1BWPA

Probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
b'ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSAVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Probing the Substrate Specificity of the Intracellular Brain Platelet-Activating Factor Acetylhydrolase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 74
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1bwpA00
4TX1A 3BZWA 1JRLA 4I8IA 1ESCA 4JHLA 1FXWA 1ESEA 1FXWF 4IYJA 1DEXA 3W7VA 4JJ4A 4OAPA 4Q7QA 5A4AA 5B5SA 1BWRA 4RW0A 2WABA 4S1PA 2WAAA 4OAOA 1DEOA 1WABA 3DC7A 1VJGA 3DT9A 4HF7A 2WAOA 3SLRA 4JKOA 4Q9AA 3U37A 3MILA 1BWPA 4M8KA 2Q0SA 2O14A 3RJTA 1ESDA 5JD3A 1K7CA 4DEVA 3SKVA 2HSJA 3C1UA 4PPYA 3PT5A 3HP4A 1BWQA 1ES9A 4K3UA 5CD9A 4K7JA 1YZFA 2VPTA 4H08A 3DT8A 1Z8HA 4K40A 4HYQA 4LHSA 4RSHA 4JJ6A 4XVHA 2W9XA 1PP4A 4JGGA 4K9SA 3DT6A 1J00A 3KVNA 2APJA 1ZMBA 3DCIA 5BN1A 1VYHA 1U8UA 1V2GA 2Q0QA 4NRDA 3P94A 5HOEA 1IVNA
chains in the Genus database with same CATH superfamily
3VPBA 3O3NB 3GPBA 1E5QA 2C58A 2IU3A 1SUWA 5FOWA 4G0XA 3GRAA 1I1OA 2BEVA 4L9WA 2VAXA 3RWMB 1NT2A 3L0SA 3PJDA 4ENWA 5BR4A 1H66A 4KIWA 1ZN8A 1A71A 3IXQA 3SFTA 3UYLA 1ISGA 5AMXA 2PDAA 3U1VA 1LX7A 1YV9A 4HQKA 1LDBA 3BXEA 3JV7A 2DUNA 3JALB 1USWA 1BG6A 4XWKA 1L8QA 4PZUA 1E94E 2CLIB 5ENZA 2XD9A 1UANA 3TLCA 1I3LA 1I7SB 1MJGM 4CUZA 1Q19A 3ZDCA 3DL0A 1C1HA 9LDBA 4OHFA 1LDEA 3REQB 2QM0A 2AFRA 2IPAB 3UFXA 1JH9A 1G8GA 2NADA 3OESA 4DMHA 2XCOA 3QM1A 4EGFA 1AD2A 1J33A 5IJAA 1TMKA 3TXYA 1IUKA 3LT2A 3L7CA 3SBEA 3UW1A 3ZDYB 3TOVA 1V1JA 1C9YA 1WABA 2C5GA 4WZBE 1ZVKA 3GYBA 1OXMA 4ENVA 3OZRA 3LX6A 5TLSA 3SXJA 5FTKA 1S8NA 2AI3A 1AK9A 5E6RA 1RE1A 1O87A 1ZL0A 2E7ZA 2ODNA 1BX1A 3BGWA 3MMNA 4NKRA 1TEHA 2J5BA 1K3UB 1YUBA 3FWNA 4DT1B 2PMKA 2CGEA 3B3AA 1D2RA 3DB1A 4XLLA 1QK5A 3AR4A 2ZDGA 3WBKA 5AESA 4RYLA 3N86A 3ZHXA 1SKQA 1KKLA 2WFLB 4E4YA 3GLIB 4MDFA 4HNHA 2IOFK 1QO0D 3IURA 1Z2CA 4PSKA 4ZGBA 3PL5A 3DOOA 3HHEA 1VP3A 2NXWA 1CJSA 4P3OA 3SR3A 2PWYA 4CCSA 4DB4A 1KOJA 3IE2A 2HFKA 1PWXA 4F3YA 4PGMA 1T3TA 5GJVC 3GFTA 4Y2JA 2BMEA 1J8VA 2I3DA 3QWBA 2PR2A 2RHTA 4LOJA 4OUKX 3PC7A 5DGIA 3SS9X 3DWFA 4AS1A 3H4VA 3KUXA 3OE5A 1NZJA 1D4AA 4QO8A 3DPUA 3ZNOA 3PCXA 3R7LA 2G1AA 1CY4A 3MOSA 3BE5A 3D0QA 3PVZA 4LK3A 1IQUA 1GA4A 3ITEA 5J58A 4B79A 3WGUA 2WT9A 4CMIB 3GEPA 3HL0A 4MV5A 2YIMA 2PKQP 2ZE5A 3ZWNA 2REQB 2DQKA 5LYJA 3KV3O 1KJ9A 1B3RA 3RIYA 4BQQA 4D2IA 4QLBA 2DEUA 2HF2A 2FDCA 2WD9A 2DHEA 3MJDA 3AM1A 5BSVA 2G70A 4US2R 1SBTA 1JHDA 5K0TA 5EZ5A 2PFSA 5AKIA 3KVOA 3LHFA 4KUEA 4RE5A 4EPVA 4ZIRA 1CYEA 5KYWB 4CDGA 4B0PA 4V1CB 1N5DA 4DDWA 2VP3A 3Q3EA 4ZKEA 5M2QA 3SJCA 3RIMA 2YYSA 1P73A 3RT7A 3WGYA 4WXRA 1LTQA 2FUG6 4MUMA 1I4WA 2WMDA 1VDMA 2R62A 3CH7A 1X0XA 3R5SA 2PL9A 2A0KA 3D1LA 4L0MA 5H02A 2Q07A 2VF2A 1Z74A 1PS9A 4PNHA 1THGA 4RPIA 3V7YA 2HEIA 1NN1A 1UMDB 1FFXA 1U8CB 3TGWA 1AJEA 3EB9A 4R7TA 1R9NA 3C3CA 4MKZA 4NARA 2ACEA 3OFSA 1JR3A 1MX1A 5JU6A 2Q3LA 3DH0A 5CFNA 2JLVA 3U31A 2TYSB 4PZAA 2KM1A 1N9ZA 1D1PA 3GX1A 5DXJA 5F1PA 4YQEA 5LP6B 4AURA 4ZDKA 4GX1A 2MSEB 2WYVA 5T64A 1G291 3G0OA 4GOXA 4CMEC 4BZXA 2ZYDA 4BRZA 5E2IA 2GAOA 1P3Y1 2HXYA 2VSFA 2Z0MA 2J3EA 1XOIA 4N6GA 1XFDA 4QPJC 3HKCA 4I50A 2YJZA 4UZSA 4FYHA 5J3JA 1QWSA 2FGKA 1XK7A 4M9RA 2EL7A 4GR9A 5K3DA 5LA6F 3RDPA 2VJMB 4WN3A 4CM9A 2DFDA 1Z73A 1IK6A 3OCUA 3QVXA 2ZUFA 4H16A 1OUMA 3LIIA 2R8YA 1QSGA 2CLEB 3F90A 3SYLA 3TTUA 4B2PA 1TQ4A 2WSIA 2CNBA 3L0OA 3ET5A 4DR3B 3HFJA 3CRRA 1VL5A 4IPTA 5D84A 1AGXA 3OEEA 1K75A 4FTWA 1ODKA 1NQVA 4JODA 5JHGB 2GERA 1QGYA 4E1VA 2CCJA 5I51A 1GAWA 1R8JA 3QFTA 1QH9A 3KBOA 3DF7A 1QYIA 1JQ5A 3GEGA 5BRAA 2PH5A 2BFDB 1ZA2A 4O4JF 3SC3A 4YLEA 4K9NA 4ZXFA 3QPAA 3WFZA 3A26A 1XTQA 3O95A 3OC0A 1GTG1 3Q8WA 3TUJC 1XFAA 3K0HA 2XKAA 3E7DA 3CY6A 3UXHA 1V5IA 1V96A 1XQ9A 5ICMA 4NABA 1ZWLA 4DJAA 5B36A 1UJCA 3R3XA 1GZ7A 3EMDA 3THYB 2A5JA 5ALDA 2WIGA 5F2KA 2GEJA 4RGVA 1VJTA 1MGOA 4WXYB 2IXFA 1CXZA 4B80A 4MZDA 1DSSG 3NEPX 3BD9A 4K3UA 1KYVA 2PRZA 1IAVA 3N0WA 2JDID 3H65A 5B7NA 5MFZA 1W1IA 4ZQCB 3UV3A 4HDNA 2EIHA 3FNHA 1J2JA 3KPYA 3O82A 4K40A 4N54A 2IXGA 1RABA 3ZE1B 3CLTC 4QATA 3DV2A 1U0TA 5JXHA 2PX4A 3M3DA 3R6LA 4HP8A 3U3ZA 2WKWA 5IDQA 4IIHA 5KSWB 1Z28A 3AM3A 4KPEC 1G60A 1XYVA 1G2PA 2RK4A 1JPUA 2HQ1A 2QD3A 2ZUBA 1N6RA 2D0PB 3EWNA 1NW3A 1SOMA 3HGTA 2QE7A 1LBIA 1KMCA 4OQLA 4P33A 3G3EA 2O2YA 2XJ9A 4K03A 2JATA 1JNYA 4XSVA 2BM9A 3KZCA 4K6MA 2GCPA 3RK0A 2LR0A 3E9EA 1Q7CA 3L06A 4DOMA 2QMOA 1ZJYA 3B1YA 3FYCA 3VPFA 3L43A 2E21A 1M8FA 1XCOA 3SNKA 3AEZA 3U49A 5I4IA 3B9BA 4LV6A 4TV8F 3FOFC 3GIDA 2LDXA 4CMBA 2O07A 2FAXA 3K92A 1W8IA 1IOZA 2DG2A 4HDRA 1J25A 4ITVA 1YQXA 3GAAA 4HNAA 1MQ9A 4K5QA 2W83A 5ALQA 5E7MA 4Q4CA 2ZJ1A 4NYMR 5DSXA 4I2NA 3OQPA 3QA3E 4M49A 3EARA 3ZDBA 1K4KA 4ZCIA 3NWPA 4RD6A 3RUHA 2QJRA 4YMHA 5HM8A 5LJIA 1A27A 1DAMA 4X1YA 5JAZA 4FILA 1A9TA 1DT3A 1P0FA 2I2FA 3MUNA 3VTFA 1UKZA 2BFCA 1J1UA 3B36A 1P5HA 2QPTA 1Q1QA 2JLCA 2X3FA 4E03A 4RKFA 4CM3A 4EPXA 1U8FO 1O97D 2I1LA 2W0SA 4ESEA 1F8YA 1WA5A 2JC3A 1QNLA 2ZTHA 3Q2OA 4K9MA 2RGEA 1V8PA 3KPJA 1RQ7A 4Q93A 1IIBA 5CJ2A 4EPYA 3HJRA 1L5RA 3WS7A 3UC9A 3QSYA 1NKSA 3VOAA 3E9RA 1EXNA 1PSZA 2FXIA 4ITRC 1M9NA 3R3WA 3UMSA 1UQTA 3I45A 2OKCA 3LY5A 2JBHA 5F21A 3ANSA 1POWA 3E9YA 5KOJB 4CM7A 5IBCA 1ODJA 1V4NA 2WC1A 3A3NA 4L28A 2H3HA 4KGDA 2PS0A 3K1AA 1X0VA 3M6AA 4C0QC 1UFVA 4DZZA 4L78A 2GWHA 5JXJA 3IAHA 5ISMA 1THTA 2VYVD 1FS4A 3IHTA 3KSRA 1M34A 4CIYA 3ME5A 2CHGA 2WYUA 3FZQA 4Q9HA 3SMQA 1KVQA 2QTAA 5YASA 5HKBA 3BSYA 3WYBA 5KHLB 2QN1A 2OHVA 3RHZA 4DHEA 3RBXA 2OMEA 4DJFC 5LUAA 4EMSA 2AYZA 2G36A 3K9QO 4EABA 1NF9A 1JDSA 1QYXA 2RAPA 2FPSA 2PPLA 1GGVA 5DNUA 2W42A 4DN6A 4UE3S 3KRTA 3UA3A 1GSIA 1KO5A 3HY4A 4OD0A 4EKIA 3K6SA 2YWRA 4JB8A 2V96A 1O77A 4FNGA 1LQUA 5EJGA 4AN4A 4EP1A 4XVUA 2PWBA 1YCDA 4DCJA 4AQYB 1NUTA 1RCTE 1EM8B 2QMQA 1P2TA 4JQCA 3DNMA 1RP7A 2I3ZA 3GA0A 5EL0A 3VZDA 2Q49A 4H08A 2YN4A 1P33A 1FTNA 1P4HA 3OM1A 4DRXA 5I4BA 2Q9AA 4PX3A 4BLVA 1GZHB 4V0KA 4UCXA 1EUCB 2P7IA 3K0FA 3ORQA 4MUYA 4M0EA 4Z9BA 4KOEC 3CEPB 1NBMD 1XVLA 2HJGA 2RIPA 2BGMA 2Q9UA 4DS3A 2BGLA 3H42B 3P4UA 3UF0A 4LQCA 2Y6UA 1JHAA 3BD8A 2WTAA 4N5NA 5KKNB 2HBQA 3H3FA 2FP4B 3CN7A 3TRJA 3DT6A 4E5PA 2EP8A 4ZARA 3JQFC 3GP5A 1Z6QA 1V3UA 4UHJA 2VO1A 1RW4A 5KNDH 4XQ9A 1PV4A 2O8EB 2PKEA 4IGIA 1FVXA 3PC6A 2VCEA 3SLKA 2VLIA 4W5WA 1U1IA 5D3ZA 2R8OA 1YGYA 2BMDA 2IYRA 4US0R 3TPFA 3ZQ6A 4E5UA 3EASA 4BMNA 4PTYA 1AQJA 1V9SA 2ERXA 4MS1B 3QWHA 2VQ6A 2BFNA 3NEYA 4KNWA 2ZROA 4Q4JB 4TXHA 5EFZA 3WR5A 2XAAA 1GDHA 3I1IA 3QE3A 5DYWA 3Q41A 2Q3CA 2Y1GA 2W6CX 3M4XA 2D1YA 4ZZ3A 3DLPX 1NBWB 2OFOA 1WDMA 3ISJA 3QYFA 3BEOA 2JA2A 2CK3D 1NONA 3EQ7A 1AQLA 1B2RA 5K01A 2VRCA 3PHLA 3OETA 5JD5A 1C1YA 3KHKA 5FWXA 3AUYA 4UCQA 2YTZA 4BNFA 3E27A 2G9VA 3B6IA 2XA1A 1M6NA 1G98A 3JAKB 2GESA 3EGXB 3HDJA 2GEFA 5TEWA 2J0UB 3WAJA 4CJXA 2L18A 3EXAA 4LJSA 5JJ5A 2HV8A 2IHTA 1ECFA 1QRSA 5GINE 2YUIA 2TS1A 5JCPA 1F9AA 1ZXLA 4S1PA 1PEDA 4G0MA 2VN8A 2XYQA 3UK2A 4OQDA 3WTBA 2YWCA 2CFCA 1NSFA 4ZEWA 5B64A 3F4BA 4JEHA 4HTFB 4TN1A 2YS7A 1P77A 2VXCA 1W36D 1U3CA 3PV0A 1VHDA 2E85A 4UUMA 1VKJA 3DO8A 1LW6E 3FTEA 4ZRMA 2R8ZA 2H29A 3B1XA 3PGXA 1DUIA 1EBBA 1YS6A 3P45A 1U3FA 2CL6X 3T15A 1T8SA 1UZUA 2JCYA 2PX3A 3LLUA 2WWFA 3P0FA 2V45A 3KQPA 4YDSA 1I80A 1LA2A 3SBOA 4R9UC 3WK5A 1GU7A 2ZGVA 5IBQA 1NE2A 1JJ7A 2BF7A 3NH9A 3HVUA 1OFVA 3H1AA 1ORHA 5LD2B 2IELA 3V4LA 5JRJA 4U2DA 4CEJA 3HCNA 1CUCA 2GAJA 1D2MA 3ZYCA 3EEBA 1HYEA 2PHZA 3FPAA 1O2DA 1UWCA 4QUHA 1Z5VA 4RM2A 1V3TA 3ICCA 3MPOA 1T1SA 3LY7A 3PGKA 4XIYA 4GI1A 5ECYA 1ZCJA 1K4YA 1MDFA 3DDZX 2NSDA 1HKUA 4FZJA 3JAMA 5HNKA 1YL5A 3V8PA 3JCZA 2W2LA 4ASUD 2XNHA 1Z4JA 3EVNA 4KFRA 1LSOA 3UWSA 4JI5B 5A2QA 1Z7BA 3AYZB 4S2UA 2OBBA 2QI9C 1KOGA 3I2KA 3DP9A 2SKEA 3LC7O 3WRVA 4JP8A 1BA3A 1N6OA 1SIWA 2F1IA 2IT1A 2JGFA 4ANFA 1VE9A 4D6XA 4IZHA 4U8HA 3JS5A 5CB4F 1BOOA 1NW7A 1K08A 1S01A 1BTOA 1WMFA 2FW6A 4UUPA 5CVTA 4ZEVA 2PY6A 5TMBA 4EG6A 3QI2A 3GG9A 2VF8A 4JH0A 5EWMA 2VJNA 2FWMX 2BGWA 2UUCB 2ROQA 1QGUB 4FCCA 2P8JA 3VR3A 1L3IA 2WU4A 2CWWA 4OB7A 1IMOA 2F1HA 2MHCA 3FMGA 1CS0B 5TMDA 2VA9A 2PMBA 5EQFA 2MJLA 3OPNA 4A6PA 1CUJA 3L07A 4OGKA 4E7OA 3QOXA 1B6SA 4KXQA 4XR4A 4AKEA 5J47A 1SZJG 3ZWWA 2IV2X 5A1JA 4BS9A 4DGQA 4DE5A 3GEHA 3R9IA 2WWVD 1JLLB 2ONKA 3LZDA 1N5OX 1SU7A 4FGLA 2VHTA 3DZBA 2PBLA 3WHLA 5CEEA 2C7PA 1R4MB 4UBKA 1N78A 1XT6A 3KR1A 5A3RA 3NYRA 3AKYA 3QVTA 5E9WA 4QYTA 4Q7LA 1O9GA 2XMSA 4DCUA 2IS1A 4Q1BA 2BLLA 3RS0A 1NT4A 1BMDA 1UBLS 1SB8A 2CD7A 3WSTA 4LF9B 1U1DA 1TM3E 2Q5LA 2GBGA 3R5TA 3QMPA 1LI4A 4WBNA 2D5IA 1IDN1 5BWLA 1UJ6A 5HJ7A 1F5NA 2N1MA 2ZKIA 3JVVA 1Y3BE 5D3QA 3JY6A 1Q6ZA 3M5WA 1BVHA 1D6SA 4GX5A 4DMCA 1P6XA 3HN7A 3NNNA 4LHWA 5ALKA 2X0NA 3GA5A 5F9MA 3V1NA 2DPYA 2JFYA 3N0XA 3ZQJA 4C1BA 4DJ5X 4LJRA 5LOVA 1D03A 1HA3A 3HB5X 1YJBA 3JQ6A 4XIJA 4TXNA 3M6WA 5BYJA 3LRXA 4Z6KA 1T8WA 4ZOCA 3I09A 3IPLA 1G8YA 5K09A 3GN2A 5A5VA 1GZDA 1I4EB 4LBYA 1KSHA 2XE7A 3SYTA 1RKXA 2JI6A 1QKKA 1D4OA 4YV0A 1Y3CE 1KHHA 4R2KA 2IYNA 2AE1A 3NUGA 1FNBA 2FG5A 4IH4A 7AT1A 1QR2A 4A8TA 4ZHQF 3PQDA 2P91A 3QVKA 2QLJA 3L9XA 3QITA 1V26A 3SXUB 3EIFA 3FIUA 3V4ZA 4D9CA 4Q37A 3DFKA 5FA6A 1VKRA 2WG2A 2RI1A 4BO2A 1OXXK 4BL5A 4Y6QA 4O1MA 1J07A 1IK4A 1M8GA 1U81A 4RVDA 4IWNA 3KSAC 2QTWB 2ZRLA 2D5AA 3C8HA 1JDJA 1AF4A 3NT5A 4ZN6A 3H3JA 3FCXA 5CT6A 5GPBA 1QP8A 3WWEA 4HX5A 3CXUA 1NVVR 1WCIB 1MFPA 1GGKA 3DBHB 4QG7A 1RU3A 2VG8A 2ZIAA 3I2GA 3K9WA 3QE4A 1CUZA 1DG3A 2Q6KA 2UKDA 3QEKA 5CM2Z 4ZRNA 3K20A 2IU4A 2ZAGA 4GPTA 1I1NA 4RF4A 3K8ZA 2TRSB 4NDNE 3RADC 5HPYB 2VQSA 4GL4A 3I9JA 2NTJA 3E8MA 5E2BA 4ZEXA 2ONZA 3EA5A 3HXQA 4I7EA 4GP6A 2VYNA 3VV3A 3DGFC 5A0VA 2JIPA 2H3EA 1EGVB 1VXOA 3H6HA 4LDAA 4J0CA 3IIMA 3FMOB 4FBLA 1W2WB 1ZMTA 4N12A 3VH1A 2Y92A 3KQMA 1ISJA 3LHKA 5C1OA 1DQYA 1JR3E 2ILVA 3NO4A 4Z4IA 3KLNA 1R6AA 1P1FA 4RWEA 3O7MA 4OP2A 1QRAA 3A7DA 2VPYA 2NVOA 1KHTA 3CF6R 3LD9A 2V6JA 4J9UE 1Z13A 1PG5A 5FOSA 1ANKA 3GUCA 4ZO8A 2Q21A 4Z49A 4UHKA 2YJGA 1AUVA 2GFHA 4LDPA 1E3SA 3UQZA 5HDBB 4L4UA 4FS3A 4UU8A 4NR0A 4R9VA 2GI4A 4G5YA 5D7NA 3FBTA 2M6RA 4X65B 1NUSA 1KK0A 1F60A 4EI7A 1KPHA 1RYEA 3W7BA 4EJ2A 3NDJA 3ZV6A 1TD9A 2M2IA 4NP6A 4D1YA 5KTTA 3RAJA 3QPDA 4Y7CA 1TI7A 3BUSA 3OQIA 3WNBA 1GTVA 2CYAA 3CLTD 4KXFB 4F84A 3K09C 2ORVA 3H9BA 4XSHA 4KR6A 2Z4TA 1O94A 5ITZB 2Q5HA 3DEJA 3JARB 3QJGA 4JJ4A 3PE6A 2J6IA 1QC5B 2XYGA 4H18A 4OJKA 4UQPA 2QB5A 3T5GA 9GPBA 4JJIA 4M0LA 3IUBA 4D4GA 2XUDA 3HRHA 4CL3A 1R50A 4N7JA 2JGLA 4KQ1A 1KQFA 4X90A 2YFHA 2WZCA 3QXHA 5JV5A 1SXHA 4CKWA 2ISSD 3DLAA 1H2ZA 5ARCA 4KDRA 3QOWA 3GEIA 4HVAA 3TK1A 2ZE6A 4P92A 1OBOA 3VR5A 1E6CA 1U3WA 3IKVA 2DF8A 2PX8A 2Q6VA 5CM9C 3BGSA 4FE3A 3O1JC 1NMEA 3FFWA 1TYEB 3KNZA 5K45A 2F7SA 1GR1A 3QLVC 2O2XA 4KQIA 4V0LA 3AYXB 2WJYA 2ONJA 4UQLA 1NULA 3FOWA 3FPLA 3F73A 1D8AA 1R16A 1OX5A 1YVDA 2Q46A 2XEXA 3BSWA 3LQ4A 4LXUA 4P4GA 3QVJA 4PAQA 1OLSA 5EINA 1V1RA 2CCGA 3L4EA 3C43A 1L7AA 2VZ9A 3PI7A 3EXHB 4Q1EA 1WTCA 3R7FA 2GARA 3T7JA 3WGTA 4D80A 3PEYA 2OAEA 3RJTA 1WU7A 1NXPA 3HB9A 2ZJ0A 1WHTA 2I8LA 2MCFA 1PJ2A 3VNAA 2DY0A 3WLRA 2I4NA 1QP4A 1TUEA 2ECQA 1K7XB 2NTEA 1KJJA 1R2QA 2IPMA 3F9CA 4GXTA 4ZT2A 3PFGA 4MEJA 3RIXA 3MWEA 4AMZA 2VP4A 1TLFA 2ZYWX 3TSCA 1OXVA 1SQGA 3HO6A 3Q7RA 5HE9A 3I73A 4Z4EA 4WN9A 4O2AF 3GJ7A 4WNCA 1IJBA 3CG4A 1YZFA 1EGQA 4GS5A 4M36A 3NRBA 4RQTA 1U3UA 3IPCA 1GILA 3O73A 4G9EA 1EK5A 2V5AA 1UAYA 4WLOA 4EAQA 5E6UA 1XBTA 4HZGA 4OUDA 1Z26A 3TIVA 3VO9A 3X1MA 4MNTA 1L3CA 4A1FA 3B89A 2O59A 3RS3A 4AO7A 3HFSA 4EEKA 3SQNA 2ADFA 1IPHA 4NNPA 3OKAA 4HMOA 5F4BA 2QVCA 5EMJA 3ADDA 1E2IA 1HC7A 3MMZA 3PK0A 1NAHA 1NXQA 2WUEA 2ZRJA 2V7GA 3GR6A 3NT4A 3S99A 2JIOA 5JCXA 4RDCA 5FIUA 2DB3A 1R00A 3V4PB 2D1FA 5E1BA 4CIBA 4MUIA 2K7FA 2BFPA 4QICA 4COOA 2FZ5A 1SXGA 2YWBA 1SVWA 2ZG6A 3FRJA 2C9ZA 1N6HA 4G3XA 4AYXA 1DAIA 2OGSA 5H3LA 2G06A 1YAHA 1BOFA 4WJZA 4XXHA 1Q0LA 1HLFA 3GW8A 4M9ZA 1B14A 1GTJ1 1SUSA 2GF0A 2NV2B 4MRRA 5FQOA 4MVJI 2W2VA 4MVCA 5LWHA 3P9QA 2Y3IA 5AI9A 4FDUA 4GDMA 2Z4SA 3UZUA 1L7XA 3OX3A 4ILKA 2P41A 4LQ4A 4O4HF 3T5MA 4FZ5A 2PRJA 3SICE 4GWGA 3BD6A 1F6WA 3FLEA 3N2IA 4KX3A 4UAJA 2EJCA 3OQVA 2WHQA 4BBJA 3FCYA 3PP8A 1YQ9A 4F97A 4U7GA 2C5EA 5EZSA 1G7RA 2I1VB 5TF4A 2XCSB 3BWVA 4U0JA 1KZ6A 1PT6A 1SXJB 4HGOA 2C9MA 3BXGA 3G8CA 4Y6PA 3OFND 4TPKA 1W8DA 5HIMA 5CLJA 3CSSA 5KYUA 2IQIA 5KTYA 3UVEA 3VZRA 2VEDA 3K6KA 4IGKA 4RESA 5CW1A 1IG3A 1M7BA 3D8TA 4BNJA 5MF6A 4RTOA 4IHJA 1T1IA 1M34E 2CE2X 2GNPA 4KN8A 1O5TA 5DHSA 1V43A 1SBIA 2JI9A 1GZ5A 4A6XA 3BHNA 1K88A 3H17A 1WXWA 3WWOA 5EJ9A 2WDZA 3BXZA 4RZ3A 4EBBA 1VL1A 1K68A 3VGJA 5B1YA 2ZRHA 2FFQA 3QLUC 4LDRA 3ADKA 3BF8A 4Y2XA 4FFMA 4DMMA 2X1MA 1B76A 4DCCA 1AMUA 4LZOA 3P0JA 1UK8A 1ZGHA 2P27A 1RPNA 3UT5A 5CCEA 1S8AA 4TXJA 3SC2B 5BSFA 2N0SA 2ZYAA 1E0DA 4HSEA 3P5BA 4P4TA 3W8NA 1J22A 5ERXA 3RG2A 3T99A 1NE7A 3TSYA 2HUPA 4HYTA 1GKLA 1M1UA 3G2JA 3PKIA 4YJKA 2ZRCA 5KVVA 3A7EA 3U5TA 3LQ1A 3JYPA 1LBEA 3L77A 1R5JA 1U9IA 1CR0A 4YXWA 2XXAB 5EWLA 1DKMA 4IUBS 4KWIA 2X0EA 2I80A 3A28A 3FCAA 5G3ZA 4ZOLB 2GDJA 4ZOEA 3TBHA 4QT4A 3S7ZA 2BI4A 3CNOA 3IV6A 3NAZA 3AUAA 4BMZA 1AK2A 1EQAA 1KDVA 1EFRA 5EQJB 5ALLA 4CE6A 4DNQA 4Q3LA 3ZNQA 2N46A 1MCZA 3DDOA 4B2YA 1U4SA 4D25A 1UBSB 4KFUA 4ZVLA 1GFWA 3H0CA 4L4XA 3M5CA 4PLWA 4GZ5A 2QRQA 2IYOA 1X14A 2D1SA 5JFOA 1PHRA 3E2IA 2OQRA 2ZYIA 3IAM1 5BSTA 4Q03A 3V1KA 5DW3A 3MQ2A 2WJWA 1CFZA 3T4XA 3TZEA 3U9LA 1XVVA 2P9BA 4LW8A 5AUQA 1EFVB 2VP2A 4RS4A 3TE7A 5IYZB 3QUCA 2GPBA 1IAQA 1SVOA 2V7QA 1YU9A 1YR8A 3E3LA 4IOMA 3INTA 4IS2A 1L4MA 2NAPA 4LTNA 1ZW6A 3ZW9A 4XAQA 1WDTA 1H5UA 5F35A 1N32B 4FP9A 4QD3A 1GRNA 2RGRA 3Q8XB 1GN9A 2WYOA 1E3MA 2AN3A 1UIMA 1G6Q1 2QEQA 2XB6A 3HKEB 3HWSA 4H2DA 6PFKA 3IMKA 4ZO4A 1E4OA 1E1MA 2AB0A 4P9NA 1QZ3A 3MTGA 4LOAA 4XX0B 2NT3A 2VEOA 5DNDA 3UJNA 4L95C 4OB6A 4B3BA 1MABB 3T7EA 2FLWA 1TIPA 2FOXA 2FRDA 1NRIA 2PGNA 2IY7A 3B70A 1QTNA 1R8QA 1CJUC 3HU1A 3PPXA 4EF6A 3FI9A 3K32A 4U7HA 1P0IA 2XNDA 3E9DA 4HC4A 4NYJQ 4CKEB 2X77A 4RIIA 1GA6A 1NFFA 3A6GA 3UTCA 3A1VA 2PM8A 4MRPA 4W1SA 1I7QB 1J8FA 1GVHA 3GAFA 3RS8A 1Y82A 1MT3A 1SK8A 5IF3A 5JSZA 1J5PA 5FPHA 2DY1A 3SHTA 2FN7A 3H18A 1RRGA 4JC4A 4II7A 3QP9A 1JR2A 1EBFA 1H2EA 3HVIA 5KS2A 1QP0A 2HDNB 3LPNA 1PR5A 5KNBA 2CVFA 3OLXA 4ZMRA 3MGGA 4UBOA 1U3GA 5C8XA 2XXJA 1D7OA 1MOQA 4YRZA 4D3DA 4GYWA 1MAAA 2F3QA 1BVYF 3LTEA 5EXPA 3IOCA 5KUTA 4D45A 4Z7QB 2JA1A 2KYRA 2JW5A 2V9PA 3TWOA 4AMUA 2CZCA 4KRFA 1PJLA 2BRUA 2WYIA 3M2TA 1GQSA 4NS4A 5CG2A 4RNDB 1EH5A 1LDGA 2OV4A 2YY7A 2W70A 3JZAA 3AFOA 1AUPA 2JAPA 3FYTA 4X54A 4AIRA 1JU3A 5KYYB 2COKA 4BN5A 3ZWBA 3AL3A 2XMCA 1QAOA 2QRVB 2GDZA 2QYSA 1ZD3A 3TBKA 4DYDA 3MJSA 2ZZNA 4FMBB 1JJVA 3LM8A 4CLHA 5C5EA 2WSYB 4X9XA 3MS7A 5JECA 1R12A 4JI2B 4CN9A 3ZD7A 2QHXA 4KAJA 3ANMA 3VU9B 3CNBA 4FMCB 4KB5A 1Y81A 1YQDA 4MQEB 3AV3A 4JJEA 1KWGA 3BIJA 1DRKA 2C2XA 4ZEOA 3K0CA 4YCCA 2IPOA 1GJRA 5H9VA 1G8FA 2BEJA 4UE2A 1J0AA 4YGXB 3DO5A 3ND5A 3PF8A 1FDIA 2ZITA 2YHIA 4HPWA 4LIPD 4YMUA 5CDHA 4JWTA 4Y2RA 5L3QA 2O5CA 1DRUA 2LE0A 1DRJA 3IERA 3ZNNA 2BEWA 1JIUA 3GUVA 1MX3A 2FW8A 4BKUA 3KB8A 3BB1A 3SKYA 1OPXA 3SJAA 5K0JA 1I5RA 2O8DA 4LISA 5ECGC 4MP3A 5I4CA 2HZBA 1WBDA 1E9FA 2VHQA 2X4LA 1R10A 1AKUA 3LSTA 2QR2A 3NLLA 1QFJA 5K05A 1P2FA 3B2NA 4QNRA 1KZ1A 2Q4OA 3DD1A 1RZRA 4UHHA 3WK4A 1ZXXA 4D81A 4UHFA 3WLLA 621PA 1CFJA 5K3SA 4QRIA 2TMDA 3A4IA 3DPIA 3PXDA 3QXCA 1X80B 5CGQB 4AG6A 2IHJA 5K6AA 4W63A 4FKZA 3R0VA 2EBUA 3K31A 2B94A 4W5HA 1TU3A 1Z2OX 3E4CA 5MN4A 1Y1SA 2ZREA 1RACA 2DR2A 4MP8A 3MUOA 2HADA 2YZ2A 1QH1A 2YASA 3EN0A 3Q87B 4MVJM 3MELA 4WZ6A 3UCXA 3O4IA 4I5FA 4ENUA 5LQCA 5EIAA 2WE7A 3CE6A 1E8MA 1R8YA 4MQ6A 3JATB 1R27A 4O29A 3ZV3A 2QAJA 5CA0F 4IDGA 4OBBA 1J06A 1Q2XA 1XQVA 3D2BA 3K71B 4J0HA 5SY6A 5A6SA 1HTBA 3DULA 1NI5A 1NJ5A 1V2GA 2HA0A 3KJQA 4DR5B 1OKKA 2IHUA 4R2MA 1GQYA 1IDOA 1UAGA 1R9GA 4F0JA 1PQPA 5DGHA 1N2SA 4C6RA 1SQ0A 3UUGA 2C59A 1JXOA 5C8DA 1DJMA 4E2YA 1QVRA 1T8YA 2QMHA 3AH8A 4QYWA 3SOPA 3O3OB 3VR4D 4FOTA 1SWVA 4WLVA 4IX9A 1UBJS 3HA7A 3HRKA 3WBFA 3U5ZB 2CV1A 1ECCA 2OECA 1QYDA 4MWEA 2UYYA 4JQSA 5IG2A 4ALJA 5TGDA 4C76A 2OCAA 1K6JA 4PNEA 1RRPA 4F9GA 3MINB 1A0OA 3O9ZA 4QBFA 5TS3A 4UAGA 1E58A 3VAAA 4KITB 1D2CA 4CMGA 4CM1A 4BMPB 5LQUA 1JKJB 4FU0A 3EAQA 1LEHA 1RCUA 4HWRA 3RJ5A 4F1JA 4L6AA 3BULA 5L3RA 1DCTA 3GLGB 3O8QB 4TKVB 1T9GS 2DBZA 2OG1A 2FPPA 1V8ZA 2YJ4A 3AGPA 4X3CA 3SVTA 1EDDA 1OWOA 3IBCA 3B6JA 3T7KA 4BVKA 4LRQA 1RHRA 3EIOA 4XPZA 5EIWA 5FL3A 5C3MA 2E4UA 2R66A 3BK2A 1QRUA 2IIBA 3IELA 3R77A 2HT1A 5K3CA 3FBGA 3F6PA 1E7WA 1LS1A 5AJVB 1IHXA 1Y5LA 3HR8A 5AM1A 1NWHA 1GG9A 1JECA 3EOAI 5LZ9A 3P4XA 2X8WA 3INYA 4UREA 1L5HB 1L4FA 1N9GB 2WT8A 1CB7A 2A9FA 3GLRA 4JIMA 3RGWS 5PGMA 1LBSA 3UANA 1UK7A 4EW6A 3RTAA 5JYEA 4KFCA 4XQGA 2F67A 1U2GA 1MMFB 3F5DA 4IZOA 4R1SA 4LYGA 2VUTA 4EUSA 1EHIA 1PT8A 3EGWA 5KKCA 1SGWA 4IDOA 5BV8A 2VXOA 4HX2A 5E1DA 5D87A 3M70A 3WO0A 2DPGA 4QOIA 4H6VA 3G5MA 2I6TA 3CF4G 3FAKA 5H82A 5TIIA 4L15A 4ZVOA 2DTXA 5JS1A 3IAXA 5AKEA 4UPEA 3NOQA 5H0IA 2X9GA 4FYMA 1K6MA 1BGXT 2GRJA 3B1JA 4N7RA 5ETJA 3UICA 3WLMA 3HB7A 1QV6A 1U0JA 4FDVA 5FLYA 2SECE 1NHWA 4BIIA 2YJ5A 2HAEA 2AMJA 3OEHA 2HSGA 2Y93A 3ELWA 3RC7A 3FMVA 2RHWA 1QYCA 1PFGA 3AFHA 3SR0A 4AMVA 4LNUB 4QDJA 3SGLA 1Q5PA 2J5QA 3GJSA 1KIMA 1PV2A 3UCFA 1UWLA 1FPMA 1G17A 2AXPA 4IVPA 4YPFA 3OAAD 1F7VA 2J0EA 1I32A 4F2PA 2CMHA 4JXKA 4DQLA 1LLQA 3K5WA 1AKQA 4YV1A 1HNZB 2ZUCA 1MIOB 1A9ZA 3AILA 4V3BA 1PTKA 2GSDA 4NZ9A 4A26A 3HCWA 4GLOA 3BDVA 4Z53A 4C88A 2BMWA 2HCRA 1DBRA 1EXWA 3BFKA 3NPAA 4WFQA 5T57A 3FUWA 4X8MA 3VSBA 5IJ9B 2EW2A 1QQ6A 2OT3B 2ZOSA 4M1YA 4QBKA 3ROXA 3ZK8A 5KU7A 5TJ9A 2H52A 2D0OB 4GQBA 4CQMB 2OPBA 3GVXA 4RTLA 3F7MA 2PZEA 2XOXA 2Z3VA 2J31A 3COWA 4G07A 5FPYA 1L7PA 2CHQA 4B6EA 4ENRA 4XVCA 4YRMA 5L51A 4YRKA 3PSHA 1Q6YA 2UU9B 3ANLA 4DL9A 3OZUA 2I4MA 4Z86A 1K0FA 2I22A 1XTVA 2CNLA 3KLPX 4JFAA 1XNRB 1HT3A 4TX1A 5C53B 1NY5A 2H31A 1COWA 2JZNA 3EVBA 3NAQA 5E0KB 4AVYA 3ZXIA 2VYQA 3RUDA 5CNJA 1O6ZA 2FUG1 1DQRA 3Q9UA 3HJBA 1KEWA 4DJDC 3E5MA 4Z99A 2EYUA 3OZBA 1R18A 2FEMA 4JR0A 3VNQA 4HQRA 3BGOS 2CNDA 2A67A 3X1XA 4BV9A 3MCWA 4KXMA 4AKIA 4C0HA 1MW9X 3GCDA 1E9DA 2W6PA 3T9BA 4U63A 4F8YA 1VIAA 3WKDA 3TOZA 5GIPE 1X7WB 1FVFA 5FV7A 4EMUA 2A1UB 4ZI5A 4IIXA 5ES3A 5IC6A 3WLTA 4YMLA 4D3ZA 1BFKA 2ZATA 1F0KA 3TW8B 1HGXA 2VWGA 3C15C 3QKSA 1BHJA 1RRCA 1ZD5A 4PCVA 2B83A 2ECKA 5F3DA 4M37A 4D9BA 4DB2A 3CUKA 1OJLA 2C4TA 2WUVA 1PYOA 4PLFA 3U7QA 3U4MA 4KHPB 1CUDA 1JKXA 2AI1A 4TT3A 3RSHA 3BHMA 4C4YA 5TQ2B 2RGGA 2V6BA 3RYIA 3BS4A 4YO7A 4BGDA 1E0KA 3UMGA 1CUAA 1GPNA 2NYRA 4MR8B 3A4VA 4HWOA 1R8XA 4YIKA 2P3OA 4G89A 2VS1A 2J9FA 4X71A 4HK4A 1QANA 1A9RA 4EZEA 5LWQA 3V2GA 1EB9A 1IBMB 1K3FA 3U48A 4PYNA 2JFOA 3C1OA 3GFPA 3E7WA 2Z6AA 5FXMA 4ZU6X 4U7WA 5REQA 3NQ41 3K3PA 5EJIA 2QT9A 3W6ZA 3L3BA 3V9AA 2O2DA 1H8ED 1BO6A 2UZ1B 2WIJA 1TKAA 1OE0A 3BCUA 3C3BA 3KAJA 1HMPA 4OJYA 3ZD9A 5A3JA 3DEKA 3FMIA 1DV2A 2CZGA 1T2DA 3FDXA 5B1EA 1GZVA 3CRZA 2GTIA 2CFOA 2GCGA 4Q05A 1CQZA 2RFLA 5HFJA 3CKLA 4LK2A 5AVJA 4DNFA 5DE3A 4HNUA 1ESNA 1XQ6A 2QYOA 3L18A 5EEGA 3QVGA 2H2DA 1ADBA 2LKDA 4GOOD 4IF4A 2DXIA 2PGIA 2P7HA 4ARCA 5CYOA 4MYRA 3N8KA 2VF7A 2OQIA 1NAIA 1KMNA 3COSA 4W6QA 5J4YA 1PNRA 3G1UA 2XYPA 3OTHA 1P4GA 1DINA 1TZKA 2G1JA 4UPDA 9MHTA 3OD1A 4WOKA 5DHPA 4GDFA 4B43A 5K20A 3QY9A 5FUQA 3EY4A 2QM7A 1GAJA 1P4JA 3MLAA 4FGKA 2AOTB 3GQBB 4GLLA 4IFEA 1ZI8A 5HRAA 3AEQA 4QEDA 4PLVA 1EKXA 1DKLA 4E5VA 3AUUA 3IMEA 4O2BA 4PIVA 3KCNA 3VYVA 3KT6A 3B13B 2ZS7A 3GUZA 2GZ3A 3LUPA 4FEEA 5AWFC 3WB9A 5ESRA 1P7PA 1VMEA 2G0TA 3LT5A 4QBGB 1FTSA 2P65A 1E5LA 4M1QA 1H69A 5FO1A 1J97A 1OX6A 3PC8A 5ERYA 2Z8YA 3TB6A 1JHYA 2IVFA 4O8ZA 3AB7A 2QSJA 4WWHA 4JJAA 2AFIB 3UKJA 4X1KA 5BWNA 1MVLA 1Y9EA 1GRRA 1VPDA 2VTVA 4JOBA 5HE8A 3AJDA 3I4CA 3SYMA 5IU6A 2WTBA 5M7EA 4ZQBA 3T7AA 2Z6QA 3BZUA 4MRMA 2ZB8A 4CQNA 2JNWA 3KO8A 3KKEA 4BFTA 3I32A 4JSTA 2O23A 2ODBA 4FGWA 4OGGA 3UH0A 1TYZA 1PQUA 2NO1A 1FSGA 2MYTA 3E05A 3T9DA 4Q3DA 3WVNA 4Q3EA 5IJXA 3I8SA 1QYVA 4B3FX 1U0EA 3I5UA 2QVXX 3UM9A 1XD2B 4N8EA 4ESVA 1PZXA 1C7FA 4DSZA 2R6R1 1DO2A 1YT5A 2N75A 2QS9A 1SBQA 2LRHA 1H42A 5J2UA 2CFRA 1WB4A 4DCGA 3PC3A 3R3YA 1BCSB 4DY4A 3DEZA 3KOYA 5AVXA 3TLXA 2C4UA 4V1CI 3KTAA 3N0TA 2ZI4A 5CYFA 1KI3A 2SNIE 4S35A 1BVRA 4MHSA 1KP3A 5BN5A 2NZJA 3THWA 1OB5A 2P90A 2HXSA 1QTRA 3M4NA 2AZ4A 1WS6A 2B92A 3KKOA 4GZ3A 4GM4A 3U4CA 1XROA 1O03A 3C8MA 4M83A 3ILYA 5DH9A 4Y1EA 4HWKA 1OTXA 5K3FA 3ND7A 4WCFB 3GPIA 1AK1A 3PWKA 4DLZA 1EA5A 3QI7A 4GQIA 3JQ7B 2QMZA 4DZRA 2QM3A 5DN6A 4YRQA 5H3HA 4BEVA 3TX6A 2RCYA 4ZAGA 2IP1A 3SD7A 3EDCA 4DEXA 4F5DA 4G4SO 2PVCA 4TT8A 1F5SA 3C48A 5AM2A 3C6ZA 3CRW1 1SCQA 4Y8VA 4ZP1A 2VQEB 4N0PA 2P4SA 4KE8A 5C32A 3DO6A 3PT5A 5H3CA 1ID1A 3JQ8A 5GZ3A 3ZVNA 2PBFA 3M5PA 3EXIA 4Y2UA 2ZBDA 3VRHA 1QLJA 2P4QA 1SCBA 2FMKA 4FYPA 2RGXA 2RGUA 4AF8A 3NBUA 1ZVJA 2C03A 3CGWA 4LEIA 1RKBA 4Y0NA 3KELA 4BVBA 1GPKA 4GC9A 2V55B 3PFKA 1CULC 2Y66A 1AKMA 4MW0A 1VMIA 3ABZA 4MROA 2FSVC 4LMAA 2Z98A 5GJCA 3PLAE 3AETA 1AQ6A 1S1CA 3CVOA 4HZUA 4CLRA 1XV5A 2BI7A 3DV0A 4IJ5A 1W581 2VHYA 2WF9A 1F0PA 3AOEA 1KJNA 1T1JA 2FZGA 3IBSA 5LYJF 2BMAA 2YC2C 3OUZA 3T61A 1ZM4A 3VKHA 5SZIA 1Z5UA 4IDEA 4UDXX 1XQYA 1AURA 1MX9A 1VLHA 1MAVA 1WDWB 1JG6A 4UM9D 4ZJYA 2HMAA 4Z0TA 1Z38A 3WK7A 3ZCRA 5C37A 4WLEA 4WY2A 1SVIA 2ODAA 2B4QA 2EJUA 4V24A 5LN1A 2Z1MA 3LQQA 4F2HA 3KOMA 1FOEB 3PFBA 4HNGA 1RHMA 1ZINA 4GI2A 1ONSA 2H4FA 3ZE0B 3A9UA 5EZYB 3AXSA 1C29B 2WQ6A 3JYHA 5NULA 2CBXA 2WKPA 3MHTA 1UDCA 3WTCA 1DO0A 2H51A 1A95A 3NWBA 4ETNA 2C88A 1GZ3A 3I83A 3I4FA 3CNLA 2Q28A 5FBVB 2XECA 2HWXA 4K6KA 3ZDQA 3ZHOA 3MUEA 3TQRA 4MA5A 1C1DB 3E81A 3CX6A 3MF4A 1FP6A 2JS7A 4NOMA 4JFRA 1SKBA 1W0KD 2F1JA 2XGOA 1U7DA 2NSLA 5AKHA 3JQ9A 4MYUA 1FYVA 1RVV1 3ZKWA 1S2MA 1YF3A 3OF3A 3VH2A 4I6GA 3NT2A 4FFPA 2PUGA 1CQWA 1NYQA 4UUQA 4J7XA 4G4GA 3UGJA 3II6X 2WZBA 2ZR0A 3OZIA 3ECCA 4J1TA 2PBRA 4JC0A 4M0PA 4BMVA 3PNKA 4BKMA 1KXJA 4GMKA 2JFZA 5DULA 1KK3A 2WOJA 3LXRA 1IY0A 3Q3CA 4PPQA 1HFWA 3GGGA 3ZTYA 1KY4A 1XHEA 1G20B 4AC9A 1DIBA 3VXKA 3TFOA 2DM6A 2FPLA 3N5KA 1CSEE 2BBSA 2JPDA 4R2IA 1XNHA 1XDZA 3K0SA 2ANCA 4NE9A 4B31A 1IVSA 4ETMA 2C77A 3DFUA 4GI7A 4F3RA 4ZTZB 3LE8A 4RQUA 2MOKA 1E9BA 3VDRA 1SA0B 1LY1A 3GI1A 4GMXA 1S2NA 4E22A 4LNAA 4ADSG 5CITA 3DEFA 4DIKA 2HWYA 1ZPDA 1WMAA 4CV0A 1ZQ1A 2PXXA 3OM9A 1HSZA 1X1SA 4L16A 4M8KA 4A7PA 3X1DA 5IXSA 3CVVA 1DE0A 2AN9A 3MEQA 3HBAA 4DMKA 1X1DA 1O6CA 1RYFA 1RQNA 4YY3B 2Q2NA 1QH8B 4UEOA 2A5FA 1XAHA 4OA5A 4EKDA 5AHWA 1IHDA 4YYZA 4KO3S 4QDXA 2JIDA 2PSHA 4MVWA 3RK4A 3ELBA 2HLNA 4FXOA 1NOJA 3ZHUA 1E64A 3IT2A 1F2UA 4J0IA 4JB3A 1A2QA 2XB2A 1JIQA 2ZYVX 3FFBA 4R0NA 2PJZA 2WDPA 3GG2A 1GKYA 4N47A 3KSBC 4AJ9A 3MS2A 4R1PA 4HB0A 5BNWA 5JALA 1LJUA 5LA6B 2HSZA 1G5QA 2RHMA 4OHBA 1T4DA 3ANNA 4MMZB 5CLHA 3OE4A 4ZJPA 2WJAA 2BC9A 3I1JA 4LYDA 5A9RA 821PA 2BE7A 4TRNA 3MQ4A 4BTEA 3FG9A 3ZOKA 3Q6MA 1UCFA 3NXSA 2HJSA 1M8KA 4YLGA 5CJPA 1TUIA 4AMBA 4F93B 4HD8A 3MGBA 1EVIA 1OAAA 1TQ8A 1YHYA 3L8MA 2UUAB 4CR7A 1IM8A 2HMUA 3KJNA 1M2OA 2DQYA 5CDFA 3V9PA 2QDXA 3BMQA 4O4JB 3OLQA 3VZQA 1CRPA 1CR2A 1JZTA 1TVEA 3NHKA 5CT5A 4RV9A 1XCBA 1SVNA 3JQQA 4BN4A 2DWQA 2VNHA 3EEYA 4XGQA 5DHQA 1SD2A 1JX6A 4OI4A 4C7MA 5KO2A 2HBRA 1KO7A 4PS1A 5G0UA 3FNBA 2B5VA 2QTGA 1D6JA 2M6KA 1FEZA 3VSEA 4A8JB 1PNVA 2OAP1 1KYIA 4NICA 2PSEA 3NWEA 4P5PA 1JQDA 4N39A 4B84A 4CPDA 5DT2A 1T4MA 3CKYA 4GP9A 3SPXA 3VJKA 4CM9D 5I7FA 3RVMA 1XDWA 3NHMA 1T36B 1HK7A 2W98A 1HFKA 5HCIA 2GXQA 1XZAA 2O3JA 3OIDA 4F46A 4EY6A 4UULA 2GCIA 1GNLA 4ZMBA 4FFWA 2C9DA 3LPDA 5F77A 4RY2A 3ZV7A 3SX2A 1M1NB 3VC7A 1FS6A 4UARA 1FDTA 3CCCA 3UQYS 2YWXA 2V0GA 4UZFA 4C87A 4RADA 1Q2UA 5TF0A 4TTRA 1XCGB 4KIJA 1RRVA 4MS4B 4NBUA 4BO4A 1XKXA 4KAFA 2MSNA 3G2HA 3RHFA 2I33A 1QDUA 2YCBA 1V2HE 1QWOA 2Q45A 3M82A 1P9RA 1HH4A 1ZIDA 3K5PA 5ADUS 1X86B 3KB1A 2VPZA 4I46A 5I8PA 1KZYC 3CURA 4AIIA 4ZYXA 2DWCA 3O38A 1VJDA 4Y6SA 5DJ5A 1RQPA 3UYKA 4YASA 5HJ5A 3KQNA 1C1XA 5HOQA 1L2TA 2PZGA 3HYCA 4BFLA 2OD2A 4GI5A 2OUKA 2PNJA 2XUGA 4CCAA 3GJ0A 5KQPA 1ODIA 4M9XA 4BKPA 4TLAA 3DDSA 4RTSA 3I39X 3D5EA 2AHRA 3RYFA 1Q20A 3B7GA 3W2GA 4TOIA 4KR7A 1A50B 1AU9A 3WNZA 2NV0A 3NXKA 4UOZA 5DIFA 1FRNA 2WV7A 3Q1KA 2QRLA 5BW6B 2AKEA 2PUTA 3RC8A 1C0LA 2QN7A 3E9CA 4ETWA 3W9UA 3IP3A 1GL9B 4DEVA 3A10A 4QYSA 2PL5A 1W85B 3X2EA 4X24A 4LMBA 1FJ2A 1K8ZB 4RKQA 3IP8A 4HXYA 4GXQA 5DEOA 4ZVPA 2V5VA 3EIWA 4X61A 1KY5A 3TQHA 2G9ZA 4LJ4A 2W8BB 3Q5DA 5CPBA 1Y4AE 1VECA 2M1XA 3AOGA 2C2OA 1JXQA 1LV7A 2QRKA 3LCRA 4PC1A 3LX5A 3GZJA 3H4MA 4CYMA 1S3SA 5KVCA 3RLFA 4QODA 4G0PA 1E2EA 3EXG1 3OF2A 4RJJA 3W3AD 1CR4A 2DOKA 4R68A 3KSUA 4YRRA 4TVKA 4DQVA 4PLZA 4XIFA 2I55A 4LDQA 1OFUX 4BNUA 3F9IA 3VMFA 3NM5A 3QK7A 7REQB 1OZ0A 2JLYA 1M1YA 3G2IA 3UUFA 4GXRA 1RWVA 3LT4A 2Z9BA 4OK6A 2B37A 1P2DA 5IN5A 4EDFA 3GJQA 1DTWB 4TS9A 4FYKA 3ZCQA 5JPCA 3HJUA 1E9VA 1KQNA 2ZJZA 1R0KA 6REQA 4EJ0A 2GBIA 5CYGA 5AVRA 3PGLA 4OA8A 4YJGB 5JY6A 1IEQA 2CVOA 3GJYA 5KDOA 4MOWA 4GLJA 1FSSA 4EHIA 1D9XA 5EMMA 4PPGA 2FW7A 5I45A 5I9LA 3CX3A 1T5LA 4KO2S 2GPAA 3RNOA 1G2OA 2J9XB 1ENYA 4Y2QA 4AJNA 4ZGGA 4C6TB 2PUHA 4EKEA 4HWTA 1QLWA 2FE1A 4YI3A 4AQDA 1D4ZA 4M8SA 1SZDA 4RHEA 4ENPA 5J4VA 2BP7B 2PMCA 4RGBA 2IYXA 3CLRC 3HZHA 1T0JB 4ENTA 1OZFA 2OG2A 3ASVA 1IY9A 1CCWA 3L92A 3OIYA 1B23P 4O25A 4HXGA 2ERCA 2R8BA 4OKSA 4RF3A 2QA5A 3W4IA 1W36B 1QCYA 1CPYA 3V8RA 4BUCA 4G4SP 3HY6A 1WB5A 3UV6A 1N92A 2VP5A 3PF9A 3H9JA 4E3WA 4AP9A 5EE0A 1F2TA 3CRMA 4E0BA 1GGFA 2MSDB 4FR0A 3ZXXA 2IE8A 3OQ1A 1IZ0A 2JFPA 1IZ9A 1E5XA 1AKRA 3ZTTA 5EUQB 4E70A 3O2NA 2G1PA 4WT7A 4H1UA 1W4ZA 4GVLA 3ENQA 1S4MA 4Q1CA 2IODA 4XR9A 4IIUA 2AJCA 5JSQA 5JTTA 3N2ZB 2H8GA 1BX3A 3NAGA 4BZWA 3B6MA 3MJCA 1ICIA 3P7MA 2Q4TA 5T4BA 2Q5QA 4GVXA 3RQSA 2EWVA 4DIBA 2ZIXB 3EZGA 4I19A 1WKCA 2EBHX 1Y6RA 4RQAA 4F5YA 2UYHA 3NHYA 2HPZA 5EXTA 1NNUA 1H85A 2IIQA 1EFUA 2JCGA 2GOYA 3ZCXA 1Q92A 1IN1A 1M1XB 4MVJA 5GZ6A 3NVKI 3QNWA 4Y9RA 4DJEC 4FQ8A 3NBMA 2OAQ1 4N48A 1O95C 4AT1A 4D79A 4IVNA 3C41J 1D7AA 1V8BA 3MM4A 1WDLA 2BFOA 4IOKA 4L3OA 5D6NA 3FOBA 5E3IA 3TZCA 4ZDJA 221PA 4RQBA 3I01M 2WP8J 3OM8A 3FVQA 2C7BA 3HXKA 1SR8A 1V0JA 2LVBA 2Y2UA 3EGCA 4OG2A 5LMCA 4DZTA 2BSQA 1ST3A 2UZ4A 4DWWA 1BRTA 2V4MA 2Z2YA 3A31A 3CUEF 3RSQA 4B7UA 5HTOA 3O84A 1C7QA 1P3DA 2X9NA 2XB4A 4Q66C 1H5NA 4POOA 5KX5A 2ATEA 2HOQA 4MULA 5DHFA 2FEKA 3U4DA 1PZNA 1X70A 5AK6A 5AM0A 1N5MA 1GSOA 1IONA 1TF2A 1UPCA 4IICA 4MO9A 1W52X 2GEBA 3PTZA 4HNQA 3H5NA 4N6OA 5THQA 2RHHA 3RTGA 3ZK7A 4BVJA 1FSZA 4B47A 3TZQA 4RH1A 1Q0TA 1BD3A 1FRFS 3FD8A 3D8NA 4MI9A 5JCZA 5JQWA 4G56A 1WHSB 1W0JD 2Q7XA 2CHVA 1QBKC 3U0VA 1O9HA 1Q7RA 3QXXA 4YJ3A 1NPDA 1RQRA 2GX6A 5A0FA 5JDCC 3DVQX 3SG0A 2I76A 4G5SA 1P18A 2FSHA 3W5VA 4BE9A 3U39A 1ZJ6A 2WF5A 3KQLA 5IRCD 1HEUA 3ODGA 3KR9A 3SFVA 2FPXA 4BASA 2CXTA 4IWYA 3BMOB 2GXAA 4BP3A 2VRCD 4HZIA 1GCOA 3LKVA 2B5OA 4EFDA 3QF7A 4F71A 2P77A 2E37A 3CF2A 2IDMA 3IOMA 5JJIA 2JGDA 2P9HA 2ZJ3A 4E33A 4RSMA 1SVLA 3OT5A 4WGGA 4CDRA 3BJIC 3I3OA 3DTNA 1PT7A 4TYNA 2HJHA 2PUFA 4A0FA 3UMRA 5H16A 2H9AA 2ZETA 3D7LA 1YQEA 2XTNA 4XFKA 1Y4ZA 2R7KA 5LQNA 1RJ9A 2YOGA 4X1OA 4XTRA 3PNSA 3C5EA 4RM3A 2D0DA 1FJGB 4B3IA 1QKIA 3TMKA 3W06A 1VCOA 1N2OA 4ZCTA 5CB8A 4RULA 1ZN9A 3QIAA 3U9TA 4OQEA 4YWJA 4AN0A 4YUAA 1PCXA 1WLSA 1NHGA 3A9TA 1DIHA 3B5IA 4L50A 1SCUB 2EKQA 1FRZA 1B41A 2NP7A 5CB4B 2A9PA 4MICA 4EEXA 3RUAA 2V9CA 2QG4A 4R81A 5DM70 5IVHA 5LQSA 2H1WA 1FUUA 1T5IA 3ZHZA 2VL7A 2WSLA 3JWEA 2ZZMA 2OP1A 4GOLD 4MK4A 1G7CA 1E8DA 4ZA2A 4WBNF 1E2PA 3DW3X 3S6JA 4N9WA 2VF4X 1X38A 2IGTA 2NO5A 4KXUA 5AQEA 1AN9A 1C7RA 5H5JA 3RTDA 2H54A 2H2AA 1NJ8A 2Q1UA 5ER9A 4XOIA 3RKSA 3V8QA 2PX0A 1TNDA 1LXCA 2A0UA 4URWR 1XHLA 3DE1X 3DZHA 3PKZA 4LPKA 5CNKA 3BIOA 4EPRA 3O9VA 1KI4A 4OGFA 2IV7A 2IHZA 3EH1A 4I5IA 2YS6A 5IAEA 1CDDA 4Q4LA 3OCZA 1JPJA 3RVKA 5ADHA 4RTQA 2ZRMA 5FKJA 3TIFA 4DILA 3U7HB 1P2BA 4QHTA 3O8DA 3ADPA 4KQXA 5AVYA 2Z30A 2W2LD 5AK0A 4CCYB 4M0MA 4KZPA 5MDHA 1WOMA 2CDCA 1DXOA 3WIUA 3LO8A 5I48A 4M1EA 2OSVA 2BW0A 3AHEA 4WUVA 3EXG2 4UFOA 4XUEA 1HX7A 2PJRA 5F2EA 1NW9B 1OH6A 4MS3A 5HZHA 3COYA 4FE4A 1XVIA 4JUBA 4XGNA 3RSOA 4BDTA 1T4CA 2BH9A 2PJDA 2EW1A 3ZR4B 1YZVA 5B6PA 2G40A 3I9MA 4IXWA 1PFVA 3K4PA 1E7SA 1EA7A 4OQNA 3VR3D 4QWMA 1VIYA 1R6XA 1XTJA 1IRIA 2IX9A 3OCWA 1K2VN 1HF3A 4K9LA 1TPZA 1ZUNA 4IQ8A 4KX5A 4MGZR 2IXBA 1NM5A 2XIJA 3EUFA 2XHZA 3M4YA 1WO8A 3DCYA 5E4YA 2HNKA 3M33A 3VYWA 4UDNA 4E88A 2QLFA 5HJEA 2VQ3A 4D4IA 2I65A 2PZKA 4F4FA 1OAOA 2W6ZA 5F52A 3EXFB 3IE0A 4AKSA 4EEZA 1YQQA 1ZSNA 1H9AA 1NMQA 4FFNA 4N0DA 1RP1A 1OYOA 3MJHA 5JNLA 3MTDA 1FDRA 4FN5A 1L4YA 3CB2A 5DX1A 3T41A 4ZYLA 1I7LA 2P6RA 1TK9A 4GUDA 3GA7A 1PK7A 1V11B 5LLDA 4MQLA 4ZYVA 3L6OO 5JCOC 4BV3A 2ZCJA 3NGMA 1T9AA 4OQYA 4DDKA 2ACKA 5JADA 3QEMB 5LIPA 3IAS1 5JS6A 2PZFA 2WU0A 2ZSIA 4LSMA 3TCXB 3QPUA 1T2AA 1EWKA 3BA6A 4KIGA 4NIMA 2QPLA 3BQMB 4M1ZA 4QBTA 5DYNA 2JANA 4BN0A 2B82A 3QMMA 5K0EA 4U7DA 2PUVA 1M3SA 2XR1A 3A2KA 1HYBA 4OEHA 5TE9A 4YACA 4AG3A 2CNWD 1EZZA 2J08A 5DSZA 3OIVA 5CXQA 5JC1A 1XQWA 5JAOA 2P75A 4BO9A 3P5SA 1DRVA 4HT3B 4B3SB 3NHUA 2PX2A 2JGMA 5BNZA 1K4MA 3JWIA 1U2RA 2ID8A 5IDVA 1FSPA 1ZSYA 3F4KA 3M8KA 3ILSA 3NWOA 3N8GA 3OOWA 4Z9XA 2NU8B 4CLOA 1DC7A 4X3OA 1AQNA 4DG5A 1YOBA 1TGYA 2P9CA 3BORA 4LJ8A 1E2NA 1HT0A 3WIEA 3OLYA 1JG4A 4JVLA 1H6AA 4F4IA 2IDJA 1D2NA 1O0SA 3B9QA 4XARA 2Q7OE 2C4WA 1Y5RA 2P8SA 3KZKA 2JZCA 3DOIA 3H1FA 2IYZA 4MI3A 3SU8A 1SVKA 4AULA 2ZBPA 1VE7A 1JBQA 2PR7A 3JD3A 4COKA 5B1SA 1N25A 3AKZA 2ZUWA 2ZI9A 3MAGA 4N0MA 5T7BA 3FOCA 1KH1A 3JVIA 3KQVA 2ID4A 4MHOA 3RRFA 2I1WA 4HFNA 3ZE2B 3T7CA 5GONA 4Y2HA 1TCAA 3ZLBA 2ZS8A 2ZBVA 4E11A 3WQQA 3KQWA 5C46F 3E9NA 1C0EA 2X4IA 3MWGA 4UEKA 2MR6A 2FZCA 4PO9A 5EJEA 2I9KA 2I4OA 1D1SA 1NVFA 2DETA 4WERA 1DX4A 4W9RA 5DKFA 5DTEA 5ESWA 4Q4AA 3AKDA 4BFVA 2HX1A 3G02A 3GOHA 5H9WA 1JBKA 1II8B 1JLKA 1UJMA 2H1HA 1FFGA 1TJYA 2ZRIA 1VPVA 3OZAA 3TSOA 4C4OA 1ZCAA 2W6JA 3DOUA 4Q1VA 4W9NA 3WGVA 4NZYA 3SZLA 1F6BA 4MVXA 1KMHB 4MWSA 3TLEA 4B82A 3IXLA 1R9MA 4ED9A 1AH2A 1A8SA 1WM1A 1HDYA 1Z0JA 4CF3A 3W4KA 3FR7A 2B8NA 2D8MA 2FUKA 1GUAA 3QBEA 3BH0A 2H1IA 2O5VA 1R6DA 3FGPA 3V46A 1JB9A 2JRLA 4Q1DA 5FULA 3CTMA 2PS1A 3HCRA 1BDIA 2F43A 1WSDA 3LZ6A 4WY5A 4AUMA 1FXSA 2XJ4A 3OWOA 1NI4A 1TUBA 5CDFE 3JQAA 1Z6TA 3CVJA 4R3NA 3ZCUA 1SAYA 4C3ZA 4TWZA 2PT5A 2HEGA 4M60A 4P4NA 5CVVA 5HW0A 1RJWA 1AHIA 1D9ZA 3SX4A 1C3JA 3I2YX 3UJBA 3KAQA 3KT8A 3OURA 2P67A 3N3AC 1U0BB 2VNJA 5TC4A 1EFPA 1IOWA 1F3LA 3LUFA 5CA1A 1HTWA 1FTWA 2P6MA 1UAAA 2P2GA 3E5NA 1RNLA 1RMTA 4UASA 2R00C 2WUGA 4HAYA 1S3FA 1JEQB 3I64A 3TUZC 1Q3HA 2LUOA 3NCTA 3U13A 1YXMA 4A0GA 1DUVG 3UMCA 7MDHA 4MO2A 3OJ0A 1SULA 4LOHA 3HKBA 2ZTLA 1BQ4A 3FCCA 1OI7A 1XUOA 1C9MA 1RBYA 4YUVA 2EKDA 4D0NA 4FDMA 4REQB 3HRIA 1USGA 4QFMA 3L84A 4F9EA 1XF9A 3IBTA 4H6WA 1NC1A 1Y7IA 2X2PA 4E08A 4B71A 2G04A 4O2AB 2C8LA 4HDKA 1PSWA 4D3FA 4KHZA 4YNBA 1JYEA 3FKSA 2G83A 4LBWA 1DZ3A 7YASA 3KPVA 2HPAA 5DN9A 3JD0A 3U3KA 2DGDA 3LUCA 2FZ4A 1NG1A 1SQSA 2F9FA 1SRRA 2TMGA 3RVPA 1AQUA 1TYBE 2YIVX 3FTNA 1W1WA 3NMUF 4CV1A 1VL6A 2OR3A 1DJLA 2BUAA 2GASA 3LUDA 4ZWNA 4OBXA 1E3EA 1DEXA 1M7HA 4JI6B 1ZK3A 2LV8A 3KM0A 1THMA 1JHVA 1W5BA 4Z9YA 3HXMA 5C0OE 3I0NA 2OFWA 2C5SA 4EI9A 1O08A 1YB7A 4HYEA 3ZHVA 1O7JA 1Z5GA 2Q29A 1A77A 4G1BA 4RIEA 3ICQB 1TKRA 4NI5A 3GGJA 4ZQIA 4OP1A 3CPHA 4RZHA 4TLDA 4JXJA 1N77A 4Q24A 3TECE 3WGQA 1FMTA 1CQXA 4UTXA 3ZJVA 3PSAA 3GJXC 1ONPA 3PDIA 4K6HA 4BBPA 3D7SA 1KAEA 3H87A 3WGZA 3HVHA 4O4HB 2H0AA 2HA3A 2FR0A 3ELYA 4I14A 4B35A 1ZBQA 1PFYA 1X1BA 3KR2A 1RVDA 2F1KA 4QECA 2R5NA 5CX1B 2FCRA 3RWBA 3D4NA 3CLRD 4G1EB 4F6RB 1G6HA 4L75A 4BB0A 1JMYA 1CT9A 3AEKA 4FKMA 5THXA 4Z3KA 4NMXB 4ER3A 1G8HA 4G5FA 1DBIA 2D54A 2ASVA 2XLBA 2QJOA 3JQBA 4G65A 3WP1B 2DX7A 3JXEA 1I5EA 4H15A 4L8FA 4WK6A 3UXMA 5JT1A 1ICEA 2CVPA 3G9ZA 1FJHA 1FMCA 4PSUA 3H11A 4W7IA 2DLCX 1M1YE 3ZDZB 2VH1A 5T4HA 5CNMA 2Q5JA 1KTVA 2CXRA 1UP6A 2RGCA 2XB8A 2Z57A 3H5AA 4XDGA 3KZMA 1U1GA 1OWLA 2VK8A 3D59A 4YRBA 1MNAA 4HJXA 2WMYA 4FR2A 4Q02A 1F06A 2Q2VA 3EWSA 5DK6A 4E51A 4X7RA 5FWAA 5C7LO 2CB0A 3H9GA 2O2ZA 5IHXA 3SHOA 4DV1B 5KJCA 5ALJA 2QVBA 3WQBA 4W82A 4MR9B 3R9XB 3HCPA 1SO8A 3PQEA 1TEVA 3H04A 1I3NA 1TDJA 3JQGA 4IMPA 4E6PA 3TXXA 2GUGA 4TTVA 5AW9A 2VT6A 4LFAB 3S2YA 2OPHA 2A6PA 4R1LA 3AI7A 4JP1A 4QQFA 3L0ZA 3UB4A 1EQ2A 3AESB 2XGSA 5E95A 1Z36A 4JCCA 4GX2A 3CZPA 3UKDA 3WLJA 4F2DA 1ULBA 3UPTA 1KXZA 2AG8A 3PD0A 3GUUA 1JA1A 1K98A 3TD9A 3WA6A 4S2EA 4LJKA 4J29A 1TQ6A 2FPKA 4OBEA 4LXGA 4M54A 4DDTA 3AKCA 2PV0A 3EGVA 3NHRA 5JD4A 3NBYC 3FROA 1NXXA 4WZBB 3PDWA 4KGXA 5CFLA 2PWAA 4D26A 4LHEA 4DLSA 2IYLD 3PXUA 2O2CA 1NDUA 3FJ1A 5TMPA 2IH4A 2BGGA 2BF4A 3KJEA 3M49A 2OHJA 4G2NA 4CL8A 1X9HA 2H1LA 2BE9A 1JKFA 1H6DA 1NVBA 3IUQA 3MWDA 4OXKA 4OHZA 5DU2A 4NLLA 5HX7A 4Z3OA 3T94A 2QMEA 3OI7A 1HUQA 2O2EA 3SHWA 4E13A 1N0HA 1XAIA 2PUBA 1ZNWA 1NX6A 2PT7A 3KETA 2V6GA 4J4BA 5DM2A 1ZAKA 1R74A 2XUJA 3KKPA 5DBEX 1EFAA 4KQFA 4MVJE 3WYFA 1EVKA 4PM4A 5LD2C 1GEGA 2O8BA 4OATA 2PQ2A 2I7VA 1XZDA 2ZS9A 2IZ0A 3MWJA 3MWYW 3MT7A 4QX6A 3WMXA 1E2GA 1Y8QA 2JARA 3EODA 1G7SA 2E82A 1E2BA 2JD0A 3HZOA 4TGLA 3QIVA 2YVKA 3TCNA 1QX3A 2BFBB 2MSKA 2AYXA 4DT1A 1TO6A 3V33A 1YKSA 1BX0A 4AROA 2ESRA 3CX8A 4N3NA 4Q3NA 2GPWA 4C0JA 1ZNXA 3GLIA 2XWSA 3R0ZA 1O3YA 4YFVA 2C5AA 1SUEA 2JAQA 3BQNB 1I13A 3OTGA 4PGAA 2XYHA 2IEBA 4YDHB 2BZ0A 4M6WB 2J3KA 1ADYA 2BTOA 3C16C 3P26A 5T8KC 3FLAA 1JQAA 3SJZA 2KWIA 4MVYA 3ZJ5A 1VLQA 3DUFB 3UJDA 5CUQA 2P5TB 5L4LA 2YWEA 1EHYA 3CRVA 3NIGB 3OX4A 2OO5A 1FW6A 4YHHB 2Z04A 3C7TA 1TIKA 4JAVC 1YHZA 1C41A 1IEXA 1YBVA 2J07A 2G4CA 3MRSA 4R1NA 3EIQA 4TVOA 1PUJA 2H4HA 5KYNA 3GGCA 2HIHA 4NV1A 5A2GA 2ABWA 4PV7A 4P80A 2JRCA 4XLTA 4OK3A 1UMCA 3S1AB 4L74A 4DADA 3OCYA 3IQIX 1A8HA 4MB0A 1TRHA 1NMXA 4AJOA 1OX4A 3FYUA 5HK9A 3WMRA 1MAHA 1MC8A 1GGEA 4Q3CA 4LZLA 4HATA 4KPFC 3ZIAA 5KYWA 3NJ4A 1Z35A 3AUSA 1FYXA 3JD2A 4TUYA 2CVHA 3DXXA 4Y98A 4OKIA 1A5AB 4K2HA 3LF2A 3MJVA 3C87A 4H17A 4EHNA 3ZPXA 2V3WA 4DPMA 5BSGA 5HDQA 4P38A 4KQGA 2ZYSA 2VHUA 3GRKA 4NHOA 3CRNA 3SIRA 3AHHA 3H2BA 4AWAA 2BWJA 4OBWA 4QEZA 2ZSAA 3FMFA 3I9KA 3PEEA 4M76B 5FLEX 3TQFA 5C5CA 3UMMA 4P7GA 3JZIA 5K4HA 2BTEA 3CG0A 3UHPA 4G86A 1M8JA 4QRHA 4EGJA 1A2BA 1H65A 2I2BA 3E1KA 5FOXA 3LUAA 2L19A 4HBGA 1CVLA 1OYVA 2PUWA 4DPKA 1TYCA 1XU4A 4DIEA 5JTUA 4E5NA 3RC3A 1O54A 3VNSA 3CUTA 3EQ9A 3ZE8A 1XPUA 2QTBA 4UW9A 5FFNA 4UAUA 2IH2A 1N2GA 4QJIA 5LP6A 2OZLB 4R83A 4FXPA 1NRXA 5HF5A 3OPYA 1RI1A 1L9KA 1ST2A 3NATA 3TG8A 3O8OA 2H07A 3MXTA 4OY3A 3JD1A 4D44A 4R7ZA 2B98A 3SYKA 1JR6A 4M9SA 4ND6A 5KJ6A 4DV6B 1TMYA 3B78A 3URKA 5CIYA 5FPQA 4G8DA 4M0CA 1W94A 2IYTA 3V97A 3P9IA 4GUAA 3L7BA 5AW3A 4C0BA 5KAPA 1BMFD 4ZYZA 3G2MA 1LZKA 1AB6A 3GFQA 1RRKA 3R0XA 4J0QA 4DJTA 2ZB4A 1J4AA 1JQLB 3IJRA 3TVTA 1GYPA 2I3GA 3USZA 2F1OA 1YRQA 2EYQA 2PG3A 4DLKA 4B2LA 4D9NA 1QV7A 1YCFA 2PO5A 3QVUA 4FBGA 4I9NA 5J40A 1SVUA 2W6NA 4NK4A 3SEFA 1CEYA 3QOYA 2AE2A 2OLJA 3WBBA 2W2TA 1JTFA 3VV2A 4HUTA 2O3UA 3K53A 3ANTA 1DWQA 2A14A 2Y1FA 1XALA 1Z5ZA 4XWOA 3GZ4A 3EIHA 2C5FA 2MINB 4J0GA 3VKFA 4LAFA 2R65A 5A4KA 4GBJA 4MQMA 4CM4A 3PHBE 4AJPA 3T1QA 3VR4H 1U0HC 2GYVA 3KVYA 3GLHA 1MVNA 1XL1A 4FDTA 4Y9TA 2QX8A 2YV3A 2CXUA 1FMJA 4FSDA 4R71A 3T4EA 1XZQA 4K05A 2B9VA 2XDAA 4CBVA 5CIQA 4AG5A 1CU1A 1DS6A 2OHGA 2PGAA 3ZLTA 4DMRA 3ETDA 4K0KB 3QTLA 7ABPA 4Q12A 2BPOA 2GM3A 1Z18A 1RR6A 1T5BA 3U61B 3L7IA 1SBHA 3MB5A 1XCMA 1KY3A 4X94A 5DHTA 5BYKA 3SP1A 4C89A 3HXOA 4FM9A 3RVJA 3EHDA 4TQGA 2O6HA 1FUKA 2XSZA 1NBEA 4FLFA 5ALEA 4UJ3A 2NM0A 5BXQC 1XK6A 4NCIA 1Q44A 4L3VA 3WHPA 1SPXA 2PD6A 5L6LB 3OQNA 2R11A 3G9TA 1NLYA 4D3SA 3BDIA 4DUPA 5JPDA 2DT8A 1B15A 2O0HA 2BMJA 2WKRA 2Y0DA 4UM8B 1U0FA 2G76A 4LV8B 3UATA 1SC9A 2XRFA 3D3QA 5B4TA 3OSZA 2QW1A 2F48A 1OKKD 4IIFA 1W5EA 4OLAA 3FN4A 4QARA 4JLAA 4RKEA 2PSDA 5IKXA 4U2EA 4LHSA 3UMBA 3GT3A 4DLVA 1V47A 4L5BA 4FONA 2IU6A 4RZQA 4JJ6A 2G5TA 3DC2A 3DEYX 1SQFA 3FSGA 4QNNA 5AJYA 3OECA 1O1YA 4U1RA 2P0EA 5IT0A 1J20A 1IH8A 2J3MA 3B8EA 3I1YA 4PFQA 4RFLA 4Y6RA 5FTMA 4B6PA 3IILA 3A05A 5G4KB 1GL7A 1XRRA 3IKLA 3M9WA 3I8OA 5CMLA 4I3FA 4CIXA 3T5DA 1GWNA 2P9QA 2O9JA 1K6XA 4DC9A 5IZCA 2WNIA 2NWQA 3LBYA 1FTYA 2SCUB 2VZ8A 2I03A 4IJKA 4NJMA 5K4AA 3WOHA 4F3CA 4KPYA 1KMIY 4RK6A 2ILTA 4JV5B 1SCAA 5FR1A 2FW0A 4O2RA 3LBNA 16PKA 3JZMA 3A06A 4LJAA 1EWYA 4XB6B 2QAGA 5DRTA 5AOAA 1R8SA 3K9CA 4JGBA 2VTBA 4GBGA 3R4CA 1RXSA 4LY6A 1KJIA 1PTJA 1U0RA 5KNDA 5F9HA 4ALNA 2IUEA 3PR3A 2O7QA 4BWVA 4BU1A 2QQ5A 2ZJ7A 3KE9A 4D3XA 3T3OA 2AYYA 1V16B 3ESDA 4BTVA 3EXHC 1EGHA 2ZVPX 3GELA 2GM4A 1UUFA 2ATCA 2QD4A 4I66A 3E9QA 5EE9A 2GUWA 2JJ2D 3EDQA 3A0RB 4DV3B 1V7CA 2BEUB 1DOHA 4C7XA 1JE0A 2K6GA 1D09A 1OLXA 1QM5A 2O4CA 2RJNA 3FNGA 1G4HA 4C9BA 2HLPA 1R6BX 1VG0B 3S55A 2V1UA 3OZVA 1OHHD 1W5AA 3GFFA 3W6NA 3MK31 2XQIA 3DAOA 4IIBA 3SF8B 1I7PA 1I6LA 1WPXA 2PQ0A 3ZBTA 2R3SA 1M0TA 1F4LA 2X58A 5EEHA 3LCMA 5JNSA 3E18A 1LLFA 1QF6A 5I7UA 1ACJA 1VPEA 2RHDA 4YALA 2HHJA 3D3EA 1IG0A 2H85A 3AIOA 3NM4A 4L08A 1Z3CA 4ZRDA 2FMHA 4L8WB 2OXTA 4OYRA 1IJKA 3RRYA 5AM5A 4RH0A 3FDJA 5AVQA 3NX4A 3KKMA 4F1KA 1QIJA 1S0UA 1JKMA 2BGIA 3J7TA 4HR7A 1L7NA 1NVEA 3HB4X 4I08A 2BFEA 3E3OA 3PUYA 4UATA 1VYVA 2MSLA 1FVHA 5G1PA 1TJ3A 3U37A 3AVQA 5JSYA 3DFMA 2EXXA 1EM8A 3DOCA 3KYCB 5ESXA 2PLWA 4YRTA 3PFHA 3NBQA 4LJ9A 1E3TA 1I2ZA 1VHLA 4ND4A 4X62B 4U5XA 1U1FA 3QMVA 2I2DA 1CIJA 2X6QA 4WK4B 2FSPA 5FH9A 4RY0A 1Q1ZA 1X8XA 3RYCB 1OGIA 2FPRA 1SMKA 4ZOQI 1B1CA 4NFYA 4WNAA 5EJ5A 3GYGA 1FFSA 3EMKA 1HDEA 3WMFA 1V37A 4C4TA 1TCVA 4XRGA 2FE4A 5FUBA 3K1YA 3KXLA 3P8ZA 4D4LA 5CDSA 2GN4A 3FHCB 2J4DA 5JLAA 2G7MC 3G59A 3VR6D 4F1WA 5C8ZA 5KQSA 2AUMA 4BJHB 4UNRA 3F5QA 4PCAA 1BCRB 1KDYA 2FH5B 2OTCA 3FVWA 1VRWA 3O2SB 3CJTA 2OBMA 4ILEA 4WZAB 2VDUE 5BORA 1XI2A 2FP4A 2QGNA 1SXJC 4EHKA 2I2AA 4E5YA 4N5HX 2IUUA 1V1MB 1PJ3A 3RBVA 3IIJA 4WA7A 2X7JA 1JEJA 2LCIA 1YWGO 1FQWA 3IA2A 4EUEA 1IIRA 4MPPA 5AJWA 2WTMA 3DONA 5LQKA 3GAMA 1NMYA 4JI0B 1C3OA 4HEJA 2CF5A 4Y6OA 4QUJA 1COWD 4L27A 1Q1NA 2ETVA 3B6EA 3IDSA 5IASA 1T25A 4O4LA 521PA 4RNCA 5FI5A 2O57A 3ROPA 5F7OA 4BVHA 1XLTA 2OM2A 3I5AA 1E79D 1YS9A 2WF8A 3HEAA 3MPUA 2RHCA 3VVLA 2NU6B 1VRCA 1JLHA 1CEQA 2Q0QA 2QUHA 2IIVA 2OOKA 3WJ7A 1BDBA 1NJFA 2VNKA 4K46A 4P32A 2YJ6A 3RU3A 1JXAA 5F64A 1J8MF 3KX2A 1QYWA 2YRWA 4JB2A 1XXLA 2VAVA 3IGFA 3LWBA 4ZC8A 4GICA 1Z0KA 1GFSA 2ASEA 2O1EA 3GVHA 1KKUA 1PZMA 4IIDA 4TKLA 1QGED 4H1HA 3GRCA 1NP6A 2BGUA 2B21A 2AWOA 5JJLA 4PZDA 2BFFA 1YO6A 4IHKA 2R6HA 4CF4A 4HXFB 1QFYA 4WK0B 5G0TA 1QUEA 1ZK4A 4EKGA 1YI0A 3EA0A 2NTNA 4DCTA 4CTJA 4HFRA 4C0SA 2XA9A 4CGYA 5ESDA 2JJQA 3WGNA 2ZIGA 4F4JA 3THXA 3T5AA 3MWKA 1S02A 5TX7A 3JTEA 4KP7A 4R1QA 4QSHA 5AW6A 4H4DA 5EXSA 4KGZA 2B30A 2HSWA 3N74A 2R7MA 4XUDA 5GQSA 3HSSA 2F8LA 1KNXA 4AS3A 1ECJA 2HTEA 3B3FA 1TU0A 5AD1A 1ZUD1 2GKSA 4Y2PA 1X1RA 3H2HA 5DLDA 4OI1A 3TD6A 1PSDA 2QOEA 1BVUA 3TH5A 1JSZA 2RHJA 5J2UF 4D4HA 1JEEA 3AWIA 1J2YA 3HVJA 2AG5A 2X5OA 3KPWA 5DPMA 1O0CA 2B2CA 2C92A 1QGAA 1XNJA 4JEMA 2PRYA 3KU1A 5KTRA 5ICSA 2QRJA 4FWIB 2VYFA 3C2QA 5GOZA 4D8XA 3THRA 3H13A 1F20A 1TQ2A 3L8EA 1ODLA 1PR1A 3AERB 2ZRAA 2C2BA 2Y1CA 5LJLA 5C4MA 3M6XA 3L1UA 5JI3E 2FGJA 2A35A 5HZGA 1FNNA 1SU8A 4F86A 3D4PA 5F3WB 3AJEA 2WJ4A 1KYXA 3B5EA 4J0EA 1KYZA 1M2VB 2PVPA 2Z2XA 1MBZA 3AI1A 4FJ0A 4NYIR 1JHQA 4WKPA 2DUWA 1IBRA 4D57A 4CLXA 1DPGA 2IA5A 4RJKA 3P27A 1WG8A 1VSTA 4OHYA 2ANBA 2AQ8A 1F0YA 3NHSA 3RUPA 1CJBA 1QOQB 5F5NA 4A6EA 4MIOA 2BGRA 4EX6A 4QTUB 4TKMA 4MGIR 2J3LA 3G2NA 1JR4A 4FINA 1LSJA 1PL7A 2GD0A 4JJ7A 4U2GA 5G0SA 3DBIA 1R3DA 1U90A 1CWUA 3VAYA 5IT4A 2B6HA 1Q50A 4ARIA 3HZZA 1K92A 5DLEA 4TM8A 3UFXB 1FS5A 2JAUA 5FP0A 3V5NA 1WZCA 2WR8A 1UJ2A 4DA9A 1Z82A 2Q5FA 2XUIA 3FVTA 2VWPA 1QFXA 2V7WA 3O21A 1QGUA 2QLMA 1N3LA 3L6DA 3LI2A 4LMPA 3CNHA 1N6KA 1ZS9A 5CB6A 4XX1A 4M9QA 1RIFA 2C0QA 2IHVA 1ND5A 1WU8A 2AI2A 3KLMX 2D2IA 2WYHA 3OBIA 4KPGA 3KDSE 1DT5A 5I9IA 2PIDA 4JL5A 1UQRA 2JHPA 3RV4A 4RBNA 4MV3A 1Q0HA 4MJXA 4Y2GA 4GNKA 5LLSA 4KVFA 1Y80A 5H81A 5E6RB 2B8EA 5LQRA 1GQ2A 4U3JA 5DFAA 3OMWA 3PQCA 1EXMA 4KXVA 2VOEA 1ZH8A 3T8YA 1XD8A 8LDHA 3QBJA 3SS8A 3TAUA 4LZPA 5CT4A 2H2IA 3G79A 3HH8A 2VK2A 4IFBA 4OFBA 4OP3A 1HZZC 2VJQA 3CINA 3AR8A 1EIZA 5JAPA 1GG8A 3GJ5A 4OFZA 5TARA 4KN5A 4GGOA 3VKUA 3E2PA 2C9BA 1S1MA 3LQYA 3OHSX 1YB6A 1SOVA 2QN8A 1ORIA 4LRXA 3SDSA 4BNLA 3EPJA 3DD5A 1VPWA 5JVDA 1GYRA 4HRXA 2O8VA 2Y67A 1ZMOA 1CG6A 1E4YA 4BNYA 3HYNA 4JHLA 1XKQA 1PQYA 5FO0A 3QELA 4H7HA 4O1HA 5D3MA 4IIYA 5GOTA 3IUYA 3FNQA 4BRWA 5IZ4A 5IN4A 1P45A 4YPVA 1M33A 4TZKA 4DBLC 4UVEA 1B43A 2VJYA 4EGSA 1QHHA 4MR7B 2GF2A 3KLBA 4ZHQA 5KREA 2HZ7A 3AIMA 5L95A 3GLIE 2R6ZA 4HCJA 3HYLA 1XRSB 4NFLA 5I5GA 1ULZA 3DLTA 4LWOA 4IR7A 5LYJB 1UFKA 1XRQA 4P35A 3TM4A 3FPCA 3W8RA 1WPQA 4B09A 5DN6D 3ZH2A 1MC1A 4FYYA 4EYGA 5L3VA 1H6CA 5TT0A 3EGDA 3FZNA 1EWTA 2QXUA 3NB0A 1WSWA 1WE2A 4ZIRB 4J76A 5FCDA 4EJSA 4RL4A 1NJ6A 3R5HA 1DAOA 3TR6A 3PXCX 1ZW1A 1E2MA 4PG6A 4R5MA 3TJRA 4MW7A 4BMCA 4GL2A 1N2CA 5TPZD 4M1MA 2J3QA 3K8YA 1UPXA 4H77A 4RPGA 5DT9A 1Y8RB 3DS8A 3TL3A 1MQSA 2YHSA 4F4DA 1KBQA 3F96A 3BDAA 4C7OB 1VJGA 3RRXA 3FY4A 2DLNA 3PQ8A 2H4YA 4MCIA 2OV6A 3RJMA 1WXIA 3KKQA 4MW9A