4LHXA

Crystal structure of nucleotide-free rab8:rabin8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
175
structure length
175
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 53
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhxA00
2DR3A 3T5GA 2IYSA 4JKYA 2ZRMA 3AGPA 4YMSA 2PJZA 3IILA 5EXPA 3IHWA 4C0AC 2GJAA 4UXJA 1IQPA 2OLKA 4V0OA 3PXGA 1ZD9A 4FCVA 1W4BA 4Q47A 4O3MA 4NDZA 2VPPA 1W0KD 4S2EA 5FUYA 1KSGA 4I81A 2XOKA 1YQTA 2IS1A 4K81B 2KE5A 3THOA 2XTZA 1YZKA 1VIYA 3NBZC 2Z83A 3GLFE 4A36A 4BZXA 2ZITA 1RRGA 2OM2A 3CX6A 4I99A 5AJXA 1RIFA 1II0A 1M74A 3R20A 1E2FA 1G9XA 3MAAC 2BKEA 3UXMA 5B64A 3CKLA 5F2EA 1IXSB 5JMTA 1XTJA 4FN5A 1EG7A 2OCBA 2K5UA 4LPKA 3CH5A 3EWSA 4OQMA 1N6PA 2FMXA 4RY2A 3VMFA 3P4YA 2IYQA 5B57C 3DHWC 5FPHA 4Q9IA 4C7OA 2O0HA 2HDNB 4V02A 1OH6A 3UIEA 2N46A 2QBYB 1E1RD 1FL9A 5D3QA 4W9MC 2J59A 2PJRA 1D5CA 3CWZA 3SOPA 1J90A 3EPHA 1AQUA 3WYFA 2B6HA 4Q1AA 1CF4A 1QHNA 2AKYA 4MYUA 2ZUDA 1FX0A 4V03A 4NKRA 4XVUA 4HAWA 2ZRCA 3UANA 1P5ZB 5DN6A 3SE0A 1FX0B 2ZPTX 4ITRC 4TSFA 1Z07A 2FOLA 4KLZA 4KV9A 5FPSA 1AJEA 3K70D 4YMTA 4BLTA 3A1SA 4LI0A 1DAKA 5DISB 4A4DA 4AI6A 4RD3A 2EWWA 2V3CC 4US1R 1NVUQ 4NTZA 2XB4A 4FW9A 1ZIPA 2XJ9A 3LW8A 1N0VC 2AXNA 1KJWA 3BJIC 2YOGA 1WBDA 421PA 2WSMA 4KU4A 1T5IA 3U3RA 4AYTA 2ZXUA 4B6EA 3N2EA 4B75A 3CZQA 2R62A 5IDVA 3AVWA 2OXRA 3PCRB 2CNWD 1OW3B 3W9YA 4JT2A 1GITA 2G6BA 1FTSA 3B1YA 2JLXA 5K8TA 1NNEA 1E9AA 2WOJA 4TMZA 4JYBA 1PJRA 1W4RA 2ZU0C 4MRSA 2O8EA 3QKRA 4XD7A 2X77A 4LV5B 2KSQA 4A0FA 2ZS7A 4TTQA 2O8EB 2QNRA 1G4AE 3DPUA 4KSBA 1OV4A 1JR6A 2EFHB 4IFBA 1QHYA 1C9KA 1ELOA 4Q7JB 1OFIA 4ZDKA 1AZTA 1N5KA 1Z8FA 4GI7A 3EZFA 4JBXA 4FMCB 1G3QA 4KCGA 4OHXA 1SGWA 3RRNA 3W8NA 4WZBE 1ESMA 2O8FB 1XMIA 4OQXA 2B7CA 1YZLA 1DOAA 4OK3A 4Z8YA 5JWHA 4RD0A 1Z2AA 2CJWA 5JLJA 2ODNA 2V7QA 3WRXC 4B33A 1HUQA 2ZRHA 2P6UA 1I4DD 2GA8A 1UADA 5FBWB 1EESA 2CJWB 2PH1A 2AXPA 4UNPA 2H8KA 4DSOA 3K9NA 4Q1CA 4A8JA 1UBFA 2G77B 3SJZA 1JR3A 4DZZA 3OEHA 1JJVA 1AM4D 4QOSA 5LD2C 3RYTC 4MRVA 1E98A 1ZW6A 5TV2A 2Z4RA 1ZP6A 1ZNZA 2F6RA 3FMPB 3NC1C 3VKGA 1WQ1R 2OHFA 2ZI7A 1KZGB 5HKKA 4DRZA 1SXJA 2YWEA 4AIIA 2F9MA 3GJXC 5F3WB 3QPVA 4R9UC 4MGKR 2OBLA 4ARZA 1GTVA 2F43A 3R9XA 2V8OA 1HYQA 2ZI9A 4KYUA 3L0IB 5LD2B 4G1UC 5DH9A 2E87A 1ZCBA 2IXEA 4TMXA 1X8LA 3ZD6A 1US8A 2DWOA 2ORIA 2IYWA 4FCWA 2YYZA 1OH7A 4Q1EA 3TE6A 4WVFA 4KLNA 1OLOA 1IN4A 521PA 2VHCA 1X1SA 3UMSA 2PBRA 4IXMA 1NY6A 1KJYA 3K0FB 3C16C 1DG3A 2YINC 4Y0VA 2W2XA 3ZGXA 4L5BA 4BEJA 1M6NA 1U99A 3LAWA 4YC7A 2R6FA 5FL7A 2OO7A 4PC3A 1G17A 2QORA 1TEXA 3IQWA 3GQBA 4BQSA 2YOHA 3ZS8A 3K0EA 2BCJQ 3GJ7A 2X19A 1LB1B 2BMEA 3R7WA 3UWKA 2OAP1 3BD9A 3Q5EA 2RCNA 3TAHA 4BRUA 2FFQA 1XDBA 2HCJB 1VG8A 2RGNC 1MR3F 3IBYA 4M9QA 4OYHA 2F55A 2IYVA 3LDAA 3R7WB 4TZ0A 3KB2A 3CPJB 4A2WA 2OFWA 2F1JA 2D4HA 4QGFA 4LJ6A 2GEDA 3SZRA 1KSHA 3UATA 4UNNA 3K09A 3M0EA 2IHYA 1S0UA 4Q1BA 2RGNA 1SKYB 2ZRIA 4OHVA 4QXAA 3SN6A 4XWOA 3GLIA 3NBFA 3E5HA 5AJZA 4XTRA 3P27A 2PCJA 3THWA 5FBRB 3DDCA 3A1TA 3ZIAD 1VCOA 1WF3A 2XAUA 4JBWA 1QG4A 3GLHE 2IUTA 2RGGA 2ASEA 1G5PA 2WAYA 3GFPA 3ADKA 5J4KA 3PV0A 4D0GA 5HR5A 4TL9A 4WA7A 2J0UA 3RS2A 4C0JA 5JFGA 3LW7A 3M6AA 1WA5A 4G5SA 5E4FA 1VYUA 4IJMA 1CR4A 4ZDWA 4GRAA 5G53C 3FMFA 4C0LA 3RS7A 3DMNA 3U6KA 4TZ6A 1IN7A 1KTVA 4RJLA 4ZCMA 3QKSA 4Q4JB 1M34E 2HXSA 4MUAA 1TX4B 4EKDA 2GAOA 3BWDD 4PTLA 4TYPA 4Q4JA 3V4RA 4ASUA 3NKVA 4M9ZA 1MRSA 3CUEF 5A5GA 2V1UA 5TARA 4TLBA 1XD9A 2BEKA 3O47A 2J7KA 1OKKD 2RGDA 2ORVA 5FTNA 4M21A 4HI0E 3GJ6A 1TU3A 1BMFA 4Q4HA 1ZNXA 4RZUA 2XXAA 4M9XA 4DSNA 4PHTA 2PLFA 2QEQA 1WRBA 2ZRNA 3KQLA 4Q4HB 1GRRA 3RWMB 2IXGA 2A5GA 1SHZA 5KSPA 1VPLA 3EA0A 3KXLA 1GOTA 5DI3B 5KOYA 3RS5A 4URYR 2PT5A 2C8VA 3QF4A 5KTYA 1J70A 4UJ3A 4F92B 1NN5A 1UF9A 3H84A 3D3QA 3EC2A 2B92A 1X8KA 2J5XA 1E2GA 2A5FA 4LDJA 1JI0A 1DAEA 3NXSA 3TW8B 2TMKA 3MFYA 3NDPA 3SU8A 2GNOA 2D7CA 3TR0A 4HLQB 2ZM5A 2J7PA 2ZYUX 3QF7A 2J0SA 1XRJA 3VR5A 1D9ZA 2CHQA 2FX3A 1U9IC 2NO6A 3HU1A 1CU1A 4GSYA 4QBFA 4QHSA 4IW3B 3BERA 4IDOA 2GEUA 2VLIA 3GLFB 2O8CB 1S9HA 3HPRA 4BPBA 4G3XA 4EQ6A 3IIMA 1NVXQ 2OXCA 4KBGA 4OL0A 4M2LA 3W6OA 1YR9A 4DVGA 4FIDA 3AF3A 1XXHE 3CRQA 4ZIRA 4GL2A 1ONBA 4EFMA 5DHAA 3T1VA 3V4FA 1GNQA 4BRWA 4B47A 1P3JA 4IFEA 3ZVLA 1T6NA 5FBQB 4BASA 2DB3A 5JWRA 2EU8A 2ZYVX 1EFTA 2ODWA 1W1WA 3AKCA 4CEJA 5GJBA 5SZIA 1HE1C 3BAFA 1HT2E 4MYTA 2FSFA 2OBNA 1CRPA 1R0YA 5EP1A 3EAQA 2WJYA 1Z0JA 4Q9HA 1XD8A 4Q18A 1OIWA 1QZXA 2XTMA 4IVRA 3GLGE 4RZ3A 1GFIA 3KTAB 1ZRHA 3GJ5A 1D2MA 1OIXA 2WKPA 2C9YA 1TF2A 1Z6TA 3WP1B 2KJQA 3BH7A 2WWIA 3EASA 3TRFA 3SJBA 1JPNA 3AKYA 3LXRA 4EJSB 3I3SR 3VKWA 4MRPA 1G3UA 3AVXA 3LY5A 3ZZTA 4E22A 2A7QA 1KYIA 3K0AA 1P2UA 1U0JA 3L0OA 4C2TA 1DE0A 4TMWA 1KO1A 3X2SA 3A37A 1H8EA 4IEEA 1P2TA 4PO8A 1UKEA 2PT7A 4NYIQ 4L8GA 1HT1E 2SHKA 1KI3A 3TGPA 2CVHA 2JCSA 1SVOA 1AN0A 1DTSA 1T3LA 2PZGA 3GFOA 5B58C 3AKDA 2IUSA 1E32A 2Q9BA 2IHBA 2C77A 4NH0A 1KI4A 2IS2A 1Y3AA 4DJTA 4RFSB 2ZU6A 3CZPA 2C95A 2J46A 3NEJA 2XSZD 5FTJA 3ICQB 3EWAA 2B8TA 2ZREA 1BO6A 4HSEA 3DM9B 3CNOA 1E9DA 4JIMA 4L15A 1NG9A 2H18A 4D25A 3IDQA 1JAHA 2VO1A 1NLFA 4RSGA 1UKVY 3PUZA 2GF9A 2VSOA 1A2KC 5JCPA 1G291 4OKSA 1G5RA 2E9SA 2BJWA 5DSZA 2QPOA 4Q4AA 3B1WA 3SHWA 3ZLJA 1EX7A 2NO7A 4DCVA 1YR7A 1IXZA 4CZ2A 3T1TA 4BWYA 3W5JA 1Q3TA 3ZZUA 4YDHB 1P75A 1W2HA 3M1IA 2WJVA 3OEED 2ZEJA 2ZYWX 2QE7A 2ATVA 3BC1A 2IL1A 2WBLC 5DN6D 2WJIA 2FZ4A 4L4UA 4IDQA 2QGZA 4NCIA 1OXVA 1S4QA 5L3RA 1NBMA 3B85A 2QTFA 4D4KA 2VP2A 2J45A 1S8FA 5TVKA 5GVRA 4LC0A 3FKQA 3HPQA 1XX6A 1IONA 4KVAA 1OF1A 1FW6A 2DY1A 2OSBA 3U44B 2WAXA 2ANBA 1IOZA 2P6NA 3RRYA 2ZE8A 4PC6A 4B32A 3I1FA 2HV8A 2JEOA 5FTMA 4HUTA 1UKYA 1J8MF 2FPLA 3T35A 2HJVA 3PQCA 2VQSA 3C14C 4IDNA 4E03A 1NKSA 1CJVC 4M1WA 5GJCA 1KDOA 3FFAA 3QKRB 2GXUA 3QI2A 3BOSA 4OBEA 5BN4A 3A1WA 1VG9B 3FPAA 3RLFA 3WXMA 2RAPA 2HF8A 1N6KA 3THXA 5KSZA 4QNMA 2ZJOA 4AKIA 2EYQA 2ZJ8A 2GJ9A 4B6FA 1P7CA 5J40A 4D2IA 5TY0A 2WJGA 3THXB 1G7SA 4MDEA 4JLKA 2ORWA 1E0AA 4HATA 3AGQA 3KL4A 1W47A 3IIKA 4P33A 2C2HA 2PX0A 5GJWC 2CL7X 1CBUA 5JEEA 3BFXA 3PJRA 2Q3FA 4JLJA 1KY3A 4QJ3A 2RGAA 5AK0A 2A3RA 2DFNA 2F3RA 3RWOA 3T12A 1ZM9A 2NQ2C 2AK3A 1OJLA 2OILA 3GCGA 3RHFA 3U3JA 1VECA 4B44A 1P9RA 4LJ8A 5KO2A 4GP6A 1K5DA 1OB5A 5CYPA 3U60B 2EYUA 5FTKA 3REGA 1UBGA 2BM0A 2KBFA 1BIFA 4JYCA 1VCNA 1E2NA 1G8HA 4QHYA 3CR7A 3PR1A 1G3RA 1SXJB 2FWRA 4QGAA 4BLOA 4IOJA 2WV9A 5JWOA 1Q3HA 2F43B 3QY0A 2QP9X 5TDHA 1MOZA 5BXQC 3MSXA 4Q1FA 2O5VA 3WBJA 4IHQA 3LBHA 3VX3A 3AKEA 4XVRA 3CH4B 1CJTC 1US8B 4QG7A 4WZ6A 1DPFA 3SI7A 3E1SA 3ZS9A 1E0KA 5HE9A 4URWR 4JZKA 4N0DA 3CNNA 3MUFA 3UK6A 2WJHA 3VU9B 1IN6A 3WYAA 2GCOB 1XEWX 2DFLA 4W5HA 2ZS9A 3W34A 1G41A 4I1VA 3A4NA 3ZJYA 2ZR0A 1N2CE 1IM2A 2WPDA 2J1LA 1O3YA 1AGPA 4URXR 3NVAA 2QMEA 1C1YA 1YRBA 2OCPA 3T1OA 2AWNA 3W6NA 1Q1BA 2F3TA 1XNJA 4QC2A 4EPTA 3H2YA 4AK9A 4F38A 1XB2A 3P32A 1EGAA 2Y8EA 1XZPA 3W90A 3R9WA 4HB4A 2QG6A 4TT3A 4CW7A 1B23P 3U7EB 2VA8A 2ZRAA 4HZIA 2Q3HA 1ZU4A 2ZS8A 2GDJA 4XD7D 4ACAA 3ND8A 3H86A 4D81A 3DKPA 1G16A 2IW3A 3GLGB 1XWIA 3V9PA 1R8QA 1R0WA 1MKYA 1VYVA 2H7VA 4Q02A 5FI1B 2YC2C 2MSCB 4R98A 3LQQA 1IJFA 5FOUA 1P9NA 4R2HA 1NJFA 5B30A 2HEIA 3WHKA 3VR2A 1OYWA 3L0PA 4JJZA 5G40A 3C7KA 1NI3A 3K8YA 4PPQA 1GRNA 4XWKA 4FWTA 1BYIA 4LHYA 4DHEA 2GAAA 5FH9A 5AUOB 1E2KA 4B34A 4YXWA 2FN4A 3I61A 1M7GA 2IF0A 4MRNA 3NTUA 1Q22A 5CB8A 4OHYA 1KK1A 2GVDC 4MRRA 3H1TA 2OESA 3LFUA 1ZVQA 4M1TA 2JLZA 3IBGA 5P21A 2H57A 1DAMA 2GCNA 3T15A 3WNBA 2HF9A 2V6IA 1R6BX 1VTKA 3JZAA 4IXNA 5CDFE 1Q44A 5KPDA 1T91A 3KKQA 4B2LA 1A2BA 4PO9A 3OHMA 2NO0A 1LV7A 4DSUA 4ZV4A 3U7FB 3U2QA 4JSTA 1Y63A 1G64A 1WE2A 4X8HA 3EZ9A 1E4VA 1IJEA 3ZIAA 3MMPA 1SKQA 3P26A 1S3SA 1OXTA 1MO3A 2FFAA 3FVQA 1N6NA 3L43A 3K53A 1IXRC 4PZLA 3FYHA 1NSFA 1DADA 2G0NA 2J41A 4LJ5A 5GADl 4TLDA 2V6JA 4JT4A 4HLUA 1W44A 5C4MA 4TLEA 1R5NA 1T4GA 1NSTA 3SJAA 1A1VA 1U0HC 4YMWA 1SVKA 2ZRKA 2GVZC 2PL3A 4D0LB 2IT1A 4FMBB 4M9SA 2CK3A 3F5FA 4PAQA 5DI3A 2ZVQX 5JJIA 2REBA 1EFHA 5HE8A 4LJ4A 4AKGA 1EFRA 3B60A 3SNHA 4B73A 2OBMA 2XGJA 2WSSA 2ZE6A 3RAPR 3SBEA 2W2VA 3D8BA 5E7IA 2P2LA 1FZQA 1MH1A 1J99A 3WBKA 1E96A 1YE8A 4URUR 1G18A 3ZVMA 5DNYB 1OKKA 2P65A 1W5TA 3EZ7A 2XZLA 5FUWA 5E7MA 5IK2A 2WWYA 2ZJ2A 4LK2A 1YZGA 1HQCA 1TQ2A 5DE3A 2D06A 1UBCA 1VCIA 5CK4A 2WKQA 5CDFA 3IO3A 2FF7A 3BBPA 4B3CA 4DCTA 4IVPA 1LS1A 5TB5A 1TMKA 3F8TA 2OT3B 2JJ2A 4R7ZA 2BDTA 2W0SA 4NYIR 1E9FA 1VYTA 3OAAD 2C98A 5FBVB 3AB3A 1ZIOA 1BOFA 2QAGC 5FTLA 5EE0A 1HA3A 4LOAA 4LPSA 3U6BA 2FDCA 4Q9LA 1E99A 2RGXA 5L8VA 3KQHA 5CIQA 4BGDA 1LNZA 2GTPA 1P73A 4UXIA 1D6JA 4PQFA 2FA9A 1NP6A 1W48A 5DGXA 1DS6A 4IOMA 2GILA 1WXQA 2HYIC 3IO5A 5SZKB 4JLOA 2V54A 5E3HA 2QSZA 2D2EA 4TLCA 5KU1A 2QAGB 4NCHA 4RD2A 2O8FA 3R8FA 1FP7A 2RKOA 1FQJA 3LA6A 5LDDC 1CRQA 2JLSA 2DHRA 4DLYA 2IX3A 1G19A 3D6TB 4ZDIA 5CLQA 2FNAA 5EZ6B 4KFRA 5FFMA 4ZI2A 2CHVA 3BFVA 1BKDR 1YR6A 4HUQB 4YDSA 1E9CA 1EFRD 3LBNA 3THYB 1XTIA 4JLVA 4D0NA 3T1QA 4HUQA 4NE2A 3MWJA 2ZE5A 3C5CA 4DDWA 3E2IA 1AS3A 4DB4A 3ADBA 3MLEA 1N6HA 2QGNA 1G8FA 1M2OB 2QROA 4M1YA 1J8YF 2AFIE 3SR0A 1IN8A 1JXMA 2QP4A 2VHUA 4QJ5A 2VL7A 2C9OA 2JJ1D 5EE5B 1KNQA 3VQTA 1ZD1A 5H68A 3FHTA 5JJLA 3Q3JB 1OPXA 3BGWA 4MITA 2I1VB 2OE2A 3QSYA 3QXHA 5AUQA 3WYGA 2NPIA 2WJJA 4PZZA 2C9CA 2GBLA 3B6EA 4WIAA 4F93B 1TQ6A 3TR5A 3WNDA 2ODEA 3FOZA 4C4PA 2XNDD 2YV5A 3H4MA 4II7A 1OHHA 3MJRA 1KSFX 3ZVNA 1AQYA 4M0LA 1N0UA 2WMNB 1N25A 2G88A 3K0FA 4S35A 5DLQC 3W3AA 4OQFA 5FOWA 5BW8A 2JIZA 3LLMA 1CIPA 1NLZA 4CVNA 1KO7A 3VR4A 3AUYA 4HEJA 2ZVPX 1QF9A 1D8TA 2FEMA 2FJUA 4TN1A 3I5YA 2OLJA 4NCNA 2QT0A 3OIUA 1N6LA 2RHMA 1QHXA 3DZDA 4M1KA 1DAFA 2KWIA 2N1BA 4JVNA 4B76A 5H70A 1UEJA 2XSZA 1ODFA 3AVTA 2XB2A 3O8CA 2H1LA 2VHTA 4AY2A 3FDIA 1J7KA 4DT1A 5KSOA 1UAAA 1HURA 1E1QA 1F60A 1ETUA 5JEDA 4UQOA 4TT3D 3WMGA 1FQKA 4L16A 3B82A 3FHOA 4J0QA 2Q3MA 4LV8B 2ECKA 2R9VA 1EXMA 4M8NE 4OHWA 4V0KA 4Q19A 1DO0A 4MKIA 2BBWA 4Q01A 1R0ZA 2PEYA 3A58B 3TSWA 3THWB 3X1WA 4B35A 1KJZA 4ZKDA 4QL3A 4URZR 2PMDA 3C8UA 2Q9AA 4I1OA 2GKSA 4LWZA 4PHGA 2BBTA 4MGIR 4A82A 4US2R 1FTNA 3MD0A 3BS4A 4UJ5A 2F1IA 3QXJA 2YNMA 1F2TA 4Q00A 3W8RA 4B74A 1NN3A 5FOXA 3MJHA 4A9AA 3HR7A 4HLDA 4D82A 4M1MA 2WM9B 3AF0A 4MGYR 1PLJA 3QQ5A 4TL8A 1NBME 2LCFA 2P5TB 2EVWX 1XPUA 4IKEA 1HH4A 4JS0A 3TBKA 3EZ2A 3QOFA 2EW1A 4TLAA 3SJCA 4E5UA 2OV2A 3ZYCA 4C0SA 1WDTA 3TUJC 2D7DA 1D2NA 4OJQA 4MQBA 4B71A 3L8ZA 1UJ2A 1X86B 4BLSA 3GPLA 1P62B 2CL0X 3BH6A 3X1XA 2GF0A 1X6VA 4HLCA 1QVAA 5EJEA 4QNRA 3AEZA 1XMJA 2XXAB 4MYHA 1XD2B 5AWFC 3J81k 2NOAA 4U7DA 2Q0HA 5JS7A 2BM1A 1W36D 3GEHA 3PITA 2Z43A 4CT4B 1KI7A 2QPAA 5CIWA 2WWGA 3KZ1E 3QF4B 1G21E 2YC4C 1V43A 2JASA 2ZSFA 1LF0A 4B3FX 4I1SA 1E3MA 2ZSAA 3ASYA 1XU4A 1Z08A 3MRSA 3NG1A 4PANA 3U61B 2NG1A 3NHAA 4JMPA 2ZTSA 1AS2A 3VTKA 1AA9A 1I4TD 2BMDA 3S1AB 3TNFA 2DWQA 1L8QA 3PENA 1UDXA 4NZYA 4ZCLA 2WSSD 2FPMA 3VR3A 1G3IA 2RGBA 1RFLA 4OK5A 4XSGA 4F4IA 4XWAA 4GMDA 4LYAA 1E79A 3GJ4A 2QRZA 4D6PA 3SS8A 4FWIB 1DAHA 2ZUBA 4ABYA 4C2UA 2G9NA 4ZCIA 5EE3A 2VH5R 1NMXA 2GZDA 3W3ZB 2VRWA 1NJGA 4UNQA 3U4QA 3RSLA 1F5NA 2RGCA 3OIWA 4D26A 1P2VA 4UNSA 1LVGA 3QEJA 4LV6A 3U4QB 4B3BA 2FGJA 2GRJA 4MYCA 3W5IA 3RVBA 3MCAA 2OCAA 2C04A 5L3SB 1T8UA 2IF2A 2ZETA 5L3VA 2ZQ5A 4TMKA 2JJ2D 3QG1A 1OE0A 3MWKA 5L3SA 5DI9A 3UMFA 2W6JD 2ZJAA 2I1QA 2IWRA 3QPUA 4HAVA 2RGEA 3VHLB 4B3DA 4DDVA 2JLYA 2P0EA 1GKYA 3D31A 1YKSA 1YZUA 3I32A 1N5LA 1E9BA 3IKJA 3NWJA 2VP0A 4I4LA 5SZHB 4PO1A 1E2EA 4HB3A 2W2TA 1EFCA 4LJYA 3K0CC 3OEEA 2CE2X 5KPJA 3GLGA 4HAUA 5FL3A 1SVIA 4IRUB 4O2LA 2BWJA 3JVVA 4NU0A 5G3YA 3VAAA 2EFGA 2W0MA 3RC8A 5EE9A 721PA 3QIAA 5BYKA 3VKHA 3A1VA 3TKLA 4JBYA 2QZ4A 4DIDA 3GMTA 4E09A 3OE7D 4EJSA 3RS4A 4NBSA 4O2RA 4LY6A 4M4SA 4Z54A 3NEYA 1CS4C 2NGRA 3BK7A 1ZD8A 4LJ9A 3PEVA 1KMHA 3QPWA 1XFAA 4LBZA 3HDTA 4KFSA 1XXHA 1M8PA 3WNCA 1KMHB 1GKUB 4XH9B 1OFTA 3EARA 2ONJA 4TWZA 1LTQA 4BE7B 121PA 4A2PA 3ZD7A 4DB2A 2XITA 4EJSC 5EXXA 5JJKA 3C15C 2H17A 3ETLA 2GWHA 2JATA 3EXAA 5JCZA 2ZRLA 2AHOA 4GFDA 1T0JB 3HWSA 3FTQA 5AUPB 4OJKA 4XIGS 3U5ZB 4RFSA 4L9WA 3EPJA 2IYUA 3T5DA 2FFHA 4RCYA 3LV8A 3AF4A 1N3BA 1ZJ6A 3EPLA 4NCJA 5AUNB 2WMOB 2FSGA 2FFBA 3CO5A 4KXFB 3FKSD 3CLVA 3MWLA 2VSXA 3VR6A 1KAGA 4LSGA 2GK7A 4P0TA 1FFHA 2WZQA 3BB4A 4LJAA 3QVVA 1G7TA 2BV3A 3WP0A 4IVQA 2LKCA 3GJ0A 2W6IA 4PQYA 1XMSA 4AURA 2VF8A 1OXSC 1GILA 3C41J 3RS0A 2BC9A 2XNDA 1QHHA 2Z6VA 3N2IA 4NONA 4WBSA 4Z51A 2QBYA 1GG2A 1Q20A 1RW4A 2DYKA 2LKDA 5HZHA 1DELA 1E9EA 4YQFA 3A6PC 3B9QA 2G83A 3X1DA 5AJWA 1T9HA 4FI3C 2F1HA 4FCTA 4P32A 1SHKA 4BLPA 2IC5A 4BFUA 3BXZA 3SC3A 2WWWA 3KXIA 3MWYW 2ERXA 4TQAA 2ZRPA 4C0KA 3KKPA 4MKFA 5K8IA 2OG2A 3LD9A 1L7VC 3CRW1 4AC9A 2D3WA 1KI8A 4KYIB 1UKZA 3NIBA 1Z63A 1Z22A 3GEIA 1CR2A 1S1CA 4LRWA 4C3ZA 4D4LA 1T3SA 3D7MA 4AG5A 3ZQ6A 1TQ4A 5C18A 2F7SA 1FUKA 4HB2A 4X8MA 3SQWA 5AJVB 2ZJZA 2YVUA 4RKEA 2ZROA 3GLHA 3LXXA 2WHXA 3AP1A 4TYQA 5JI2E 5CB6A 1CKEA 4GT1A 2JDIA 4LYHA 1SKYE 4HDQB 2ZSBA 3QKUA 4GMXA 3TK1A 5D3MA 3GLIE 3WMEA 2VP4A 4QRHA 2WKRA 1P61B 4LYFA 1E4YA 1II8B 1TEVA 2BBSA 4JJKA 2VYFA 1ZAKA 1I2DA 5KUTA 2VSFA 4PC2A 1K8RA 4K46A 2QN6A 3KQKA 2V9PA 3Q7PA 1ZM3A 4EPRA 3KFVA 5DO9A 4NYJR 1E2HA 5IT5A 2J9RA 5JS8A 5C4GB 4A8JB 2ZRFA 4RD6A 2QY9A 2DWPA 1KI9A 4JL8A 4KO8A 1FNNA 1T0HB 3THYA 4NP6A 2GJ8A 1O87A 1XJCA 3KJEA 1U9IA 3MG9A 4G0NA 1B0UA 4FMDB 1KI6A 1G3MA 2R44A 4LBVA 5EZ5A 3PEYA 1SVWA 1RKBA 3KDSE 4NL4H 3PIRA 4GBMA 4QKQA 4ILEA 3B1VA 3RSOA 4DLRA 2CEAA 3UG7A 4F4CA 2IYZA 4OHZA 5JSZB 3SYLA 4A8JC 2DFKB 1U90A 4OI1A 2BMJA 2IWHA 3KQUA 1Z0DA 1E9SA 1EWRA 1JXOA 2JA1A 3M4YA 2ZIAA 1XEWY 3TVTA 1RE0A 2IYRA 2AFHE 3B8HA 2OFXA 5JRJA 4KODA 2WIAA 1JR3D 2BIFA 3HU2A 5EP2A 1N6RA 2HXYA 5K8UA 2IS4A 4Z8XA 3CF0A 1SXJC 2GK6A 3CF2A 2GCPA 2B21A 3KX2A 2G1KA 1X8JA 1KDTA 3Q7QA 1SXJE 1A7JA 1LS6A 1KO4A 3CRRA 1U81A 5HTKA 2VIIA 4M53A 4AWXA 2PCLA 4A6XA 4O25A 2ZRJA 1K5GA 2GXQA 3KUCA 4M1SA 1E2MA 1E94E 4JKIA 4EAQA 4C9BA 4Q7LA 1JR3E 2R65A 1DO2A 4OQNA 4LYJA 1G8GA 4WOPA 4HZUB 1P60A 5CK5A 1AKEA 5KHOC 1NMYA 3TLXA 4AKHA 4GNKA 3K09C 2ZAMA 1TUIA 2AR7A 2QAJA 1COWD 1QHGA 2FSIA 1OIVA 1XJQA 4DT1B 2PX3A 2B7BA 3TQFA 1ZM4A 1KGDA 3QE0A 4AD8A 3EPKA 1XTKA 2PZFA 2X1VA 1P2SA 2IYYA 1Z29A 4JLBA 1N6IA 1R5OA 2A2ZA 4KSCA 3IEVA 4PSVA 5BN3A 4ZKEA 4R2IA 1PLLA 1QVRA 1SZPA 1KNXA 1Z3IX 4HDCA 4TQUS 4DLWA 4R71A 1W7AA 1SVSA 3DEFA 4DEYA 1XCMA 4Q66C 2HUPA 3WY9A 3TIFA 3KXKA 1IN5A 4XJXA 2A30A 1U8YA 2ZAOA 2IYXA 2V55B 4DKXA 4PPFA 5LPNA 4MDFA 1GRQA 2BCGY 4HAZA 3PVSA 4Z1MD 1F2TB 1KKLA 1GL6A 2GJKA 1U2RA 4GPTA 4HAXA 1BMFD 4NHOA 5HPYB 5JECA 1HY3A 3G5UA 1WCV1 1NIPA 3OE7A 5GVSA 2H5EA 2OCYC 8OHMA 2D62A 3RRMA 4DLXA 1GZSA 3LWNA 2MSDB 5BQ5A 2Z4SA 3CNLA 1CJUC 3WMFA 4UXHA 4YONB 3QJYA 4M22A 2HJGA 1I4LD 1E69A 2VP9A 1IBRA 1JBKA 2R2AA 2W6ID 4LHXA 2NO1A 3OF5A 5IRCD 2XEXA 3A36A 2AKAB 1EWQA 3EZ6A 2EWVA 4NYMR 2VP5A 4Q21A 3VHXA 1YZTA 3FKSA 4G5OA 1XD2A 2O8BB 1QDEA 1KK2A 2D74A 4RD4A 3B2EA 4CEIB 2QQ0A 1JPJA 4DUGD 3C4JA 3BB1A 4M1OA 3OEHD 4UKDA 4AKEA 2X2FA 5J47A 2JJ8A 2Q6TA 5LB2A 4C0BA 4HYYA 1Z0KA 3ICEA 4Q48A 4P4SA 1XEXB 2ZRGA 1Z6GA 1KY2A 3AUXA 2OZEA 3LVQE 4H9GA 1GDDA 1QHSA 4XVQA 1T5LA 1CEEA 1NN0A 2CDNA 1R4AA 1XEXA 3QBVA 1W0JA 1G7CA 1S3GA 2CCJA 1RRFA 2ZI3A 3ND9A 4DIEA 2X2EA 1EX6A 1Z0AA 2ATXA 2CXXA 3RC3A 1YRAA 3U7GA 2V4ZA 2R6DA 2V1XA 2ZR9A 3QBTA 1TPZA 4GOXA 4KHZA 3SFZA 2HLDA 2QA5A 3GLFA 2O8CA 1FPMA 4OI2A 2HT1A 3P4XA 3IPYA 1G8YA 2QMOA 5BWMA 2G0TA 2CLDX 1VHTA 1BYUA 1VCMA 1TL7C 3CM0A 3DOEA 5FR2A 3MGCA 1TUEA 1JECA 3A4MA 3O8DA 1R8SA 1E1QD 3QXXA 3IPXA 4PC1A 1NMZA 1Q0UA 3SFVA 1GWNA 3R9IA 3PUWA 4ZIRB 3ADCA 1RPZA 2C78A 3O8RA 4LJ7A 1ESNA 1PVOA 4UNRA 3B13B 2O8DB 4JLPA 1GL7A 1ZUIA 1QG2A 4BFWA 5KDDA 2NIPA 1C4OA 4CIDA 1ZBDA 4MUBA 2DPXA 3I5XA 4CEJB 5HCIA 1Q57A 2F1RA 1E0JA 1E2IA 3LX5A 4YLGA 4DCUA 4WZAE 2QUZA 5JI3E 1VMAA 1JQJC 2IEYA 3DVLA 2P6RA 1ZM2A 2DBYA 3G0HA 2JDID 3T61A 5M04A 2W6JA 1CULC 4ZI3A 4JLDA 1KO8A 5KYKA 221PA 4CYMA 1M1YE 1Z6YA 1Z47A 2QSYA 1CJKC 1MT0A 2WIBA 4DXAA 3UPUA 1OH5A 3NC0C 1H8HA 1N5JA 3I8XA 2UVQA 1E2LA 4MKGA 1KDRA 1E9RA 4ESVA 3ADDA 3N5CA 1L4YA 2WICA 2BMFA 2RB4A 4PSKA 3ZH9B 4A0GA 1JAIA 1E6CA 5EP4A 1T3HA 4QGHA 3Q85A 1AGRA 1ANKA 3QG5A 4Q1DA 5SZJA 3PEUA 1FUUA 1Z6XA 1DG1G 1A82A 5FUVA 3SHFA 4BUJA 2WVJA 3H0KA 4V0MA 4A6PA 2AD1A 1NY5A 4G5RA 1W36C 3B1ZA 2IYTA 1TF5A 3LRPA 5FPKA 2A78A 3JVUA 2PLRA 3B7GA 1QHIA 1H65A 1RYFA 4B3GA 4MKHA 2FZLA 5AR1A 2WWXA 4CRWB 2IA5A 2QE7D 4C7OB 1E79D 3FWYA 3RNLA 3EIEA 4ERNA 1G4UR 3EIHA 4CDGA 2FH5B 4QM7A 2NO9A 4ASUD 3Q9LA 1KZ7B 1QHHB 5CJPA 5FOVA 1N0WA 2YWHA 2GHIA 4JLNA 2R6GA 1N5IA 2ZRDA 3K9LA 3CB4A 3Q72A 4G5GA 2NMVA 5J4LA 3L82B 3L8YA 3TAUA 1ZCAA 5ELXA 1CJMA 1I2MA 4TYYA 3OFNA 2D2FA 2QTVB 4JVLA 2GZAA 2YOFA 2W00A 1VDZA 3CWQA 4H1UA 5BN5A 4WXRA 3LH5A 1MABA 3KKMA 821PA 1ZINA 3BORA 3LX8A 3I73A 1GNPA 4AYXA 1D2EA 3GP8A 2ONKA 1MABB 1NRJB 3K0SA 1PV4A 4C0QC 4B2PA 5IF9A 2ZR7A 3CRMA 1VG0B 3I4LA 3QEOA 4K8OA 4IEIA 5F9HA 2J7PD 2BBOA 4CF7A 3IUYA 5LBIA 3TH5A 3U44A 3CF6R 5J5CA 3ZZ0A 4CT5A 4OI4A 2QTHA 3AF2A 4AYWA 621PA 1RZ3A 2WOOA 2YZ2A 1E0SA 5TMPA 4A92A 2A9KA 1K6MA 1AK2A 4Z1MA 3TW4A 3PEWA 2YJTD 5D3MB 2ZSEA 2YKGA 2A5YB 2WWFA 5UKDA 2CL6X 2C03A 3NH6A 1R10A 3AM1A 4IDPA 5EQTA 4LGMA 1YR8A 4TQ9A 1Z83A 4JLMA 5JBQA 1OSNA 3PG5A 2VTKA 1IHUA 4DC9A 4DUGA 1A5TA 1CP2A 1U94A 4RKFA 1KOFA 2H16A 4YXWD 4TL7A 2GEVA 1QBKC 1ZUHA 2GXSA 3FGNA 2AX4A 3ASZA 1TF7A 4XTCS 2WWHA 3NHBA 2BVNA 1SQ5A 3P1JA 4NYMQ 1JJ7A 1JEDA 3UKDA 4PC7A 2GJSA 1TAGA 1OH8A 4PHHA 1EFUA 1ZYUA 4P4UA 4WXPA 2IBMA 4X8OA 3AVQA 5FR1A 4MH0R 3KQNA 2CVFA 1SULA 2HT6A 2IK8A 3X1ZA 5FPTA 3I62A 5LB4A 4ZDJA 1OYYA 1JNYA 2VBCA 3S1AA 4IOKA 2CHGA 1COWA 2DFTA 5E95A 4A15A 5EUMA 1KI2A 4PQRA 5CITA 2NZ8A 1FMLA 1P72A 4MGZR 4W5WA 1Z0IA 4DCSA 3DM5A 1RYHA 3KJHA 2C96A 4N1AA 5K8LA 1E1RA 2DCUA 1R5BA 3GD7A 2GCOA 5EUQB 4XOIA 1YJ5A 3ZVRA 4BECA 5J4HA 3A4LA 2AL7A 4KITB 1UDWA 1CR0A 3TMKA 4BZQA 3NBXX 1E2PA 4QFMA 1UBEA 4OI0A 1AZSC 4B43A 4EPWA 4TSFD 1JALA 5CM9C 2O52A 3HU3A 1Q1EA 5F9FA 1P4SA 4OQLA 1MO6A 3TUZC 1DEKA 3CONA 3K70B 3RRZA 2AD5A 1VKJA 1LY1A 3KFXA 3TUIC 2QPTA 3R8CA 5CJ2A 4L9SA 2N42A 1G8PA 2XZPA 3CBQA 1L2TA 2H92A 2HLDD 4JVMA 3Q5DA 2JLRA 1GL9B 3CIOA 4DDUA 3QXCA 1UFQA 2C99A 1TU4A 3OESA 1CTQA 2EFEB 3DL0A 4BFXA 2NTYC 1XZQA 3C5HA 2UZIR 3DKVA 3GJ8A 3O8BA 2R6AA 1Z28A 4QBGB 1NBMD 3OIVA 4BFZA 2IYLD 1D9XA 3A1UA 2ZE7A 3IIJA 3AVOA 2ZUCA 2X8AA 3QUSA 4NCKA 3RANA 1W46A 2FE4A 1W36B 3BRWD 1YZQA 1H8HD 2FSHA 1GAJA 1UEIA 4PR0A 1YZNA 1CLUA 4BZPA 1XTSA 3UMRA 2J0UB 3CX7A 4KFTA 1XCGB 2QMUA 4TTRA 4Y0AA 3VX4A 1U98A 4PPGA 4BFVA 1RRPA 2Z0MA 2ZJYA 3TJZA 2EFCB 2O0JA 2OAQ1 2Q21A 1VIAA 1HTWA 1IAQA 2LWIA 4E07A 3AP2A 4HB0A 1FMJA 2QL6A 5A4JA 5KSYA 5TXGA 1JEEA 2IS6A 1OFUX 1II9A 4FXPA 1ZC4A 4TYWA 2CLSA 4GZLA 5C46F 4Q03A 1PLKA 1V5WA 2FGKA 4HAYA 4TTPA 1P6XA 2CE7A 4NPHA 1J2JA 4RZXA 3UG6A 4A1FA 2QM8A 1QRAA 4Q4LA 2XZOA 5FBLB 2PEZA 3CPEA 1PUJA 3SDZA 5CM8B 3IEUA 3PUVA 4ZO4A 3I72A 2CK3D 2VEDA 4F91B 5L3QB 5EXSA 3WRYC 4NYJQ 5ANRB 4ESHA 1HE8B 4DLTA 2ZI4A 4B48A 5L3QA 3U3OA 4P4SB 2NZJA 2JLUA 3EC1A 2FU5C 4FD2A 2A5DA 3GFTA 4N0EA 1IY1A 4N3NA 1WBBA 1X1RA 4DLVA 4ON9A 2VHJA 4TMVA 4U02A 4EFLA 3EIQA 3F0TA 1ZM7A 2QQEA 1Z06A 1NVVR 2WTUA 5KNBA 1SVLA 4EPYA 3LO5A 1OHHD 1KKMA 2QU8A 4KJZA 1ZNYA 3BFKA 4LHVA 4XSHA 5EP3A 1HV8A 1W0JD 1W49A 3IGFA 3KUDA 5HZKA 1RVDA 5IK2D 1M7HA 3FMOB 4EQ6B 3F3YA 1RC8A 1OB2A 3TSOA 1KDPA 2AWOA 1AS0A 2QM7A 4P3YA 2IUUA 3HYRA 3REFA 2F9LA 1MV5A 2OFOA 1W5SA 3CR8A 2R6CA 3AVYA 4A0HA 1SVMA 3PUYA 2BJVA 5GJVC 4PXAA 4POAA 5H8WA 3GLHB 3QVUA 1R2QA 3RABA 3FHCB 4KI0A 5B2ZA 3OIYA 4LUCA 1GIAA 2O8DA 4LBWA 4PFSA 2RMKA 1E2DA 1N6OA 3TSZA 3QKTA 2YHSA 1RJ9A 4CGZA 3LLUA 2P3SA 3DO6A 2CCKA 1LW7A 1BS1A 2BEJA 1RJ9B 2QAGA 1II8A 2CNWA 4DEXA 4HDOB 1EK0A 5JHGB 1ZC3A 2EFDB 4QHTA 4RD1A 4C0HA 4D4JA 2WPDD 3OAAA 4H1VA 1AIPA 2OUKA 1S9DA 1LFDB 2Q9CA 3AP3A 2XX3A 4G01B 4BLQA 1W4AA 4KBFA 3LNCA 1X3SA 3CPHA 1IY2A 2PZEA 1XEFA 1VHLA 5IHPA 3B1XA 1MRNA 3KKOA 1ZUNB 3LVRE 3ONWA 5G3ZA 4LCBA 1F6BA 5KNDA 1RRCA 5H1YA 2ZANA 3PFIA 3K0AB 5HKKD 3ZQJA 1KI6B 4B2IA 4GOKA 2FEOA 4IDHA 4F7WA 4FMCF 2A5JA 2GBLC 2P67A 3SYKA 1LF5A 4YMUA 4PHFA 1Z5ZA 3SQXA 1BH2A 1CXZA 2ZJBA 5JSZA 2XOKD 2QENA 1A4RA 3EG5A 4JL5A 4PZYA 1S1MA 3K1JA 5KNCA 4YMVA 4JSYA 1G1MA 2MMGA 1HQYE 1ZU5A 3AH8A 4ARZB 4TMTA 2GZHA 3T34A 1KIMA 3AV0B 4GP7A 2NPFA 5C2JB 2ZSDA 1NKTA 3I92A 2QT1A 3OFND 4FINA 5DYIA 2CCGA 1Q21A 1MO4A 4WAUA 2V7QD 4Q9JA 4B3XA 1W0KA 3JZMA 4LZZA 1G5TA 1KSJA 1R0XA 2KI5A 1G7RA 4Q5IA 1W4CA 1G6HA 4WW0A 1GNRA 2J0VA 3DMDA 4P4TA 4QGGA 2JIZD 1WB9A 4GZMA 4CEHA 1S96A 2ZI5A 5CYOA 5DHFA 4DBLC 1M7BA 1FOEB 3Q8XB 1GP2A 4HZUA 4Q4AB 1W2GA 4LHWA 3T06B 3SBDA 4CEHB 3TVDA 5JZVA 2JLWA 4W7SA 4RVCA 4FMDF 1Q1QA 4NMMA 4P31A 4U00A 5BYJA 3DOFA 3NDBB 4HLUC 3QXSA 4URVR 1YVDA 2OEPA 4LX0A 3VFDA 3CRVA 3KKNA 1JQLB 2C5LA 4GDFA 1E2QA 3BB3A 3E70C 3CW2A 4QBHA 1DBSA 2AK2A 2ZJ5A 4QM6A 1FNMA 3ZDQA 4ZPXA 1Z0FA 3GLIB 1KK3A 2REXB 4ACBA 5FOSA 1TQDA 1XTQA 3I8SA 4D80A 5HCNA 1KK0A 4Q7KA 4V0LA 4W5JA 4RZ2A 2JAQA 3V00A 2ZYTX 2QP3A 4U5XA 2ZI6A 5FOTA 3IQXA 2CBZA 4MA4A 1H8ED 3K9HA 4EIWA 3K9GA 2J0QA 1NN1A 1PUIA 2ODBA 2E1RA 5FUXA 3VR1A 4A2QA 1KHTA 3B5JA 4OK6A 2XNSA 4DLZA 3VNUA 3OZXA 2YWFA 5FPYA 4PAMA 3SEAA 4LBYA 5JHHB 2HCBA 5A0FA 2VHQA 2G3YA 3B9PA 4RFVA 1NIJA 1GSIA 1NLYA 1Q12A 2W83A 5CLLA 4US0R 2VP6A 3KJIA 3QKSB 1WP9A 1KMQA 4BEBA 4BLRA 2FG5A 1OT3A 1R7RA 4EPXA 3U7HB 3AVPA 1XF9A 2JJ1A 1NVVQ 2GESA 3ECCA 2BKUA 4Q7MB 6Q21A 5J4YA 1KI1A 1XBTA 1XTRA 2BOVA 3DZ8A 2R8RA 1XJ0A 3GEEA 2HYDA 3X1YA 1GVNB 2RH5A 3VNVA 3EW9A 4KAXA 4D4MA 1S2MA 4JLAA 2ANCA 2J3EA 3U3MA 1OXUA 3NBYC 2O8BA 1SXJD 3HR8A 1DAGA 4EPVA 4DWJA 4PSAA 4CEIA 3HYTA 1GKIA 4I1UA 3PUXA 2IXFA 2P5SA 3QENA 4TL6A 3HP1A 1YHNA 3AVUA 2ZRBA 4DSTA 1TADA 5C1BA 3HJNA 1UM8A 1Z2CA 2AN9A 5EXTA 1Z6AA 2FV8A 1T8TA 3A8TA 3CX8A 3L0SA 1NG1A 1OFHA 5EE1A 4EDHA 1XPRA 1OXXK 1TNDA 3FB4A 1WMSA 1G6OA 1ZNWA 2KBEA 4GOJA 1P9WA 4BFYA 2CLCX 1F2UB 1F3OA 5JRZA 4V0NA 4EUNA 4V0ME 2J87A 1U8AA 1U8ZA 2GETA 3WHLA 4F4JA 4BFTA 1XP8A 1F2UA 2BHRA 3EA5A 1GUAA 4JL6A 5AJYA 2EQBA 1XPOA 1E2JA 3SYNA 1FP6A 2FPKA 3B78A 4PAOA 1Q1ZA 1PZNA 3VU9A 2G1JA 1DARA 3KB1A 4KFUA 1G20E 2CMKA 5KDLA 3L2OB 3UWOA 1F48A 3BE4A 1IY0A 3NH9A 1XCPA 2MMCA 1KO5A 3AF1A 4G5QA 2Z5FA 2QRNA 4BFSA 1GM5A 1JB1A 4AG6A 4LHZA 3BIFA 4A0RA 1AKYA 3LQRA 3IHLA 2VF7A 4PPNA 2PMKA 2KB0A 2W58A 5J4VA 1UPTA 2I3BA 1XMVA 2IEZA 3P20A 4DCNA 4TYNA 3KJGA 1TTTA 5F98A 2XTNA 4QBIA 5DIFA 2RHDA 5FL7D 2B8WA 3TQCA 3AVVA 1L4UA 2I4IA 1NVWQ 2L0XA 4DLUA 4JVSB 2O0KA 4DLSA 4IOLA 1U0LA 4X8LA 1NL3A 1HEIA 4KVGA 4RCZA 3FFBA 2UKDA 3AQ4A 2REOA 2QMHA 3LBIA 3K70C 2JLQA 2UZ3A 2YWGA 3G82C 3KTAA 1YU9A 2QI9C 3BH0A 4LC1A 4O0MA 5E7JA 5FI0B 3RDPA 3RS3A 3FE2A 3FMIA 2GXAA 4QJ4A 3N70A 1DAIA 4EFNA 5DYGA 2JGNA 1VG1A 2MSEB 5KDOA 3EX7C 1MO5A 1DVRA 4PX9A 1ZMXA 4C30A 2JLVA 1CR1A 4Q9KA 3U3KA 5G41A 3QNUA 3GJ3A 1NF3A 2ERYA 3K0CA 3W6PA 2XJ4A 4DDTA 1KAOA 1XXHB
chains in the Genus database with same CATH superfamily
2BEWB 2IYSA 2ORED 4JKYA 1OY1A 1UDRA 4U2EA 3VTAA 1ABBA 2HSDA 1G2PA 2I55A 3D0KA 4TKUA 3IILA 3CJRA 4L1KA 3IHWA 5EXPA 4YREA 5SYNA 4UXJA 1OFGA 5KNDH 1W4BA 4O3MA 1U7TA 3DE7X 1MQ9A 4ZRNA 3NBAA 3O7MA 3CS3A 5HHTA 2H9IA 4J91A 4M76B 4FFRA 2PQ0A 5EQFA 4I5DA 1W6UA 3GUZA 5KJEA 2KE5A 1Z2PX 4A36A 2Z83A 1YCGA 3ROQA 1TU0A 1E18A 1F12A 1SUPA 2HMSA 4NXNB 3NHZA 4I99A 4M8SA 1XQXA 4HBZA 1PZEA 3WGNA 4XA8A 1E2FA 1GA4A 2FQYA 3O3CA 2BKEA 1V1JA 2FWIA 2XRMA 3UXMA 5B64A 3IS3A 1IXSB 5IN5A 4MB2A 3JYPA 4WN9A 3BRWA 1QE3A 2X1MA 4LPKA 4CNQA 4OQMA 4MV9A 2GLXA 1MW9X 1S3IA 4WSOA 3VMFA 3VU8A 4GQIA 3PE3A 1KZ9A 4INOA 2I2BA 2PWBA 5FPHA 5H3CA 1U2TA 3I0MA 3R7DA 3VPHA 4ZHQB 3OZUA 3V2GA 4V02A 2WZDA 4U5QA 1GD1O 1OWNA 4YAEA 3I05A 5ITVA 4HNAB 5C8YF 2IU6A 3B2NA 1TZ2A 2ZFUA 3SOPA 3F6SA 2OOKA 2OQRA 3AK4A 3E3NA 3EPHA 2B6HA 4D1YA 4MIKA 1QHNA 3BDVA 1GYPA 2Y0DA 3IOMA 1FX0A 2I4OA 2WDPA 3FMVA 1YHZA 2BFBB 1LBSA 4I4NA 2ZRCA 3MLBA 3UANA 3C1AA 3H8VA 4M9UA 5DN6A 1FX0B 4UEKA 4X65B 4RHYA 1Z07A 2FOLA 2PUVA 3FUCA 1D0IA 4ZRDA 1C4KA 1T5BA 3K70D 2B78A 2WHQA 2VCEA 2JI9A 3UENA 4A4DA 2XUQA 4RD3A 4GRDA 2V3CC 4WERA 1YVPA 2IV7A 2HRZA 4CE6A 3L7IA 1YL6A 1KWGA 4RK0A 3ZDZB 3GPDG 4JNKA 421PA 5JO0A 1WDKA 4KEAA 2JJYA 1QZTA 2NNWB 3NB0A 3PKIA 4B6EA 5HEKA 3FB1A 3N2EA 2XT0A 3R7SA 1YVEI 2XD9A 2G76A 3CZQA 1HNNA 1GU1A 3HGTA 2OXRA 3R6WA 5IDVA 1OW3B 1M72A 5BW4A 5F51A 3RG8A 2AH5A 1GITA 2PMFA 2G6BA 3GAZA 3ZH2A 3B1YA 1RBMA 1GAEO 4MCJA 1IK6A 5K1ZA 4OX9Y 4QTUB 1E9AA 3IP8A 3RS9A 4BV9A 1NNEA 4B3RB 2ZU0C 3BGIA 1T1GA 5JFOA 4KIWA 2ZWOA 1P4GA 1FVOA 4DILA 3RVSA 1PTJA 3VYWA 1P18A 4OATA 2Q1WA 1XZNA 4PXSA 4HN9A 1K97A 1G4AE 3MTDA 3STUA 4A10A 4ARAA 3Q7SA 4E94A 1QIGA 5IFKA 3JW8A 1ISRA 3UWDA 4Q7JB 5CFNA 1WW2A 3IPRA 2GEBA 3NCTA 2Q2QA 1WOYA 1XROA 3NCHA 4G4SP 4Z0PA 4C21A 1CY0A 1SELA 1ZZEA 4JBXA 3TZQA 1L9XA 1XE3A 1G3QA 3C3JA 5E3JA 1SGWA 2GPBA 2OZLA 2QN1A 1ESMA 3RRNA 2O8FB 2BGJA 3A9WA 1VJDA 1YZLA 2G8NA 2QB5A 3L7OA 4CMKA 1Z2AA 2IIVA 2Y2UA 4UVIA 3AESA 4PZUA 4IJ6A 1A71A 2YVLA 2ZRHA 3VPXA 2HSZA 2GA8A 1L7XA 1SCKA 5CFRA 2BTEA 1EESA 5IG2A 3GP5A 5F4BA 3OWOA 1IDN1 4O4LF 4X44A 5JZ9A 1AN9A 1VPDA 4WDRA 2WTMA 3WLQA 2W2NA 3EZGA 4W6QA 4DQXA 4DSOA 4HFRA 4Q1CA 1SCNE 3U62A 1XVLA 4R2XA 5EQJB 4DIFA 2VPTA 1JR3A 5C8XA 4DZZA 2VUTA 2O5RA 4J0GA 1MC5A 4BJHB 2ZIGA 4HADA 4GLLA 4C2AA 4QLBA 1U7PA 4RMIA 5L7TA 2FPWA 4RDIA 1ZW6A 1ZBQA 1ZP6A 1VP3A 5LYJA 1M2HA 2ID9A 2QRHA 3M3DA 5IKXA 5BNIA 3ZHRA 5CMLA 4RM3A 1SXJA 2YWEA 4OQEA 1JAXA 2J8ZA 3QPVA 4HGNA 4E70A 4WL0A 1USWA 1JP7A 4MGKR 4DMFA 4YQYA 5ESDA 1GTVA 2BKXA 4KYUA 1NUSA 3R7FA 3DP9A 2E87A 5BR1A 1XP5A 3A6EA 2IXEA 3E22B 2J3LA 2C2GA 3H4IA 1KVSA 1U2QA 1US8A 4GZ3A 3IC5A 4OJMX 1EGVB 5LOVF 3WLFA 4OXNA 5AM5A 3BZWA 1GT91 1IN4A 521PA 4H15A 2PZ8A 2P1ZA 4IXMA 3C16C 4K2AA 5IUKC 1RCFA 1OU0A 1L5SA 3GRRA 4IVNA 2Q29A 4YC7A 3ANLA 1QOPB 3MWDA 1QHFA 2GM3A 2V65A 1OLUA 1C3LA 1TDJA 1HLDA 3BBLA 3IQWA 2Y1OA 4BQSA 5C5CA 3ZS8A 3DUFB 3A4YA 4M83A 4UAVA 4CXMA 2X42A 3I5MA 3JQ9C 4EI8A 5AESA 1VC2A 3FNIA 3Q11A 3MJCA 2VOEA 3Q5EA 4OY3A 1M9NA 4RLQA 4V2IA 1VG8A 2H63A 4L4XA 1KP3A 1MR3F 3P5SA 5GIPE 2F55A 2IYVA 3IR6A 5KJ6A 2RJOA 1O7JA 3CPJB 4B2YA 4EY3A 2X8JA 3LZDA 5CHYA 4Y2UA 1LRJA 1JVSA 1GRCA 4QGFA 4XGIA 3FWKA 1VMDA 4B3IA 1UMBB 3UF0A 4KAJA 4OHFA 1VBFA 1YULA 4L02A 4UNNA 3M0EA 2IHYA 2I7TA 1VIMA 4Q1BA 2P7HA 1OWMA 3CFYA 3J81A 4MZXA 2ZRIA 3QVSA 3SN6A 1SVUA 4D9GA 4XWOA 5IJWA 3GLIA 1JZTA 2FRVA 3P27A 2XKKA 4P35A 4AUNA 2IODA 4Z7QB 1DFGA 5KVVA 3A1TA 3DHYA 4DV7B 1NU6A 3CU5A 5DOVA 5HILA 1DQYA 4KGVA 1VCOA 1JG4A 1QG4A 1V8ZA 3GLHE 2Y2VA 4KRYA 2RGGA 3KXPA 2JHCA 3F6PA 4HWPA 4XJTA 4ZEMA 2ASEA 3R6LA 2WAYA 3LDUA 3ADKA 5J4KA 1UBLS 3PV0A 5DYYA 3KSUA 1V7PC 3PNMA 1CB0A 4TL9A 4WA7A 4YJ2A 3TR6A 3QX8A 2V7WA 5KKNB 3LW7A 1WA5A 2GEKA 3AY3A 1I7DA 4QQKA 3AETB 4G5SA 1VYUA 3CB2A 1CR4A 1ZH8A 2OWEA 3K2BA 4YJ2B 5E4FA 5G53C 5B1SA 3RS7A 1QB8A 2XIQA 1WZNA 3NQ41 1IN7A 3IRVA 4RJLA 4V39A 5HIMA 3EUEA 3K20A 3QFHA 4EEXA 3I3OA 1VJRA 1X42A 2Q49A 3AEUA 4HRVA 1NUUA 3O1LA 1WPXA 4EKDA 1AMNA 2GAOA 4ZYTA 1PJLA 1RKXA 1X0XA 5BMVF 3NKVA 4M9ZA 1QPZA 3L4JA 1MRSA 5A5GA 3HACA 3QLUA 5TARA 4TLBA 1ODSA 3O47A 2EZ9A 3EXFA 3OJOA 2R25B 5FTNA 4M21A 5IVPA 3IOYA 1UIMA 2HWXA 4GVPA 2H4XA 3OO0A 2OZVA 1TVEA 4GYYA 4JEUA 4Q0MA 2PT6A 3T5BA 2XXAA 1ENZA 1O6ZA 1N3IA 4RGVA 4KPYA 4C20A 2ZRNA 2EX0A 1DZIA 2WNSA 4JVOA 3RWMB 3ZXUB 3KQLA 1EGHA 2B8EA 1W52X 1O54A 2YJGA 3KXLA 1SCBA 3QPDA 4K7JA 4CCSA 4KZKA 2YDXA 4WOJA 5DI3B 1ZJZA 1OZ0A 3OQIB 4MIEA 5BNTA 2V8BA 2ZJ4A 4URYR 2PT5A 5IVIA 5KTYA 4LNAA 3F4KA 3OP1A 3M70A 1Z2EA 1NN5A 5DW0A 3RJ9A 2RGYA 4UREA 4O8ZA 1H6DA 1MORA 1W9MA 3D3QA 1U3DA 1X8KA 2J5XA 1E2GA 2J9ZB 5FHQA 1DAEA 2VHEA 4Z4QA 1UT8A 4RY8A 1VGRA 3NTOA 3RVPA 1QFZA 2IPLA 4OGFA 2ZM5A 1AUOA 3TTWA 5KC9A 5J1TB 5IAJA 3PIDA 1XRJA 2CHQA 1U9IC 3HU1A 1U8FO 3E9ZA 4FFSA 5AHKA 3GW8A 3DZCA 3D6AA 3GG2A 1HEYA 2C42A 1DG9A 2Z2KA 3G5LA 1ZW1A 4O4JF 3KV3O 2GEUA 2VLIA 4K9NA 4ZC8A 3UWPA 3HPRA 2NXJA 3GLFB 1E20A 4KYTA 5L40A 3IIMA 2BTQA 5GZ3A 3ZJVA 3BJRA 4YAJA 3G1WA 4MUFA 1OGIA 2ZUTA 5ALJA 4FIDA 4EHFA 1XT6A 2RHHA 3AF3A 3R3YA 1XXHE 2QMQA 2FN3A 2WKWA 2R11A 3EIFA 1ONBA 2ID7A 5FKJA 1NJ2A 2ZZMA 5DHAA 1T4CA 3LK6A 4MOWA 2GDZA 5DTRA 3M5DA 1TCUA 1ST3A 1Z5PA 4MR8A 1T6NA 3EXEA 4YFVA 5AKZA 3TBHA 5JWRA 2WWRA 1T4CB 4HMPA 3IMCA 1EFTA 2XRFA 3BREA 1Z5VA 4KB5A 4LDNA 4QPJC 2CFCA 1UH5A 4UUNA 1AB5A 4KK3A 3VDQA 4BNDA 3NWOA 1HE1C 4KLRA 1HT2E 2VRNA 3TTXA 3BSWA 2XE8A 1MJGA 2WJYA 1CQXA 1NM5C 4K9KA 4NFYA 3FTEA 3PB3A 4FIZA 2PTGA 4Q18A 1N2GA 1AUPA 1WDWB 1ZY2A 2XTMA 4HCJA 4QDTA 3MT9A 4WVLA 3D3EA 5ERGB 1UKCA 5I7EA 4INPA 3FJYA 5MN6A 1UPXA 5AKEA 3AZPA 3BWYA 3MFQA 3NNSA 3NT4A 4WFQA 2H8GA 1QFXA 5DASA 3GJ5A 4BIMA 4KPGA 2H5LA 1FS5A 1UJ5A 4J7CA 3N0RA 4AIRA 1DBVO 3R3UA 2ZWIA 4IV0A 4CLRA 2GN0A 3RT9A 3DEAA 3PFCA 3FHJA 3FXAA 1MENA 1JPNA 3FI9A 2LIPA 3I3SR 3AVXA 4MRPA 4YUWA 1KYXA 2W5UA 1R0SA 2HU7A 3ZZTA 2YDYA 3T1NA 1VM6A 3K0AA 3THRA 1O8BA 1U0JA 2ECOA 1ILEA 1NQ5A 1AKTA 1KO1A 4YBRA 5BVHB 4I36A 2ENUA 1P2TA 4YS6A 1NMEA 4O4IB 1PSZA 5FJJA 1WPRA 2G08A 3GWZA 4XUDA 5E1OA 1USKA 5EZYB 5KKAA 2CVHA 1DTSA 3EXG1 1XVAA 1SB9A 2IXBA 1P33A 3JD2A 2Q6KA 1PJ8A 3JRXA 4CMEC 3OLQA 2QVBA 3QELB 3IT3A 1DNPA 2XWJI 1ZAYA 1Y6JA 3ZY6A 1Y3AA 4D0RA 4RFSB 2ZU6A 1TO1E 1S7CA 2G25A 4L6IA 4PNZA 3QELA 4Y2PA 3QSGA 4R1OA 3RWBA 3ZTWA 3ZOZA 2A5LA 2R5FA 3NEJA 4GM1A 3ICQB 1KKUA 2ZREA 3BWBA 4IRXA 3VV3A 5JNLA 1U1CA 3TZLA 2VXOA 1G21B 2G09A 2H18A 1D0VA 1Z4JA 4RNDB 3TX6A 1FRFS 3HZZA 2FX5A 3UT6A 4AICA 5HRCA 4D25A 3VOAA 1UBTS 1YIOA 2WHYA 3GRVA 4HD8A 4C2BA 1UFRA 5CBPA 6ADHA 3BIJA 2VSOA 3K5IA 4R9SA 5FV4A 1NBAA 2NU6B 3E05A 1ODIA 1G291 3FNFA 4IHAA 2VDRB 4WH0A 3LPCA 2BJWA 1QGUA 4R8MA 5DSZA 3S29A 4C3OB 3SHWA 3RHZA 4HNUA 2NLOA 4PG5A 2NO7A 4LMAA 1PR2A 4J0DA 1EVKA 3RYIA 3K5PA 2AUMA 4ZYWA 13PKA 1IRXA 1YDFA 4IP0A 4CZ2A 1Q3TA 4OFZA 4DCOA 3ZZUA 3DVAB 2VZ8A 1YAHA 4QAQA 4DR5B 3M1IA 3D5EA 5FQNA 1VKNA 4AJ1A 3SDSA 2ODAA 2D59A 3GUYA 1IRIA 5JYDA 2ATVA 4ITVA 3BC1A 1M34B 3USZA 2WJIA 4L4UA 3V6LA 1H4QA 4MUYA 4OPMA 4CL2A 3AM4A 4NCIA 2FWAA 2AYXA 5L3RA 2C2XA 3W8DA 5M34A 5HDQA 2QTFA 1KPGA 1K6XA 4E5DA 1NW4A 4B6OA 4RS4A 4WFIA 3SF8A 1IONA 3M9XA 1N1GA 1RWWA 5JS1A 1IHOA 5I9SA 1NJ8A 4PC6A 4RSRA 4ZT3A 3IEMA 2JEOA 4UCFA 3U1BA 3H2IA 1UKYA 4AJPA 4POOA 1P7ZA 2J5BA 2VQSA 3C14C 3JQQA 3MS7A 4IDNA 4B46A 1J07A 2AUTA 3B1JA 4ER6A 5L4LA 1CE8B 4NZ9A 4KOEC 5TIIA 4A8PA 1I7LA 2HEGA 2J9FB 2Y1CA 5BN4B 2OXTA 4CF6A 2IYOA 1ZITA 3GZJA 3BOSA 2OQ2A 2TS1A 2AJBA 1WSDA 4IG9A 5BN4A 3UAVA 3DTYA 3V3TA 4GL4A 5HIKA 3EEIA 1N6KA 2ZJOA 4BNKA 1J1UA 2EYQA 2IFTA 4AKIA 1R12A 1QYIA 4D2IA 1E6MA 3G1UA 3M4ZA 3FVTA 3L7LA 4JBHA 2QM0A 1DAPA 5CNMA 3FIUA 4RSMA 3I9V1 1VLVA 4A8TA 3KL4A 3IIKA 3LQYA 2PX0A 3BD8A 2CL7X 2R86A 1CBUA 5I6DA 4P53A 3FDZB 1SKUA 1K6EA 2X23A 3NHRA 3H0EA 1R66A 1R18A 3P9QA 3TQIA 1O95A 3DMFA 4QJ3A 5AQ1A 4H7DA 2IYPA 3PNOA 4FBLA 4OKIA 3TQHA 1YQWA 2CUTA 3IPAA 1ZESA 2VF2A 4O5OA 4RVGA 5H81A 3RWOA 3P5BA 3VC3A 1ZM9A 1WHTB 2AK3A 1A8HA 1OJLA 3H99A 4IO0A 1C3OB 4X95A 3DBLB 1VECA 2XTAA 3WIEA 4B44A 2WF5A 1K5DA 3F5DA 3F96A 3QMPA 4GP6A 3KSBC 3ESRA 2EFYA 2W2KA 1YQXA 5FTKA 5DMHA 3GJYA 2PS9A 3REGA 2DUMA 2BM0A 3QZUA 2KBFA 3T5MA 4DARA 1WNFA 1TYBE 2WG2A 5ELMA 4EX6A 3C3EA 4Q6BA 1RKUA 4H08A 2GB4A 4EZBA 4QREA 5CURA 5JNUA 1DIOB 3PR1A 3I1YA 4DBLE 1G3RA 4ER5A 2VHXA 3R3SA 4F6RA 4LF5B 1E3JA 4QGAA 1UK6A 4IOJA 2J9GA 3JQ8B 3H7IA 5JWOA 5EUCA 1M83A 2QP9X 3NDIA 2Q5LA 2I2XB 4Q1FA 2O5VA 3IDOA 4XVHA 1WMEA 2O2ZA 2DCMA 5L4NA 3CH4B 3PK0A 3VM6A 1L4NA 4LGYA 4QG7A 2OD2A 4OFXA 4MNTA 1O08A 3CLSC 4FE4A 2ZPAA 3AB8A 4O2BB 4WADA 3WB9A 1B42A 3WLAA 5BN1A 4URWR 3T0FA 5BQFA 3R3VA 2XDQB 3CNNA 2ZGVA 3ZCPA 5IJXA 3KU4A 3WYAA 4KXXA 2DFLA 4FK8A 4ZV7A 1HLFA 5ALTA 3W34A 2C88A 3WJ1A 3A4NA 1WF6A 3NGXA 3ELYA 4RGYA 1N2CE 1T1SA 5ECDA 3CURA 4P7KA 3RCBA 1IPFA 3H4VA 4HXFB 3TJRA 4EBBA 3SSNA 4QWMA 2P9CA 1O3YA 2MSKA 1NUAA 3KO8A 5DNWA 2QMEA 1Z0UA 4BU0A 1BN6A 2AZ4A 3RKRA 1JBQA 4J0JA 1FDTA 1Q1BA 1KYZA 2DETA 5JAMA 4M9CA 3H2YA 3OF2A 3I12A 3DWGA 1A2OA 1E1NA 1EXNA 2DQ4A 1OJ7A 3GFFA 4HEHA 4CW7A 1KAMA 1NLUA 3U7EB 1PW7A 2VA8A 2ZRAA 4RK1A 4HZIA 4QUEA 4CKEA 4XD7D 3CKKA 3ND8A 4RLFA 1NA5A 4WJKB 1O94C 3UH1A 4D81A 3ERCA 2ATCA 2J5KA 3J7TA 3NGMA 3OLYA 1OROA 1SIUA 10MHA 1GGMA 3C74A 5ES3A 2MSCB 2OHVA 3FWHA 5FI1B 3LL7A 5CVEA 4G0YA 1B6GA 3ETNA 3IDAA 4NAHA 5FOUA 1P9NA 3DUWA 4YV7A 3PXCX 4PO3X 1RPTA 2I4TA 4EB6B 4JJZA 1NI3A 2XYQA 1BYIA 3LQKA 4BGVA 2GAAA 4TVBA 2YV1A 1CHDA 4B34A 1PX2A 1RMYA 4DHEA 2FN4A 3E1KA 4WLNA 3ETCA 1P81A 5AVRA 5I9MA 4DUPA 5CB8A 1WMFA 1EVYA 2IUEA 2QRVA 3MPUA 2A14A 3MTJA 3I2JA 1USGA 3RTDA 2CVQA 3H1TA 1FTYA 3QX9A 4M1TA 4GO1A 4B8YA 2JLZA 3BGVA 1EDOA 3RT7A 4ZVKA 5FEUA 1FVHA 4NF2A 3JAWB 3PTLA 5K8JB 3JASB 3MVEA 1VTKA 3EEFA 3LC1O 5DLDA 4FILA 1FA9A 1UZLA 2DUUA 1T91A 4B2LA 1CNMA 1A2BA 1PG5A 5C8ZA 1L8OA 3L6BA 2NO0A 3PNSA 3NJ4A 2R0QC 1U8CB 4II2A 1G64A 2FWMX 1GYQA 3JS5A 1L5VA 2ZYRA 4MS1A 4X8HA 2DTDA 3I83A 1RZRA 4R8RA 1E4VA 5HA5A 5IUNC 1YJXA 3ZIAA 4DY4A 4RLHA 3FRJA 1S3SA 4MS1B 1RWVA 3FVQA 3V2UA 5AK3A 1N6NA 3L43A 3K53A 1N0IA 4CM7A 4WBNF 3W1VA 3HUFA 2GM5A 4XX0A 5EXDA 4ND8A 3RJZA 3ZHOA 2XCTB 2D1FA 1O8CA 3WK5A 3D2AA 3FPLA 5T57A 2OC4A 3T54A 1PNRA 1NBWB 1T4GA 1JBEA 1JTVA 1L7EA 3W77A 5FNVB 5BP7A 1QO9A 2QZSA 1SVKA 3S40A 3SMVA 2GVZC 3LBAA 1NHGA 3HJBA 3GFBA 5CD9A 4M9SA 2CK3A 1JHXA 3PYXA 3MERA 3PBKA 2I80A 1VL5A 2ZVQX 3WYNA 3ER9A 1QG0A 2D5AA 4EW3A 3DBVO 4LJ4A 3UK0A 1FMCA 3FDFA 1CVIA 2EQAA 3B60A 3GVIA 4X7MA 1OBCA 3ZV5A 5E1DA 1V1RB 2MSWA 4LXUA 4UQPA 1EVQA 4AJ2A 4C01A 5THQA 3SXJA 1Y9ZA 5F1OA 2PU5A 4YAKA 2W2VA 3D8BA 3RIYA 3EVDA 1N5DA 3NV9A 1RAIA 3BQMB 5E7IA 1HNWB 4I7EA 1HO3A 3LCRA 3WBKA 1E96A 1EB8A 1YE8A 1IN1A 4QU9A 3ENWA 3WWZA 4E2XA 1V5IA 4EJMA 4EMSA 3CX3A 1T9BA 3EZ7A 5SY9A 4AKTA 5C3MA 3LOPA 1XRRA 4LVCA 4BQIA 1KDYA 2DKNA 1W73A 4LK2A 3RV3A 1HQCA 1T43A 1TQ2A 5DE3A 5AHOA 3P2YA 2HRBA 4MJLA 2GF2A 5EWJA 4QXOA 4Z0TA 2FF7A 5CDFA 5KX5F 1PG2A 3E48A 3OTIA 4Y0NA 4ZCLA 3RU9A 4K0RA 1QYVA 4NDAA 4PAWA 5REQB 1NVFA 5TB5A 1TMKA 3F8TA 2OT3B 4JJIA 5TGTA 5AVWA 3VISA 4UEQA 2W0SA 4LDRA 4MWGA 3AB3A 2PNFA 5EE0A 5KBYA 4LOAA 4R1MA 4EJ6A 1D7AA 1EEXB 1TLFA 3DE4X 4QXRA 1E99A 4ARVA 2FJ0A 4EGAA 3OY2A 2MTBA 3I64A 3KQHA 5CIQA 3F7TA 4N6NA 4BMSA 3ZLTA 5ALDA 3K3PA 1P73A 2P5YA 4REQB 4UDNA 5BV2P 4AM8A 1W93A 1WXQA 4RHTA 1QCYA 3DLTA 3IO5A 4M8IA 3SZOA 5EHXA 2V0GA 4ALLA 2OAGA 2EERA 1DFIA 2ZBGA 1UQUA 2P91A 5BUQA 3RASA 3VOTA 5JVDF 4NCHA 1DTWA 3LA6A 1FMFA 2IX3A 1R15A 1YXMA 5JCJA 5D85A 1Q6ZA 5CLQA 1HEUA 4CFZA 1RTKA 2X58A 5EZ6B 5KNCD 1C2YA 1QE0A 4J76A 2BY4A 1TC2A 3BFPA 4JXKA 4RA6B 2YIVX 4ZVSA 3TD9A 2XECA 4PBRA 3H2BA 5EZSA 5ALRA 5LZ4A 1S8NA 1FFXB 3IKLA 4YDSA 3FTCA 1LPSA 1TW3A 3KSMA 1Q0ZA 3OCXA 1Z34A 1LUAA 4AW9A 3WAGA 4NCBA 2EJWA 3DULA 3WIBA 3GU3A 1JLSA 3LYAA 5I4IA 2PUAA 5E1MA 1GN9A 3MWJA 3C5CA 1P7VA 4D9CA 4G0UA 1N2CA 3E2IA 4DB4A 3ADBA 2VNKA 2DHCA 5CXXA 2Y68A 2YVAA 4D44A 1GTMA 2QGNA 5KWEA 1G0OA 2IYNA 2GK3A 2JAWA 2JHAA 4XB1A 4CU5A 1LX7A 5CTJA 4I55B 1QGDA 4LZPA 1JXMA 4QJ5A 2VHUA 3S70A 3IELA 1M2OA 3QHAA 5H68A 1DB3A 3P2OA 4UUBA 4E6EA 1VSBA 2F2TA 3R9WA 3Q3JB 1OPXA 3DXYA 3PQ7A 5HMLA 2I1VB 1XQ6A 5AKHA 4BNNA 1RSZA 1E60A 3AR5A 5B7GA 1RM4A 5AUQA 1GDTA 1XTTA 1WZEA 2NPIA 2WJJA 1O97D 2GBLA 5TNXA 3HS3A 3NW9A 3AFGA 3F7OA 3O4FA 4PZDA 3TTVA 3TR5A 4HPWA 1R6DA 6YASA 1VJ5A 2FVYA 2O8VA 4MR7B 1NPDA 4N8EA 3VO9A 2WB2A 2ZTLA 1JDUA 3HL0A 3H4MA 2HZ7A 3J7AC 1AQYA 1MJ5A 3GL9A 3D6UA 1O5TA 2R5WA 4M0LA 1OC4A 4Q3OA 1XKLA 2G88A 2IP4A 3EFOB 3K0FA 4S35A 5DXFA 4L07A 5FOWA 3RSZA 1VSQA 1JTEA 1KFEB 1CFJA 2HH9A 5FX2A 3KZVA 5KINB 5LVAA 2TRSB 5E9WA 1YI0A 4CEHA 5BSWA 1GY8A 3KQYA 3IA7A 3NOXA 4CM6A 3R3JA 3LGXA 4K1LA 4W9RA 3ZXXA 3K96A 3AUYA 3Q3HA 1XK6A 5EKUA 4DM3A 4W5RA 3U81A 2ZVPX 4BTEA 2HTFA 1D8TA 4MUJA 3E7DA 2FEMA 2FJUA 4C07A 2GAFA 2ICAA 1BU5A 2MDTA 2AMVA 1XZCA 2FFJA 1DAFA 4FYIA 1Z5UA 4JVNA 4B76A 2XSZA 4WNCA 5JH7B 4QQ8A 2O4UX 2IIPA 4K8RB 1UAAA 3DL2A 3JATB 1F60A 4MYDA 4BAGA 1ZVKA 3E6AA 1Y7HA 1FQKA 2JFZA 1U28C 4EY5A 3MJDA 4L16A 3MT7A 4YRQA 3KKZA 2GPSA 4C6TB 2PE5A 4G0WA 3OCZA 3PLNA 5HSGA 2ETXA 2Q3MA 4LV8B 4YK7A 4DYVA 4DBVO 1TM2A 4EKIA 4M8NE 2F9FA 2QN9A 4OXXA 3RBXA 4Q19A 4MKIA 1X2BA 2PEYA 3THWB 2N9UA 1CUWA 2Z3ZA 1AXRA 2PRZA 1ADFA 2B61A 2UYCA 2FPIB 2KMLA 3JQ7B 3N0TA 4IBOA 5KAMA 1ABFA 1DEXA 1UC5B 3LP8A 2HMAA 2XB6A 4I1OA 5LP6F 4KACA 5K4GA 2BBTA 3UA4A 4ENWA 3QVXA 4A82A 2E2WA 2VWQA 4UJ5A 1QZ3A 1XJWA 3WBFA 3U31A 1Z4KA 2DPGA 3OMLA 4HC4A 4Q00A 4TZTA 3TLKA 4TVKA 1K7EB 1V7ZA 1PJTA 4RHUA 3HR7A 3ZWOA 2WM9B 3SX0A 4UBJA 3ODPA 4MB0A 4MGYR 2ZIWB 4EM6A 1Y3HA 4WBXC 1IXYA 2ZJ7A 1HH4A 3CZ4A 3TBKA 3EZ2A 3QOFA 4IIDA 3OWXA 3SJCA 2IPAB 4OQYA 3M6MD 4E5UA 1A69A 1D2HA 3RVOA 4YCSA 2J08A 1PW5A 5KX5A 3ZN2A 3IX7A 4G9BA 3UICA 4BLSA 1X86B 2FPOA 2XMZA 3ICOA 4RK4A 3VNAA 3GPLA 4BN4A 1T6XA 1P62B 3CEAA 3JD1A 3SF0A 3UEOA 4ZWNA 2WF6A 5DWQA 1U1EA 5EJIA 5B7PA 2GEFA 3OC0A 2UXDB 4YRKA 3UC5A 1FDVA 3TGLA 4Z7JA 4MS3B 1D1PA 4QNRA 1WS6A 3DZBA 1KWKA 1SM4A 5AWFC 2UUAB 3EXG2 2NOAA 4U7DA 1DOZA 5C1DA 3NRCA 5IBRA 4TTJA 1HG1A 1PZXA 2PQMA 3BTVA 3GEHA 5IAKA 4UTNA 3LUHA 4D7AA 1IDOA 1CNFA 5LZ7A 2CXSA 1XVIA 1NGSA 2AZDA 2O20A 3UMCA 3QF4B 3LF1A 4HGPA 5K03A 2WU1A 2YC4C 5JJBA 5ITWA 4JIGA 1XZKA 2FSUA 3IQHX 4DEVA 3NG1A 3U61B 2RGRA 3TLMA 3Q2IA 1Q7RA 2NG1A 2RI0A 5K45A 1GJRA 1EUYA 3TPCA 2BMDA 2A9QA 3IXLA 3OKPA 4CJXA 1M2FA 1O2DA 4L3WA 1UDXA 2WYUA 1NW8A 2GX6A 2WSSD 4IL5A 1A5SB 5DWDA 3ZZNA 3TECE 1G3IA 3NTLA 2PKCA 3OLVA 3QGMA 3TN7A 3Q3GE 5CTAA 4PYMA 2Q5HA 4B4OA 4XSGA 5JUWA 3DTVA 4GMDA 4KIJA 5EYPB 1ISIA 4DMGA 4U9UA 2IJGX 2OM6A 3JQCA 4N3BA 2YV2A 4RJTA 2ZUBA 5FT9A 2GZ1A 4BX0A 4KQMA 4HH4A 2ZXEA 1QO7A 1CWUA 5BSKA 1JQDA 3WA7A 2DC1A 2VRWA 4FHDA 4YP7A 1F5NA 2CKDA 2XCUA 1AG9A 1P2DA 2DSTA 3C8ZA 3O74A 2A0FA 1KDVA 1W8IA 4DADA 1FNBA 2ZJFA 4R31A 1DC4A 4GC5A 1LVGA 1W76A 5FUMA 5JYBA 3U4QB 5HUJA 3WRXA 1W581 3I9NA 4MYCA 5K4HA 4NNJA 3ZVKA 3MCAA 5MF6A 2OCAA 3BL5A 3H8JA 1MOSA 2VZLA 3O95A 4LIPD 3R7LA 4E5PA 5L3VA 1RQXA 2ZQ5A 3GFQA 2JJ2D 2VJPA 1K75A 1U5CA 4CQLA 4OREX 2H0QA 5L3SA 4I4TB 3E84A 4BX2A 5DI9A 3HM9A 3UMFA 2I1QA 3I4CA 3QPUA 4HAVA 3PGMA 1YR3A 1UXGA 1MQSA 4LRYA 3VKUA 4YIHA 4CETA 1JQKA 2F90A 3H6HA 1N5LA 3TLEA 3O8OB 4L27A 3BWXA 3HUDA 5E4YA 1QHEA 2W2TA 4MHOA 4LJYA 5IT4A 3NOOA 5HKOA 1NP7A 3OEEA 5DLYA 3GLGA 3GRZA 1DWUA 1T5SA 4E5KA 3JVVA 2PGDA 2EFGA 3B7WA 3LY9A 3RC8A 5LA6A 5EE9A 721PA 1T9ZA 1PT5A 2HQBA 3J80A 1P0MA 4RTLA 3TKLA 4JBYA 3DA8A 3WIVA 1YCDA 5B2EA 3FKJA 3JR7A 2W6MA 3N8IA 3OE7D 4TKLA 3B3GA 5DNVA 4EJSA 1CQIA 3AJRA 3CBGA 4D41A 4LY6A 1BEEA 2ZTHA 3QW4B 3ZDCA 1B6SA 3BK7A 3TRJA 4B4DA 3KPUA 1RI2A 4MARA 1KMHA 4P5EA 3QPWA 1Q3KA 4LBZA 2DPMA 5HKBA 5IJ9A 1TZCA 1VB5A 3UGJA 3KT8A 3IQGX 5F52A 1KMHB 3H3XA 3HYLA 3ME5A 1GU7A 4XH9B 3EARA 1LBIA 3D7KA 2WJ4A 3BJMA 3GT0A 4TWZA 1ISMA 1BX0A 1JN0A 1QAQA 3BA1A 2OFPA 2Y93A 3KVRA 4G24A 1CSEE 5IVDA 5H7XA 5B4UA 5TVGA 1BROA 3ETLA 1BKSB 2GWHA 4S05A 1U4SA 2ZRLA 3ZWBA 4EYKA 2QU7A 4JOCA 3T95A 5AUPB 5SYMA 5LQUA 1JSXA 2C00A 9MHTA 3CNEA 4ERXA 1DMRA 3N2KB 3FF1A 3D0OA 3LIPA 1MMFB 5TGDA 2CXOA 2WFLA 4NCJA 3BDAA 3KZXA 3GZNA 2WMOB 5AM1A 4F3RA 3PFGA 2ZT5A 3FKSD 3RIGA 5BNWA 4LA4A 2HQSA 3VR6A 1Z56C 1KAGA 4LSGA 5I4KA 3BB4A 1PKEA 5CVDA 4LJAA 3QVVA 1Z4LA 1QUEA 5JSKA 4HNAA 2YMQA 4IVQA 5AKLA 4HVTA 4CHTA 3PX3A 4PN3A 3CCBA 2UUCB 1T3TA 1YK1A 2W6IA 3GJ0A 3PR2B 4WZZA 1X19A 1GILA 3C41J 3OQ1A 5KOHA 4AX4A 5FO0A 3N2IA 2QXYA 1TZJA 4WCVA 2QBYA 2BFOA 1Q20A 1RW4A 1BX1A 2DYKA 3G79A 3OJCA 4S1TA 4YNBA 1CVRA 1E9EA 2PD6A 3BCSA 5DW3A 5AW7A 1BE8A 2G83A 3A6PC 3X1DA 3MTIA 1REQA 4WY8A 4YAOA 3EQ6A 4K6MA 4RK7A 3ANSA 1T9HA 4FI3C 1WCXA 2F1HA 4DCGA 1MC4A 1FRQA 2NXCA 4UHBA 3KVOA 1ZHOA 2IC5A 4MUGA 3BXZA 1DIBA 2WWWA 3KXIA 3SC3A 2X8BA 3NYIA 5BV7A 4HDSA 1N2EA 4YCJA 3DE5X 3KKPA 1GGJA 4MKFA 4U2BA 1R50A 1R3UA 1SQGA 3LD9A 2NUPB 1U7HA 1UKZA 3FH0A 4RW0A 4ZT2A 3C3WA 3BKXA 3O94A 5B55A 2AF4C 5E6UB 1XJ5A 1POWA 1GZUA 3GEIA 5A0VA 4JAVC 2AN4A 1PGNA 1YRLA 3D7MA 3WTBA 3CSUA 1ISFA 5E6RA 5C18A 4X8MA 1JE1A 3SQWA 2C58A 4BVLA 3HUEA 5J2UA 1ZO8A 4RZQA 4M1QA 1W75A 4YAUA 2Q0SA 7YASA 4CM4A 1U0NA 4TYQA 1NE7A 3P2JA 5JI2E 4JP2A 1CKEA 2D7JA 2JDIA 5K3BA 3HB9A 4YRZA 3TG8A 3QVKA 4HDQB 4XJSA 4CM4B 4DAOA 3QKUA 3R5SA 5I7RA 4AZ0A 1M6VA 5JMWA 5D3MA 5CU7A 5KHAA 3WMEA 3CVYA 3D8SA 4G5YA 1I6KA 3KJXA 2ZBFA 1ZGZA 2G9UA 1TEVA 2WB4A 3KUKA 4FW8A 4G56A 1GPBA 1ZK1A 1G55A 3LC0A 3VVBA 3LM8A 3E7WA 4YFYA 3FPSA 1I2DA 1L4BA 2YHBA 1QKIA 5D51S 2VSFA 3TM5A 4D6YA 2V97A 1LBQA 2VF4X 1K8RA 2W6OA 4K46A 2XBLA 4LCEA 2QN6A 4DR3B 3FLMA 2V9PA 3UHPA 2QSUA 3R5FA 4GR4A 4BO9A 1ZM3A 4JR2A 1ST2A 3KFVA 3M1YA 3M4JA 4EPRA 3OEWA 3OZCA 1E2HA 1GA1A 4LDPA 3BRQA 4NYJR 1C3EA 1BJRE 1Y4AE 5DGDA 1WTCA 1YS2X 2ZRFA 5C4GB 4A8JB 1JWAB 1Z15A 2IIQA 2QJTA 1SBIA 4MROA 2BR4A 3EEOA 4OQDA 4ID9A 1KI9A 4JL8A 4Z9AA 1V3QE 5JADA 3D8HA 4FFOA 4FDLA 5IDWA 1MHPA 3MG9A 3IQZA 5IAOA 1EU1A 2J6BA 2OL4A 2X0KA 1ZNQO 1SQ0A 2PSDA 1G3MA 2R44A 1V4VA 5IAEA 1U5BB 4EGJA 5BMVB 1CF2O 5K3EA 4R3NA 5H5JA 1DDGA 2VUUA 4GBMA 3OFVA 5NLLA 4DLRA 3B1VA 5A6SB 2CEAA 3UG7A 1STOA 1Z0SA 5SY6A