3RAFC

Quinazolinedione-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/dna/antibiotic
molecule keywords DNA topoisomerase 4 subunit A
publication title Inhibitor-stabilised cleavage complexes of topoisomerase IIa: structural analysis of drug-dependent inter- and intramolecular interactions
rcsb
source organism Streptococcus pneumoniae
total genus 59
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rafC00
3LTNC 4FM9A 4Z3OA 4KPEC 1BJTA 3RAFC 3KSAC 2XKKA 3QX3A 4KPFC 3L4JA 4G0UA 4G0WA 4I3HA 4J3NA 4Z53A 4KOEC 5EIXA 3RAEC 2XCTB 3K9FC 3FOEC 2XCOA 3L4KA 3RADC 2XCRB 2XCSB 2RGRA 4G0VA 2XCQA 3FOFC 3KSBC 4Z4QA 1BGWA 2XKJE
chains in the Genus database with same CATH superfamily
3QM1A 1T2FA 1I1HA 4QU5A 4XIIA 2HUPA 3NO4A 1X1DA 4TKLA 1JXQA 1G8JA 3RYCA 4PPNA 3DDOA 4PHGA 4RZ2A 2AI2A 1A9XB 2RHTA 1QH1A 1VCMA 3GAZA 5E2IA 1OPRA 3R5FA 4CZ2A 5DV9A 2IA5A 2Z95A 3ND9A 3OT1B 3THOA 2BZGA 4K0KB 4WDRA 2FN7A 1M1UA 4TV8A 4Q3BA 4RV4A 2FG7C 1EIWA 1G8KA 1N5LA 1R8XA 2YXEA 3R0VA 3EPLA 4N82A 2JLWA 1XZFA 3RSLA 3ORQA 4DFDA 2GWHA 3PU6A 5B2FA 4Q12A 2ZULA 1BN6A 3O8OA 5K03A 1BH6A 1KC1A 4UM7A 2JLZA 2FMXA 4D92A 5BYKA 2QPOA 1S3GA 4JR1A 3FE2A 5FYQA 3R8XA 4TUYB 2WWRA 4J9VA 5EHGA 4R8MA 3N28A 1YB5A 4D98A 4J0EA 2DQSA 1WKBA 2XUAA 3VPGA 3GWGA 1NVKA 1VA4A 4I4CA 2UUAB 1MB3A 2G6TA 3DAPA 3S2IA 2FEMA 2YJGA 4B74A 2FMKA 1IHXA 1L4FA 2IKQA 2PZMA 2GCNA 3OY2A 4K6FA 1E2KA 3QU9A 5ICGA 4QXPA 1C2TA 4XRRA 4IIVA 2QPAA 4X85A 1BMDA 1YB1A 3EXAA 3C85A 1FNBA 3OTWA 4AKIA 5DU2A 6NULA 2F3QA 2BBSA 4I4IA 5FORA 3MEQA 2G0TA 1NLMA 2R79A 4Q34A 2JFBA 3I64A 2K2WA 1U2SA 3E8SA 2FA9A 2YWGA 3PVZA 4PNZA 1NAHA 4KYIB 3CPSA 4NS4A 1WZEA 2B2CA 3OEEA 2BCJQ 4KU4A 4YREA 3VHXA 2EFGA 3VJMA 3CA8A 3ZKWA 2GX6A 2XE7A 4D46A 3KQUA 3QK7A 4JOQA 2XZTA 4R1OA 5JCJA 2QG9A 2B5VA 2BOVA 2MHCA 2MDTA 2V6JA 4D4MA 5KYWB 2HZBA 4KYVA 4R7ZA 3DVSX 2O2GA 1VPVA 3ZQ4A 1NV8A 4Q4HB 5IZCC 2H00A 4CM9D 5JZSA 1V8FA 4L02A 5LQJA 1LTHR 4D0GA 4QM7A 3BC1A 4FMDB 3NZEA 1E1CB 4WA8A 1X0XA 3E7PA 4KFCA 3M6WA 1COWA 1ONPA 1FFHA 1G41A 4NDZA 4LYJA 2PMFA 5B7PA 1PR0A 1B00A 4KE8A 1OFVA 1CZHA 3ZWVA 1P4HA 2C82A 1ZUNA 2JI9A 4D97A 3ZCSA 4LF6B 3OZTA 4O4IF 4YLGA 4A26A 3A11A 2O5RA 3SBXA 4GBGA 2C5HA 3SNHA 1SZDA 3R74A 2O8DB 5H82A 3M4JA 1BWRA 1RHQA 5SV2A 3SXJA 4DE5A 4IZ6A 3ETEA 3L0SA 4FWIB 3NBQA 1PWZA 4D9MA 1RJFA 3QY0A 1JHQA 1SN7A 5LKAA 3I04A 4D6XA 2VS1A 2HBYA 3DVQX 4HX9A 4AKEA 1YR7A 3EXG2 2VL7A 1NYTA 4HP8A 2CNDA 2O1XA 1SA0B 5BV8A 4I50B 1QV9A 3C8UA 3O1IC 4MUIA 3R20A 1JSRA 4ETIA 1PU2A 1THGA 2NU7B 4ENPA 1C8LA 2BRUA 2D59A 2X2PA 2XVXA 5TJ9A 4EBFA 4OFXA 2RGGA 4RYLA 2K6GA 4I1OA 2ORIA 2CCGA 3P4YA 4H17A 3X1KA 4D4GA 5CEFA 4MVYA 1QIEA 1JL3A 1CNMA 4NV3A 1DWPA 4M38A 1AN0A 2EBFX 3INTA 1XMPA 3TZCA 3OEHD 4YJHB 4I2NA 2GCPA 4L1KA 3DO8A 1Q14A 2DMRA 1EVZA 2H59A 4OFZA 4YAJA 4KHPB 5IK2A 1BS1A 2BGMA 2ETXA 3DDUA 5CVCA 5LOVF 2I2CA 1C1DB 3PC6A 1VKNA 4L8VA 3VX4A 1JHXA 3GEMA 3KKPA 2CZGA 3V46A 1P4GA 1TK9A 2WPNA 2F4NA 3ZIUA 5CLFA 2LW7A 2DWOA 4P81A 1Y5NA 2X19A 3KQTA 4ITUA 4IV0A 4O3FA 4PSDA 3SE7A 4F9FA 1ADJA 1Z8HA 2BW0A 5KNDA 1PEDA 1CRPA 3V2GA 1LDEA 1E64A 2WKPA 4RK4A 4X8HA 4YBRA 4BC0A 4ZGWA 3VC2A 3ER8A 4CV1A 2HNAA 3MTJA 4EB8A 1YMUA 2ABWA 5D85A 1LCIA 1N2CE 1T3HA 4PQFA 5B37A 1ZC3A 3LY9A 1T10A 2VHQA 4K2HA 4PLCA 3PITA 5IARA 3MFYA 4X92A 5EJIA 1E2HA 2PBZA 3M2TA 2XV1A 4JN6B 4KN9S 1RKBA 2AVNA 1WCV1 2CHUA 1TT5A 2C95A 1MQ8B 2XUFA 1NFQA 3BFPA 1G3MA 3U40A 3W34A 2G17A 2P75A 4PZ0A 1E0DA 2MCFA 3EBOA 4Z3OA 2RAVA 3BM5A 3A4MA 3K6SB 3M6LA 4UNPA 2Q3FA 4BXOA 3GOHA 1KNXA 3A3YA 3MWKA 4L4YA 5CYGA 3CUEF 4DDHA 1M6VB 4KXYA 1NVBA 4ID9A 3TM4A 3NVDA 4FYIA 3LLVA 1EHYA 1IHDA 3DZJA 4AJEA 2PYIA 3EDCA 2IU3A 5CURA 4FKZA 2PUAA 2UVPB 4KODA 4RORA 4QLOA 3ZVKA 1ZH0A 3OJXA 3DAGA 4J0IA 3P2YA 4KIUA 1NRXA 2DHEA 1DBQA 4IDBA 3SC3A 4BO9A 2A5YB 3CRVA 5FFMA 3QV2A 3MCVA 5ITWA 2XCIA 2QIOA 4YJ2F 4KLCA 1SXHA 4HH3C 3PC7A 1RI2A 3E58A 4HAYA 4L0DA 4URFA 2GYVA 3BCSA 3DBIA 4RNDB 4S04A 2F17A 3L0ZA 3L1UA 2QE6A 1E7YA 2JJ1D 2DSNA 2G5PA 3G8YA 4LE1A 3W6OA 4GDFA 2BPOA 3O75A 1KZHA 3K09C 3RVKA 1UBSB 3I52A 2YDXA 4OUDA 1IVSA 1PZGA 1QIJA 3PZBA 3LKBA 2C3OA 2EX4A 3U7EB 5KYYA 1Z06A 2IS1A 5H4GA 1JBQA 3EK2A 3EA5A 3OLXA 3VSAA 2D5IA 3B7PA 4K26A 5JATA 1W87A 3O3CA 4MUXA 3Q9UA 4GI7A 2ID9A 3MQFA 1G2IA 4J9UE 1B3RA 2GEFA 3TPZA 4U2DA 2CHEA 3DZBA 1HNWB 1KVRA 1JHZA 1R0YA 4EYSA 4C3UA 3I92A 3PLAE 5FPTA 2NAFA 5EKTA 3U44B 3NBKA 4CDGA 4BBJA 3ZLJA 2OC4A 1XZIA 1EDOA 5BSGA 2TMYA 2HWKA 3C3MA 4H16A 4IKOA 4PGHA 2GBCA 3RM3A 2PUBA 1L9XA 2B5WA 2B82A 3ZVMA 4W5JA 1QIHA 3BXOA 1VJRA 1Q2XA 1G2QA 4FIDA 2OZPA 2VWQA 5K3OA 3ZE6A 1G5HA 5DIFA 1OROA 1ZJJA 1Z4OA 2JDIA 1HT0A 1NU8A 5G1PA 1RHUA 1TK3A 4FOSA 2Y76A 4IQ0A 1BMQA 2G08A 3FHJA 1XQXA 4KRXA 3GFBA 3LNCA 5CK5A 1K92A 5HK8A 2ZPTX 1YRQA 3VR5H 4XH9B 3ZDXB 3R3SA 4FNGA 1LZKA 1XPRA 3SJBA 1S7GA 5EWLB 3LO5A 4IHJB 4GVPA 4S2UA 4US1R 4UU1A 4C2TA 1IHUA 1MIHA 1PR4A 2P35A 4DMFA 3AUUA 4RJJA 1CUCA 3RYTC 3WE7A 4B7AA 4DA0A 5BQ3A 4KXXA 2F3SA 1UPUA 1K4MA 2YFKA 4TRNA 3R9KA 4B4WA 1L5ZA 2AJ8A 4CM8A 1BW9B 3CZ5A 3I34X 6GPBA 2BL4A 2VDNB 3VZDA 3DKKA 1OC2A 1ZNXA 2A57A 1ONNA 3WMRA 1WDLA 3T3IA 4U7FA 2MYUA 4BV2A 4N5DA 1LLDA 4H2DA 1E6KA 1TLLA 4N18A 4NG5A 1VG1A 2KQUA 2HI0A 721PA 4YMUA 2QR2A 2WPDD 1DQZA 4WY2A 2ADMA 5DHFA 3TOCA 2OCGA 3WGJA 4CMJA 5DW3A 4W99A 2YY6A 3PFKA 3STUA 5LZ7A 2WP0A 3DNFA 2WG0A 2XQJA 3QPDA 2I7DA 3KALA 5SY4A 3JARA 4YLEA 3CRZA 2LP4Y 4UPVA 3FZEA 5CTAA 3EMBA 3BJRA 3GEEA 3DWFA 3MRXA 2V0CA 1E3QA 3E7FA 3THYB 3KLPX 1BDBA 4X61A 4ZOBA 2Q3CA 2W5UA 4R2JA 1UKBA 2Y6UA 3KJZA 4U4AA 3LFHA 1RWBA 4U9UA 4YR9A 4L16A 2DAPA 2FXVA 3LM8A 4GZ6A 4BQNA 4BVAA 4KQ6A 4IIJA 2BIFA 1M6EX 4AJKA 1W94A 1A1SA 1P0QA 4V0MA 4ZOCA 1WU7A 5E2BA 3TMAA 2XY4A 1JA1A 1FTSA 1Z8DA 1JEQA 3MN1A 5DEIA 3BMQA 3OZXA 3STVA 4IMRA 4ZEVA 3ZZNA 2IC5A 4UUBA 5B7QA 5C1BA 1QR6A 1PZHA 2J1LA 3M81A 1MABA 3EQ9A 4OHKA 4DA7A 5JXIA 5EWJA 4Q1VA 3KLBA 3CC8A 4NCKA 2VKTA 4WCDA 5IAKA 3PTAA 2DR0A 4GBJA 5T67A 3EY4A 1D6SA 1K27A 2QQEA 3ENKA 3HSKA 2N47A 3HYSA 3I76A 2XITA 4Q24A 1CEYA 1CJMA 1IONA 4Q4AA 3FRIA 1YV9A 2BF4A 2FUEA 4CQNA 5JC1A 4LWPA 3JASB 3VH2A 5F35A 2WJPA 2B1GA 3PVSA 2CDRA 3V8NA 4OO3A 1QCZA 5LZ5A 3SYNA 3FOBA 5LD2C 1E89A 1J8QA 2AH5A 3UANA 1Y3CE 1HK7A 4TTTS 4MRAA 1KL7A 4KUGA 2COUA 3IKVA 1A5AB 1CUHA 3UWPA 3RRBA 1DXQA 1UKEA 2ZDHA 5TQ2A 2Q3EA 4RHFA 5JAHA 2O0HA 1JB1A 1WCIB 4Y0AA 1S2MA 3VR6A 3F6YA 5AJZA 1IAQA 5K05A 2HJHA 1I7NA 2QN7A 2J3EA 3V5NA 1OLOA 3HR4A 2VWHA 2NP6A 4WL0A 5J43A 2I7VA 4UU7A 4LIPD 2HWYA 2RHRA 4CQLA 3DE7X 2NNLD 5FNVF 1YAJA 2YINC 3SNKA 5JCPA 3ORYA 1MXHA 1ISMA 1H0KA 1GTG1 1NXTA 5CNIA 4PZYA 4I1VA 1RE0A 3CB4A 2BZSA 2HFJA 2XKKA 1ESCA 5C5CA 1BHQ1 2JEYA 4UU0A 4I9FA 1HUQA 1LA2A 2YXDA 1ZK3A 4IWNA 3N87A 1QVAA 2AZDA 4QDZA 3UMGA 1G8SA 1J21A 4CLOA 3DL4A 3GH1A 4BVEA 3UH0A 2J9GA 2R8YA 3W4KA 1MGOA 2GH1A 3FUTA 3NJ8A 5CG2A 3D0RA 3FOEC 4G5FA 4JHLA 5KVQA 3T3DA 4E1AA 4W5NA 4XYLA 3MILA 2CF6A 4GL4A 2AR7A 5FOWA 1D6MA 3G2OA 2QBYB 3ICPA 2VIIA 3LVRE 4AQDA 2RD2A 4EECA 1HDRA 5AI4A 1E20A 4M6WB 5FAKA 2GD0A 1YK0A 2ZJ4A 5JROA 4GLOA 4HNUA 3DMTC 4S1TA 3AI3A 2H2GA 5DBIA 3ZWMA 2NSLA 1V4VA 3MUEA 3ZLBA 4Q4LA 3CKMA 5ESDA 5AW9A 1N0IA 4EY3A 2Q2QA 2GN8A 5DLDA 3FTDA 5K0TA 1JSLA 1NDQA 4LJ7A 4PGGA 5JAIA 4Q4DA 1QH9A 1L0BA 3EIFA 3FMPB 2YNMC 1TGVA 2WF6A 1D2MA 1G60A 3NUGA 3MUNA 4K46A 5HFJA 5HOEA 3ONWA 5FA6A 2QRPA 1E7RA 1DO2A 1KMNA 1ORRA 2V6FA 4W5OA 2WQZA 4DUGA 4HLQB 5HQJA 1OFIA 1YNSA 3IUQA 3NHYA 5EHQA 1Z63A 1E2BA 1XZJA 2JB9A 4HX2A 2ECQA 2JAQA 3P27A 4LDNA 4FHCA 4N5MA 2B1QA 4FQ5A 4LYDA 4E2ZA 1ZH6A 5CFQA 3RRJA 2Z8XA 2G76A 4OKNA 4A8JC 5IW8A 5LQUA 2A7XA 3RYHA 3VZCA 1L1QA 4J0KA 2OHIA 1GU7A 1Q1GA 2WIFA 2YVAA 4ERXA 2M6KA 3HJFA 1CRWG 5CTJA 1A0OA 1WMDA 1WV1A 1CY0A 4IHAA 3TCNA 3X1MA 4YCMA 4PHHA 3U3DA 5A5FA 3A10A 1YJBA 3GRPA 1INLA 4CCSA 1KEEB 1M1YE 1KKLA 1YU9A 4TSFA 4QQ8A 2NPFA 4O4JF 4CUKA 1FJGB 3S2SA 4BEBA 3FCCA 1J09A 1U3UA 4QBGB 1W6RA 2CT8A 2I4OA 2PMBA 2RI1A 3OE4A 4DIBA 2QD5A 3JZMA 4G65A 3D9QX 2H9AA 1BJRE 1MG0A 4XUEA 6YASA 4M1OA 1AQJA 2NU6B 3VZBA 3T1QA 4PR0A 4FMCF 4E09A 1PQ4A 1UZUA 2A88A 1EJ6A 3W5AA 3H04A 1DJOA 1Q11A 4M83A 4DYVA 3GX1A 1JIXA 3ONVA 2V7XA 4D9GA 4G56A 1FMLA 3SS8A 4CG3A 1OAOC 2FVYA 2FSIA 1T4MA 3GJZA 2VKQA 2OHFA 4QO7A 3RF6A 3HZOA 1ZCZA 2G72A 1GL3A 2M2IA 3O47A 1QZZA 2H2WA 3OPMA 4TPKA 3RUPA 5KYXB 5DYTA 4AN4A 1AKWA 4LX8A 1Z3CA 1MG5A 3RTDA 3OMWA 1GKKA 3NQ41 3ESCA 4L6CA 4QODA 2FX3A 2XQVA 2J0QA 1NSTA 2IFTA 4K2AA 3G2PA 1NFRA 2D4HA 4EYEA 3EVEA 2BTQB 1T5BA 3HUEA 4H7DA 5DLQC 1O89A 1W93A 1OWLA 3SX4A 1HG1A 1AMNA 2HJGA 4YJ2B 2A5JA 3L8FA 4HDSA 5K51A 3GGOA 2B7CA 4CKWA 1XZQA 3FTCA 4HFRA 3FF1A 3SKVA 5J47A 1UAAA 1X7DA 2IUSA 1XRQA 2VI5A 3QQPA 3WWPA 2QPLA 4Y7CA 1B6TA 3CW9A 1HE1C 4A0RA 3NONA 3DLBA 4RW0A 1QAQA 2GWRA 1EGHA 4OSPA 2Q4DA 2CLFB 5HQTA 3TLZA 4EFLA 3K0FA 4LPSA 1X80B 3VKGA 3GIDA 3VZSA 3TMKA 1DFIA 4INJA 1WB9A 1UL1X 1GLGA 4J3JA 2R8OA 3GFVA 2H1RA 1I6KA 2R1VB 4DB2A 3FCOA 4K86A 1YOBA 3RVOA 1KVTA 2LPMA 4KDFA 2QNIA 2Y1FA 1KSHA 1C3LA 1E4EA 4PTYA 2JAOA 3IKMB 5BORA 1VE1A 1POWA 1X7YA 4LOJA 4NXNB 2D1SA 4XGRA 2WM8A 4MHSA 1T1RA 2R7KA 2JI4A 3T0GA 3VOAA 1CEQA 1CCWA 2Z3WA 5FTMA 3AUTA 4FSHA 2Q6LA 3F47A 4ER5A 4QBKA 5CA0B 1UXIA 1LLCA 1E3SA 5KB3A 3K8OE 4M88A 1XMJA 3R6WA 3VVMA 4A5SA 3LKDA 4EIWA 3IH5A 4G4JA 3KOXA 4C6HA 4IF4A 4F8YA 2MSLA 2XUHA 4G97A 3BVPA 3SHWA 1XVVA 4M76B 3I9V1 3T9FA 4HLUC 5A1TA 1I2ZA 1IB0A 1TVCA 3F7MA 2F1IA 4I3FA 2C31A 1JQEA 3LMKA 4R3WA 4GKAA 2QM8A 5BSTA 1L5LA 3TE6A 2AZMA 5EMKA 3G9TA 1T4CA 1G8MA 1WZ2A 4P80A 4A1OA 1X1SA 2ZAGA 4JLOA 2FSVC 4BFLA 1R88A 2A1UB 2V6MA 1U7UA 2RKWA 3DBHA 5DI3B 3UXYA 5CD1A 1NZDA 3MHTA 1K7FB 1PHRA 2HMUA 3RS4A 1P7YA 4JLNA 1FK8A 1S2GA 2QJRA 1K0UA 3HA5A 4QBHA 4WLEA 3VH3A 4G8DA 4WXEA 3L77A 3DXFA 5DNAA 1VL8A 1FJXA 2CB9A 5JUWA 1HRKA 2PU7A 5JY6A 2VDPB 2WJGA 2PRYA 1JPUA 2IBMA 1PZMA 1YVPA 1JLMA 1YRLA 3S70A 3W2GA 2ES4A 2E82A 2I4RA 2OK8A 4BBPA 4EMTA 2O6LA 1M34B 3AG6A 2RHHA 2FP3A 1JR2A 1JAYA 1OBOA 4TQUS 2X0FA 4ED9A 1A9SA 1UJBA 1EXVA 3LGAA 4ZHQA 2PGNA 1XAGA 3QVVA 2QK4A 3E3OA 4Y9DA 4M89A 1FFAA 4JUAA 1V43A 3SEZA 4ZVTA 1JAIA 1I3LA 4MVJP 3LNTA 4XIYA 1T8PA 5J5VA 4EATA 3BXFA 2I54A 3E9YA 2OD7A 4JY7A 1KEUA 2XXAA 3V9PA 1L5VA 2D5CA 2UYCA 5EFOA 4G0QA 1OFUX 2Y3IA 3LW8A 2XRYA 1NT2A 2HDHA 4MYRA 4UVEA 3VTZA 3R09A 1KF0A 1CSEE 2E89A 1PIWA 3FNFA 1NBMD 4UD6A 4F71A 1NMZA 4LGCA 5MGBA 1XWIA 1FFYA 4D6YA 2Q1TA 3ZNOA 5EPUA 4ZJYA 4KRGA 2QRMA 4Q9IA 2CFSA 2WZDA 3SR0A 3KP1A 1F14A 3QMWA 4M0UA 2WT9A 4CIBA 5FWYB 3DOIA 1Z7EA 3OZBA 4IOLA 4HV4A 2O8CB 4OBXA 4IXMA 2V9ZA 5EZSA 1XNJA 2EGGA 4IHKA 2JFXA 4PCLA 5LQNA 3QVGA 4BZZA 1XKTA 4HEJA 1GAQA 2R25B 2A3RA 5KSZA 4FGZA 1QORA 3R7AA 2PX3A 1NF8A 4P36A 3FGOA 2QU7A 1VXOA 2F43B 1I3CA 1IDN1 1YMVA 4BVKA 3RODA 7ADHA 2ZIGA 2OORA 2KX7A 4QTXA 4YUXA 1NN3A 4E2XA 5BXYA 2VUUA 1CUVA 1DQPA 1TTPB 1Z6ZA 4HO1X 4J2TA 5CPBA 3DL0A 2GD1O 2WILA 4RFSB 2JGNA 2XKJE 1IM8A 2FWAA 2OBYA 2R84A 1FP1D 4K8RB 4Q6BA 5LA6F 3KPVA 4WOJA 2FFRA 2ZJ8A 1YIAA 4QYMA 3AM5A 1GXSB 1RP7A 1U80A 1A9YA 3W8EA 3LVBA 1M75A 1WB6A 4UMFA 2E4YA 4A6EA 4B3RB 3D0QA 2Z8YM 5A4AA 1NR7A 3H05A 5ECYA 1SJ9A 2G77B 3HCCA 2QD3A 3LUDA 3H2YA 1VSQA 3K71B 4K9RA 5KQLA 2QU8A 3DBRA 3H1GA 4DLNA 1E8MA 2WTUA 1F5SA 2VJBA 3JD2A 1TE2A 3L7JA 3Q3GE 4JIMA 1I3NA 3MMZA 2PFSA 2WP8J 1ZXBA 4GUAA 3AF1A 4O2BA 1KJ9A 4R54A 1UPFA 2WK1A 4D9NA 1QNLA 4C7OA 1BJKA 3IJPA 1PI3A 1Q50A 1NHWA 2I1WA 2XYPA 1REQB 3L8DA 3OECA 2X76A 3ZIAD 2ZYDA 4ZMRA 4B81A 3RS9A 1KJNA 3NR2A 3TI9A 4DW8A 2FLWA 3WKAA 1P2GA 5L45A 3GLSA 4S1WA 3JY6A 5FNVB 3GNLA 3K1AB 4P82A 3DEKA 4N3AA 3PXAA 4ITRC 4IDAA 3IUYA 4PPGA 2BN4A 4QGFA 4EG4A 4AP9A 3ZCQA 3SSAA 3ANTA 3ZCRA 3IAS1 3RC2A 1RW4A 4YAGA 2D1YA 3PIRA 4M0PA 4WMLA 3B85A 4DV3B 1C3OB 2ILTA 3PIIA 1T9AA 1EX7A 3EAFA 4NNJA 1LZLA 3BGVA 4GEKA 3DGFC 1FU4A 3ZHXA 4ZTUB 1A4RA 1G6Q1 4CF6A 5P8WA 4B4KA 1JVNA 3BORA 1E6EA 3BWDD 1KAGA 3D6MA 5IXJA 1HZJA 4BCCA 2AMYA 3LVFO 3MWYW 4RKFA 2UYOA 5DI9A 1SB9A 3D7SA 3NTVA 4NZMA 2BE9A 1A50B 2XUKA 3G0CA 4GR9A 4PXYA 4OHZA 3P0HA 5BSRA 5C1DA 4GDMA 4WASA 1M6WA 3RAPR 2A5DA 2PD3A 3O38A 2AD1A 3F8SA 4FHDA 4FWBA 4JVOA 4NBSA 2LD4A 1OILA 2WMNB 3TL2A 1MPXA 3BE6A 4JGIA 1XTTA 5EE3A 4KXLA 4F11A 3NXKA 3RU7A 3CXRA 1SU6A 3CUSA 3AXTA 3C7KA 3AL3A 3IV9A 3JXEA 5AHKA 4HAOA 1BYIA 2YJTD 4Z9XA 2BFNA 4OF4A 5ITZB 1ATIA 2GGSA 2VP0A 1KZ9A 1PJAA 3Q5GA 4KGVA 3GLHE 4HZGA 3SIRA 4B0PA 5BN1A 3HB7A 2ST1A 4C01A 1QONA 3EB9A 3G1UA 1UM9A 1AF4A 4X94A 1U6KA 4YO8A 5F23A 3CNQS 4XWOA 3ENZA 2YMLA 2RC5A 4IGKA 5K6AA 2HRRA 2PO7A 5A6SA 1HTTA 2ZIEA 3FSJX 5DNCA 5LP6B 3V32A 2JGFA 2Y71A 3GF4A 3W5JA 3QVWA 2Y4NA 3I6YA 4IFEA 2QVBA 3BDAA 3E9NA 3U4QB 1NUAA 3K9NA 4N0MA 4O4LB 5AVOA 5ELXA 1KK1A 4TV8F 2ZBDA 3RC1A 4IIFA 3LYHA 1K7SN 5DOVA 2GK4A 2WTEA 1L2TA 4ENSA 5JH7A 2NTEA 1N1MA 4JBHA 5HR5A 1KI6B 4ZV7A 2H31A 5E7MA 4DCPA 4F5YA 1YBFA 1RRKA 5G41A 5B3KA 4P92A 4YMGA 1RM3A 1Z5WA 2VHCA 1KDOA 1EFPB 1M1NB 2VSFA 3GEIA 3ZXXA 4LYYA 1A8UA 2E6KA 1K5GA 2MSWA 1EG7A 1Z83A 4MV7A 4UPDA 1T6YA 4Y6SA 3KETA 1IY9A 3R7LA 1FJ2A 1H3EA 1QH8A 2DZDA 3IEXA 4BJHB 5J4YA 2BBOA 4JWTA 3GBPA 1IB6A 2CYAA 2VH5R 4X1KA 4EYQA 5JECA 1J97A 1SWWA 1P77A 1S02A 1VL5A 4EBBA 5GY7A 4CEIA 1AHNA 4X1YA 2E4WA 1Y1KE 2IUTA 3KWFA 1DKQA 5DBOA 1I4OA 4R8RA 1JG3A 2HMSA 3I8OA 2I4NA 1CY2A 2Q0HA 3CU5A 1FXSA 2O20A 3IPLA 3N6VA 4MARA 1U9CA 1XQ6A 4OKSA 5KNDH 2F1KA 4BVGA 4HH0A 4WKNA 3D6FA 5BN4B 1KI1A 1XTUA 2QX8A 4G25A 3G9ZA 4L22A 4HN4B 2JFQA 5SZJA 3A1UA 4BB0A 3GLTA 1AO0A 3JZIA 5IKXA 3N6XA 1Q5PA 1RI3A 3EYAA 4JHXA 1YL7A 1ZD5A 3IQGX 3EPKA 5G3YA 4A9AA 1XELA 4Q3AA 5A03A 1IEVA 1ZAKA 4BQRA 5H1YA 2FE1A 4HWRA 1JR4A 5YASA 4X62B 1M2WA 1GNTA 4UM5A 4HDMB 4B3FX 5D86A 3QBTA 1UWCA 2O07A 3JALB 2KM1A 4QJBA 4A6PA 1DOHA 3LW7A 1AGRA 1D7OA 1GQFA 1HFJA 1P72A 3JQCA 3PUHA 4NG4A 2A92A 3RC3A 2IYVA 3CBQA 1EFRD 5CB4A 1Q74A 4WFJA 2GPBA 5KYUA 1QF9A 1N2IA 2Z2YA 4ES6A 1P61B 1T5IA 2ONYA 3CT4A 2ZSKA 3MVEA 3IQFA 3B1FA 1SEVA 3OE1A 5EZ6B 1MO4A 3IT3A 3TTUA 1QBGA 5GIPE 4KXVA 3CG4A 5CP8A 4P7BA 4H3HB 4AX4A 4F0JA 1KY4A 4YHBA 5DHSA 4BMYA 3OM0A 4ZVRA 3IOMA 4LF9B 1QO7A 2FWJA 2QZ4A 2W8BA 2PX5A 4XUGB 5AT1A 1AM4D 2GR9A 4AJIA 4M98A 3T3HA 3AU8A 3AR9A 4F6RB 1ZBDA 4OB6A 5C37A 4GH5A 2BFDB 4RO0A 4YCDA 1XVUA 3HN7A 5I45A 2FPPA 2VNSA 4L78A 1F2TB 2EDCA 1Y3FE 3DDCA 2P9YA 4Q1BA 2PSJA 1FMCA 3BD9A 3D3NA 3SMQA 1JNYA 3AIIA 3EGWA 4HB4A 3UZUA 1RYDA 2E7ZA 2GPWA 2J3KA 3Q10A 2GCIA 3OKPA 3I0MA 3RGGA 1MDFA 3H99A 1IN5A 3WMWA 5EMJA 4L76A 3E5HA 3V00A 3I4CA 3QTBA 4KXFB 3VU1A 2IYOA 4QFDA 1YF3A 4TYMA 1O77A 2W8ZA 4QO8A 2OZKA 1TFRA 1M0SA 2XGJA 1N2OA 2PKCA 5FOTA 1RJ9A 1ADFA 1AUXA 3FAKA 3GG2A 3CZRA 4ZT7A 3VNBA 1W4AA 2AUNA 1SUCA 4HN9A 4AJ9A 1HSZA 2FUCA 1U1EA 4D79A 1QU2A 1QFJA 4DHWA 5G1OA 1CQIB 1GGVA 4MDYA 5T3YA 3HG7A 1OXBB 1VIMA 1GPYA 3F7NA 1NQAO 1H94A 1K68A 2YIDA 5AI5A 4ARBA 5BQXA 4AZ0B 8ATCA 3EXEB 1Z39A 4KPFC 2BP7A 1X1QA 3Q7EA 3UH1A 5A0VA 3DE2X 1RM5A 3R0IA 2AMFA 2QTMA 3AEKA 1L5WA 1PSDA 2XNSA 3BCUA 1X7GA 1NBAA 3DBOB 4NATA 5JBQA 1ESEA 1JKJB 1ZUIA 1VSTA 2Z04A 2ZQ5A 3LZDA 5E8JA 2ZR0A 3OKAA 3FD8A 3MCTA 2XE6A 1JIJA 4Q19A 4TV9A 3BRQA 3OPYA 4QLAA 1K3UB 1JSZA 1CP3A 2PJDA 1PDWA 3EDMA 3H75A 3SC2A 5HKKA 4B9AA 4EHDA 3EARA 4JXZA 4BU1A 2HRCA 5E6SB 1NF3A 1C8KA 1W46A 1IN7A 1LSUA 1VP3A 5FULA 5ER9A 2Y1XA 1M8KA 2XIQA 4XGNA 4K9KA 3N8HA 4EZIA 3S40A 3GLIE 3FPFA 3N2GA 4F3TA 1IVYA 5JD6A 1LQTA 4WERA 3H19A 5F12A 4MW6A 4HWGA 5T4EA 2EF1A 1I6LA 2GKOA 2JIDA 3LHFA 4MS4B 4PYOA 4ZPJA 1HZZC 1ND6A 2DUNA 3KPWA 4N6NA 4CM1A 3ZKAA 1UDXA 3ZDAA 3F5QA 3QIAA 4GE0A 2DR2A 4EA7A 4ZANA 2BM1A 4HFNA 2J59A 1R6VA 5TXGA 2P2DA 4D43A 2HHCA 3DUFA 1XA0A 4DL9A 2HA2A 4P4SA 3NBMA 2XWJI 1OX6A 3B1WA 5I7HA 1P2DA 2WWFA 1VBNA 2EVWX 2GN4A 5KVVA 4IDCA 3JTEA 4FI3C 4IDOA 3V1TC 1PGNA 1PR1A 1KYYA 3L7LA 2WWIA 4LNUB 3TE7A 2DBRA 2ECOA 4D02A 5DPMA 1E0KA 1Y6RA 5AW7A 1MAVA 1V3UA 3AEYA 1R7RA 1TD9A 1FDSA 1GLVA 5LA6B 5TF0A 5BW8A 2WV7A 3FY4A 1YZTA 3GL9A 4BN0A 4F86A 4LDQA 4KOEC 2X0IA 3QBEA 1PJZA 2YV5A 1QZTA 3EG5A 3O73A 2VNAA 1XFAA 2W4QA 4HAVA 1YDEA 2JIMA 1KWKA 3AR5A 2H5IA 1ORWA 2B36A 4I5DA 1UCFA 2H29A 2JFZA 3L07A 1A77A 2PH7A 2ZYUX 3FETA 3PKJA 1XI2A 4WZBA 3E2MA 1T0UA 3VZQA 5D5QA 1U9ZA 1J07A 5B55A 1PZXA 5LZ4A 1YFJA 1HLPA 1L4BA 2HC9A 2WZCA 3E1SA 2DFPA 2IW1A 2XQFA 5B1HA 5I9IA 3JATB 1TU3A 1OGJA 1YXMA 4C0LA 5J4KA 3R3WA 4RSGA 1H2FA 5L51A 1NE7A 1YRAA 1L4UA 1UFOA 1UMBB 1BCSA 1E94E 1CFZA 3HY6A 5GJWC 3DQPA 1EXDA 1YB2A 5LC1A 3J7AC 1Z4QA 4ENVA 1XVAA 3NT4A 1LDGA 5IC6A 1ZU4A 1N5RA 1CDZA 1OGIA 1T8TA 2VJLA 2VJYA 4KE9A 2H2HA 3FSRA 3ISTA 3BIWA 3GJQA 1NE2A 1W581 2YWFA 5ABPA 1GUYA 5JFOA 4EY4A 3ZTYA 3WRWA 3VTFA 1KYTA 3FX2A 5LB4A 3W77A 1XHLA 1IOLA 2NU8B 4MPDA 3CH4B 1T0BA 2B9EA 1FW6A 4GVXA 5CYOA 3P9RA 3HJNA 3JWJA 3L6EA 2F3UA 2E3JA 1CQPA 2H1LA 2QD2A 3UJ8A 4PC1A 3WGQA 2RARA 1FTQA 5CD9A 2IPAB 2YRXA 2WHPA 2WWGA 4JA0A 4QECA 3PHJA 5CRIA 4XR9A 1USKA 4O1IA 2Q6OA 1O3YA 2HA5A 3G8AA 3ICVA 3K2EA 4CIVA 1HETA 4QWWA 1EP2B 4YAEA 2P8SA 2FN4A 1EB8A 3GA7A 2ZBVA 3VR6H 1IQ0A 3OKCA 1AVTA 1WULS 2E85A 1KJ8A 3OTIA 2ARKA 4QQFA 1F3OA 1RAEA 4WEOA 2GRUA 4UTRA 4DGQA 3AM4A 1FFSA 1W48A 3ZGNA 3U6BA 1N7JA 1ZD9A 3HUFA 4DLWA 1EK0A 3DH0A 1RLJA 1VIVA 2AC7A 4TWAA 1Z6TA 3H6GA 1GUDA 1AKTA 1N3YA 4GR5A 3DZHA 1OZHA 1NRIA 5DN6A 1OR8A 3ENWA 3KUCA 4CIAA 2WSSA 3G49A 1RHJA 4KPUB 3Q2OA 1CX9B 2AXEA 1FNDA 3GELA 4J91A 5DXFA 5CDFA 4BLWA 2QTNA 4K9DA 3OTQA 1GR1A 1YZLA 3BCRA 3CUYA 4EUSA 3TQRA 2EWMA 2FX2A 2AR0A 3G9XA 3TSWA 2D0IA 2PL1A 1N2CB 3NDPA 2HDNB 3BS4A 2DPMA 2DLNA 2PS3A 2O05A 3FZQA 3H4VA 1M33A 2RIRA 4RKWA 3GGGA 3NEYA 4U6QA 4WJLA 3ZGZA 1QH1B 2ZYRA 3N2NA 4G5RA 4CQJA 3Q3CA 5BR8B 4DNOA 3M82A 5FA5A 1ODFA 1OIXA 1Z2PX 1SOMA 5AKEA 3VXKA 5SY6A 1TZMA 1T91A 2ZKLA 4KQWA 4TV8B 3D6VA 5FTKA 4Z1MA 1F0KA 3G0IA 4CODB 3D2BA 4I4NA 1S2DA 3TW0A 2EU8A 3ABRB 2VSOA 1PVOA 3FNRA 3A1TA 4UBNA 3F96A 1B0ZA 3H9QA 3N0RA 3Q7SA 4IIJF 4XIJA 1YACA 2AYXA 3WHIA 3WQHA 2C4NA 1IHYA 2FVXA 3O8OB 1U65A 4UTZA 2ZWIA 3DWIA 2A1IA 1N4AA 5JD3A 4K6HA 3SDBA 1GG9A 2HBZA 1N8KA 2K87A 3QXHA 3P9NA 1DC6A 2PX8A 1ZSVA 2W6JA 4J4TA 2ZZMA 3DDZX 3GJ6A 4N3GA 2XXJA 2W98A 1IY8A 3MPUA 4H1VA 1EXMA 1AKMA 1E69A 3FSGD 2CNWA 2G1KA 2HQ1A 4MMYB 2NYRA 1MR3F 3IKTA 2YJNA 3VTAA 1HFEL 1R37A 3HVKA 2JFFA 2YWHA 1KEKA 3AF5A 5I9TA 4DLVA 3ZWPA 3PB3A 3G13A 2P6MA 2ASEA 2HMAA 3EGXB 1GNVA 3NEPX 4OQXA 5D6NA 3JQDA 5ER6A 1JLLB 3ICQB 3UMBA 4Q1EA 2DBYA 5FI5A 4FGJA 3UIEA 8OHMA 1X14A 3IEPA 2YVUA 3FRHA 1EFDN 2D0PB 4K6GA 4D26A 3PQ7A 4WJKB 2F3PA 4YUWA 1ECPA 3AF4A 5DULA 4AL4A 4ASUD 3WIEA 3RRMA 1I7QB 1N6OA 2HLNA 4GICA 2FI1A 1XQ9A 2L0XA 3UJPA 4AZTA 2J7PA 3IT1A 3AW9A 3OOEA 5I51A 5DM70 4MROA 4ARCA 1H1LB 1T9GR 3DLTA 4JLBA 3VHXB 3RW9A 3F6SA 2AN5A 1Z2CA 5JSYA 5L7WA 1L4MA 4CHGA 1RBZA 2WG1A 1R0RE 2DQKA 4LN1A 1GVHA 2R00C 5EIAA 3S7ZA 2RGDA 1WLYA 3DSRA 3IMKA 1OU4A 2Q1XA 3P0EA 3QOWA 4G0ZA 4ND5A 4NBLA 6AT1A 2Q7OE 2Q29A 3GWZA 2AKAB 3ED5A 3ORFA 1NU6A 2ZE7A 3KAPA 5FJIA 2IYFA 4FTWA 1E99A 4U7GA 4W7SA 1R5NA 1TF7A 4CNBA 5J4VA 1XRRA 2XT6A 3SBEA 5F9FA 3VDXA 1Y8RA 4HOYA 4OP1A 1R10A 4QSHA 1E3TA 1V5EA 2XGOA 4LJ9A 1U0BB 4PICA 4RIFA 4UXJA 1A2OA 1WE2A 3NWBA 1AY0A 3FIJA 3IEIA 4HVTA 3M89A 4UKDA 1DWUA 1ZUNB 2FWRA 5ALLA 3VH1A 1NYQA 2VLBA 4O2AA 2QE7D 3ET5A 4C4SA 3EBPA 4B31A 5B1YA 3MTQA 4B33A 4M8SA 3ZNPA 2E1RA 3C1TA 1GGJA 3A9RA 3OX1A 4LSWA 3MJCA 5BV7A 1HQYE 4TMFA 1YKSA 4L2IB 4MV8A 3SJZA 1KA9H 1PTJC 5TT0A 4E3ZA 5JDIC 1WAMA 1AD2A 1P8AA 1N8NA 4TM7A 4XEUA 3THXB 1RHKA 3BDIA 5K4AA 1VLMA 3VI3B 4UEWA 4TYNA 1Y9EA 4LK2A 4EHBA 1GTRA 1CDOA 1O94C 3WNBA 3FPCA 1IATA 3AUFA 3PFFA 3Q2KA 4JJ8A 2BFBA 3I45A 1CY8A 4UBOA 5FF9A 1ZK4A 2W2LA 3RWOA 1ECLA 3WGKA 2QNRA 1M2HA 1ADGA 2GEVA 2H9YA 1DC4A 2NIPA 3QUSA 4GPD1 3KJQA 4K40A 4LZAA 4QTZA 2XT0A 2ZVJA 4KKVA 4RKYA 5FUYA 2GKGA 3UKOA 3DL7A 4IJUA 1JR6A 4C4XA 2GMWA 3GYBA 2ENWA 1YDMA 1M6NA 2JS7A 1RFGE 4OD0A 3HYCA 1QJ4A 2QRZA 3K2QA 1W0KD 2A33A 4QBTA 5AKXA 4EA8A 4H4DA 1ATZA 5ALMA 3ZJTA 2FY8A 1ULUA 4PTZA 2O7NA 3UUEA 1C7IA 3EDOA 5EPEA 5AVSA 5JSHA 3FYTA 5EXXA 1Y37A 3OU6A 4L3VA 2ZI3A 1KY3A 2AKEA 5C9ZA 2DGDA 3BE5A 2DPXA 5EKUA 2OO5C 3KHUA 3M0EA 1C3XA 1TU0A 4X6XA 2W2PA 2DHDA 4OQZA 2R8BA 1U28A 2HLDA 3FW1A 1ZRSA 4ZZ0A 1R64A 1DBRA 1KO8A 4PS1A 2EJUA 3VQTA 4LXYA 5JW6A 1GADO 2GDZA 1ZHFA 5ALPA 1BA2A 3NIBA 3G0GA 3LLCA 1VJTA 3DOCA 3FNGA 1E32A 3OUZA 3GDOA 3WGTA 3IT2A 3ZV3A 1R4AA 3G0DA 1P9OA 3G6KA 4MICA 2WT4A 3OO0A 4HY3A 2JIRA 4TTIA 3H16A 2P9HA 2QI9C 3BFJA 521PA 4HDRA 3O0TA 4WINA 4QFBA 4AUNA 2HMWA 1B6GA 1YZUA 3S8EA 3DWGA 1YO6A 1NJ8A 1QVRA 1U1CA 2J8ZA 4INAA 4OJKA 3IC5A 5FUXA 2P9JA 4PWYA 1TT5B 4I4LA 4CDMA 4UTVA 2MU1A 1KBOA 1L4KA 4G01B 1SXJD 2OV2A 4ZVLA 4EJMA 4JNCA 4OA5A 1H2WA 1U2QA 4U8HA 3HO1A 1WW8A 2VTVA 2WRZA 3LK6A 5FB3A 4Y9RA 2P0YA 4BXOB 4CR6A 1YVDA 4JEHA 4LX0A 1S8NA 4HTAA 3WNCA 1CB7A 3PG5A 1YBMA 4M0DA 1Z5VA 1FP6A 1NQOA 1XN1A 2YWEA 3SZMA 4OVKA 4BWYA 2VWPA 3AIOA 1OB5A 2V0GA 3AHCA 4MX8A 5HUHA 2YOGA 3C45A 1QH0A 1RJWA 3WK4A 1E1RA 1S2IA 4IGFA 1J20A 2FOLA 4REQA 3FFWA 2VCHA 3MIIA 4K5QA 2OFWA 3RH0A 1BE6A 2F7SA 4DJTA 2GCOA 2HJWA 1QHHA 2RAPA 4KNWA 4XDYA 2VRWA 1W2GA 3DJFA 3MAGA 3RARA 2VDVE 1U6IA 5LZ9A 3EIQA 4AMUA 4B47A 4ZOQI 4Z2YA 5CFPA 1Z7YA 5HMLA 3SC6A 4DUZB 3JYOA 1OZGA 4Z0PA 1P7VA 1E7QA 1HDYA 4WNAB 2C4HA 3PUIA 4Z9BA 1CKEA 1HC7A 3ZOKA 2TSYB 2VH2A 4YI5A 2CLLB 4D41A 5KNBD 3QXSA 4OUDB 3OIUA 1UKZA 3D2CA 4GRAA 5P21A 1NRWA 2ZU0C 5KYYB 1T5HX 2BMAA 3CUKA 2ZSAA 3RK4A 1DMSA 2VWGA 3FIUA 1NM5C 2IIVA 2NO9A 3A58B 3ASZA 3NDJA 1A8PA 2L18A 3B82A 1IULA 3BGIA 2R68A 4Y2SA 3WHKA 2TYSB 1P5FA 2GI4A 5HKAA 1KSFX 3SF8A 3UHAA 5K8IA 2EAUA 2ZIVB 4P35A 2ZTUA 3TSZA 4G0UA 1SQSA 1ZONA 1WY7A 1M6YA 1GLNA 4LS3A 5HRAA 1YI0A 3PRHA 1PSZA 1Z7BA 2RAUA 4AG3A 1KYVA 3HGMA 3TKLA 3R5SA 5JS6A 2GNPA 1DQYA 1UAYA 2GN6A 1VIDA 3DTTA 2GVZC 3RYFA 3JD4A 3WWCA 1FFWA 3N2EA 2G8LA 4PFSA 5AM4A 4B6GA 1NVTA 2YXNA 1E6CA 4E30A 1JBEA 5F7OA 3B89A 3T5PA 4JI8B 1Y63A 3LC2O 5CUQA 5MF6A 2PSHA 3W9BA 4Z7QB 1QQAA 1RBQA 1P2BA 3RWBA 1VLHA 2ONZA 3R3ZA 2IJGX 5C80A 2VP4A 4UULA 3FPKA 2CY0A 2PPVA 2XYRA 4RJ2A 5CB6A 1VG8A 2WB4A 4PWZA 2JJ8A 3EW9A 3DTVD 2GO1A 2ISQA 5TPZA 1CY7A 4K9LA 2WBLC 3BEOA 5JZBA 4E5SA 4DR1B 5D7BA 2EATA 3WZMA 2CV1A 1HNZB 2HV8A 1B1CA 2ZETA 3Q12A 4OJQA 5EIFA 3SZOA 3GPIA 1VG9B 3AJ9A 1F5NA 3M70A 5CX1A 4B40A 4EGAA 1W36B 2Y1WA 2JFNA 4RJIA 1BMFA 2XLCA 1P0IA 4HK4A 2R65A 1MJGM 5IJXA 5KNCD 1RHMA 5F52A 1ZKDA 1D2AA 1KEWA 1OT3A 3ONNA 3SCZA 3ZYCA 2X5JO 2CLHB 1KO5A 1E2PA 2QTLA 3G1WA 1GFIA 2YVKA 4RY9A 4XFKA 1Z22A 4LHWA 3RSFA 2G09A 1OH8A 2IXGA 4RH1A 4NEQA 4INOA 4PS0A 3L0OA 2NZYA 4JXKA 1NJFA 3MLEA 4RNCA 1Q0LA 2QTHA 3OPNA 3HVRA 4G5OA 1OC4A 4ZHQF 2AJBA 6CHYA 3LPCA 3IVAA 1PG5A 1U7HA 1O4WA 3EJWA 4LE2A 4OM7A 3FMFA 5C4IA 3S2GA 3VR0A 3MB5A 3INRA 3D1LA 4IF6A 1WETA 2EJVA 3LDAA 2CUZA 3JARB 4DSUA 2Q3HA 3VYRB 2ZI6A 2XAUA 2C7PA 1RRPA 4IOKA 2GBLC 3H97A 1Z6XA 2BE7A 2FX5A 4H3SA 4TS1A 4UQOA 2RB4A 2H1VA 2X4DA 2DT5A 3M6MD 5IDXA 1JDTA 1QYRA 1BO6A 1T2EA 3WA6A 4AZ3B 2ZXEA 2O1SA 2J6HA 3IUPA 5JAPA 1N9ZA 4G5GA 3RIYA 4AZVA 2I0FA 2VRNA 3LIIA 4O5OA 4LFAB 3H5TA 2H57A 3U9SA 4IIJB 5KWVA 4TZTA 1LRLA 4LZNA 4E22A 1SK8A 2P6PA 2GQ0A 1M2JA 2EWWA 2GZSA 4FINA 3UAOA 4DCUA 2EG5A 1ODLA 2CVPA 1E9BA 3UJ6A 2QAGA 1JEQB 2BHLA 3GJXC 3GMIA 4LY0A 3BMQB 1FFXB 4INZA 3IB3A 2HK6A 1F0NA 4NBWA 3PUJA 2WOJA 3GB9A 3PHGA 2C0CA 6ADHA 1T1SA 5EE5B 2JAHA 2YTZA 2WYIA 4BRWA 4NZYA 4RTQA 4E5NA 5EWJB 1E9VA 3HCRA 1JQJC 4TLAA 3V4RA 1RC8A 3MTEA 4C05A 3JZFA 4W4TA 4WECA 3B1YA 2HD4A 1OMOA 4O8ZA 4GPTA 5KQRA 4Q4AB 1N77A 3PXUA 2PH3A 4YQYA 3OF3A 2PMEA 3SKXA 4CN8A 1R16A 2O8VA 2WIJA 1U0LA 1U2DA 2ZRJA 4BNNA 3KB6A 3PHBE 1AQ6A 3HTXA 3DDHA 1ZMBA 4QDXA 3UT5A 1ESMA 2PNFA 2BAGA 4RESA 4MGYR 3LY8A 1QYCA 5DNWA 4C7XA 3CIOA 4MRNA 4U39A 2VAMA 1Y3IA 4TRMA 5TQ2B 2W70A 3AHFA 4O2BF 1E2QA 5B4UA 2Q0XA 2H9IA 3EA4A 3CYFA 2IKSA 1KO4A 5IAJA 2B78A 1FQKA 3E18A 1DKNA 4UEOA 1RHRA 3GW8A 4R16A 4FYXA 4U8GA 3G0BA 3H87A 1UWLA 2I78A 2JJMA 3IODA 3T1OA 1X87A 2JKVA 1AS3A 1YK1A 2QV7A 3N8GA 5BSVA 2VJNA 3D2LA 3O8DA 4CQLB 2EZ9A 3K92A 4HGPA 4U1RA 5T4HA 3ZXUB 3HN6A 1E7SA 1KE2A 3W04A 3ZDYB 5LIPA 1EFKA 1FP2A 1PJBA 1H42A 1MO2A 4RH0A 1GTMA 2BGRA 4B80A 4EITA 4X8LA 4CLOB 4DIFA 3BH7A 3Q88A 4Y1RA 5CB8A 1WXIA 2HEIA 1WOMA 3G2KA 5JVDF 2JLVA 4F5EA 4L50A 5LSAA 1C14A 5MGNA 3ZU2A 3GQBA 4ZN6A 4IVNA 3RDPA 3DBLA 5AJTA 4WBNF 2WWXA 1VPDA 3H2KA 2XNHA 4TS3A 1TCBA 2XTZA 1Q16A 3K94A 4MIOA 2DH5A 2GUGA 2IU4A 2QUHA 3T0FA 3O4RA 1U1GA 2BONA 3OFND 3L1KA 4PLTA 3ROEA 4CT0A 1SEPA 1BGXT 5KNLA 1PV4A 3DEAA 3QPUA 2WJVA 4KN8A 1GPUA 4G5XA 3QE0A 5EQFA 1JS1X 2Q1SA 2R62A 4AY5A 5FDFA 4N3NA 5U9CA 1XCGB 3O2SB 4HWPA 3VR3A 5TVGA 3PLNA 4LV8B 4QAJA 1XMIA 4IO0A 3L4KA 1TYEB 1SHZA 2SKDA 4B7ZA 4E08A 1K6JA 1PD1A 3IJEB 4ND7A 4H08A 5DHTA 2JFYA 4MVJA 3RK0A 4I8XA 2ONKA 3W79A 1Z35A 1RWXA 2XHZA 1KMHA 3C5HA 5F73A 4B44A 2F1OA 4UM9D 5HZHA 3IL2A 4JS0A 1AT1A 3F67A 3FN4A 2PQ2A 3TYXA 4CMCA 1RJDA 1UBNA 3BGSA 5B3JA 2PX4A 3ZHOA 2QZZA 1YB6A 3TEFA 3PUWA 1JKXA 5D1NA 1YBVA 2HHAA 3DM9B 1F8UA 1UC8A 4DIDA 2WU3A 1QK4A 3PQ3A 4NI5A 1VJ1A 1TCAA 2WIBA 4MUMA 3RRNA 5JWOA 2LWIA 4R2LA 4NJMB 4X1OA 2HCRA 5GM1A 3ONDA 5FBWB 2R6GA 2G88A 4FYVA 4JOBA 1P44A 1KEZA 5IUJC 5JH7F 1T36A 4PCAA 4URVR 2J0UA 2Q5QA 2JHPA 2I67A 1D7AA 4P7KA 3WNQA 4BB5A 2N46A 1E58A 1IJEA 1C9JA 1ENZA 1RCUA 1YZQA 1N0WA 1Y5RA 2O8NA 2P78A 1AO3A 2PY6A 3EVZA 2FMUA 4OHUA 1FL9A 3TFWA 2X0EA 1MRNA 2VJDA 4L5BA 3GNSA 4QUEA 4B75A 1GPJA 3F74A 4GAEA 5EKXA 4EL0A 1B8VA 1G21A 5C53B 5I9NA 2ATXA 1ISFA 1C29B 3PFGA 3U5TA 3FTFA 3N39C 3NB0A 3Q7QA 3EAGA 1XRJA 5F1OA 3GUVA 5ECWA 1U3TA 2XODA 4TGLA 1R0LA 2PWBA 5DHPA 2GM4A 1P4AA 1PWYE 3OWHA 2ZUBA 3K6KA 1TZJA 3F3SA 1MUUA 1ZITA 1TYBE 1E9CA 2XWPA 4FFSA 5DTMA 3VR2D 4ZYZA 4Z7NB 4TYPA 1WQ1R 3Q9SA 4HMQA 1SCDA 2Q6VA 4ZO6A 3DJYA 1V1MA 3L7AA 1DIHA 1O96A 2RI6A 3HVJA 1FUUA 2ZJ3A 3HR8A 3IV6A 1GKLA 1GDTA 4FSDA 3U5ZB 3NS7A 2JGIA 3ZHCA 1DBIA 1XTIA 1QG6A 1KY5A 4QU8A 10MHA 2XAAA 4P4TA 1Q1NA 4DQVA 5I7UA 2V54A 1NBHA 3E4CA 1DINA 1TXGA 3QKRB 1MNQA 1RKXA 3K1JA 3A6LA 2QQ0A 3ZHSA 4Q7MB 4CKWB 3M4XA 3MIZA 2X7XA 2YYYA 4HG2A 4IV5A 4NS1A 1MHPA 1U31A 4NHOA 3PFHA 2XDYA 3PYXA 3QPAA 3WBFA 3ZXIA 1OBVA 5I7SA 1W5EA 5HIIA 5BOSA 3SYTA 3Q9NA 1U9YA 2DKFA 2X6TA 1Y9DA 3C16C 1GAWA 3C3YA 3V1MA 2BH2A 3K0FB 1ZRHA 3O4IA 4ZZ1A 4WK0B 3HBLA 1W4BA 3VYTB 4A8PA 4P98A 1TF2A 2EW8A 1N2EA 2PLFA 2BR4A 2GPSA 2EKZA 4D5EA 1XA3A 3CF4G 2IP2A 1VE9A 1MB0A 2PGAA 3NM4A 4REMA 4ZGBA 2C2WA 3P4UA 4RD6A 2ZB8A 1E4EB 4GMHA 2IUYA 1YQWA 3A6PC 3EXHA 3BXHA 5A71A 3ESDA 5CXUA 5G0TA 3OP1A 1X7YB 1GGKA 2QVXX 1V6CA 3MT7A 3BQNB 3W5SA 5EUCA 1PYGA 3R7DA 4H60A 5AKHA 5CXXA 4KACA 1H8EA 4OG2A 1PNRA 1PWXA 4IZHA 1P6QA 1TECE 4R81A 5TR9A 4L8YA 4LYGA 2FHSA 4B2IA 4KQHA 1K88A 4YJ3A 1MC1A 4FOLA 2B1IA 1N7GA 4C08A 1LQ2A 2IWRA 1YZYA 3LF1A 4IGAA 1JTFA 4CLXA 1BD3A 3OVMA 5JTUA 4U7WA 3O91A 3HVHA 1DPGA 1X15A 2VT6A 2PXXA 1G1MA 4I9NA 3VVBA 2PRJA 4YV2A 1UEJA 3WIBA 5IBRA 2DULA 1JT9A 1BOOA 3HP4A 2RGYA 3ZOZA 3O2NA 5FT9A 3DMPA 1XF1A 1VB5A 4PX3A 3EWNA 3SYKA 3A06A 1LGYA 2Z1NA 2WLTA 3EEIA 1JHMA 2QUKA 2W42A 2XA2A 3PWTA 1QZ3A 1XVTA 3TK1A 4DWVA 3BAZA 4PIVA 1E0AA 1IZ9A 4EG8A 4E15A 4KQFA 3DMGA 4JR2A 4PRYA 5CVDA 2QN9A 3ROZA 4I81A 1TYCA 2N75A 3K5WA 1WD7A 2PS1A 3TGPA 2B7BA 2C8JA 1DEAA 2HRZA 4FSXA 4HJXA 4X00A 2C0PA 1PFKA 3GLGE 4IMIB 1THMA 3QLUA 4IIBA 2H2IA 3GLVA 1AMUA 1KC3A 4G8CA 3JVDA 1MRZA 2CNOA 3UYKA 1KRXA 1N6RA 1GNRA 1RWVA 2DQ4A 2A9KA 4OHRA 3DMNA 4REOA 3KJHA 1EJ2A 4NZZA 1IN6A 4K03A 3E15A 4W5WA 2M9MA 4BB9A 4BP8A 2XEXA 5AH0A 2R6R1 1RBMA 1S3FA 4N6OA 4X20A 4HDKA 1EESA 4ZHQB 1SUWA 3QA9A 4M1TA 5DCUA 4RMIA 1UDRA 4HNAB 3GZTB 2B3DA 3RSQA 4TV9F 3IEMA 2WAOA 5HM8A 1YFKA 2VEOA 4GNKA 2G1PA 2PU5A 2XXAB 1PR9A 1YR2A 2A9JA 5JIBA 2QZ9A 3BL8A 4QULA 4GOXA 2AN3A 2N1MA 2O2SA 4YB8A 1U3CA 3C1UA 4ZCRA 4N5HX 3DYBA 1EGVB 4H7FA 4P1ZA 1H23A 4E5YA 3KZNA 4HEA6 1IUPA 4HWKA 5IXYA 4DR5B 4DRYA 3U1VA 1GZ4A 2HT1A 4DS3A 1WSAA 1ZAYA 3L6DA 4ZEWA 4BV9A 2GERA 1KPGA 2UYQA 4AULA 4ZAYA 1S8OA 4KQCA 3USCS 5A3SA 2Q5EA 5I8PA 1HLDA 3RRFA 1PL8A 1T43A 3ND8A 5JFTA 5JS8A 3LD9A 3E9QA 3NHZA 4AS1A 4U7TB 4C3ZA 3EVGA 4JI6B 3QVGB 1LK7A 1UXGA 4TVOA 5TE9A 1MFPA 4M0FA 4ZI7A 2Q2WA 2PBRA 1NVVR 2AZ4A 3BSFA 1KH1A 2D74A 2BSQA 1NJ2A 1UOQA 3CIFA 1TAGA 3LX4A 4W8GA 3ZH2A 2GZ1A 5HCIA 4BBZA 1NONA 1ZK2A 3CR3C 4URZR 5T6MA 4ZAFA 4PPYA 3NWOA 4G9GA 2HU7A 4X3OA 4TTQA 3P2KA 4D3DA 4DM3A 4ML3A 1E5TA 5ALKA 3GUUA 1PF7E 3IVCA 4MUJA 4CU5A 2IYAA 5EG5A 3PEUA 4CIXA 1H0RA 3VZRA 1Y4UA 4JLJA 3M3DA 5GOZA 3N2KA 1RM4A 5EE9A 3EWAA 5F21A 1HDCA 2G1UA 3ETNA 3NOVA 5IH3A 2GO7A 5J4HA 2VP3A 1U8TA 1IPHA 2BI4A 4G37A 3KKNA 4CMKA 3V7UA 4EW6A 2HSWA 4ZK6A 5HUQA 1SUFA 2VNIA 4QHYA 1BXGA 1YE3A 3DBRB 1V26A 4L9AA 3DMYA 4E21A 2R8PA 4YPOA 3JQFC 1M8GA 1C50A 1RE1A 2JGRA 4GLFA 5CEJA 1UFQA 1JFTA 3KLNA 1IQUA 4O2BB 4QUKA 1XEFA 3PHLA 5BYBA 4C7OB 2V7PA 3ZWDA 4CXMA 2G4LA 1GRCA 4KMSA 4NU8X 1N8SA 3I2JA 3F9RA 4MKHA 2WKRA 3KHSA 2OQ2A 1L7VC 4GF5A 4H59A 1XXLA 5DNEA 3MW8A 4PV7A 2CDBA 2D5LA 2EHDA 2VAPA 1FDIA 2PT5A 4QVGA 3Q85A 3U0VA 4TT3D 4DLUA 1NW4A 1IOZA 3IPCA 3RIGA 1EXWA 1VMKA 3E4DA 3BXZA 4UBIA 2HHLA 2JASA 3UYLA 4B7UA 2C7VA 2Y2VA 4JZKA 2GZDA 3QEMA 3R6DA 1Z7WA 2YFQA 2IV2X 3OCCA 4WZAE 4I6JA 3JQGA 2IY9A 2WZBA 1QB8A 4BN5A 2JA2A 3NKVA 5DYNA 3H8VA 1LPPA 3P9ZA 1PNTA 1LQUA 4UZEA 1UBRS 2VK2A 3BIXA 3MRVA 4S24A 4YMLA 4RLQA 4P0QB 2IEGA 2PL5A 2AC2A 3PVCA 3KE8A 4TWIA 4RVUA 5B64A 1RKUA 1UJ6A 2ZJZA 1QHXA 3R5KA 2QR5A 1D0IA 3FGZA 3O92A 3QEKA 3RHTA 5HMMA 4MUFA 5SYAA 4Q7EA 1II0A 1FNNA 2ZJOA 1E9DA 4JU9A 4MEJA 5C7OO 2ET6A 1GYQA 1HDEA 1ZVKA 4RIIA 4ON9A 1JSCA 1GCOA 4ZCSA 1VFPA 4PZDA 4D57A 1PEYA 1EINA 3FMOB 4LJYA 3LQ1A 4PTLA 3T3GA 1WXHA 1EWKA 4BFVA 1XA4A 3MBKA 3KR1A 3JQ8A 5DWVA 5LLSA 3I37X 3ZUGA 4GKBA 1L8XA 3NHMA 3TO5A 4ND6A 1VGRA 1Y1SA 2L2QA 3HU2A 4KXQA 1J0CA 2EKLA 4MR9A 4PGAA 1PFVA 3S5JA 2I29A 3IRVA 1I6WA 2SICE 2XB9A 4DKJA 4QEKA 3WGNA 2AQKA 4J7XA 3AVOA 4KDRA 3WZLA 3FDIA 4BNDA 5KU1A 1UP7A 2QL6A 2AF3C 4KO1S 4KO2S 1J4AA 3X2EA 2QJFA 2GUWA 3EOBI 1SU4A 1QV7A 4CF5A 1O97D 3U9LA 1U0SY 1X6VA 2JLBA 1N57A 4IXTA 4OUKX 2NV2B 4LVUA 3VGPA 1QHNA 4RZSA 1FRFS 1NNI1 4LE0A 4OXKA 2B8JA 4CI9A 1IWOA 2IIPA 5JH7B 4EFDA 4PANA 4DCGA 1T5DX 4W63A 1FRNA 3OPXA 4XB6B 1JFLA 4ZAZA 4F04A 4CKZA 5M29A 3GARA 3ZCXA 2ZJ7A 4GMFA 2Y92A 3AX6A 4AMYA 3HFGA 1HY3A 4YRKA 4MQ5A 4EFMA 4RV5A 4MA4A 2P79A 4P3PA 5SZIA 2NSHA 1NPTO 3HCFA 4ZXFA 3TW6A 3ZK9A 1NFFA 3L7NA 1NBIA 4HSEA 3TVYA 3SFZA 3E0QA 3Q8MA 2QUBA 1I94B 2Z08A 2QAJA 4RZUA 1QH8B 1K3FA 1Y33E 4IDQA 4TRJA 2VQ3A 4FYHA 3RADC 3QMPA 1P5ZB 1F20A 3KD3A 4OMDA 4JLMA 1XTVA 3RVSA 4X1KB 4EVRA 1H4QA 4NK4A 4CLHA 1ISRA 2C3UA 4MR8A 4CEIB 3OFSA 3OQIA 2VSNA 4X1YB 1KOJA 3HYTA 4FE4A 3L43A 1Y81A 1VI2A 1X7XA 3NUQA 3W5HA 1WZIA 2ID4A 3GEHA 3LOPA 4RLFA 4C4RA 2WJYA 1X7ZA 2GZ3A 3GI1A 4FGSA 3HEMA 2PFKA 2X5NA 3T0IA 4KH1A 2YJZA 3QJGA 4CF3A 1FSGA 2P6RA 2FH5B 4YT5A 3FUCA 4KNVA 4MUAA 3SSMA 3TLYA 2FSPA 3PPYA 1U2RA 5AJXA 1AKEA 1J2JA 3C8ZA 1KZYC 3GBVA 4OB7A 5CDSA 2WWYA 4J4HA 1R0SA 2OAP1 1OQAA 4QJ5A 4KWCA 3WGLA 3DEHA 2ZRDA 3HWWA 1ONOA 1QK5A 2EQBA 4XAQA 4HD8A 2NV6A 2VK8A 1KHHA 1E62A 2Q4BA 3BJIC 3CB2A 1ODJA 3HU1A 1R0KA 2VUIB 3I1YA 4IHQA 2ZAMA 1PAUA 4L3OA 4RVNA 4XCQA 3AY7A 1XCJA 1XEWY 3B1KA 4P32A 2B30A 3W06A 3WXMA 1JHYA 3T06B 1JLHA 1T9BA 3JAMA 1JIKA 1SRRA 3DHNA 3H83A 5FOVA 3V33A 1X9GA 1BDJA 5BUZA 5CB4B 1G7RA 3DC7A 3HB0A 1U3DA 1FU8A 3LE8A 1UC4B 3N0XA 2KI5A 4GI5A 3STYA 4BWVA 5KYUB 5JU6A 1JILA 1JR3D 1AGPA 1OX4A 2J67A 2NYAA 2VDLB 2X4GA 3JQAA 3KLOA 3MJDA 4XZ3A 2PHZA 1GCUA 1ZI9A 3CO5A 3VV2A 3VZPA 4DSNA 5K0EA 4O2AF 3TR5A 1TC1A 1YASA 4FYYA 4DLTA 1X7HA 3CVXA 2B8TA 4PSKA 4B6QA 3SYRA 4GX5A 2ZRNA 4BFSA 2XQIA 4X60A 3CZQA 2WDPA 4I4TA 3WK9A 3P1JA 1TIPA 4V0RA 3WK6A 4DQXA 1SKYE 4E5UA 5C1PA 1OYYA 4FDTA 3T4UA 4ZC1A 1EBUA 5HE8A 3L04A 3I2HA 1U0TA 4R1QA 5EINA 4ZU6X 1XQVA 1ZLYA 2FPPB 2HIAA 3CEAA 4PONA 4WZ6A 3IX7A 3DFKA 3KZMA 5B3AA 3VSDA 4CIDA 2NO4A 5ICCA 4YRCA 4HXEB 3RUHA 1J0BA 1RCTE 1OA0A 2QQ5A 3A27A 1QAMA 2R7AA 3D8BA 5HF8A 2O8FA 5AW8A 3WAGA 1PSWA 2NTJA 3GRKA 3IDFA 1DZ3A 4KQKA 4BNIA 4YV7A 2C9ZA 3ZV5A 1I01A 1YR9A 2SHKA 5K0NA 3V8MA 4RCYA 3HMQA 2GJ4A 3LQFA 4GQBA 3LCUA 4BNWA 4N01A 1ZZEA 1RJ9B 1XD2B 2AC4A 3GGSA 3KT3A 3OMLA 2OQVA 3WNVA 3WYNA 5CDYA 3V8BA 3T9EA 2VYVA 4GW3A 3BE8A 1DQSA 3NXSA 3SY8A 5I5EA 1U11A 2XMDA 2GA9A 1PGQA 3QX3A 5ALYA 1O0CA 1EWYA 1DAHA 1RI1A 3K09A 4EW1A 3KVNA 3ZI7A 1E6UA 1ECJA 2VJPA 3VISA 3X2FA 5GP1A 2NVWA 1OB2A 2CXTA 4XD2A 2BP7B 2HCTA 4QAQA 4DABA 3EGOA 3P2EA 1YZVA 2OGSA 3AEKB 2XD9A 3EVNA 3PC8A 4ZYUA 4KOAA 3E27A 4KFTA 4UW9A 2GYUA 1E8DA 3BOSA 4GOOD 1BE1A 4EB3A 4KITB 3AVYA 4Q47A 2PLNA 5ED4A 3CEHA 1JLSA 4TV9B 2OV1A 2WNIA 1C0EA 3OPYB 4BWFB 2IEZA 3KKKA 4IH9A 5HF9A 2XUGA 1XU4A 4B4UA 3SC2B 1LSJA 2KYRA 3GDGA 4IVPA 1N1DA 1R66A 4FYPA 4PC7A 4H1UA 5B1DA 4BWGA 4DCSA 1L7XA 3AL0C 5EE1A 2VQFB 1GKYA 4A27A 4N7RA 5JYBA 1YCHA 3KSMA 1W73A 2DRIA 3N2GB 1SPXA 4P34A 4A4DA 2GJSA 1OH5A 4YTEA 3ZHVA 2CLSA 5IABA 3UMRA 2EX1A 1NV9A 1QGED 2O14A 3SVZA 1N5KA 1NN5A 2QX4A 2DUJA 3H2GA 3WBKA 1DIBA 4BJ1A 2R3SA 4EENA 2FN9A 1V95A 5AIBA 3T1HB 1UANA 5JLAA 4L74A 5AVRA 1EVQA 4G2NA 1VZ2A 3AR8A 5LWHA 2G82A 2HB6A 3DUFB 1YS4A 2R7MA 5K3DA 1DC3A 2PX2A 2J3DA 3Q11A 1BRMA 1CUUA 1ZD1A 2PJZA 2VBGA 1HF3A 2CFTA 1K1EA 5ULLA 1O58A 2CXRA 2E4VA 3PYMA 1QE0A 1P39A 3RTGA 1MOPA 3TRJA 2CXOA 4AY2A 2BGTA 2H7YA 2JBAB 3SLGA 3W1VA 4F4FA 3H5RA 3I5YA 1CQJA 1E1KA 4COKA 1ZSNA 1QG4A 5D01A 4YUAA 2W0SA 1XVIA 5HJEA 1K4KA 5ALRA 1OOEA 3AONB 3AKZA 2O4CA 3TZQA 3VVCA 3RVJA 5CYFA 4AMGA 4W8HA 1IM5A 3RBXA 1FUYB 2NO7A 4LMRA 4WD3A 4UASA 5EZQA 4ER7A 5KVSA 3PJRA 3M1YA 1U5AA 3NMUF 4OHYA 4QYSA 3ZBPA 3PI6A 4AIRA 2D3TA 2FQ1A 2PMCA 2VFAA 2LKCA 4HQ6A 1H2RS 4IWXA 4PZLA 2FWNA 4WZBB 4DADA 1QQ6A 3GYGA 4I9HA 4RA9B 2VA8A 1KJIA 2G36A 3ZGVA 1LPAB 3I28A 3H4TA 1VLVA 1O57A 3ZW7A 5K8VA 2JGAA 5DT9A 5DXAA 1C7RA 5IAOA 3GFSA 2PGLA 4XYEA 1KPIA 3O93A 3QFFA 2X1HA 3D6JA 2VATA 4ZEOA 1CJTC 3CGWA 5FHRA 3TQTA 1BCSB 4R69A 4DUPA 1HH4A 1GFWA 2VT2A 4KR2A 1DRJA 3KKEA 3Q1KA 1Q20A 1XX6A 2C5LA 2RKBA 1WA5A 3KK0A 2PKRA 4ZD6A 3PXDA 1O95D 1UP4A 1WZCA 1XDWA 3E9MA 2HK9A 3MINA 3SHTA 5BT8A 3KQHA 1NJSA 1P7ZA 2HO5A 1NG1A 4G09A 4D8VA 3M5WA 4H7EA 4DLXA 3RD5A 2YKGA 4BFYA 1QNFA 3A2KA 2X15A 4GEGA 3WKCA 2PO5A 2ZDQA 4WWHA 3P9XA 4UARA 3L0CA 1DNPA 5HILA 3DEFA 3NHAA 3KOUA 4GS5A 4Z9YA 1EWQA 3NAZA 2WHPB 3TIIA 2FZWA 2LXNA 3EN0A 4PC3A 1P31A 3B8HA 1XBTA 1D1SA 4JBLA 2PVPA 3P9IA 2Q5JA 4FD2A 5ESRA 2UDPA 1W1UA 4AURA 2JAWA 1KFBB 1GA1A 1PZFA 1G98A 2CJWA 2C1EA 3L18A 4JT4A 5HIAA 5CR9A 2Q5OA 1PEAA 6REQA 5GJBA 1FQWA 1UOPA 4JB8A 5JEEA 4J1TA 4JQOA 2P30A 4NBKA 3ZR4B 4C0HA 4COOA 1WD5A 1RPZA 2DPGA 2QMQA 4NVRA 3HYRA 1K4YA 3FDXA 2GJ9A 3AFIA 3CZCA 2MTBA 1U5BA 5J5CA 3VR4A 3CBGA 1QYXA 4UMEA 1IUNA 1FLNA 2FPRA 1UKVY 5FP0A 4F3CA 1Z07A 3NANA 2FEXA 1T25A 2B69A 5CT5A 3ILHA 2JCBA 1GZ6A 3PNQA 3W9SA 1JPJA 3AEQA 1O9HA 3G2MA 4FBGA 4PU0A 2VQSA 2HWXA 3Q7IA 4MQ6A 4TMXA 3R2JA 3CUVA 3QLVC 1Z5NA 1Z8FA 2IIBA 5EIOA 4KLRA 4F97A 4PINA 3PNPA 1P45A 3TM5A 3ZGLA 4TWJA 4XVHA 5WRFA 1KI8A 1G8PA 1OKKD 2ZSUA 3ADPA 3AEXA 2P91A 2P9BA 2QSJA 5EHXA 4Y2UA 2Q3LA 2PV0A 3GT4A 3N0WA 2CEKA 3L8HA 3THRA 3UTCA 2J45A 5E6RB 2V03A 4HWTA 1HQDA 2J5QA 2YW9A 1RXYA 1J0DA 3I5MA 2GRAA 4H6VA 5C7IO 1KGSA 4MINA 1TJNA 5A9SA 3JW8A 5KJCA 3ND5A 3ETLA 4UTXA 4WN9A 2J33A 4DDUA 4UZSA 3FMGA 3GY0A 3RWMB 2QSUA 4TL9A 4CVNA 4URWR 3PQ4A 4B7CA 3WGIA 1BX3A 4G67A 3WLTA 2AVDA 4MVJH 4DCNA 2PKEA 2HJVA 2YWDA 1VJ0A 5LR6A 1BC5A 3FG9A 1Z4MA 1MRSA 2B8NA 3AHIA 2GOYA 3FKJA 3I8XA 3OQVA 1RRVA 1GFSA 1RQ2A 1V9LA 4NCXA 2WWWA 2X22A 5E1DA 5EVJA 5GAJA 1PVVA 4YACA 2NVUA 3KVRA 1XEXB 3MUOA 3RTEA 4M54A 2WFLB 4DG9A 4ENQA 3ZQUA 2DBZA 4DWJA 3EZ6A 2A7QA 2J48A 4I5GA 1L4YA 3NVMB 4IDPA 4RAQA 3U13A 3B6JA 2ZM5A 1ZVQA 2LR0A 2G63A 3C5EA 5KTNA 1DC7A 2A4KA 1ZR2A 3RFTA 1XV5A 2A78A 3UGTA 4A15A 3O8QA 3I1IA 3G85A 1I1OA 2XVAA 4L4XA 1BIFA 1AJEA 1OUMA 1ZOLA 2I3BA 3BGOS 4U2BA 1J90A 4G85A 1G20E 4ND8A 3L4SO 4UAGA 1ORHA 3C7DB 3NORA 3NAMA 2BMJA 5EYPA 4Q15A 2H06A 3A6EA 1MQ9A 1XO1A 4A16A 5IF3A 3G7SA 1OCEA 2VT7A 4DBVO 3C70A 3OJFA 4PAMA 2NQTA 2EBHX 1KE1A 3D3KA 5JAQA 1PGOA 5KTRA 2IOFK 2YV4A 4MH0R 4YT8A 4V2UA 4NOLA 4RTSA 1NTRA 4BNYA 3IUEA 1FZQA 1BQ3A 4GP6A 5K09A 5KWEA 2HU8A 3DLHA 3UKDA 4BO0A 5ADUS 1NJ1A 4BKQA 2JJ2A 3PHIA 3TCKA 2VT3A 3D2AA 5FWAA 2HQOA 2J9FB 2ZRQA 4YFYA 5BNWA 1Y1PA 1BFKA 3LGSA 5FWDA 3DLCA 5TS3A 2I22A 3IVXA 5IBCA 3I2FA 2CC2A 1CJBA 1CTQA 5JD4A 3N2IA 1FXWA 4LG1A 4WKBA 4OSEA 5IM5A 4M9UA 1AQLA 2EJBA 4E12A 5ILOA 3ZJ5A 2W6IA 2EJCA 3N5KA 4QPCA 2BWJA 5ISMA 3ACBA 3FVQA 4CGZA 1FLDA 1L8QA 4O2AB 3UB4A 1L4GA 1A9ZA 1J25A 4GYWA 1I6MA 4G0OA 4L7QA 4NNPA 4WOBA 4DJFC 3OIYA 2Q3JA 3V1YA 3AZOA 5GWXA 1RLMA 2BV3A 1H3NA 3ODGA 1EEHA 1CY6A 2C8VA 3FYSA 3T3MB 1XSEA 3NV7A 4HFMA 1WEKA 4DMHA 4LJ8A 2A0WA 3DOFA 4KIJA 1A4UA 2IRWA 4RQBA 3VU3A 2DJIA 3GP5A 2I3GA 4JZYA 1QV6A 1D8TA 4H4CA 2BFBB 2Q3DA 4F4UA 4BRZA 1VHJA 4XDZA 3C39A 5IN5A 5BN5A 3TG2A 1W30A 1FRZA 1P3Y1 3D4PA 1VFNA 2I7CA 2MSCB 2X1MA 2VNKA 4EJFA 1OIWA 4MVJF 2QJTA 2WTNA 4MV6A 3DPIA 2QG4A 1RDFA 2OZEA 3U7GA 3ET4A 2H1WA 3NIFB 3TBFA 4HUJA 2C9OA 3AU9A 1KAQA 5B7NA 4ILEA 1LBHA 2ZRCA 3EW7A 3ZG6A 3CNHA 4B3BA 3GCZA 2YS7A 3DQQA 1LW6E 1Q22A 2G5CA 4TWRA 1DAIA 4N0PA 3AESA 1TQ4A 3AJRA 4C2BA 2ZR8A 2FR1A 1ZI8A 1V9SA 2PGIA 4LQ4A 5CBKA 5JNTA 5K0BA 2O3SA 1Z4KA 2XNJA 4D1YA 1U02A 3FVWA 3MWEA 2WJ3A 4HTFA 1HRDA 1G1AA 1PFGA 2IGBA 4AW9A 5HYVA 2I2FA 4ND1A 3CLVA 1XZ8A 3R76A 3PDWA 3VYSB 4ARZB 1QOQB 4YGYA 1ZISA 3ABZA 4HDRB 2WC1A 5IYZA 3LLUA 3GN2A 3IAM6 4Z3DA 1Q91A 1YKGA 1RD4A 2G80A 3DT6A 4KAXA 4CTKA 1WW2A 3ADKA 4HYEA 1UBTS 2B21A 5AVWA 1S8FA 5F9MA 4X7RA 3KM0A 2BFEA 3UXMA 3GLFB 3FNEA 1XPOA 2ZW9A 2QXTA 3SS9X 2X0DA 2IP4A 3KYJB 3ILYA 3LV8A 1GGMA 3L05A 2FZCA 4Y30A 1H5QA 1DC5A 3V8VA 4BL5A 3NH6A 3GH3A 4DA4A 3QI7A 3ANNA 3ZK8A 5JNSA 3X3HA 1IBLB 5KZMB 1OLUB 1BCRA 2H5JA 2IOFA 2NTVA 4LF4B 2PS9A 3ZTTA 5DHQA 1CNFA 1H2AS 3ZVRA 1EIZA 3FWKA 4JXJA 1KQGA 1IWBB 1UMCA 1T8WA 1QZXA 3U17A 4CIYA 4EJ2A 1UQUA 4REQB 4Y1FA 4BO6A 1J99A 2FSVA 2QVZX 1YS9A 4JFRA 3A9VA 1L7AA 4MWTA 3JYHA 1W8IA 2GCOB 5BOVA 3VYWA 5IM4A 1ZHOA 5C1OA 2PJUA 4E3WA 3M6FA 1JFRA 2YN0A 1E9SA 1SBYA 2CNBA 4QJ3A 1AHIA 5EUMA 5IT4A 1Z74A 4R1NA 3ZDEA 2F59A 3RFFA 1VCOA 2IP1A 1QANA 1EX6A 2HJ9A 4YP6A 4J94A 5HZGA 1S3IA 1XTRA 4I0WB 2OBLA 5ERYA 5FBZA 1PLJA 1EXNA 4N8SA 1RMTA 1RQ7A 4EL5A 2QP3A 2IBTA 3MG9A 1AHHA 5KTPA 4FPXA 4G8BA 3ELYA 4GHWA 3VGJA 4OHBA 3QVOA 2XCUA 4RD0A 2WJJA 3TLMA 1YDGA 4NCJA 2C4UA 121PA 1JECA 2EZ4A 4H6XA 4NU0A 2ZIXA 4A5OA 2CMGA 2D5AA 2QW0X 5HXAA 2QGFA 2PLRA 1SO8A 2OO3A 4TVKA 4HGZA 4KN6A 3FCUB 1PW7A 1UDWA 1XZMA 4M0KA 4RANA 4CETA 1Z0UA 2EKPA 3EISA 4DA9A 5JASA 3FR7A 2BR5A 4NZOA 3KX2A 3AOGA 2C8LA 2FAXA 2QTFA 1FEZA 3R3YA 4WACA 3RYFB 3IDQA 2ENUA 3IHTA 4YJ3F 3NTOA 4ABYA 4TROA 3BFKA 1TRKA 1T8SA 2ZJ5A 2ZB7A 1GR0A 1A27A 1S9DA 2XEDA 2WYUA 1GGFA 3EH1A 3KWJA 2BEWA 1R18A 4KTTE 3CVJA 3WK7A 5A5DA 3QQ5A 1U9IA 5IJZA 3KR0A 3GJ7A 3P0RA 2VXBA 5GONF 1CLEA 2YWCA 5EJFA 1LRJA 1W19A 1GQRA 2FQXA 1VECA 2GFQA 2QROA 2RG1A 2ZYAA 3DHVA 1DQRA 1T9DA 2JFWA 2ZBRA 3QV1A 1BKDR 4KAJA 1K86A 4OGLA 1G291 2CDAA 3GO4A 5IAGA 3U7HB 2HH9A 4RY0A 1X94A 4ZVSA 1K6XA 3KQYA 5FOSA 5HRUA 4M0EA 4GX1A 3GRFA 2BJVA 3V80A 4BEVA 1MVLA 4U6NA 4UHCA 1M83A 1SIBE 2YOHA 3G7NA 1I80A 3ICCA 1VE5A 3L6BA 3GBSA 2DFVA 3QU7A 3GDFA 2GN9A 1EK1A 2P67A 3OPVA 1XIVA 4IBOA 2GEUA 1TUBA 1ISJA 3QP9A 1GILA 3F3YA 2Q0QA 3K5IA 4MW0A 3RKRA 3SPXA 4CUZA 4CHTA 4Z4FA 1IXSB 1UR5A 1FVOA 3ZDBA 2M32A 4RPCA 1R27A 1IK6A 1F4VA 2N9UA 1G8FA 4CKYA 1DOAA 4BASA 5FEUA 2ZANA 3TKAA 3QUQA 1ZZGA 3PC3A 4JX9A 1Q0QA 4M21A 4YGXB 3FYUA 3LUFA 4PIPA 2CJFA 2PUEA 2W4IA 1HDIA 2ANCA 4H4EA 4KK4A 4RETA 4V1CA 3TLEA 2V8OA 5JPIA 3WGZA 3O8CA 1ZVMA 3HCBA 4LHVA 1YVUA 2R1UA 4LRYA 5JYDA 1E0JA 3QF4B 1R6XA 1HG0A 1O97C 1WXQA 5LP6C 1ZWLA 4HRAA 4EZBA 3VHQA 5KQPA 1J42A 3SYMA 1KIMA 2JIOA 5JQGB 4O3MA 4WXMA 2B25A 3MZ0A 5DO9A 2JIQA 4GPBA 2X42A 1XYYA 5JSQA 3O03A 4JI2B 3S6JA 2Y1GA 1T2CA 4NOMA 4E0BA 2HPVA 2OFFA 4KSBA 4ZI7F 2QAGB 3SF0A 2IODA 1DCTA 4QUGA 3ZE1B 1FTGA 2X5KO 4HR7A 2BUAA 5BMVA 4LOLA 1SOWA 2P4SA 1FDTA 3ETGA 4LJ4A 3CKYA 3H4IA 1SY7A 3LUCA 3W5BA 4DR7B 1OWPA 3RTBA 3I2IA 1F8XA 4HEA1 2JD2A 4HPJB 8ADHA 3GUYA 3KSAC 2XPCA 1FUEA 2ON6A 4WGFA 1Z37A 4NYIQ 3RC9A 1YQUA 3S2FA 4PAOA 1VSVA 3LXUX 2A58A 3A0UA 2IHJA 1AV7A 1CZOA 2JD1A 4U0KA 1UEXC 3AEZA 1E2LA 3U4AA 2C54A 5FUMA 3LUAA 1YRYE 4KXWA 2V7BA 5L7YA 3SU8A 1QSGA 4D0LB 221PA 4I66A 3ISVA 2XTAA 3UT5B 3Q72A 2OECA 3IUJA 3UAXA 1Z5PA 2R44A 3MWDA 2QRLA 3OEHA 4ZQFA 2D00A 5DEOA 3OJEA 4IJWA 1AZTA 4XUDA 1WPRA 4G1FA 5LU9A 5F4ZA 1L8OA 2GF0A 1KBQA 4YCAA 1BXRA 4FGUA 1K97A 2QEQA 4EYOA 1FS4A 3LHSA 3OM9A 5BVGA 3WLKX 1A5SB 4ZGGA 5LDHA 4C6TA 2PM8A 3N70A 1HKUA 1ZKMA 3WVNA 1Y4DE 5I7VA 3HXOA 1GDHA 3RIHA 2XGSA 1U2EA 4YRLA 3RAEC 2GPNA 4Q3KA 4EEZA 3OIDA 2ZJ0A 3N8KA 1LC3A 1SBHA 3RFVA 2GM9A 2KSQA 4RC9A 1PT8A 2GAOA 1E3WA 3ZQJA 4BMOB 5C5IA 1LX7A 2ZXUA 3CONA 3RVLA 3AXSA 3BWBA 3ZNQA 1CF4A 4C9BA 5KYTA 2TS1A 4Y1RB 2ZI9A 3U3JA 4M22A 1RYNA 4I1IA 3QVSA 1VPLA 1CVLA 3D0OA 4LNHA 4JJ7A 4V0OA 4LWZA 3GQBB 4C88A 3T7CA 5EJ4A 1MTZA 3G8CA 1XALA 3DBLB 1ULTA 3TS1A 4ZCPA 2G9UA 2CLIB 2YYAA 3R7FA 2DUWA 5KOHA 1VKJA 3T7KA 1ZL0A 2Z8ZA 4M53A 4JQZA 1TI7A 2WWHA 3CX6A 3K0BA 3KXIA 2QMEA 1KVUA 3KEOA 4OLAA 4RIHA 3N75A 4OK5A 5BR4A 3BICA 2F8SA 4KGDA 4OPMA 4NQZA 4LVCA 4MQFA 5CDTA 1R12A 2CBZA 2HBQA 2H4XA 1T3TA 3CINA 3EUWA 4J0JA 3W5C