3D9QX

Proteinase k by lb nanotemplate method before high x-ray dose on esrf id23-1 beamline
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3d9qX00
1P8JA 1IC6A 1KDYA 2IY9A 2ZWOA 1GTG1 1SCAA 1XF1A 1ST3A 2XTJA 2Z2XA 1SBIA 1JEAA 1SBNE 1GA6A 2ID8A 3EIFA 4JP8A 3WHIA 1DBIA 1NDUA 1EA7A 1SIUA 1WMEA 2W2QA 3DE5X 3DE2X 4H6XA 2DUJA 2P4EA 3CNQS 2W2NA 2Z56A 1KDVA 3SQOA 2PYZA 1TO2E 1SIOA 1C9MA 1Y48E 3F49S 4C3UA 1EGQA 3Q5GA 1AF4A 5JXGA 1Y1KE 3F7OA 5SICE 1KDZA 1SUCA 3F7MA 5FFNA 4LVNA 1TM7E 1Y4DE 1WVMA 2E1PA 3BX1A 1CSEE 3DYBA 3DE7X 3LXUX 3GCWA 4DWWA 3TECE 3DW1X 1GNSA 1PTKA 3I2YX 3I34X 4NE7A 3WIVA 3UNXA 3VV2A 3ZXYA 3D43A 1SIBE 2XRMA 4OV6B 5JXJA 2WV7A 2GKOA 1S01A 2Z57A 2B6NA 1WMDA 2SICE 3A3NA 3DW3X 3LPCA 4KB5A 3GT3A 4ZARA 5JXHA 1PFGA 5JXIA 4DZTA 5CW1A 2WUWE 1SPBS 5AMXA 1OT5A 1OYVA 2TECE 1BFKA 1GA1A 2PQ2A 2X8JB 3AFGA 1AVTA 1Y9ZA 3I30X 3LPAA 1C9NA 4K8RB 4ZOQI 1YJCA 1VSBA 5AVKA 4DJ5X 1SUEA 1SCNE 2Z2YA 3WQBA 1GTJ1 2QTWB 3I37X 3VYVA 1BH6A 5ARBA 1AH2A 3SICE 3EDYA 1KE2A 1IAVA 1S2NA 1TM5E 1C3LA 1YU6A 4NE9A 4NMXB 1PJ8A 1Y3BE 1GT91 1OYOA 1TM3E 2PRKA 3D9QX 4H6WA 1GCIA 3BGOS 1SCBA 1NDQA 3HJRA 3L1KA 4MZDA 5AQEA 1T1GA 2PMWB 1PEKE 1T1IA 1SUBA 2DP4E 2PKCA 3AJ8A 4KPGA 1A2QA 1SUAA 2W2MA 1WSDA 1R6VA 4CG0A 1SVNA 3DVSX 4H6VA 4C3VA 1AK9A 2SECE 1R0RE 1NLUA 3P5BA 3CO0S 4YN3A 1KE1A 1TMGE 3VHQA 3EE6A 4GI3A 1AU9A 4LVOA 4AKTA 1TK2A 2WUVA 4WOCA 1AQNA 3A3OA 5B1EA 1BJRE 1S02A 2HPZA 3LPDA 1GTL1 1ST2A 1Y3DE 1R64A 4WOBA 5ARCA 2ZRQA 1SBTA 4HVLA 1HT3A 1P7VA 1SCJA 1YJAA 1LW6E 3QMPA 3DVQX 4RYDA 2PWBA 4Z2AA 1Y34E 1TM4E 3GCXA 3AJ9A 2W2PA 1Q5PA 4M1ZA 1ZVJA 3DWEX 4KG7A 2G4VA 2V8BA 3H42B 5ARDA 2W2OA 1TM1E 1SUDA 1SBHA 1V5IA 4AKSA 4BWGA 3TI9A 3VV3A 1Y33E 3OSZA 3QFHA 1Y3FE 1SELA 1P7WA 1BE8A 2DQKA 3VSBA 1C9JA 3GT4A 1Y4AE 1ZVKA 3DE1X 2Z58A 1SH7A 2HD4A 4J94A 3DE0X 1MEEA 1Y3CE 2Z2ZA 1V6CA 3PTLA 4FONA 4I0WB 5FBZA 3VTAA 3WIUA 1CNMA 1GA4A 2Z30A 4CFYA 2ZWPA 3DE4X 5K7SA 1TO1E 1BE6A 1GNVA 4HX2A 4OMDA 3DE6X 5AVJA 4B5LA 3DVRX 2IXTA 1SUPA 3PRKE 1THMA 1SN7A 1UBNA 2SBTA 3QTLA 1BFUA 1SCDA 1T1EA 3Q40A 5I9SA 3DDZX 5B1DA 4OMCA 2WWTA 1MPTA 1SBCA 3TI7A 3ZXXA 5JMOA 3A3PA 2SNIE 2ID4A 5FAXA 4CFZA 1TECE 2ST1A 2X8JA 2PWAA 1AV7A 1WMFA 3DE3X 3BPSA 1DUIA 1YJBA 3T41A
chains in the Genus database with same CATH superfamily
4CKYA 4TPKA 1WVGA 2Q50A 1MXFA 3D8TA 2F43A 3V2GA 5JAQA 1JRLA 4RKWA 3P32A 4PSDA 2OZPA 5KNDA 2DXIA 3CONA 1Q83A 3QE9Y 1QYXA 2PX4A 5THQA 2JCVA 4B0OA 2ZT7A 1LKZA 1L7OA 1EH5A 3LUAA 2AG6A 3L2OB 4IDPA 3ZKAA 4YO8A 4U5XA 4RJLA 4DUZB 1U1DA 2A9FA 2FU5C 2VJBA 3EFOB 1NVBA 2X7HA 4I8IA 3VJMA 5KSWB 1NVEA 4XTCS 1O58A 2DVMA 1V0JA 4C87A 4MRNA 1M8GA 4PZZA 4W5NA 4NZ9A 4ZMSA 1S8OA 3AHHA 3SYTA 1D9ZA 4P4SB 3CSDA 4Y9TA 1FRFS 4IV8A 4PN7A 5HCNA 1JWBB 1R18A 5EHGA 5CA1A 1UBFA 4Z2YA 3D5QA 3KVRA 4MAAA 2R66A 1GKUB 1CHNA 1Q16A 4CLOB 2VYNA 5HOQA 2YRXA 1N7HA 3A3NA 3G8BA 1WMDA 3MCUA 3T9CA 1CR2A 4YDRA 1TEHA 3SQLA 1CZKA 3LUPA 3PNSA 4J90A 1A9OA 1W36B 1YQXA 3KJHA 1DC4A 1M2OA 4IDGA 4LTNA 4I08A 1PT8A 2O3JA 4TT3A 3E2IA 2FQXA 2J67A 2OO5A 2BGUA 3Q6IA 4LHVA 1NP3A 2P69A 5DCLA 4LS3A 4JB0A 3L3BA 5LSAA 1RBYA 2JDIA 2YVUA 5JZBA 1QRTA 5KTTA 4FK8A 3FNQA 4KBFA 1SD5A 3PXBA 3MTQA 3RIGA 3UF0A 5HZHA 2NO0A 3ZU6A 3D3JA 4RJTA 1OROA 4ZWNA 4K28A 2CCGA 2FPPA 5E2IA 5EE1A 3B7WA 1RACA 3FR8A 4N5NA 4Y2HA 2DQSA 1UJ4A 1JFTA 1OSNA 1ACMA 3L49A 2G1PA 4L5IA 4W9MC 1PT7A 4Z49A 1P1BA 2FY8A 2NUBA 3OZRA 4UULA 1NLMA 6NULA 4W7HA 3K72B 2IS4A 1KZ6A 1BA2A 3GOHA 2HOQA 2QTZA 1Q6YA 3KJEA 2QOEA 5GIPE 1LLFA 3AUTA 3MJHA 3QVJA 4PTZA 1X7WB 1EFTA 5FV7A 2F3QA 4EKEA 2DULA 2H4JA 2OG2A 1FMLA 1FX0B 1NN5A 3D7MA 1VB3A 4ZYXA 2VF8A 2YRFA 3VVLA 1FDVA 3I0NA 1UDRA 3EBPA 3WZLA 4OI0A 1FUUA 1QGUB 1QPBA 5T6BA 4DLRA 5IM5A 5FNVF 1P29A 1UAYA 4FFBA 4UAVA 1Y6FA 1ID1A 1WD7A 1DBRA 5L8VA 3BWBA 4ZEVA 1M0WA 2AEJA 3WMXA 1B8OA 5LIPA 2ZS8A 1EHCA 4XA8A 4Z0HO 2F67A 4E2FA 2VPIA 4NG5A 5JZSA 4F93B 3RJTA 1Q1QA 3GUCA 4JIGA 3OEYA 1MV5A 1T35A 1W75A 1GGMA 2AMJA 2XHEA 4F85A 4ER5A 2VHJA 1XROA 5CT6A 1M5UA 1T9BA 1XAGA 4MS3B 1FLNA 1NQXA 4M21A 3UH0A 3PJFA 3OJXA 1FMJA 5FULA 2YQ4A 3OFJA 4LMRA 4AF7A 5AW6A 2CL7X 5G0UA 4UAGA 4M0PA 3LIPA 3L1HA 3FCEA 2WWXA 3C1AA 2J48A 3TJZA 3GGCA 1NPTO 1BD3A 1SXJE 4QTYA 2G77B 2XDQB 4XGNA 3V32A 3ASZA 1HQDA 1SKMA 3UCEA 2NG1A 5SY9A 4EZEA 3KQPA 3OFND 1SBIA 4DUGA 1WTAA 2CVZA 5JWOA 1UXHA 5L40A 4D9JA 1E3WA 2DUJA 4AYTA 1DS6A 4RC9A 1JDSA 3PG5A 3T7KA 4TLAA 1ZHHA 4P33A 2BGMA 4REQB 1E3TA 2D4HA 1RADA 1ZCBA 4AJLA 2RI0A 3H75A 2X5JO 1MZVA 1SCUA 4P93A 4RU1A 4TXNA 5ICFA 3PL5A 3HCAA 4Q4CA 3QY9A 2WPDA 4M1OA 1ZY2A 4RY2A 4EY4A 3ZJ4A 3DYBA 3PX7A 2L17A 5HFJA 1C9YA 4LY0A 2FF5A 2Q5OA 5BYKA 1Q1AA 2LCFA 3FPAA 5DEIA 4B6QA 2RK6A 4URWR 3ZU2A 4PZUA 1N1DA 2WV7A 2Z57A 1XQ1A 4X6YA 1QHSA 5DLDA 3FYDA 3B1KA 1A4RA 5BQPA 3UJCA 3W3ZB 5CD1A 1WETA 3PDIA 4AZ0A 3O4VA 4HDAA 2O2GA 1SQGA 4Q4DA 4BRUA 1P5HA 1MB3A 4JBIA 5LOVA 2IHVA 1RVDA 4LUCA 2AUMA 2IEZA 3BE6A 4KO1S 2NW6A 4MSUA 3BSYA 3TLXA 5LMZA 2HRZA 3MFQA 4OP2A 4A8HA 1T8PA 3ABIA 4MS1A 4LYGA 4OKSA 2BTEA 3HCWA 5AJWA 5AKZA 5CIWA 2WKWA 2QVZX 3P7MA 3QFTA 1UZAA 3OG9A 1IXZA 4MQ5A 1LF0A 1J7JA 4D0GA 2JK1A 1OA1A 2UYQA 1L4MA 2PPVA 2X15A 2PWZA 4GKAA 2X5XA 1FP2A 5EKXA 1NOJA 2O0LA 2W5UA 4K9SA 5D3MB 3KXLA 1MW9X 1NGSA 3PPWA 4G1VA 5A5DA 4Q1EA 2YZNA 2EJTA 2WD7B 3QUQA 3OE1A 1EP9A 4WNYA 2VSYA 1XTVA 4G0WA 2V54A 5CCDA 3RSOA 2PIAA 3AF3A 3P71T 4KITB 4KPFC 3NALA 4TWIA 4KNYA 4D3XA 1NOKA 3GU3A 4IEEA 2Z6UA 1JH8A 3HCDA 1GIAA 4KMSA 4XJTA 3EZNA 3P9CA 3QE3A 3WFIA 2YXDA 1JPJA 4GDMA 3JY6A 1YE5A 3UOWA 2N0SA 3QELA 2FUKA 3ZIDA 4D7AA 3L7KA 5DF1A 4DTIA 1CY7A 1HTWA 1T3GA 2HFJA 1NBOA 2ZUDA 4NLLA 3C3DA 4OSOA 3SIRA 1RWBA 4AVYA 2FPWA 2YASA 3NWBA 1OIXA 2FFRA 3RUDA 1JSCA 1Z5ZA 4HPJB 4KIWA 4WNCA 1E8DA 4AN1A 1FTWA 1XKLA 3B6IA 2HNKA 3H9CA 3WL5A 1UMDA 1E6WA 1W6UA 2Z5VA 2XCQA 4P3KA 1ZN8A 1EMDA 1PVOA 2BV3A 1MLDA 3TGPA 3VAAA 3MTJA 3E27A 3M5PA 4P82A 5LA6B 3WI7A 4CF4A 1MXHA 4YRGA 2A59A 1QHFA 4HX5A 1ETUA 2Y0PA 1Z5UA 2Q5EA 1R4MA 3RAEC 3QNUA 1JHZA 1QWSA 3TOCA 4RZUA 3RUAA 1MAWA 1JIQA 3PQ3A 2WU0A 4Y30A 4Q00A 4UXJA 3THRA 3GRYA 5LQDA 1DGQA 3KYDB 1M1YA 1ORTA 2Y2VA 4WY8A 2QL7A 4IVQA 3CEAA 3QWFA 1EYZA 2XZPA 4ES6A 2F55A 3UUEA 4LJ9A 4EI2A 1I6KA 1HE3A 2R60A 3AEUA 3BD9A 1CQXA 3GJ0A 2ECQA 2J3KA 4G4GA 2BVNA 2RH4A 3GRVA 4UUQA 3F9RA 2XJ9A 3C7CB 3MPUA 2AIRA 2JNWA 3T9FA 3Q3EA 1L9KA 1J8DA 4WLFA 3SZUA 4I9FA 5JXGA 3LAWA 3QTTA 5T4BA 4F3KA 1YNOA 3E0XA 5BRJA 5HZGA 3PKZA 2I6QA 1V9CA 1BDMA 2NZVG 5FO1A 1T9DA 4QUAA 3PIIA 3D31A 4JEIA 1AQLA 1E3JA 5DBIA 2Q8PA 4NZZA 3HFRA 3EXEB 2X0NA 3T5CA 1NQWA 5B1IA 5CDSA 2YWDA 3ZGOA 5C8XA 4EW6A 3UEOA 3P26A 5C4IA 3IIKA 2FSVA 4XR9A 3IR7A 4NFSA 5G4LA 5H82A 1EDOA 1Z4QA 2JJMA 1KMHB 3E4CA 4URXR 1ZN7A 2Y9MB 2C4MA 1AGXA 5K3FA 2IPOA 3LC2O 2J59A 5FX2A 4YAWA 4PG5A 2OMKA 2ZJ3A 2VUIB 4JUFA 1R2QA 1E3SA 2WJHA 3KZNA 3KT6A 2PGXA 5CNIA 4A8PA 3HADA 3K6KA 4MV8A 4GX0A 2OGWA 4C5AA 1O5TA 1X94A 1JQ5A 1GL6A 1NVUQ 4YIHA 4QYIA 2IOQA 2ZRLA 1FXSA 1HWYA 1D2GA 2PRZA 2J3EA 2Q6TA 5DDIP 4N47A 2BE7A 1JIVA 3F7TA 4UFPA 1UJMA 2K2QB 5EQDA 2C95A 4MV4A 1AJEA 4K9MA 2O2ZA 2OZLB 2MMCA 4QEDA 4DBVO 2VQDA 4YP0A 1FUYB 3PTAA 5A4KA 2H3EA 4WLNA 4YJ2B 3SYNA 2N3ZA 2D8MA 4RACA 4V0OA 4MR9A 4TLBA 2BFAA 4TZ0A 4CEIA 3K1AA 1YUBA 4HCJA 4EG6A 4TVSA 3K9FC 4CRWB 5AXCA 1DIOB 2ZDHA 3L5KA 4PZYA 4RVHA 5REQA 2YIVX 3V8BA 4YONB 1RLIA 1UZNA 1ZXLA 2BFCA 3AVQA 2XH8A 5EWMA 5LJLA 2VUHB 2MMGA 2Y05A 4ARAA 4NAVA 2H59A 2HO5A 1C1DA 1LBSA 1I2AA 1ZINA 3EXAA 4HQNA 1SK8A 2V8BA 2XE8A 3GZNB 1ZGCA 2E49A 4Z3KA 4G0YA 1L4LA 2ZQZA 1V1JA 3LOQA 4RSGA 2P65A 1SULA 3UK2A 3UO8B 5A04A 4L3VA 2Q0QA 1VRVA 4NU5A 4XB6B 5DM2A 5TPZD 1PWZA 3H13A 1JKFA 1KAGA 3HABA 3MM4A 5JSQA 5JSUA 2VDUE 2KS6A 5DXAA 5E6SA 1D1PA 1HH4A 3AR3A 1GU7A 1ADYA 1LLDA 2ZJ0A 2GPWA 3BWEA 3E9YA 3NFYA 4DCMA 5GZ1A 3UBTA 1RRCA 2ZXEA 5CDFE 3KQKA 1BE6A 3M1YA 3F5MA 3NBAA 3RSLA 5AIBA 3GBPA 2YY6A 2CLMB 1C30A 4X6LA 1PR1A 4CL0A 4WCVA 3BMQB 3PGMA 2YBDA 1C4KA 1RWMA 4K40A 1CE8A 2VSFA 3SKYA 5FPPA 1V9LA 2QG4A 3FAZA 3I58A 5BN4B 2W71A 5JSYA 4YUYA 1XGKA 2K2WA 3GD7A 1R9MA 1YS1X 1E7QA 1UPBA 3TUIC 5LUAA 1ISFA 3EZLA 3ORQA 2WICA 4E4YA 4KZKA 5I3CA 3L6EA 3DFFA 4OB6A 1E2BA 2Q0XA 3HKCB 2VP2A 2ZAMA 1GG2A 4HDNB 2IW1A 3NI2A 3NEYA 1KOGA 1OAAA 2WKRA 1BWRA 2I6TA 4KPUB 4ZDKA 3DE2X 4Y0VA 1VTKA 3FF4A 5AVTA 2XB4A 1C7RA 1I4EB 2J0UB 4G0QA 4IS3A 4KTVE 1B00A 1FNCA 2WWVD 3HH8A 1KP3A 1SIOA 1EEHA 3H4VA 5EIAA 1UKZA 2P4SA 4D41A 4W5RA 5T5QA 2IHZA 4O1MA 4DYHA 1KF0A 1WX1A 3KALA 4JXJA 3UJPA 3THWA 1XCGB 2BMFA 3B5EA 3OAAD 4KLZA 5FEMA 3VR6D 3FSEA 4RM3A 1N2CB 4D56A 4EUFA 4FWIB 3HB9A 4F7DA 3SR4A 1A5AB 2SCUA 3GPLA 2I1VB 2G28A 2M6SA 1WQ4A 3OPYI 4R6WA 1D2EA 1CXZA 2J08A 3K0KA 4K9NA 2REQA 4XXHA 4M0UA 4C78A 4B5KA 2JD1A 1Y1LA 3L8DA 4E1VA 4MWBA 2FNAA 3OCCA 3KU4A 4CGZA 1A9QA 3KR2A 3ESBA 1LDEA 2WLSA 1JSLA 3AIIA 3FYTA 3O31A 3G0IA 4KFSA 4O4LF 1MVLA 4LK2A 1XZEA 4KI7A 5C51B 2GCPA 3OC6A 2HCFA 1K6EA 1E64A 1L8XA 3NC0C 5BPHA 3A11A 1ZLXA 3IV9A 3VYVA 1H94A 2GO1A 2H9YA 3OQ1A 3CPSA 1AUQA 1SCIA 4PONA 2FZCA 1FDTA 1COWA 1NM5A 1W1IA 5IXSA 1AKUA 5KINB 4OHZA 3INYA 4LQLA 3RU3A 1UM9B 3LYAA 2NXWA 3DLCA 4B71A 1HRDA 3AX6A 3HM2A 3ZE1B 4AUMA 5KSOA 1TCBA 3P5BA 4ALMA 3S2IA 2GEJA 4YRRA 5GPBA 3GP5A 3HVRA 3CW8X 1OBVA 2BFNA 4UBMA 2WM2A 2HZBA 1U8YA 3KYIB 3VBEA 5FT9A 5KTRA 2GSDA 1BOFA 1S2MA 2VOEA 2Z83A 2ZB8A 3S8YA 1TCUA 3ED1A 3OFSA 5EUMA 1SBTA 1M6WA 1VJRA 1AXGA 2P2SA 1I24A 4U2EA 4FOOA 3HJFA 1VXRA 1JPNA 1YQTA 3UGKA 4F6RA 2H1VA 1M2KA 2W2PA 5THKA 1T4CB 1EQAA 1W96A 3WDKA 3BDVA 4N41A 4QRHA 5D2CA 3RWOA 4LF8B 1W59A 1DT3A 2N1MA 3QBDA 2HA0A 4EDFA 2R84A 2QR3A 4LJ7A 3IP3A 1YGPA 1FLVA 1QH9A 3INNA 3RLIA 2BH2A 3EPHA 5BW8A 1QVAA 4DSTA 1EFDN 1YZLA 1GJRA 3O3OB 5EWLA 3FGNA 2BGLA 1BMQA 3ILXA 3LRPA 3JZMA 4I50A 5FO0A 3I9MA 4MA4A 2QIPA 4NE2A 4TTVA 3E9NA 2COUA 3AG6A 2PBZA 3FYHA 4ETNA 2CDBA 5HVNA 5J2TB 3E5MA 3LVFO 1ULTA 4OHXA 2ONZA 3KR1A 1T8UA 4QUKA 3T35A 4CLRA 3AP2A 3Q2IA 3AP1A 4I1PA 2NACA 4CQNA 2EBFX 1YR2A 2AZMA 1YQ9A 5H59A 1ONSA 3KEOA 4BZQA 1AV6A 3O1JC 4YXWA 2ST1A 3RIYA 4B8WA 1CDDA 3H5RA 1ATZA 4J91A 4O4HA 1TPZA 1Z25A 4LRTB 4XUCA 2IOFK 1UPFA 4RDXA 3H0CA 5C8YA 1SVMA 2XCIA 5EKDA 1P61B 3AJDA 3F74A 3U3XA 3HA3A 2OECA 3EEIA 3D7KA 2CB0A 5FOQA 1ST3A 4AWBA 3HS3A 4UEOA 3K0HA 3HUUA 2PGDA 1F06A 5C31A 2WM9B 1E1NA 2ALJA 4OPMA 1QGOA 4NH4A 2YBEA 1EXMA 5I47A 5TQVA 3HJAA 3MAAC 3ELYA 1QGZA 3UPTA 3SMQA 1CZHA 3CUKA 1U1GA 2K5UA 2WP8J 4EFKA 4BNZA 1FLDA 4NMHA 1WOYA 1IJEA 1JE1A 2B4QA 3W7BA 5HKKA 2LWIA 3EA4A 4XYBA 1KTIA 2UVDA 1UKBA 5A71A 4RLSA 2DKNA 1T5OA 2WTMA 3FIJA 3GJQA 3L1UA 1NHGA 1GPWB 1FTSA 3TIGA 1WBBA 4DWWA 1OW3B 5BT9A 1ZNQO 2H18A 1I80A 3PP8A 3ZV4A 1H23A 1ZK1A 1ZN2A 3O4IA 4KLAA 1EIWA 4L4ZA 3N2LA 4EW2A 5JASA 3M4NA 4FGLA 4NCXA 4Z4EA 1S01A 2WSIA 4EGQA 5JD6A 3C0KA 1F2TB 3JWIA 1BYIA 1SXJD 3HMQA 4A36A 1VKRA 2JLQA 3BS4A 2G17A 3O8QB 3C14C 1GAQA 1L0BA 1URPA 1WXFA 2JJ2D 4EKYA 5T41A 3C1UA 1QX4A 1GPMA 4TLCA 1MZPA 1PJTA 2NZJA 3AKYA 4NTZA 4YAFA 1GV1A 1PQPA 3CLRD 4KX5A 4WINA 4Q7JB 4C22A 3UK1A 2VF5X 3Q7QA 1KIAA 3WBBA 3RU2A 2MHCA 4TL7A 3WWDA 3AC0A 3NAGA 2FRXA 2AUTA 5BV0A 2EHDA 3B6EA 3BDIA 3G79A 5DMXA 4OB7A 4YGYA 5HRCA 1OV4A 4GZLA 3O5AA 1GU0A 1ZAKA 2R6DA 3RIMA 4BN4A 2E85A 3ZLJA 1NNI1 3V1YA 1VM6A 1YRLA 5DRYA 1LCIA 4ZOEA 3EZGA 3BFKA 5KJFA 1P7ZA 1IHOA 2PS1A 4KL8S 4AZWA 4O4JB 2A4KA 2RGCA 1SHKA 1U8CB 3EMKA 4R4JA 5DNCA 3U6KA 4KVZA 2B4AA 2WOOA 1LJLA 4MQUA 3ESCA 1GY8A 2O59A 5TQJA 2E5FA 1ECCA 1YMQA 2JK0A 3I23A 3RRXA 4BV3A 5FUXA 4BQPA 4IJWA 4DNPA 5LBUA 3AF4A 1N75A 1QP8A 1YL5A 2VN8A 2XEDA 3ADDA 1DEXA 3B7PA 4GX2A 3FGZA 4P4NA 5D3QA 1RE1A 3AFHA 4ZP1A 2LCIA 2NO7A 4TL9A 1IM8A 4DT1B 2R8EA 4R2LA 5DGIA 2OM6A 3HHPA 4OYHA 2YZMA 4HGRA 1QHHB 4X7BA 4BAGA 1CW2B 4F1WA 1Q0HA 2OHHA 4EEXA 2AG0A 5HJ2A 1FDIA 1DNPA 1VB5A 3ZK8A 2QSZA 1KY2A 3A9VA 2OWEA 1I3OA 1T0BA 3L01A 3OJFA 1Z0IA 3R6TA 5LN1A 1CUFA 1V45E 5BUCA 1T1JA 4OQFA 1L4GA 2QRQA 4KRXA 4RVUA 4PNHA 3U4DA 4EHNA 1QP7A 3R09A 1IN7A 2PY6A 3QTLA 2NU6B 1T1EA 1X86B 1VFPA 1G2QA 3UPUA 2PT9A 2GT1A 2E18A 5ALLA 1DWPA 1EFHA 4MV3A 1KFEB 5G1OA 3HDTA 3VNQA 3BC1A 3NX4A 4K05A 4R9VA 2O8EA 5AKEA 4IDCA 4B7XA 5CBKA 1O95A 4MGEA 5ENZA 4X84A 5BY2A 3F6EX 1M54A 4WZBA 3RVDA 2Z2XA 4A10A 4XQCA 1UM8A 5LQMA 1ADFA 3N3AC 1DBIA 1NC1A 1WV0A 2XMRA 3PHIA 4FU0A 3E9DA 4FTWA 3LQYA 1YBHA 1ZD1A 3G2HA 5BSKA 3WRYC 3WIBA 2XOEA 4I19A 6GPBA 3TQCA 1VGQA 2E4YA 3JZAA 1B41A 3BIFA 3DEZA 4YEDA 3UWDA 3ZD9A 5CB4B 3ZDDA 4LVNA 4TTSA 4FI3F 4B8ZA 1XFAA 1P77A 2O0KA 4X95A 4YVFA 2JI9A 3N0XA 3JAWA 2ONYA 2IOHA 2QTLA 1B3RA 2QP3A 2XNDA 4U2CA 4NBRA 4K03A 4YJKA 4EFNA 4UZFA 1D8AA 1N5KA 1J56A 3RSGA 1DG1G 2A92A 1WDMA 1E8MA 1O77A 4HXEB 4NNOA 2VDWB 3C8UA 2VAVA 1EFPA 5DBOA 1IWPB 5DTEA 2CJPA 2HLDD 5H16A 3RTDA 5BN4A 2JLCA 3WVNA 2BTQA 4B4DA 4PNPA 3PPYA 3EHDA 1GPNA 4QVKA 3U3JA 1YTLA 1DMSA 1N9ZA 4WFIA 1CDEA 2XWSA 2XGMA 2YYAA 4HTFA 1RD4A 4LWZA 1LPPA 1GTJ1 1UEXC 3I28A 5AQ1A 5C8DA 2CBZA 3I83A 4I50B 5AKIA 3TTYA 3NH9A 2GEDA 4G63A 1U7OA 3O2NA 1T6ZA 5GZ3A 3H9BA 4R0MA 4HNUA 5GOTA 3PFWO 5IBPA 2MSEB 3QEJA 4URYR 4X3CA 3HYCA 5DGXA 4Z0TA 1RZRA 4U7GA 2IDZA 3W9BA 3KL2A 4C6RA 4LTDA 4ZU1X 3LH5A 2UZ1B 1POXA 1P2GA 4DMCA 3NIWA 5HP4A 1RMTA 5DJ5A 5A0TA 2ATEA 1W87A 2E4UA 2GCOB 2VVTA 2ZBFA 3C4VA 3HXLA 4RD1A 5P21A 3HRKA 5TDHA 5DSXA 1MAAA 5C8YF 2EGUA 3TJMA 3A9UA 1FFBA 2CF5A 3L4EA 1RXWA 4NSNA 2YL2A 1M34B 1V8OA 2ERCA 1HT3A 2GN6A 2ISCA 2WSSA 5LYJF 5L3RA 1SVLA 4PAQA 3GNLA 3AY0A 3NASA 3W8RA 2PU7A 3IV6A 4OJNA 4UNPA 2XITA 4BFCA 4MOWA 3L0PA 1Y1SA 1V4BA 2GN2A 4QSHA 4ZI2A 3TPCA 1OWNA 3GAZA 2CWDA 4QKQA 1K5GA 5JQGF 3IT1A 4RK4A 4BNKA 4BGEA 1NMEA 1OGJA 1SBQA 3OOEA 3ADBA 1Y4AE 3O38A 3GBSA 4V03A 5DNWA 2HF8A 2D6FA 5U1PA 1PN3A 3IAM1 3PVZA 1X13A 4B3HA 1XRSB 4IXDA 5B3KA 1WOMA 4ZO4A 3Q3JB 3IJRA 3NNDA 3PNLA 4MX8A 4S2UA 1U65A 7REQA 1NNUA 4KSCA 3IE2A 2HBZA 3MOIA 5LIRA 3H8WA 3CSSA 3N6RA 5I48A 3GLFE 3D7SA 2XGJA 3Q2OA 3W8EA 3MCAA 1IWOA 1EWYA 1IHYA 1UC5B 2QT0A 3GUYA 5K3SA 1IPHA 1GN9A 1F0NA 2QMUA 3J7TA 5EJ2A 1O8BA 3SJCA 4BO7A 2AQHA 4BN0A 1ECLA 4QUIA 2G83A 1L5GB 2O8DB 4YPOA 2DT8A 5E1MA 1DOZA 2J6HA 2RC5A 2PT5A 4BEVA 4EHBA 4Z7JA 1DKOA 2HIGA 3BFJA 2CDCA 1ZD4A 2J8ZA 1X19A 4A5OA 4H6XA 4EDHA 1O2DA 3PDCA 4FZ5A 5F73A 2QZJA 3TE6A 4PLGA 4F45A 3EH2A 4RYLA 4CKEB 5GZ6A 1JP7A 4L7VA 4N3AA 1Y1KE 4DCVA 3TSCA 3EOAI 3VZDA 3NP9A 1M7HA 1Z2PX 2UV8A 3FVQA 2CFSA 3VO2A 3O92A 1H1DA 4HFJA 4YAKA 3OZWA 4FOLA 4DDKA 3QMWA 2I7TA 4MR7A 3VV2A 4BB6A 1ZCZA 5SYAA 4EYOA 2AN3A 2CLSA 4JZYA 3FOBA 4WZAB 1AURA 2XMZA 3PQEA 2QRMA 2DFLA 2VDRB 3GT3A 4N5IX 2Y4OA 3WNZA 3R8CA 4OQ4A 1SPBS 5A5GA 2CBGA 1PHPA 2HGZA 2BPOA 1MT3A 2JIMA 2AVDA 4ZOQI 3FVTA 2PZLA 3AERA 1Z8NA 3RAGA 3V4PB 1FP1D 3MINB 4OJQA 2HWXA 4BX8A 3G82C 3QU9A 4WACA 4DEVA 4F3NA 4B44A 1N0UA 2IYEA 2R00A 3N5CA 5I9LA 1O95C 4TGLA 3IE0A 2HU7A 1HOTA 4IYRA 3OA0A 3DP9A 3NORA 3UG7A 4EVQA 1NXSA 3KIPA 4RA9B 5IJ0A 2Z5GA 3DVAA 3L6BA 4MR8A 2O8EB 5AW0A 2CLKB 3T95A 4D46A 2G9QA 3DOOA 3ZYZA 2PJRA 2AFHA 4QGGA 2EX1A 3BHMA 4MVWA 2ERXA 5JY6A 5FI1B 1G4AE 2WFMA 5JCJD 1SGWA 2CLLB 4PLZA 4NCHA 4QWMA 4X62B 2WWYA 3TAHA 3HCFA 2D7DA 1V11B 2HSWA 1ID8A 4KR6A 1TJPB 2ZJ2A 1DOHA 3SQNA 1OXVA 3H8VA 1D07A 3EIUA 4ZRNA 5DM60 3L4BA 3STVA 2PRYA 4KG7A 1OIWA 4ZKDA 4U3JA 3FSRA 1M1ZA 3ECCA 1ZBDA 4ZOCA 1GGNA 3UXHA 3ZCTA 3DLTA 4E7PA 4R2WA 5KTMA 2H3HA 5AVSA 4X41A 2DQZA 2YHIA 5FUQA 3AR9A 4OI1A 3T5TA 1MH9A 1E89A 4YRMA 4CDGA 1ZMTA 1A69A 1M6HA 3PR2B 4BP3A 3DUFA 3M6WA 1VOTA 2IXAA 2NPOA 4ZQCB 1YUNA 2CMFA 4R2KA 5DTMA 2IWRA 3CFYA 4YV2A 1J2RA 3AB8A 3R9XA 2AN5A 3L0YA 2JIZA 1J2YA 4OHMA 1Y4SA 5KB3A 3PXUA 1N92A 2RH9B 5IVPA 3WLHA 1W47A 1BFUA 1GPUA 2JCYA 2BIFA 3UWMA 2ZSBA 3UZUA 1PT9A 1M0TA 4CM4B 3OKCA 1LFAA 1XZIA 3GR6A 2QG9A 3FB4A 3W5SA 2Q1WA 1AZWA 2WG0A 1SQFA 2JI8A 3DEHA 3IMCA 4RSRA 1USKA 1J9EA 2AXEA 2JFPA 2QTNA 2IBMA 5DTRA 1NSFA 3IILA 3MTIA 1E5TA 4O4HF 4P3OA 3RU9A 3CBQA 3U7QA 2XRYA 1DU4A 1T29A 4R69A 1SHUX 3ZV5A 5G02A 4BVFA 2P9FA 3EVGA 2AWOA 2OV8A 2RAVA 2JJ8A 2QMOA 5IAEA 1W76A 1VA4A 1PRYA 3D8BA 2FSIA 2I65A 3WHLA 1T3LA 1Z6GA 4ECEA 4KACA 4KHZA 2BR3A 4XDYA 4JT8A 1KZ9A 4A6DA 1WW2A 4C03A 3NT4A 1ODLA 4MRMB 1UPXA 1DJNA 5KDDA 3K0AA 4XR4A 1N34B 2O6LA 1F4PA 1E2GA 3KLBA 5GM1A 2HJSA 5BQ5A 3CH6A 3G2LA 2IF0A 1OVMA 3NJRA 2HHJA 1IK4A 1LGYA 1XMQB 4CKBB 1APBA 3IYLW 1JAYA 1MDFA 2JH3A 4X54A 2I54A 3LPCA 3T1QA 1LC0A 3HA7A 1R6BX 3OOYA 2ZUSA 4CCWA 2AR0A 3IODA 3ILHA 5IEBA 5GV7A 5M7EA 3FPKA 3R7BA 3ZU3A 1KJQA 2E2WA 3PENA 2AJDA 3M4JA 3TGWA 4YJGB 4PNEA 1M3SA 1UP6A 3I4FA 3PE4A 3A8TA 4XLTA 1ISIA 4YRPA 3CA8A 2NUAB 2PZMA 4TWRA 2ZU6A 1TYZA 3MHPA 1CUHA 3LA6A 3H5IA 3QPWA 5A1TA 4XPIB 4OBEA 2EFHB 4PLFA 3VUFA 2C59A 5BSRA 4BX2A 1C8KA 3N39C 2C2BA 1ZISA 3OX4A 2ZUUA 1MX5A 3H2YA 4MV0A 1QMPA 2WTNA 3EVEA 2DP4E 3K9BA 1WHSB 3LD9A 3EDCA 4ZYZA 1T36B 2W2KB 3O2JA 3OEHD 1AK9A 2J5BA 3GGJA 4U02A 4KH0A 1K68A 2ZRMA 3IUPA 5LBTA 1X8XA 2QZ4A 2VF4X 2PL1A 4O29A 1H5QA 4Q12A 4TYMA 2OO5C 1TF5A 3D8RA 3OKFA 3A9RA 4ZVPA 1DAKA 3D0RA 3IP1A 3LSTA 4LOAA 2AQKA 5FNZA 3R8XA 3K9CA 4JVNA 1IVNA 1CY1A 4OA5A 5E38A 2B6HA 3UJ3X 1JI0A 2QXYA 5K45A 2P0EA 2PMBA 4H7DA 4KWEA 1Q11A 1N7JA 4LYAA 4GDFA 4E13A 3EFOA 3S8MA 4M7PA 1CUWA 1CUBA 2OQVA 4DPLA 3QX7A 3FHLA 1YE8A 1C3OB 2B25A 1VE7A 4KE8A 4FX5A 4GYJA 2C29D 2ONCA 3VR2A 2Z08A 1H5UA 1PR3A 4YI3A 4BZZA 4HADA 3NWPA 3T4PA 5L4LA 3WMFA 2RBEA 1SU7A 3H5WA 4IIEA 4Q6WA 1TYDE 4TKVA 5I7SA 4CQJA 3BIOA 4TT3D 3STUA 1H2WA 1H69A 2GJ4A 5SV2A 1C9KA 2B20A 4UEJA 4N1AA 4UUPA 2VH2A 2VF7A 1UDWA 3C7DB 1DKLA 5FOTA 3Q3CA 4X1KB 2HDOA 2WI8A 1JLSA 3QKRB 1R0SA 1II9A 3HDQA 1W35A 4QQNA 1CUUA 3W6UA 2PUDA 1UCFA 2WSSD 1DIRA 1Z6PA 2JAPA 5JVDF 2BH9A 3IAAA 4JI7B 1L5YA 1XRLA 4JQYA 2JEZA 2LVBA 2HRRA 4JITA 3TR0A 4WZAA 5KAMA 1E59A 2Y1OA 2YQZA 3OCXA 4Q3DA 1IQPA 3RE1A 3HBFA 5HDBB 3EEBA 2Q46A 1JFFA 2WSLA 4XB2A 1YR8A 1JDBB 1U2EA 2F64A 2JIRA 3NDIA 2ZIZA 5TPWB 1KVRA 2PTHA 3TEMA 1LSSA 1U7TA 2ZAYA 4BLSA 2B0JA 5AVQA 4D8UA 2AD5A 4G5YA 3TM5A 3KJIA 3KPVA 1KBZA 5FBQB 5FTNA 3TTUA 4CT4B 4JXKA 2CNOA 5B5SA 2A3RA 2G3YA 2JHPA 4IV0A 1RCFA 4ZI3A 4L4XA 1RPAA 1N2OA 1MX1A 1VHQA 4NOMA 4WGFA 2BFWA 1U8XX 1NV9A 4WGGA 1N8KA 1QU3A 1PVVA 1IY0A 4N4AA 2PLWA 4N7MA 5DYIA 4HGYA 4B73A 4E6PA 3M4XA 1FSZA 5IFKA 3KKQA 5BQXA 4NDZA 4IIJA 1EAMA 5CXSA 2XVYA 2FEOA 1H0KA 4CQLA 4YT5A 4JP2A 1E2LA 4XLZA 2J32A 8ABPA 1ZRNA 3B52X 1T24A 3EZFA 3F73A 1OYVA 3RF7A 1BFKA 1KU0A 1R4AA 2PUTA 3ND9A 5IAAA 1JU4A 2QNRA 3L6OO 1YL6A 2O8DA 1KDRA 1L4YA 2C2KA 2ZOSA 2R48A 3M1LA 4UU7A 5EP1A 5F3WB 1JQJC 3R9WA 5HILA 4DJTA 1KS9A 4UKDA 3GGPA 2DHCA 1ULAA 2C0QA 3BGDA 4M0DA 2IXFA 1Y3BE 1CJVC 1KOLA 5K20A 2HDWA 3CLUC 3N1UA 3ZWPA 5HKBA 3G5TA 2CJFA 4Q7EA 1JEOA 5BQOA 2P9GA 1N7GA 4GMDA 3O91A 4CE6A 5C7LO 1SD2A 3CVVA 4JBHA 1CE8B 2ZBQA 3RUCA 3ADOA 5CA0A 5A2GA 4R5HA 1JEYA 1EE1A 4IW3B 4P4TA 1KS2A 2CK3A 2IIPA 5IVIA 2JFNA 2KBEA 1NI4B 1Z5NA 2W6MA 4IH9A 4QT0A 3KOZA 2B8WA 3MMNA 4K6KA 1N2GA 3O9MA 1Q15A 5JRDS 4U6SA 1AB6A 2OBBA 1MG5A 4ID3A 3QIVA 2AC2A 1J0AA 1H2HA 3PXDA 2ZRPA 2WEKA 3JVIA 1QH1B 1HGXA 3SXPA 5A2QA 2K6GA 3R0IA 4P83A 3TMAA 2WPDD 1YRWA 2IYPA 2IQIA 1UC9A 2EQBA 5DB4A 5CEJA 4MJXA 2WWWA 3LPNA 3N7UA 2VJDA 3PC7A 3RJ9A 3IE1A 2R2GA 3EB9A 4F2DA 3AIKA 4GKKB 2FEKA 1SCQA 3MJSA 8MHTA 3BGVA 3BE8A 1FFCA 3ZI7A 1NUAA 2QRUA 4NFYA 1NXWA 3ICCA 2IIQA 1VLVA 2Q6LA 2VATA 2XE7A 4GEGA 1DTEA 2G9NA 3OTHA 1AB5A 1TUGA 2EKBA 3IO5A 4IZHA 5CP8A 5B7PA 1AC5A 3H1FA 4FBLA 3SK0A 3Q8XB 1RPJA 4A0RA 1KVQA 3HLYA 4CUZA 3T0FA 2E4XA 1TEZA 1YL7A 5D1HA 4BNMA 3GMDA 4D5GA 2ZRJA 3O83A 3HB1A 1Z08A 1W73A 4B43A 4ZGGA 2QUZA 1KYQA 4XRRA 1GCAA 4KXVA 4MV9A 3I39X 3X2FA 3WLPA 4WBSA 4GVXA 4UBNA 5DI9A 4ZV4A 4Q5IA 1E1QD 1QFMA 1CR1A 1KAMA 2H57A 4KBGA 1X1RA 4D0LB 1TXGA 4H0FA 3A1EA 3WQSB 4F96A 3PPVA 1RHMA 1Y5IA 5K6AC 5KYNA 1U7ZA 2H4WA 1AS0A 3B13B 1G55A 1ZSYA 2OSBA 4NDNE 2P67A 1I3KA 3UGTA 5CA1B 2RHDA 2P9ZA 3IERA 4FFVA 4C89A 4CKBA 5CUQA 2ZZNA 1PT6A 2AFVA 5EIXA 3K1YA 4YREA 5JWRA 1GFSA 5IMSA 2R4UA 3AQ4A 3K92A 2O7NA 4MVXA 1Z0AA 3P9PA 4ZCMA 3DDWA 4OJTA 1YU9A 2GCEA 5ALXA 3E22B 4EUSA 2OXTA 4ND1A 3RO7A 4TXMA 1K7XB 4LIPD 4AECA 5KTKA 2BBTA 2BEUA 3SZRA 1U7XA 3R9IA 1EVIA 2W70A 3OX1A 3VXKA 2VNHA 4XQ9A 1G8AA 3KJXA 4KQKA 1GNPA 2BJWA 2X8BA 3E5NA 2X6TA 4G5QA 1ZN9A 3PHHA 3GJ7A 2WVJA 1C5KA 2FR8C 5K3CA 4D97A 5ABPA 2O7RA 1UR5A 3DW3X 1Q0TA 5JE8A 2XKAA 2CHFA 1CIPA 4BBJA 4OXRA 1KMCA 3Q9LA 4EWLA 1G3QA 2C2YA 4MO2A 1Q21A 1L5HA 3FLEA 5BR1A 5C1DA 5I8WA 2CF6A 2O5VA 2Z9CA 1Q50A 3H1BA 4Q3LA 1F12A 1I7LA 2W4MA 4WVFA 3ZPXA 3U62A 5EFOA 4J7CA 5FI0B 1ZICA 2FZKA 2OT3B 3JD0A 4MI3A 3IKVA 3WLEA 2Z98A 2C2WA 2E5WA 1FK8A 3NHYA 2JGJA 3KPYA 3O94A 2I34A 3OT1B 4LEIA 3ZWAA 4F2GA 5IHPA 1C3OA 1LDNA 1R4MB 2Z3WA 3P0FA 1RABA 1TW2A 3TLCA 3MIIA 4GPTA 3U3DA 3X2SA 3DVSX 1PGPA 1YSCA 1VPDA 3AKDA 3ZGVA 3CLTD 3U48A 1QF9A 1GRCA 2GF0A 4RIGA 2Q49A 3FFBA 3IDSA 4AXXA 5HQ3B 4RVNA 1USGA 3DGFC 2VRBA 4WOCA 2C7OA 4BY9E 3H97A 4KGZA 4GMHA 3REFA 3PC3A 2HF9A 4D6YA 4MUXA 4G5RA 1Q91A 4M60A 4WOBA 3EISA 3H6HA 5AHXA 2WTEA 5KTNA 4PLCA 3S7ZA 4Y6GB 3TTSA 1MW8X 4MYCA 3SBDA 2FYTA 1HUQA 4H4DA 2A78A 2R6HA 2ZBGA 2BEVB 3FZNA 4KO3S 4MKHA 3COVA 1VXOA 4AY3A 4B4UA 2VXYA 1RAIA 3ELDA 2NU7B 4A2WA 1FB5A 4FEEA 2VDOB 3U7IA 3R3ZA 2CHVA 4JVOA 4DIUA 1K7YA 5HBGA 4EYEA 1V43A 1FPMA 1R10A 3AJRA 3EULA 3FY4A 4IHJF 3NFRA 4W82A 1RP7A 5JFTA 4B34A 1YR6A 4AI6A 1KNQA 1KSJA 1JHMA 3ZZ1A 1Z06A 1A4XA 3B6ZA 4OGFA 2DFDA 3O3NB 1GRQA 1M8KA 1PR6A 2F1KA 1WTCA 3LK7A 3O03A 3P2EA 1RLUA 3SQMA 3NAZA 4W1SA 1SUPA 1V25A 3REGA 3RASA 2RG7A 1USWA 2P5YA 3ZCUA 4PRKA 1DZ3A 1QYWA 3M6LA 1QO9A 4Q66C 1I7PA 2DTXA 5FTKA 4AXBA 4XUEA 4W63A 3GUHA 3UFXA 1OY1A 3GEBA 1H2AS 5AXBA 3CUTA 4DLLA 5L51A 1Z7WA 2XCUA 3WYGA 3FMFA 2PBRA 3U7GA 2J7KA 1GGFA 3PS9A 4ER7A 2IKSA 2PGNA 3MELA 3BXGA 4KUHA 1WCYA 4HQFA 3I9V1 1D03A 3RYHB 4A8JA 1NWCA 3LSYA 4PICA 1T25A 1KXJA 4FFMA 2AF4C 1OLXB 3H84A 3MCZA 5K8VA 4LJLA 2YC2C 4PLPA 3C4QA 3VO8A 1I2ZA 2M1XA 1PX2A 1PO7A 4KN9S 3HV2A 3IBYA 3BTUA 3LUGA 2Q6IA 3GA0A 3OBIA 4LJAA 3I1YA 4IJVA 4FKZA 2H1CA 4TKUB 1OWLA 3EA5A 1B43A 3E82A 5LQNA 3GCWA 1TCCA 3NAMA 3ZZNA 4RX1A 2W7TA 2GD6A 2IRWA 1F2VA 3G5UA 3KT3A 4R3UC 2HMUA 3KKOA 3HR7A 3I1JA 4FZJA 2FAXA 4G1EB 4GSYA 2ZFUA 3AL3A 4KE9A 5EIWA 2WHPA 1OWOA 1PLLA 5FLKA 5JXIA 3QKRA 1UMBA 4TQGA 1IY9A 3MJCA 4FWBA 4QPCA 1ZH6A 2A14A 2ORED 5B7GA 1TAUA 3ANTA 2PMKA 4WX2B 2F3RA 2H63A 3CG4A 1A5TA 4R71A 2HMSA 2SHKA 4Z4FA 1B26A 1QRRA 3KL4A 2GZRA 4B85A 1EUZA 3EDYA 5F3DA 1NVMB 2GEBA 3QHPA 2DWQA 3JQBA 4WCFA 5ESWA 4E2ZA 4XQGA 2WMNB 1PZHA 3IIEA 4IWNA 1QG4A 3CNEA 1LB1B 3HBNA 3PF8A 3W8FA 1P73A 5JAPA 4NCBA 3G8YA 1P1KA 3CZAA 3L7JA 5JJ5A 3WGZA 3VHXA 1ISRA 1GKLA 1ZQ9A 3COZA 5C46F 4KRYA 5KVSA 3IAFA 2IUTA 3UWKA 2V3WA 1FC0A 5J1SB 2BZ1A 4FEAA 1FSPA 2VTEA 3I6BA 1OFGA 4W5OA 4FFNA 1XE3A 1ZH4A 2G5CA 5D5PA 2L42A 4WUTA 3KJQA 3VR3D 4LF6B 3TQQA 4FMCF 4PVDA 2JFGA 1EFRA 1G4UR 1YWGO 1MO5A 2C3OA 2II6A 2MSLA 2PV7A 4OATA 3C6ZA 3UWOA 4MRVA 1LSOA 2FH5B 4QUEA 1H6CA 2G06A 4RE5A 4HLNA 3S99A 5EQFA 2LR0A 3WLJA 3RC2A 3W04A 2H2WA 4HWGA 3H42B 3L8YA 2WQ6A 1IRIA 1CY0A 2ADOA 3H16A 4B6SA 1E9SA 4O2AB 1RQ7A 1ENZA 1EB8A 1CS4C 1LI5A 1V41E 3CZPA 4FUTA 1UFRA 4JQZA 2X7JA 1I3LA 3TZEA 4H18A 4B3BA 2ZM6B 4QDUA 2J46A 3VPDA 4J94A 1SH7A 2GASA 3AZQA 1NFQA 1FJHA 1ZPDA 2QE7A 3E7FA 3T54A 1TZCA 4QVIA 1CLEA 1GEEA 4KU4A 1ONNA 1UMKA 3R0ZA 3SHOA 1ADGA 4BS9A 2ONKA 5I7RA 3PNQA 3DE6X 1EBFA 5DNEA 4ALLA 4A92A 1AMUA 2IX3A 1U0TA 1VDZA 3TPZA 2FKNA 2BFCB 2AV6A 3H17A 2ZW9A 3ITKA 5EWMB 4EGCB 4QZVA 2O7VA 3DZGA 3ZW7A 4MK4A 4DWJA 4Q9NA 4RF2A 1D2RA 3I4CA 2UKDA 2FEWB 2Z8YM 4ZAFA 3IVXA 4F1KA 2NZWA 1NU8A 4D4HA 2P2LA 1FTQA 2QTFA 3GRRA 1QVWA 1Z73A 3OLYA 2HA7A 2Y0CA 4GUDA 1GTG1 2OOKA 1LTKA 4D80A 1ZIYA 2X76A 1H5NA 2DUMA 2OO3A 4OHFA 4LFCB 4D9IA 4M1TA 3EWSA 1YT5A 5HF5A 1WMEA 3UYLA 1L4FA 1WXQA 3VU8A 4XX0B 1S4QA 1QVVA 4B8YA 3IPAA 5FI5A 2GF9A 4NCKA 3N2GB 3GVPA 3WIOA 1G42A 1N2ZA 1Z36A 2FMKA 3REQB 5KX5A 3KZ1E 5ADWA 3IEMA 2FUG1 1XYGA 2VNAA 5IZ4A 1HKUA 1JQBA 1VRCA 4IRUB 4GLJA 3S28A 5FIUA 2FKAA 2H4YA 1WCXA 3LWBA 5CCEA 1CP2A 4CMEC 3IUSA 3U39A 3VUEA 3A6JA 1UK6A 1I4WA 3AHJA 4FFLA 2V5AA 2VDQB 3C7AA 5K99A 4HRAA 3WAGA 3FIUA 5K01A 5K3DA 1U3UA 2RH8A 1P2SA 2R8OA 3O8CA 2FEXA 3F3KA 3HYLA 2PU5A 3P9QA 1TU3A 3GEIA 4M37A 4YMSA 1ZL0A 3TB6A 2WWFA 1G9XA 3GF4A 4AJ9A 2XGGA 3GJSA 5CLFA 3A6LA 2QK4A 1PJQA 3RR2A 3ZQ6A 4DA9A 1TM5E 1TMYA 3AUJB 2OHGA 4G9GA 4DUPA 1O97D 1XDGA 3BWVA 2HK6A 3CLVA 4JNKA 2X0IA 3KVVA 1DB3A 2GEFA 1LZKA 1L4UA 3CRW1 4MVJF 4MZDA 3WL8A 4KCGA 3ZBQA 3C3BA 4LSGA 3REQA 4WBNF 1SUBA 3R5XA 1JIKA 3NONA 3E2MA 1BRTA 2W2MA 4I3FA 3PXGA 3FDFA 3BH7A 1J25A 3L4BC 2FZWA 2A8YA 1KJJA 1KPIA 4OLAA 2RB5A 4UHEA 4CM9D 1JKIA 2ECKA 4BVEA 5HF8A 3ORRA 2ATIA 3RYTC 5CFOA 4YRAA 3IPXA 5ITZB 2X9NA 1VKJA 1NF8A 2ZSJA 4M2LA 4Y6RA 3I6IA 6ABPA 5J2TA 5KJ6A 4PINA 1B3BA 2O6HA 3A1SA 4P3YA 3LBYA 3U7RA 4EY5A 4ZFNA 5DBHX 3CCFA 4AMBA 5CK5A 1O54A 3PR1A 1T5LA 4J7XA 4LHZA 1Z29A 5ALMA 5F7JA 3RANA 1FP4B 3WQQA 3O74A 5B2FA 1JHQA 3ETGA 1Z18A 4JI0B 4IDEA 2UZ3A 5LB2A 2ZJZA 1WDWB 2FETA 3T5MA 4NWIA 4FHCA 1E9FA 3LT2A 5JI2E 4D9BA 2BW0A 3CLSC 4Z7QB 5HS4A 3WBJA 4PZPA 2C9YA 1NVXQ 1C1XB 1EG2A 5H1YA 3G3EA 4XFDA 4LYJA 3KFVA 1L5WA 3PUWA 1TLLA 5LUBA 4CFSA 5ITSA 1WA5A 1XNHA 4MWSA 4TTIA 3KKKA 3PQFA 4N76A 1WB9A 1D2MA 4DLUA 1VL0A 4MW1A 1IBLB 1TZ2A 5ERYA 5AKHA 1TKCA 1U0SY 3EC2A 2YN4A 2GZDA 3L7YA 4ZI7F 4OREX 4LFAB 3SJZA 1J09A 3B51X 2QA5A 1G19A 3RUIA 1EDBA 4EW1A 1B8VA 2AOVA 4NOLA 5JI3E 3T34A 2ABWA 2GAFA 4RA6A 5I7UA 1BVHA 5K3FB 3B12A 1AQJA 4WHMA 3HB4X 2JBAB 1LU9A 2IU3A 3O7WA 5LP6A 2YYSA 1TA9A 3QVKA 4C05A 5IJXA 3F7NA 4UVIA 3ZGXA 5HX7A 1GTVA 4U7HA 4C2AA 3BWXA 2QP4A 2DRIA 1G3MA 3P2JA 1ZOLA 5TE9A 2BMEA 2QU8A 1M8JA 1Y3HA 3AINA 3BFXA 3EZ9A 3FMOB 3IP8A 4J07A 4QTZA 5AKXA 4G07A 2UUAB 1E6UA 4O2BA 4QQ8A 5E1BA 1DJMA 1CZRA 3IQHX 3Q7PA 2IUYA 4B1FA 1Y7IA 9LDTA 2FCRA 5K6RA 3ECSA 2FXVA 1JB9A 1THZA 3E7XA 3F6RA 4ZAZA 4TROA 2JGKA 4E30A 3TECE 3L7NA 4XAQA 1MP0A 1XI2A 2MINB 1ZL2A 4C2TA 4D3ZA 1PYGA 1I1NA 2NUTB 1WCV1 4EELA 2NNLD 2ZT6A 1U80A 4I5DA 2CXXA 4C0AC 2WJVA 2QX7A 4KQWA 2IV3A 3W6NA 3ZCSA 1ZCFA 4M8IA 4DE5A 5J4LA 3LUKA 1G5TA 3PVCA 3AFGA 2PKYX 4UREA 1GGJA 3CM0A 4ZVSA 2OZVA 3ABRB 1ZZGA 4LXUA 4XIYA 2FHPA 3GEPA 2FSVC 1BX0A 4DQVA 1N33B 1XTQA 2PX0A 2NVOA 4EFLA 3KK0A 4Z1MD 1QDUA 3A7DA 1MJGM 2IXGA 1G8YA 2XDYA 5CRIA 2PZFA 3T3GA 1LVGA 3KX2A 4DRZA 4WY5A 2HLPA 1FX1A 3GFQA 2V7XA 3V46A 3N0WA 2D5AA 5B37A 3SBOA 4EIWA 4PRLA 1XMJA 3PITA 5IRCD 2W2VA 3I1FA 3SZGA 3E3NA 1NZFA 5HQJA 1W5BA 2XA9A 1AU9A 3SE7A 3MC1A 3KS9A 1HQCA 1KH3A 4WJZA 3GMSA 1F5NA 5ALIA 2CXNA 4XYGA 4LN1A 1ISPA 1V7QA 1Z3CA 3LZCA 4U5QA 4ZO6A 3JD1A 1XQ9A 1Z3IX 1G21A 3IB6A 5G53C 2VHCA 4JASB 4QXMA 2RGEA 2XQJA 1WIWA 2BUBA 3N2GA 4IDOA 2NU9B 2Q1TA 3TINA 3ZGLA 4BLTA 5CIYA 2QM3A 1D4OA 3K5HA 1AGYA 3EFBA 3OFVA 4R5MA 4CYMA 3SDSA 3CCCA 4MUIA 4F6LA 1R74A 1Y6QA 4P4GA 1IQUA 2Y76A 2A0UA 3D2BA 4RTLA 4DDVA 3MERA 1CETA 5EJAA 2IFTA 4ZQHA 2OPBA 4DMFA 3ISTA 3V9PA 4DLKA 4ILKA 1MMFB 3PC8A 4JD5A 3VTFA 4M87A 4PO9A 4EA8A 4NJEA 3PI6A 4QJBA 1QJCA 2GETA 4QHTA 1FRQA 3UJBA 1D09A 2OGUA 2PT7A 3OZUA 4XWAA 4YBZA 5DX8A 3RS8A 2ESRA 3PZBA 4UNQA 1S0UA 3BYZA 4WV3A 1QX3A 2AFHB 2HTFA 1EGAA 4JT4A 4XH9B 3WISA 5F7XA 2RK3A 3FTDA 1JPUA 4MV6A 4OB8A 4O63O 5KCZA 3ETDA 2ZZMA 2BHTA 3R4CA 4AK9A 3OF3A 1RT9A 1WMFA 8GPBA 1R4NA 1YB5A 1T43A 5AI9A 4R3WA 3L18A 1M1NA 3MB5A 3UHPA 3BEDA 1KZGB 5CH8A 1UBLS 1RTKA 3K16A 4PIPA 3ROMA 2HHHB 3QEAZ 1XYYA 4F4HA 5ALVA 5JTTA 3ILYA 4WOJA 2OVBA 2ZZKA 1JUDA 3N59A 3O8LA 4BYMA 1BMDA 3SQOA 3O0TA 3TD9A 3L6RA 1P7CA 3N2ZB 3AM5A 5K1ZA 5JEEA 4BCDA 1ODIA 3U7FB 3ZD7A 2C9DA 1SVIA 2RGNC 5JNWA 3WK4A 4AF6A 1ZC4A 5TMDA 1Z4NA 1LBTA 3R6DA 1UWCA 2EBWA 4LSWA 5B1YA 1WXGA 2P9CA 3DW1X 3MYRA 3MRTA 3PE3A 1L5LA 3ZUGA 5I7FA 3LQ2A 2BM8A 4S24A 3D64A 1PK8A 4RENA 1A72A 3TOZA 3QOWA 3UM9A 2B5WA 3BRCA 5AW4A 1I10A 2HQOA 4HG2A 1XR3A 4WXYB 1ZKMA 1X1QA 1VP9A 4CUJA 1M67A 1QYCA 3ZDRA 2PQ2A 4V3BA 1Y8AA 3LPAA 5DOZA 3NVMB 3GFSA 1KDTA 1MQ9A 3HN2A 2QPTA 4GH5A 2QJWA 5H02A 2YFHA 3LIIA 3VZSA 4B3DA 4FYXA 3ETHA 2HWKA 1CQIB 5ESXA 3V1KA 4BIMA 5TJ9A 1RI2A 2QZSA 16PKA 2XB8A 4LJ8A 2BFPA 2P79A 3RAJA 1RXVA 1P74A 3CMMA 1DWUA 1XL1A 2PHZA 3DO5A 2V7UA 4U39A 4ILEA 1YDHA 2J5XA 2LTAA 3IAM6 3M2PA 3R5HA 4TLMB 3SX4A 5I4IA 1OTHA 1T1IA 3PFIA 4IFEA 3EXHA 2YVAA 1J4AA 2NXJA 1XF9A 2RJOA 1YKFA 3MA0A 3OMWA 4JS0A 4PZLA 2GLUA 4QOEA 4UMEA 1KMIY 4Y9DA 2GCNA 2NQ8A 1A9TA 3N53A 3URKA 4BQQA 1KE1A 3B1VA 4ESOA 3BK1A 5DLYA 4RTSA 4MRSA 4QTXA 3CF6R 2JFHA 3L0IB 4P0QB 3U3KA 1Q7CA 1X3SA 2O3SA 2CB9A 4WH0A 3PUZA 3EPRA 3K0EA 1YF3A 3B3GA 5C3UA 4I14A 2D74A 5I7AA 1GTL1 1I7DA 1XNQB 4HQ0A 4KQEA 5EHQA 4MO9A 3D1JA 1Q7BA 4Z4GA 4I4TB 4Q19A 4R8KA 1QE0A 4LTMA 1QRUA 5FNVA 2AOUA 3IOMA 1VI5A 3L8ZA 1MIHA 3DAHA 5TJHA 3VPHA 3OLWA 1GFWA 3MG9A 3WLAA 3G5LA 5DCWA 1Y6JA 2D0PB 4JU8A 1JT2A 1EWQA 4DBZA 5A4DA 2PR2A 4IZIA 2QPAA 5BVGA 4F91B 4ARBA 3WS7A 1TUBB 2FPRA 5LXTA 3TS1A 4PR0A 5EZ5A 3SQWA 2HWUA 2V3CC 4FI3C 1XEXA 4GPZA 3B1JA 1BA3A 2GTHA 2KM1A 3FCXA 3CT6A 3N76A 1AZLA 4OU4A 4QYXA 3OQOA 3O8NA 1JXMA 2UZAA 1R0KA 3BRWA 1NVVQ 5HGJA 2DH5A 2VJQA 2XT0A 4JJ6A 3BT7A 1IG3A 1WZ2A 4DC0A 5A02A 1DAHA 1F38A 1I3NA 3OVMA 2X9LA 4JNCA 5LD2C 1E1LA 1U2GC 3N86A 2CFRA 2EFEB 2GZAA 2XI4A 1OFUA 1X7HA 1S9HA 3AUXA 4UTXA 4YQZA 4C6TA 1CQPA 1P33A 4QTUB 3IQZA 3TLYA 4Q03A 3CZ9A 2GA9A 1Y1TA 2IYOA 4R9SA 4RGQA 3PFCA 3RYCA 3ZNOA 1QIMA 2M9MA 2ZTSA 4MI9A 4BC0A 1IY1A 2QPOA 4AZ3A 4C20A 3KT0A 3WFJA 1PFQA 3CXUA 1AXEA 1XTZA 5EE0A 1DX4A 4DB2A 2QT1A 1T3TA 2PO5A 2XF2A 2YW2A 4QO8A 1NJFA 1N3YA 1HDEA 3LY9A 2PBFA 5B58T 1OF1A 3SLKA 4BLUA 1ODFA 3SOPA 4H59A 2NT4A 3J81A 1WULS 4RK5A 3V1LA 1G0OA 4HTFB 4LSMA 4DCTA 1TO2E 2GD0A 2MYPA 3AM4A 4GVPA 4QQFA 1E1DA 1TUBA 2CUKA 3G49A 3Q6NA 4Q21A 4RADA 1T3HA 2ARKA 3AU9A 3HPQA 3NVKI 1O6ZA 3IUEA 4HPXB 2JLRA 3T7EA 1LPAB 4U8GA 4C07A 4QASA 6ADHA 5LOVB 3GLIE 4AJ4A 2AWNA 1TADA 4BMVA 2FVXA 1XYVA 3OSUA 4XWGA 4PYMA 2IOFA 4YASA 3AEUB 1XXLA 4MS3A 1G5HA 2FUCA 4UE3S 4ROTA 2ISQA 4REOA 4Q6BA 2A67A 5T4HA 2XRMA 4I55A 4FQ8A 1K97A 1LV7A 3DONA 3L04A 1T8WA 4UHJA 3KB8A 5DMHA 2Q4RA 5AR1A 1SCKA 4RORA 3II6X 4LZJA 3EZ7A 2ZUVA 5C52B 2BEKA 3GPIA 3VI4B 2QAGA 4FDUA 1JIUA 1HE8B 4DV1B 3AUYA 3F71A 3RVOA 3LL4A 1YZKA 4RFSB 1HEUA 2GYYA 4FR5A 4EH1A 2XB2A 4YCMA 1KI1A 5C9ZA 2R5NA 4C29A 2F6RA 5A3JA 4OBWA 4C21A 4EZBA 5JZOA 4LCBA 1R3UA 5FUWA 1FTNA 4L9RA 1DJPA 2I8AA 3AKCA 2P5SA 5WRFA 1L5KA 2FPIA 5DHQA 4R2MA 4S04A 4TUYB 4RJKA 4FS3A 4P2GA 2C20A 1N2XA 3KXPA 4LPKA 2D1YA 4F4CA 2C1EA 1RQGA 1NJ5A 1XVUA 5EXPA 3SVZA 5CDFA 2WJ3A 4OQEA 5B55A 5BR4A 3FGPA 5TLSA 1IONA 1J90A 2FZLA 1XB2A 2GK6A 3IJEB 3P4UA 4IL5A 4MPDA 1MGOA 5EP4A 3JZDA 3BMNA 2JH9A 3PC8C 3WGVA 4UBKA 2C2ZA 3M3DA 3HUEA 5T64A 5FLEX 4L8FA 1QB8A 4ZHQB 3NETA 3W1VA 4UJ3A 5JDIA 2EYUA 4BQIA 1ZOSA 4KMOA 2UYGA 2BZSA 4TS1A 1U1IA 1G2OA 4G1UC 5JBQA 1A1VA 4WLEA 5AM4A 3I04M 1HXHA 2V7QD 4EF4A 5AM3A 1XVTA 1YVEI 2OZLA 1EM8A 4UNIA 3ZEIA 3N8HA 3ETLA 3K5WA 4IDFA 2G5TA 4B45A 2NAFA 3WA6A 4IZ6A 2JCSA 1N0VC 4XARA 3JAKA 4A0SA 4RLQA 1M72A 2R7AA 1KYYA 1YGYA 1EAYA 2F8LA 3IIJA 3QUTA 2HWWA 2G80A 2BEJA 4NRDA 3VU3A 3W05A 3JQPA 2YX1A 1Y3CE 2ZIUB 5EE9A 4WXEA 5A5EA 1KR2A 2FZVA 1GDTA 4N6NA 2QAGC 5ANRB 1Z4MA 5BN3A 2VDPB 1MNAA 1JWAB 3NBYC 1RWWA 5EXXA 3RVMA 3WRYA 4EVSA 5JJKA 5IJAA 3E9CA 5LQJA 3WLIA 3R24A 4FINA 1TC1A 1B6SA 2F9FA 3NUGA 1J9ZA 2X0JA 3BIWA 1XD8A 2P9HA 4GO1A 4OK5A 2QS9A 3AETB 1M2EA 4DPMA 5FWNA 3AKEA 2SNIE 2FR8A 5FB3A 2QV7A 1ZD8A 3IXLA 4KHPB 1XZNA 2FN9A 2FG6C 3UT6A 3VKWA 2O8FB 4ASUA 2HXSA 4WECA 4GRIA 1N5RA 3DBOB 4KGXA 4GQIA 1F8YA 1SCAA 3S7TA 3CNNA 3DZIA 4KLRA 1F3OA 2W8BB 4HDCA 4E5PA 3NTQA 3AVPA 3LVBA 2F48A 2ZDQA 3F98A 4E4RA 4FBMA 1EJ6A 1O9BA 3ZE6A 3QWBA 2ZAIA 4IQ4A 4AS3A 3SFTA 1O6CA 1PJCA 3R9KA 1GVHA 3JAKB 3PQCA 4LA4A 4LVUA 1BHJA 3AZOA 4C7OA 4ZV7A 4PC1A 3E7WA 3TXAA 2J0VA 1OX6A 4WSOA 4P0TA 3C1OA 1KMHA 3GRZA 4ZGBA 2AFIB 1U7DA 5CW2A 3T7RA 4HLDA 3VO1A 3RK1A 4YV7A 3CVWA 3ZJVA 4OOFA 1RAHA 4KQGA 4GMFA 3IAS1 2BBWA 3EIOA 2CXSA 3N74A 4KWHA 5IKMA 3P9KA 1VSUA 1WEHA 2HKIA 3A4TA 1Z2EA 4GAEA 4PQFA 4PO3X 1YRBA 2XT9A 4BO6A 5HK9A 1Z5WA 4X1OA 3W2EA 4C6HA 2JFQA 1T0UA 1EIZA 4KMMA 4MDEA 4IIUA 1V96A 3PGKA 4GI1A 3HRIA 4UM7A 4QDOA 4HH3C 4ZCSA 2ACWA 2O8FA 4Q9AA 4NR0A 2DLCX 2QD2A 3ONFA 3I3SR 5AM5A 3TW6A 2FQ1A 1IEWA 2UUPA 4KE6A 1BXZA 1SO8A 3FZGA 4PAOA 4ZYVA 3GZTB 2UVPA 3UV6A 2JAUA 3KB2A 4FGWA 1CJBA 3CZQA 3HY6A 2LDBA 4R2IA 3QI2A 3F2IA 1B16A 2WT8A 4PGHA 2VRCD 4K1XA 2M6KA 1DDGA 4D8YA 1U1EA 3KZOA 2QDXA 3P9NA 5C1OA 5K8TA 1JL3A 3UJNA 4J29A 3LRXA 2VRNA 4WW0A 1RAEA 3PDHA 3ZIUA 4BNJA 1RM3A 1Q44A 5P8WA 2G5GX 1GYPA 4BVBA 5IF3A 3L41A 1HA3A 3DUFB 5CT9A 2C3PA 1AZSC 4YTEA 3BUSA 4A03A 3LX6A 3RIXA 2DR0A 1JQ3A 721PA 3I53A 3NP7A 3RVNA 5KX5B 1XXHB 2VJKA 5GADl 1KA9H 3GLGA 4MJ3A 1SHLA 3A6FA 3F3YA 4LXQA 3L7DA 4RZIA 4QFBA 4ZI7B 2O52A 1IXSB 1TTHA 2B21A 2Q9CA 1XAIA 3VNAA 3KOXA 3ZVLA 1JTVA 5B6PA 4AKSA 4CNBA 2JH8A 3RPEA 1I94B 2GN0A 1Q2UA 2EWVA 2YMQA 4HNVA 3O26A 3OZSA 1W1WA 5C0OE 3T99A 1ZR2A 3FDJA 3G9QA 3QXGA 1Y1RA 1LPSA 4ICIA 4RVCA 1CPYA 2DCMA 3INTA 2PL3A 2W6OA 4IQGA 4I3HA 2WR8A 3P8ZA 1L7NA 1KZ7B 4OBBA 1G5RA 3SC4A 2QW0X 1A1SA 3UVEA 4RHTA 3RJMA 4C4AA 3ITEA 1NMSA 3D54D 4R1QA 5IJZA 4U9IS 5ICEA 3FTFA 1K6XA 3IQFA 4ZAXA 4MJ7A 1U3TA 3MSXA 1UJ5A 2OXEA 4CMIB 1LJ8A 2XKKA 5TS3A 1WB4A 5I9TA 5I7WA 1HE4A 4D4IA 2D2VA 3D3WB 1TL7C 2VXCA 2NO6A 5ER9A 1KPGA 1YRAA 4M98A 2V7VA 4MKRA 1PEAA 2EFYA 3KO8A 4YP6A 3P96A 2XMCA 3KKPA 4UM9D 1QONA 2OP0A 2Y0DA 3JW8A 1L5NA 3RQSA 2QUAA 3EJ6A 3SHWA 3D4NA 3JRWA 1YZQA 2O0HA 5CVJA 4YCAA 3P2IA 2WF7A 4YUXA 5FADA 5C2JB 5SZIA 4D44A 2GA8A 1CJTC 2IYYA 5DCYA 2QNBA 3G2JA 5DSZA 3BSSA 2BGRA 3FYUA 1B7GO 1TO6A 5TF4A 2AZTA 1LNQA 1GGVA 4KP7A 3OLZA 4LC0A 1OXMA 2EKZA 5FPSA 2DAPA 4JBXA 2HLHA 2ORIA 3ODPA 4PXAA 4N40A 1U9IC 3SEAA 3TG8A 3MRSA 4IJQA 4QJ3A 1BWPA 4LNUB 4O4JF 3O6VA 2PGLA 1N5IA 4QYIB 1Y5LA 3LJKA 4KQ9A 4NZNA 2R6ZA 3MWDA 3TOXA 2FUEA 2C7BA 1O87A 2ZRFA 3AI7A 3O1LA 3T7SA 4U7DA 3KQNA 2WHEA 3INGA 3QXCA 1RJWA 1KEKA 1JAHA 1FFGA 3U09A 4EYGA 4OMUA 2PMFA 4IQ0A 1NIPA 3T0IA 5EJGA 4GWKA 1XD2A 1BE1A 4BYGA 4MW5A 1SR8A 2AT1A 2GAIA 1SOWA 4BIIA 2C1ZA 1N9GB 3WWYA 3UJHA 2QPLA 3ND7A 1MOPA 1YJ5A 1ZG3A 2DBRA 3COWA 3IQDB 3E81A 1LNSA 4G0XA 1W9MA 4L3OA 5JNRA 4PO8A 3OICA 2XUKA 3MB8A 4JP3A 5LC1A 2F8TA 3FZYA 3H8JA 3PRHA 4I1OA 4OLFA 3B8EA 4EGSA 3DWGA 3GJYA 2XKJE 4WKCA 1LBQA 2VCYA 4F7WA 2HADA 3WGMA 3U31A 5FAKA 4Y0NA 3AR6A 4LG1A 2ZREA 2D1SA 1WG8A 3OESA 1JR3A 2WM3A 4G0MA 1DTSA 4II7A 4KNWA 3WWOA 4AW9A 4CIBA 1FZTA 4II3A 2BZGA 5IUJC 3W5CA 3RC8A 2HDHA 4CT0A 4GLFA 4RV9A 5EMHA 3RSCA 1XQYA 1VGVA 1NVGA 4ND8A 3KKNA 3F67A 2QUHA 3WBFA 3WLNA 5JATA 4L0MA 4AY5A 1FFXA 3X0DA 4FPXA 3EGCA 3FOCA 1R12A 3H86A 3IBGA 4PPQA 3LWZA 2FSGA 3KB1A 4KKXB 4Q47A 4ZKEA 4CLXA 3KEGA 5DLQC 5JS7A 2Z8ZA 1T2FA 1ESCA 4XIGS 4AZSA 2E9SA 2CC2A 3UYKA 2KMLA 1SB8A 4LXYA 3KHTA 4W5HA 2AX3A 1YK0A 421PA 1VG0B 2ILTA 4HWTA 5TB5A 4F38A 3TM4A 2KHZA 3M6AA 1X70A 4PR3A 3SAJA 5EHXA 5TMPA 1J99A 2H2DA 2PCLA 3A1NA 3ELWA 5JS8A 2FTKE 3EIQA 3N8DA 5FWXA 3PWZA 4UEQA 5IH7A 4RPJA 4F5ZA 2E4WA 1T4BA 2I6XA 3ND5A 1CUVA 1NRWA 3WOHA 4AJPA 4TN5A 4XX1A 5KOIA 4AJIA 1K2VN 3LBHA 1NJ2A 1ZNXA 2A6PA 4UATA 2PYDA 3FYCA 3T9DA 2R1UA 3TNJA 2YNMA 3MGGA 4Z2AA 2OXCA 3KJNA 2P3SA 5DM0A 4RDHA 2J85A 1WWKA 1WXWA 3FCYA 3OWOA 3WV5A 4F4JA 1P72A 2I4IA 4AJHA 2VHQA 4ZOBA 3ICQB 4J8PA 1PQ4A 2QE6A 3KV3O 2OCDA 2ZVJA 3CIOA 2C88A 3JQ8B 4MW7A 3VDNB 3TGLA 1UBHS 2FDXA 2PX3A 3W6ZA 4TYPA 2W6JA 3N7TA 1O94C 2C8KA 3C6QA 3LGAA 4IIYA 4W6QA 1I14A 4HDRB 2MWMA 4HC4A 4LOKA 2PANA 5IJWA 4PGGA 3U13A 5AHKA 3CE9A 3A4LA 4KIJA 4MVJM 5TMEA 4M7OA 2ID7A 4JLDA 1YS6A 4OKIA 3WIVA 1X7YA 2PSHA 4TSRA 3VX3A 3ZLUA 4NOJA 1LNZA 3CPHA 1KYZA 1TF7A 3AMVA 4KB5A 4UMFA 4GOOD 3C3AA 3S2YA 4YMUA 1WMBA 4H08A 1OLSA 4OXNA 2OQIA 3B9BA 1E32A 1XDUA 1MAHA 1VIMA 3UCFA 1CZLA 2PT6A 3EUWA 3KOWA 3PPIA 1QFSA 1O0SA 1ZRSA 3V7WA 3T1TA 1E2PA 1GQSA 3JSAA 4GC9A 3ZEAA 4V2IA 1J5XA 1ZUNA 4R6XA 4BLQA 2Z3VA 3LP5A 2FPGA 2V6GA 2V03A 2WDZA 3VR0A 3PL1A 3H2BA 4LE1A 1UMCB 3PNPA 5F5LA 1NDQA 1NJ1A 3PT9A 5CDYA 2I2BA 1TAQA 2GUGA 3BTSA 1QPGA 2ZETA 4F5WA 3KAKA 4GI7A 2Q5HA 3QKWA 3MQ2A 4RLHA 1Z6YA 4H7HA 4GI3A 3BA1A 3DO6A 4DV4B 1Z68A 5DHFA 5E6RB 3HE3A 4BE9A 1U0JA 1UFQA 3SS8A 2J7PD 1P62B 2JL1A 2UZ0A 2QENA 2NVBA 3D8SA 2DPMA 3LLVA 1SCJA 2AN9A 1Z26A 2EXXA 2VZ0A 3E03A 3X43A 4AP6A 4DQUA 4HAUA 3EBOA 2X2EA 1D1TA 4DA0A 4DJFC 2NLOA 1FFHA 1LI7A 1RYHA 2XMPA 1P0CA 3OJ0A 2GEKA 3GJRA 4RVSA 5LCXA 1NW7A 2WF8A 3WYBA 4ENVA 4KVGA 4CV3A 3E53A 3N8IA 4DN6A 2VRCA 1CB0A 1R50A 2XMSA 2Y1WA 3ROXA 3TQFA 4ABYA 3GLFB 2ORVA 4OA8A 3STXA 3WJ1A 5JARA 5LQCA 3ZYCA 1RXCA 3FYSA 3JARA 5CYOA 5JO0A 5D86A 4ESEA 1NVTA 2QL9A 3FROA 1JA9A 1R6XA 4KRGA 2PD6A 1QHEA 4H1UA 1CNMA 1VHWA 2TSYB 1ZIOA 3OIFA 3BJEA 3HWRA 3A4IA 3TQIA 4HX2A 3IEIA 1SU6A 2OFOA 1N1GA 3ZBPA 4BO9A 3DOFA 4YS6A 2EG9A 4C4SA 5IUKC 3W7AA 5CFPA 1R3DA 2G1KA 1PG0A 4TS4A 3TBKA 1X38A 3Q40A 1QTIA 3QE0A 1H2FA 4BNDB 2MJLA 5JAZA 3DOIA 9MHTA 1BQ4A 3FPSA 3BHIA 3TI7A 3GQBB 3A3PA 2GX6A 5AI4A 4QPPA 4YMIA 4BB5A 1W581 4UJ5A 4TZTA 1N6LA 1IOLA 4L6AA 1JHOA 1PR9A 2H0AA 3IO3A 3L7CA 1FMCA 1MC8A 4XUDA 4A16A 4Y1GA 3F96A 1A2OA 1EVKA 1Y82A 3VBCA 5ILQA 5E6UB 1D1SA 4RGVA 2NNWB 1XV5A 3K2EA 3DQPA 3OP1A 4EJSA 1IZYA 3H6GA 1G7TA 2F1OA 2G0TA 3FNHA 4C7VA 5IWAB 1F9EA 4KQCA 1PSZA 3C6BA 4IWXA 1K89A 2X22A 4YMHA 4NV3A 5LB4A 3TW8A 1Y4DE 2VPZA 4WKOA 2VNIA 1XU7A 2HYDA 4WBXC 4OSPA 2EJVA 1G17A 3PUKA 4G24A 4NKRA 4PVCA 1DCTA 4AQDA 5KNBH 3DMGA 4ZPJA 4RWEA 1JG7A 5JMWA 1ZH2A 5DYTA 4QG3A 3C6KA 2O2SA 1E7RA 1F7VA 3DBRA 1KK3A 3PXCX 3WJ2A 2J4DA 4FM9A 1REQB 1JVSA 1XZJA 1IZ9A 1O6FA 5SZHB 4X1IA 1RQLA 4PC7A 4JZKA 1YOVB 4WL0A 3H9GA 1VFNA 4UD2A 1L7XA 4RKFA 3GJZA 2ZM5A 1SCNE 1U7PA 2I2WA 2XQKA 3RKRA 3PT5A 1PFKA 3EG9A 4KE7A 1N2SA 4MWGA 4PZAA 3PJDA 1KZ1A 4MHTA 2EDAA 1XALA 4BUJA 3WNCA 2I2AA 3QLUC 1NJ8A 2BOVA 1HQKA 4KI0A 2FF7A 2HH9A 1L1FA 4IIJB 4IG9A 1GCIA 3BSWA 1GTMA 1IFXA 1YMVA 4OBXA 3WK6A 4ZDIA 4HP8A 1W5TA 1XDDA 3EDOA 3MWDB 2GOYA 4XJXA 3RTCA 4BGDA 4IX1A 4N18A 1GDDA 5F12A 2QZZA 4E70A 2GDJA 4C4YA 2GILA 4RHXA 5CLQA 3B3JA 3W1WA 4WN3A 1KVSA 3CX8A 3PD1A 3GFTA 1LLUA 4IDBA 4M38A 2C8VA 1N5OX 3T6KA 4ZVVA 3X1JA 1KIMA 1NW3A 2VTVA 1G7RA 1KAEA 2GO7A 1VYHA 1E0DA 2G8NA 1SVWA 1XEWY 1P7VA 1NKVA 2OOSA 2R7MA 5DISB 4RH0A 5GMOA 1SQ6A 4HUQB 5K8LA 2VZ8A 3R3VA 5J23A 1HE5A 2FE1A 5JD4A 4YJFA 3CW9A 2XQIA 3TDMA 2NZUG 1GZVA 4G67A 3GT7A 2QROA 1KY3A 4Z7NB 1NUQA 2PLRA 3UG6A 4LHYA 1P7WA 1QORA 1POWA 3GEDA 4CMHA 1XLUA 3N0TA 3QEMB 3PEYA 1LDBA 3NHRA 4DR4B 1S6YA 2A9VA 3AILA 5JJCA 2YOFA 5CDUA 1UPTA 1RM5A 3U0BA 4YCLA 3LI2A 4NHEA 3C5VA 4V0LA 3J81k 5HJ7A 2C78A 3DHEA 5E9AA 3VAYA 3DHVA 1M2NA 1UDBA 5AHWA 3SSMA 1F0KA 1QQ5A 4B47A 1WR8A 4CL2A 5ES3A 3OZEA 3WP1B 1H0HA 4UUBA 5J5CA 1IIRA 3HEBA 1G21E 2VH5R 1WQ1R 2VAPA 3MAGA 1TK9A 2XXJA 3TL3A 4CG2A 2YWJA 1XRJA 1KWGA 4N0EA 1JEYB 3X3HA 4WEQA 2PCJA 3E8MA 4HNRA 4BNWA 5K8JB 2B4RO 4OKNA 4X63A 1YH3A 1M2VA 3F8TA 2V96A 4FNGA 1E1CB 1KO4A 2JGNA 1VPLA 2ETXA 3IP9A 1RC0A 1UINA 4YA6A 5EERA 4ZAVA 1EWRA 4QNMA 4X94A 5HFAA 3WDSA 3IVAA 5ALGA 3ZWOA 1RKQA 2YCBA 3BQMB 1JIXA 3NRBA 3GFBA 1YB7A 4F5EA 2V6IA 2WD7A 4LNAA 3CH4B 3GV0A 3ONWA 4GSKA 4AP5A 5KSZA 1Y7PA 5DKFA 3QVOA 1P3JA 4GUAA 5KNDH 1CLUA 3JZIA 2UXDB 5ITZA 4BZWA 4URVR 1F4VA 2IVZA 4QVGA 1KEZA 2XQVA 1DO0A 3DTVB 4LSZA 2C61A 3AR5A 1KRHA 4HVAA 1RIFA 1O5IA 3PX2A 4FLMA 4RHFA 2GPTA 4GU5A 4XEUA 1KI6A 3VPXA 5HWSA 1ZD9A 3QBJA 4FXPA 4GI5A 5F5XA 3V8RA 5TIIA 3KV1A 4XGQA 3VH2A 3I9OA 4HUTA 3JQEA 1T5DX 3AM3A 3OTOB 1DVRA 1ZGBA 4K86A 1PLJA 4GBED 4FCWA 2TYSB 2EZUA 2I5PO 3E8SA 4PAWA 4R0VA 4ROSA 4UFNA 3KOOA 3CUYA 3S4YA 2YV5A 2ONJA 2VS1A 3T15A 5BR7A 3MCWA 1J1UA 2RHOA 1HOXA 3MWYW 3PFKA 4EL0A 1XZDA 1NNEA 2EG5A 2HJRA 1OZGA 4CQMA 1YULA 1L7MA 4DOMA 4RCVA 1C3LA 4CTOA 1IOZA 2KW5A 3GLSA 1J9GA 2C83A 2QWXA 2OK7A 3AXTA 4PLHA 1CEEA 3QKSB 1Q1ZA 4PG7A 1DJQA 1ECGA 1VSVA 1NA5A 3ZTYA 5L3SB 3GVHA 1Z9BA 13PKA 1Q0QA 2IS6A 1Y9AA 1ECPA 5TS2A 1X8JA 4S1TA 2QM7A 4W8HA 1FU4A 2HREA 2V7WA 2EKPA 2R1TB 3L43A 5DHUA 5ALUA 3U9LA 3ZW8A 2JLZA 1AGRA 3KCNA 4KPEC 3KYJB 2EFCB 4U2KA 4CTJA 4WFJA 4L6CA 4POAA 3DSRA 3QKSA 3WKDA 5I9IA 4D92A 1ISGA 4EPYA 1JTEA 3HYSA 4NULA 5ICGA 3DV0A 4Q24A 4L2IA 2FPUA 3RI3A 3WK9A 2RGXA 4AJJA 4JLJA 5FBKA 3DYIA 4LDAA 4H7FA 4D0RA 3L40A 3R7WA 3RYFB 5GJBA 2W2LD 1SQ0A 4KQMA 5B7NA 3R2JA 3UB4A 1GP2A 1P5JA 4FWTA 1EFAA 1NDHA 5ALJA 1EFVA 1MQ8B 4GW3A 5D84A 2LPMA 3ER9A 1U7UA 4XVCA 5CNJA 1ZDMA 4KYIB 2HI0A 2C9BA 3VR5H 1XO1A 3S8EA 4C4TA 4JLMA 1O9HA 2VHTA 3KG2A 2CXUA 1QH0A 3I8OA 3LG2A 4KXXA 5EXEA 1QCCA 2DU8A 2MYNA 2NADA 2D1FA 3AR2A 2QDKA 1AKQA 1Z6XA 3I05A 1IRXA 3IOEA 1A5BB 4XGKA 1SVSA 3RRYA 1E99A 2GI4A 3OQVA 2PUHA 1AHNA 1PEDA 1E9AA 1YIAA 1ZUIA 4JSTA 1X80B 1Z74A 2DH6A 4JVLA 4B3FX 4DABA 1AGNA 3AVXA 3NDJA 1II8A 1RSZA 3U49A 4IYJA 2FJPA 3IPRA 3E3AA 4K81B 4LV8B 4OSEA 4XKJA 2QRPA 4NDAA 3W77A 1N5MA 2PLAA 2HUPA 1R5JA 1ARZA 1YDMA 2Q2OA 3RIEA 2VHZA 1WCIA 1P1HA 4JIMA 2I6GA 1WP9A 3QRWA 3WG9A 2IBTA 1U9IA 2DPGA 1BW9B 3LF2A 4J2TA 5K4AA 2R62A 3QH4A 4B7AA 1ZVMA 1U5BB 2VP0A 3D2LA 4CMK