3D9QX

Proteinase k by lb nanotemplate method before high x-ray dose on esrf id23-1 beamline
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3d9qX00
1LW6E 3Q40A 1SUDA 3VHQA 2Z56A 3GCXA 1GTG1 1Y3CE 3TECE 4GI3A 1YJCA 3EDYA 3F7MA 3VYVA 4DWWA 1SELA 1WVMA 2XRMA 3P5BA 2PKCA 1V6CA 5FAXA 4C3VA 1TECE 2SBTA 1BFUA 1SUCA 1SVNA 2W2PA 1ZVKA 1SCDA 4NMXB 4HVLA 3PTLA 5B1EA 1SCBA 1CNMA 1S01A 4HX2A 2ZWOA 2Z2ZA 3DW1X 3Q5GA 4WOCA 1SBTA 1P8JA 1EA7A 4ZOQI 3I37X 3D43A 1Y34E 3VSBA 2Z2XA 3QTLA 1PJ8A 1YJBA 1SIUA 1TM3E 1Y33E 3A3OA 3H42B 1T1EA 3EIFA 5K7SA 1IAVA 4JP8A 5JMOA 3DVRX 3LPCA 1AU9A 1SBNE 5JXGA 5ARBA 3GT3A 3F49S 1SBCA 1OYOA 2IY9A 2Z2YA 3OSZA 3DYBA 2PWBA 1OYVA 3TI7A 3VTAA 4H6XA 2B6NA 4ZARA 1KDVA 1DBIA 2Z58A 1KDYA 1GA4A 1C3LA 1SUPA 3SICE 3QFHA 3VV2A 4H6WA 1WMFA 2ID8A 3QMPA 1P7WA 1MPTA 1SIOA 1TMGE 4MZDA 3L1KA 5JXJA 4CFZA 5JXIA 3WIUA 4B5LA 1VSBA 4CFYA 3DE0X 4KG7A 3GCWA 1YJAA 2X8JB 1TM4E 3CNQS 2HPZA 2P4EA 3DE3X 1BE8A 1AV7A 1TO1E 2ID4A 3I2YX 1CSEE 1SUEA 4NE7A 2Z57A 2X8JA 4DJ5X 2WUVA 3A3PA 1T1GA 3AJ8A 4DZTA 1R6VA 3BX1A 4KB5A 1SUAA 2G4VA 5B1DA 3ZXXA 4AKSA 3UNXA 1GTJ1 1HT3A 1A2QA 1T1IA 3BGOS 3EE6A 5FBZA 5AVKA 1NDQA 4C3UA 4CG0A 2DUJA 5JXHA 1TM1E 1PFGA 2Z30A 5ARCA 1EGQA 2SNIE 1IC6A 3I34X 2IXTA 2WUWE 1GA6A 1GCIA 3CO0S 3LPAA 4RYDA 1SN7A 3DE6X 5ARDA 3WIVA 3F7OA 1AQNA 1C9JA 1YU6A 1Q5PA 1Y9ZA 2W2QA 1Y4AE 2GKOA 4NE9A 5SICE 5AVJA 2SICE 1PEKE 3DE1X 4WOBA 3TI9A 1Y3BE 1WSDA 1Y3DE 5AQEA 3WQBA 1KDZA 3LPDA 2PMWB 1BFKA 4FONA 4BWGA 1SUBA 4M1ZA 1GNVA 2DQKA 3WHIA 1SIBE 2W2NA 4H6VA 2PRKA 5FFNA 1SH7A 3DW3X 3AFGA 3DVQX 1UBNA 4J94A 3SQOA 1XF1A 1BH6A 1GA1A 2PWAA 2TECE 1KE2A 1JEAA 1NDUA 2ZWPA 3A3NA 3LXUX 3HJRA 1R0RE 5AMXA 2ST1A 2XTJA 1AH2A 3I30X 1ST3A 1R64A 1Y4DE 2E1PA 1PTKA 1WMDA 1SCAA 1AVTA 4OV6B 1OT5A 1KE1A 4Z2AA 1GT91 1WMEA 3DE7X 1BE6A 1THMA 3DWEX 4LVOA 2W2OA 4KPGA 2SECE 2V8BA 1TK2A 3DDZX 1S02A 1Y48E 1GTL1 2ZRQA 3DVSX 5CW1A 4AKTA 1DUIA 1C9MA 1SBHA 1S2NA 1NLUA 4LVNA 4YN3A 1AF4A 3D9QX 3AJ9A 2PYZA 3ZXYA 1BJRE 3BPSA 4OMCA 2HD4A 3PRKE 1SBIA 1Y1KE 1P7VA 1ZVJA 5I9SA 1TM7E 3GT4A 2QTWB 1AK9A 3DE4X 1Y3FE 2W2MA 2WWTA 1GNSA 1ST2A 1SCNE 2WV7A 3VV3A 3DE2X 4I0WB 1SPBS 3T41A 4OMDA 1SCJA 2PQ2A 1TM5E 4K8RB 1TO2E 2DP4E 1V5IA 3DE5X 1C9NA 1MEEA
chains in the Genus database with same CATH superfamily
1N2JA 1ZD1A 2A5FA 5FYDA 5I7UA 3DOFA 1QG0A 2FTKE 3AR6A 4WNYA 3I9OA 2V9CA 5CVDA 3KQVA 4LF5B 3W6NA 5LPNA 1G6Q1 2PT7A 3DNPA 3GGDA 4JA2A 1H4TA 5L6LB 5HVNA 3EZXA 5TRTA 3H1AA 4PGMA 3IBCA 5H7XA 1E99A 3PUWA 4PQEA 5EIHA 4IILA 4PBTA 4MEBA 2NM0A 5CA0F 2I7TA 2J59A 1Z3IX 3ZH2A 3Q5GA 2C7PA 3E2PA 1P6XA 1RE1A 2NQTA 3FBTA 3QVMA 4HXEB 2AFRA 4CM6A 1Y34E 2XYPA 2VDUE 3A28A 1F5NA 2ZAMA 1S6YA 3QEJA 4GI7A 3ZC3A 3DOUA 1VI5A 2OXFA 3AF1A 3GEHA 1MQSA 3N07A 4AF8A 3QEAZ 5KKCA 3TX2A 4ZDJA 4XPIA 4CR6A 5CEJA 1I80A 3BEOA 2Z08A 1FU7A 4YBRA 4B3HA 4UMDA 5F12A 1YRHA 1CULC 3RRXA 4DJDC 3EMVA 4PONA 1PEAA 3DL7A 1Y7HA 5A0VA 3EF0A 4QM7A 4FYKA 2H63A 1Z4NA 4F9EA 1N6IA 3OUUA 1LK7A 1N1DA 1LVGA 1YR6A 4N5LA 4Q3OA 5DT9A 3MT8A 2VAVA 4RMGA 2C78A 4JL8A 3VPHA 2F00A 4I2VA 1GU0A 1JG3A 4DDKA 2PXAA 4D1YA 3UFXA 1RQGA 2C95A 1Q6ZA 1KPGA 3AYZB 1UPXA 1JLLB 4IEFB 2OGUA 2W2VA 1U9YA 3CX6A 5EWMA 3OQOA 1L8LA 1P9NA 3N2GA 3SC2B 4OYLA 5LQJA 4D02A 1KK3A 1UXKA 2XZPA 5KYUA 3OCCA 4JASB 1M34E 3L1HA 3PXDA 4LY0A 4XGRA 3CSDA 1R3UA 3BDIA 4M89A 3GNTA 2CCGA 3RVMA 1ZUHA 3QVUA 4YH1A 4Z8XA 5EFZA 1E7RA 2YZMA 2QRJA 4HRVA 2C61A 2Z30A 3PC6A 3LA8A 1A27A 4WE3A 1QC5A 4G1CA 3ZEAA 3HYLA 3U19A 3O74A 1DKPA 1G8FA 2C2MA 2PSSA 1KO8A 2QNBA 2XHZA 3CUYA 3GFQA 3PIDA 4JENA 4NJMA 2I22A 2VJBA 3EEYA 1F2TA 2EJTA 1DX4A 3MAAC 1MO3A 5DU2A 3RVDA 1QAQA 1WHSA 3DQZA 1XZFA 1FFCA 2YKGA 2VPYA 1SIBE 4G67A 5SY4A 3G49A 4F1KA 4HJRA 1NATA 1VRVA 4J94A 1QIHA 5DYWA 1DC3A 1KF0A 3AJDA 4ZVPA 4F2HA 1G17A 2L0XA 3EGVA 4MSUA 3T5GA 1XSEA 1IHUA 4Y2QA 2PQ0A 3KSRA 4GC9A 3EIEA 1IZ0A 3ZHVA 2NXWA 4YREA 1YS2X 4UFOA 3TMYA 1RI4A 3FUXA 4UUNA 2RC5A 2WABA 4GP6A 3REQA 4KVZA 2P0AA 3VH3A 4ZI3A 2OUIA 4OXQA 3PCTA 4LJ6A 2J5QA 2ZR9A 1KMCA 3ZS8A 1NBWB 3FYCA 4N3GA 1S2NA 4I50B 1M73E 4X45A 2P6RA 1KEUA 4MUKA 4DG9A 1VG1A 4KAFA 2IOYA 3E9RA 1J2YA 4PVDA 1JG1A 3UIEA 1NN5A 2MYTA 5CBKA 5HZGA 4DV5B 2XTNA 4QUGA 5HCIA 3TX6A 5HRCA 4Q39A 4IYRA 1X9HA 1V8BA 3ISJA 3BF7A 2V6GA 4GUAA 5A3QA 1LU9A 5HJ7A 1A8SA 1OE0A 3AR9A 4HEHA 2VHVA 2EG9A 1LW7A 2DSTA 2OC4A 5AI9A 3VPCA 3SP1A 3I01M 1E7SA 1E1NA 1I0IA 2DM6A 5JARA 2ERCA 2GPSA 3FR8A 1AS2A 3NUGA 4FD2A 4KQ1A 4Q7JB 3ON5A 1DTSA 1JDBB 4QUJA 5FOUA 3BWDD 3CA8A 1PR0A 3H2BA 2UZAA 4RD1A 3U62A 1YZFA 4MUJA 3LFHA 2DWCA 3A4IA 3QTLA 1BD3A 1PT8A 2GRUA 3KOXA 1HZZA 1QLHA 2WU8A 1YRBA 3VYSB 3LI2A 3GRUA 4ZP1A 5FR2A 3W9SA 1JYEA 1R8XA 2O7RA 3N9IA 3AXSA 5JZMA 2QGNA 3EQ8A 1Q7BA 3U48A 2QXTA 3GFTA 3N0WA 4RHXA 4OA5A 1I24A 1RZ3A 3LCUA 2WJPA 1VDZA 4YRTA 4F4FA 4V1CI 3RANA 1ZN2A 3JD0A 3RS5A 1KDYA 3MGGA 3W2TA 1WKVA 2ISSD 3OWHA 1W85B 3VC1A 4BMSA 1LRLA 1CDZA 3FCXA 2VF2A 2QL7A 3ND8A 3RRFA 3KSBC 1LJUA 4MQUA 4X7PA 1O95D 4NMHA 1DMSA 1JG4A 4MV7A 5IUKC 4BP9A 2ECPA 2IEZA 1UWVA 3WDLA 3JYNA 2VI5A 1ZD3A 4N0EA 3CEAA 5BNIA 2IU4A 3C8DA 3R5KA 5KOJB 4IXDA 2XGOA 2WC1A 5CA1A 4EG6A 2IX9A 3P2OA 4HGQA 1J24A 4MS3B 4RW0A 1P0QA 2CXSA 3L82B 2XODA 4KGVA 3FOZA 1WDWB 4Q93A 1YHNA 3CT6A 1P75A 3CF0A 1OVMA 4WCVA 2DPHA 3SC3A 4HNTA 2FFRA 4K40A 2FU5C 3MD9A 3NU1A 3R4VA 3AHEA 4XB2A 4NYJQ 3L6OO 2CV1A 1NX9A 2GPBA 5TT0A 4C7XA 5BWCA 1E94E 3QG1A 5JFTA 1UH5A 3PV0A 2Y93A 5ESDA 4A6PA 2I8AA 2VNIA 1CY0A 5I4CA 1ADYA 2AVNA 1DEOA 3KJEA 3MRSA 1VDMA 2C5GA 4ZOAA 2R48A 1YK0A 3HXKA 1JJIA 2EQBA 2VJMA 3MJ4A 4M1EA 4WZBB 1GSIA 5AW2A 2Q4TA 2DKFA 3M83A 4G9GA 1PFYA 5C35A 1PT7A 2XUFA 3BMCB 4O3FA 4C4SA 2PG3A 3L8EA 1VLLA 4B4KA 4HLUC 3MG9A 1U2QA 4QU8A 1YI1A 4FFVA 1AA6A 1F17A 1KH3A 2B7CA 2WD7A 5K6TA 4OKSA 1VHQA 3T15A 4AF6A 2XNSA 5JDIC 1Q7EA 1U2DA 3IC5A 3EK2A 4K6MA 2ZUCA 1FUEA 5E1BA 1W9HA 1X7XB 1DZIA 1JIUA 1U99A 2BEWB 2PDAA 2FZLA 3EVCA 3FBWA 3K4PA 2ZRQA 3DV2A 3WIOA 2VYQA 3HS3A 5KYGA 3ZD7A 4D4IA 5IH7A 4TL7A 5JISA 2ZSUA 2GN4A 3JV7A 4H35A 3PS9A 1DC7A 2NU7A 1V47A 3THOA 1QRTA 3LVBA 4MW2A 3SVTA 5FDFA 1TYBE 2J45A 3BORA 4XYMA 2HN9A 3WNCA 3OIYA 2VC2B 4GXNA 1CC1S 1EFTA 2RGBA 5EERA 4N82A 4ZO7A 3G2QA 3T34A 1WDLA 3W06A 1RRMA 1ZRMA 1VSQA 4MVXA 3WLNA 2GESA 5LQMA 1MB2A 4QLAA 1C3EA 1A9XA 3Q15C 3BMXA 3IESA 4XI9A 3Q3VA 4QOIA 3MCZA 1O1YA 4CM3A 1L3BA 1JVSA 4PEVA 4IW3B 4RFLA 4AJ1A 2L82A 4K1LA 3TD9A 1ORWA 1Z4IA 1COWA 1HL3A 1KKLA 1PNOA 2IXFA 4PWYA 1LXCA 1RWVA 5T4BA 3SHOA 5A4KA 2JFBA 3ZGLA 2GN2A 2PPLA 1BJKA 4KTVE 5BSGA 3QNWA 1AUQA 1ML4A 3TJMA 4YUAA 1UL1X 2H1VA 4EK9A 2JGIA 3TZLA 3INGA 3OZSA 1C1XB 4IV0A 5COBA 2P75A 3IE2A 3UO8B 1H4QA 3OVMA 1GTRA 3U31A 1V9SA 1DCTA 2HR1A 1WMSA 2HMAA 4X66B 2DH6A 1EZZA 1S9HA 1A7UA 4P82A 4WADA 5CJ2A 5HKKA 2QT1A 1NXTA 4H6PA 2CT8A 2Z2YA 3K9CA 4IJWA 2BMJA 13PKA 1N2CE 3HMKA 3ICVA 4XJTA 5G40A 4O2BB 3DM9B 4BMNA 5AFSA 3T4XA 1XZGA 1OXUA 3HEMA 3IOMA 2OORA 3C5WP 5GM1A 4D8UA 3ND6A 2IHZA 2X1LA 1WXGA 4IUYA 3T7DA 4G23A 1FSFA 2O2CA 3D5TA 1ZHHA 5T6BA 3L6DA 4YCMA 2NGRA 4JWKA 3URKA 4DLRA 3HY3A 2PKWA 4ILEA 3IBFA 4OP1A 2WV9A 4LDQA 1X70A 3E7DA 4Y9UA 1IXKA 3OT1B 1JMKC 3A32A 1PS9A 5DCYA 4D0RA 3MMZA 2VEOA 5EOVA 1E2LA 3IB3A 3VYUB 5E9AA 4GX5A 4OXIA 3VH2A 2HJGA 4AZ3B 3PA8A 5LQNA 1UP7A 4J6EA 2W6OA 1WPRA 1EBUA 1PW5A 3QNMA 5HW0A 3IUMA 3Q10A 2B4QA 4M38A 2ZUBA 2H2IA 2PMDA 3EHDA 4JLPA 2ZIXB 4PHCA 1NYQA 4B1FA 2FW0A 4JEMA 2QA5A 5CJPA 2HCTA 2DBYA 3NW9A 4QQNA 4UHFA 1P5FA 1B0PA 4BQQA 1ZU4A 4NENB 3EG9B 3HWSA 4XCXA 5G0SA 4XWWA 5EUCA 1CR4A 1RBYA 2BFFA 1Z4LA 2XCIA 1AKUA 4UUOA 5LBIA 3STTA 3UUGA 3NNSA 4URFA 1HM5A 3ZHTA 5JO0A 4MICA 2Z8YA 3T7EA 1J0AA 2VT2A 1TCAA 2NN3C 1Y8QA 5IG2A 1QVWA 4KQ2A 1V6AA 2BMAA 4CXMA 2JLBA 1HNZB 3IBSA 3CE9A 3N3AC 3PG5A 4ARIA 1HTTA 5AI5A 2G1AA 4AN0A 1FP7A 4WVLA 3FMVA 5JAOA 1L4MA 3W2IA 1F4LA 2BSQA 1FRVA 1G16A 2P4UA 1DGQA 5KQRA 4KXVA 3NHRA 3SBDA 3VPAA 3ZXIA 4MV4A 3AWDA 3WRXA 3ZNOA 4B87A 5FAKA 3OC6A 3M6IA 4LVOA 3WYBA 3HCFA 4DCVA 3SVLA 3HU5A 4XKJA 2PJUA 5A5GA 5JUWA 3GRPA 4X1IA 5BW8A 4US1R 3P7MA 1Y42X 4OMCA 3PRKE 4KCGA 1JKIA 1RAHA 3EG5A 4JJZA 2YWHA 4R5HA 3SR3A 1Y1QA 5IZCA 3HI4A 1NW4A 1Y3FE 3H1BA 4GEGA 4MVJM 5CBPA 1QHYA 1WMAA 5JH7B 1ESZA 2R00C 4F8YA 3AHFA 1XRPA 4E5PA 3H65A 1DQRA 1BS9A 1H1TA 1Z83A 3AG6A 3GJ3A 3OM9A 3UK7A 1ZWKA 4E33A 3WBFA 2B3DA 1B0AA 1NVAA 2HCBA 5DHUA 2X0DA 4C6TB 3H97A 2QTFA 1M1NB 2D5IA 4QBTA 1YIOA 3RPEA 1EJ2A 3OZFA 4FMCF 2YFQA 1EBFA 4I1OA 1V6CA 2DMRA 4IIXA 4M9QA 1LZKA 1KOGA 1KBOA 1LDNA 4IBOA 4PSKA 1HQDA 1O2DA 2QJFA 2NXNA 5EJEA 2IYWA 1CR0A 5AYVA 2BUBA 3KFLA 3V5NA 3ACCA 1II0A 1TT5A 4YUWA 2WWHA 4EG1A 2DB3A 4Y0VA 2HADA 3ZIDA 3M8KA 1UM8A 5HDBB 5K3BA 2OA0A 3VRHA 2FPGA 5BN1A 4PCVA 4JLKA 4JBLA 2F1IA 1M2VB 3LDHA 5FA6A 1XXHA 1G8GA 5L3QB 1KU6A 3V8QA 3ZGOA 2PX8A 2ZXUA 4JGBA 4QODA 1KS9A 5BOSA 4N49A 3HB0A 3LZ6A 3QLVA 2PWBA 1OYVA 4XZ3A 2NLOA 5LXTF 4ZTZB 5GADl 2YASA 3YASA 1PZFA 2IDJA 2VAXA 3JU3A 3FW1A 3IT3A 4ZO9A 4D26A 3ROTA 3DWFA 3T6KA 4EEXA 3A6PC 3JQAA 1QORA 3A11A 4JYMA 3D4IA 1EG7A 2XMQA 4G4IA 3WRXC 1PT9A 2Q2WA 2JBAB 4BIIA 1I4WA 3ML1A 3C15C 2BSAA 3EGOA 1E8NA 4DIFA 3VI4B 4NJOA 4HDCA 3ZZMA 2AXEA 2ZG6A 3QKSA 2Z6VA 1V11B 3ZJVA 1QHHB 3NATA 3PT5A 2HSJA 3ANYB 4HNQA 2HGZA 4L28A 1YOBA 4GOXA 4TL6A 4F5ZA 2WF5A 5AHWA 1NDQA 1D5WA 1GZ5A 1W0KD 1A9YA 2XGSA 5D5PA 1OAKA 3MUOA 2ID9A 2ZVDA 3H5RA 4H0FA 4DSAA 1I7QB 2IUTA 4WCFC 1X1QA 4YAWA 1VIAA 3BOSA 3FMPB 1IVYA 1ADBA 1HPLA 1N3BA 3EGXB 1Y4AE 1JP7A 3HFGA 4NEQA 5GJWC 5C8YA 1Q0SA 4ZI7A 4CT0A 4R98A 5AVXA 1PR4A 2D4HA 2QZ4A 1TLLA 1BFKA 1SUBA 3ED5A 4A2CA 5JNVA 1MRSA 4E21A 5K3DA 5L3QA 3KR2A 4L5CA 8ADHA 2Q8NA 3PENA 4DUGA 5FP0A 1L7OA 1ZAYA 1WNTA 1E7QA 4FYXA 4D43A 4IHAA 2GX6A 5EVCA 2IYSA 2HSDA 5DH9A 1U7HA 2Q27A 1BDHA 1LC0A 2VF8A 4K6OA 4AAYA 1W2WB 4JMPA 3QE0A 4Q12A 2I99A 3T9CA 5AVYA 4EECA 4G1MB 1OPXA 1OT5A 2YYYA 3GJQA 4LOJA 4RKYA 2ZBQA 1Y4SA 4KO8A 1UAAA 1H2WA 1QIEA 2YBDA 5I47A 2CWDA 5K0JA 2CVZA 4KBYA 5CCBA 4CYMA 3M1AA 1GG2A 4FC7A 4HGNA 5A06A 3EEBA 2QTMA 4W9NA 4ZOLF 5LIRA 1KJWA 2EHDA 3OIDA 4QPZA 2C8LA 4GOLD 3BRSA 5REQB 3EYAA 1R5BA 3I6IA 3TAUA 2DLDA 3RUHA 3DBHA 4M8LA 3TYXA 2WU4A 1HQYE 3CZ4A 2JH8A 3OT5A 3KQPA 4I0WB 2ADOA 5B7PA 3U4IA 3KG2A 4ARZB 2WYUA 1KI1A 3WK6A 1WCV1 5GOZA 4HSEA 3KBOA 1C30B 3NTVA 3DO6A 3ORRA 3UJAA 1JW9B 1M33A 1ODTC 1Q11A 1VBMA 2J0SA 4JS0A 5C4IA 4H1WA 4R7GA 4CIBA 4S05A 5E2IA 2A3NA 1KEPA 3SKYA 4HUJA 2XVAA 2FZEA 1H5UA 1ZVKA 3DVAA 2ASVA 2ZB2A 5DTEA 1QSGA 2CLIB 3TD6A 4AK9A 1KFJB 4JGIA 4ASUA 1X39A 4UOEA 3MILA 5JY6A 2Q62A 2RKOA 5AVRA 1E0SA 5F2NA 1A88A 4D80A 1T4BA 2Y1XA 1CNFA 1JPUA 3M3HA 2EARA 3AIIA 4BVAA 5IDVA 1C0EA 2EIXA 4CLEA 4YDHB 1OLOA 1YUMA 5HZKA 5B1YA 2QX4A 1YFZA 4J0QA 3V4SA 3K15A 3D6TB 3MWYW 3B12A 3IHLA 4MYCA 1J7JA 1X7WA 3O1LA 4TWAA 1GUFA 2Q5CA 4P83A 2JLCA 3AVOA 4D0GA 5LOVA 4ZU1X 2B99A 5IDXA 3QFHA 1IG3A 3GJTA 2YHSA 3ZHYA 1OTHA 1G8HA 5E6RB 3VDXA 4F45A 4JVNA 2I67A 1JHVA 4Q1EA 4ND1A 1LSUA 4WNCA 1R4AA 1L7EA 4BFZA 3OETA 4DFDA 3ER6A 3II6X 5KOYA 1Q92A 1U9CA 821PA 1G5TA 4ZCRA 2YFKA 3IT1A 4Z3DA 1SD5A 2WUFA 5CA0B 5HJEA 3KB1A 5AW6A 4HDRA 2LZ0A 4Q4JA 4BV3A 2X0RA 3NRCA 1GSHA 4FSXA 4H3VA 1R4NB 4YMWA 3GNQA 4I55A 5AXBA 5T4EA 4U2KA 1FMTA 1JQ5A 4QPPA 4HN9A 1KS2A 4HDAA 1BA3A 1NLZA 3KJZA 2WD8A 5JXHA 2YUTA 2XBUA 3RBAA 1UK7A 2PX5A 4JC8A 1RLMA 4KQGA 4KR2A 1JSRA 4FD3A 4XPZA 1I14A 3GAMA 3IMFA 2Q4OA 3EWNA 4HO1X 2LCQA 4CIAA 2B7LA 5HXAA 1JQEA 1HWYA 3RFFA 2D59A 1G2QA 4E1AA 1K2WA 2ACWA 4JI1B 4KO1S 4P31A 2J3EA 5BQ5A 1MVNA 3V2UA 4YFYA 1U4SA 2C4MA 3IO3A 5ALYA 1ZDMA 2RBKA 3KU4A 1AQUA 5E3IA 3RUPA 2A5GA 1IL0A 2F1RA 4FU0A 1V8DA 2V9ZA 3EUEA 5LA6B 1LFDB 3FOBA 3WWZA 2F59A 3TLXA 4B79A 2E48A 1YVUA 3IB6A 4FHFA 5HIAA 1UC5B 4TYNA 3INYA 1QP0A 2RGRA 5CM9C 1ZRSA 4XYLA 1BS1A 3TOSA 1WNFA 3K5PA 4G5XA 1P0CA 1KY3A 4BY9E 3MOSA 4MIKA 1I6LA 3U26A 4UU8A 2CK3A 2DWUA 1LBEA 1JHXA 2BKXA 2WSMA 1CQIA 3DGEC 3ESAA 4UXIA 3G0HA 3MLEA 1R0LA 4MB6A 4FDLA 4F8JA 5CU7A 3KDAA 2DTEA 1LBTA 4MWCA 3BWBA 3D9QX 4Q6WA 3VJKA 1YR9A 2FN4A 3IP6A 4HZUB 3NOXA 4I55B 3KJFA 2B5WA 3QKTA 4PG6A 3BDVA 1FPMA 2JLQA 1KAMA 2QOEA 2XB6A 4KFTA 1QTIA 3RFVA 2WUDA 1VJCA 4JQCA 3K09C 3RTGA 5B3JA 4B4DA 4FBMA 2FP3A 1B8UA 2BKVA 1F14A 1ZOSA 2VTDA 3FCCA 5TC4A 4B3FX 4IDQA 5LQRA 1SCJA 4RMHA 4ZMBA 1CQWA 4BO4A 5KTRA 1QYCA 3G02A 2OLEA 4R69A 1K66A 1H93A 2C54A 3EXAA 3HCNA 3B38A 2OHHA 2WKWA 3DV0A 3OJXA 1CUSA 4I5FA 4XLTA 4N3AA 3K2IA 3TQHA 1FRNA 1MX5A 1RADA 3U4AA 1CZHA 3F7MA 1AA9A 1CY4A 4KFUA 4XDGA 2QTBA 4PYIA 2P2ZA 3N58A 1ONBA 2W2PA 4YAJA 4ZVVA 3SF8A 4KHPB 1OFUA 1YE5A 3E3NA 2WU0A 3A6EA 3HGTA 2XD4A 3JZIA 4KITB 2JGFA 3N8KA 3TW0A 4RYLA 4DC9A 1N0UA 1PJ8A 1WD5A 4FYHA 2FHPA 4WZZA 4WBNF 3LDGA 3O4GA 2BFNA 2KYRA 5KVCA 3J81k 2CLKB 1IUKA 4DS3A 4F2PA 4PSDA 5B6JA 1QYXA 1ECJA 1PDWA 2CVOA 4NCIA 3DFMA 3IPYA 4TKZA 2C5HA 3LF1A 4UVDA 2AJLI 2OGZA 2GPYA 3IDSA 3RJTA 2BF4A 4EJ0A 3MNFA 4G0QA 2QVCA 2GETA 3ASUA 3DEIA 4FGZA 4L85A 4U39A 5B3AA 1RYBA 1E32A 3COSA 5IBRA 3T5MA 1U7ZA 3WQRA 3I04M 2Q29A 4JOCA 1Z5NA 3HVIA 4V0SA 1LUAA 3QE2A 4TT8A 2E4UA 4U7WA 5EIWA 4KR7A 3O4FA 5HMLA 3ZHXA 4A8JA 1WUIS 3HYRA 3FYUC 5CTAA 4RA6A 5I7HA 4U7FA 3KVRA 1G2PA 4N39A 1Z63A 1M8GA 4XB1A 4C08A 4QOGA 4PLYA 3X1YA 4E2FA 3TXYA 3VUFA 1SOVA 4RMIA 5E9WA 4I55F 5BV8A 3NHLA 3FWZA 2A5YB 4UFNA 2IHUA 3EDOA 4Y18A 2W71A 3DLPX 1Q77A 2VT7A 2HC9A 2GB4A 2EIHA 2WKQA 4J7XA 4IIBA 1WDMA 2C1EA 4XB6B 5AUPB 1EH5A 3AVPA 3DV0B 2RSLA 3K92A 5EWJA 4FGSA 2AZMA 1P3JA 2D8AA 1KI7A 3Q12A 5DJ5A 3I73A 3TTYA 3LT1A 3ZGZA 2VTKA 2FW9A 2PR2A 2H59A 5AXAA 1IEVA 1HEIA 2BGLA 1FFXA 2C59A 3GJ0A 4ID3A 4JMLA 4QUEA 4E11A 3I5XA 1RACA 5JZSA 2V7GA 5B37A 2IEYA 4AX4A 1E0JA 5AVJA 5DO9A 1OX4B 1C4OA 2ZYWX 3QELB 4C2AA 1FDOA 2ZYHA 2OFXA 5H1YA 4EAQA 5EN4A 2CJXA 1O97D 3MUNA 2NVUA 4M1ZA 5PGMA 4Z3OA 1WBJB 1ECLA 4MKFA 3IAM1 2IJGX 2JD0A 5JQGA 2O2ZA 3RJMA 1U0TA 1D3AA 4RTMA 4LOHA 4KACA 2DJ5A 3PU6A 2JLWA 3OCYA 4I2NA 2PTHA 2BCEA 4M1SA 4MLPA 1YFJA 3HV0A 4OQEA 1GP2A 3HA5A 2YFHA 3C8HA 4UKDA 4OP2A 1T0JB 4BLQA 4EUFA 4M9RA 4TWBA 2HUNA 4OG2A 1W76A 4XX0A 2GEFA 2PAAA 2I6UA 1UZAA 3AVXA 4X63A 1CW2B 1FYVA 1YZQA 3IEXA 4K46A 2CXRA 3WDKA 2NXJA 1H6BA 1E5QA 1H6DA 1N4AA 4YO7A 1TM7E 5I9SA 3K6RA 1TJ5A 2FX2A 4LYFA 4XJSA 4YQZA 2C57A 4EPVA 4R31A 5JS7A 1EDEA 4E51A 3V1TC 1QQAA 4RPHA 2W48A 1DAIA 2IYAA 1NV8A 4OJTA 5TQ0B 5IKEA 1K9VF 1EPUA 5A4JA 3OLVA 4RZUA 4EVQA 2JJ2D 4K6KA 4JVSB 1LKZA 3JQ8A 3KUCA 4BNGA 4WXPA 2PUCA 1B14A 1KO4A 3AUTA 1LDGA 3KZOA 3QYFA 2A1TR 3F98A 1NNEA 3HJAA 4DXDA 1YULA 5T8KA 1DWOA 4RXTA 1V1RB 2R6DA 3B5EA 4AQDA 1K5DA 1ZP6A 3RSLA 3AFIA 1VMKA 1E18A 1O6ZA 2A84A 2CXHA 1EVEA 3V3KA 1CY2A 5DK6A 2BTOA 2A0KA 1J07A 1LC3A 3S44A 1C7FA 4IS2A 3D1JA 3K9BA 3LUKA 4JYBA 5EWMB 1VPEA 1QRSA 1SBNE 4FDMA 4YMLA 5ADUS 3GT3A 4JKYA 3KPJA 3RYTC 3GG9A 2X8BA 5HQJA 1VKNA 3GLQA 4FFNA 2HWUA 2ON6A 3ENWA 2Q5HA 1ZI9A 2CB0A 3K0KA 5HILA 3TAXA 1U9JA 2Y1FA 4IDPA 4KN8A 1L4LA 2C9CA 2XOKA 1HEYA 1U3WA 4C29A 4AJ4A 1E2MA 3M6UA 3CWQA 1DAPA 4PLTA 4WNAA 4MWOA 4ZAFA 2OENG 2ZAOA 2KS6A 2P1DA 3CXUA 4H2DA 1XZHA 5HIIA 1LNZA 3MT0A 1TF5A 3JRNA 3H86A 4ZYLA 3SBXA 2ZRIA 4BZXA 4MUYA 5ESRA 4DUZB 1G60A 1G5RA 4RL4A 4UEOA 4XFDA 4IJMA 3TDNA 2GBCA 1TZJA 4MKZA 5KAPA 3OEEA 2AFIB 1Z15A 2Y1KA 4WW0A 2GJSA 3S7TA 5BUCA 1O7JA 3Q1LA 3NYIA 1XG5A 3GC6A 2AKYA 2ONCA 3AM1A 3RYIB 1N6HA 2FZCA 3I1IA 1CJCA 2ANCA 1GKLA 3NALA 3TIXB 2WYOA 2NU8B 1GV0A 3ZY3A 1N7HA 2CJWA 2HFKA 4JLUA 1ODKA 4RCZA 1YA6A 1VCNA 4R4JA 2PVSA 4WOJA 5H83A 2VT3A 4OY3A 3FCYA 1CZRA 4J1SA 2XB2A 3DMDA 2QAGA 3GYBA 4FYVA 1SQGA 5B3LA 3CNOA 4B3GA 2F3SA 3RNOA 2EYQA 3USZA 4WNIA 3WGTA 4EVIA 1I4LD 1KZ6A 4QBIA 3BSYA 4XTRA 2HK6A 1T43A 2IEBA 3SJ7A 5KB3A 4JP3A 1VGRA 3DJFA 4IQ8A 2EXXA 5EP4A 1AKQA 3I6ZA 2BI4A 2BZSA 4J1TC 1X19A 4QOSA 1QJ4A 5IJ0B 1Z6PA 4EZBA 1OR8A 2PZGA 3GD7A 2HA2A 3OLQA 1Z13A 1Z0UA 3CLHA 2ZTVA 3HCWA 3NHSA 3PQ5A 5DCLA 4YIKA 3ZKWB 4AJEA 1IEXA 4DDMA 4DLBA 2JS7A 3JPYA 4RJTA 2FN7A 3GEPA 4UQLA 4B83A 3TIIA 2PYZA 5ICFA 1USVA 4BX0A 1EFDN 3HNPA 5AM1A 2X42A 5E9JA 3R75A 1Y1KE 1V4NA 2X5OA 3F6SA 1NOIA 4U3JA 4EA9A 4GWLA 4NBUA 1NW7A 3BXOA 3FZNA 4GOJA 4RV9A 4FFDA 3UMRA 5L9AA 1OI7A 2ZU6A 2NAFA 3E5RA 4MUAA 3GFPA 2VLBA 3Q85A 4RK1A 1KH1A 2UXCB 4JV5B 2CNWD 1RWNA 2QSJA 3EDYA 3O82A 1NMXA 3SIPA 4BBPA 3MJTA 4XQ9A 5IAJA 1I4TD 1C1YA 2WRZA 4C20A 4UCXA 3NBQA 4S3MA 1Z35A 1HYHA 1S01A 1LWOA 2A3RA 3AUYA 3ZV5A 1MHPA 5B1IA 3NXSA 2J3LA 1ENOA 1EVQA 1W73A 4QATA 4WKOA 5ELLA 1YC5A 1OV4A 3UFBA 4O4HF 1O3YA 2E6KA 4R9RA 1OI3A 3KOYA 3NJ4A 4HWOA 3FSGA 1AB5A 2PL5A 5E1OA 4IOKA 1D1PA 5BN3A 3CX8A 3DPIA 2ZK7A 4B74A 3QWFA 3IBYA 1ZY2A 2NUTA 4ZHQB 2XZLA 1F48A 1QHGA 4GKBA 3PYMA 3ZCQA 5HUHA 4B2PA 1ZESA 2F6RA 1I0LA 4A6XA 5DGHA 4EA6A 1IBRA 3F6BX 4UUPA 2W2KA 1D2GA 2R4TA 4AY3A 2BCJQ 2BEJA 4AJKA 4OX9Y 4LFBB 3G8CA 1DEKA 2F8TA 1MN6A 1D2NA 1KP3A 3BKWA 4LZOA 4ZT3A 4OLAA 1Z6GA 3B1KA 2QYTA 2X8JB 2PFKA 2WVJA 1MH9A 2D5BA 1HFEL 3KL4A 4M1YA 4ZVMA 2YS7A 5BRNA 2V65A 1P4AA 2B2XA 3AEXA 1RLJA 1CIVA 4QUDA 1KC1A 2I2CA 4EFDA 1P1HA 1TNDA 3ETCA 1FMCA 1GQ2A 4OKIA 1JTFA 5EJ9A 5CXUA 4LF7B 1IHOA 2B1JA 4RU1A 2F3QA 4LPKA 4N01A 2VYNA 2GCIA 1PQYA 1CUZA 2FSVA 5IANA 1NBHA 2JJYA 5KOHA 1KQGA 1IZZA 4FR5A 4JXXA 2WKSA 3ESCA 5EI5A 3QUBA 4AW9A 4R2LA 4FCCA 1NYLA 5KMGB 5JT1A 3SXPA 4POAA 4EYQA 4LX8A 1T3LA 2AD1A 1XDBA 1Y9ZA 2ODEA 3GZNB 3KYDB 1QZUA 5DZSA 4WK2B 4RX1A 5FNVA 3AETA 2FKNA 4TL8A 3CWZA 4EATA 3RRNA 5ELMA 1ESCA 4GL2A 5FH9A 2F4NA 3KTOA 3R3WA 4Q9AA 1UBMS 1VFNA 4Y2VA 1QP8A 1XZPA 2V7TA 3RW9A 3N8GA 3VGJA 5IYZB 2R47A 1EFAA 4PZAA 3PLRA 5B30A 4KRXA 2VYND 2R1TB 1DADA 1T2CA 2NZJA 3M5CA 3AKCA 4K3VA 2W2KB 1FQJA 1RHUA 3L7IA 3KSMA 3DMTC 3B6IA 3EVGA 1P4RA 2OMEA 5MF6A 4KVGA 3R5SA 3LDFA 1PJ2A 1R4MA 3LKBA 3OE1A 1U90A 3G5TA 2HFJA 1VZ2A 4MV0A 4N3CA 4CW7A 4N76A 2H9YA 2V55B 4MB2A 2J4FA 2X41A 3I53A 3BPSA 5ES4B 3UOGA 4WN3A 1CQZA 4RHTA 4ZI7F 5I7WA 3UAWA 1GVNB 3DHVA 1AXEA 3DMYA 2VUHB 4ITRC 2PRJA 4OI2A 1E9FA 3M0EA 4I46A 2H4YA 5JPCA 2O0JA 2XY4A 3C1OA 1MOPA 1PHRA 1V8PA 5TMBA 3WKCA 1ZJ4A 4KDFA 3CRVA 1E9RA 1F2DA 1PR6A 3V4OA 4DVGA 5LNK6 2MSWA 2XUZA 2C7GA 2UVQA 2JHAA 5H3CA 1FVOA 2W93A 3B9PA 3AVTA 5LU8A 3K5HA 2H5JA 3PC3A 2KB0A 3H7AA 4HWRA 3OIWA 5B1HA 4C2UA 4Y9TA 5CA1F 3KDSE 3Q2KA 3NOQA 4RE5A 5EUBA 4YASA 2WU3A 1C0LA 3EUFA 5FBRB 3EC1A 3ISVA 4JSTA 1GGEA 3UK2A 4G9EA 3HCRA 4IWNA 1ITZA 3UF0A 4MVCA 2D1YA 1JNXX 4KXFB 3SQLA 5AW7A 3D7LA 1M2OA 1WBDA 4IM7A 2EGHA 2Q8QA 3A14A 1AQYA 1IOZA 2GK7A 1LD3A 1WEHA 5CRIA 5LQCA 1H3EA 1FYDA 4C05A 2Z5GA 4ABYA 4F4HA 1L5HB 5BN5A 4CF7A 3TUZC 2AUMA 1N5JA 2ZWIA 3ZR4B 1P19A 1HSZA 1FFBA 1PGOA 3TQSA 1X6VA 1C4WA 1U5CA 4L3OA 3G82C 2O1SA 3AIKA 4RGVA 1MAWA 1JHDA 1NZFA 1J1IA 3KLPX 4NAVA 4WKGA 3TEFA 1Q1EA 2JBWA 1MJHA 4BQRA 2QQEA 4YQYA 3RU7A 2P9HA 2C94A 1G3MA 2WWXA 4IICA 2VP4A 1CUGA 4GYJA 2QUHA 1E5DA 4M1WA 4C6RA 3HP4A 3W4IA 2ZS7A 4DJEC 1JHZA 3NC4A 1RYMA 1HRDA 4UM9D 3AYXB 1WU7A 3UV3A 3DPUA 5FBZA 4CEIB 1AGXA 1TA4A 1MA0A 4WOPA 4ZI5A 4WY5A 5A6SB 2QPOA 5B7QA 5C53B 3KZKA 4ZAVA 1PJTA 3ZDBA 3CJTA 1D0SA 1T5BA 2UYQA 2M9MA 1OU4A 5FUBA 1YU6A 1FBTA 3TSOA 4YXFA 1ADJA 3V4PB 4HNAB 4X65B 1XP5A 4R1OA 3SNKA 4LN1A 3TI9A 2ZGVA 4LCBA 4QGGA 3I12A 1XTKA 1UR5A 4EKDA 2PUHA 2A1UB 4OQYA 3ZBTA 2RG7A 1QCDA 1PLLA 2CSUA 1ODSA 1NVVR 1XL0A 3EMBA 1RAIA 3GW8A 3TNFA 4DT1A 3AFGA 3MWGA 1ZXXA 3PDCA 4FGJA 4KXWA 2GEDA 5ALLA 4YRNA 4QWWA 3UUFA 3TOVA 3V7UA 1P7YA 3AY6A 4EHHA 1OKKA 3AINA 3KKLA 2P9FA 3GFOA 5B4VA 3VKUA 3VVBA 1T1SA 3TZBA 2YMQA 1WPXA 2WWRA 1ZS9A 3K1ZA 4D79A 5ALRA 2J5RA 3MSXA 4ZODA 1CUUA 4RH3A 2WUGA 1Y7IA 1M6EX 4WPGA 3LY9A 3T7KA 2PUFA 4ID9A 2HIHA 4K03A 2O4UX 4CIDA 5BR7A 3EVAA 4J76A 4UVIA 3TLBA 5ABPA 4TV8B 2YOFA 3TFOA 4JI8B 3MBOA 2HZ7A 2YJTD 5BV7A 4M0KA 4KYTA 4O4IA 4F2GA 4D3SA 3T5PA 4EGFA 2O3TA 1C0IA 3OEHD 3Q8XB 2FZKA 4KE8A 1OH6A 3CRZA 3NTLA 1RE0A 2FPWA 3P97A 2HJ9A 1D8AA 4AXBA 4B35A 3GARA 2XUQA 2VH1A 2IKQA 2ZSAA 4OGWA 3QE4A 4YMGA 1Z0AA 1PNTA 1YRLA 3LP6A 2OFOA 5KX5F 1RIFA 1RJFA 1NF9A 4ESEA 1ZCZA 1TFUA 3P5BA 2YZ2A 3CX4A 1YDFA 4P7GA 2OWEA 3VVCA 4Q3NA 3PKZA 4Y1RA 4ADSG 4Z6KA 2ZS8A 4RZSA 1E92A 3KLNA 5CNIA 3WLHA 4HTFB 1SULA 5DTQA 2XYGA 4DRYA 4F3NA 5JVDF 3M5WA 2EC5A 1QB7A 1GD1O 2VDWB 5JNRA 3EGWA 1VLJA 2XYVA 5D1NA 1NG1A 2PK3A 1UK9A 1UT6A 4IJ6A 2X22A 4JT8A 3WX0A 1YT5A 3P2MA 2B6HA 1EE2A 2JBHA 1Z22A 2B9VA 2HJSA 3DUWA 3PXAA 3WSVA 3G2PA 1H4SA 4LRXA 1JVNA 1P18A 2QVYX 4Q3DA 3GPDG 3RVQA 4ALIA 5J2TB 1M1YE 3KB6A 1RRPA 3SICE 2I54A 1A8PA 3IEPA 4TKVB 1BXZA 4LRWA 4WLUA 1GJRA 4MZDA 3KQNA 1G5FA 2OFFA 5LA6A 4O2AB 3C4JA 1T0BA 3RHZA 3H2YA 3FG9A 3I09A 3J81A 4MCJA 5BO5A 1ZNQO 1P7PA 1P74A 1NV9A 2PU7A 1SWVA 2VQ6A 4PO9A 3TLGB 5MHTA 3H1EA 5LA6F 3IODA 4TT3A 3LCMA 1QXSA 5IM5A 3TLYA 4UULA 1O4WA 1A76A 3I45A 3FPLA 4DE5A 1PWHA 4QYWA 4RMJA 5BSRA 5KJ1A 2IH5A 1MO6A 3IEKA 3T5DA 4QUAA 2FSFA 3CBGA 4KLZA 5A6VA 5I7VA 2YXBA 3KOOA 2C42A 2IZ1A 3GVIA 3E8XA 2FQXA 3N75A 5HJ2A 4KGZA 4K26A 2IIBA 4JLJA 1E0AA 1QHFA 5EWLB 1MOZA 3K4QA 1OLSB 1N3LA 1RP7A 2Q28A 1LI4A 3DJYA 1JQKA 3DKPA 1F4PA 3GA7A 2P2YA 2GDZA 3EFBA 4P08A 1T2NA 5ER6A 4N47A 3TTTA 3V8RA 4AX8A 4BNLA 5KOIA 1JA9A 1Y3DE 5ETJA 2OVFA 3WMEA 4QGSA 3K05A 1Z7EA 2RB4A 3O47A 2QRQA 2ODNA 5CHYA 3VR5A 3U7FB 3HZOA 4WFQA 2F2TA 1O0BA 4DV7B 2JI7A 4QFDA 3WKAA 4ACBA 1BKDR 2RAFA 4ZVOA 1CFJA 5KX5A 1R0RE 4U0JA 1RJWA 3PZRA 3B6KA 4DCPA 1YONA 2WWYA 3K8YA 4J0IA 5IT9A 1H5NA 4JUDX 3QVTA 3IR7A 2WU1A 5BT9A 4EI9A 4LE0A 2DGDA 3IA2A 2QTTA 1ISJA 2FPPB 2OFWA 4UBNA 3SIRA 1MX9A 4KPGA 4RZXA 5IW8A 2X2FA 1GOTA 1M8KA 4CIVA 4YAIA 1MG5A 2X2OA 2H6EA 4ZV9A 3U1VA 4PAGA 2E21A 1SVMA 2YY6A 3HXQA 3DUFA 1XN1A 4K86A 1XQXA 1NBOA 1QGDA 4X5OA 1M76A 3OJWA 2VSXA 4Y6OA 4BPBA 5BYKA 2JC3A 2XITA 3E3AA 3PQ3A 4RH1A 2VPQA 5L7YA 4CT5A 3JZDA 4H7KA 4KODA 2YNMA 2GUGA 4CLRA 5JQWA 2RAUA 3C14C 3GLGB 5LYJA 1TD1A 3IMGA 2XQKA 3TECE 1NXPA 3W3AD 5IT0A 1RWPA 4QU0A 4TXJA 2BGWA 1MOSA 2ZVJA 1AKTA 4A8JB 2K5UA 3ZD6A 1IN4A 4J2OA 4RA6B 3IEVA 1N9GB 3NAQA 4GM4A 4HK4A 3S5UA 2BM9A 4XPIB 4X62B 1WXWA 3UGKA 3A0RB 2KBFA 3K9GA 5F2OA 1QCYA 3L5OA 2Q0HA 4M46A 3NBKA 3VU1A 3LLSA 4C43A 2B8WA 1NVXQ 4PG7A 3X1MA 5C18A 4DYHA 3KKOA 3RRBA 2RIRA 2X9VA 3QK7A 4OHCA 5AKGA 2BR3A 4DLUA 1SCIA 3HYTA 9MHTA 3ESQA 4DDTA 2JLZA 2BE9A 1KJ8A 2JCYA 1MIHA 3L7YA 1QIMA 1ZM9A 2W0SA 3BBLA 3DVRX 3MJRA 3N86A 2P2LA 2Q9CA 1ZCAA 2B37A 3DVLA 4R7TA 3G88A 2PKEA 2BRUC 3O8QA 5KYUB 4HQ6A 2VBIA 4BUCA 4A2QA 4XYEA 2EWVA 1JWAB 2Y9MB 4O2AF 2VCHA 1FCJA 5TPZD 1U2TA 2IHVA 2NVUB 2ZBUA 3UXHA 1Z33A 3QF4A 1C2YA 5EKSA 2Z8XA 2M98A 1YVEI 3K73O 2QKYA 4RESA 2UUAB 1A5SB 2D2VA 2XKJE 1OIVA 5B6PA 1T2VA 2IZ6A 3KALA 5BW4A 5IEJA 2YV5A 5EHXA 3IAXA 3LS2A 2Q8PA 4HJXA 2OAGA 1ZH4A 3H0CA 4RSHA 1U8ZA 2WP8J 5HSGA 1YBVA 2GZ1A 1TEXA 1JHAA 1JILA 3CW9A 4HNUA 1K8RA 2J85A 4M36A 1PI3A 5CR9A 2GVDC 2GBFA 3LUBA 3Q0TA 3LUHA 1U3FA 3RVPA 2BEVB 2AEFA 3GZTB 3MCVA 3GLUA 4LGCA 4DY6A 3K2QA 2YV4A 3T3MB 1EP9A 1VA5A 2VPIA 5GGYA 3V33A 4G1VA 1WDTA 1J8QA 2UKDA 4QARA 2NT4A 4MULA 3CUSA 4JU9A 5BSVA 1ZGGA 4CN8A 4Q7KA 5EY5B 2XDAA 4WLOA 4D0SA 1DAEA 3FHTA 3EFOA 3F6RA 3QXGA 5AVVA 2P9TA 3EF3A 1U11A 2RHJA 2IYYA 3B48A 3FFBA 5E7QA 3S68A 4GS5A 3S1SA 2D0PB 5HIKA 1L5ZA 2CLMB 2Y77A 3GRVA 1N2CA 2C7VA 4PU0A 5E7IA 2D4AA 2QLJA 3CZAA 4X6XA 3FAKA 5DK4A 3FYSA 4B6FA 4Z7OB 4RV5A 1W94A 2I4OA 5A2QA 3D7SA 1I7SB 2G63A 1T3TA 2H4WA 5CFNA 1AVTA 2G0AA 3BFKA 3LQKA 3V8EA 2XAUA 1M7GA 4J16C 3FETA 3Q0EA 1HLFA 1L4UA 3SYLA 1CR1A 4JAVC 5FLEX 4CM5A 5BMVF 3KC2A 3I8OA 3R0XA 1A5BB 2F3RA 1JMYA 3JQFA 4LXIA 2IW1A 1YUNA 2VJKA 3DHWC 3IP5A 2Q4BA 4RBNA 2XMZA 1PF7E 3TL2A 5I5EA 4S1NA 2JAOA 2WD9A 4F5YA 5ICEA 4EG8A 3W6ZA 5J4VA 4NTZA 1ZK4A 1E66A 4LV6A 1OWMA 1ZVVA 3EEFA 2QX6A 4RQUA 4EITA 1OBOA 4UMVA 1REQA 5DM4A 1QH0A 1UZUA 5FOSA 2Q7DA 2A5DA 3ZYZA 4AURA 1GIAA 3BRQA 1FLAA 5TB5A 2J09A 3H9JA 3GCXA 3HDJA 1U6KA 2WJZB 4P2GA 3VYVA 2QRUA 4G0XA 4QBFA 1QX3A 4C0AC 3LPLA 5C5EA 1UFVA 2J31A 3CRQA 1RPAA 4ZOEA 1YVDA 5HK9A 4JKIA 1E77A 4ENTA 3FTPA 2NQ2C 2OYRA 3JQCA 4Q1VA 4YALA 2JIPA 3B20A 3ULKA 1RQPA 1I5RA 2PH7A 1JLKA 3D2BA 5I9BA 2ZOSA 3ABZA 3W5JA 1GZUA 2R11A 4DIOA 4RE6A 2IEGA 4LRUA 3GLSA 2B8JA 3U3OA 3WAGA 1G8KA 4BQPA 1QYDA 4R9SA 2UZIR 4P4NA 1FS4A 1JLSA 3FH0A 2IY7A 5KYYA 4P86A 2AL7A 3FA2A 1TW2A 3ABIA 2R2AA 4WINA 4BNDA 3Q41A 3BT7A 2GYYA 1Y8AA 1YS1X 4LQDA 4KWEA 1I9CA 3DEAA 4C5AA 1RYYA 4D7AA 1S2DA 3KKMA 5F7ZA 1T5SA 5DGXA 4A16A 1LBIA 2PMBA 2P67A 4ER5A 3DBOB 3LYLA 3RAJA 3AVYA 4G4JA 3V32A 3NC0C 3COYA 3DAOA 1YZYA 5I3CA 5K0FA 2QLBA 3SXUB 3OF5A 4J0FA 1YZHA 2ERXA 1JFFB 4R5MA 1DVRA 5K0SA 1N78A 2C1ZA 1HT1E 1LLFA 1PEYA 3N3BC 2OCKA 4FWIB 4KN5A 3PT9A 1FFYA 4KBFA 1KFEB 3ZEIA 3RTEA 4B8YA 3AJ8A 1D1QA 5DIFA 1XRSB 3SJCA 1OYWA 4R8MA 3EMDA 5JG7A 2ZB7A 3QU2A 1T35A 2GBLA 2LCIA 5D5HA 1TW3A 5EP3A 3O8LA 1S2IA 1DLJA 3ASVA 4HQLA 3BFPA 6ABPA 3LXRA 1B8VA 1MJNA 3QA9A 2FJUA 4I9GA 3LL4A 3WLMA 2AG6A 4HXGA 3W8DA 4I1PA 3IFSA 4PS1A 2WIBA 4YAKA 3X2EA 4ARUA 1W4BA 5COAA 1WG8A 2VDKB 1I2DA 1ONNA 1EFRD 2NAPA 2IHYA 4G36A 4NV1A 5L3RA 1SKBA 2ZKLA 4PZEA 3LHDA 3ZY6A 1QOQB 1XU9A 3VX4A 2WQZA 5CB4F 1XTBA 4EI8A 5FTMA 2JIZD 4PLWA 5KZMB 1MJGA 4FBGA 2DPLA 4H7JA 3MPOA 5GQSA 3RVOA 3OZRA 4AS2A 4MRVA 1W0KA 4D4JA 2O57A 3ZLJA 1QHSA 3L18A 4HXYA 1FYWA 1ZINA 1ACJA 1YGYA 2ZJ6A 3KX2A 1GGVA 2W00A 2ALJA 3ND7A 3Q5EA 5IEBA 1M0WA 5CT4A 3K5WA 4E4YA 2ZIGA 2IDKA 2ZXFA 5FL7D 5JD5A 2GM4A 2IS1A 1D6MA 3TUJC 1KSGA 3FHOA 3W05A 2YJ4A 2GJ4A 2FB9A 1E96A 3VKFA 2B20A 4H17A 4EPYA 1AF4A 3U16A 3E3MA 2ATVA 4TVBA 2CKDA 2ZSJA 2O06A 5E0OA 3RC9A 1QK3A 2Y1LA 2JFHA 1F8XA 3QHPA 3WGNA 3LTEA 1WZ2A 3NWEA 1U1FA 3VYRB 1VYUA 3CPHA 5KI6A 4BJ5A 4D8TA 1IQ0A 1YB7A 2GCPA 2O8FA 1SZJG 6REQA 3VV2A 4ZV4A 4YLEA 2C99A 4D25A 3FIUA 3MQFA 4GPTA 1TF2A 3VHQA 4JNKA 3A10A 4AKIA 1VJ0A 1H1LA 3EULA 3CZ5A 3EWAA 3L0IB 4IDGA 2VDVE 1GUZA 1ECGA 3QTBA 4L6IA 1UC8A 1OZGA 1QPBA 1XPRA 2FPIB 4DCSA 1N5IA 2PGIA 3GGSA 4NCKA 1WZEA 5LZ8A 2FSUA 4YXWD 3QMWA 5JANA 2FW1A 4W5WA 5BWOA 2JFPA 3BWMA 3L0CA 1U63A 4AY2A 3AF0A 4B73A 3RAGA 3EVEA 4RPKA 3DT9A 4IQGA 1KQFA 1KQOA 2Y1WA 1RJGA 3CGGA 4L51A 3PEUA 3HB7A 3LPCA 2XUDA 2ZRBA 1FFDA 4ON9A 4Q4LA 4OHUA 4PQRA 4XQGA 3RO7A 2J3DA 4CCYB 1ULUA 2XTAA 1WXFA 4QHTA 3DZDA 4YJ2B 4EGCB 3PVSA 3HNRA 3J7TA 4N3BA 4TYQA 3SKXA 3V4LA 2YXNA 1J70A 4RKEA 1MEJA 2RGYA 1UQUA 2CV0A 2X58A 2R0QC 3S7ZA 1PG0A 1IXYA 2ZPUA 1W36B 1QX4A 3IVXA 1KHHA 3IUNA 3T9DA 3JD2A 3RWOA 2UYOA 3H5LA 1G7TA 3R74A 1P0PA 4MP3A 4QDUA 3F2IA 3JYOA 5KIAA 4KHZA 1SXQA 5JYEA 4UM8B 1NGSA 3R6DA 4B6GA 2WEKA 1BIFA 2P9BA 5CM8B 1IN5A 2FR8A 2FEPA 1HL7A 4HQOA 4QREA 1KI8A 2IYLD 4BRZA 2Y67A 3W5DA 3KD2A 4W1RA 4F2DA 1RTTA 1RJ9B 1PT5A 3DQPA 1PEDA 3MZ0A 3TB6A 3VDNB 2D8MA 2BFBA 2J87A 1THZA 3AZOA 3L84A 3V6MA 4B7CA 1N0VC 4YR9A 3HCPA 1R5JA 3ANNA 3UAZA 4MR8A 1TU4A 2QORA 4IDAA 1P77A 2IPLA 3KQOA 1FUUA 1MV5A 3NYQA 4IYJA 4ZIRA 4B40A 2NXCA 3RFTA 2QD5A 1Y1SA 2FZ5A 5IJ9B 3KTAB 3QA3E 5ICGA 1EHIA 3WAKA 2BSXA 3CB2A 4Y7CA 5DHQA 4EW2A 1VE3A 4MUGA 2FDRA 5FOTA 4MDYA 4LS3A 3GFFA 4PPYA 2R85A 2PRSA 3P9IA 3WK8A 1DSSG 1ZNYA 3MJHA 4BEVA 1TRKA 4PANA 3JSXA 1ODJA 2CL6X 2JIDA 3PUKA 1UT5A 3OTQA 4NNPA 5C8DA 1AJEA 2ZPAA 1OXVA 2DHCA 2QRKA 1BOFA 1D7AA 2Q6VA 3ETNA 4GX2A 4HAYA 5ALUA 5JJCA 2ZSHA 4GL4A 1Z47A 5YASA 3WB2A 3GEGA 1J8VA 4Z99A 3UHPA 5FR1A 2BF7A 2ZR8A 3IQGX 4KDEA 4AIRA 5HJ5A 1JKFA 4XFKA 4WJKB 3SIWA 4CKBB 3BIXA 3L1IA 1EWQA 1CQJB 1SBIA 4MI1A 4TT3D 1AKEA 2HSGA 2VDJA 2OPHA 5C8XA 4FJ0A 5H9VA 2Q3FA 2JF0A 2ZCVA 3JCZA 3KV3O 3U3KA 3VAZA 3VU0A 2X0NA 4RVNA 3C87A 3PQDA 1JGTA 2HDOA 5CDUA 3BXZA 4ZWNA 1XEXB 3H11B 4IO0A 4DR3B 1HI9A 3H8WA 3IQFA 4HAXA 2O5VA 4LUCA 5E4YA 3E5MA 2OBNA 3DPSA 3ZHCA 5HBRA 3H84A 1C7JA 4AJPA 3C1AA 4BS9A 4FGKA 3WKBA 2AI3A 4DB4A 4BDSA 2FVXA 4IDNA 1MIOB 4KLCA 1PVDA 1PYDA 1OIWA 1XJQA 4UEJA 3TSWA 4BNVA 5I48A 4M7OA 1P0MA 5IDWA 4P0TA 1AQIA 1T8RA 2GJ8A 1GCOA 4LMPA 4NBKA 1ZR2A 5A5EA 4GPEA 5C1PA 5BMVB 1L1QA 3AVWA 2VDLB 3LDUA 3MSCA 1NASA 3DH0A 3VSBA 1UPTA 2ZE8A 4KKVA 1HLDA 3NVDA 1YAHA 3TTVA 3LBYA 1QKKA 1N4DA 1R37A 3LW7A 1TQ4A 4CTOA 4M8SA 3MBKA 1YOVA 2FMFA 1UDBA 4C78A 5IVHA 4L2IB 4WXMA 1SCKA 3CRRA 3W8RA 4M0PA 1V8ZA 1OIXA 3TUIC 2UYHA 1Q84A 3AO0B 1WMFA 5F23A 4LISA 3C6ZA 5TGDA 5MN5A 4KKXB 3T3DA 4F5WA 3PFKA 1NP6A 2VJOA 4TMTA 4JN6B 3OM8A 3IKJA 2DG2A 3JAKB 3L9XA 4BZQA 1B6SA 1QVVA 1TDJA 4DQUA 3LO8A 2B61A 2GILA 2I9PA 1NXQA 2BTQA 3O8DA 4GW3A 1LI5A 1EI9A 4EBFA 3ZJYA 1SKQA 2GZAA 3FVTA 4XJXA 3STXA 1FUKA 5GIOE 1Y5MA 2R4UA 2ZJ1A 4OFZA 2TS1A 4ATNA 3OU7A 5C31A 3EXFA 1RHKA 1TMKA 3JQGB 1N1EA 1P45A 2QD4A 3FYUB 4XWKA 1Q44A 1T1IA 5EMNA 1MIOA 1BEEA 4FDTA 3VSEA 1HA3A 5IN5A 3GZ4A 4M1KA 5D6OA 4B4VA 3M9XA 3U81A 5JCXA 1VCOA 1FL9A 2A33A 3MJFA 2PGLA 5BSHA 3OIUA 4TV8A 1AQNA 1E2QA 1DIAA 3PNQA 1RS0A 4A0SA 1IVSA 2EX1A 5AXCA 1PD0A 2A6PA 4GNRA 4AY5A 4W5JA 1FP4B 1KC3A 3THSA 2QLLA 3OHPA 3FPGA 5ALQA 1ISIA 3WLPA 3DXZA 3PK0A 1U1IA 2GBPA 3NKFA 2PJRA 5J5AA 4Q01A 4UEWA 3LT2A 1KSFX 8OHMA 1T5LA 5FFNA 2D54A 1Z56C 3GMSA 3PI7A 1FNBA 3Q6NA 3AF2A 3G3EA 4UM7A 4P4SB 5I9MA 1UPBA 1LBQA 1VRWA 2FK7A 1FEZA 1JXMA 3WQHA 4D6PA 4F38A 4YRZA 3L1UA 3RAEC 2C00A 1CG6A 2IE8A 4JK3A 5GONA 4WCFB 4ZRMA 2X3YA 1Q2UA 1T5DX 4GOND 4HDQB 1TJ3A 4KK4A 1LF0A 1G5QA 2QZPA 4FMCB 3AEZA 3DAFA 1QB8A 5BNTA 2CL7X 3BB4A 4LVUA 3IMKA 4I1IA 3LOQA 4N7RA 3C8UA 5EHNA 2EF0A 3RS8A 1QO7A 3MMXA 1XR3A 3EXFB 2Q9UA 1M2HA 1JHYA 1BN6A 4TLAA 5CMLA 4JJKA 1ST2A 1VBNA 1Q3HA 2CFRA 3RFCA 4CQJA 2OR3A 5IVIA 3FWPA 2NW6A 3AJAA 1IBMB 1DRWA 4AECA 3WBKA 1BXGB 2MYUA 1S1CA 3F47A 1PL8A 2VZ9A 4UU7A 3JZFA 2ZRJA 3BD8A 1A72A 4ME6A 4A8JC 2YWBA 3Q9LA 4LBWA 4O02B 4QXRA 1CUHA 7AT1A 3JAWA 4L5JA 4E15A 5FOQA 4M8IA 4BMYA 3ZV6A 1FP4A 3R6LA 5CFPA 1XRLA 1TPYA 3H9GA 5KYVA 1TKCA 1L7NA 2J4CA 2LKCA 2XRYA 3TCNA 3U13A 3H5OA 4ZRNA 1NBME 3TM5A 1NVUQ 1V7PC 1TTTA 5AIBA 2QN1A 2WE7A 1L6RA 4M87A 5JCJD 5K6RA 3GI1A 2YMLA 1I3MA 1M2EA 2VIIA 2WJYA 4I19A 3EIQA 2RHRA 2CF6A 3DZHA 4I4TF 4NZOA 3VMMA 4EA8A 5FPPA 1G38A 2FAXA 3HE3A 3DAHA 2HA6A 4GZ5A 4PZYA 4W5TA 3P5SA 3LLCA 2OBMA 4POOA 3H18A 4IH9A 1XELA 3DA8A 3A04A 1PVVA 2PWPA 2XEXA 2G76A 1IPHA 1FQOA 2PD3A 1YI8A 3LUJA 3KJQA 4QNRA 4D9BA 4JBYA 1UBRS 3BJEA 3LUFA 4LJLA 2ET6A 1TF7A 1WXXA 4IDDA 3TZEA 1Q3KA 1T5IA 4DZRA 1YAJA 4M0CA 1T3SA 3NKVA 1EXMA 2BY4A 4L5IA 4WTOA 5JNWA 1TCBA 2JFZA 3NR2A 2JAPA 4YMHA 2I66A 3SQMA 4RK7A 4BX8A 2O1EA 4C0XA 4D45A 3EPHA 1BNCA 1TVKB 2QYSA 3WIDA 3MXOA 4GLBA 1QNFA 2E4VA 4G9BA 4DWVA 4C2TA 1YQWA 3DCJA 3ZWXA 2Z57A 4C7BA 1O77A 4LOKA 5AJTA 1KQPA 1N7JA 2FFAA 5FTWA 4EGQA 1UMBA 4PX3A 1C7QA 1ZOLA 1HV8A 2XQJA 2EP7A 3KYJB 5B2ZA 4AP6A 3A6JA 4CODB 2A9KA 3HJUA 4RF5A 4TTAA 4E5KA 4LRTB 3I3OA 3ZGVA 4K9LA 4NU8X 5D51S 1QLJA 1VPVA 1T13A 1WIWA 2FUCA 5EJIA 3RS2A 2FZWA 4U02A 1GQRA 3E8SA 4IXNA 2FR0A 4AYWA 2FLKA 3G5LA 4ZK2A 4MRAA 2DBVO 4AN1A 1YB2A 4FNMA 3I5YA 3ENVA 3PPVA 4ITVA 3UEOA 2OD9A 2F43A 1NJ2A 1Z2PX 4UQPA 4MWEA 4AG5A 4DCNA 5LKRA 1ZVMA 1AKMA 4WUVA 1XE3A 5DBGA 4RULA 1DRKA 2V7UA 1ZMXA 2IPMA 2EW1A 1WXDA 5DRTA 4C4OA 3TJZA 5D3ZA 1XTVA 1RQ2A 3VKVA 4NP6A 3T4PA 1MCZA 3GP3A 4B9EA 4HRAA 4G97A 1N9GA 4AULA 3RLFA 3ZDEA 2ODPA 5K3EA 5CLFA 3AKYA 3V97A 4CKWA 5A4FS 3ZTWA 1EK0A 1QS0B 3KLBA 3UWDA 2BTEA 1C7ZA 2VJAA 2AR9A 2F1JA 2YWJA 3NC1C 4QLBA 5H8WA 2FETA 1DBWA 1T4CA 4ZVRA 2FCRA 3K1JA 1XZQA 2VH2A 3TCKA 4TMWA 1B15A 1EINA 2DLCX 2BEKA 1W8IA 2QMQA 3GLRA 1RWKA 3SWWA 1E64A 1RXIA 2QQ0A 3IOYA 3ZGYA 3OZIA 2BHRA 2XVXA 3W9YA 1AMOA 3T3NA 4MS4A 2PZAA 2WUEA 4WESA 3GQBB 2Z1MA 3UJ7A 2GWRA 2HJWA 4US2R 3GELA 3FOWA 2AE1A 4GKVA 2DP4E 1G8YA 2GI4A 4FS3A 4P6VF 2PA3A 3ZHZA 4ZYXA 2CDCA 2R8BA 3S27A 5FPKA 1UKYA 4DL9A 3NTUA 1LX7A 5EXDA 4LY6A 5SYNA 5FEUA 2GD1O 3S3TA 2F43B 4H7PA 3JAMA 5JE8A 3EBOA 1W1WA 2HQ1A 4TWJA 5KYXA 1YR3A 5I3ZA 2BH2A 2FR8C 2O1XA 3D8UA 3HLKA 4RVFA 5DULA 3STUA 5DHFA 3I37X 1H4VB 1TU3A 3ETHA 4MMXB 1XCLA 2DFTA 4D4HA 3HKEB 4Q7MB 2I2XB 4YV1A 4UTVA 5AHRA 4Y3UA 2IP4A 4CKWB 3L8DA 1RKXA 1QS0A 4F1WA 2D06A 5G1PA 4DC1A 4MDEA 1SVLA 2LNDA 3HJCA 4LHWA 4ZCSA 3TW8A 1UBJS 1IN7A 2Q5IA 1MTZA 3QWAA 3FWNA 4IWXA 4KLAA 3QKUA 3WL6A 1T4CB 4AKTA 5I4KA 5IABA 1SUPA 2FXVA 3R0JA 3O8NA 3DNFA 4MKHA 1R0YA 4Y6RA 2G88A 1XMVA 1ZG3A 3A27A 5C7OO 1IULA 3EFOB 3S8YA 5JXIA 3RC8A 3WIUA 4ARAA 2FMHA 1NUSA 4G8JA 1S8OA 3NUZA 3TTWA 3K0AB 2KJQA 3AILA 4LKOA 3DMRA 4TMFA 3CUKA 5DN6D 1PGPA 4DA0A 2BV3A 3EZ7A 4L9WA 5TGTA 2TMGA 4XM2A 4C4TA 1SUEA 3BWXA 3R0IA 1KO1A 1Z16A 5ECYA 2VSFA 1HSOA 4FGLA 5L6MB 1Y1RA 3NB0A 4L8LA 1N2BA 2O8BA 3SR4A 5LFAA 3P0HA 3ZU5A 5LXTA 2J0QA 1J21A 1SXJE 2I6SA 3NFRA 1WV0A 4W5QA 2NPIA 4L72A 2IPAB 3VZQA 1Z18A 1M6YA 2P9ZA 1B2RA 1YRYE 1Q5PA 2Y1EA 2Q3JA 1UJ2A 4GOMD 5HMMA 4EH1A 2XD9A 1C7RA 1R16A 2VF7A 4Y6GB 3Q87B 1SQ5A 4ZCMA 2H00A 2YHIB 4Q3AA 3RAFC 2CUZA 4EO9A 4LRQA 1NNUA 1I6WA 4FTWA 3FJOA 3DVQX 1UZNA 3LYHA 2J6IA 3I4FA 4M6WB 3WWYA 5FA8A 2J46A 1U7WA 4OXYA 1PLJA 1Z75A 5LLDA 1A7JA 2C8KA 1FFEA 1RXWA 2P9CA 2J67A 4HWSA 3CW8X 3VYWA 1ST3A 5B2EA 3ZUPA 1O57A 2TSYB 1Q0QA 2H29A 4TZ0A 1C14A 1NQVA 1RXSA 5EJ8A 4BNWA 5TPZA 2BHTA 1IPFA 4DCOA 5K0TA 3C3PA 3BGSA 2R87A 1S02A 3GJ6A 2FI1A 3HKCA 2EFHB 2R1UA 3DDHA 2QUBA 2PBFA 2DHEA 5AVUA 4NJEA 3DMHA 1BXKA 2QXYA 1R0ZA 2W37A 2QTHA 3MYRA 2GBGA 4NZZA 2O8BB 1L7DA 1Y7LA 3EEOA 5TJ9A 1SCNE 2GYUA 2AOWA 4YP1A 2H1FA 4RFVA 5LBTA 4ER3A 4QDTA 1STOA 3UBTA 1VHTA 4HF7A 4RF4A 3FZEA 3CH7A 2H4XA 4BNJA 4IFIA 3Q8MA 2VATA 4Z0PA 2PYDA 3A1SA 1PX2A 1CCWA 2GPAA 2P7HA 1TPZA 3MWEB 1ZK2A 1EDZA 2F67A 3E7PA 3O4RA 1ILEA 4YMTA 5CVTA 2C3OA 3QE9Y 2QN9A 3G9TA 3LK7A 3U3XA 2AKEA 2Z5VA 1UAYA 3IAFA 2OGWA 1GTVA 2H5IA 1UIMA 1V1MA 4LCJA 3BN3A 4ZZ2A 3QENA 5F5LA 1QWOA 4AM8A 4KREA 4I8DA 5FPHA 3JVVA 1P8JA 1OROA 2YIMA 4N7MA 2DR0A 4XD7D 3TPZA 2IPOA 4EEKA 1G291 3O03A 4RTQA 4QBGB 4B48A 2OV6A 3ZE8A 4FDUA 1JEDA 3QEOA 3PDIB 2N3ZA 4C07A 4JP8A 1GN9A 1SKYE 5BT8A 2HHLA 1U1CA 2FQ1A 2JLUA 2JD2A 1ZPDA 3REGA 2WIDA 3KSUA 2VUIB 1GAJA 4L1KA 1YTLA 2WZBA 4ZQIA 3HKCB 3OFVA 5IPFA 3AR8A 3G85A 1NY6A 4ZOBA 1C1DB 1GQQA 3AEYA 3UB3A 1KZ4A 3JYHA 4CPDA 2OBXA 2EGUA 3U3ZA 1WVGA 1YS4A 4INPA 3L1KA 5EQFA 3DTNA 5AI4A 1H6AA 2VUSA 3O8OB 3BCHA 1U1GA 3VZCA 2FQYA 2QV0A 3WRWA 4QFMA 2IP1A 4MQEB 1D03A 1SHZA 2Q1SA 3FYHA 4IGFA 1FB5A 4LI0A 3ZI7A 5CFZA 3MOGA 3QPUA 2EJWA 2H51A 2EGGA 3KYBA 4BNNA 3L1VA 5F21A 3CFYA 4YJ3F 3DMNA 4B09A 2OYSA 4DQLA 5JXWA 1XA3A 3ASYA 4GSLA 3NCHA 1LI7A 2YZ7A 3V1KA 3MWEA 2PZ8A 4Y0NA 2JLVA 4EW1A 3RDPA 4ND4A 1GNQA 3CRNA 3G0CA 3PFFA 2PUDA 3T9BA 4G8BA 3NEPX 4KXYA 3VKHA 1PZMA 1HYGA 4IUDS 4TQUS 4AXXA 2DUJA 4L5YA 3L93A 1PFGA 4LWZA 3I34X 2OO5A 1N5DA 2VYFA 4CMGA 2HMUA 1KY4A 1U9IA 3NOVA 4HGRA 1J5PA 3AUKA 2QB5A 4K6CA 3SLGA 5CLLA 3QITA 1FDSA 5AQEA 1U81A 2FMUA 2IZ0A 1ZONA 4QYXA 3SKVA 1M9NA 5DLQC 2HRDA 2O8FB 1GCAA 1YBAA 2X4GA 3FGOA 2JCGA 3EGEA 1M7HA 4QG7A 2PRKA 1W4AA 4BMOB 5BNZA 3LUAA 4LECA 1AS0A 3QYAA 4DCCA 4TL9A 3BYZA 1TL7C 3M70A 1N0IA 2YN2A 4P4TA 4PSCA 5FADA 1X7XA 4EG5A 1SBZA 4KPEC 4B6PA 4KR6A 1YIAA 2L19A 2RKBA 4R1QA 4JJ8A 4B43A 3BGIA 4HWTA 4YDQA 2E4YA 3MELA 1LA2A 3NH6A 4UJ5A 1SVIA 4AG6A 2YJ3A 3M4ZA 4Y30A 2PLFA 2BC9A 4MNTA 3KZXA 4YY3B 5AKYA 2WHPB 2PL9A 3JWEA 3LCCA 4BFXA 3A70A 4NXNB 2Y05A 2HRCA 2PLWA 1KIFA 1ESDA 2VAMA 5WRFA 4N5NA 3QOXA 1KJQA 4NE2A 5AVOA 3RK1A 5KVSA 3ZTYA 1XZNA 1JZQA 4TRRA 3N8IA 3RCBA 2I80A 2YC4C 1YD7A 3IALA 3L0ZA 4I99A 4AMZA 2QUIA 4WFKA 4X54A 4Z9FA 4Y9SA 3W2FA 1ZITA 1JVBA 1OXBB 3NI2A 1OAOA 3UJ8A 3D8SA 4YAUA 1ACMA 5LLSA 1CDEA 2Z6QA 4I7EA 3P0EA 3LUGA 1T8PA 4ONEA 4F97A 4CI9A 4OH1A 4QU9A 1MENA 1P60A 2NUTB 3JR7A 2B78A 3EH2A 2QRVA 3IP3A 3QU4A 4TKUA 1RC8A 3E7WA 2DBZA 4A2WA 3CT4A 4LYHA 3GJYA 1BCRA 1XNGA 1YRAA 4HVTA 3ZQKA 1O6CA 4X60A 5I7AA 3OIFA 5NULA 1R15A 3JWJA 4YJKA 4M49A 4FCWA 2V74B 1A9TA 1EEHA 1Z5PA 1NFRA 2J9YB 1UJMA 2W9XA 3CO5A 3IP1A 3L8HA 4LDJA 3BD9A 4TTPA 4GWKA 1EJBA 5JMPA 3PPXA 4Z4EA 3GJZA 2I2AA 1NRXA 4I9FA 4O2BA 5KAMA 2O2IA 3AG5A 3V34A 3ONVA 3ILSA 1VPLA 3F5QA 2V96A 4OUDA 4QT0A 2IXEA 4AJ9A 4GBGA 4BXOB 4CQMD 1W96A 1BDBA 5J23A 3A7DA 5JTUA 4N5DA 4HH0A 5KUTA 1PUIA 1Z06A 1ATZA 1P7WA 1SURA 5CYFA 1JR3A 2IYUA 5CNMA 5KSYA 2AOTB 3QH4A 1I3OA 2CLSA 3R0QA 3LW8A 3EDMA 1AX9A 1R1DA 3B52X 4X3PA 2AFVA 2E4XA 3W6OA 2E5WA 4A0QA 3DDWA 3COPA 3RYFA 3LP5A 3VOAA 3LV8A 4ZVLA 4JJAA 1RBZA 1QHXA 1VE9A 1XMIA 5KVAA 1K6JA 2RGNA 3M2TA 4BLUA 1DIHA 3O3MB 1X87A 4C2BA 5K20A 2ORVA 3KSZO 2O7VA 2B4AA 3CN7A 5EZ6B 3G0IA 4NIMA 3BMNA 1XKXA 3BJZA 2K2WA 3HM2A 4PZUA 2ZIXA 3W8FA 1HMYA 4IFBA 3NETA 3N28A 1CETA 1FDRA 3BXEA 2CNDA 3EG9A 1AMNA 4OB6A 4HTAA 3M6FA 4Q18A 3MTBA 1GA6A 2BFFB 2VRNA 4CDRA 3H17A 3W1WA 4I4LA 2AMFA 3F8WA 3ICWA 5AUQA 4CUJA 3OPVA 1BGWA 3WYDA 2J6BA 5LB4A 3QKWA 4KWIA 3VBEA 5JSKA 2Z5FA 3MGAA 1Y8QB 4F3CA 3KZMA 1PWYE 1OILA 3F97A 5KINB 5DTIA 4JFRA 1JDUA 2J3MA 2EATA 3E61A 2N75A 3WK4A 2H3EA 1N8NA 1V9CA 3WLQA 1E0DA 5F4BA 4KSBA 1RYZA 2VWHA 3GOHA 4AUEA 1QU2A 3GH1A 1F7VA 5G0WA 1BSVA 1K4YA 2VAPA 5FJIA 3ZLVA 1DXQA 2BZ1A 3K6SB 4WOKA 2FPMA 4I4NA 4LBYA 3E53A 5EIFA 4ZYWA 4ZN6A 2GK6A 1A4IA 4R51A 1JIQA 4IQFA 2AIRA 3FM9A 1RPNA 3IQZA 1KRXA 1S2OA 2A92A 3GDFA 5AM3A 4CG2A 5EMHA 1V5GA 2QI9F 1X1EA 3ROMA 4UE2A 4QFBA 3RYFB 2ZRCA 3VC3A 1F7UA 3T61A 4PGAA 1K3UB 2VYVD 3QEKA 2YZKA 1PHPA 3QV2A 4R54A 5AM5A 2NP7A 1SPXA 3D0OA 3IT0A 3K1AB 3GP8A 1FS6A 1B0UA 4QDKA 1NSYA 3KOUA 3O3OB 4KOAA 2C9ZA 3TQCA 3EY9A 1JPVA 1VP3A 3GCZA 3CNLA 3AM4A 2AZDA 3PUIA 3U61B 1FQKA 2QTNA 1CERA 1PR2A 1NT2A 2I1WA 2N47A 2XCQA 2Y1DA 3FPEA 1IG0A 1SBYA 2DF8A 2MOKA 4NHEA 1I3LA 2GHIA 2PUTA 4XD2A 4YCJA 2WM8A 4NV0A 1XCMA 1DQSA 2KWIA 2QAJA 3C43A 3PWSA 3RROA 3ZDFA 5A5VA 3D6NB 1QFSA 3ILVA 1H0RA 4V0MA 1DBPA 1KWKA 2Q41A 1CS0B 1VE1A 4WK4B 1U0BB 1EUCA 4JLSA 2QTRA 3TVTA 1TB4A 4JCCA 3WYAA 5GV7A 1SBTA 1AKYA 2YJ6A 3L4SO 1ZJWA 1BMDA 3BJIC 4KIGA 5K8VA 3IOEA 2Z2XA 4L5BA 4JX9A 5H68A 2HRZA 4MV1A 2VJDA 4ZU6X 1N8KA 2OWDA 2JEYA 1L5FA 2GFIA 1GVHA 5JMOA 2FPUA 3PGXA 2CXPA 1D0VA 4FM9A 1WB9A 4KXUA 4Q21A 1GDHA 2AVDA 4DIUA 1RFGE 1N5RA 3CV3A 4ZCLA 1A5TA 2GFQA 3OSZA 3R3UA 1FXWF 1TCCA 4LRSB 3ABSB 2FDXA 1M2FA 3LFTA 3DOHA 3FCAA 3MXTA 3PFHA 3G8AA 4M37A 4QEDA 5TMDA 4LOAA 1DAMA 4BZPA 3OX3A 3QVXA 5A04A 3UA3A 1P2GA 1PDVA 3Q3IA 5E4FA 4EF4A 4IF6A 1R8YA 1L7PA 4P7KA 4HPWA 4QBHA 3KT0A 3RYHB 1DX6A 2PGAA 4X9XA 5JC8A 1JU3A 2QUZA 2JHCA 2G72A 4L8YA 2X4IA 3TL3A 3FI9A 4E5SA 5A4AA 5EESA 5CB0A 5J1SB 4P4SA 1SOAA 3IXLA 3OOHA 4XCQA 3AZPA 1M8FA 2HLNA 4ZVUA 4RVCA 3Q72A 4OM8A 1B76A 2H0AA 3VR4D 4W5OA 2ZB3A 2YXEA 3BULA 4EEZA 4ZK6A 5B57C 2AMLA 3ABOB 3FHCB 4M99A 4JUAA 4BVBA 2V7WA 1FQWA 1C50A 4P4UA 1ZQ9A 3PRHA 2VDPB 4JB0A 4JLDA 4PICA 1HT0A 1XRMA 2M6SA 4JXZA 2WSIA 1PS8A 1XEWY 4IIJA 4UQOA 3QLUA 4E32A 2DETA 2X5KO 3LRPA 3IMCA 1ISHA 2L2QA 3BSFA 3ESXA 4B31A 1O6BA 2H11A 3A1DA 3TQTA 1D09A 4YLGA 4JJ6A 3ESDA 1R9MA 2DFLA 1BKYA 4GMGA 2G1KA 1HKHA 3TKAA 4KL8S 3B1ZA 4FHGA 1Q19A 2Q2QA 4GQBA 4EHAA 1TVMA 2J9FB 2PWAA 2ZYAA 1V41E 1KZGB 3BD7A 3HB5X 3KVNA 3VC7A 3L8MA 1M34B 1VLMA 1Z8FA 3ROQA 1ZN7A 4K9RA 4CLOA 3IVMA 4NESA 3OIVA 4XM1A 4Y6LA 4PRLA 5DGIA 4N4AA 3DDSA 1SU8A 2QGZA 5ALIA 2IWHA 4ZVSA 4N6OA 1PO7A 1IUNA 3AOGA 3AR5A 3FE2A 1AS3A 2R6HA 1WV1A 1TVEA 1Y48E 1PX0A 1U3UA 5JZBA 3DHNA 2J0EA 1FFHA 3L77A 3H7IA 3K8OE 4FWBA 5K51A 1IB0A 4AI6A 4TUYF 1R2QA 4BBAA 1CK4A 4HMOA 4HQFA 4J0DA 4P3KA 1QO9A 2EHJA 1O95C 4PYOA 5HTKA 1HETA 5F52A 4Y1RB 1A9RA 1QFMA 3N7AA 1ACLA 1Y81A 1L7AA 1XTQA 2HV9A 3Q7TA 4OJNA 2C0CA 4I6GA 1DT3A 1Z0ZA 2EWWA 1N9KA 2RH8A 1KPHA 4KO4S 2YJGA 3D0QA 4QLOA 4ROTA 4NU6A 3WGYA 4G0NA 3I9NA 4D56A 4D96A 2AFHA 1FP1D 2NG1A 4KSCA 4XYBA 3O8BA 4DSNA 1QOPB 2AFIE 2VLIA 3UV6A 1ZGJA 3W8NA 2FNAA 3K09A 2RHTA 4A4DA 4YQFA 5AK0A 2WY2D 3R5JA 5KWJA 2WAXA 4UAGA 5AK4A 1D4ZA 3DEJA 1TGYA 3AUXA 2ROQA 2YINC 3IBGA 3IHKA 4QQ8A 1P4SA 1L5SA 4UNQA 1T1JA 1FOEB 2EFJA 3ETDA 1JEQB 1FLVA 2JIMA 4FE7A 2QJTA 5SZIA 3C5HA 1H2YA 1VI6A 3VNSA 5EIBD 3H1FA 3IUJA 4CCSA 3CURA 4D74A 5KJ6A 1UADA 1JJFA 2XDQB 4MVYA 4TVOA 2DFNA 4KVAA 1X0XA 3FKSD 5JAQA 3KPWA 4QX6A 4N3NA 4BVKA 1ODLA 1V96A 5L3ZA 4PC2A 1F4VA 4AWBA 3ZIAA 4NL4H 1AU9A 3ZLUA 4FNGA 1FIUA 3GGCA 1ZBQA 4RIIA 2ORWA 4JGGA 5BOVA 3NANA 3DYBA 4CL0A 5BSTA 4KQFA 3ZGXA 2QD3A 3FD8A 3QV1A 3E05A 1W19A 3LX5A 2NO0A 2W5UA 4AMGA 1EX9A 3GPIA 1HNWB 3QU7A 1U2SA 2R7LA 2X8WA 4UMEA 1QRAA 1ZGZA 4NCJA 1BRMA 1LQ2A 3I6YA 5DM2A 1FNDA 1P31A 1WUTA 1EBBA 1NJ6A 2Y6UA 3VJRA 1I9GA 2JEOA 1NC3A 4HZIA 4PRZA 2BMWA 2QY6A 4R1SA 2X5XA 3IV7A 4DSTA 2FZVA 3TLKA 1NR7A 1SXGA 4G3XA 2B0JA 2NUBA 3N0XA 3SJAA 3NJ8A 4PC6A 2FP4B 4TGLA 1IWBB 4EM6A 4FYJA 2MR5A 2VZ0A 2UU9B 1BHQ1 4Q9HA 4YT2A 1RPZA 4YR7A 4IVQA 4O2RA 5M3BA 3D6AA 5JYBA 1OXKB 2PWZA 4KWCA 1T15A 3W5CA 1NQUA 1EWVA 5BQ3A 1A3CA 2GKOA 1UODA 4HWPA 1US8B 2JCVA 5GZ3A 4GNKA 1TK9A 3EYWA 3GQBA 2EKBA 3H8VA 2CV2A 2MSLA 3A1NA 1FFSA 2O8NA 1LK5A 1JDSA 1EQ2A 5K4AA 5C34B 1G21B 2B5OA 3CMMA 1JXOA 1KGDA 4N5IX 2RGXA 4P80A 1AO3A 5BRAA 2PBZA 1I94B 2TMDA 1KZ9A 4Z8YA 4GIBA 1H9AA 2K2QB 5IU6A 1QC5B 3HJRA 1SO8A 1E1QD 2O52A 4V0ME 4OXXA 2DU8A 2ZYRA 2QJWA 1A8UA 1Z45A 4ABTA 4YJHB 4C7JA 2R5WA 3D3NA 2XUHA 4YUYA 4H7IA 4YRKA 3G6WA 4RORA 3OO0A 4ZAXA 5FWXB 5AHOA 3U37A 4LJ4A 1RZRD 4C4RA 3S1LA 1B42A 5ANRB 1T4MA 1E1KA 3ABRB 3HA7A 2X7HA 2YQZA 3OU2A 5KNBD 1GTSA 3NEJA 3HUUA 4B3JA 1T0PA 2FQWA 1WO8A 2REQB 5CXSA 4L7QA 2YCLA 3CLSD 3T7JA 3TW8B 2O5CA 4JP2A 2A7QA 1ZMTA 2Q3CA 5EIE