3RAFC

Quinazolinedione-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibitor-stabilised cleavage complexes of topoisomerase IIa: structural analysis of drug-dependent inter- and intramolecular interactions
rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/antibiotic
molecule keywords DNA topoisomerase 4 subunit A
total genus 59
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rafC00
4G0UA 4I3HA 4KPEC 4Z4QA 2XCSB 1BJTA 4G0WA 3LTNC 2XCQA 3KSAC 4J3NA 3K9FC 2RGRA 4KPFC 1BGWA 2XKJE 5EIXA 3L4JA 3RAEC 2XCTB 2XKKA 4FM9A 3RAFC 3FOFC 4Z3OA 4G0VA 3FOEC 3KSBC 3L4KA 4Z53A 2XCOA 3RADC 2XCRB 3QX3A 4KOEC
chains in the Genus database with same CATH superfamily
3IMEA 1Z4JA 3UF0A 3QWIA 2I2BA 4ZVNA 4XTCS 5CDFE 5HF5A 5TC4A 1N5RA 2YNMD 3IDFA 4EKIA 4EITA 3U56A 3PDCA 2G1PA 2QVXX 4R7GA 4OB6A 4AYXA 4RC9A 3A3PA 3D8NA 2DAPA 3NHWA 3RVKA 3SLGA 2WSMA 3ENNA 1KJYA 1EQUA 3D9QX 4EHAA 3BSSA 5CLQA 1Q0UA 3OPQA 3L49A 2FX2A 3FSGA 2W8BA 3H1AA 5F1KA 3GRCA 3I9V6 2C61A 1TZMA 4ND8B 1EFRA 2GZDA 1T9HA 4OKIA 4Z9YA 5JO9A 5CNMA 4RPGA 2FRXA 1WJGA 1GZSA 4GPBA 3TLKA 2C03A 2Z4RA 4EB3A 3L06A 4KQ2A 4QBKA 2HJHA 4GSYA 2H29A 4G0WA 1D9ZA 5AVXA 1TU3A 5HSGA 1SU4A 2CMHA 4KGXA 4M1YA 2LZ0A 2BTOA 2F8MA 3IOYA 3MUNA 4CTMA 4KN5A 4CLRB 4MR8B 2ZZKA 1ZK1A 3IT1A 2GAJA 1JHAA 1CP2A 3AHHA 1WXWA 3KEMA 4YAOA 4DLXA 2OO5A 3NC1C 4C4YA 2C7VA 2HPHA 1N8KA 2MSKA 4Q4HA 3CZAA 3D3QA 2P8SA 3W5AA 4MS1A 1EPUA 2R47A 3H2BA 3TLGA 4HFMA 1YQ9A 4K9KA 1GTMA 4MWBA 4TTIA 4C9BA 5HQJA 1LV8A 2WP0A 3QZUA 4EMTA 3BZWA 1MC1A 3TGPA 2CSXA 3WQBA 2FETA 3IR7A 5EQJB 2R85A 1EB9A 3AEKB 4BNGA 2F8TA 4QGBA 5DI9A 4LX8A 1SKAA 3ZE9A 2NWQA 1IBLB 1ZM7A 5TQJA 3VDRA 5JSZB 2BFFB 2QJRA 2WJZB 1IH8A 1TW3A 2IIQA 5DWQA 4EVRA 4KB5A 5EMHA 3WJ1A 3KDSE 3COPA 4AS1A 5EHQA 1PK8A 5GJWC 2FN3A 3I76A 4ZKEA 3WSWA 3U4QB 3HJGA 2UVQA 4FMBB 5KAMA 2XGJA 2E87A 2FFQA 1F14A 1II9A 2NZYA 2ZWOA 5HF8A 3WKBA 4AKEA 1OWLA 1P9WA 3GK3A 4OHBA 4OO3A 4O2BF 1IONA 3Q7RA 4X6YA 1NZJA 3MZ0A 4R1PA 4FN5A 4U7FA 5FFMA 4CN9A 1M1YB 4QYWA 1TO6A 4KO2S 1SXGA 5MN5A 2VDWA 4ZALA 1KWGA 2OR3A 3BJIC 4RHCA 1IM5A 4TQUS 5BQOA 3L84A 4Z4IA 4JP1A 3B6KA 5CYPA 2VH5R 1FDUA 4JX9A 4TXLA 3MHPA 2FV8A 4I8XA 4C3ZA 4YH1A 4K9PA 4QUEA 1FZQA 3S6JA 5B4VA 2J5XA 3EGWA 5DMHA 2RK3A 3DUWA 4NVRA 4PBSA 4RAQA 5JLAA 1E3LA 1MC8A 2WNHA 4EWLA 1YRAA 5G4LA 5KOHA 5DEIA 4BWFB 2QR2A 3WKEA 1AM4D 4E5VA 4LJ9A 1ZRHA 4PEVA 2JFFA 2D59A 1GV0A 2R6ZA 4Q47A 1TRKA 3R2JA 2EBFX 3I12A 4AUEA 3S1SA 1RHJA 1DV2A 4R8RA 1FMLA 5LQRA 4NDZA 2YDXA 2IWHA 5H0IA 1NUTA 2PXHA 5TIIA 3THWA 2CV0A 3KQOA 2XXAB 2ECKA 2I8LA 2NVWA 1XTZA 3FPKA 4PX3A 4B09A 2G8LA 3M1YA 2GK4A 3JQBA 2JKVA 4HFJA 4YMVA 3WLQA 3WTBA 5A7HA 1UOPA 4TV9B 3IXQA 5ALQA 2GN8A 1T8SA 3HO8A 4IOLA 4D6XA 2UUAB 2VDWB 2ZIZA 3K16A 3LNTA 3TJMA 5FL3A 3MFYA 1BEEA 3ONEA 1R6XA 1GA4A 4YC7A 1K3FA 4R71A 4LOJA 3BJMA 4Z4FA 1SXJE 3IGFA 1M34A 2W5UA 3DCNA 2OXTA 2G1AA 3K20A 3VAAA 3HI4A 1JEOA 4WKNA 1J7JA 4D6YA 4CKCA 4EI7A 1CHDA 2PRSA 3UEOA 3NTUA 4G5OA 3ZW7A 2HHAA 2ON6A 4MW5A 4C22A 4TLDA 2XEDA 3BUSA 3GEIA 3ST7A 5DTJA 1BHQ1 1K8ZB 1M9NA 1C4KA 2Q1TA 3U5TA 1ULTA 1CJKC 3WRXA 3H65A 4BYGA 5C5DA 5CB4F 5JVDF 2IYAA 1E2DA 2G5CA 2RHLA 2YIDA 1CQJB 2A0XA 3HLKA 3HE3A 5K8TA 3O8OA 1EX7A 1IB0A 1MGOA 1V0JA 1AQNA 1YJBA 4MKRA 4Q12A 2RI1A 4JVSB 5H68A 1UWLA 5SZKB 4JI3B 5JJBA 3U3MA 1YMUA 1E2PA 4HT3B 2R1VA 1Y3BE 3COYA 3QBJA 4KSCA 4WLEA 5EVJA 3VPAA 4RMNA 2NTNA 3EMBA 1RAHA 3BIJA 4WACA 5IEJA 2DR2A 2PUJA 2IEGA 3OCUA 5LBUA 1TC2A 4MO2A 2Z5GA 3H13A 4ZO7A 3ZWAA 1JILA 4IAOA 3F5MA 4WKOA 1D09A 4GWGA 4NZZA 4BQFA 5IAKA 1L8QA 3K1TA 4PF1A 3REQB 2V4UA 1WZUA 1JTFA 2OHGA 5AVRA 2P2GA 5E1DA 1XR3A 3D5EA 1AKYA 4KMSA 1Q3HA 2C1EA 2JJ8A 4H08A 3JR3A 1R9JA 3WNVA 4F7DA 1V5EA 4ZYYA 5HZKA 1XRJA 1SUAA 2K6GA 1BCRA 4A92A 1IOVA 4JI1B 4DKJA 5A0VA 1AHIA 1GPUA 2GCPA 1KDZA 2V59A 3K5WA 4PCLA 4EHBA 4RHTA 3K09C 3OX1A 3ETHA 4FNOA 1QZXA 1ZG3A 2ID7A 1EUDA 1ADYA 2Z4SA 3EOZA 4NQRA 4OJNA 2B30A 3FXAA 4B73A 5BNZA 3ZV6A 1L9XA 3STHA 2NXWA 4WECA 5FPKA 4N3AA 1J06A 4HQ6A 3ABIA 3G2IA 2DH5A 3SQMA 1UXIA 3ZHUA 2GAIA 4E30A 3AFNA 3AONB 4EJ0A 5AW4A 5L95A 1G59A 4OHFA 4Q18A 3REGA 4CT5A 2O8BB 2FEMA 4BC1A 3K8OE 3BRSA 3MTQA 1FX1A 4KK4A 2QNRA 4ZEOA 4ICIA 3HXOA 1KGDA 3HCRA 1U28C 4GMXA 4B35A 4JWKA 1UM9B 3F6BX 2KX7A 3IV7A 5CFLA 1J2EA 2PKQO 2EIHA 3LDFA 3C48A 4KCGA 4OI2A 3WGHA 3RASA 4WGGA 2J5QA 2W2OA 4UDOA 2WIJA 2PVCA 3TFQA 5F1OA 4IICA 3L9WA 4MMXB 1VMAA 2LUOA 3MERA 2QXYA 2IU3A 3IODA 4MX8A 5G1PA 1N8TA 1YTLA 2P4QA 2W22A 4NEGA 4ED9A 5IAOA 2SCUB 4BLUA 1JBEA 3LC2O 3P9RA 4JT8A 5KMGA 4B4UA 3I9V1 2O0LA 1M72A 1M7GA 3GLGE 3MJVA 3D8UA 3BGIA 3QOFA 3JSAA 4J1TA 5IKEA 1XQYA 2QN7A 4YCBA 2CLHB 5K6AC 1Y42X 1TNDA 4GOND 3EDYA 4FMCB 1U1IA 3SC4A 2REOA 3W9UA 1SXIA 5DHRA 3ELWA 3E7FA 3NBXX 1G3MA 1PNVA 2ZE8A 3GEHA 3IPRA 2ZBGA 4O8CA 1TZ2A 1IHYA 2JATA 3RJMA 5LA6A 1N7HA 1NNUA 1GUDA 3TSOA 3JWEA 1AN9A 5HA5A 5BSVA 4CIYA 4DV0B 1UBLS 3ILYA 4AXBA 2ZYGA 3COZA 1JR3E 2O7SA 4YECA 3EPJA 3QMMA 2QRHA 1I7DA 4RKFA 5TQ2B 1YVPA 4JBXA 2H7YA 3UW1A 1E2BA 3GLGB 2EWMA 5AKGA 1OCEA 5CT4A 2FH5B 3EIXA 1OWNA 1YDHA 3KAKA 3OAAA 3PX2A 3W34A 1M2WA 4Y0VA 1JXOA 2JRLA 1XMOB 3IEXA 3BKWA 4EKDA 3QV1A 3KB1A 2ZAGA 4A73A 4REQB 1HDYA 1LI7A 1MG0A 1A82A 3KB6A 4IM7A 2TYSB 3UKOA 2ZXUA 2XWSA 5D51S 2PH7A 2BFAA 5JH7B 1ORVA 1RCFA 4X85A 3DFFA 1F2VA 3AIKA 3B5IA 5CT8A 2EQ5A 3VZDA 3WYEA 2EVWX 3A27A 4ZMRA 3JQ6A 3NRJA 2DGDA 4JYCA 4WZAA 3ZWWA 2IVFA 2PBZA 5IVHA 1QHHA 2EJCA 3LLCA 4WDQA 3LUDA 4PC1A 3ZWBA 4DA7A 4DJ5X 4X3PA 4P4UA 4PAOA 4LCBA 1GCUA 3KFVA 4QAQA 3LC1O 1P74A 3K6SB 2Y8EA 4G4IA 4MSUA 4UE6A 4U0KA 3ZOZA 5JSUA 3D4NA 2GESA 3L4KA 5E2BA 2Z83A 3S8EA 4H15A 4MKGA 5IKXA 4X1IA 1FBNA 2HT1A 4BEBA 1DC8A 1EA5A 4ALNA 1NKTA 1ZU4A 4CTOA 3OO0A 4LJLA 4B7UA 2R2AA 5FTWA 1PS8A 4DADA 2GASA 2W6MA 1NJ5A 4NV1A 1TPYA 4TTSA 2OY0A 5EA2A 1Q77A 2NYAA 3CEPB 1B4DA 4A15A 4C1BA 3KYBA 1CRZA 2VP9A 3GDOA 4MGZR 4WMLA 3R8FA 2JG3A 3C87A 1ESNA 2IYEA 4RDXA 1E6WA 3G0HA 2ZUEA 3LOQA 1W581 3D7MA 3DE4X 2EDCA 2Q5CA 2AK2A 4J76A 1ZVVA 3ZD6A 4S24A 4R6XA 1WPQA 3F71A 1DG1G 3JQEA 2OHIA 1IVYA 1JG3A 1K08A 2W6ZA 1PZNA 1YQWA 4FJ0A 4LX0A 4V0RA 3RHSA 2QYSA 3WGTA 3NVKI 3MYYA 5AHKA 5C4IA 1FJXA 2W6NA 2ISCA 1S6YA 1YZGA 2J9RA 4Y2XA 1E9CA 3P2YA 4HVCA 5HKOA 1O0CA 1J8QA 4UZSA 3PCRB 1JDZA 4XJSA 5TQ0A 1O95A 3OZIA 5JR3A 1QE5A 3HU3A 1NUAA 5JD6A 1PU2A 4OP3A 2ZR0A 4HAWA 5EE0A 5C8VA 3M6LA 3FVQA 3UB2A 1GVHA 4P22A 2JDID 2X7JA 4DNXA 1XEWY 4UHFA 1UJ4A 2O3TA 4D4KA 3P97A 3FCUB 3Q3VA 3PJEA 2DFVA 1XX6A 3DL4A 2Y1GA 3R5HA 4UNSA 5DO9A 1KAHA 1LH0A 1Q11A 1RAIA 4QPNA 1U5AA 3CF2A 4O2AF 1XDWA 1CX9B 5EEGA 3UT0A 1TK9A 1WXDA 5EMJA 4LJKA 1M7HA 5ALTA 4ZV9A 5DP1A 5C1IA 4F4JA 5JI3E 3A6KA 3MS7A 4Y6SA 2J30A 3GVHA 3LGSA 3VZSA 1DDOA 1JAHA 1TF2A 3R09A 1U2TA 2BFMA 2QX4A 2PJRA 2YVQA 4IIEA 1JQAA 4RPKA 3OLQA 3QVGA 1NQVA 1N6HA 1LV7A 1U11A 3PENA 1FTGA 2AA3A 2RK4A 1DKLA 3AB7A 3M6WA 3A11A 5F73A 5FWDA 4E15A 1OZGA 4HN2A 1N6NA 5FTLA 1J5EB 5BOSA 1VSTA 2D1SA 4EX6A 2FPWA 2FWNA 2GBFA 1RXIA 4R9NA 3D2BA 4ZAZA 5D01A 1PHRA 3CIOA 2HU2A 1PJ3A 4AX4A 4UEWA 5HFNA 1DDIA 4BX3A 5IUNC 3RGWS 3AJAA 3KD3A 4O08A 1NVKA 3ET4A 5CX1B 3WAGA 4Z4GA 2VI5A 2FGKA 5JLJA 3ACDA 1KZYC 3E9MA 1WCXA 2XMDA 3RBAA 4M1ZA 2BGMA 3EBPA 1A4IA 1DOZA 2AS0A 2AEFA 4MUMA 3V4PB 3I61A 5C52B 4RY8A 4KL8S 4UHBA 5B57C 4P82A 3G5LA 4P0QB 2R4QA 4OREX 4AM8A 5K8VA 4A82A 4AUKA 2V3VA 3P9XA 5ALWA 3VC1A 4C88A 5JANA 1VYHA 1KHHA 1H4VB 2MSWA 4ENPA 2ODQA 4CETA 2ASEA 4UEJA 5ALMA 2BJWA 2DR3A 2P6MA 3X1WA 1QYXA 1U7OA 2V0NA 5FLYA 4H27A 1M2OB 4WJKB 2W8ZA 3ROZA 2FZ4A 2TMYA 3KZMA 2IZ5A 1JIIA 2XEXA 1AGXA 1KI4A 1IM2A 3G49A 1JHXA 5JAPA 2XUIA 1FVOA 4Z2YA 2QR3A 3SD7A 3G9QA 2ZI3A 1U3WA 5TF0A 1SCKA 2C7PA 1MD9A 3M1AA 4U7WA 1XKXA 3GDFA 2JEZA 3T3HA 2ZATA 4HS4A 4ETIA 3GEGA 3KETA 5AVWA 2BM0A 4JBHA 1AD2A 1BW9A 1VSVA 4OJQA 2FU5C 1J56A 3ZTTA 2A88A 4UREA 2ZW9A 3KV1A 2XGGA 4RVHA 1CUCA 3KFLA 3LAWA 3K4PA 1NBHA 2HTEA 4GLFA 4I46A 4BATA 2C3YA 3LF1A 1FFHA 3GCXA 2ZR7A 4PPQA 3VYUB 3S44A 4ALLA 1A8UA 3RRZA 5LFAA 3QK7A 1FFAA 4MVJH 1JT2A 3CUKA 4M0DA 4HGPA 1I2AA 3NT4A 1IC6A 4R3UC 4B7XA 2HBZA 5A0TA 1HNNA 1WVGA 2DBZA 3GUHA 3DC2A 4Y18A 4L22A 3O8OB 2G9QA 2GCEA 4ZO9A 3ZDQA 4KPEC 2C92A 4YJ3F 1JQDA 2ZJ3A 2X2PA 1P18A 3GFPA 4FDVA 4UJ5A 4DDHA 1NU6A 2DPXA 1KIFA 2G70A 3K0AB 4B3JA 2AOTA 3W6ZA 2MU1A 2GBCA 1EK2A 3HCDA 2X58A 4J1QA 2ZTSA 2B2CA 5ALPA 3JVDA 2YV5A 3CTMA 3PFIA 3E3OA 3UATA 1XZEA 3LPNA 5DYYA 4AX8A 3FUVA 3KTAB 3FFAA 4P53A 1B76A 2C9MA 5J3JA 3MD9A 5ICSA 4MMYB 4D25A 3IMKA 3STUA 1CFZA 3RJ9A 2LPMA 2BGKA 4EM6A 1POXA 5BV7A 3RVDA 4A5OA 1G2IA 5D3ZA 5JZOA 5LOVB 3OF2A 4K81B 4OU5A 5SYAA 4X1IB 1YUNA 3M9XA 3TBHA 4EA7A 4N47A 3CB4A 4UOZA 2CJYA 1BROA 3U44A 4ZHQA 2EOAA 3MUOA 5IWAB 4CR8A 2BR5A 4U02A 2NP6A 2WE8A 2GFIA 1U98A 2H1LA 3LCVB 4GBED 2D2XA 4MTLA 5IP5A 4GKAA 4X62B 2JGLA 4D56A 2CXUA 3F67A 2XX3A 1IIBA 3KFXA 4J9UE 5EZ5A 1FFYA 4CMAA 4EJ6A 4R1TA 1T13A 2XKKA 3FPHA 4ZOAA 2D5AA 3A8TA 1JI0A 1OF1A 5DU2A 3K6JA 5BWCA 5KOHB 2HA0A 3GRZA 5KSWB 1PG5A 1E2GA 1OFTA 2XF2A 3C7TA 4E5UA 4MS3A 1ZD4A 3T7DA 1JSLA 2J6HA 4PGMA 2P78A 2FN4A 5K0BA 4NV3A 3A70A 4PY2A 2O8BA 3CCCA 2D2FA 4L5YA 2CKMA 2JJYA 5J23A 1BE8A 2NO9A 1P72A 1WSBA 4IMPA 1T5BA 2FHPA 2QUJA 3DBVO 4WEQA 2P2CA 4GRDA 4M83A 5AKYA 4GLJA 1XLWA 2VPTA 5FP0A 1QGOA 2AV6A 4ZZIA 2E1PA 3NTOA 2NVBA 2WQ7A 1N32B 4F38A 5LYJA 4ZPXA 3H11A 3TL3A 3G0IA 1R9MA 1VI2A 5TMPA 4EY4A 3AR8A 3L1UA 1I5EA 3Q3CA 4W99A 5B36A 3CNOA 4Q02A 1U2PA 2O8DA 1ECLA 5E4TA 1NMSA 1ZD8A 5HJEA 4IJMA 5AUPB 1M0TA 4DBLE 3TIGA 2G77B 5AI4A 5IH3A 5CDFA 4MW7A 3CV3A 2XQGA 5K3BA 4UC0A 3KVNA 3OA0A 1A7KA 2JI4A 4HDRB 3KKQA 1WMAA 1L2TA 2B1RA 4Q3DA 5DGIA 2QRZA 1FNCA 3T6KA 4Q1VA 2ZRPA 5A1TA 1NURA 2NT4A 2LDXA 3QIVA 4N4AA 3J81k 1KBZA 1QOZA 3L4BC 3RREA 1ZJYA 2P27A 4C87A 1R5BA 1BDMA 4MVYA 1EDBA 1AMOA 1XMQB 4QOSA 2OHXA 4K7JA 2V65A 1G1MA 5CB4B 5KQLA 4WZAE 2Z4TA 4XQGA 1G8YA 1N2OA 5DHPA 5KZMB 3HG7A 2V6MA 3UENA 4ARZB 3UCXA 2NUPB 5BP7A 4EEKA 1FYXA 3IDZA 2H59A 3IMGA 1E2FA 3DTNA 3D8TA 2GZHA 4HB4A 4CDGA 4MZXA 1E8MA 1FQWA 3OIYA 1KETA 1YS4A 3LQFA 2QW8A 3PR1A 4LG1A 3P0HA 3OH8A 3SDSA 3I2IA 1G5RA 2ZU6A 3RGGA 3NC4A 3Q40A 2OZPA 1XJWA 2QRLA 4RD4A 1VKHA 3ZHYA 1Z7GA 1OBVA 5D87A 3E27A 5KQMA 1F60A 2RHGB 3HCCA 1A5ZA 1AK2A 1ATZA 1QO7A 5HZMA 5TY0A 2IXAA 3CRW1 4LHYA 3I8SA 4FYJA 3ZUGA 1C5KA 3U81A 3ACBA 1QIJA 5I7VA 4C7KA 5EMNA 3T1OA 2J7PA 2VLIA 2Q5HA 4WNIA 3T12A 2UXBB 1H2BA 2OV2A 4LEIA 1E1DA 3MGGA 1ZVMA 1OFUA 2IODA 3H19A 2GHTA 5DULA 4PLCA 1KAOA 3RUDA 5CH8A 1X7XA 1RMQA 3DDNA 1NI5A 4JB0A 3U3RA 4AYTA 4BNTA 1PP4A 5H9WA 1G0NA 2YOGA 3KKOA 1IXSB 4EMBA 4EPTA 5K8IA 1BVHA 4MI1A 4Q3OA 1NVUQ 5KU1A 2FZEA 2A33A 3E9QA 4FYYA 5TRTA 1DKMA 1TF5A 3B1YA 3FHCB 4I5DA 3T5DA 4DRZA 2J3IA 1UBNA 2M32A 3OIDA 2RFLA 3DO8A 2R25B 1H2RS 1IDOA 3CT4A 1F0PA 1P5JA 3GPDG 5FA8A 2C2GA 1Q74A 3I5MA 1S8NA 1TUBA 1DAFA 2CUNA 2HMWA 3S1LA 3VDQA 1CJCA 1T4MA 1VTKA 3NVMB 3HSYA 3QBEA 4EB8A 3TZLA 3KZVA 1DBRA 3VSCA 2EX1A 4OI1A 3IVRA 1T25A 3GJ7A 1Q20A 4LXQA 1WZNA 1EXWA 1B3BA 4OHKA 4PS1A 4MCIA 4QUBA 3SSOA 2F64A 1RBYA 4Y2GA 1XCGB 1YAJA 4H7JA 4BFXA 1VL0A 5IW8A 2OLEA 1H9AA 4GUDA 3SEZA 1UXKA 3K32A 5EXXA 4LNHA 4Q66C 2QTVA 5HCIA 2AZTA 2OXCA 5BNTA 3L6BA 3HUUA 4FGSA 3FIUA 4H6XA 2AI3A 2PRZA 2ZFUA 1QC5A 5ELMA 5AHOA 3ZGLA 3IVAA 3W4JA 4WLVA 4YV2A 2M6RA 3GAZA 1K5GA 5E6RA 4AL4A 1BDHA 1AG9A 3PLNA 4P4NA 1JR3D 1Z74A 1GUFA 1DX9A 3JALB 4NBTA 2WAAA 2RHMA 1QV9A 3VR3D 4TQGA 1UXGA 2O4UX 1IN7A 1Z12A 4HNUA 5CU7A 4BMXA 1RRVA 2C2BA 5AM5A 4ES6A 4GD3Q 3FG9A 2H08A 4U7TB 3U7QB 1T9DA 3DBHB 4J2OA 1NFRA 1NBIA 4Q9LA 4CJXA 2Q3MA 4Z4HA 3D6NB 5BR1A 7GPBA 3DHNA 2Q3LA 3QWAA 4CM7A 1CFJA 4DA9A 5JZVA 2XZPA 2J3EA 4M8KA 5KPDA 4QJ4A 3H2GA 3NKFA 1CLEA 3KLNA 4EY3A 3EW9A 4LZPA 4C0JA 2GEKA 4Y6QA 5J2TA 1U9YA 1GFIA 1UEJA 2QE7A 1P80A 4OMUA 4RA9A 1I4WA 4D4HA 3QOXA 1SCBA 3QUTA 5E9WA 4OMDA 5CDUA 4KQWA 3UJDA 1BS1A 3BD7A 4M1TA 1ZGJA 4BFZA 2O2HA 1EE1A 4QOHA 5CFOA 1RYEA 2YMPA 4MYTA 1ZN2A 5JXWA 5D8DA 4MQEA 3VPXA 2O23A 5BURA 2I4TA 1HMYA 1XRRA 2F67A 4PSAA 4S05A 3L5KA 1FPQA 2L82A 4BNDA 2VHWA 3EAFA 2DUWA 5LOVF 2FE4A 1ODTC 2CUKA 2P1DA 2I3DA 2X8BA 3BMXA 3BE5A 4MB2A 4EUKA 1QDLB 3RSCA 3HVHA 3H6HA 4ASUA 4KPGA 2WJVA 1W52X 1RHKA 5BYKA 1R3UA 2X5KO 3P4YA 1N9GB 1TPZA 1A8SA 1H1LB 1JAYA 1E62A 1JLSA 1V1RA 4G3XA 3VX4A 4YFVA 4INJA 4ZJPA 3IHLA 3TB4A 4YONB 4CQJA 4QUDA 2OO3A 1M6WA 4ME6A 4EX7A 5AOAA 1V4NA 5DOZA 3ZH9B 4C6TA 4O0MA 1JG2A 2X3UA 2JFWA 2JCXA 3B3AA 3T61A 4UM9B 3RABA 2QK4A 1XAGA 2ZIVB 2M1XA 3GAAA 1OZHA 4Q7KA 3OQPA 4KQGA 4MAMA 1CSEE 4UBIA 2C7RA 2H54A 1PYDA 1MX9A 2JFYA 3KKKA 3EY9A 3MT7A 4MS1B 1RRPA 2PY6A 3V1KA 4ZZ0A 2BE9A 4AXXA 1G6KA 3B12A 3AC0A 3OLXA 4M3NA 4QGGA 4B1FA 1P1KA 1WDLA 3JATB 1YIDA 3GT4A 3WRVA 2RK6A 1P1RA 1MDBA 1PFWA 3T3EA 4CUKA 4MR8A 3IQDB 4IHJF 1E9AA 5EJFA 4YPVA 5JADA 2FPGB 3TQIA 4IRXA 2GD0A 5JFOA 3GRYA 1GNLA 4HF7A 3DAPA 5C7OO 5J2UF 5CFZA 5HUQA 2ZRKA 4HQLA 4ZAGA 121PA 3X3HA 3DLCA 1SXPA 5B1HA 1T5TA 2Y05A 2GM4A 4MEBA 3ZEIA 4HGYA 3U4DA 1SUPA 5KJCA 5BPFA 3DOEA 3JQ8B 1E8DA 1FCJA 4LSMA 2O2EA 5I45A 5KHOC 3ADDA 2G80A 3O8BA 4RKRA 5A4JA 1XZFA 5IDXA 5IXYA 1DKNA 1MQAA 3EWNA 3P0JA 2Y1CA 1LF5A 2P9HA 4BNZA 2X2OA 2PKXA 4XZ3A 3CJTA 2PA3A 3OG9A 2AYZA 1NQWA 4KXMA 3GJSA 3LECA 4LCJA 5IS2A 4C78A 3R9XA 1QX4A 2A1IA 1E6UA 1GPKA 1SBYA 1ILEA 4K03A 3KKZA 5ALOA 1RRCA 4YY3B 3ZCSA 4G8BA 1KYQA 3LUHA 1E2JA 3OCJA 4RWZA 1QFMA 3ZXSA 1RHMA 3M6XA 3HB7A 4JP8A 1IB6A 3AYXB 4W5HA 4RTSA 1DJMA 2JVJA 1DBIA 2CVFA 1EAYA 4UFOA 2FCAA 3PCTA 3IAS1 3HR8A 4R40A 4JJAA 4UUOA 4XWKA 5KTRA 2E5LB 3WSVA 1IHDA 3FCEA 3HXKA 4NENB 4PYLA 4TSFD 4RD1A 4F9GA 2H9YA 4RLFA 2YZKA 4E5SA 4G9BA 4P93A 3QVWA 1JHMA 1KORA 2M98A 1CVRA 4II2A 3QSYA 3HKDA 4MPRA 5HW0A 3VKUA 2CF6A 3NNSA 3V1UA 2FY8A 1DZ3A 2FJPA 1SG0A 1BN6A 2Q6IA 3O84A 1GT6A 3VYVA 3W2TA 3PGXA 5JO0A 2FSIA 1BW9B 3I1JA 1GCGA 2SICE 2W37A 4UBKA 3BH7A 4YEDA 4BFVA 3FYDA 3RG2A 2DQKA 2CB9A 2YMQA 1W75A 4URZR 4ZGWA 2Z6AA 2PZJA 2W4QA 4UDNA 3H2ZA 3WLRA 1T91A 2YWHA 1Z4NA 3T06B 1LBHA 4YCCA 5K9ZA 2R6FA 4D0RA 1XZNA 3GFTA 3K96A 2JIBA 2MYTA 2W58A 4JDUA 3TMYA 4DSOA 2C7OA 5EUCA 4IUYA 5D7NA 4UTPA 3TEJA 3D1VA 3FDZA 1WXEA 2QTAA 2WU4A 3Q15C 1SCDA 3FPAA 3C5CA 4WESA 1ZUHA 3DULA 2ICAA 3ESZA 4FIZA 1WTAA 3BB4A 2IP2A 3OTHA 1QMPA 2CBXA 1QNFA 2Q5JA 4A8JA 2GF9A 5FYDA 5IHPA 2RHCA 5J43A 1ZI9A 3KCNA 3R0ZA 4WJLA 1K8YB 3ZNQA 3Q4GA 4HXEB 3H1GA 4LF7B 2YWBA 3PD0A 2OFPA 3OC6A 4WXHA 3L4EA 3SJCA 4RZHA 1OAOC 2WUGA 1JYEA 4IUCS 5DX1A 3R9IA 4IUDS 1ML4A 3DE3X 4OQYA 1CZKA 2IDMA 2BMAA 2DJIA 4B3XA 5I8PA 1CJBA 3OUTA 1V47A 2EXXA 2O4CA 4INAA 1P31A 4KXNA 4EY5A 5LP6B 4HDRA 2H4FA 4LSZA 4E03A 3JD4A 1HYEA 3AL0C 4TWBA 1AE1A 2VPQA 3DV0A 1SBCA 4GHWA 4ZANA 1F6BA 2FEOA 3F6PA 3FWZA 3ZXYA 3ZZUA 4CF5A 4E6EA 1AKQA 1G5HA 1KJQA 2YY7A 3SVLA 2ZROA 1IPHA 1E1QA 2VNJA 3OJFA 1Z29A 3M89A 1T6YA 2PMWB 1CBUA 2QRMA 4JNCA 3VNBA 4E4YA 1UR5A 3HADA 3B1FA 5BSRA 2RHTA 4LRXA 3MAAC 2Q5QA 4YROA 1NQTA 1JDTA 2CE2X 2J3KA 2QWXA 1EINA 1IPEA 2OGUA 3DKPA 4JODA 4L0CA 4CLXA 1PJSA 5KTPA 3Q7EA 1AB6A 1Z33A 4OQFA 4ZVOA 1VI6A 4J7CA 4BC0A 4LIPD 4HQKA 1JEYA 1LK7A 3CZPA 4PYQA 1T0UA 3OPYB 4RJJA 3PUWA 5CDYA 1LTQA 1LFAA 1EFKA 3O4IA 1R0BA 1UDAA 1KJ9A 2FXVA 3C8DA 4QWMA 4MUHA 4BX2A 1D1QA 1LRJA 4GZLA 4ZDIA 2A5FA 2AQIA 2GTIA 1LWNA 1MJHA 3LBYA 3QX3A 1CRLA 2CVPA 1DUSA 4FYWA 4HBGA 1LQ2A 1DRKA 4F8JA 1PVDA 2EERA 4XFJA 4G5GA 3I4FA 1W96A 2Q45A 3M6UA 3ITNA 4BN4A 2R5NA 4EABA 1YH3A 2B3TA 3H1EA 3W6UA 1XTUA 3ZWVA 4YRTA 4B47A 1Z5PA 3H8SA 4MGEA 1G7SA 1JXMA 2BSXA 4I66A 4NYJQ 3UB4A 2PX8A 4ARZA 4UNQA 1LQTA 4LC9A 3EUAA 5D5QA 4F7WA 2W2KA 5LLTA 1IEVA 5KYVA 3K2BA 4PR3A 1UMCB 4RE6A 1AOXA 3LG2A 5HPYB 5KINB 4WWHA 4MUAA 2HFKA 3TD9A 2QGZA 1VHDA 5D3QA 4PZEA 2H57A 2X13A 5CW1A 1S0UA 2ZBPA 4LY6A 4WQMA 4H1WA 1NSYA 2GJ4A 5BV8A 3GZNA 1OB5A 1MC4A 4OP1A 2HGSA 4TYYA 1Q44A 2YVLA 3CSDA 4BQQA 1TKBA 2A0WA 3K0AA 5I01A 1Q21A 2FPLA 4F04A 1FQKA 1QHHB 1XRLA 4HB3A 4BLPA 1ADFA 4IIXA 3ZE8A 2OD9A 5CFPA 4FNGA 4JEMA 1L8LA 5EHXA 3C6KA 1QYRA 2I9PA 6LDHA 3M6VA 3QU9A 4RLHA 3IQWA 3LI2A 4ZOBA 1Y89A 3EEYA 3RAJA 1PJBA 1WBBA 1TCVA 4DMMA 2Q41A 4YP0A 2I2WA 3G0BA 4LYYA 3UPDA 1E7MA 5LU9A 4RV5A 4QBHA 1LLDA 1Q17A 5BT8A 2XUJA 3C2QA 3B5JA 2BHTA 3G2PA 3SQOA 3O8CA 1R6AA 2UYGA 3KBOA 4KXYA 3FTEA 2MINA 1JYSA 3RKSA 3V7FA 1U0EA 3F8WA 1I3NA 3FLMA 4MJLA 4AJLA 2FDRA 1OXKB 3U4GA 3AR5A 4XWYA 4ENQA 1HY3A 1ZUWA 3E53A 1D3AA 1I6LA 5IABA 5C0OE 3X43A 1AT1A 3PKJA 1YS7A 4D3ZA 3OJXA 1E5TA 2F4NA 1GKLA 4NZPA 4C7XA 4KE7A 1U7XA 5TEWA 2I0FA 1DKUA 4GT1A 1BQ3A 1L4EA 2D1FA 3IT2A 1FSPA 4B6JA 1MT0A 4DV5B 2D5IA 5BR4A 1GGJA 4QQRA 3PNYA 5K0SA 2MSDB 2VJNA 2JGDB 4NYMR 1JLLA 3IEIA 1DXHA 1IAVA 1NUSA 1O4VA 3OMLA 5I9SA 1UDCA 2XHZA 3I1FA 2YFHA 3M6FA 1NUHA 3C8HA 4XA8A 1W1UA 4RPIA 5BW6B 3FPJA 4L28A 2Z6UA 5FRDA 3OA2A 4QHTA 1JIJA 4QRIA 1OY1A 5CNIA 3P0FA 3AKCA 1I5OA 5JATA 2IYZA 1Y4ZA 1Z28A 3BWEA 4M1MA 3U4HA 3E22A 5A4IS 2RD2A 1T9CA 4P4TA 3PVSA 4IMJB 1ZHHA 2Q6OA 1F2DA 4FE3A 1W0CA 4LOIA 5F4ZA 3SBDA 3TQCA 1GPH1 2O52A 2V7TA 3G88A 3IV9A 1DL5A 2CF5A 4K9SA 1TFRA 5G3YA 1U3CA 3RK0A 1UKCA 2LR0A 2I7VA 1U7TA 3D2CA 3DGFC 4UD6A 4H7PA 5LJIA 5EHNA 1Q1BA 5AIBA 1KK3A 3WK7A 3QHPA 2DWPA 4LZAA 3ADPA 4JELA 4B3FX 2Y77A 3O8LA 4YGYA 4TZTA 3UXHA 4DCTA 2REQA 5HQTA 4D41A 5LP6A 1DLIA 2H1VA 2FWIA 3T34A 3H2KA 1P44A 4LW8A 1OWPA 1FY2A 2ERXA 3HDYA 2I7DA 1QAMA 2TMKA 4JR1A 5ETJA 2AZDA 2GARA 1Z4OA 2F9MA 4Y7CA 2OCGA 3T9BA 3L77A 2Z1MA 1P5RA 2FR8C 4HXYA 4E1AA 4EHIA 2QRQA 2ZE5A 3F90A 4DLUA 3WQSB 3TSWA 3G5UA 2HHLA 3D64A 2ZSAA 2D54A 4L07A 5FWXA 4DHWA 2C9CA 4A8JB 3FLAA 2IY8A 3KQYA 1YCFA 1Z2DA 4HI0E 4FXPA 1XLUA 1LBQA 4NYMQ 4ZAWA 3WYNA 4AB1A 4LRSB 4AG3A 4U8HA 4GXNA 2I4OA 4JQCA 1KZ4A 3ORYA 2DHRA 5E9JA 3TXXA 4NPHA 3L7CA 1Y34E 4CEIB 3ZJ5A 2RBKA 2CXHA 1CV2A 3I64A 1A0OA 1RWNA 1MB2A 2J9FB 2I4LA 2PYZA 4ECAA 3QG1A 1KY5A 4ARIA 2PX3A 4BU1A 3PD7A 5FOQA 3TL2A 2ZEJA 4XDGA 3RADC 1DC3A 4QNNA 4B9AA 2YXLA 2IF2A 3A9WA 4ARBA 4GKKB 1ECGA 1RT9A 1H1LA 5FTMA 4W8GA 4CL2A 1A50B 2HUNA 1RQ2A 1QQ5A 3JAKB 3GRFA 1Z7YA 3GJZA 3I4LA 1BSVA 1WOYA 3UAYA 2PVPA 1KQNA 4ZYUA 2LW7A 3UMCA 1U5BA 5CK4A 5FBQB 4F6CA 6NULA 2FFRA 1FS4A 3PV0A 4QXOA 3RFVA 1IZ7A 2LCQA 4NL4H 1OZFA 1SUIA 1T43A 4B4WA 3HM2A 3DFMA 2PUWA 2HLDA 1DCKA 3N2NA 2IPOA 5LMZA 1HG0A 2VQFB 1P5FA 2VBCA 2DFKB 4FXOA 3NHUA 3KQUA 1AMNA 3BOSA 2OBNA 3K9HA 1XO1A 1EFLA 1NVFA 4QBFA 4HQNA 5EP2A 4M9UA 3PUZA 3UAZA 4EA9A 4QVKA 2G4LA 1VIYA 3PXBA 4KZPA 4Q4HB 4R8LA 2PS3A 2ZPAA 2PL3A 2Y4NA 2Q07A 4IIVA 1MJFA 3CTPA 3KQWA 3C3AA 4HNGA 2GF2A 3G59A 1NQUA 2CXNA 2WJIA 3RSZA 1LDEA 3RCBA 3RF7A 2JFVA 2ATXA 2Z5VA 4YQEA 5EHIA 2EGHA 4Z54A 3UJCA 4F46A 1GQOA 1DOHA 2Z58A 1QWSA 1GZ4A 3JQ7A 3KB8A 4LZOA 3VJKA 5F9HA 3TIIA 3BRWA 3DBHA 2VHTA 4CQMD 3JQ8A 5CLGA 3GC6A 1JJAA 5EWLA 3E9CA 1RI1A 4UTNA 1RJ9A 1DJPA 1NYLA 3O9ZA 1NZFA 3MN1A 4WXRA 2FOIA 1RWVA 1USIA 1NT4A 1GGEA 4NMHA 5EFOA 4LMPA 5G0VA 2FYTA 2QJWA 2GVNA 3HZRA 3P20A 4PGFA 4RJIA 1GCAA 1MTOA 4X7BA 5IBRA 1L7AA 2GPSA 3G89A 2Y68A 3ED5A 2Q2NA 3PUKA 5AHXA 5LKAA 1L7OA 5BSKA 1G8AA 3E7PA 5FCDA 3MRTA 3AXSA 4X8MA 3KYDA 4IEIA 4K87A 3HC7A 3O74A 3U3DA 4DR7B 3AP1A 5K3DA 2IUTA 5K3FB 1B74A 4ND5A 3SQDA 4KO1S 5KREA 1DFGA 1GPMA 1KI3A 1KNXA 2IBMA 2V7XA 3F9CA 2JGEA 2OC9A 3ZE0B 4M1WA 3L02A 5DM1A 4GBMA 1QKJA 2IOFA 3IUYA 1UP7A 2WFMA 1D4ZA 4V0QA 5B3KA 1T8PA 3PBKA 3AIOA 4JI2B 2K7ZA 3IXLA 2ZZNA 3HFGA 2FPSA 3NIGB 1QVAA 2NX2A 4AY6A 4M6WB 4PLHA 1V1RB 3C7CB 1D1PA 2CT8A 3AF6A 4ER5A 5JQGA 3MWJA 2VDOB 2SKCA 2G04A 1HYQA 2MSLA 1W9HA 2HWWA 3A6HA 3VUFA 2YHUA 4KUGA 2O06A 4HAUA 4QLOA 5BSUA 4P3KA 3HBJA 5J63A 1VFNA 1U8EA 2R9VA 3CONA 3ZCQA 2HF9A 4B32A 1TAGA 2QI9F 3QY9A 4PPGA 1S3SA 4ENRA 1CY2A 1M8KA 5JCJD 1UMBB 1RWWA 2XIQA 4HPWA 2ERCA 1IVSA 4F0JA 2VZ0A 4XKJA 2O8FA 2F9LA 2KB0A 2PQ2A 5EVCA 5C53B 1EBBA 1AB5A 4R9RA 4AP9A 4D98A 2EYUA 2ZXFA 1SEVA 5LZ5A 4GM1A 4AICA 2R8BA 5CFQA 3X1MA 1F17A 3E5HA 4HNRA 3MPUA 1J0XO 4TKVB 2V97A 3DONA 4JUAA 4IDBA 4NCJA 2RAVA 4TMVA 3ZGYA 3F7TA 3FPGA 3A4VA 4YA6A 2LIPA 2RGRA 3A9SA 3L18A 1TCAA 3SX4A 2JC3A 2F90A 2B82A 1AO3A 1IY2A 4LI3X 4RAOA 1NNI1 5KJFA 3JQGB 4D46A 1J4AA 4RANA 1RQ7A 3AKZA 2ATIA 1B14A 1I13A 1P7ZA 5CG2A 3GQVA 2H4WA 1SNYA 4X44A 4RHYA 5JSFA 3I53A 4KREA 1BH2A 1D2AA 1IK6A 4WKGA 1FB5A 1V5WA 4B7ZA 4F56A 2Y1FA 1AV7A 4JYMA 5M7EA 2BELA 3HYSA 1ZDMA 1SZJG 2ZULA 4LC0A 4RK7A 3V33A 4EUHA 4DDWA 7MDHA 2ENUA 1A8QA 4KBYA 2FHSA 3N87A 1BKYA 4QDJA 3KK0A 4PX2A 4UD2A 4G1EB 4Z86A 5B53A 1VCOA 3S1AA 5ERGB 2CMKA 5BW4A 2Z3ZA 3PQDA 3KZNA 4WNAB 3ETGA 4Z9AA 3OX4A 4UUMA 1X8LA 2FEPA 2I3ZA 4Y7DA 3EVDA 3MRVA 1QKKA 1IK4A 3AFMA 4FGKA 1D2EA 4P80A 3HDVA 2QJOA 3BREA 2SBTA 1FEZA 2J3QA 3EFEA 4QXQA 1F1JA 1H0SA 3S55A 1R3DA 1FW8A 1UBHS 1UK9A 2IHJA 3N3AC 2HWKA 3PQFA 3VU8A 1YZUA 2H1FA 2YBDA 3O8QA 4GICA 1U8AA 1WVIA 3LCCA 3MBIA 2BP7B 4L85A 1Y6JA 4JI5B 4D74A 4NBUA 4V0OA 5CA0B 3UPUA 1YASA 1I1QB 1OAOA 1NDQA 4UAVA 3RRYA 4PR0A 2NPOA 3PB3A 1I4LD 4ARCA 1LDBA 2WSYB 1R9GA 5FEMA 5IYZF 3IEKA 3B2QA 4QJ3A 1S3GA 4ILEA 4BO1A 4I19A 3OFJA 2EHJA 2HIHA 3KG2A 1ZCJA 3KVYA 4JB3A 4P08A 5IKPA 4FEYA 4M54A 4MPJA 2OV8A 4D92A 2ZBUA 4FFBB 2VRCA 3IJPA 2PKYX 1XNHA 1J0EA 1ZH0A 4YO8A 3D4IA 1Q1QA 3FAKA 4KLRA 4LGMA 3VAYA 1I0IA 1U2RA 2QN2A 2YRFA 5D1HA 5A4DA 2GEBA 2HNAA 1CUIA 5DRYA 3FDFA 1C29B 5J4HA 3H9QA 4HXFB 4BWYA 5LU8A 4K88A 5EESA 1IEWA 1O95C 4FFLA 1P6QA 3R20A 1TM3E 3GY0A 4HQFA 4MW4A 4WY8A 3QVJA 4MIOA 3ZN2A 1HR0B 4XGQA 2IS1A 2FF7A 4Y6PA 1LBIA 4ZDJA 4LI0A 3NWBA 5CCDA 1WDTA 4ZK6A 1DARA 5TE9A 4C6SA 3WWCA 2GXAA 3AVWA 1VL6A 2FVXA 5D5PA 5DTQA 5KQPA 2VF4X 2QVZX 4BFYA 3EZYA 2GRUA 4BNFA 1EXVA 1QDEA 3RAFC 1IBMB 1OC4A 2W2QA 1ZD3A 2W8BB 1GKUB 1WEKA 2D3WA 4NH0A 1KMNA 1QC5B 2JHGA 5IH7A 3QBVA 1P9LA 5EYPB 3VO2A 1CC1S 3I6YA 1KAQA 2EG9A 2UZ1B 2J08A 1KJNA 4FZ3A 3AI2A 2C2OA 4B46A 4I5GA 1JMYA 3AUXA 4DIEA 1Z26A 1R2QA 3GGSA 1MW8X 1GUBA 4KAFA 1Z6ZA 2CC2A 3JQBC 1E2KA 5HJ5A 3KLOA 4NJMA 4YJ3A 2QBYB 2OP1A 1QIGA 1RYDA 1PDVA 4IJWA 3LS2A 4YRIA 4CIWA 2D1YA 5JCXA 4GDFA 2DVMA 3KOYA 4YJHA 5JVDB 4NC9A 4P5DA 3UFXB 2BBTA 1Z0AA 2RGXA 2ZYUX 4YP6A 1OT3A 1XVLA 1VCMA 2C5AA 3MAGA 4YMHA 4KQHA 4XB1A 5H9VA 3TDNA 4DBLC 1IIRA 4G2NA 4L16A 1AO0A 4I1YA 1Q14A 2VDJA 1QB7A 1ZGBA 3TLGB 2EATA 4L72A 1IE3A 3WFIA 4INPA 1M8JA 2QE7D 1UBUS 3FYSA 2F1IA 5K3OA 1G1AA 3ROFA 4TZKA 1H93A 2XTNA 1F8GA 2DPLA 1KK1A 1NXSA 2D1QA 3EAGA 4TWZA 4XYGA 2B8TA 1BFDA 5HJ7A 3KYCA 4FHEA 1PGQA 2ILTA 3DP9A 4Y98A 5G0UA 3TN7A 2OSVA 2AD5A 4Y2JA 1VE3A 4NYJR 3RB8A 1CRPA 4U4AA 3EH1A 3KZKA 3RANA 3WV4A 4F84A 1TMOA 2OGWA 1C8KA 3DZKA 3ZBUA 2XB2A 2EW8A 4KAXA 4JBYA 5AHWA 1U8FO 1RLIA 4A1FA 4FR2A 5HDQA 1EU1A 2DERA 3GIDA 4EKNB 2FPIB 2GCOA 1C80A 2YZMA 4XIJA 2PSDA 3LBIA 3UUFA 1R0LA 2PFKA 1BKDR 1FDVA 4WN9A 2IE8A 3FCXA 1EWRA 3O0TA 4D1YA 4DCMA 3P8ZA 3QKUA 4K8RB 1OYOA 2QLTA 3G2JA 3T5AA 1EHIA 4OOFA 5B1SA 2O5CA 4ZVVA 3K6KA 1PT8A 1Y3DE 1BCSA 3LY5A 3OPVA 1EFHA 4XM0A 4J1TC 1BG6A 1RLMA 1VJRA 2ZM5A 5LQMA 5P21A 3NB0A 4B6SA 1XCPA 2GZRA 3F78A 2CFCA 4Y6RA 2VFAA 4EL5A 2AR7A 4YT4A 1DO2A 3BIXA 4PLTA 2V9CA 3IP1A 1A8PA 3WHIA 2MMCA 2BWJA 3G0GA 5HCUA 3TOSA 3ZWMA 4RXTA 4TS3A 4L27A 3TTXA 4Y9UA 1GSIA 4NSNA 1IQUA 2QRVA 3EDOA 4DQLA 1DXQA 2PLWA 4N3CA 2H92A 4B74A 5BV1A 3R0JA 3LV8A 4DMUB 3NGMA 3H9CA 1JKJA 5T3YA 3B1JA 1K4YA 1RYHA 2EX4A 4P5PA 1VM6A 1HOXA 3AXTA 4YJ2A 4ZMSA 4KFSA 3ZLUA 4B6GA 5B3AA 1YCDA 3I01M 1SGWA 3V1MA 1G4HA 2BBSA 4U9UA 1V5FA 1GQQA 1IN5A 1EFPB 2ZOSA 3PHGA 4Q6WA 4BZPA 5GZ6A 2VPXA 3ED1A 1HQCA 2NU7B 2VCEA 3HUEA 4FFDA 1Q0ZA 3W90A 3W2EA 3H3JA 4HGQA 4J0IA 3VMFA 4E5DA 1TZBA 621PA 4FMPA 3OP1A 4EFNA 2P1RA 4IV8A 2GSDA 4JI4B 5KYUB 2E4VA 3TWOA 4G89A 3TO5A 5BQXA 5ILOA 4PO8A 3KTFA 1WB4A 2FZLA 3C3WA 1F06A 4H1TA 3G5MA 2EDAA 1CNEA 1V11B 2HRCA 2ZRQA 5FV7A 1G19A 4X1YA 2GM5A 1GFWA 1F0YA 2ZRCA 2HL6A 5TGZA 3V8RA 4EHHA 3UHOA 2QKYA 1WU7A 1ZNWA 1EE2A 2GZ1A 3EQ9A 4I6JA 3ROEA 3HBMA 1FMTA 1DHTA 1K89A 13PKA 2VJMA 4OQZA 3L6UA 3PFFA 4GWLA 2VYFA 3FR8A 5K6TA 4OQ4A 4PZAA 2X3FA 4EI8A 1PNOA 3K05A 4A5SA 1JSXA 4JI7B 1NR7A 2IF0A 3LQQA 2PLRA 1NPYA 2VHCA 1QRRA 1EYZA 1KH2A 2GNAA 1G9SA 3DB2A 3R5FA 3NHRA 5T3UA 3VM6A 4F45A 3UMMA 1MN6A 4JJ8A 1ZOIA 3TZ6A 2G06A 3WJ7A 3RARA 4F21A 2NMVA 3GBSA 5AVJA 1HFJA 3D59A 1C0IA 2BAGA 2WK1A 1CUZA 3VGPA 1KDYA 1HDXA 4DXHA 2BGNA 3KEGA 2OCKA 1HC7A 2L2QA 3F49S 3PC2A 2HKIA 3DP7A 3SFVA 3ZIDA 4FFVA 4P84A 1ST3A 1CJSA 1GP2A 1JPJA 1F38A 3E5MA 3UIEA 5CA1B 1Y9EA 2XSZA 2O48X 4OPMA 2H31A 2H16A 4US2R 2CV1A 4CDMA 2IDKA 4I50A 2J87A 1NW4A 4YUZA 5ARBA 3TZKA 4HQ0A 1C41A 3GJTA 4FOTA 4HV4A 1N25A 1ZIDA 3HVUA 1PTJA 1I4EB 1P7PA 4Q4LA 5K6AA 5IFKA 3WNBA 4HMPA 5JJ5A 1UFKA 4TMFA 4BO9A 5CIYA 1CB7A 2BFEB 4J1NA 5IJXA 2PMEA 3SQLA 2VUIB 3ISVA 2VDQB 4L5AA 3BCSA 3PUYA 5MFZA 4UZEA 3L7IA 1NVAA 4EMSA 5IK2A 3TBFA 1RXCA 1ZM9A 4IF6A 4GPEA 3CH6A 4G1CA 4YJGA 3RUAA 5CYGA 1MB0A 1E6LA 3GNLA 3I04A 2IK8A 2PR7A 3CJQA 1TEZA 5G0TA 1HK7A 1X94A 5BW8A 3MRSA 4MIYA 3EXEB 3V8EA 1RM5A 5ALJA 2BIFA 2GLTA 2H7VA 3TR5A 4RKWA 3SJUA 1TA9A 4F5EA 1F8FA 1PI3A 4QBTA 3VX3A 2WPDA 10MHA 3EF3A 1NATA 2XB6A 3A9RA 3LFTA 1KEVA 2CVHA 3CRQA 4WY2A 3KL2A 3IUSA 1AXRA 2NV0A 1ZC3A 3MBKA 4OH1A 3OZAA 5J9FA 5REQB 1W19A 1Y7PA 4MYCA 4C21A 4IJVA 4DEYA 3CNEA 4LWQA 3UK1A 4UTRA 3WKCA 4XRGA 2JFBA 3U80A 2IX3A 4N65A 3SXPA 1IDN1 1QE0A 2C42A 3H7IA 2AEMA 2BY4A 1MQ8B 3T7EA 1E0DA 1GUYA 1W4ZA 1YS2X 3C8MA 3FTNA 3KEOA 5BOVA 4NXNB 2Q1XA 4QFDA 2OB1A 4B79A 1PGOA 1N6RA 4ZZ3A 1L5HB 1DKRA 1UZMA 3ENVA 3NAZA 3P4UA 4FCVA 2R1TB 2BGIA 1F2TB 1NA5A 3BTUA 1WCIA 3FVVA 4HH3C 1VJ5A 3RS2A 3ELDA 1IOLA 2PYDA 3FSEA 2QL6A 5A06A 1UJBA 3A2KA 2G5PA 3PE4A 4CQNA 4BCBA 3C0KA 1KF0A 2NO4A 3IKMB 3RVBA 7REQA 5I4CA 3R7WA 4CMHA 4EGCB 1L4LA 1DWOA 2J41A 2O8FB 1K6XA 1O94D 1GGKA 2WLTA 4CZ2A 4YNBA 1NP7A 3QITA 4BVBA 4DLAA 3HJRA 2R87A 2UZ4A 3N2IA 3PNVA 4DMRA 4YCSA 1TU0A 3ZI0A 4EEZA 4KWHA 2MR5A 4TT3D 1RAAA 2DUNA 2BFCB 1PR3A 3ABOB 4QNMA 4D4GA 4ZQCB 5JFTA 2GKGA 3GJ0A 3FVWA 3BIFA 2WMOB 1MB3A 4O2BA 4MINA 2JIPA 3PS9A 1Z7WA 3GQBB 1AGNA 3VO9A 3RVJA 1Z6AA 3W78A 3IUNA 1OPRA 2FVYA 2A59A 3BXHA 3OQJA 2HPZA 1SIBE 3NWJA 1FFGA 2NYVA 4YRJA 3QVGB 1NJ8A 1K0UA 3QX9A 5FQOA 3TAUA 5JS6A 3K09A 4AO6A 4CLHA 4QFMA 1O94A 1NMXA 1Q0HA 4LDRA 4BUJA 3R0XA 1V2GA 3AYZB 4YTEA 1W36C 4ACBA 1U65A 2JLQA 3A14A 2JA1A 1EZZA 2W00A 5I8ZA 1UC4B 5JC1A 5CPFA 2C5FA 4OXYA 3FMGA 2QQFA 3WGMA 4ZI7F 4DB4A 1ZP6A 1MX3A 3UV6A 1U28A 1M0SA 3A6PC 4MVJD 1C81A 2P6NA 2XYRA 5DBEX 1ISHA 1Y4AE 1V11A 2XT9A 3F74A 4GX5A 2JLVA 2ACEA 2FRVA 1ZA1A 4M38A 3F9IA 3RYIB 1OH5A 2FZVA 2NO7A 3U9SA 1J2JA 4PYRA 4FD2A 4YRFA 2DRIA 2IZ0A 4E4TA 4I4NA 2D4HA 4OUKX 2XDQA 5FLXA 4FTWA 2Q0XA 2XQVA 1UBCA 2DFNA 4IKEA 1L4KA 2GJKA 2X0EA 3VZRA 3FDXA 2ZUBA 1E77A 1JSZA 5JWHA 4CL3A 2VR1A 3GLTA 1XZLA 1RBZA 4FWBA 4PNEA 5TT1A 4WBNB 1Y8ZA 2I6QA 1WMDA 2JAQA 3VR3A 5F12A 2GEVA 5DNEA 1JR3A 1RRMA 2PSEA 2V7VA 3IDSA 3FI0A 3R6DA 1EQAA 5ALIA 1E6EA 2PCLA 1YNOA 1G5PA 1M6EX 3TTUA 5KBYA 2BISA 3DH0A 4YIHA 4ZGBA 4ENUA 2PIDA 4DCJA 1E5XA 4WOKA 3RQIA 1A2KC 1RWXA 1D8AA 4ZXPA 2YZGA 1UINA 1KPIA 2EZTA 2BDEA 2F62A 2AJLI 4XB2A 5CLIA 5KTTA 1E98A 1MAWA 3F6EX 1OMOA 3OEED 3SICE 1GPYA 4CL8A 4CNQA 1PFQA 3QJGA 2Y67A 4RK1A 1TQ8A 3M4NA 4FYMA 4GP9A 5EP3A 3VHXB 4TYQA 4X65B 4CT4B 1EJ6A 5G0SA 1BX0A 3AR7A 5JBQA 2Z6QA 1Z18A 3M4XA 3OCVA 5CW2A 2IV7A 1EUYA 4I99A 5IAJA 2A5YB 5J2TB 2GOYA 3DAGA 3DEYX 3N2YA 4EYOA 4BZWA 3V00A 2QMHA 5CDSA 2FOXA 5ITSA 3PGKA 1J07A 2H5LA 1BU8A 5DASA 2KPOA 1QYWA 3KJGA 2H00A 2IOYA 4DR1B 2Z2ZA 1SIWA 2VYVD 3GLSA 2GCGA 4B76A 2NU6B 3A0UA 4URWR 4F3NA 4HLNA 3D81A 4KGDA 4YAUA 4ZTZB 1RHUA 1W0JD 3ETJA 3KSMA 4ZYLA 1QFJA 1YZQA 3D3JA 4HNHA 4OXQA 1H3NA 1II8A 1H6BA 1T36B 1NVBA 4KWIA 4LHSA 4EB6A 2HEGA 2EFEB 5B58C 4QPJC 1UANA 4ROSA 3FDIA 3LO8A 3NCHA 2IOHA 3ADKA 4OA8A 2Q4BA 3MRXA 1LGYA 3WP1B 4EKGA 2WR8A 2KYRA 5FULA 3HM9A 2XMZA 1M1YA 4U8GA 2ZUWA 4UUQA 3GPLA 4AQYB 1UAAA 3GLFA 4UBMA 5FBVB 3QEJA 4DCPA 2JH8A 1WMFA 4H2DA 2HDNB 3QPBA 4YMUA 2WF7A 3FY4A 2ZAMA 1UKAA 2VSYA 4POAA 1MAUA 4BJ3A 3N58A 4WFKA 4BVFA 1WXQA 4KXLA 4LZWA 3B1VA 1LNQA 1BO6A 4OCZA 3TQSA 3SHFA 1WD5A 2Q0SA 1LLQA 1HE5A 1BJKA 1BOFA 2C3PA 4XQ0A 1E94E 2NO5A 2H2DA 1PVVA 5LM3A 4ENVA 5ESRA 1YJ5A 5AI5A 2B0JA 4FBMA 4WKPA 3V7NA 1JJFA 3B60A 4OAQA 3SHQA 3VSAA 4EBFA 2RJNA 2ZWIA 2W2XA 1GPJA 4R83A 4QT4A 1E60A 1EP1B 1XTJA 2J67A 3IBGA 4NMLA 2GM3A 4NNOA 4BL5A 2NUTB 3HGTA 1GVNB 4KXWA 3EMDA 4OV6B 4ID9A 2CWDA 3CIFA 1Y7LA 3W3ZB 2BR4A 5CVJA 4B2LA 2YL2A 1Y1TA 3DXXA 3HJAA 4N01A 3SHWA 4Q1BA 2VHXA 5COQA 4F3YA 1M34B 2HK6A 2AD1A 2FR8A 3S2FA 4N49A 4U2EA 4LUCA 1E61A 2DX7A 5JZBA 2ZTLA 1KYTA 1R74A 4V3CA 1Q1NA 4RD2A 3Q0TA 5AOVA 3LCMA 4MLDA 1NG9A 5EZYA 4UM9D 4P3XA 3USZA 3ZR4B 4RFSB 1ZW6A 4K8OA 3E7WA 3Q11A 2D7DA 3DC7A 5EIEA 1AHPA 2RJOA 2H2WA 2P9GA 3ROKA 5BN5B 4JP5A 2KE5A 1KE1A 1DTWA 4OB8A 5B30A 5BRAA 3WE7A 2D0DA 3QKIA 4C07A 4ND8A 2EBUA 4QPDA 5HKBA 2ZR9A 2Q7XA 4ROTA 3B53X 1A5TA 3E9YA 3HHEA 4UHCA 2FWMX 1L6IA 3F5QA 3DZIA 3S70A 5TS2A 2CGEA 5ALZA 1Y8RB 2AXNA 2X8JB 1E7RA 5U4QA 1VPDA 1JIXA 2V03A 1RAGA 1E79D 1UBFA 3D7LA 3EZLA 3N07A 5D86A 5IWCA 3E70C 4G07A 4Q9DA 2X0KA 4GQIA 4RHEA 2QRUA 5L3RA 3BGSA 4RLSA 4JOSA 4CNBA 3EZGA 3NASA 2B83A 1I1OA 4IV5A 1WHSA 4L5JA 1R37A 4RH3A 5SY9A 1VE5A 2VSNA 5ICGA 3EVEA 3FGNA 5KVAA 4LRTB 1TAHA 4FYHA 1SC3A 3ZCPA 2OSBA 3IB6A 3K9LA 4KZKA 1H0HA 3CH4B 3RROA 3H97A 4TLAA 4QU8A 4OY3A 1DBSA 2G28A 3IIMA 4MGHA 3WWOA 4PYIA 3RPEA 5HKLA 4DLRA 1ML3A 1I10A 1VDMA 2DHDA 2QT9A 5EZSA 3ZCXA 1MORA 1GAWA 1JAXA 2SKEA 4JVMA 1FNNA 1ZW1A 4PQYA 4PSDA 3AETB 2XUZA 3FVTA 5C7IO 2WB4A 3EQ6A 3OLZA 2Q6VA 5LQJA 1ODJA 3DDOA 1SPXA 1AX9A 4KQMA 4MOWA 1Y3FE 1X7ZA 2OGSA 1PCXA 2GZ3A 4MQ6A 4A8TA 4A0SA 5REQA 4DGSA 1FX0B 2QN8A 1PFUA 1JU4A 3NALA 4FYKA 4TYNA 3UK0A 2CEAA 3ENWA 1EVLA 4Y0NA 5HG0A 1KYXA 1JECA 5FUXA 2VPWA 4H4EA 1ZCBA 4N1AA 3AB8A 5LWQA 2EEZA 4X45A 4Y2VA 2Q46A 5EFZA 2R66A 3D6VA 1ZXLA 5TMBA 1NYTA 4BRZA 1U7PA 3R3SA 3HY6A 1FSZA 5G02A 1SB8A 1KO8A 4P4LA 1LI4A 2J59A 1XTBA 2WSIA 2X7HA 3JAWB 4CR7A 4JVNA 4D5EA 2IYVA 3VJRA 1QHYA 3OQNA 1KSFX 2UVPB 4FZRA 3FKSA 3H86A 5GINE 4KN6A 1VJTA 2OCDA 3TE7A 5CBPB 1PWYE 5IX8A 3V1YA 1GU0A 2IYLD 2CFRA 2WNIA 3JQGA 3DKIA 1DHRA 2PUVA 2BM8A 2D06A 3JCZA 5FO0A 5KYXB 1VXOA 2ZSBA 5J40A 2N75A 3U5ZB 1F7VA 4U6NA 3PPWA 4CPDA 1EGAA 4R1MA 1KQ3A 2AWNA 3LZCA 2QTZA 3HZOA 1XLTA 2P41A 4BMNA 1N2IA 5K2OA 1A8IA 2O8CA 1KZGB 4TRJA 1KH1A 1MRNA 4TKUB 2ZRDA 2OC4A 1IN6A 5ECYA 2X9GA 4PQEA 3U1BA 3I42A 5B1IA 1BA3A 2E1RA 2DQYA 3RTAA 3M5WA 1OBOA 2AJCA 3ZHTA 3Q8WA 3FNFA 5ALVA 2EKLA 3KS9A 4QATA 2ERYA 4W7SA 3GP5A 3M0EA 3UWMA 1U7ZA 1B2RA 4MA5A 2CVOA 3NLLA 1L1EA 1N5JA 2WYIA 3FUUA 4X7MA 4M9QA 3NOQA 3LPCA 4GX0A 4W82A 3FVRA 3GJ5A 4LOKA 2OYCA 4K1XA 4DQDA 2GRJA 3EK2A 4Q4CA 3X1JA 2QG4A 2EJBA 3PZRA 4MVJF 5GM1A 1LVUA 1NRXA 2ZJ2A 4MICA 2QM3A 4CLDA 4EDHA 2C2MA 4C2UA 2XA1A 3MTAA 3ONWA 3AT1A 2JLXA 3DAYA 3GRRA 3LDAA 3RIEA 1NF2A 1EESA 2OBMA 1V25A 3ZNPA 4IDFA 5ITZA 2V98A 2FJ0A 3OLYA 4CU5A 3PKIA 4ODIA 5HE9A 4L9RA 1WR8A 2HBYA 5EJ7A 3PTZA 3PX7A 1NBWB 2W9XA 4Q9KA 1UPAA 3C3YA 1YR9A 2V5VA 3WV5A 4DCGA 1RBQA 5FQNA 3KYDB 3KWLA 1OXBB 1VP3A 1ZZEA 4UUBA 4AT1A 2BJHA 1WULS 3LY8A 5E2AA 3OOHA 2GF0A 4PZUA 1GUAA 3QP9A 5T8KC 4BVKA 1Q1AA 3A25A 1DAGA 3ULKA 3L04A 2CK3A 4FYIA 4JJ4A 1K9SA 1KVSA 1R00A 1XYVA 3CO5A 1PR5A 4FBLA 5FIUA 3RVPA 2Z3WA 4U5QA 8ADHA 1UBOS 1A9PA 4FR0A 4NU8X 1Q12A 1Q3KA 4RSGA 4UCQA 3SXUB 5EJ8A 4PHHA 4CYMA 5I9TA 5HIIA 3ZQ4A 2IHUA 5JYBA 3EDQA 2OQVA 4JUDX 2GBPA 4ARAA 4AMZA 1XZPA 2V45A 4QUIA 3SC3A 5F23A 3MGAA 4B3RB 4G8DA 1NVEA 2CJWB 1RPJA 3ESRA 3OKFA 3KPYA 2P91A 2R8ZA 3D31A 4RHXA 1W0KD 3W77A 3VR2D 1JS1X 1U9CA 4GOXA 1JFTA 3TOZA 1VMDA 1RJWA 3DT8A 1JEEA 4YDQA 1E4OA 1JPUA 2GYWA 3GZJA 2C20A 5KVQA 3GOQA 4FS3A 2A1UA 3C39A 3AFIA 4H1VA 4TRMA 4EFDA 1KBOA 2JDIA 1VG1A 2VPPA 1AS3A 1Z0FA 3WJAA 1A04A 4D9FA 4FIDA 3QQPA 5ARCA 5JJLA 1BFKA 1JLHA 4UARA 1MABB 2E85A 4DXDA 4RVCA 5A4FS 2YJ5A 3RYCB 4BMPB 2JLUA 2HJWA 2PS0A 1UAGA 4OIFA 2JLSA 4X20A 3K3PA 5M34A 2DBVO 1K2WA 2Z3VA 1XCMA 4GPAA 2M6KA 1XQWA 5DIZA 1OLSA 4DREA 4L4UA 1U3UA 2CJFA 1USKA 2GA8A 1VYVA 3E05A 5EEHA 2DFLA 3S0JA 5ESDA 2H52A 3M6MD 1SOWA 2RGNA 2ZSJA 3PVZA 3QPUA 4EYKA 4MROA 1T9GR 2VT3A 3OFVA 3OKAA 4ITUA 2AL7A 2Q62A 2JD0A 3WLFA 1H8ED 4J16A 4PGGA 3RC9A 3I0NA 1E9RA 2RB4A 3AUSA 3KVOA 2JA2A 1T4GA 5LZ8A 4KDFA 1A96A 1Y5RA 4KXXA 2I3BA 2XUQA 1PKEA 1YSCA 1QCCA 1TVEA 3LQKA 5C8ZA 2IS6A 2IELA 2XGOA 3SBEA 5DWDA 1KSJA 3G2QA 5FEUA 2P5UA 3VZQA 4YV1A 8MHTA 4ESOA 3DQZA 1Q5PA 1TKAA 3H18A 4LPKA 4PLVA 1ZJZA 3DBLA 2OXFA 2Z43A 2ZTHA 4H6PA 2AN3A 1PRYA 2RGCA 3JQDA 3X2SA 3IHTA 5K99A 5DLDA 1M67A 2P77A 2XYQA 5LDHA 1BXKA 1YA4A 4UTXA 2C4MA 4A3SA 1PZFA 2XZTA 4UPVA 4NFYA 3ZDAA 5BSFA 1W8IA 2HM7A 1OE0A 3LWZA 4IYRA 4PYKA 5FOWA 3UTCA 1XA3A 3EOAI 4PAWA 1AC5A 4AZ0A 1VKOA 4GR5A 3VNUA 4QICA 3ZXIA 1HRDA 5ED0A 1K7SN 4CIVA 4YLGA 2YWXA 1PE0A 2CYAA 3HV2A 1H1TA 2PRJA 2VATA 3O2SB 3PNBA 4HY3A 2H5JA 5LQDA 1J49A 3EQZA 3N6RA 3BDIA 1FUIA 3FN4A 4LVOA 5A9SA 5DLYA 4IIJB 2BFDB 3DAOA 2ISQA 4GGPA 4JJIA 4QYXA 4TS1A 5HILA 2GCIA 2XZOA 1IY8A 1TA0A 2IIVA 2RH5A 1WXGA 4IJ6A 2ZK7A 1VBFA 3SZ3A 4RGBA 3ZHXA 1R64A 4QQNA 3W7VA 5C7LO 3IOBA 1GSAA 2QQEA 1H1DA 2GB4A 4UEOA 1VJ0A 1SHTX 5E1MA 1AKNA 4JLJA 1GAQA 3C4QA 3I72A 1O2DA 1MOSA 1OX4A 3EIHA 1Y8QB 4YB8A 1ODKA 6YASA 4KQEA 2O8CB 1XK6A 2VP4A 2ZR8A 3AEYA 5DTIA 2JGJA 3DJYA 4JBLA 1UOQA 2Y1KA 5K8CA 2X0JA 5KOJB 3A4MA 2H4YA 4EATA 1WIWA 3NWEA 4U39A 5AVSA 4UW9A 5CJ2A 4YMSA 4ABYA 2F3SA 4QRDA 4CG3A 3WGZA 2HK7A 4TZ0A 1N57A 1ZKDA 3OSZA 4DMCA 3EFBA 3EPPA 4I2NA 1RC1A 1DQSA 1DX6A 3U13A 1XHEA 5AUQA 3MCZA 5J4KA 4N7BA 3M4JA 3GAFA 1NVMB 3WRWA 4E94A 1AXEA 5H70A 4WADA 4QJ5A 2P9QA 2YWEA 4C29A 3KEFA 2H0QA 4XVRA 3TX6A 2CNNA 4IGIA 4LZJA 5H8WA 4J43A 1OWOA 3SDBA 3QUQA 1RLOA 1YKGA 2QYTA 3H2SA 3H7AA 5C4GB 4D44A 4WT7A 5LKRA 2MIIA 4RESA 1T4DA 4UE3S 5TQ2A 2O7RA 3OCCA 4RH0A 2HQSA 2H4JA 3CRVA 4YRGA 3TVTA 1GPAA 4C2AA 1UPCA 2FMIA 3VAZA 2JHFA 4X0EA 3FOAA 4XDZA 4B2PA 1SMKA 221PA 2PRYA 4E5NA 2E37A 1E1RD 2EL9A 4MKHA 2QM0A 1XA4A 4EI2A 2WB2A 3TD2A 1MPXA 1UPXA 1X70A 3D1LA 4FQ8A 4IQ8A 1W48A 3AJDA 3AEXA 3WGOA 2VRCD 1Q50A 3OMXA 3K7EA 4RYDA 4N5IX 3ICWA 4JLDA 3GOHA 3MFQA 1RRGA 3T9DA 1KNQA 2H7CA 5FO1A 3PXEA 2HV9A 2C4VA 3G79A 4IOJA 3HWWA 5AXCA 2FCRA 3AH8A 1SB9A 2H0RA 3BH0A 5K45A 1RC0A 4LWZA 2HC9A 2NIPA 3UJ9A 4D45A 3CS3A 4CKZA 3U9TA 3RYCA 4ZDWA 4FFOA 1P4AA 2IOQA 3BERA 5E3HA 1YULA 2JBAB 3L8MA 3B3FA 4AJHA 3R3JA 2BI8A 4BNJA 3ZWYA 5FI0B 3SX0A 5PNTA 4RY0A 1KL7A 2DCUA 5DKFA 1EGQA 1V41E 1YKSA 1XL0A 3MUFA 4EF4A 2AFHB 2AUMA 2UV8A 4AQ7A 1JSCA 4PXYA 1YJQA 3HPRA 3LLUA 4E46A 3KKEA 2ZJZA 4CMCA 4LF9B 1V8DA 3EF0A 1VE6A 3WRYC 4ZCRA 3O1JC 3H9JA 2Z5FA 3AEZA 1XRMA 2B37A 2JCYA 1V1MB 1FTQA 4CDRA 1PLLA 3HRIA 5BN5A 1ONSA 1D6SA 5E8RA 3WSTA 1UK6A 2ASVA 1L7BA 3C5HA 3H1BA 3ODGA 3PYLA 3THXA 1W4AA 1U6KA 4KIJA 4XPZA 2GETA 1VKRA 4HDNB 3TS1A 3WIEA 2AMLA 3ZV4A 3BCRA 3F73A 1ZONA 1JU9A 2IXTA 2WEKA 3LU1A 4HH1A 1U31A 1Z0IA 1BRMA 1U2EA 3CBGA 3GEMA 3I5AA 2GD6A 1VPLA 3ASUA 1LD3A 4UBLA 5AW5A 2Y2UA 3UO8B 3PNPA 3NHSA 3F7OA 3WKAA 3DV9A 3EC1A 1IBRA 2QLNA 4GUAA 4L0MA 3S2YA 4G0QA 1Z38A 3LXXA 3OJ0A 3FNEA 1DT5A 1YZVA 1HOTA 1YBVA 2BGRA 3L82B 1P1FA 1U6IA 1USVA 2IW1A 4DPLA 3IJRA 2OV6A 5HGXA 5TPWA 2N1MA 3O4RA 2C2KA 3SF8A 1N78A 4N5MA 2WYWA 3LCUA 2Q8NA 4JL5A 1FLDA 2QTCA 5GGXA 1Y6GA 3ABQB 4KKXB 3KKLA 3MJFA 2O5RA 5KU7A 1CR4A 5JDCC 1KOGA 1O1YA 2ILVA 3ZD8A 1SWWA 1C30A 3FYCA 3PFBA 1FDIA 3EWAA 2YVKA 3JQFA 2IYQA 1QG2A 4R6WA 2ABWA 4LMBA 3RJ5A 4WBSA 2PKEA 4JYZA 1S2MA 1LDGA 2D2IA 2OQ2A 2QL7A 1I2ZA 4L4YA 2A0KA 1MGPA 1S2GA 4TMWA 3X44A 2HJRA 3O3CA 4KLAA 4IIFA 4UXIA 1UC9A 5KTOA 4UUPA 4PAMA 4KFCA 4IEFB 5JCJA 3L7KA 5UKDA 4J49A 5JDCA 4DA4A 3BGDA 1OIWA 1Q7BA 1E5LA 3VU9B 4X91A 1TUEA 4MQFB 1E4YA 3CMCO 1EX1A 1QH8B 3LKDA 4MCHA 4QJIA 1YIOA 3GT0A 4G4JA 3ZY3A 1N7IA 3I9JA 2Q5LA 3UWSA 3ZGOA 4K1LA 3BHMA 1RYYA 2WQ6A 4DUGA 1TLFA 4HGZA 3BTOA 4E3ZA 4AZSA 4DSZA 1QYDA 2AWOA 3CW9A 1Y33E 5AOCA 3F6RA 1PLKA 1I1NA 1RIFA 3DWGA 3R5JA 4EYSA 1VLLA 2QYOA 3JVUA 4EG0A 1Y80A 1ZR4A 1Y4UA 4P32A 1ZHOA 4E11A 4KQ1A 3WLSA 4QQFA 2POQX 3PE6A 2LV8A 3REFA 2NZWA 2OXEA 1ZU5A 4E31A 3BSFA 4PHFA 1KRXA 3BM5A 4GIBA 5IZCA 4CIBA 1DDGA 2OKCA 4WL0A 3SQNA 1DRUA 4IZIA 3HY3A 3KKMA 3LUKA 5F5LA 5JD3A 2WT4A 3E3LA 4DMGA 4IVNA 2GPWA 2Q5FA 2J3DA 3ECAA 4DLLA 5JEEA 3B1KA 2QAGC 1PWEA 2LWIA 3E2MA 4B3HA 4OXXA 2R79A 4IHJA 1AUPA 4MHTA 3O03A 1KYIA 3B6IA 3KVVA 4RQBA 1ZK3A 1JVNA 4WRRA 2VBIA 2HRZA 1BXGB 3IPAA 4V2UA 4QASA 3VYSB 1JQKA 4GPTA 2CHQA 4WLOA 5JH7F 1TMYA 1KOLA 1NDHA 4YPFA 3FHOA 3ZWNA 5DZSA 3V32A 3VPHA 1QIFA 3EQ7A 5F1YA 2JH3A 2WIBA 3NBFA 1DKQA 1G42A 2H1IA 2PL1A 2ZBVA 3OT4A 2IGTA 3EG9A 4IX9A 3RYHB 4ZN6A 1YB2A 1K63A 2B98A 3B1WA 1X39A 4XUEA 3NTRA 4ENTA 4F2HA 1U8XX 1DRWA 1L5WA 2XCSB 4Y1RA 1RJFA 2X0NA 5DLQC 1L4HA 3AETA 5ICEA 4PO1A 5F33A 3KJXA 1WP9A 5HS6A 3RBVA 3AVXA 1XQ6A 1NKSA 1IMOA 1CY8A 2BVNA 3U09A 4MP6A 3AHCA 4QYIB 1VL1A 4MUYA 2RC6A 3LGAA 4H31A 1GSOA 5ECDA 1C1DB 5TPZD 3HGMA 2PH1A 3T7RA 3CWZA 3K9CA 3ONVA 3TUIC 5KQRA 1DMRA 4FMCF 4J75A 4UULA 4WX2B 4JOQA 3UA4A 1SEPA 3DWIA 5JSZA 1RBMA 2IDJA 1P2GA 2SCUA 2X14A 4FOSA 4KRGA 1N5OX 5BQ3A 2E55A 3RKRA 4XXHA 4B3BA 1VLMA 1WVMA 4DLTA 1EUCB 1J0DA 3KT6A 1QJCA 5LC1A 3NPMA 5KKAA 3SNHA 1EFDN 1EXDA 2PXCA 2DUMA 1H69A 3OCYA 1CZHA 1FTNA 3PZBA 1QZTA 3LUBA 5AJTA 1E1RA 2X1MA 1ABBA 1A9QA 4IHJB 1NVDA 4PYMA 1R6DA 2CDRA 3T15A 1ISGA 4RHFA 2FXIA 1ESEA 4MQUA 4ZVRA 3N5KA 1X80A 1W8DA 4M49A 3WAKA 1W44A 1K7XB 3GFVA 1IL0A 4DQUA 3H4VA 5HNKA 4W9MC 2O8EB 1EFCA 1E2IA 3AY3A 2WTMA 1QV7A 1LBSA 1NBEA 2Z09A 4ZVSA 1ZCAA 3BF8A 5GOTA 4EGFA 2JI8A 2DP4E 2X2EA 5SZJA 1U9IA 2I8CA 3F0TA 3P96A 2DMRA 4G84A 3GCGA 3UG7A 3HUDA 1A2OA 4XSHA 1G6OA 2DKNA 5TR9A 1TF7A 3EGVA 3I30X 3R5SA 4RMJA 2E21A 4N7RA 4BQPA 3LQ4A 3S5JA 3VRHA 2TSYB 4BUZA 2I6SA 2OM6A 1FJGB 3MWEB 1JHQA 1ZK2A 4J16C 3RI3A 3IDQA 4Q7QA 3WB1A 3O1HB 2AVNA 1ZI6A 4IO1A 3E5NA 1EWKA 721PA 3KO8A 3VNAA 3E82A 1S8FA 1M54A 2O0KA 2F1HA 2EP5A 1GXSB 1ZJJA 3OZ7A 5C32A 5C4MA 4W5QA 1U2SA 5LQSA 4XASA 5EIFA 4YMGA 3FOFC 3T95A 5FDFA 1JWAB 3K72B 4AG5A 3RUEA 1G8FA 1FL9A 1KZ7B 3AKDA 3FZNA 4DSTA 3LVQE 3WWEA 2FQQA 4BFTA 4Q93A 1OLUB 3C7KA 3LYHA 1WKVA 2NZ2A 1DG9A 1QHEA 4UJ3A 3KWJA 4FI3C 1RABA 3MGCA 3U49A 1COZA 5DOVA 5LUAA 5JD4A 1NNLA 3PFWO 3IA2A 2BZ1A 2XW6A 1DIRA 1SQGA 3PRKE 5SYNA 1K06A 2J4DA 2P7HA 3K2EA 5JXHA 1KI1A 1ONNA 2P2YA 2WZQA 1TMGE 2IX9A 1V16B 5H4HA 1GILA 2QT0A 3ZU6A 1ZICA 3LVFO 3GL9A 3EX7C 4XD7D 4IIGA 1KARA 2QTMA 4BP1A 2JH9A 3TD6A 3H2IA 1SCNE 5DTMA 5HIAA 2LP4Y 1ZIYA 1AURA 3FGPA 3GJ3A 2YVUA 2F17A 2ZCUA 4C7JA 3DNMA 4ZAFA 1NI4B 3NFYA 3B9PA 4P4GA 4A23A 5GVRA 1BYUA 3AV3A 3QKRB 4W5TA 3CVVA 1Z8DA 4B4KA 4P8RA 2WPDD 3BMCA 4DLSA 2QLLA 2DT8A 2XR1A 3D4LA 3AR4A 4IX1A 4YCAA 3PJDA 2C8JA 3SMQA 3CEJA 1E6CA 1HLGA 5CAEB 3V7UA 1U8TA 4LYFA 3K31A 3IAM1 3ZW9A 3QI7A 3VSEA 3QXJA 3G82C 3OZTA 2CY0A 3V6LA 2OO5C 4QPPA 4BVEA 1QIHA 2RAUA 4QQ8A 1GCIA 3UMFA 1YFJA 5B7PA 5LIRA 4S2EA 3UOAB 2VP5A 1YA6A 2P5YA 4NHEA 4RMIA 4WW0A 4FS8A 3F5DA 3GRVA 3H83A 3EC2A 4CG0A 3FYUA 3CQ9A 4K9QA 3OKCA 2I80A 4EW1A 1N3LA 3CE6A 1R8XA 3CKKA 4MYSA 4IILA 5FWYB 1DBPA 1EH5A 4MULA 5FJJA 3WMXA 4C0HA 1G9XA 3ZOKA 3WLKX 5AUNB 1XP5A 3GFFA 4OQNA 4YHHB 3UC9A 2IV2X 4ZQGA 3R7NA 3GJ6A 3LFUA 2B2NA 1YA8A 3QENA 4IHAA 3PTLA 3FAZA 2ORIA 1O5OA 3NETA 1D1SA 4LGYA 4IVQA 2JLBA 1PR1A 4AULA 1L5SA 4N6GA 4GBJA 4DWOA 2VPZA 4KKVA 1BHSA 1SOMA 2WICA 1NSTA 3O75A 3BIWA 4G2TA 4GI5A 5CHYA 5ESWA 4DG5A 1YCGA 4P3NA 2E4UA 2QY6A 2CV2A 3WL4A 1OFGA 2H11A 3RS8A 3OM1A 1J5PA 4M0LA 2P9BA 1G8KA 5JXIA 2VAMA 2A5JA 1VHQA 4LNUB 1BJTA 4IXWA 2OZVA 4XCQA 4ZQHA 1V6CA 1P8AA 1MT3A 1HLPA 2GI4A 1JPNA 2IEYA 3ETCA 3KR2A 4TPKA 5FNVF 5KHAA 3UN1A 3PXGA 5JJCA 3JQCA 3W5CA 1GGMA 5BN4A 3TNLA 1RU3A 3IQIX 5FUBA 5U4XA 1AVTA 4RFVA 2ZIAA 5I7FA 2ST1A 5D6NA 1L7EA 4BJ1A 3LPLA 2H2IA 1U0RA 1LNSA 1DXYA 1CY7A 1XTTA 4MRMA 4F97A 3SF8B 1WPRA 4G24A 1XJQA 2WSSA 3Q7PA 1D7OA 4GMHA 2GWRA 4HWGA 4CIXA 2AQKA 1Z0KA 2VTVA 1U4OA 3FMVA 3BCUA 1SHZA 3G0CA 1PJAA 2GJ8A 3KU1A 4NAHA 2I7XA 4QDZA 4X60A 3TLMA 2ZBFA 1HL3A 4BYMA 2BYTA 5AK3A 1G21B 3G9TA 3MOIA 4YCJA 5FI1B 3VHLB 5HVNA 4BFUA 1ZUIA 4HFRA 3N8IA 4M0UA 3E1GA 4NYIR 2VYND 3IT3A 3K70D 4S0XA 3VC7A 4LBWA 3LT0A 3AHDA 5K2MA 3FHTA 2L17A 2O20A 2CJPA 2XKJE 3NANA 2PG3A 3DEKA 3FGOA 3M3DA 5EJMA 4XIGS 2V7QA 1R4NA 2FR1A 4X93A 4QM7A 2B8WA 2JPDA 4JLSA 2FUEA 3PU6A 2QZ9A 5E9AA 2N1BA 4NQZA 2PSJA 3JD2A 2Q6TA 4DSAA 4JC4A 4R2IA 1GPBA 3LP5A 4A03A 5F98A 2C3OA 1I32A 1Z25A 2Q5OA 2AN5A 4XDHA 2HQOA 2PQMA 2FPRA 3DLAA 3G8AA 4UVHA 5EUMA 5GJCA 2E7ZA 3ZEAA 4MGIR 1O0BA 3TLEA 3TZEA 1OXXK 1EEXB 3KAQA 4AP6A 3TUZC 3DOOA 2IU4A 1LJLA 3N7UA 1JMKC 4MVJI 4DQKA 2NSLA 3VDXA 4EG5A 1X92A 2QX6A 1WZIA 4G56A 1RZUA 4P92A 3TZHA 4IGFA 4BGVA 3NYRA 4HO1X 3ZQUA 7REQB 4DC9A 4RJTA 5KDLA 2JGNA 1TJ3A 2P9EA 4WK0B 3I62A 1PJRA 4MWTA 4AD8A 2BKXA 2YYYA 1VPVA 3OE7D 4D81A 4KXVA 3UUWA 2DULA 1YJCA 3K8YA 2TECE 1MEEA 4AUNA 1PQWA 2WM3A 2CDCA 1QZUA 3JARA 3S2UA 3UK6A 2Z2YA 1DT3A 3LJKA 3GLHB 4D9IA 5E4FA 3FHJA 4GZMA 4XGRA 3S7ZA 2AW5A 1P6UA 1UWVA 3GROA 2AR0A 3A36A 3H16A 4KMRA 3BJRA 3WGLA 4PZ9A 4XQCA 4RTNA 5I8WA 5EN4A 3L0OA 4FJ1A 3K1YA 1HM5A 3QUBA 2QP4A 4MRNA 4ZICA 1U04A 2ZBRA 2RBGA 3K35A 5L8VA 4DV6B 1XHLA 4B5KA 2WA1A 1ZMRA 3KDPA 2D5LA 1SCUB 4OGKA 2PWAA 5FFFA 5JYDA 1AHHA 1GEGA 1QHXA 2EC5A 1E89A 3DB1A 1T3TA 5C8XA 5BUZA 3W8DA 5L4SA 1E4EA 4AZ3A 4KLNA 3WGNA 1DTSA 4CLEA 1P2SA 2XCOA 1QVVA 1W4RA 1ZGZA 2A3NA 1Y8AA 4GZ5A 1C3OB 3E7DA 4YP1A 5JARA 3PFHA 4K2AA