3RAFC

Quinazolinedione-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
226
structure length
208
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Inhibitor-stabilised cleavage complexes of topoisomerase IIa: structural analysis of drug-dependent inter- and intramolecular interactions
rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/antibiotic
total genus 59
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rafC00
3LTNC 3L4KA 4G0UA 5EIXA 3RAFC 3KSAC 4G0WA 2XCSB 4KOEC 4FM9A 4I3HA 3QX3A 4KPEC 3RAEC 2XCOA 3K9FC 4Z4QA 2XKJE 2XCRB 2XCQA 1BGWA 4KPFC 4Z3OA 3L4JA 2RGRA 3FOFC 3KSBC 4G0VA 4Z53A 3RADC 2XCTB 2XKKA 3FOEC 4J3NA 1BJTA
chains in the Genus database with same CATH superfamily
4KXLA 2OEPA 3CISA 4E3WA 3AF0A 2PL9A 2XGOA 4K9SA 4Q7MB 4N5LA 5TEVA 3ZBQA 4EZEA 3K0BA 2Z09A 1H8HA 3MTEA 3NRBA 4MWSA 4LYEA 3ZGXA 3EQ9A 4L3WA 4MWDA 1Z2CA 1J70A 2V7TA 1OU0A 4XW2A 4EENA 5KWSA 1JG1A 4MQEA 2YCBA 2DY0A 2EFEB 4L8VA 3B6MA 3T7IA 3ESCA 2OSVA 3S5UA 1X6VA 5CVJA 4A2CA 6REQA 1E2BA 5T4EA 3ETDA 4CV1A 1QIMA 4H1WA 5F76A 2W6PA 2WJYA 5JS1A 2J3JA 1EE2A 1SD2A 3WRYC 4XGIA 4ZZ0A 3E2MA 3LE8A 1YKSA 2IWHA 1L3IA 2MMCA 3UF0A 2NZWA 4MDYA 2WRZA 2OQVA 1SXJC 1TJYA 1B43A 1QVVA 5JDCA 1X0XA 3SJCA 3ASVA 4LYGA 1YQUA 3GVHA 4NCHA 4N3CA 1U0BB 3PLNA 5C8VA 1XCPA 2PTGA 1E2UA 3BIJA 1N2HA 4DLXA 3QLUA 4I3HA 4CCYB 1UBEA 1M5UA 1I10A 1MTOA 2PXXA 2O7VA 2VCYA 1S5PA 3BSFA 2H59A 2VXYA 5CDGA 2AFHE 3CNBA 2UUBB 3WADA 4MKIA 1DU4A 1SUFA 4LHVA 3VZBA 1RWKA 2EG9A 1U2GC 1S4MA 1EUDB 5FOQA 2D5IA 2D5LA 2WU1A 1HT2E 1P2BA 4HAOA 1U0TA 2HCJB 2DFTA 3VVCA 1BVUA 1T5BA 1VOTA 3EXIA 4FMBB 1BKSB 3PT5A 4LTNA 2PYIA 1E99A 3P4XA 3TSAA 1UBMS 2XMPA 1Y6JA 1NMEA 2AOUA 1POXA 1ZSNA 2CLIB 4J1QA 4KWHA 5E95A 3GLTA 2IYRA 1KZ1A 4QYXA 1NT2A 4XQ9A 5KYXA 1ACLA 3ANMA 3VPGA 4EY8A 4LNHA 2H6EA 1CIVA 1FZQA 3RWBA 1QIHA 3AHIA 4L22A 1UKCA 1JZQA 2GERA 1RM0A 2XVMA 4JS0A 4QNRA 2J5RA 4RZSA 4PAOA 5FBLB 3HDGA 4NCXA 3KKKA 2OT3B 5AHXA 5SY4A 2I1QA 2FU5C 4EI8A 4ZMBA 4ARCA 2B8EA 1O9HA 2X13A 3X1MA 2M6SA 2OZLA 1G2QA 2Z4SA 3C7DB 1B00A 3AFNA 1XAJA 4XB1A 2ODNA 1NP7A 2J3KA 2P3OA 3C24A 1R8XA 1MQSA 2R2GA 1AKYA 2QMZA 4ICIA 4MVJI 1OY1A 4NE7A 2BR3A 4PIVA 4DB4A 3ZYCA 5FFNA 1MUUA 2A59A 4MR9B 2WINI 4U7HA 4NP6A 4J3NA 2W90A 4NU6A 1L3CA 1TQHA 1JF8A 4MV9A 3ZS8A 2VUUA 1K98A 1DQSA 1Z8FA 2DOKA 3O9ZA 2AI2A 2WWXA 4QSMA 5HJ5A 1KTIA 2PX3A 4B0PA 1Z7YA 1KO1A 2RGYA 4P2BA 2WOOA 5AT1A 5FPHA 3WMEA 2FRDC 1YL6A 1R7RA 4C4SA 4YJGA 3ERCA 2UZ4A 2OYCA 3MTJA 1KOLA 5FV4A 3FAKA 3V7WA 3B1YA 3WWDA 4CKYA 1EWRA 1I14A 1N75A 2VSNA 1R88A 1SG6A 1UUFA 1IEQA 1ORWA 2IW3A 5DGTA 4YCNA 1AGNA 5EPUA 1UDWA 13PKA 3D6TB 3RU3A 3S1AB 3HXPA 1OJ7A 5FL7D 1B0PA 2X8JB 2H1HA 2RGNC 2BR4A 2AX4A 2DU8A 2O52A 2WYUA 3CZCA 5IF9A 3UMFA 1UBHS 3L4KA 3JPWA 4H15A 4PX9A 5ALZA 2AG1A 2FSVA 2CNDA 2BGUA 2F9MA 2YS6A 4DBVO 4I1PA 3EA0A 2WYIA 1USIA 1OUMA 2C97A 2JZOA 4QEKA 2HM7A 3MAJA 4IEIA 2B1GA 4CMGA 4LDPA 4YRLA 1JWAB 2NTYC 3FY4A 2OXTA 4EX6A 1KOFA 4FT4A 1XF1A 1QSGA 2C4KA 3CO0S 1GRCA 4GRAA 4HB0A 1OZHA 5CNKA 5LQMA 1NYTA 1MB0A 3PVZA 3W5IA 3KUUA 4X1KA 5CT4A 3GZTB 3HDJA 2V5VA 3EXEA 1P9LA 2R8EA 4JWKA 1D7OA 4WVFA 1F0PA 2QTHA 5JH7B 1ZQ1A 2V5AA 3FI9A 4BX8A 3RYCB 1QK5A 2XUAA 4R68A 1MFZA 1ORHA 3NTXA 1C0IA 3K0KA 4N7MA 2Z9CA 1ZUD1 2OHIA 4I7EA 2W4QA 5JOQA 4ZEVA 1ZR4A 4RGVA 4M1SA 4O59O 3U3MA 5FPQA 2G6BA 4LSGA 2ZSJA 4FKMA 5FBZA 1ONBA 3TXAA 1JB1A 2R1VB 3I1JA 5KYUA 3WC4A 5TGDA 3FDJA 3L92A 2AZTA 1XAIA 2VFAA 2R7KA 2YX1A 3MJ4A 1XZ8A 3OX2A 4IFEA 4EBFA 2PPVA 1TO2E 3OD5A 3VHRA 4RD0A 3CEAA 4CODB 1XJCA 3GT0A 2AEMA 3EHDA 2G77B 3N2LA 3DF9A 2P79A 3BXXA 4ZWNA 3I83A 3K53A 3N2IA 2PN1A 5ARDA 4UBMA 2EWMA 5BNFA 5AM2A 2BZSA 1QIJA 2O6LA 2E49A 2FB9A 3IDAA 4M88A 1TU3A 4RQUA 1KO8A 3RTAA 1G5RA 1U2PA 1DKUA 1E32A 2MIIA 2VPTA 1M2GA 1OHHD 1NN1A 2VTEA 3E61A 2PSEA 3GIWA 4JUIA 4F1KA 1Z6GA 5B58T 1VBKA 1RYEA 2HQBA 4K87A 1TJ5A 5CURA 3RT7A 3V6LA 4AJNA 4CT4B 1Z39A 4ZFNA 1K3FA 4B75A 3CF4G 3EIQA 4RSGA 1ORDA 1STOA 2YZ7A 4YONB 4BOYA 3RYFA 1FUUA 1D5CA 5J47A 1GV0A 1A9TA 5CVEA 3ZJ4A 4KITB 1C7RA 4PO9A 3ZHYA 2Z2JA 3DAPA 1R8JA 4ZQEA 2FW8A 3DE7X 1CZUA 5DU2A 4BC0A 3USZA 4IJUA 5A9RA 3UJNA 2N3ZA 1EG7A 2PSSA 3LVFO 4HLDA 3RVRA 3WLOA 2FW1A 1R64A 3B6IA 5A02A 2ZS8A 4BJHB 1KAQA 1QU3A 4EB0A 4Q47A 3MS7A 1R0XA 1V8ZA 1PX0A 4OHBA 3SQLA 4PV7A 5ADUS 3WNVA 4DCJA 3ORYA 3F47A 3MS2A 2XOKA 2AFIA 2B25A 2ID9A 5AI9A 3PPIA 1P0IA 2WUGA 4EW3A 2O8FA 5I51A 2WF9A 2MMGA 1OZFA 5KYVA 3AIMA 4ND7A 4XJTA 4CF5A 4FX5A 4BAZA 5KJFA 3VAAA 2Z5VA 1CJKC 2O7RA 3HBMA 5DLDA 2XBMA 4X1IA 3GBPA 3N3AC 4JYBA 2IL1A 1F12A 2XDWA 1OH7A 4XM1A 4A91A 1TTHA 3A11A 4QGAA 2BM9A 5G0TA 2XTNA 1GY8A 3K9NA 3K9HA 4MQ4A 3C7CB 4OMUA 4LQDA 3K2QA 3NBXX 2GWRA 2OENG 1Y7LA 3JSXA 4M0UA 4EFKA 2Z30A 3ZX5A 4YV7A 4A2WA 3QJGA 4P08A 2BMWA 4BV2A 1GSAA 2XNDD 1RHRA 4ETNA 2FVYA 1DEXA 4KQWA 3HEMA 3LYLA 3OQNA 4HLNA 4QO8A 5K0LA 4LPKA 1SUEA 3G5TA 4IDNA 3RSQA 1CDEA 3T35A 2FGJA 2G8NA 3UKDA 1VQ1A 4KO4S 1JUDA 3UENA 1YS7A 1M1ZA 2YWFA 3O7MA 4HEHA 3E9CA 2IGTA 3GP3A 2PV7A 1H5QA 3FFWA 4JLBA 4TS1A 4KQ6A 4WKNA 5I3CA 5IANA 1V8BA 3GJRA 1BE1A 1U3WA 1RPNA 2B82A 5KTKA 2IHUA 3I62A 3RUDA 2F90A 4F4DA 3V55A 1RJ9A 4CDGA 4F45A 2WJAA 1FFBA 2VDKB 3BZUA 5PGMA 2QUAA 2AXNA 4LJSA 4EUKA 9MHTA 4EBBA 3K0AB 2Z6VA 3MIIA 5IXSA 4RJ2A 3FYHA 2PWZA 3AB3A 2CWWA 4HTFB 1I01A 3JAWA 2C5SA 4LJKA 2WAMA 5FNVA 5JR3A 1U0LA 2VDOB 4MKXA 1LRLA 2AQIA 2QGFA 1Y42X 1RTTA 2JW5A 1ENZA 1JIVA 3NNNA 1ECCA 3C2QA 1H69A 3E9EA 4NS4A 1G8KA 4XYGA 2OGSA 4IO0A 1NOJA 1U0FA 4J7CA 2CT8A 3EFBA 5AUNB 4OBBA 1M72A 2NT4A 1X7XB 4CKCA 1GAXA 2MCFA 2YIJA 3CH7A 1E79D 3IELA 5BW5A 2XZOA 3WDSA 1IXSB 1A5SB 2YWCA 4TKVB 4C4ZA 3NGMA 3VVMA 5C8DA 4QELA 4FYMA 1KI1A 4BJ5A 2PX4A 3N7UA 1ZI9A 3HB5X 3HYTA 2ZYGA 3Q0EA 3FNRA 2FVXA 4FN5A 1E3EA 3C3XA 2ADFA 4OP3A 2BH2A 3CE9A 4Q1BA 3R7LA 2O8CB 3WIDA 3HQ4O 3EOAI 4QUDA 3PJRA 3QPWA 3VHXA 1XTJA 1KGDA 1UP4A 1TQDA 4KDCA 3RRMA 1J5XA 5C1PA 2FMTA 4J0DA 3A7EA 2LIVA 4GRIA 4M7PA 5K3EA 4XJSA 4CMAA 3SQDA 3CX4A 2Q2OA 3QTLA 2DUJA 1IY9A 1XP5A 2DBYA 2O2EA 3M6VA 1NXTA 2ZYRA 1LJUA 2PUGA 4MUJA 4A8JB 4Q37A 2WP8J 3RS0A 3KXIA 1I7SB 4HN9A 2ANBA 2C3YA 3HKEA 1QG4A 2O1SA 1XKTA 2X1MA 4MWCA 3TS1A 2I4TA 3VH2A 1L4BA 1Z08A 3KJFA 5B7GA 1C29B 2J3EA 3FF4A 1NQTA 4YRPA 4F6CA 3N0RA 3T0IA 1ZS9A 3UT6A 3I6BA 1Z6AA 2ODWA 2YHIB 2GTIA 1Q7BA 1JT2A 1YR2A 3K31A 1S9HA 5TMDA 2RB5A 4DJEC 1UT5A 3U56A 4KE9A 3E3NA 3FNGA 4BLVA 10MHA 1BC5A 2OAQ1 4QYIB 2H63A 3MTBA 5EWJB 2GDJA 3QHQA 4KTTE 1JVNA 2HV8A 3ESZA 1DLJA 1TCCA 2PKQO 2VJCA 5EN4A 2BFOA 3AIIA 2W9XA 5BOSA 2XMGA 3FVVA 1GA6A 2H85A 2J32A 4CKEB 1ZN9A 1NR7A 1T4BA 3O93A 2FZCA 3DFMA 3A9SA 3X44A 4Q93A 3ZVNA 4LWZA 2VHYA 1N1MA 1H8EA 1G3MA 2ZQ5A 1UJ4A 4ZVOA 2Y66A 2TRSB 2H1CA 1T8UA 3KDPA 4EG3A 4GOJA 1RYZA 4UMEA 4Q4AA 4M0PA 4BNGA 5KSOA 2OECA 3M5CA 4TZ0A 4DPLA 1YI0A 1JR2A 1L8LA 1S2MA 2J4DA 3BCSA 5AICA 3PUJA 3IKJA 4ZRMA 1Z74A 4BE9A 1QIFA 1V4BA 3FG9A 3FOAA 4OFBA 4DNQA 1HG0A 5DCYA 4YDHB 4ZQCB 1KMQA 2BEUB 2WW8A 3HUEA 3G5LA 3L1HA 3RBXA 3DLTA 4WCVA 4OX9Y 5I48A 3ETGA 5CMLA 2GEVA 1MB3A 5ICGA 2LGJA 3DUWA 1Y3CE 4X00A 2YYYA 3PHLA 1FMCA 3QSGA 2PGLA 2F8LA 2YZNA 3B1FA 1KI9A 3CNEA 3KR2A 1J2TA 3NBUA 5IRCD 2NTVA 5L3ZA 2EF0A 5DOVA 4EPTA 3LP6A 3FH0A 1UBUS 1UOEA 2POQX 3R3HA 4Q3DA 1XJQA 3F1KA 4WCFC 2EJUA 5KNCH 1XN1A 4ZTUB 3W5DA 1SGWA 2FV8A 2IHJA 1DFHA 3UMCA 4UTRA 3KE8A 4LAFA 1FLDA 2VP6A 1EWTA 3KSUA 2VTBA 1JHRA 2X22A 4QYMA 3HO6A 3JALB 4HVAA 4ZGBA 4N5HX 1W36D 1P77A 1ZD9A 3SQMA 4QLOA 3GEGA 5E6SA 1M54A 3RTGA 3Q3HA 1L9KA 1WMBA 3FR7A 1TO1E 4NENA 4B7CA 5IKMA 1FFXA 3Q7QA 4IRMA 1ADJA 4FEGA 4CN8A 4NZNA 3WWEA 2FFHA 5IJZA 3RBVA 1N9GB 1KDVA 3KZCA 3PGA1 3SZRA 3WBKA 3PLAE 3BHNA 4CM3A 3T5TA 1RAEA 2K7ZA 2XJ9A 5C2JB 2C20A 4YHHB 4GFDA 4Q1DA 3A31A 2Q1SA 3D4OA 2X5XA 3M6XA 5AK6A 1NDUA 1RKQA 3ET4A 1X1AA 1TUIA 3A3NA 4D41A 1GJRA 2OCAA 1A71A 1PZEA 5DM0A 4AKTA 4D4HA 2ZP1A 4RDXA 2EEZA 2VBFA 2R4QA 3NP9A 5HOQA 2J0VA 5DGIA 4F7DA 1BMFA 4D80A 1AQIA 4YMLA 3EGDB 3Q7IA 5GOTA 4CMKA 5E8RA 4V3CA 4QQKA 1X80B 5MGNA 3JCZA 4KR9A 3M82A 3RS4A 2WHQA 1R3UA 3T9CA 3X2SA 2PZ8A 2P4UA 3ZYZA 4CM8B 6Q21A 2ZGVA 3KETA 1AGPA 1ZVQA 1V9SA 1V1RA 2BUCA 4AN4A 4Z5XA 5L8VA 3OEED 5HGJA 5GOZA 5KNBD 3NHSA 2Y9PB 4RJIA 3ESBA 5JZBA 1INLA 2VHXA 3LA8A 2R1TA 2O06A 5B1DA 1OROA 2E5FA 4C4OA 3AR4A 1P1HA 1OVGA 1T3GA 3R0JA 1OYWA 4M21A 4NAUA 4AX4A 1LBTA 3PC2A 5LZ5A 3ZK7A 4QYTA 4U00A 1U90A 2ZAMA 1T5LA 5ED4A 1H6AA 2DFLA 4EF5A 4GLLA 1DKNA 4HSEA 3D2CA 3QFRA 4O33A 1ZONA 2AMLA 1FRFS 2HUPA 4Q7LA 1SBQA 4WZAB 1X8JA 1SELA 2FUCA 3VH3A 1K0UA 4M2LA 4BMYA 1DIRA 4PYOA 1DT3A 1T6NA 4X45A 3L84A 4KMOA 3SR3A 2QUIA 3DZCA 4YJ2A 1PGQA 1IY0A 3QVXA 3H2KA 1GQRA 3AB8A 3A26A 3LCMA 3MRVA 3CZMA 3CUVA 4FR5A 4HN4B 4JP5A 4NV0A 1YH3A 1H93A 5H68A 4Y2XA 4OBEA 4RU1A 3W2FA 4UULA 4M0EA 1SRQA 2YQ5A 4P5DA 4H7EA 4DA4A 3SIXA 2AFHA 1N92A 1KJJA 2ZDGA 4MW4A 4PLVA 2UZIR 3A37A 4Z6KA 5KYWA 1PR2A 1XMXA 1XCOA 3KXDA 1I1OA 2YVLA 1HE5A 1EHIA 1L7OA 1SA0A 3H16A 4EUNA 4TN1A 3FJOA 3EARA 4BN5A 4DM3A 4CG3A 2XECA 3KQYA 1CT9A 1JDUA 1RXCA 1I1HA 3QFTA 2K5UA 4QODA 3AHEA 4EQ6A 2VI5A 5FD8A 4BKMA 3FNEA 2WIJA 2GBLA 3HGQA 2QI9C 3PXCX 1L4GA 2PE5A 5HUHA 1N3YA 4CEJA 3JVUA 2PUFA 3L4BC 1CYEA 3HP7A 4IZHA 1T8TA 4NFSA 1B8OA 2JLQA 1KS2A 2WTNA 3HO8A 5L51A 5DNEA 3W1VA 1GTZA 1J6UA 4QOEA 2W8BA 1Z8HA 3VC3A 4BVHA 2GA9A 2H9AA 3FMPB 3PCRB 2V7XA 3R24A 5BXYA 3R3ZA 4LCBA 4ZV4A 2Y99A 3BTSA 1M2HA 4HC4A 2IU4A 1M76A 3D3KA 3AY6A 3C5EA 5DM1A 3MAAC 4DSUA 1U65A 1M6EX 4HDRB 1X42A 2PWYA 1JPNA 5BQFA 1FSSA 1M1UA 4JBXA 3BS4A 3NBQA 5JXJA 4KYTA 4L6CA 1OWNA 3C6ZA 3EUFA 4JLJA 1UIMA 1UH5A 3PX2A 2XNHA 4TLEA 5H1YA 2WWGA 1QDUA 2ZIUB 2WWIA 1NMSA 2O19A 4V1CI 2GK3A 2QNRA 3FVWA 1U4SA 1MX3A 2FWPA 4CKBB 1XA4A 3NVKI 4RAOA 3T3IA 1MJFA 1RI5A 1Z8NA 3FDZB 5A4IS 1BEZA 3IESA 1SBZA 3OCJA 2Q3FA 4LHZA 4LRUA 4UJ3A 5AKXA 4FDAA 3U3ZA 4Y1RA 1HDGO 4N7JA 4NYMQ 4ZT5A 4DCCA 3COPA 4XD2A 2ZIXA 4P4NA 8MHTA 5DIFA 5LFAA 3WDKA 1RWNA 1SVLA 3EEYA 2I3ZA 4YJ3A 4AKGA 1EGVB 2GPTA 4RVHA 4AN1A 1MJGM 1YI1A 3VDXA 1S8AA 4GI5A 3REOA 5JNTA 2V3WA 4GMXA 3T7SA 4A23A 3E9QA 3N59A 5I7FA 3OIVA 2ADMA 3AF6A 4RENA 2AOTB 2EBHX 4BFUA 2AF3C 3OFVA 4KBYA 3TSZA 4BNWA 1PJ2A 1X1TA 3E82A 3TIIA 4EHFA 1CFZA 4EYQA 5J23A 1G5PA 5EWLB 1Z4OA 3A9CA 1HDYA 3JYLA 4QX6A 1OPRA 4KO3S 3KD3A 2AW3A 3F6YA 4MPTA 2CLCX 5K2OA 1KEPA 1ODSA 4US1R 4PG7A 4MYRA 3RVPA 3RYIB 4DCPA 1M8GA 4L3VA 4TTTS 4U02A 3FDFA 4C7OB 1FY2A 1OBOA 1ISGA 2XTJA 4MQLA 5EVCA 3MPUA 2O3TA 3ESQA 3MOGA 4EG4A 4IIDA 4RTKA 3KWFA 3B5IA 1QHNA 4K9LA 4PLFA 4PQYA 3U7FB 1D1QA 3BG5A 4EI2A 4OLAA 1QYDA 1L7XA 3LUCA 2XAAA 4OHRA 2FF5A 4BVAA 1W30A 1JV2B 4G07A 1T3SA 3AF3A 2ST1A 1CVLA 2IYOA 3CPJB 4X54A 4C0KA 4PAGA 4YMTA 1T36B 3TZQA 3KNZA 1VYTA 2DWPA 3BKWA 3SHVA 5IAAA 2B7CA 4I8XA 1DELA 2PXHA 3MG9A 1EFLA 1TZCA 2ORED 2A5JA 4IH1A 5JRJA 5T8KA 1GYQA 3F2VA 5CUQA 2IS1A 1YWGO 2CNBA 2Y1WA 1XPJA 1QGDA 3KHTA 1U9IC 5A6SB 2AG5A 2B9EA 3GEMA 5TQ0B 1AKVA 5DASA 4OJMX 1VHTA 1RVDA 5BN4A 2W6ID 1ODJA 2W71A 1DPGA 2WP0A 3CRW1 2WIAA 4HH4A 1X3LA 4MP3A 1VMDA 5FAXA 1F0YA 1W76A 5HG0A 4GYJA 1J0BA 4CM5A 1W0CA 4JT4A 4RPHA 3ZXUB 4ERNA 1H3EA 1DXYA 2DAPA 3F3YA 5KQLA 5IT0A 4EWLA 1AJEA 2ORIA 3VR6H 3T41A 1J7KA 5EMHA 3WSVA 1NWCA 2AOXA 2GEBA 3LF2A 2Q3HA 4Y8VA 2BT4A 5CA0F 1LGYA 4B35A 4DWWA 1FFYA 3N76A 1RQPA 2FZ4A 3P9KA 4NNOA 1EVYA 2FMIA 4NMLA 3ANLA 1RBYA 1EUCA 4N3AA 2WC1A 1GNQA 2DWUA 3OZEA 4FE3A 4P98A 4JVNA 3FCYA 2EVWX 3IQDB 3VH1A 1WD7A 1NVBA 4I55A 3N8GA 3T3GA 2G07A 4MVJF 1XKXA 4DHWA 1G4UR 2DLDA 2VQFB 3WMXA 1CR2A 2B35A 2Z2KA 3MS4A 3AUSA 4WXHA 3AUAA 3PNLA 2QG9A 3E9YA 1ONPA 1G8AA 1WDKA 3JQCA 4YP5A 4WSOA 5FI3A 4ZZIA 3M49A 3WK9A 4LZNA 3Q8KA 3K5WA 1ZYUA 5JXHA 1WCYA 3KL4A 5D3MA 3PEFA 4R1UA 3PWTA 1C30A 2J0UB 2ASEA 5JD6A 3GRUA 2B8JA 4FDVA 4QGGA 3VMFA 4BNIA 1ARZA 2FN3A 5KOJB 2VZ0A 1MDBA 4QYSA 5LD2B 3ENVA 2XITA 2QXYA 1J23A 1H1TA 1KO4A 4HAWA 1W87A 2EXXA 2VKQA 2JEOA 4OHOA 3WIOA 2W42A 3RIGA 1DUVG 1M2OA 3CF4A 3FM9A 2WFLA 3OWXA 4NBKA 4AYWA 1W6UA 2OILA 5D6OA 4K9KA 4TMVA 5AESA 3D6MA 3GGPA 1LNQA 2YDYA 3G68A 4MSUA 1C8KA 3RJ9A 3VR3D 4R40A 3ZVKA 1N6IA 3KAKA 2QG6A 3PTLA 3FOFC 3KEFA 5ALRA 1U28A 1SUDA 4GO1A 3WKBA 4TMXA 1M6WA 1N5KA 1UZMA 1ZJ5A 1HFJA 2DRIA 4CG0A 5BV2P 2J59A 4J0CA 3KCNA 4Z9YA 3BMQB 1C0EA 4H7DA 3REQB 3WL6A 2P11A 3M83A 2I3BA 3AJ8A 1G5HA 3DZJA 3O4VA 2ZYIA 3GJ4A 4IF4A 1JPVA 2ZRPA 4JNCA 3M9LA 4R2XA 4EP1A 3FBTA 3RV3A 1WUHS 5TVKA 3ILXA 2QN1A 5LYJA 3V33A 5DFAA 1GRNA 2ZE7A 4MQFA 5CIYA 3W34A 5JUWA 4JLPA 3EVCA 2P2LA 3WNCA 1LJ8A 1NLUA 2ALJA 2O59A 4DT1B 5EIBC 5JAIA 2RC5A 2BFEA 4PQFA 3UHFA 4A0HA 3OZ7A 3Q8WA 4IS3A 1IMJA 4F5WA 5BR1A 1Z6QA 2BTOA 2FZ5A 1CEXA 4CMIA 4FVTA 4EUSA 4IJ5A 4DUGA 2IX3A 2IRWA 1F1BA 2CJYA 2Z56A 3FB4A 3K0HA 3BD9A 1HT0A 4L8YA 2A1UB 3GJ8A 1QOPB 2QVYX 4MKZA 2Z4TA 4V0KA 3EPKA 2PU7A 4X41A 2NT3A 3F7MA 5BQPA 5REQB 1QGYA 2HJVA 1MIOA 4KGZA 3DMFA 1R5BA 2QQGA 4JQZA 4E12A 1EWVA 4QHTA 2GHIA 4XTRA 4CUZA 3OZAA 3IJRA 1PL7A 1UBNA 3RIXA 2XZDA 2N1MA 1I13A 3ZLUA 4NZYA 4J0JA 1GVHA 2WSLA 1JHUA 3FR8A 4BBJA 4DLWA 4BKRA 8OHMA 1SKMA 1XIVA 2OB1A 1WZCA 1DHRA 1KSFX 4JC0A 5BWOA 1J0DA 5E3JA 1CEQA 4MEJA 4WXPA 5JO9A 3TL3A 1YMVA 1ZD3A 1I6MA 2ECKA 3ZOKA 1SXPA 2CNOA 3WV4A 2FPIA 3DGEC 3A58B 3IVGA 4UE6A 3AR8A 4KQIA 2CZGA 1NQXA 4H7FA 2BCEA 3D6VA 1JMVA 4LVOA 4N01A 4E7OA 5JSZA 3DMHA 3NH9A 3K70C 4BTLA 3MILA 4GP9A 3FD8A 5A62A 3MB8A 4OIMA 5E4FA 1X1SA 3A9WA 4LOKA 5ECWA 1GTMA 3ZNOA 1MNAA 1VBNA 2IPOA 1HDEA 3VYTB 4DMKA 2CJWA 4L5CA 1J8MF 4NRDA 1G9TA 3GJ5A 3HCWA 1C7QA 3LUJA 4B3HA 2UXCB 3KUDA 1VXOA 3P9SA 2J3IA 3A4LA 3SEAA 3GP8A 5KYTA 2A30A 1RSZA 5I7VA 2VF8A 3SBDA 2JIPA 4TWJA 3TO5A 3A36A 1BGXT 1U2RA 2G36A 3PG5A 1CNEA 4JCCA 1G3IA 5GAJA 5C34B 3G0HA 1MC1A 5T64A 3IQEA 4HQRA 2GF9A 4KRYA 3UJCA 4C7VA 2BE7A 3VR5H 3LECA 3A2MA 4OQFA 4OYLA 5J4YA 2QIOA 1QO9A 4GBJA 5JXIA 2EKPA 2EATA 3FTPA 3C6KA 1E6LA 2P9BA 2JBWA 2AD5A 3FCUB 4L7QA 5CYPA 1OT3A 4G37A 1G6OA 2OFXA 5IM5A 3TRKA 3CS3A 3JV7A 4WL0A 1Y9JA 2HYIC 2OQIA 2ZXUA 1JA1A 5FWXA 4IKPA 1WB4A 4JVSB 3FCSB 1VP9A 2DHCA 3JARA 5KVAA 4K40A 1M8PA 3I9FA 4AG6A 4FSDA 2ZJ2A 1N6PA 1IQRA 1VZ3A 4EHDA 3EHEA 1ECFA 2QBYB 3GFVA 4RM3A 5JLJA 1IAVA 2QX7A 4OUDA 4H7PA 1W8DA 5EUQB 3MFYA 3QVMA 2B3TA 2Y6VA 2H08A 3LAWA 3ICEA 4Q3CA 4C6TA 4U2CA 4UDNA 5KX5A 2R7MA 3IUNA 2IUEA 4Y1EA 1FE8A 5AK0A 5DTEA 5DGHA 3RUIA 1GITA 5J5AA 5H70A 4F6RB 2EX4A 3KZKA 4ZEWA 1DC6A 2NADA 4DLLA 1Z5PA 1QIGA 3LW7A 2A3RA 4TVOA 1WDTA 1FEZA 4BMSA 2W6MA 1LI4A 1YBMA 3N5CA 3CN7A 1V5WA 1RYBA 1ZOSA 2DULA 2V1XA 3EIEA 3IAS6 2QRVA 4RD6A 1R1DA 3EZ9A 1BE0A 1VHJA 5JZVA 3T54A 3W04A 1FU8A 5U1PA 3ZWMA 3GRVA 2VYFA 4D4IA 1Z0ZA 2OBNA 1YBVA 2YNMD 1C14A 1VCNA 1GG9A 1F0NA 3QFFA 1OXVA 2XTZA 3PZBA 4ZAYA 3HYNA 4AZ0A 1AXRA 1D03A 5DX8A 4C29A 2XW6A 2ZB2A 4HFMA 2W2TA 3TRHA 1Q16A 1TMGE 2VDLB 3Q1KA 3LWZA 3P5SA 4MMYB 1JHVA 4PYMA 3ANYB 2OESA 1WOMA 2REXB 2CE2X 4I6EA 2FSSA 1OBFO 1Z6YA 2ZREA 1LC3A 3SQNA 4CDMA 3AESA 3BULA 2IBMA 3NG1A 1ACMA 1UJ2A 3UC5A 4ETMA 4HMPA 3SZGA 3DHNA 4R0MA 1R37A 1T2FA 3DG9A 2OC9A 5C1BA 4ITUA 3JWGA 1CRZA 4ASUD 4RTOA 3STTA 4RQAA 4ALLA 1E8NA 1OPXA 2OCIA 3T9FA 1C8BA 4UVHA 2FMHA 3JD2A 4LGCA 4U9IS 4Q16A 5JCOA 2BM8A 1U7HA 4URYR 3RUAA 3VO2A 3ZHCA 1DTEA 1NV8A 1XZNA 2NXJA 1RCFA 2JHGA 1PT7A 1KXZA 1LI5A 1P18A 3K0FA 1YQWA 4ROTA 5DP2A 5CCDA 3WLIA 5H83A 5CB4F 1I8TA 2ZRMA 1GRVA 3PXXA 4WESB 3MJDA 2B0JA 1K7SN 2PANA 4IX9A 1ADFA 4CM4B 4ZI7A 1GUZA 4CEIA 3DAHA 3UW1A 1AZTA 5IN4A 1I2ZA 3E7XA 5B4VA 4AC9A 4JX8A 3ZE9A 1W0KA 3K7EA 1IZ0A 4JOQA 4U7PB 1IQUA 3QWHA 5ETJA 1QIKA 4ARZA 4NCBA 2OHGA 2XYHA 2HGZA 4MARA 1ZUNA 3TPFA 3AF5A 4FILA 4FFNA 4NL4H 3USCS 4TQAA 4CNBA 1RKUA 2FG5A 3BFVA 3KB6A 5JXWA 1VJTA 2R8ZA 1ZGBA 5EHZA 1GEEA 3IRVA 1NAIA 3MQ2A 3AI1A 2Q28A 5ESWA 1CK4A 3DH0A 2FPMA 1JLHA 2JZCA 3I76A 1TQ2A 3QV2A 4AAYA 3KSMA 1XCJA 3CR8A 3QE9Y 3ZLBA 3UHAA 4ZHQB 4ZP1A 4I9HA 1ISFA 4BNVA 4ZRDA 1ZWLA 1SXJE 1WXHA 5CIWA 3U7EB 4B6JA 4ZA2A 3UT5B 4U6QA 3BIFA 1XAGA 5IJAA 4R1QA 1MB4A 2VP2A 1X3SA 1Q1ZA 1ISRA 1P1IA 2GJAA 4I1RA 4YJGB 3WGLA 2PZKA 3DWGA 1VA5A 4AJIA 1Z47A 3U6KA 3PXDA 1AHIA 2J9XB 1IUOA 3PNKA 5EQTA 1U2QA 3BE8A 3DKIA 3IVRA 3G5MA 4O25A 3WTCA 2JLZA 1I5RA 2HMAA 1WSDA 2QAGA 3NJ4A 1YV9A 1UP6A 5BSRA 1C9NA 5EE5B 2R5NA 2VSOA 3V2UA 2HXSA 2IYXA 2WPDD 1KPGA 3CX7A 3EXHC 4L4UA 2IIBA 4Z1MD 3B8HA 2B1QA 3KC2A 3DE0X 2GM9A 3O2JA 3PBKA 4LJ9A 5L9AA 3H5RA 1VPWA 3ZZMA 4HGZA 2JKVA 1EIWA 2QL9A 4KW7A 1C4XA 4ZT6A 5T3UA 1OFIA 3SPXA 3U44A 5K6AC 3RC2A 3KQKA 2JG3A 1QIIA 2FKAA 2J7PD 3LUFA 4G9BA 1DFGA 4HQKA 2FJPA 4RZQA 4EY3A 2ZRDA 5A5DA 5T4BA 2IS2A 2LDBA 5K0JA 4TV8A 4X1KB 1VLJA 3GH3A 1NL3A 4N5IX 1VI2A 3K0CA 4PQGA 3UXHA 1SC3A 4DNXA 1ANKA 3DA8A 1I3OA 4UXJA 4HPWA 4AICA 1LNZA 1SWVA 2RH9B 4N5NA 4X7MA 4FOLA 4JB8A 4CIBA 3NAGA 1TA9A 3GLGE 4PINA 3ROKA 1YOBA 2W0MA 1GAWA 1VLQA 2PJDA 2GBCA 1Y5IA 3QMMA 4IHJB 2ZJ3A 3OFKA 4IJVA 5DULA 4ZREA 3NXKA 1QGAA 2E4AA 5LP6F 3ZWBA 3N7AA 1PDWA 4EZBA 4LEIA 1W44A 1LF5A 3CUSA 4GPTA 1WOYA 4X3CA 4Q05A 3WOVA 2P40A 2COKA 3QK7A 1JH8A 1L9XA 2YMLA 3PR1A 2R47A 3TD2A 4ZEMA 2J31A 4LGVA 2ZB4A 3H9QA 4MLZA 1M6YA 1HRKA 1Y4DE 4ANFA 2R8YA 1N2GA 3OTIA 1A9SA 2QX8A 1D7AA 1WF3A 2R1ZA 1J1ZA 3UK6A 5DI3A 4MICA 3SXUA 2FPXA 1E9EA 2G1UA 3V1YA 1JAYA 1HE8B 3U4MA 3GUCA 1SCNE 4UPVA 4BU0A 4CQMA 1N77A 4AQYB 3OPYI 2OV3A 1M6VA 1P8AA 4OI4A 1ZVVA 3QXCA 1PTJC 2YRXA 2A84A 1EFUA 2JI7A 4HAZA 2B5OA 4LCEA 4W7SA 1JPJA 3RYFB 1RR6A 4G1UC 4FLEA 5T7BA 4UD6A 4DSNA 3HZRA 5ALQA 4UBKA 4GBED 4DCVA 3UOGA 2AK2A 4QGFA 5DLEA 1DJMA 1KH3A 1RD4A 1Z4KA 2YZGA 1J33A 1P0CA 2YN4A 4FBGA 4KXWA 4FGKA 3ROEA 4D8WA 3I04A 5EE1A 4Q9HA 5C8YA 3MWYW 3RIHA 4DMHA 1CDZA 4G9GA 2CHVA 1ZO8A 4R9SA 5KVSA 4KJZA 5CDSA 1Z6ZA 2QGZA 5IF3A 3CZRA 1QIEA 4CZ2A 3DUFA 4JDUA 3WYGA 3CCCA 3D4PA 1C81A 1O77A 2XMDA 4RKQA 4C0JA 2Q5CA 4TLCA 5JNUA 3LYUA 1APBA 2O8FB 5L3SB 2FF7A 4X62B 1VL6A 4UMFA 2GI4A 1XQWA 4Q1VA 1II8B 2BKXA 4P4SB 2HMSA 2VPWA 4HRYA 2O14A 5E1DA 5C3UA 1T1SA 4Q4JB 3KQNA 4XE5A 4X1IB 5IT4A 2GJKA 2I4LA 4HDMA 3DKVA 4KWCA 3AIOA 1D09A 1PJCA 4MA5A 1Z73A 3JQFA 3S2UA 4R4JA 6ABPA 3QVOA 3W6NA 2UAGA 1XHEA 4XUGB 4DPKA 2WICA 5KWJA 1UWCA 1TM2A 4G84A 4AZVA 1AMUA 2AE2A 4DJAA 2A4KA 4GL4A 4LJAA 2EL7A 2IOHA 3E27A 2FFAA 2LKCA 3DCIA 3IT3A 2OC4A 2PS9A 1CFJA 1YUBA 1Z63A 2QQ0A 3KQSA 1G42A 4M53A 3UMYA 3DTTA 3QX9A 4N9QA 4I14A 1FA9A 4R1LA 1RWQA 5KKCA 3R0XA 3GRPA 1LKZA 1SQGA 3HN2A 5E7MA 4FLMA 1KZ6A 4MUXA 3VSCA 1EP3B 1Q0QA 3BD6A 3ED1A 4D4GA 4KQ9A 3G23A 1JTVA 1LDEA 5BVGA 3TX6A 5JPCA 4GVXA 1TUBA 2QTMA 1VGQA 3G89A 2D54A 1IZ8A 1IJEA 5E4JA 3BILA 4A5OA 1KHTA 1JI0A 4OJKA 3V4PB 5DHQA 1EZ4A 2F4NA 5AOBA 1M7BA 1XSEA 1GT91 2ZRLA 4Y6OA 4C0AC 1YXMA 2BJVA 4QDJA 4EATA 4KE6A 5DV9A 4CG1A 4ZYVA 3OHMA 5KBYA 5H59A 1C3OB 1Q0UA 2B7LA 2XI4A 1R5OA 3NS7A 4GM4A 1VCHA 2BHNA 2ZRCA 4OL0A 5SYMA 4RIHA 1VKHA 1NVVQ 2JFXA 4XIYA 2ZM6B 3W5BA 2BHLA 2OO5C 3F4BA 1XQ9A 4Q4LA 4WK2B 2SKDA 2JLWA 3GB9A 3ISVA 3KJHA 2G7ZA 4TXLA 4ZD6A 4CV0A 5KUTA 1THMA 2DE0X 3DEFA 2VHUA 1RXUA 1M8JA 1DHTA 3BL6A 3JY6A 4TV9A 1ABFA 2WSSA 4IMJB 5K0NA 5GADl 1OI2A 1YZFA 4Z7NB 3RM3A 3M3HA 1IOLA 1P3DA 1PRYA 2QPTA 2ZPUA 4IZIA 4JEUA 3PD1A 2NXEA 3PA8A 3GAMA 1DC8A 2GZ3A 3IXMA 3SSMA 3G2JA 3GJSA 3OWOA 4BP3A 5A0TA 5J4HA 3DMGA 4G5RA 1V7ZA 3QA9A 4GI7A 2VN8A 4Z7QB 3T5PA 4JC4A 1G41A 3NW9A 2R6FA 4JLSA 1E3MA 3K8QA 1A88A 4WY2A 2P35A 2DSTA 4N03A 3WBBA 4LHXA 4GWLA 3STWA 3V1LA 2AJDA 1P2GA 3E8XA 4K9NA 1L7MA 3I0MA 4Y9UA 4ZQIA 2O0KA 4H3KB 2HREA 4ND8A 1R9NA 2C2KA 2HK8A 1EFAA 1KK3A 2I2FA 1Z2NX 2I6QA 4QJ4A 1WZEA 2DTEA 4IGIA 5TE9A 3WIVA 2JLSA 4XPZA 3QE0A 3LW8A 2B1RA 1KORA 2QROA 3P9PA 1TCVA 2AMYA 3U3OA 4KN8A 1BH2A 1NW8A 3MT0A 2D1YA 4JDPA 4MUAA 4N6GA 4JXJA 4RORA 2C7VA 2IHVA 3Q8XB 5TPZA 1VKNA 3DDSA 1NDHA 4QUGA 4YJKA 2AJ8A 4AUNA 2MYPA 5E8JA 1KVSA 2BMVA 4ZO8A 4BASA 5JCJD 5JISA 4IZ6A 5H3HA 3FMIA 2OHHA 3KHUA 4WVLA 1V5GA 3DMNA 3SSAA 3AHCA 1PK9A 1QTRA 1UR5A 5G3ZA 1MLDA 4RDIA 3PEYA 4ZT4A 5IN5A 2IXBA 1UT6A 1YRBA 5CD1A 3U31A 3N07A 3E9NA 4KIWA 2GCNA 5CX1A 3FFTA 1OXBB 5IKEA 1MNQA 4JZKA 1WNFA 2XXAA 3QEMB 2W2VA 3VDRA 1JU3A 3AM5A 1XVIA 3LK6A 1OIWA 1A7JA 5BV0A 1GKKA 2O3QA 1EGQA 1S02A 2D1FA 3ND6A 4JB3A 4ZICA 2UYYA 3IUMA 3C7AA 3S8EA 1VSUA 2F3TA 3S5JA 1PD0A 2CLOB 2QL6A 1I9GA 2QZSA 2V45A 2VDWB 2X7XA 4AS2A 4E5YA 1MVLA 4HKTA 4KZPA 5TVGA 1UKYA 2J30A 3VR0A 4II7A 5LL6P 2J07A 3LHFA 3R1IA 1WZIA 1JXAA 1YVRA 2YUTA 4HXYA 1G8MA 3H4MA 4EB8A 1WETA 4FDLA 1L5QA 4PSKA 4WW0A 5FRDA 2EJBA 4CRWB 4JJ7A 3BIXA 3CJQA 1US8B 2HLNA 2P41A 4MKHA 1CS4C 2C3UA 1I4TD 1W5SA 4BZWA 4EB6B 2DBZA 4NV1A 1SXQA 4U6SA 4TWBA 3LUDA 3VJKA 3JRWA 4RTSA 4RWZA 2WHYA 5IVDA 1DXQA 1F0KA 4KU4A 2Y1CA 2ZVDA 4N6OA 2I5PO 4F85A 2LD4A 2Z08A 3C4QA 4PHGA 4XUDA 3OTOB 1GTVA 4ZQFA 1JKJA 1QB8A 5E6SB 2Y68A 4HS4A 2RGRA 3PJGA 1U2DC 3B9BA 3KKZA 2GETA 4E3ZA 3V8QA 5M04A 3F74A 2HW8A 2JBHA 4A2PA 1PR9A 3HFRA 5FPTA 1OILA 4HXFB 4IVRA 4IYRA 1GO2A 1BRMA 3HACA 4HGPA 4E4YA 1QF7A 2Z5FA 1NW6A 1UXJA 3R7WA 1LS6A 3H5WA 4Q0MA 2BFWA 1T9AA 5DM2A 5T4HA 3EWIA 3IHWA 1VLMA 5E7JA 5AR1A 4FM9A 3S2GA 1P44A 1WXGA 5FUBA 1XJ5A 4NAHA 1ML3A 2FWMX 3IPRA 3M5PA 4Q1CA 2CNWA 4B3FX 1MVNA 7ADHA 1TAUA 3CHYA 3IDOA 4DR5B 2M9MA 1E7QA 4KG7A 4BGUA 1ZOLA 4ED9A 4HUJA 2JRCA 4XIIA 1OWLA 2JS7A 3BPSA 3S28A 1YB1A 4FFSA 3GDFA 1G66A 1C2YA 1NT4A 1ZICA 2HFKA 3A3YA 2QTLA 4KV9A 1LF0A 1Z4LA 3NHLA 4LRQA 1PT9A 1FUEA 1H4QA 4CTKA 5A06A 1ZMOA 3VC7A 2RKOA 4GSKA 3CLUC 1Y9EA 1L1EA 1Z36A 4GW3A 3BH6A 5EIHA 5JFOA 2R79A 1G0NA 1URPA 3NBYC 3W8DA 2XQIA 3THWB 3NB0A 5JZOA 3TTYA 1UMBA 2AJCA 3TZHA 2ZU0C 2VYNA 2C29D 3LCCA 3ZWQA 1JHZA 5HZHA 2ZM5A 2FA9A 4JENA 2YHBA 1T2UA 2LW7A 2YY7A 3LIPA 1UFKA 3OESA 4NECA 4RPIA 2WE8A 4U7GA 3JZDA 1LPOA 4IDDA 4NV3A 1QRSA 4GL2A 3LOQA 4MB2A 5G1PA 3LG2A 2HR1A 3CNOA 3DZHA 3QIVA 4AMYA 1GU7A 4EJFA 3BXFA 1GFIA 1U2EA 3IKLA 2BJHA 3HA7A 1YA4A 2CY0A 2BBWA 3E3OA 3RSZA 1VE5A 1EE1A 1UDBA 3K6SA 3HTXA 4I2VA 4UBNA 4Y9RA 5JQGA 4A0SA 4R7ZA 1HUQA 3OZUA 1R27A 4P93A 3DAOA 2Y05A 4OL9A 2G5PA 1TPYA 3I5AA 4FHFA 2KSQA 2GFIA 1Z0FA 4FHGA 2RAVA 1KH2A 4KWEA 3FKSD 4Y2GA 4BMXA 3Q8LA 1KYTA 3D4LA 5JO0A 3CRNA 4TWRA 2VPZA 3IHTA 3PC6A 2YZMA 4Z51A 5IZ4A 4PU0A 4QFCA 3DULA 3RGWS 1UDRA 3WQHA 4RCYA 1ZC3A 4C4PA 1F2DA 2L18A 3FUVA 3C98A 1YR6A 1NVAA 1KK1A 1TADA 3ESAA 2AFHB 4RBNA 4C87A 1YF3A 4IILA 3A4YA 3EF1A 1EFPB 1EFRA 1XFDA 5ELLA 1D4AA 1PGJA 1SCBA 4ER0A 4RPJA 5HE9A 3ZLVA 2J0QA 3CYFA 4G23A 4QJBA 2NU8B 1SZJG 4GUAA 3V7UA 4ESVA 4GE0A 4RIGA 3ROTA 3VXKA 2PNJA 2G8LA 1YS9A 3E70C 8AT1A 1N4DA 4F4FA 4L5JA 3B9PA 4XWWA 3BQNB 2IOFA 1IM2A 5DM60 4DWOA 1CQZA 2OGUA 4AULA 3L18A 4YP1A 2O4UX 3EIOA 3W0LB 2Z2ZA 3OZBA 2MJLA 5AVSA 4BV3A 2WBLC 3ZWAA 4GPAA 1MABA 2DM6A 1WXFA 4IW3B 4O8CA 2X42A 5TPWB 1EMDA 1R12A 2HLPA 4R2MA 4RTPA 2QX9A 1ZLYA 5FOWA 4YVFA 2REBA 4EVRA 2C4UA 5F78A 5FI1B 4DCUA 4P7JA 4U1RA 1VSTA 1XD8A 4S0ZA 1LD3A 5C81A 5IJXA 1JQAA 3I2FA 4JJZA 4IAOA 2D00A 3JWJA 2C0QA 1QHYA 3RSOA 3RODA 3GRAA 3HB1A 4BRUA 2JIDA 4US2R 2P2YA 4ZCIA 1EBUA 1J07A 1PR1A 2ZT6A 2LKDA 4EKNB 2Z8YA 2D7DA 1Y8RA 1WUJS 1A72A 1IBRA 4TXMA 4A8HA 2JKZA 4I81A 5DXJA 5CXXA 1YK0A 4Q1AA 1SXJA 3MJTA 4JA2A 4WFKA 1A9QA 4Y2PA 4FKBA 2Q50A 1HO3A 3A1TA 1RBMA 4PGMA 1KJ8A 1G3QA 4ZYXA 3ONVA 3FDIA 1YR9A 2WWWA 4D96A 3JQ6A 3LNTA 4O08A 5AQEA 1MG0A 5E2AA 5D5QA 3ZDZB 3KOUA 1U2GA 4HQLA 3RAFC 2NXNA 1Z3CA 1ZW6A 2BKEA 1MC4A 1J8QA 2CUKA 2Z9BA 3LLUA 2C42A 4M1WA 4MRNA 4TXHA 1PZMA 2XRMA 3BD7A 5EWMB 5EPEA 3T7RA 1W75A 3PDJA 1NXSA 1JG6A 1E64A 2AHOA 3DOFA 1DJOA 1M8KA 3TRDA 4HZIA 3DTVA 2E9SA 4PLYA 4OLHA 4B44A 2ZR7A 1GCAA 3N7TA 5AO9A 2QX6A 4D44A 4E32A 4S05A 4LHYA 3L7LA 3U4IA 1X15A 3FE2A 2FOLA 2F3UA 1E9DA 3K8YA 1M66A 4X90A 3EAQA 3ZY6A 3EBOA 4YGYA 4BP1A 4ZZ3A 1TZKA 2GBFA 1R0CA 4ONEA 1TM7E 2JLRA 3URKA 3VU9A 4EO4A 4Y9TA 3VPXA 2D59A 2XWQA 3JR7A 4D92A 2E1PA 5LLTA 3TFWA 3U7GA 5HKLA 1VMIA 1EVEA 2Q4RA 1DBIA 5HZGA 5JSYA 3THRA 4YUZA 3DOEA 5BNZA 4LHSA 3GLGA 1OV6A 2O1WA 3K6JA 2DFDA 4Q4HB 1FXWA 2AH5A 2HBZA 1IJKA 1YRLA 2OHFA 2WJVA 3C3DA 3D8RA 3OT4A 3RT1A 2FWRA 4PTLA 3UB2A 2ZRKA 4C4RA 4GR9A 4R98A 1N9ZA 2YRFA 2C4VA 5CIQA 3KQVA 4JAVC 3OJWA 5DKFA 1D4OA 4LOIA 2QSJA 3WYFA 3DZFA 2EQAA 3EC1A 4ND4A 4O3FA 3O8OA 1TF5A 2AYZA 4W1PA 3RRZA 4G26A 4B2YA 4ZVRA 4OJYA 4UFPA 1UBOS 3HV0A 4BFZA 1Z56C 1EBBA 4OQXA 3U7HB 4S24A 5BN4B 1G20E 1GQ2A 3IIIA 2XVXA 1OFVA 1QE5A 3UYKA 4KJXA 3ZU2A 2PMDA 3EPPA 1OYYA 3R6WA 5CVUA 1P6UA 3NPMA 4DEYA 1T5HX 2G0AA 4NBTA 1LPAB 2QJFA 3DHEA 3ICWA 1D2CA 1VG9B 2OE2A 3Q0TA 3ZCUA 5FLKA 2RGNA 2HHJA 1D3AA 3V1TC 4F9EA 3VYVA 1AE1A 5E7IA 3REFA 3IKTA 2I2WA 5CYOA 4OTZA 2HA0A 2H4WA 2C2ZA 3S2SA 4YMGA 1EESA 1DE0A 2O1EA 4I4TA 1YZVA 1HL7A 2QB5A 2XE7A 3F3MA 4DDWA 4WOJA 1FJHA 1GKYA 5ERGB 2YYZA 3V7FA 2YHSA 1XYYA 2KS6A 4PM4A 2GRJA 2I4NA 3DLIA 2B5VA 2C96A 2IUSA 4IVNA 5BQ3A 4YV1A 4I55B 2HADA 1EFVA 1U8FO 4RHCA 3TTSA 1K3UB 3COSA 5LQDA 3T3DA 3CONA 3FIUA 1E1QD 3VH4A 1VKOA 5DHTA 1IHPA 3HYLA 3WKEA 3DTNA 3SLRA 1I36A 4TUYB 1YACA 5L6MB 1QLHA 3S70A 1PHPA 2BRUA 4XR4A 1SY7A 1YGPA 3L4EA 1C30B 5K45A 1JFVA 2IPAB 4LKRA 3KTAB 4LHEA 2ZYVX 2VP0A 1QVRA 4M4SA 5FT9A 1AQJA 5HA5A 3EA5A 1JG7A 3MJEA 4HDNA 1Z0UA 3T3EA 4S1PA 1ABEA 1M2OB 1NN0A 1EINA 2XSZD 3U5TA 4LJRA 2VSFA 3DT6A 3FYSA 3PFGA 2QTTA 5IHXA 2VNJA 2ERYA 1PJ4A 2AG6A 2REQA 1VIVA 2RHCA 4HDKB 1XZFA 2V5UA 4OGWA 4BZPA 3E0XA 3PXAA 1MO3A 4I5GA 4NLLA 5IUJC 4AB1A 3ZDAA 4XYBA 3KXLA 3QPDA 4YRFA 4I4CA 4RY8A 1A8UA 1I6LA 1V41E 4HDQB 2H9IA 3B3GA 5HM8A 5LYJB 1VBFA 1Z0IA 3CMCO 3F9CA 3BXPA 3F6RA 1PV1A 3Q8MA 1IN8A 2XOEA 1K27A 3I01A 4NOJA 1OF1A 3KCQA 3B6KA 1A5BB 3GPIA 2E1RA 4MW0A 4BO1A 4CF6A 4QVIA 4QARA 3W5UA 3BMNA 3EVZA 5DTJA 4D6YA 1FVXA 3ACDA 5HK9A 1KQFA 4Q7KA 3EISA 3BQ9A 4GAEA 3WIUA 2QTVA 4JC8A 2YWGA 3JATB 4CMIB 2HRCA 3D8TA 4L74A 1PN3A 5K4GA 4MWOA 4MINA 4U7FA 4L6AA 3QUAA 4IX1A 2R6AA 4TLMB 4GICA 5FTKA 1V5IA 3O74A 4LY0A 2K2WA 2Q29A 1B23P 3QKIA 3TW6A 4NMMA 2JGDA 3UJ6A 1XNGA 2JIQA 1ZN7A 4G9EA 1V95A 3B2QA 4UVGA 3Q3CA 1GQQA 4D9JA 2NP7A 4J91A 3CG4A 3PEVA 2LCFA 4OXKA 1NW4A 2V3CC 3MWEA 4TRNA 3W7AA 3K3PA 1W46A 3QXHA 2ZU6A 1X19A 3H99A 3PUKA 4J6FA 2WFZA 1DBRA 4TSFA 3VKHA 3OZXA 2CLDX 3CE6A 1WKBA 1W9MA 1U0OC 3QI2A 3IE0A 4LZJA 3NV9A 4WDQA 3CUYA 1SHJA 3OEHA 3VVBA 3AR2A 3LDUA 3J81k 3UZUA 3WK7A 7REQB 2AVDA 2FPIB 3PC4A 3DNFA 4EJ2A 2JA1A 2IYNA 4XFKA 4N47A 3R9XA 3WNBA 4HUTA 2P7HA 3F6EX 4HX2A 2Y0CA 1QH0A 4JR2A 3NNDA 3RYHA 4EA6A 3HU3A 4REQA 2AMJA 4FUTA 3EVFA 4WBSA 1P9NA 4A10A 1C7JA 4OP2A 4FCCA 1YQ9A 4KPYA 1F1JA 4ZI2A 4ZAXA 3IMEA 4M0MA 3DLCA 5GP1A 1T91A 2A1TS 2PIAA 4M9ZA 5LN1A 2AUNA 3PD0A 4NFLA 4XGKA 2JZNA 2BAGA 1YZLA 2ID7A 4JA0A 2V7BA 3CG0A 3SQOA 2RE8A 1Z2EA 4HGYA 3TIXB 1DUIA 4F86A 5IZCA 1PLLA 1GZ6A 2ZUDA 2VAVA 4LDJA 4X8HA 2EAUA 3TRFA 4D25A 3RANA 2SKEA 4IPTA 3D8UA 1O03A 3KPJA 3NHKA 1Y0BA 5HSGA 5AJWA 2YV3A 3OY2A 4HYQA 2FLVA 1XRMA 1Y81A 3MTGA 2CNLA 4P84A 2VJMA 4ERXA 2Z3WA 2VJLA 1TM1E 2HF9A 2VK2A 3UXMA 1ILEA 4ZT3A 2VQ3A 2ENWA 2PVPA 4RABA 5BYBA 1SQSA 3LL7A 3W6PA 2VSXA 5LQNA 1BDIA 2X9VA 3HSKA 1T1JA 4Q15A 4HAIA 4QU0A 3VHLB 1A5AB 4GMDA 1AZWA 3ULKA 1LSUA 5HGXA 3CLTD 2IZ1A 2ZJYA 4N0EA 4MVYA 5JI2E 2QVXX 3SMQA 5ICSA 4DC0A 5KWEA 5JNLA 1JEDA 2WF5A 2PVSA 5KSPA 1JQEA 3BRWD 3KZOA 1NIPA 1TJPB 4E5DA 5LDGA 1EDZA 2YXPX 1NUUA 1U5BA 3IOMA 2VR1A 1SMKA 1E3QA 2RHJA 1VPLA 4HGNA 1XA0A 4JIGA 3PLRA 4FXOA 4MGKR 4BEWA 3JQGB 3OX3A 5KS2A 2WF8A 5FYQA 1CU1A 1TVEA 2H00A 1NVVR 2KPOA 4LFAB 4KLCA 4BQSA 1FC0A 4O2BA 4KSYA 4CJXA 4QXQA 1FMLA 1AA6A 2JIBA 1QGUB 3FUCA 5K3DA 3ZZUA 1SXIA 4JYCA 1DTSA 2QSUA 4GX2A 1UKVY 1W9HA 1UXKA 2OP1A 4O2RA 3KR0A 4DZTA 1F8GA 3IPAA 4Z4IA 4LFCB 2JB9A 4C3OB 1U8TA 2BEWA 2YJNA 2OK8A 3CW9A 1THTA 3DFKA 1E9VA 1BHQ1 3ISJA 1GLNA 2NZJA 3KTOA 4HJRA 1ECPA 2ZJZA 4DUZB 4ENUA 3DM5A 2WKQA 4YRKA 4WUTA 2ZWIA 4EFLA 3DGFC 4K9PA 5TQVA 4MULA 2P68A 1P74A 2AJBA 4K0RA 1UK8A 4XLLA 5AXAA 2VDNB 3FHJA 2B2CA 2LVBA 3LGAA 3N2NA 3A0RB 1DKOA 3NUGA 3WFZA 4JUDX 4M99A 2SCUB 2FSIA 1ZMTA 4MGHA 4D74A 1Z16A 5DGCA 1TLLA 4KFRA 2CSXA 2VHTA 5LVAA 2UYQA 3FNBA 4WX2B 1CS0A 4V0RA 2Z8ZA 1GHTA 5EP4A 4DIDA 3A6JA 3R41A 4RCZA 3JD1A 5I7SA 5DDIP 3MBIA 2V54A 4FOSA 4NONA 4P7GA 3WGUA 2V7UA 3OETA 1BYIA 1LK5A 3DFIA 1J8VA 2QU8A 3RHZA 2BGJA 3MMNA 1KC1A 2Q27A 4RK1A 1NUHA 3H13A 3IAUA 3K0FB 4HK4A 1QHSA 4Y2SA 2HWWA 2H5LA 2OQ2A 1SBTA 2QVBA 3NCHA 3MINA 1WHSA 4C0XA 4GC5A 4UDXX 5JWOA 1FYFA 4AKIA 2X3FA 4HQNA 2XH8A 1OFUA 1V2HE 1FP6A 1H3NA 2J5KA 1FTNA 4C89A 1NR1A 3Q5DA 2AYXA 4CKWA 1XZAA 4QD3A 1RI4A 4X6LA 5SICE 4ZVKA 1ZESA 1KE1A 4XQ0A 4Z4HA 3U5ZB 5BV8A 1W85A 4M9SA 5ITSA 4RPKA 1DIHA 2BN4A 3SSOA 1YC2A 4H3VA 3KQWA 1T9BA 2PWBA 2PLRA 1UBKS 3LBFA 1GCOA 2GBIA 1ZUNB 1K0FA 1BX1A 2J9RA 1ZDMA 3W7BA 1SKUA 4HPXB 1ZD1A 4G4JA 3WTBA 3ZW9A 3C3JA 3QJ5A 3SHWA 3EA4A 3VUEA 3WE7A 3AVYA 1JHXA 5ERXA 1HLGA 5F98A 3ZHTA 4QWWA 3N6VA 3NIFB 1ADYA 2DTDA 5LOVA 3HVIA 4JJEA 4XSGA 3LYAA 3SYLA 3G1UA 3CGGA 5K8UA 1IB6A 2GHQA 4HAXA 4NBWA 4YRDA 1DADA 1CHNA 2GTHA 3PNMA 1VPDA 2G9ZA 4KN5A 5C37A 5JHHB 2H2FA 4XCQA 1PVVA 3D31A 2YUIA 3HFJA 1CRPA 4ZO6A 3DZIA 5ALJA 1UEXC 1NA5A 3AR3A 4J0IA 3HYCA 3JTMA 3FHCB 3AHGA 2BDEA 3JQ8A 3HGTA 2V9CA 3QU7A 3WG9A 5A1TA 1U5AA 1HRDA 5K0FA 2MINB 1KRXA 3OLYA 2CL0X 4EDHA 1XRJA 1YI8A 2GD1O 1L8AA 1NP6A 4MIEA 3UTCA 2OXCA 1HDXA 1JAHA 2I2AA 4S2UA 2OAGA 3ND8A 2XZLA 4CNQA 3G2NA 3GJZA 1EK0A 1B15A 1E2NA 2OCKA 2XR1A 2ZS7A 3L1IA 4OQQA 4AJKA 5KOIA 4HATA 5J4VA 2ZAYA 3IPLA 4UOQA 4PCLA 1HYEA 3QMWA 3KUXA 5BOVA 4O4LA 1XALA 2BSAA 4IKEA 3F6PA 1TU4A 3MF4A 3NWPA 1R00A 4K46A 4E2FA 1Y33E 1V6AA 2PIDA 3TKYA 4JP3A 3SM9A 2WD9A 2IHTA 1PG5A 3ZIUA 3C41J 1ZJZA 3GI1A 3UPTA 1C41A 1PS0A 5C5IA 2JK0A 1ZGAA 4H4EA 5KIAA 1BQ4A 5FA8A 1JFFA 1GARA 3T6KA 3TPZA 4DDMA 3CLSC 5JSHA 4F3TA 3LS2A 3C70A 1T24A 3EXAA 4MUYA 1FLVA 5FADA 5IEJA 4AJ1A 3FOWA 2CNNA 1MEEA 3FZNA 1HFKA 1P29A 1T3LA 1ZVJA 3VGPA 2WD8A 4IDQA 2B8TA 4PLWA 5EMKA 1O97C 1XWFA 2QNBA 3NFRA 4GZLA 3OA0A 3KFXA 1H2XA 2AN1A 1JSLA 1QH8A 3COWA 3DQZA 1FFHA 3H84A 4PO8A 2R8XA 3CBQA 3M1IA 4MITA 2QR5A 2NXCA 2YW2A 3VM6A 3H5TA 1XXHE 4G0PA 4MEAA 5DI3B 1ZCFA 1BNCA 4BXOB 1ZN2A 3CSSA 1UINA 5B1EA 3KVYA 1Z0SA 3A1VA 2COEA 2Y1KA 5JH7F 3I3OA 5ALGA 1YVEI 2C1EA 3MJCA 1ZOPA 3W5VA 1XTKA 2FSFA 1OBVA 1M6VB 3GO4A 3QWIA 1TF7A 1XZCA 1MB9A 1Z5NA 3F5DA 1LQ2A 4MMXB 1N5OX 4N82A 4BO9A 1LI7A 3M6WA 1GNTA 2B99A 2D2EA 3KR9A 3NR2A 3ISTA 1K7CA 3EY9A 3PE4A 5D2CA 5HDQA 1RQLA 4BGEA 4YYZA 4KODA 4EF6A 2HWUA 3W06A 3CNNA 3GW8A 2R3SA 1S1MA 4I1IA 4L7VA 1RWWA 3AEUB 4RETA 1J2EA 3RE1A 4C0LA 4IR7A 4RY9A 1GGNA 3DEHA 4YT5A 3VNSA 4MUGA 1YB2A 4EG6A 3O8CA 3H6HA 4PLPA 4YC7A 5AWFC 3LXMA 4XDHA 3UAYA 4UUQA 3ZQUA 1DDGA 2G17A 2YWEA 5AKGA 2DETA 2QW1A 2W7TA 3MTAA 3A4MA 3AHFA 4MR8A 3L4BA 2HRZA 2F3RA 3UKJA 4NCAA 2GK6A 1LDNA 2CF5A 2W2XA 3SFTA 5CJPA 2BFCB 1R8YA 3WSWA 3W5HA 3ZH2A 1QLWA 3SC2A 3BRQA 1OLXA 2BUBA 3DXYA 1L5YA 2QQ5A 3HNRA 3NBFA 3UNXA 3O1LA 4DV3B 4EYEA 3P97A 3W6UA 4IXDA 2B8NA 4HRXA 4DCOA 4FD2A 4TS4A 2MSLA 4GXQA 4E4RA 1M9NA 4JGBA 1CC1S 2QLLA 1JXOA 2YVKA 3DDCA 4F60A 3TKLA 4LMPA 1ITZA 2WT9A 2IDZA 3W90A 1ILWA 1G6HA 1TJ4A 5JYEA 4FFRA 4TKUA 1JH9A 3SN6A 2C8KA 3LDGA 4HZUB 3U4DA 1NQOA 1VG1A 3N8KA 3ADDA 4P3OA 4P7KA 3TD9A 3QMVA 4JITA 4W5JA 1PF7E 2NUBA 2IYLD 3ONFA 2EOAA 3LFHA 4PYLA 3MVEA 3QBTA 1XD2A 3BGSA 4PYIA 3E1GA 3ABSB 1U0NA 2FWIA 2RH5A 3ZJYA 1LEHA 3ZZTA 4GOKA 3HA2A 2BJWA 4GQIA 3OE7D 5CEFA 4Z3KA 3ILHA 3ENQA 1ZEMA 3CLRC 4X20A 5JCXA 1WDWB 1HQCA 1CQXA 3TGPA 1E7MA 3CLUD 3DZ8A 1EVJA 3CNLA 4F71A 1ZHOA 2PRIA 3L6OO 3NHFA 2NUPB 3ORFA 1LPNA 5EZYA 4DSAA 2UYOA 3LT1A 1C1XB 3C39A 1F20A 1XTTA 2XUDA 3WP0A 2HZBA 1Z0KA 2JAOA 4IDFA 5JJIA 4GYKA 1H0SA 1J99A 4AMUA 3H2JA 5K0SA 1OOEA 2V96A 2JDID 3AY3A 1S6YA 3MWDA 3UJHA 2RHGB 1SAYA 4W6ZA 4TOIA 5DTQA 3AP2A 3OMWA 4G0QA 3PU6A 4RH1A 5KNBH 3NEYA 4FYIA 2XQJA 1NXQA 2NNWB 3CUKA 1KBOA 3QLUC 3M4ZA 3CC8A 3FTEA 3FJYA 5D5HA 4V0OA 2MTBA 2ZRBA 1OX6A 1I3CA 2EZ4A 3C87A 3IEXA 4XWGA 2X41A 3SOZA 3GJ7A 1WRBA 4XARA 5A3QA 2Y67A 2X0IA 1SD5A 1RACA 5I8WA 1QP0A 3IEMA 4LJ4A 1UC9A 4DR2B 2X5NA 4D1YA 1E4EA 3KV1A 4Q19A 2IY8A 4YAIA 3FOZA 3OJCA 3RREA 1U2ZA 4CT0A 3TSOA 1SM4A 3PPXA 1C9JA 1XU9A 5BQ5A 4FB4A 3KKOA 5J2UF 4WACA 3OSUA 3NHUA 3ZQKA 4EFMA 5F51A 4ENRA 2G08A 4J7UA 2IZ7A 1C3XA 2F6RA 3R44A 4KQFA 2P6MA 3FPJA 1ZFNA 2Y0EA 2EQBA 3GUZA 3D5TA 3GZJA 2PX6A 2FEOA 3FSRA 3W5SA 3PQ2A 1NXXA 3IP1A 5T41A 5ER6A 4KL8S 2GUGA 2AWNA 4E1BA 3GGOA 1W2GA 3B1WA 2NO1A 5DCWA 3AVUA 4KQ1A 4YJHB 1U9IA 2PGXA 3OFSA 2EBUA 3LA6A 5CBPA 2ATXA 4FGZA 3ZV4A 5CNIA 4I2NA 3OCWA 1WMFA 4Q82A 1NJGA 1XQVA 4BX0A 3QUBA 3UJBA 3G6KA 3FGNA 3PUHA 4AF6A 1YB4A 4FSXA 1AY0A 1WMAA 1ZLXA 2VCEA 2I6XA 3HV2A 2HDHA 3FBWA 1DC4A 4LMRA 4LXHA 3W4KA 5LQRA 4EGAA 4PHFA 4JSRA 4E51A 3HKCA 3UGKA 3EF0A 3WNZA 1O8CA 3V2HA 3VAZA 4H27A 4CM9D 3QIAA 4M9CA 4MV6A 1AQYA 1P9RA 2ZBRA 1D1SA 3SX0A 4DLZA 4DW8A 3A6KA 2ZLBA 4H9GA 1K7FB 1CVRA 1JHPA 1ZHFA 3BA6A 1EVKA 3LCVB 5CX1B 3RGGA 5ES3A 5B1IA 2CSUA 2JHPA 5DBOA 4XYEA 2GLUA 1ZGGA 3BMXA 1H66A 4MDHA 1BIFA 1KI4A 1IFXA 2PWPA 5JEDA 3TCNA 4WLUA 4FC7A 4E2WA 4XJVA 2QY6A 2ZOSA 4I5IA 4YCBA 1E5DA 3G9XA 3UICA 6CHYA 4DR7B 2FWJA 2WIGA 4LC9A 1JYSA 2RDMA 2UVPA 1TE2A 3FYCA 1NE2A 3G0CA 4MPJA 4U7WA 2H17A 1BFUA 4RKRA 1PQPA 1NLYA 4HP8A 2E0IA 4PC1A 3RVMA 2QLJA 2BMAA 4IMPA 1PT5A 2HYDA 3HL4A 5HE8A 3E9RA 5KI6A 3BL5A 5DNUA 1IK4A 3E9ZA 3LCRA 1XMQB 3EY4A 4JVMA 2VTDA 1W2WB 2DWCA 3JXEA 4ZVLA 4BNFA 1V8FA 5TX7A 1M5TA 1RP7A 4NXNB 2XMCA 4P54A 1AGRA 1GPBA 1KERA 2B2XA 1XZDA 4FCVA 5CFZA 1D6MA 2WDPA 1NSFA 3SP1A 3TLKA 2AEJA 2ZWAA 3B5JA 1D2GA 1SG0A 1JEQA 1Y3AA 4LZLA 5EJFA 1KKLA 4LV8B 3KT8A 3GRZA 1UJCA 1W5TA 5HJEA 3A9UA 5LWHA 1L7BA 3FOEC 3QBDA 1UBRS 2YFQA 4R0NA 4F72A 2PYDA 5JAZA 3H5OA 3KFVA 2UYHA 1AUXA 2PU5A 4WKOA 4COKA 4BWFB 1X0VA 1MX9A 2D2XA 2VKTA 4D4MA 3LVRE 3Q6NA 1L7AA 1AK1A 2JFGA 2NZUG 2ZR0A 4GMHA 2YV2A 1FFSA 2B92A 5DK4A 4UFNA 1M0WA 3W79A 3DPSA 2WSMA 1XXLA 2VDUE 4FGUA 1B7GO 1PFVA 4Z4QA 4BB0A 2BFDB 1P72A 2C2WA 2I91A 4RMJA 4TVKA 1D6SA 2A5GA 2IE8A 4ZEXA 1YRQA 3B9RA 5ICCA 1RM3A 3LY9A 4FIDA 4IGFA 1J8YF 3OAAD 2Z5GA 4EA7A 3A1FA 2HJRA 1U80A 2QD4A 4OY3A 2PKYX 5JSFA 2I62A 3DZGA 3GMSA 1MX1A 2I3AA 4X95A 4XIJA 4HBZA 3RD5A 1J90A 2GPWA 2XF8A 1DAGA 1TQ8A 2YXNA 4IMRA 2V55B 1QONA 1VIAA 2YC4C 3KT3A 6LDHA 5LBTA 1KZGB 3A27A 4NZ9A 4DLYA 4FWIB 1NNLA 2FDCA 3KKLA 3VU1A 2DPHA 4UHBA 2H1LA 4AKHA 4IDBA 3LPMA 2O4CA 2VWQA 3K20A 4HMOA 4F56A 2QPLA 3IAS1 2HF2A 1KFBB 5JVDA 2PCLA 4ITRC 1JAZA 1UMBB 2CFSA 2GNAA 2XA1A 3AGQA 4ZODA 1TIPA 5FL7A 3AM4A 5C5EA 1T8YA 5GONB 5L95A 1QC5B 1RQ7A 3AG5A 3UUGA 3LCUA 1H5NA 4DYDA 1J00A 2IPLA 4WJLA 2UYCA 3LDFA 3AJDA 4JSTA 3E22B 4PXYA 2H4XA 3DXXA 2PH7A 3IFSA 2QM8A 4QGHA 4CF7A 1IHUA 1UMCB 3IUYA 4H08A 2ZETA 3GJQA 1P2DA 3Q6MA 2Q07A 4ECAA 2JD2A 3AVTA 5DNAA 4MHTA 1YZNA 1Z88A 2CXHA 2YVAA 1Y5MA 4IDEA 4ALKA 5TQJA 1GUFA 4HWRA 2G9VA 2HPVA 5CXSA 2C31A 3FUWA 3HCEA 2W2LD 4UAGA 2QMUA 1HEIA 5LYYA 1P75A 4C2AA 1JHMA 3KRTA 1AB5A 1CJMA 3H9BA 3S8YA 4FFDA 4Y1GA 2Q0HA 3HMKA 3ZTWA 1O94D 4UHJA 3TQCA 1Z25A 3GG9A 2IUUA 3H1TA 3WA6A 5D3ZA 4TYWA 1M2KA 3EVDA 4XVRA 5DBHX 2CVZA 5KTMA 1DCFA 1HTWA 5FBHA 2R87A 4WINA 1YOVA 2I7TA 2FPGA 3HHPA 4PSAA 4DA8A 3AUFA 1J2RA 2E2WA 1K1EA 3CEHA 3HHEA 1CIJA 3OQMA 1YDMA 2XD4A 1J9EA 1SC6A 1X86B 1ZR2A 1V47A 2WJPA 2QUBA 1G21B 1QX4A 2X76A 3PQ6A 5CYFA 4CUJA 2BOVA 1YDFA 4G0OA 2IIVA 4ZQHA 1E1RD 3TLYA 1K63A 2JD0A 1YS4A 3G0BA 2DQKA 3W7VA 2HHHB 1WB6A 4UU7A 3UWOA 5BPHA 3T4XA 3V7YA 4BWYA 3AOEC 5EZQA 3OLXA 3WGZA 3EH1A 5A4FS 1ULSA 2AG8A 3WV5A 4MVJG 4GLOA 4YY3B 2XGJA 1KEZA 3IOCA 1T34A 1VIYA 9GPBA 1OD6A 4L78A 5I9NA 2RGAA 2XCQA 1BU8A 2D1RA 3B2EA 1OAAA 2HFJA 4XQGA 1GPLA 5CLQA 1DJNA 4BUJA 2EU8A 1QR2A 1GZ5A 4QVGA 4MTCA 4X91A 2XCTB 3NBMA 3NTQA 2D5AA 2XVZA 4W8HA 5EJMA 3ZKAA 4LN1A 4OQEA 4DY4A 3O2NA 1SD1A 1Y1LA 1H0KA 1NRIA 2Q4BA 2TMYA 2WM3A 3FN4A 3HKBB 2VAWA 1QWOA 4ZGGA 2QE7A 3L8HA 4RX1A 4JL6A 3R8CA 4A7PA 4WFQA 1WDMA 2CD7A 1KMIY 1R2QA 3THYA 1X7ZA 3LUPA 1NBEA 1UAYA 2UZ1B 5EQDA 3ZLTA 4FFWA 2E82A 3BF8A 4JJFA 4DY6A 5BV1A 1MT0A 5EHXA 2HSGA 6PFKA 1GN8A 4H7JA 4C7MA 1GGHA 2YY6A 2MSWA 5M29A 3ZDEA 1J56A 3GA0A 2CV1A 1JDTA 1ZI6A 1SXJB 1VJGA 2R7NA 4X63A 3NBAA 3BXZA 3UFXA 1A3CA 3GZNA 3HZOA 4ZT7A 1RRGA 5GGXA 5K7SA 1MOQA 2CWDA 3NHRA 5IWCA 5LNK6 3ND5A 3VC2A 4F91B 1P2UA 1SQ0A 4MROA 4RXMA 4MVJE 2PH5A 3V4LA 1G60A 3CINA 3A05A 4HB2A 3ZUGA 1WA5A 3RSCA 1P2VA 3OZCA 4D6PA 1PR6A 1WJGA 1OYVA 2IQ5A 1QQBA 2YJZA 2ZQZA 3EXG2 1SB8A 4W9NC 2B94A 3Q9NA 5FFFA 3MGGA 3EWNA 3D3EA 3QYAA 4XOIA 1KA9H 1MXFA 4L16A 2MU1A 3ZY5A 2FHSA 2YV1A 2QR2A 3L8EA 2FQWA 2FUNB 2QTZA 2WTUA 4A82A 2C9OA 1K4KA 2VZ8A 4IWYA 1LW7A 4DLPA 4RV9A 3T5AA 5TNXA 5D86A 2FN9A 2B4RO 4RXUA 2C9YA 1NUAA 1YU6A 2P5YA 4WCDA 2BPOA 4EMUA 4XB2A 3HLYA 1IXYA 5CK5A 1HM5A 3EEQA 1R6UA 5H9WA 2NU6B 4UAUA 3E5HA 3ZEIA 4AFNA 3V34A 2PT5A 3FHLA 1H2BA 3VU9B 4ZALA 4E1AA 5HR5A 3IYLW 4BTVA 4Q3KA 4ZI3A 4ABTA 2C00A 3KVOA 4JR1A 4AMGA 1CF9A 2AQ8A 4YT8A 2B78A 2X9QA 5BXQC 3GUUA 2EGUA 3P2OA 5MFPA 2PWAA 2VJBA 3BOSA 2Q5FA 4I9GA 2XCOA 1UFVA 5CT6A 4FK8A 6NULA 3EXFA 3PFBA 1IG3A 3FGOA 3NYQA 3RRYA 4CDNA 2N9UA 1IMOA 3U7QB 2QAJA 1DG9A 1Y3FE 2KI5A 4Q9JA 2XWSA 1HBJA 4TMFA 4WWHA 1DWUA 3GCXA 4FNAA 1I2MA 1NVTA 1RU3A 1L4EA 1UC4B 1NUPA 1B3BA 1ISMA 3N0VA 3SJBA 2WA1A 5JNWA 4COOA 4DYVA 5AI5A 4Z54A 3DW3X 3QI7A 3ETEA 1MU0A 3W4IA 2H16A 3KOMA 4DLVA 4DUPA 4DTCA 1DAPA 3MSCA 2JFWA 1O6FA 1ZK1A 4FZRA 2ZBGA 1OC2A 2C4NA 3EW7A 3P0RA 4AL4A 1XXHA 1ZD5A 4RULA 3TUZC 4PIMA 1VMKA 2WHEA 1E79A 5A4KA 1Y9ZA 2ZATA 4R1PA 4DJ5X 2EFCB 3KD2A 1PYDA 1EFDN 3WLMA 4OA8A 2HCRA 3DOCA 4LNUB 4KLRA 3QEOA 1T2CA 1W4ZA 3QVUA 4N41A 3MT8A 1OVMA 4D79A 1Q3HA 1RIFA 2QYHA 3EPRA 4UM9D 3SDBA 3ZE8A 4B0OA 2DT8A 1UJBA 1KXJA 1MJHA 2AT1A 3EXHA 1IBKB 3EGXA 3KAPA 4JYAB 3W5JA 4OLBA 5JPDA 2PAFA 3R5XA 1P4GA 1ORIA 1XRPA 1V26A 2YS7A 2AN9A 4N5MA 4I4TB 3PEWA 4DR1B 4LSMA 2XF2A 3JQAA 2YFHA 1AKQA 1JB9A 4JEHA 3KTFA 3U62A 3DTYA 1FP4A 3GFTA 4DXDA 1IATA 1W5EA 2JJ2A 5EEGA 3RUEA 4JIMA 5E7QA 3OZVA 3OOEA 2CL7X 3C48A 4KQEA 3RVLA 3OF5A 5G0UA 1EFVB 3O75A 1EVQA 3T9DA 1BJKA 4IUBS 1NWHA 2HJWA 1Y8QA 1Y7PA 2Q2QA 3IJEB 5FTMA 4EUHA 3PQ5A 1B0ZA 2I1LA 2MSEB 4FEAA 1HR0B 5K51A 3ZQ6A 2CZCA 4IIJF 4ZQGA 2I7CA 3PSHA 2BGLA 3UA3A 1DINA 1XZKA 3SBEA 1JFLA 4KFCA 3S7ZA 3TG8A 3CQ9A 2K2QB 3M4NA 1DOAA 4M9UA 2GH1A 4WOPA 1XA3A 1X7GA 5DBEX 1G9XA 4EX7A 4ARVA 1O9GA 4JBLA 4D9BA 3W8EA 1RRMA 1IDOA 1I2BA 2D8MA 4HDNB 4NS1A 1C1DB 3WGTA 3O94A 9LDBA 5FPKA 2D5CA 4YXWD 4ER5A 3R4VA 2P9GA 2FOXA 4WGGA 2OZKA 4XKJA 1R6VA 4K6GA 3FTFA 5FJIA 5FQOA 4Q1FA 3SE0A 1UBCA 2H1WA 4D3DA 3DE3X 3IR6A 3TOZA 3TW8A 5IM4A 2IUTA 3KOXA 5DZSA 2BEJA 2JGAA 2VVTA 1CUCA 1YGYA 3OQIB 3OUUA 1SJ9A 3P19A 2A0KA 4O2AA 1JA0A 2NXWA 2YMMA 3EZNA 4YRJA 3COVA 3PUYA 2HH9A 2PQ6A 3T52A 4G24A 1XEWX 3ZV6A 5HQ3A 2DYKA 2PLAA 1X77A 3NTVA 5AVQA 1ZNZA 2DF8A 4YJFB 4KCGA 4R1NA 1XDZA 1Q0TA 1YB6A 3AERB 4EI9A 5LMZA 3BJZA 1P4JA 3H17A 3AUJB 3E9MA 1M2VB 2H06A 3EEBA 3IGFA 1OR8A 1Z62A 1JTFA 5TC4A 2Q99A 4LJLA 2CLHB 4ZIRB 1P17A 2EP8A 4G89A 3T3PB 3W5AA 3LKVA 1AKNA 2KMLA 4OQLA 4BNDA 1E1LA 2RBEA 4O5OA 4WASA 3TQFA 4WZBB 2FYTA 2GPNA 4YRNA 4CEHB 2ECQA 1JG4A 2HOQA 2N75A 4FE7A 2GHRA 2BV3A 5FHRA 5LZ8A 1IBMB 1CE8A 1P5FA 2IC5A 4PZUA 1V25A 1PZFA 1KZHA 2OBMA 4JLVA 4HFNA 3L82B 4WLOA 3FPHA 2JGDB 4JJGA 4UHEA 3D1JA 3T3NA 5JD3A 1ZKDA 4LRTB 4Q7QA 1WBDA 1WE2A 4O3MA 2HIGA 2C94A 5EGNA 4A0QA 4E15A 4WNAB 4D56A 2DUMA 1IM8A 3ZIDA 1QFYA 3HGMA 2HA5A 2NOAA 4IV5A 2DMRA 1Y1RA 1CERA 1XZJA 2IYEA 5TS2A 1KFJB 4R8KA 2ZBPA 5AW6A 2B36A 3I2GA 5IX8A 1E1CA 4BQFA 4OBXA 3NEPX 1RYNA 2VRNA 5F1OA 3T38A 4RF5A 3EULA 1NVUQ 2E87A 1SG9A 3F7OA 2H11A 3O9VA 3ZHSA 5L4NA 1OB2A 3R9XB 7MHTA 3H9EO 4K1XA 5I5EA 3E5MA 1F3OA 3OPMA 1GV1A 1SUSA 5FPPA 4BMVA 4KI0A 4YK7A 3CB4A 3K05A 1T4DA 5DWDA 4ZJUA 4TZTA 2P9ZA 4Q4CA 1C4KA 4BEJA 3I58A 4Z9BA 5TIIA 3MMSA 1Q22A 2DJIA 1P6QA 3UHJA 4EG7A 4CGZA 3HR7A 5E4YA 2DQYA 3W1EA 3LX4A 4FYVA 1CQIB 2A9OA 2O07A 2VYVD 1SVSA 1KU6A 1G63A 4DLUA 1NPTO 5AK5A 1GXSA 5F5LA 3V8BA 4A6PA 5TQ2A 5HBGA 3PFNA 1T2EA 1UAGA 2J9FA 3ZQ4A 5JU6A 1JN0A 2D62A 3LUGA 3C85A 1FW8A 2IGBA 4BX3A 4PZEA 3T1OA 1E9RA 5CB6A 1FRVA 1Z34A 2Z3VA 1VRCA 1O97D 3B7PA 3EGOA 3NDIA 4K6MA 4NNPA 5E2IA 1GM5A 4YMIA 2PHZA 3KB2A 5KKAA 3WZ2A 2AZ4A 3C3EA 3PDHA 3VOBA 4S2EA 2VNKA 2OO5A 2X4GA 3NVAA 4KO1S 3I4CA 3SKVA 1QFJA 4KC0A 3MRXA 1T9HA 1V0JA 3NFYA 5TGZA 4B85A 2ODPA 2Q7OE 4CR7A 2ZYSA 1YRYE 2OMEA 1LLCA 4LKOA 1XVTA 1RWXA 1QFSA 3NAMA 5EFOA 4ZV7A 1ESMA 3VPFA 3B20A 3SX2A 2BFNA 1OZAA 2HWYA 1U1EA 2IP4A 4P4LA 4R7TA 1O58A 3BHIA 2BF4A 4KXVA 3VSAA 2BYTA 3K9FC 3DMPA 2BBSA 1W29A 5KPJA 5GIPE 2FE4A 2VYQA 3RK1A 3ZGLA 4QBGB 3VYWA 1QK4A 2BFBA 2CMFA 2YV5A 4O5AA 1X9IA 2IVFA 2ZBDA 4YLYA 4TQ9A 5EC8A 1DO8A 4JXKA 4WFJA 4UTPA 1BGVA 4QXAA 3TW0A 4EQZA 2C4MA 4FGWA 1CULC 1TA0A 5JCZA 2NQ8A 4YCJA 1A2QA 3WNQA 1QKJA 1ESCA 4QOHA 3AV3A 1AKTA 2A58A 4FB5A 1LLDA 3UJ7A 3THXA 1ZI8A 5ILOA 4C9BA 5JROA 3VZPA 5IHPA 2UUCB 1RC1A 2FEPA 2A57A 3HB9A 3ORSA 1EXNA 3OA2A 4UUMA 3OMXA 3IJ5A 5FULA 3DZKA 3PUXA 4D0NA 4X66B 4L28A 1U1DA 1L1QA 3B53X 3DXFA 4MZDA 5AVRA 2D0PB 5TRTA 4EGFA 4QKQA 1PR4A 1ZL0A 2HRBA 4RH3A 4RZXA 2BTQA 4WLVA 2C9DA 3B82A 1YR1A 4GU5A 3WO0A 3H5NA 4JXZA 4MVXA 1AOXA 5J43A 2PZMA 3ZWYA 3AEQA 1GU1A 4XTCS 3RYTC 3FF1A 4YXFA 3OO1A 2QM0A 1TM3E 1YL5A 4K88A 4E2XA 3HH8A 2GX6A 3P4YA 4FGJA 5E0KB 2GRAA 2JLBA 1RCTE 1QYCA 2RCYA 3LF1A 3T1NA 5HKKA 3OD1A 2YH2A 4ZEOA 1UANA 3AL3A 1TKBA 2CBZA 2JFYA 4RKWA 4QTXA 1EXMA 3A2KA 1XL1A 2Q3DA 3NYIA 3RIEA 4C04A 1H8HD 1SZPA 3CXRA 4EABA 4ZCRA 3GFQA 5DCUA 2PBFA 3ADKA 4Q24A 4FFOA 1DC5A 5C1DA 2HA2A 2G82A 2FZLA 3QELA 2GARA 1S7CA 3UB4