QE6A 1GGKA 1E79D 3T8YA 2GJ4A 1C3VA 1NATA 4AKSA 1Y1KE 3WWYA 2ONJA 4ZYUA 1JKFA 3R6GA 4JC5A 2WYOA 1KVQA 4IHJB 3HNRA 4K9QA 3EIQA 4OXNA 2HWUA 1L5LA 5I8WA 2JHFA 2IIPA 4PC2A 1EGQA 2HNAA 4DIOA 3PE3A 3QLVA 1BU5A 5IUJC 4FIDA 4ZCMA 1Y6QA 2PUTA 4Q3NA 2IU0A 1Z83A 5A5GA 3VJMA 1LDMA 3ER9A 2ZROA 3I2IA 1UAGA 1CEEA 5IHPA 4TKUA 1X7XA 1IPEA 2NVBA 2W4QA 4Q03A 3D4PA 2VQ3A 1LZKA 5ERXA 3FROA 4E46A 5L40A 5EJAA 2DKOA 1AX9A 2WVGA 3H86A 3W4JA 2ZDQA 4WNYA 2ZYDA 4IOKA 5H70A 4EYGA 1P4RA 5J5CA 1R5BA 1V3VA 1A69A 1SD2A 2C7VA 4FOSA 1A2QA 1Q83A 2O2ZA 3ML1A 2DQ4A 5AJTA 1MJNA 2CCJA 2IUFA 2WMNB 4N0DA 4C0SA 4AK9A 4RC9A 3EXHC 1N4DA 1FUIA 4Z0PA 4HAXA 4REOA 2PFKA 4N8SA 3AKDA 1LDNA 2YDXA 3E2MA 5KQRA 3Q9NA 2Z1DA 1EWVA 1SIWA 1XQ9A 3DVLA 1NJ6A 4PX2A 3OT1A 5IZ4A 4G8JA 4YRMA 1UC9A 2VJLA 4A10A 4V03A 2PH7A 4DT1A 5LQSA 5KNLA 3CVUA 4DQKA 2ZVQX 1GAEO 4JGGA 2YW2A 4R5MA 5LXTA 3HCEA 5LYYA 4D3FA 5TJHA 3F7MA 1GFZA 3UCEA 1PL7A 2CLLB 1DEHA 4FHDA 1UBGA 4NU8X 4U9IS 3UA3A 3UMBA 3HB5X 5LDDC 4RFSB 5DNAA 2BMEA 1KO7A 2FW6A 3A9UA 3Q3IA 3AKYA 3QYPA 2GYYA 4WXHA 2CLMB 3BA1A 1Z34A 1Z0UA 4P7BA 4R6XA 2EW1A 4EHJA 4QD3A 1UZLA 4DM7A 4MR8A 4R7ZA 1T5BA 1BHJA 1UM8A 2EGGA 4HZGA 3TDMA 5ERYA 1C3OA 5DNDA 2A88A 5KNBD 3RQSA 3IR6A 5HCUA 1QC5B 4MRSA 1CZRA 1ZINA 2AOWA 4JLOA 4RWZA 4JP2A 2GEDA 3PWZA 1DIHA 4GPD1 4PQFA 3SJZA 3B89A 3THRA 5LKRA 2PKQO 3U3JA 2PE5A 4RTQA 3BQ9A 2H7VA 4EKNB 5H68A 1DIAA 1N9GB 2KWIA 1KAEA 4M7OA 1XFDA 3CEPB 4ZTUB 3ZGXA 4E15A 2O2EA 4LYYA 5EI5A 2QVBA 4C2AA 2VF7A 5K3BA 4HDOB 1WV1A 2RHRA 4FKZA 1KBZA 1U2GC 3IEPA 4EY3A 4MAAA 3PR2B 3STHA 1RAFA 2F7SA 3GGCA 3ESZA 4TXMA 4NDAA 2PMCA 4KVFA 3U3DA 2Z3ZA 3AFHA 1C4OA 1BMFD 1FX0B 1CZNA 2GOYA 3LTEA 2CCKA 3QXHA 2ZIXB 4LXUA 3S2FA 3HSKA 2NPOA 5EPEA 3MUOA 4OCZA 2EF1A 2XTMA 3KQTA 2K2WA 2QIPA 2ZRGA 3UH0A 4C6SA 5IRCD 1X0VA 2BDUA 2X22A 3DH0A 2II6A 3FTCA 1PJ2A 3DNFA 3I2GA 4BQQA 4QSMA 1TMGE 2NU6A 3ZNOA 4DJDC 5AI0A 3KT3A 4FFSA 4QUEA 1NV8A 1VXOA 1Z7BA 2VJPA 4Q6BA 3ENNA 4MLDA 1AURA 3WSVA 2OVBA 3I6MA 1CUUA 5KSOA 3FPCA 4WY2A 3EQ9A 1OTYA 2CKMA 2PO5A 4ZT6A 3ZHYA 5A4FS 4HXEB 4HJRA 3RUCA 3DEFA 3FMPB 1GA1A 2P7HA 4GYYA 1JLLB 4O2AA 2FFAA 4WZ6A 5EERA 5EJFA 4ZVNA 4LMPA 4NJMB 3DAHA 3FFWA 2C5BA 4DDWA 3WLRA 3QI7A 2J3DA 4AN0A 3V1MA 2W2MA 3GCGA 4DG5A 5CVEA 3D2BA 5KYTA 1ATIA 1Z28A 2QZJA 3AL3A 3EVEA 2ZU6A 1NRIA 3GEPA 4N3CA 1UQRA 2N9UA 2OZLA 3GJYA 2H29A 3HDQA 3MS4A 4QXRA 3WK5A 2Q4BA 1I13A 4E5VA 5K0CA 3K6SA 1K06A 1Z16A 2OLKA 4L57A 4R8MA 3T7CA 4H7IA 3EF3A 1ZRNA 2X0IA 5HS4A 5E7MA 1F2TA 1QIFA 2JFBA 1DAKA 3JAWA 4NYIQ 4O59O 2PL3A 1DOZA 2X8AA 4ZRMA 5CDFE 1E0AA 3SSNA 3HXKA 1A71A 2YX1A 3TOXA 4DNQA 4DRXA 4I4TF 4NV0A 3IIEA 1CNFA 4C6TA 4WAUA 3B20A 3Q6IA 1S02A 2FNAA 4POAA 3LHSA 1CS0B 3W5DA 3BXZA 1OXBB 3AEUB 3JATB 2RDMA 3BS4A 3PPIA 1KNXA 3OJOA 2A1UA 4I6EA 3KLBA 3EQ2A 3KYIB 4WWHA 1XA3A 4ZAGA 3TN7A 5KSZA 1JRLA 5LR6A 3A05A 2ZPUA 1SXPA 1YZ3A 3PGLA 4NBNA 5FORA 2ZR8A 2FE1A 2AR9A 3OJXA 3PNPA 2EDAA 5ALDA 1YI0A 3WIVA 1XQXA 5LLDA 1FDWA 4IMIB 4U6NA 1YBVA 2BKXA 1NUQA 1PEKE 2I22A 5FHQA 5A3JA 3AILA 3L1IA 3BBPA 2ZAMA 1T5SA 3SXUA 1KVUA 3CUTA 3DUFA 1PBTA 7ADHA 2PS0A 2FQXA 3U7QB 1YHZA 1QDEA 4JZKA 1X8LA 1TQ8A 1MT3A 4NCHA 1VCMA 5CP8A 2PQ0A 4JC0A 4Y1RB 4BLVA 4YUXA 1AO0A 4D8TA 4KWEA 3DWGA 3LMKA 3UXEA 1P5JA 1FFCA 3O90A 4M1OA 1K66A 4X20B 4DF3A 2QJOA 5JD4A 1TFRA 3E82A 4MA5A 4N01A 4WLNA 1P6QA 4I9GA 3VO9A 2A94A 5LQDA 3D0RA 3EEOA 4GX1A 1T35A 4HNHA 4JENA 5J4VA 4Q7LA 1RJEA 4NC9A 3RNLA 1JIJA 3IO5A 4TTSA 1YDWA 2UUBB 3UMFA 3WS7A 3HL4A 1Z5OA 1VJGA 3F5SA 4UFOA 5TGDA 5JS2A 2IYNA 2JFWA 4OQPA 2LCIA 2PM8A 4PPQA 4Y2SA 3R7WB 3UV7A 4AG5A 4DYHA 3GRRA 4ZOQI 4PYLA 3EGVA 1M5TA 3C98A 2GK4A 1O8BA 5I9IA 3UHPA 5EESA 2IODA 1OGYA 3LKVA 1TMKA 3COYA 1UFRA 3R8FA 1GTMA 3KQVA 2DPLA 5ITZA 3RTEA 2QL5A 5BOSA 5CTAA 4Q02A 4LY0A 4XIYA 1SCAA 4WLFA 1U8UA 2ZJ3A 4BQSA 3I62A 1HQCA 2AOTA 3DZJA 1IY0A 2X41A 1Y3DE 4U7PB 2VK4A 3IJRA 3SEZA 2PX8A 3AEUA 1Q0RA 1YS4A 2OGWA 3JATA 4N3AA 4TKVB 4UNNA 5D2CA 2CUZA 4EDFA 5FH9A 2GEBA 3ZX4A 3C14C 2BGJA 1GGMA 3BMCA 4ZK6A 5AW5A 1IUPA 2JGJA 5E2BA 2X0NA 3AM5A 3AP2A 1HY3A 5HPYB 1UXGA 1NUAA 1IFXA 1B7GO 4HQNA 4HNUA 1XEAA 3VMFA 2I6SA 3KE9A 2QUBA 1VL1A 2PEZA 4ETNA 5ADWA 3P2IA 5LZ7A 3TI9A 3I0MA 3H17A 1PD1A 3Q7TA 2I3ZA 2DHCA 2JLAA 2BKEA 3PLRA 2VK1A 1E3WA 3LDFA 2FSFA 4DLZA 3IEMA 4GMXA 3RC7A 1PSWA 2B82A 9MHTA 3ZNPA 2H3EA 1UEXC 4CIVA 1D4AA 1U7WA 4TMXA 5JYBA 1CUDA 2HRBA 2ZK7A 3KDPA 4I50F 1AMUA 3ZXYA 5HKBA 1FDSA 3IHWA 4EITA 4LOKA 4BQNA 1D07A 3K9LA 1PK8A 1YL7A 2W83A 5DMHA 3M5PA 4EG3A 3RAEC 3WB9A 5K8UA 1G66A 1WBDA 1GILA 2D2VA 3OPMA 1T0BA 3K0SA 4I4TA 4HAZA 1SK8A 1DG1G 1A97A 5DE3A 4QUDA 5DI9A 1QC5A 4RE6A 2KYRA 4KSBA 4Q9LA 2RBEA 5JD3A 1V5EA 3OX4A 3PFGA 2Q9AA 4J7CA 4UCXA 5ILOA 1SUSA 4LI3X 1A7AA 4TTQA 2ODEA 2IUEA 4YVFA 2PBFA 4QQFA 2C7OA 3OA0A 3QF4B 2ZE8A 4HPXB 3TXAA 4ISBA 5D1NA 4N8DA 4H6VA 5EUBA 2NVUB 2WOJA 3ZV6A 1RDFA 3E7WA 1IM2A 4FGKA 3IP9A 1R9GA 2O7SA 4I9HA 1ODCA 3BSYA 5CK5A 5LU8A 5FYDA 3AK4A 1QOPB 2C94A 2OWEA 2IPLA 4KK3A 4OHUA 5LA6F 3KDAA 1ZH4A 1MORA 4IFBA 1U98A 2DQKA 3E58A 4F4HA 3WLPA 8LDHA 1KH3A 2QZPA 4YRPA 1UBEA 1M8GA 1CP3A 1T1RA 1Y7PA 2P0AA 4OA5A 2QRMA 4N40A 3MTDA 2CC2A 2V97A 3NGLA 1JEOA 3OUUA 2HYIC 2DGDA 3H97A 1B26A 4KC0A 4A82A 1XPOA 5TC4A 1KEVA 4RU1A 4V0OA 3GRZA 3QBTA 1XRLA 3P2OA 4F45A 2GHIA 3MAJA 1U2SA 3TD9A 3UB2A 3A4LA 3Q7SA 4LWPA 1P7YA 1QHGA 3RR2A 3VM6A 4B80A 1E4VA 1UBOS 3QRWA 1NW5A 2FWBA 3HDJA 4Y0AA 3V4RA 1N6KA 2H0QA 2XSZD 4CKWB 1QUFA 1KYWA 1L1QA 2X6TA 3EZ7A 4Q16A 1ZNQO 4OV6B 4UXHA 4XWKA 1MOZA 3PPYA 1QGYA 1QG2A 3M0EA 1A3CA 3ZS9A 1FMFA 3HCFA 4LTNA 2Y1WA 3ZY6A 3ZHQA 4UKDA 1DBVO 4B81A 4OPMA 2QRJA 3MBOA 5C7YA 1XOIA 3QUTA 4H18A 4CKBB 1P0IA 3TAUA 1LBEA 1DAMA 2AYZA 4FPXA 4RVHA 2O8EB 1AB5A 4O25A 1LCIA 1YIOA 3D8HA 3NP9A 4TL6A 2HI0A 2BEUA 4KW7A 1Z6AA 1J8QA 2KW5A 2P68A 1PAUA 4DJAA 4CXMA 1VA5A 3HUEA 3GEDA 4MYSA 3C5EA 4KR0A 3JQ8B 1GGEA 2XI4A 2AQHA 3LOUA 3PQ6A 3NVKI 5ICGA 1FLAA 2XE8A 4NHEA 1JHPA 3MJDA 4QNRA 4ZEMA 2B4AA 4YT8A 4PC3A 5EKUA 1CIPA 3R0VA 4LOHA 1LVHA 3GH3A 2C57A 1CUJA 3GNTA 1DG3A 2XD9A 4YJHA 4OEHA 1HDIA 1V8OA 2GK7A 4LZPA 2IYSA 4W1QA 5E7IA 3RVDA 1F38A 4QTXA 3UG7A 2CNDA 4DWVA 3NS7A 3VRHA 1RZRD 1Z0ZA 3R7AA 5CT5A 4JT8A 2Q49A 3NHMA 3DCJA 5JAIA 2B5VA 2Q1SA 4C0JA 1AH2A 1UMDB 4MEAA 5G1NA 3K1YA 3H05A 3K2BA 3MQ2A 5KYWA 3BIFA 1G8PA 2EBUA 1X19A 5DDIP 3R3XA 2B1GA 1HL7A 3OEEA 5KC9A 2OBMA 3A04A 2IUYA 5KPDA 1RVV1 1X7DA 1WDLA 5ICEA 1ECCA 1FSFA 1EB8A 1VLMA 3ULKA 4L0CA 3X2EA 4X1OA 4ZT5A 1VM6A 2PD6A 4XX1A 1JKXA 2B1JA 3Q5DA 1JDUA 1FBTA 1QH8A 1FMJA 3ICVA 1WP9A 5BUCA 3WAGA 1AG9A 5I8PA 5AW7A 1MC4A 3U39A 5BR8B 3PSHA 2OESA 2OBXA 4AWBA 1JMYA 1VBFA 4BIIA 1LF0A 2FPSA 1ISSA 4LE1A 1ZD5A 4IQGA 7GPBA 1HQYE 3HI4A 2XKBA 3LG2A 3FDIA 4CDMA 1A95A 4RZQA 2H8GA 2FDCA 4II2A 3RK1A 3SZ3A 4K9NA 3DFIA 3N8HA 4M6WA 5L51A 4GNRA 2BAGA 4NWIA 3V3TA 9LDTA 3AI1A 1MXFA 1NJSA 3DE5X 2NU8A 5BO5A 3WIBA 4E13A 1PZXA 2CL7X 4PZYA 1E3MA 1BW9B 3HZHA 3IPRA 1ADYA 2GJ8A 1V8FA 4HZIA 4PAWA 4QYWA 5FBKA 5J2TF 4HNSA 2XR1A 3BSSA 2GXQA 2K7FA 4Z9AA 4D9NA 5BT8A 1Y34E 4DDVA 3GH1A 1QCZA 1SXIA 1W88A 5M3BA 1LNSA 2BFNA 5ESWA 1FP1D 3AESB 4M7RA 5TSDA 3SF0A 4AJLA 2JVJA 2OENG 3JQ6A 5LQAA 4YXWA 5K8IA 3GGSA 1P4AA 3AFIA 3X1XA 2X0DA 2WF6A 1JBKA 3FGNA 1Z08A 3CT6A 2BF7A 1N1DA 4YRRA 3UT5A 2Y9PB 2ZG6A 2BEVA 4G09A 4HATA 3W5IA 1XDDA 3JR3A 3WL5A 3BIOA 5FPSA 1SEVA 3TPCA 2HBZA 1QXSA 2FETA 4S0XA 1BVHA 2IE0A 4JOSA 1PJAA 2HHLA 4TVOA 4DDMA 3F8WA 3HYTA 4DQVA 3M6MD 2HWXA 1WV0A 3VC7A 4M8IA 5LP1A 2HO5A 4MEBA 4KK4A 1ORRA 3KVVA 3IE2A 1E3JA 1GAWA 5AM2A 3T4EA 1SA0A 1ONBA 1TZCA 2J9ZB 3ADOA 2P9EA 4MQLA 3CF2A 3L77A 1MEJA 4D0NA 3TQSA 3PX3A 3I23A 2H08A 3CW2A 2J33A 2Z98A 3KQWA 2GKOA 2DWPA 4PYOA 3COZA 4RMJA 5CUQA 3TS1A 4BLUA 1EDOA 4YRZA 2QUHA 1BYIA 1Z68A 2GEJA 3I6YA 3NGMA 4KUEA 1ZHHA 2HL6A 4HQ0A 3OJFA 1YA8A 1EXWA 2QN2A 1JXMA 1PHRA 4U8HA 3HEMA 2BFPA 1S2GA 2YMPA 4DL9A 4DC9A 3NWEA 2GCOA 3DDSA 1EVYA 1PCXA 1P4HA 1FYVA 2JJ1D 3R6DA 4AECA 4YALA 2AH5A 1THTA 4JGIA 4EM6A 5BW8A 2GAOA 1LRJA 4BU0A 2QLNA 4EHBA 3K1JA 4H1UA 1UWCA 1FXWA 1PWEA 1WLYA 2G5CA 4L5YA 4ZEXA 2Y92A 3ZDRA 1DBQA 3BQMB 3QJ5A 4BZWA 3MJ4A 1HPLA 2PX0A 4S12A 4DLLA 4TXHA 3AB3A 1NN5A 2LUOA 4Q39A 1VP3A 1VBNA 2QP9X 4I8XA 2BFEA 3WO1A 1CB0A 2D62A 4Q66C 4NL4H 3VPBA 2PFGA 3PNSA 4MR7A 1TD1A 3OEYA 3LT4A 4YBRA 2ZVPX 2OK8A 4OGLA 4RJLA 3T52A 2R7MA 3Q15C 4J7XA 4DHWA 2NQTA 2X3YA 1L5SA 3DHNA 3EDRA 4JBIA 4ZHQB 1RPAA 1IY1A 2Q3EA 5ALHA 3DPSA 5KTRA 3HB7A 2C7GA 1ZAKA 1X1RA 2H4JA 5K0SA 1Z2DA 2WNIA 4IGEA 4KAAA 4M8KA 5E1BA 1Y6FA 4AO7A 3LXUX 1XTIA 1XVLA 3NHAA 3S40A 3U3RA 3GVIA 2I9PA 4HYQA 1IQUA 2BCGY 2W7TA 1V35A 2FDRA 1GOTA 4QDJA 1N36B 5EL0A 1WPQA 3SHFA 3EBOA 3C3JA 2A5FA 5HBRA 5AXCA 4QLBA 4QGHA 2F43A 1K9SA 2VJMB 3GLQA 3RVMA 5DM60 4IEFB 1ZCJA 1XNJA 2H3HA 3AF1A 3KQLA 2REQB 4B6SA 3LQ2A 3SFTA 1SBHA 1IHUA 3VPCA 1C81A 2DU8A 1HUQA 2P9FA 2IRWA 3AVTA 3G89A 2BTQB 1K08A 3S7ZA 1OREA 1JJFA 1MEEA 2HH9A 5DXJA 1BX0A 2GFQA 3IUJA 1EUDB 3KLNA 3BWDD 3U6BA 1M2NA 5DWQA 3IPYA 1RWMA 4GKBA 5L3VA 4ZT3A 2HA5A 3JAMA 4XYGA 1GCOA 1XUOA 4BGUA 1VSQA 2VJDA 3JQAA 4MAMA 1NI4B 3SIWA 2PLFA 3GRVA 4E12A 4EG7A 4L8YA 4L51A 2F6RA 2GCGA 5GVRA 1WDWB 1BGVA 1J7JA 3NOOA 4X41A 1PSZA 4DIMA 1R4NA 4MIOA 1ANKA 5IFKA 2ZYSA 4MGEA 3LUKA 2I0FA 1ORDA 3ZH9B 1G3RA 1U3TA 3H2BA 4YLYA 1MH1A 5JHGB 1QLJA 5JFTA 2WJVA 5AT1A 5EP3A 3PJRA 1JNXX 3QSYA 3DSRA 1AQIA 4JEMA 2BCEA 5K20A 4LPSA 3ORHA 5CK4A 5KNBA 1FS6A 2FN7A 3QXCA 4MQ4A 4WNAA 3RRYA 1HYEA 2FTKE 4JUIA 4IDCA 2ZUDA 1KJ8A 5K0TA 1G19A 5JYEA 4D41A 2INGX 1T9KA 3OCZA 3IHKA 4ZVOA 4ZO4A 1W5EA 2ADFA 4AROA 1S2DA 4FZVA 1R3UA 2W00A 4RXUA 3T5TA 1MVNA 3TFWA 3JVVA 5GIPE 1KDTA 1J5PA 1HURA 1UDCA 2QLBA 2PUCA 4ZJPA 5IZCC 4ARZB 1IDOA 1Q1BA 5TQ2A 4F9TA 3BVPA 3JYQA 4NX2A 4RVUA 5FTNA 4ZYZA 3EW7A 1LU9A 1DPGA 3SJAA 4DV6B 2JLRA 1ZD1A 5JD5A 1TVEA 1SJ9A 4X97A 3H9UA 4GSYA 5LVAA 2YXDA 1R5JA 2RGEA 1DCMA 3CUYA 3DBHA 4MX8A 1W9HA 3KD2A 2CDAA 4HJXA 1C1HA 3RKUA 4GZLA 1ZS9A 4LBYA 5CW2A 1G8MA 1GAXA 1ZRHA 3U5TA 4E5KA 3GP8A 3BKXA 2PA3A 1MGOA 2YWCA 3MWYW 3PQ8A 4X66B 1Y4AE 1D1PA 4LYHA 1ZXBA 3OZIA 4KDRA 1TAGA 4EMBA 4BNIA 2H48A 3OLZA 1FYEA 4M0PA 4EJSC 3ZGOA 1RIIA 2EWWA 1YDHA 3V8BA 1SU7A 1WTCA 1C1XA 2Y3IA 2EDCA 3GIDA 3OCXA 4LECA 5FXMA 5B37A 3UJ9A 1FEZA 4B35A 4F86A 1JX6A 3LOPA 3PITA 4GLLA 4A3SA 1U5AA 2J48A 2X4IA 4CLOB 1RBQA 1HG0A 1W29A 1KQFA 2Q4DA 3ZIUA 4N6GA 2ZB8A 4PSAA 5EOVA 5A0VA 4XWGA 3CRQA 3CVJA 1IC6A 5IUNC 4ZDIA 3CH7A 5EWLA 4X8LA 1FL9A 1Z15A 4JWKA 1WZ2A 5DEIA 4RXMA 1T10A 1Z0KA 1ISPA 1VHDA 3ZXIA 5H16A 1X7XB 2AC7A 1DAHA 3FBWA 1UBMS 2I55A 4ILKA 3K70C 1NDQA 2QR5A 3GMDA 3JVIA 2R5FA 2V4ZA 4X1IA 3ICPA 1EGAA 1MC5A 1FLVA 3ANYB 3DTVB 4I1RA 3S2EA 3ER6A 3TM5A 4QL3A 3PQ7A 4BQPA 3LCUA 1E9CA 1IB0A 4XM0A 5HVNA 2B3DA 1QQTA 3CEJA 2PHZA 1WPXA 3L7MA 1U5BB 2VZLA 4M37A 4GP7A 2WAMA 2YINC 1RWKA 4FFMA 1YO6A 2BMVA 3BB4A 1Q15A 5AKYA 1I2DA 3JU3A 4F84A 3FPBA 3N8GA 4AS1A 2VPZA 2VJCA 4EY6A 4RCYA 1YZYA 4Q9DA 2GXAA 1G7SA 1XHLA 2P91A 2L17A 5BWCA 5J2UA 1GPKA 4JFRA 2MCFA 2FPIB 3O1JC 6GPBA 3AUYA 2BF4A 3BMQA 2V0GA 1X1CA 3G8CA 2DYKA 5CCDA 2VJQA 3PNOA 1V5FA 4V1CB 1E2DA 5AJXA 4Y6GB 4G8DA 3ORSA 4AP6A 1PUIA 3L7IA 4H7DA 2CXRA 1FXUA 1LK5A 2EEPA 4B32A 1JHMA 4IH1A 3I2YX 3PZRA 5FOTA 2FB9A 1AZWA 3IP5A 3PV0A 1SBNE 3SS8A 1IZ8A 3ZLTA 4EB8A 3TZHA 1LXCA 1WHSB 4PS1A 3W2HA 1JSCA 1ZMOA 2PU7A 1X8JA 4PRLA 1FF9A 4PLFA 5IKPA 4NULA 4YRLA 3CQ9A 1S01A 3MTEA 4V3CA 1IK4A 2I66A 3F47A 4LDRA 4DJ5X 4N76A 1I2AA 2NZ8A 3QEOA 2XB2A 5DGCA 3R7DA 2HGSA 2BFOA 2EKQA 2QBYA 1MV8A 1ZNXA 2AUMA 1HDXA 5EUCA 2FFBA 2KLBA 4W7SA 2EARA 3RFTA 2D2XA 1F14A 2XZOA 1UXOA 4CI0B 4RKYA 3RSHA 4CKXA 4MUXA 3M2TA 2BR4A 4QYIA 4CJXA 2H31A 4ZN6A 5HHTA 3WGQA 3I5MA 1JZQA 3BXOA 3HSSA 4MGHA 2W6ZA 2BH9A 4IJUA 2XT9A 4BJ1A 2ZKLA 4N1AA 5AHOA 2B6HA 5TVGA 1UWKA 1A8QA 4HH3C 4KFRA 4YJGB 3AJ9A 3TQIA 1U1EA 1K4KA 2R84A 1NVKA 2R44A 1AS0A 2EG5A 2G4LA 5LZ8A 3GBPA 2X42A 1ZZEA 2DHRA 5K0BA 2FQWA 1DWPA 1V1JA 1L8OA 3GF4A 2MMCA 3JQPA 5CLLA 3TWOA 1AN0A 4BJ3A 5CDYA 1X74A 4TV8F 1W36D 4JP1A 3EX7C 2WB2A 1W581 3PRHA 4EO4A 2L42A 4CQMB 4FMBB 1SOUA 1T2EA 3RT7A 3OP1A 1V7CA 4BFVA 4E94A 3U7IA 5A5FA 1OWPA 1KY3A 4XEUA 5AICA 5CFLA 1IBMB 4RZ2A 1OVMA 1SHKA 3ETHA 4EL5A 2V96A 3QPVA 1K86A 2IVFA 3HXLA 4MUMA 4UCFA 2MIIA 3EG9B 3GLIB 2JGEA 4EA9A 3U31A 3EF1A 1PS0A 4N82A 4AZWA 2QV7A 2C8JA 4LVCA 5E4JA 1X14A 2FN3A 1A9SA 3G1UA 1VLLA 1J24A 3GDFA 1Z8FA 4Y7DA 5HDBB 3G5AA 2QUKA 4XJSA 1YDGA 1PJLA 2C4NA 1DKRA 4NEGA 1WKBA 4F1KA 1E3LA 3OLQA 2CNBA 4IWNA 3WKDA 3ELUA 3K0AA 4R9UC 2OZLB 5DX1A 5F5NA 2A9FA 3DLBA 5AM1A 1JJAA 2AG5A 3G2JA 2GRAA 2NUAB 1QWSA 4I0WB 1A50B 1G9SA 2A7QA 1GN9A 1KYVA 3OCJA 4KR2A 1FQOA 1Z0SA 1YAJA 4REQB 2JBAB 5JC1A 4J29A 1W0KD 2PZEA 3O4VA 4UHKA 1ZA2A 5A6SB 4WESB 3C43A 1LEHA 1KARA 4BKPA 1FSZA 1YS6A 3TOVA 2QNIA 2AV6A 1J2UA 1EINA 3I52A 2J3KA 2JGFA 2OT3B 3T5AA 1AN9A 3A1NA 1Z6YA 1PEAA 5JXGA 3NHKA 1IWPB 1UBRS 2XGMA 2XRMA 4NH0A 4M0MA 2IZ6A 2ZYRA 3R3VA 5B36A 1B8PA 3SLGA 4DBLC 3UANA 2YIVX 1IK6A 3CUKA 5DM2A 3FKSD 1EB9A 5K3FA 1Y7TA 2JD2A 1TIBA 4EGJA 1MX1A 1S7CA 1AVTA 4I9NA 2BGIA 2APJA 5TARA 1S8FA 4YR7A 5CLJA 2H2AA 2VEDA 1XZQA 1EVEA 5KNBH 4N8EA 2H1OA 4J4BA 4C1NA 1J70A 3BJZA 3M7IA 4FFVA 5J58A 3KKEA 1YZHA 3PKZA 4CNBA 1CDZA 3FOCA 1GZHB 4FNOA 1AUOA 1IXRC 3VH4A 1RM3A 2UYYA 3KL4A 1TX4B 2J0UA 5I47A 4RSRA 3FF4A 3ONEA 4MINA 1XMXA 3KNZA 2IYPA 4NABA 2RC5A 4TZTA 4PLTA 3IQGX 2QIOA 3GP3A 4PFKA 4HDSA 4WOJA 5J63A 3V1YA 2YJZA 4D4LA 5K0JA 3DXXA 2IKQA 4IGAA 4Q7EA 1ZO8A 4M1YA 2FEMA 5TRTA 5CYOA 3TZKA 4ZCRA 4RVFA 2ZRIA 4EMUA 2VC2B 1W87A 5LWQA 4HO1X 5AW6A 1THMA 4ISCA 4PYQA 1O5OA 3RAGA 2UVQA 4QUBA 4WN9A 3DOFA 4PG6A 1M1UA 4D44A 3MHPA 2CMGA 3C41J 4FOTA 1MRNA 2MYPA 1GL6A 3ESDA 4U3JA 3WL3A 4LZAA 4YUWA 1T2CA 2P4HX 4US0R 3LY7A 4COOA 2JLZA 1A8HA 4ILEA 4LTMA 4UPDA 2EKBA 4O2LA 3CZ5A 2RMKA 5H1YA 4XVUA 2OYSA 1QOQB 4N49A 4E2YA 5DLQC 1GGNA 5CLHA 1HTTA 1JDTA 2W8BB 1ZMRA 3ZW7A 4ZO8A 1HKUA 1KRHA 5T4EA 4ENPA 3PGA1 2HU8A 3QVOA 3UMCA 1TZMA 1KZ9A 1OH5A 3UOWA 2P9CA 3WL7A 4KH1A 4X1IB 5AKZA 1G5PA 1ZM3A 1NVDA 1M10A 2OC9A 4RD2A 3OLVA 4Z51A 1L6IA 1IU9A 2BFWA 2HDWA 2QYTA 2V7VA 4D3ZA 4DLAA 4XB1A 4E6EA 4BAGA 5E0OA 1M8FA 2W6OA 3DE4X 5SZIA 1L5NA 3WHLA 2GHTA 2AT1A 1VSBA 2DY0A 4AXBA 1SHLA 3MJRA 4AURA 4LSWA 3DMYA 5DVZA 3EPRA 2NO9A 4HD8A 3R9IA 4B7UA 4JUDX 1AZTA 4A73A 1A9ZA 2PGAA 3H13A 3V32A 3UT6A 2O8BA 3GLUA 4TLCA 3JQRA 3W2EA 2P0YA 4QOIA 4XI9A 4HEA1 1M1ZA 1H69A 3WNVA 3RJMA 3RU7A 2AQ8A 1T5DX 3RS4A 2BISA 5E2IA 3UAOA 3IC5A 2RHOA 1BMTA 1LRLA 3P9QA 1KU0A 5C3UA 2FDXA 3AZOA 1KP3A 4QPJC 3WYDA 5M2QA 5B5SA 1MO5A 2Q6IA 2ZSJA 3Q10A 5K45A 1JV2B 3WADA 2HV9A 1QJ4A 2QJTA 3EC2A 3ZOKA 3OA2A 1XQVA 3EYWA 4JV5B 2HCBA 4NP6A 1QIDA 1T0HB 1W4RA 2G5PA 3H5WA 3UJ7A 4F2GA 1N9KA 4Z8XA 4FSHA 1W1IA 1HEUA 1N2CA 3FA2A 3NT2A 4Q7QA 2CF6A 4GI5A 2YXEA 1R1DA 1GPH1 1Q7TA 5A03A 4O2BB 1FP2A 4G1FA 3A6JA 1M1YA 1WSDA 3CLHA 4INOA 3PKJA 5CT4A 2FSIA 4LEIA 5AVWA 3HKDB 4XX0B 5K0LA 3OFJA 4ME6A 3SEFA 5G02A 1JR3E 4PAQA 5D85A 3V4PB 3N74A 3RRNA 3CX6A 4JXKA 1QKIA 2OHFA 1ZVJA 5ALEA 4X62B 3NHUA 4PYJA 2ZXEA 5FRDA 4ZREA 1P9RA 3M6VA 3P4UA 5EMLA 4FDAA 5K3SA 3AHDA 1S2NA 4KQ6A 4PEVA 1QP4A 2WF8A 2NSJA 4ZDWA 2QTMA 4K8OA 2BLLA 3UJNA 4P3OA 1C80A 3AEQB 1ML3A 5KJEA 1RLOA 2OCYC 3FYHA 3LT5A 3OE4A 3QMPA 4W5OA 4A26A 3VNVA 3T99A 3GEMA 5B7NA 3NBYC 4FYJA 4YWHA 2P69A 1O94D 2Z6AA 1RM0A 5F5LA 3AXSA 5IT4A 5D87A 2PO7A 2PKRA 5JEEA 2QE7D 2D3WA 4G0NA 1XZCA 2EHDA 2CHVA 3ZV3A 4D3SA 1GUBA 3R8XA 3IAXA 4YJ2B 4GT1A 3OQOA 4PPGA 1X87A 2HFJA 4O8ZA 4OK5A 1NM5A 3UK1A 1Z2CA 4UHEA 1RHUA 3W7BA 2IIQA 1Z6GA 1WXWA 5JAQA 3FHTA 5EMNA 4IIJB 5JT1A 5DCYA 4EYOA 2GEVA 4YJFB 4GG1A 3U40A 2OP1A 5AK5A 3JRXA 4KOAA 2DSTA 4BBZA 2B94A 2Q0QA 2F90A 3GK3A 2P2DA 4XVHA 1GQQA 2D2IA 2ZTSA 3PF8A 1Y8QB 2O0JA 2G71A 3N2EA 3O3MB 4V1CA 5JROA 2H06A 2HU2A 1G5HA 3KEMA 4RYDA 5EA2A 3SEAA 3NRCA 1EVKA 2A5LA 1SC3A 1MD9A 2V9ZA 1CEQA 5BNZA 1DTWB 1JMVA 3TTTA 1E9RA 2QMQA 1TPYA 3ORYA 4R5HA 4W8OA 1QG6A 3FRJA 1VCHA 2JI7A 4UTXA 3AP3A 4XYEA 1QGDA 2Z4SA 4JBNA 1DEKA 2O7RA 4MR9B 1ABBA 5FKJA 3SHOA 1K8XB 3ZD9A 3A4MA 3PXBA 1TCAA 2CL5A 3OO1A 3VZDA 4ZFNA 1NU6A 3UK6A 3F6BX 3IELA 5KDDA 1D6SA 4WPGA 2PJDA 2JLQA 3RC8A 2IDJA 1EFRD 2F1IA 4D45A 3U7EB 1FCJA 4CHGA 4YAKA 2BMWA 3CLTD 2X1MA 4D02A 5KYNA 1JHXA 3ETNA 4HMQA 1KIFA 3VUFA 3HTXA 1L4UA 2QRKA 4BX2A 1XO1A 4EX7A 1K8QA 3T7KA 4MCAA 4OSOA 4ZO6A 3KDSE 2V7UA 2ZJ8A 2I65A 3N07A 1M1YE 3IMEA 4UQLA 4WLUA 3INTA