1BWPA

Probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSAVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Probing the Substrate Specificity of the Intracellular Brain Platelet-Activating Factor Acetylhydrolase
pubmed doi rcsb
source organism Bos taurus
total genus 74
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1bwpA00
1Z8HA 3DC7A 1BWQA 4K3UA 4HF7A 3C1UA 4NRDA 4DEVA 2VPTA 4XVHA 4M8KA 2O14A 1YZFA 1VJGA 4LHSA 1ESEA 4HYQA 3PT5A 1DEOA 4Q9AA 1IVNA 1J00A 1K7CA 2Q0QA 2WAAA 4H08A 1V2GA 3DCIA 1ZMBA 4K7JA 5CD9A 4K9SA 4S1PA 4JGGA 1ESCA 4IYJA 1PP4A 3SKVA 1BWPA 1FXWA 1DEXA 2WABA 1U8UA 4Q7QA 2Q0SA 3SLRA 2HSJA 3DT6A 5JD3A 3MILA 4JJ6A 3W7VA 1VYHA 3DT8A 5BN1A 1WABA 4TX1A 1BWRA 2W9XA 2APJA 2WAOA 4JHLA 1FXWF 1ESDA 4RW0A 3DT9A 3HP4A 4OAPA 4I8IA 1ES9A 4K40A 3KVNA 4JKOA 5A4AA 1JRLA 5B5SA 3U37A 4RSHA 4OAOA 3P94A 3RJTA 3BZWA 4JJ4A 5HOEA 4PPYA
chains in the Genus database with same CATH superfamily
2C5AA 3FZNA 1W59A 3EPRA 3D4IA 3NI2A 3Q3CA 4CMBA 5HKOA 2P8JA 1TUEA 2PTGA 1JQDA 2HOQA 2JJ1A 3AYZB 4LYJA 4QQKA 1GKYA 4BKQA 4CEHB 4HAIA 1QGDA 4AN1A 3EXEB 4DR7B 2G1KA 2HNBA 2XUQA 4JYBA 4RGVA 1LNSA 3RI3A 1YJAA 3BMCA 4D9CA 1SC1A 1UZMA 4HDQB 5ALEA 2RGNA 4V03A 4Y1FA 1D7AA 1E7WA 4ARUA 5C53B 3M1LA 1BEEA 1Q57A 4JIMA 1J9GA 3KXIA 2HA5A 1UQRA 3AH8A 4HQ6A 3ANXA 3SGLA 1LSJA 2I66A 2WHEA 3A37A 1MP0A 3FFTA 1QH8B 2RKBA 5JR3A 2VZ0A 4F4DA 3LOUA 1ZN9A 1Z8FA 3CZCA 2F7SA 3ND7A 1LLDA 3BERA 4KBFA 5K0NA 3RCBA 3DE0X 3G5LA 2Y6UA 4OLBA 4QYTA 1FP6A 3I3OA 1EJ2A 3TD6A 1CUEA 3DEFA 4QBTA 3A1UA 2PXXA 1DMRA 2VDQB 2GA9A 4X6YA 2K7ZA 1GG2A 2ZFUA 5ENZA 4OP3A 3KCQA 5J47A 1CS0B 3VNSA 3MWEB 1OX5A 2YWEA 2QRVB 3IQDB 1B3BA 3LPDA 1SQ5A 5SY9A 3F2VA 4LJYA 4PV7A 1EFAA 2PUCA 4FD2A 2Q21A 4WKOA 1NQOA 3SQMA 4B6SA 4RVUA 4K87A 2P6PA 4LTNA 3ASVA 4HVTA 1M5UA 1ECFA 2PUEA 1XKQA 3TMYA 2G9QA 1I3CA 3RT7A 2QLBA 4GI2A 1RXEA 1Y6GA 1Y4DE 3I1YA 2C5EA 4JT4A 4KU4A 1QO0D 3HABA 2O7QA 4PVCA 5K6AA 1NW7A 1YDEA 2W98A 2WNSA 2VVTA 3QVGA 3O82A 4C6TA 1OC4A 2XQJA 3ZDZB 4BX0A 3OQNA 1YOVB 1VBNA 2X3UA 3I05A 1R4MB 1S02A 4D98A 4GZ6A 2CUNA 3QPWA 3ZU6A 1A2QA 1YMUA 2J08A 1EGHA 2GD1O 4YDRA 5A02A 1X7WA 1FFDA 3KBBA 1V26A 4GLBA 4D41A 4PAGA 1IHXA 2ODWA 1OLXB 4G1UC 1Z2CA 4QUIA 4FDTA 4GI1A 1T8UA 4BGUA 4OCZA 3B53X 4HAOA 4XQ9A 5DK4A 4F9EA 2IH4A 3CM0A 1R6UA 1GPWB 5IWCA 4C4ZA 4IUYA 3QVTA 2GF0A 1OQAA 4X60A 3AYXB 4PPQA 4HWKA 2FZ4A 4MUKA 4XQGA 4D3YA 1RBZA 5AXBA 4WFQA 4QHYA 2NYVA 5EI5A 5JZ9A 1M72A 1U65A 3KOOA 2I22A 4YJ3F 2VQFB 4O3FA 3SZLA 3TFWA 4PBRA 1I3OA 1PT5A 1W1IA 1Y8AA 4MHOA 2XMPA 3VZPA 1KP9A 4G25A 4UUAA 4EGFA 4UU1A 4M76B 1R0XA 4I99A 2OWDA 3JVEA 2ODAA 3ZDRA 1WPGA 5K8VA 3S8YA 3EY9A 4CHTA 1ZN2A 2XB8A 3KEQA 2HQRA 3KHUA 3BMQA 3FLBA 4IGEA 4OYLA 2C7PA 4V02A 3CS3A 3RO7A 5EP1A 3NIGB 1B8UA 2BUBA 2P7IA 4QJIA 1YZQA 4LRSB 3BRWD 3SDBA 3R09A 3KUXA 4MVJP 4B7CA 4NLLA 3HUTA 3WMWA 1DRVA 3TQFA 2IXTA 4CUJA 2HNAA 4CKXA 2OHHA 4XDZA 5IJXA 1NE2A 2Y92A 1GA4A 4XA8A 5HF5A 2QL5A 1PJBA 4FC6A 5BRNA 3ZDCA 3CUYA 3FPJA 1WUKS 2GWRA 5KWEA 2YOFA 2DCUA 3CURA 1TF7A 1RPZA 1JFSA 4HS9A 3VDXA 3NHFA 3W6PA 4IOKA 5KVCA 1L8LA 1RXYA 3CX3A 3OD1A 2ZRBA 4Z0NA 1KYIA 3BEOA 2J9FA 4BZQA 2VJNA 3EVDA 1RIFA 4BASA 2PX4A 4I1SA 1XE3A 1B6GA 4QICA 3RIXA 1U8YA 2BFMA 2PQ0A 4MSUA 5GJWC 3HO1A 3E2MA 4E32A 3GLRA 4IBOA 2YYAA 3MJVA 4EZIA 2BUAA 3PNOA 2AXEA 3FZEA 3HJAA 5C32A 3Q40A 1DAMA 3K6JA 2VQSA 3O1HB 4LHVA 4LOIA 4X93A 4WY2A 3RSFA 1QIKA 1NL3A 4NQRA 4K6GA 1YZKA 2R7KA 3UBMA 4UBMA 2XDWA 3IPAA 5JCZA 1U7XA 1SVIA 2HH9A 3EJ6A 3H2JA 1OZGA 4JXZA 1PZFA 3DHEA 1ZK2A 3VOAA 3QVMA 3WLNA 2WWFA 4ZK2A 3GZ4A 3AJ9A 3T7AA 4UUOA 3F4KA 4YV7A 4INOA 1DAGA 3NWEA 3MTEA 5I9MA 2WQ6A 2GD6A 5FPQA 4IDHA 1NASA 4EENA 1J8DA 1M2EA 1PJ4A 1DRUA 3I53A 4HQOA 4QVIA 4DRXB 5C80A 1ISFA 3RK1A 4LYEA 1M7HA 13PKA 3WQQA 1S3FA 4JIGA 4DXAA 2C58A 2HM7A 1LBSA 1LBTA 1HT3A 4OV6B 1H2EA 1JR3E 2PRZA 4XUCA 4AG3A 2B25A 1PVOA 4RWEA 1WBDA 1ZNQO 3FYCA 1Z6TA 2BGKA 3EZ6A 3CRRA 4C7OA 2VNIA 2ZKIA 3PL1A 3QNWA 4MVJI 1N5OX 3EN0A 1E98A 2YL2A 4CL3A 4EPTA 3AIIA 4YAKA 1MW9X 4CXMA 3TUJC 2ZXEA 2FRVA 4GL4A 5E9QA 3MS4A 2YWDA 4OYYA 4L0DA 2Z5LA 1VM6A 2FLWA 4IF4A 3ESYA 2QTHA 5MFPA 2P0AA 3UJ6A 3ZJVA 2GCPA 3BTOA 1G5QA 2RJOA 2Q9BA 1FJXA 5FWYB 3KT3A 1KOFA 1R8QA 2Y71A 4JROA 1NXTA 3FGPA 4PX5A 1G20E 3B52X 1OGYA 2ZBUA 3VHLB 2QF7A 2ZEJA 4GZLA 3H2KA 1E58A 4PQGA 5DNDA 2BTQA 2WVAA 4JBLA 4ZC1A 4CG3A 5AW1A 5KOHA 1T8WA 1RNLA 3UW1A 3UHJA 1FNMA 1OXVA 1JKXA 3O95A 4KFRA 4A6XA 1ZUHA 3GA0A 4EJMA 1P0CA 1HG1A 1QIIA 2IL1A 3ESBA 4PWYA 1O8BA 5CM2Z 4KOEC 3HP7A 1NYRA 4NFYA 2VJOA 3H8WA 3HJTA 4N1AA 5AK5A 4JQZA 4PPYA 4Z2YA 3B1XA 2ZUCA 3NTLA 4AMZA 4YRSA 2CLDX 4JDPA 3B7GA 3INYA 4L8LA 1JNXX 1CP3A 3RAPR 4G8DA 1TK9A 2RGEA 4GQAA 3RBXA 3O4GA 3ZE2B 3DOHA 3L6RA 4K88A 2WUEA 4TMWA 4LYHA 1ZH0A 1KK2A 5DM0A 3CW2A 2BFOA 4IXDA 3C6ZA 3BHIA 3N2IA 4U7JA 3D8NA 3TRIA 4BX9A 5FJIA 3AJEA 4BWVA 1N6PA 1SH7A 2GVDC 2TS1A 2QLNA 1ML3A 4M8KA 1QKKA 1TCCA 4ZQFA 1CZRA 1O1YA 1T4CA 4PZZA 1I2DA 2ZRMA 4GICA 3PP8A 2JK0A 5ABPA 5C51B 1NAIA 2FPLA 2NACA 5IPFA 4HN4B 2PFSA 3R75A 4OJTA 4GP9A 1KI2A 5GOZA 2F1IA 1V37A 2GLUA 4JT9A 1LY1A 1BE8A 3FMVA 4JU8A 3KE9A 4N5HX 4Y2PA 2GM4A 4NBWA 3ZTYA 5DVZA 1WTCA 2AE1A 1U9CA 4HT3B 5GJBA 3QKSB 4QQ8A 1V8PA 2YKGA 1NW3A 3QFSA 4J7AA 1KC1A 2BLNA 1G5HA 3RRNA 4RK0A 5EMLA 5B6JA 1HBJA 1SK9A 3LLUA 3U7IA 1KRXA 2WU8A 1DV2A 3HO8A 3T5TA 4QPZA 4HOYA 2AOWA 5IDVA 1YVPA 1K8YB 4FS3A 1RS0A 1UBKS 2IOQA 3OCYA 4KMMA 4L8YA 4BQPA 2QTBA 5C8YF 1IFXA 1E8DA 1VLVA 2ETVA 2GHRA 4RCVA 3D5QA 4J03A 4ESVA 1ZRSA 1QGOA 4RK6A 4XLTA 3Q2OA 2UZ1B 2WKWA 4MP6A 2HK8A 2ID4A 2ECQA 3NNSA 4HJXA 2A3RA 2NUAA 2WP8J 1K1EA 3EWSA 2JRLA 3L1JA 3I9V6 1ZVMA 3RYTC 2BP7A 2RBKA 3CH6A 2HR1A 3I5MA 2WWTA 4WNAB 2WYHA 5DCYA 4RZXA 1QPZA 1CU1A 1UXKA 1UP4A 2HU7A 3FTCA 5DK6A 4YAWA 1A5SB 4YJGB 2JFGA 5C7LO 3PEWA 1GPYA 2BOVA 2CHGA 3AOEA 3JQCA 3IYLW 3OT1A 4KPGA 4OLFA 5ARDA 3MB8A 5EQDA 4DN6A 1LV8A 2P40A 2QTFA 4ITUA 4G1FA 4OHKA 1K66A 4H1TA 1MQAA 5BNWA 1US8B 1QHSA 4KQEA 3SVTA 2FJ0A 1SC3A 4HBZA 4Q37A 1EWVA 3M6XA 4HEA1 4RDIA 4MQEB 1E2PA 3ESRA 3IQZA 5CIQA 4D8YA 1KZ9A 3KC2A 4OO3A 4TSKA 4DKJA 3RODA 4FFBB 3FPAA 3KFVA 1N0VC 1G8MA 2SICE 3TZCA 3JYOA 4HPJB 1THMA 3AU8A 4KRGA 3F97A 4Y7DA 5EWJA 2V7WA 3TZQA 2A5DA 2PSEA 2XZPA 3OKCA 1Z0UA 1Z6YA 3U1VA 2JH9A 4QE3A 3U4CA 1QJCA 4HGNA 1DV1A 1D4FA 4FIDA 1DPFA 5EXXA 5CH8A 1JVBA 2P3QA 4EHHA 3HXQA 3FOEC 1BMTA 1EWRA 4AUKA 1E1RD 4JBYA 3NS7A 3Q4GA 4G4SO 4OQMA 2FW7A 3E9ZA 5EIAA 1H4SA 1KORA 4DLKA 2C4HA 3Q9NA 2B8NA 2L69A 4XWOA 3IULA 3L84A 1BE0A 4XKJA 1ND6A 2FGKA 5HCUA 3K4QA 1CR0A 3MTBA 4L1KA 2FR1A 2ZITA 2RARA 3ZHYA 4EJ2A 1O6FA 2QQFA 3RROA 4F1WA 1QQ7A 2YW9A 2HBQA 5AI5A 3QE3A 3ZXXA 5FQNA 1ZQ9A 2XCSB 3QHPA 2BN4A 3WQHA 5TY0A 1NTRA 3L7BA 1JBKA 3ORFA 3QNUA 3GRUA 3CBQA 1T4BA 3V7NA 3PLNA 1Y7HA 3HCDA 4JNKA 3OE5A 4MUEA 2ADOA 3VX4A 4BP3A 1Q2UA 3WAKA 5HJ5A 2QRUA 1NU6A 3KYIB 4J0EA 2RGNC 4KQ2A 4MRMB 3E9YA 3ICVA 3IQXA 2Q0XA 1T8SA 4MKHA 2NUTA 1I6KA 2CB0A 2FZCA 2ATXA 2Z98A 1JR3D 4UVDA 4Y1GA 1EXMA 1J90A 1E1YA 1JXQA 1ZVKA 1ODKA 1SNYA 1U0JA 2FUG1 3CQ9A 3WNDA 4ZI7A 4I4CA 4CF3A 1DTWA 4U39A 2YN4A 4EWLA 2QN1A 3ENWA 1FNSA 1QHHB 3V8NA 4L95C 4L9WA 3WIOA 3JSXA 3PC7A 4OHUA 4N5LA 2DP4E 3SX0A 2OFPA 4DFDA 2RH9B 4NL4H 4ARAA 1KMHA 3FAKA 4HCJA 2CSUA 3NIDB 4B6OA 1HV8A 5TARA 1OIXA 3ZIDA 1H2FA 1KOLA 1CY1A 4OJYA 1TGVA 3KLNA 4PLCA 2H00A 4DCPA 1ZZGA 5DBEX 5JG7A 1JECA 3KTFA 3WL6A 2ZU6A 3JQGB 1P75A 1A95A 2WUFA 2NP7A 2VXYA 2AYYA 3C1AA 3K09A 4RGQA 2VF8A 2ZDGA 4N7MA 4TXLA 4W1PA 4F04A 5KU7A 4MRSA 10MHA 4JLNA 1L4LA 1UC9A 2H9AA 1E7SA 4MZXA 5KVAA 1U0LA 2NGRA 2EDCA 3A9CA 4JQSA 4XRGA 3DB2A 1ZOLA 1MRZA 2IHTA 2I76A 3OURA 1S4MA 1TW2A 1Y7TA 2FQXA 2PKEA 2TMKA 3M81A 4MR8A 2QTAA 1YS7A 4NZZA 1OXTA 4UUQA 1R4NB 3ORSA 3WYEA 3ADPA 2XUKA 4RVCA 4D9IA 4G5XA 1D4ZA 2LZ0A 2YFKA 2WYUA 4X8MA 3LT4A 1XR3A 2CBGA 2OC9A 3PB3A 3T8YA 4Z9YA 1KJIA 3V80A 3VKVA 4C3UA 5K0GA 4EAAA 3I32A 2WC1A 3UK7A 3QX7A 2M2IA 3CNBA 2HLDD 4LC0A 4PYLA 3FPKA 3W5HA 5JH7F 2LGJA 1T25A 1WUIS 4BO3A 5CLFA 2FEKA 2IS4A 3FE2A 4I1OA 3EW9A 3O2QB 3U1TA 3ZY4A 1R0CA 4JL6A 2IF2A 2PYDA 3HK2A 1N5IA 2A7XA 3DDNA 2EQBA 1N9ZA 1WLYA 3KKQA 1B0ZA 1B76A 4MK4A 1SG0A 4UTNA 3MS7A 3FHTA 1ES9A 5KTKA 4K40A 4M9XA 1VZ2A 1HYHA 2W70A 3SZMA 3AF6A 1T0PA 4Q9IA 1X7DA 2C4WA 3WOVA 1AF7A 1KEPA 1UBHS 3FTEA 2VF5X 2A2ZA 3ANSA 2PFKA 4YCBA 2IYWA 3HNOA 1S6YA 3LAWA 1Y1QA 2WUDA 1RT9A 2V59A 4RLSA 4N3CA 2GKOA 3A3YA 4QBHA 1F2UB 1DG3A 1ZNWA 2V7BA 5A9SA 1LQTA 1D1TA 1RLTA 3DC7A 5EIOA 5FUMA 3RS8A 2EV9A 4WECA 1BFKA 1IMOA 3D0OA 1AUQA 2QRLA 3TRJA 1DDIA 4S1TA 3BE6A 1AUVA 2HK9A 1M76A 5F2KA 3H19A 3TGLA 1SUDA 3MELA 5K7SA 3SDSA 3FCSB 3MA0A 4HDOB 4ICIA 3VH4A 3KOUA 3GB9A 4OUDB 3PQ8A 5LWHA 2BE9A 4DV0B 2OCKA 4FSDA 3VYVA 4M0KA 2IDMA 4OB6A 2WFMA 3TB6A 3RJ9A 1N8NA 4HQLA 1LJUA 1HOTA 3MTGA 4U5QA 3NIWA 3EXIA 4QTTB 4ASUD 3GEBA 4A8HA 2OBLA 3ROTA 2WD7B 2P9EA 3I83A 3VTFA 4B4VA 5CEJA 2CJWB 5DI3A 5FI3A 3FJYA 3S99A 1YB2A 5HK9A 3CYFA 1EP9A 4BNHA 1S8NA 2YWCA 1QFYA 3GEGA 1D6MA 1NC3A 2YWFA 1TVKA 4K9KA 4KPUB 4KQMA 2Q7OE 4BKPA 4BVFA 5DHUA 2XOEA 2H0RA 1IOVA 2H51A 2HCBA 3KT0A 2GO1A 1ONOA 3B70A 1CZLA 1G5FA 1POWA 3EVZA 4GXTA 4HWTA 1Y7IA 3U3XA 4FFMA 2E1RA 1ILWA 1DKRA 1HH4A 1VCIA 1KAEA 4ZIRA 1LX7A 3KB8A 1Z6QA 4JD5A 4NU5A 4IGAA 5AOAA 3T3GA 5U1PA 2O7RA 5K8UA 4PHFA 4EIWA 5EE9A 5TEWA 4G4GA 5ISMA 2VQ6A 1ZK3A 3P2OA 1GNPA 1GZ4A 1UAGA 4Q3EA 5F1PA 2AG1A 4IQGA 1RE1A 1H4VB 4NDNE 3ISJA 4IILA 4AKHA 4HWSA 4MGKR 2DFNA 3HJGA 2AFHE 1L5SA 2XYGA 5BRAA 1S7CA 3ZNQA 1JG7A 4DDWA 5ESRA 3ZBTA 2WPDD 1DFIA 1JIJA 3KJGA 2MSKA 3LGSA 5IP5A 4PBSA 1PL0A 1X87A 1JDVA 2V9ZA 3E2IA 4Y2TA 3R3SA 3C6BA 3DZCA 4DZTA 3PDJA 3FDFA 5CT8A 1NVXQ 4C2TA 4OREX 3UWOA 2JLVA 1DEAA 5FHRA 2FSUA 1T1IA 3CRW1 3N0XA 3DEKA 3V8VA 3K9LA 3FWKA 2I7TA 3QE2A 2C54A 2ZJFA 2ZJOA 4H17A 4H1UA 4JOBA 3KVOA 4LJ6A 5DNEA 2XAAA 5L4SA 4AN4A 4KXXA 4ID3A 3NORA 5EIWA 3UT0A 3R7LA 1PG0A 1XVVA 3VSEA 2ZI9A 1J0BA 3MJFA 4RIHA 2VRNA 1L5WA 2I7DA 3TX6A 3UNXA 2H3EA 2Y1FA 4IWNA 4UZSA 3OD5A 3DA8A 3PNLA 1DZIA 1C81A 3ECAA 4HB4A 3U7EB 1RYYA 3VU3A 3KVNA 4TTRA 4XOUA 3HU5A 1H0SA 3OY7A 3T3DA 4ALLA 4ARBA 1REQB 2G9UA 1VI5A 3CUSA 1PF7E 2C4UA 3UAOA 4PGMA 1L1EA 2PUJA 1IB0A 2UVQA 4PLPA 3RB8A 4DAOA 1H3NA 2EWMA 1EXNA 2WYVA 1QQ5A 4ZVSA 4EL0A 4EW6A 1DVRA 2IODA 4AO7A 4KO1S 1CQIA 4M7WA 5ALYA 4NHEA 1QP0A 2B3TA 3N70A 1WXWA 4C87A 2YXPX 4DC1A 1C30B 2XWPA 3IDOA 2CNWD 2PWYA 5JHGB 1TA9A 4LIPD 2FEAA 2A1TS 3AKZA 2PE5A 3KKEA 4EVSA 2NLOA 1SHUX 2JGLA 1JUDA 2Q46A 1TAQA 3K16A 1MH1A 2HNKA 5DGIA 1ZGZA 4P93A 1APBA 3MCZA 3NBYC 4U2GA 4B6JA 2B8EA 2REQA 4PLFA 3E53A 3KZOA 4UBLA 4BNDB 4QYMA 4J4TA 4RH3A 3HZZA 3K0HA 4JYAB 2GYUA 3EBOA 4HEHA 2J7KA 1CY2A 3A6EA 4IIBA 4LFCB 4P31A 2B0CA 3GU3A 4MUFA 1PU2A 2C7BA 3EVGA 2FPSA 1G19A 3JPYA 2PBFA 4NBUA 2XBMA 1NONA 3DQZA 1EX9A 1RMYA 5E1MA 4OP1A 1DJMA 3AVWA 2XRMA 1YC2A 5BSUA 5CFOA 1AA6A 4YRRA 1GPNA 5D3MA 2WU0A 3L8EA 2AG8A 4KR2A 2ZUSA 2RAVA 2YFQA 3CF2A 4N5DA 1E18A 2X4LA 1XU7A 2B35A 3H83A 1SQFA 2ZUFA 2WOOA 4NECA 1FP7A 4CG2A 1WBBA 3EVCA 3C2QA 3LZDA 3PTLA 2C5HA 2VHYA 5KYVA 2JGKA 3L8DA 1ADCA 1J70A 3T7SA 2WTUA 2RK6A 5CFPA 1NR5A 1P2GA 4MVYA 4ZN6A 1W6UA 3QEJA 2Q5IA 4GL2A 5L9AA 2XTNA 1GQSA 1VPWA 1WHSA 1BIFA 4DA7A 5CX1B 3DNMA 2GI4A 4H9GA 1PK9A 4F2DA 2A7QA 1YDWA 1C7EA 3F6RA 4AJNA 2XVYA 4F4FA 3F6PA 1Y33E 2ZKLA 4QJ5A 2A33A 3H5VA 8OHMA 2J8ZA 3PQ4A 3ZHQA 1P2BA 4EPWA 1X7XA 2GAOA 2ZBFA 4L73A 3ZU5A 4G5SA 1HY3A 5KYTA 5LFAA 3ICCA 4L76A 3GRZA 3DKVA 1SWVA 2AC7A 4HFNA 4NJEA 2FZ5A 1O03A 4QJ4A 4MUBA 3UVEA 1TVMA 1M6EX 1HMPA 2CEKA 4TMKA 1N6OA 5AVYA 3BG5A 1S01A 3X1YA 4CI9A 1QUEA 4B9AA 5KYGA 1H9BA 1P4HA 4BMZA 1NKTA 1H66A 3EY4A 3KKLA 4QSMA 4Y1RA 5I4BA 4PIMA 4US1R 5IN4A 3O3NB 1PJTA 1M34A 3VDQA 2ZJ0A 4LHXA 2CEAA 3ZWDA 2EZ9A 5IF9A 2J31A 1F0KA 1LUAA 2VLBA 5DGHA 1M7BA 4ZCTA 2BM0A 2XWQA 2O05A 3ULKA 5LZ8A 4EHLA 5FLKA 3AOEC 4J2HA 4AICA 1NKVA 2FPIA 2OCIA 3P4XA 3P4YA 2LKCA 1PYOA 1P2TA 2BFAA 2AFIE 5EJMA 4YONB 5I9LA 3AVXA 4MQBA 4CKBB 3EXHA 2L19A 2PIDA 4B45A 4ZDJA 1N2EA 3IKLA 4I8IA 1RWXA 1UFQA 2WSYB 4DY6A 4Z7OB 3ZD6A 4NBNA 4I1VA 2AK3A 2IZOA 3ZKWB 3RYCB 1TECE 1ZUIA 4XGQA 2DT8A 2BM1A 4FGUA 3RUHA 4DREA 1J2RA 3HL0A 1SOUA 1USUA 4KR0A 4TWZA 3V8PA 1I9CA 4B5LA 1BH2A 1QC5B 2A35A 5ED4A 2Z1DA 3G6WA 3LHKA 3MTDA 1OY1A 2GH1A 1TJYA 1P18A 3OTQA 4JEIA 4H1HA 3VSDA 3KZKA 1PQPA 1RMTA 1GUZA 3KVYA 3WE7A 1E6KA 4D9JA 2XZLA 2GHQA 4M98A 3WGQA 2WF5A 1EESA 2YRXA 4ESEA 1IHOA 1Y3AA 2VF7A 2BKUA 3AL2A 1AKYA 4XRRA 2OFFA 2UZAA 4UBJA 2D3WA 2QLFA 5EG5A 1EFRD 1ZGAA 4KX5A 3UFXB 3UQYS 5LZ9A 3PPVA 1KY5A 2RHMA 3WYNA 5AXAA 1KQOA 2Z95A 2BMEA 1QJ4A 3EGVA 4O4IA 3WK5A 1DEHA 2BI8A 4I4TF 1I0ZA 2IXBA 5DW3A 4JKIA 3QBVA 1WCXA 3JQBA 3OM0A 4US0R 4Z4QA 1XCLA 1UXGA 3DQPA 4LF4B 2IDJA 3IEXA 4GE3A 4ROSA 5AKJA 3T38A 2ZT6A 5GZ3A 2DWQA 3GA7A 1POXA 4R40A 1CULC 4Y2RA 1KZHA 1ISSA 4KQWA 4JLPA 1PNOA 1VKRA 2FWMX 2G0NA 1JFFB 3BHMA 2ONJA 4FFVA 1IULA 3SN6A 4M2LA 4F84A 4FWTA 1XNRB 4P5EA 1EG2A 5BR1A 3IMFA 1OYWA 2HUNA 3PNMA 2CXHA 3AI2A 3A2MA 4YMGA 4HH0A 3TW8B 2A9QA 3NYRA 3USCS 5FWXB 4J0HA 3OOJA 5IBQA 1CRLA 2Y1GA 4M8SA 3G3EA 4DLAA 3I9V1 5DRYA 3T5AA 3AB7A 4F72A 4U2FA 1E3JA 1AQIA 1VL0A 4I46A 3LQ2A 1E6WA 3L8CA 3ONDA 3HA2A 3EEOA 3MCAA 1CIVA 2V9PA 4RHYA 4D42A 1U8UA 4C5CA 1R3DA 3BSFA 4UUNA 3TSZA 1VRVA 5H80A 2J46A 3I58A 5KDDA 4JC0A 1USKA 2R11A 1JAXA 5HKBA 1O57A 2GM9A 3NONA 4LCBA 4UATA 3NCTA 1X1BA 1I94B 3OIWA 2JHPA 3KG2A 4GLJA 4EHJA 2Q2VA 2O7SA 2B21A 3V8QA 3EXFB 4I9GA 1UJCA 2RHTA 4L3VA 1UT6A 2G82A 2AJ8A 2CHEA 2JHAA 2L18A 4YY3B 2PSFA 3V7YA 1NLZA 1Q21A 1OVMA 4CM3A 4R9RA 5EJ7A 5ECDA 3UAGA 4MP3A 1ZUWA 5F33A 4A3SA 2CNKA 3ND9A 1ZUNA 3BMXA 5JJLA 3LNCA 5K51A 2C2YA 4EECA 3B20A 4XM1A 1LLFA 5KHOC 4XDYA 4X1IB 3OQPA 3Q7QA 4ACAA 5KNBH 5LKRA 1EUCA 3KR2A 4LFAB 1FDVA 4O5OA 1K4YA 1BJRE 1GPAA 1PFWA 2BFEA 1J0CA 3FGOA 3EFOB 1OLUB 1GA1A 1LVHA 1BQEA 3VJKA 1N2CE 4YRCA 3E8MA 1NVKA 1Y5RA 5K0TA 3EC7A 4D82A 3RIHA 4L75A 2DC1A 4XJVA 5IKEA 4KXYA 1G4HA 1NPTO 4DJTA 1LZLA 3JQQA 3LBFA 2Z09A 3N8DA 3ZVLA 3HR4A 4HB0A 4NCHA 4CQLB 2HWXA 2GNOA 3VNQA 2ZM5A 1GUAA 2IJGX 1GNRA 5LJLA 5D85A 2EYQA 2Q1UA 4IJQA 4BV8A 5BV2P 4PAQA 1HE8B 4JJ8A 5TQ0A 1J1ZA 3RHTA 5T64A 4BCCA 3AW8A 1M0TA 2XCUA 1AG9A 1TF2A 1ZKMA 4JODA 4AY5A 5JVDB 5J2TB 4W1RA 4GR9A 1Q0HA 1J0XO 1E9RA 3P5SA 2H0QA 1Z39A 2D5BA 3VMFA 1AKNA 4ZT4A 1SFRA 1LTKA 4JZYA 2L82A 4GMFA 1B14A 4F4JA 5C8YA 1L4BA 4OIFA 4D80A 4P32A 3WYCA 1SVSA 3NEYA 4E08A 3ERCA 5EYPB 1M2KA 2ORED 4RZQA 3HZRA 1EFHA 3DEZA 2AUMA 2AJBA 2JLRA 3ESAA 4UFNA 5CX4A 5KKCA 1MJGM 1UC5B 4P83A 1CQXA 1G7SA 4B4OA 2R1VA 4OK6A 4QDXA 2X19A 1A5ZA 3IPRA 4ZEVA 5JHHB 2GN1A 3M3HA 4RY2A 4PZDA 3BX1A 1OLSB 4DXHA 3EFHA 3BQMB 4OVKA 2WJAA 1E3SA 1WKVA 1LWNA 4ILKA 4OHFA 3IVMA 1H8HD 1NBME 1T43A 1KKLA 1PJRA 1VL5A 1YB6A 3E9DA 3LCMA 2I3GA 4WPGA 2EKBA 3O8DA 5DI9A 4LFBB 5KX5F 1GG5A 4A0QA 5BSKA 2Y99A 3V2HA 2AVDA 3C6YA 1JFLA 4N18A 4G1EB 3RSGA 4DA8A 5KQGA 1WVGA 3OPYB 2BEUB 3PJFA 2ZBEA 3JU3A 4Q1AA 3Q7RA 3GY0A 4MJ3A 4RV9A 1QLHA 4JI6B 5KKAA 4K26A 1T5LA 4REOA 2YDYA 3G5TA 1SC6A 1DRKA 2PMFA 3H65A 2OCXA 4HWOA 1QPGA 3AJAA 4PQEA 4LXUA 5HM8A 2G9VA 2Q1XA 3VNBA 1WCV1 3MWDB 1ZG3A 1MEOA 4B32A 1FJ2A 5JAUA 5BVGA 4GLOA 3CUKA 1QGUA 4MW7A 3KPVA 4R68A 5D6NA 1Y1RA 4HGQA 1QP4A 5A5DA 3OFKA 2YWRA 2ZUBA 1Y4AE 1N5RA 1UBFA 2MYTA 1VYVA 3H9EO 4BCBA 2C77A 3CR8A 2YQZA 5CNIA 1XNHA 1C9MA 4Z9BA 5FA5A 4CIVA 1PJCA 1ZD9A 4DQLA 5JQGB 2BWJA 2R8RA 3M1YA 1K6MA 3MGKA 4UMEA 1AURA 1XT6A 4QTZA 5ALGA 5EHNA 5EKTA 3RVRA 4G65A 3TPFA 3VR6A 2XUGA 4A4DA 4MX8A 4HMPA 4AJEA 1QNFA 5KYWB 4IFBA 1E8NA 1JR6A 3BFVA 1XZBA 1QO9A 2JPDA 2UAGA 3B6ZA 3GZNB 3JY6A 3OP1A 3B2QA 3RC7A 1OYVA 2VIIA 3H2HA 5T6BA 5IJ9B 1PK7A 1U7HA 3AUKA 4QARA 4TZKA 3R5JA 1MC4A 3VBEA 1RYHA 3HJUA 4F2HA 4OM7A 4EI9A 3QPVA 1J8VA 1PVDA 2OCBA 4H6VA 3K2BA 3ROZA 3QOFA 2IDKA 1II8B 3NHPA 4Q4HB 1ZJ5A 4DWJA 5BXQC 2C2GA 5TF4A 1ADBA 1ZVQA 4Q3AA 4UVIA 3GIDA 3N6RA 4I5IA 4B4DA 4G37A 2ONYA 1CZKA 2HN9A 1NW6A 1GLNA 3F6EX 1MO6A 4N54A 3JQPA 1TRHA 1Z37A 5HFAA 4TRMA 4YMSA 4XD7A 3QWFA 4YPFA 2JH8A 3H05A 4N3AA 4JI8B 5CA1F 4AS1A 3IT3A 3DMDA 4BFVA 4CCYA 1HDEA 1V16B 2JFHA 2V7VA 4DF3A 4NYMQ 4CYMA 3B38A 1S2NA 1ZXXA 2VEDA 3QKWA 4Y30A 5TR9A 2AC2A 3FPEA 3GLTA 1VMIA 1RABA 2EHDA 2JJMA 1PGPA 4HDAA 1KF0A 4IL5A 2C82A 5AJZA 5E3JA 1G3MA 4BJ5A 3AFOA 1FB5A 1Q3HA 3PS9A 2Q2WA 3EYWA 4NU6A 1TQHA 1HQDA 2JCGA 2DRIA 3LE8A 4GMGA 4MVJF 4Q1DA 1AZLA 5GWXA 4BNNA 2DFLA 2COUA 3ZGVA 1VIDA 2XE8A 1Z5NA 5J2UF 3DYIA 3CNEA 3ED5A 3FFAA 2UYHA 3GD7A 1O0CA 1FVXA 3A2NA 3B85A 3FCYA 3L0ZA 5EP2A 1SC4A 3BWEA 3E3MA 4Z0TA 1DRWA 3INGA 2IP2A 2GXAA 4YYZA 1CNEA 1GL9B 4XIFA 1R74A 6LDHA 1XVTA 2DF8A 1WWKA 3MWLA 5K0FA 1WQ3A 2YXLA 2ZIVB 2IS6A 1G6OA 1T5IA 4INPA 4F8EA 2JCXA 3ETNA 3Q88A 4ZZ3A 3PR1A 5JWOA 4G9GA 4U7WA 3K7EA 3EDYA 2WAAA 5IVDA 4XFDA 1D9ZA 3ABQB 1H2AS 2HIHA 3EWNA 1UPCA 1RJEA 2P2DA 2RG7A 3JD2A 3I92A 4GUAA 5NULA 1V8FA 3SEAA 1OT5A 4EY6A 1JEYB 1JHQA 1T1GA 3EARA 2X0NA 3OJWA 4YRBA 1UJNA 4MCIA 1BW9B 3V8MA 5CEFA 2B2NA 4O3MA 1UINA 2BFDA 1GTZA 1SQSA 3DLIA 3G88A 4JNCA 1BMQA 1W5TA 1NDHA 3JYHA 1AT1A 2IKSA 2YYYA 3LBAA 1JHZA 4RZ2A 4X3PA 1PP4A 2PA0A 5LA6A 3TOCA 4GIBA 4EB6B 3D8BA 3I01M 3REGA 3OUTA 5H3HA 1EVEA 4L72A 1EGMB 4DE5A 1D04A 3TLAA 2OCDA 1OFUX 2DBZA 4UE2A 4UDYX 3R5SA 3PCXA 4N0PA 2CB9A 4W5QA 3EH1A 1MA0A 4RTMA 2V03A 2VUTA 2IZ6A 1V9CA 3ZXSA 3DL4A 2Q4EA 2TECE 3HXPA 2HBZA 4JUCA 1ZXLA 3QI2A 1JKJB 4GMHA 4Z1MD 2GCOB 3E61A 1MO5A 1VMEA 2HI0A 2MR5A 2C7QA 1MAWA 4LPKA 1BXKA 2AHRA 2OAP1 2C03A 3LHSA 4PLGA 2PT5A 4KVZA 5DASA 5TSDA 2JI9A 2JAUA 2YY5A 4AD8A 2Q27A 4E2ZA 2JGEA 1MC5A 4UQPA 1GNTA 721PA 2OCYC 4R8VA 1TXGA 4JZKA 3WG9A 4RCZA 4WCVA 3T7TA 1RFGE 5BV8A 1WABA 3VR5A 1G17A 1SVLA 1BDHA 1OXSC 1BXRA 1LPPA 2IYTA 2VXOA 2B9EA 3HEBA 4C30A 5DH9A 1MX9A 2HRZA 5T7BA 3ZIUA 5DHFA 2BEKA 3B9PA 3NB0A 1W2HA 2XUAA 4ZP1A 3SBEA 4IPTA 1JU3A 1ZHHA 3OU6A 3Q12A 2OQRA 5B53A 4LGMA 4UM5A 4EA9A 3EF0A 3RRJA 4B0OA 2ZAOA 1XG5A 2R2AA 3EQZA 1QTRA 3QVOA 1QYVA 4RW0A 3AWDA 3EK2A 4I5FA 4YRDA 1Z5GA 4WKCA 4ZICA 2Z08A 2JNWA 3EG5A 1XCPA 2Z43A 5BMVB 5AM0A 5IMBA 3ESQA 3UF0A 2WQ7A 1CHNA 4KXUA 3CLRC 5CT5A 5AW3A 1X9IA 2HQBA 1XD2A 4RSHA 3VDRA 1YCHA 1MORA 3HU2A 1FSZA 3OQOA 4UMDA 4BO9A 1CB0A 2CVQA 2JC3A 2I91A 1P3JA 1PN3A 1XZGA 4NESA 2PGDA 3EIHA 4P4NA 1NSFA 3GD5A 3EDMA 3DLPX 3EIXA 5T4FA 3EXHC 3KLPX 4RVSA 3F1KA 3A1TA 4MGHA 4YIKA 4UMFA 1EVZA 3PNVA 3V6MA 1C7RA 1BWQA 2IF0A 4YP7A 2H5EA 3PQEA 1DWPA 2B94A 5DCWA 3ECSA 1YB7A 4L78A 4TWBA 5H1YA 3N7TA 4FDLA 3BT7A 2XMCA 4FHFA 1G2PA 2WJHA 2I67A 4ZQIA 1KQNA 1E62A 2W4QA 2VAXA 3KAPA 2BFPA 1ZESA 3C3JA 4NS4A 3A58B 5KTRA 4DCSA 2Y1CA 4LNUA 4PSVA 1PR0A 1X7YB 4HYTA 2HF2A 2CXPA 1BGVA 5LQKA 3A10A 2PH5A 4GHWA 4F96A 2G83A 1WG8A 2JBWA 1HKUA 2VHEA 2VN8A 4DR5B 3MF4A 4WY5A 3SXUA 4ZFNA 3TZ6A 2GZ3A 4GKJB 2PKCA 1BKDR 3A1NA 5TVKA 1SCDA 1YU6A 1MX1A 5BSHA 2YHIA 3BB1A 1Z82A 1AC5A 1EM8B 5HR5A 1BS2A 3H5TA 2QQ5A 2BFBB 4D96A 3WGLA 4RA6A 1P4SA 3EDQA 3WXMA 3U39A 1ULAA 2H16A 4PYKA 1P4RA 2XTAA 3JQ9A 1Y4SA 3AF4A 4KQJA 1FUEA 4ZAVA 4Z3OA 3CLSC 2YC4C 5EP4A 3HWX1 5DRTA 2JJQA 8ADHA 3AEXA 3JQBC 1ZM2A 1R6TA 3GEIA 4TLAA 3UK2A 2VFAA 2WP0A 1SWWA 3HGMA 4R8MA 2HHHB 2CV2A 1AK1A 1WXEA 4IJWA 4MEJA 3DBHB 1A71A 5DBIA 3SVLA 4KR3A 2FZVA 3VR4A 5KDOA 2I2CA 1Q11A 2CJFA 2VTKA 3FHOA 4QDOA 1MEJA 3AGQA 3RRBA 2AUTA 3FG9A 2G9RA 4P34A 3N8GA 5P8WA 5D84A 4CLRA 2MYPA 4DNXA 2UYYA 4RWZA 2GR9A 2PPLA 1WIWA 1ZX1A 2JGDA 5TQJA 1NAHA 3ZCSA 1C1DA 1RLUA 4ME6A 3EXG2 1GLVA 4H18A 1Y6FA 3QSGA 4BFCA 3D7RA 3PHHA 3IUJA 4BS9A 3U4IA 4XYEA 2VAWA 2V0NA 4H2DA 5E1BA 4I3FA 4PRKA 5BORA 1JAHA 3EGDB 4X85A 5JYBA 3GLIB 1ZVJA 3LIIA 3QMVA 4HAVA 2KE5A 4CR7A 1PT8A 2QMOA 5HG0A 4B35A 4HFMA 4D79A 4JSRA 2JEOA 1BA2A 3KD3A 3AVPA 3TNFA 2WFLA 3ZWAA 4ALMA 2PR7A 5LOVF 1R6XA 4GOMD 3AHGA 1N92A 3KLBA 2YOHA 3KOZA 4CKCA 4EB0A 1RKXA 3CXRA 3L6UA 3D54D 4FLMA 4WZAA 3PEEA 2Z56A 3U49A 4IDEA 1AGYA 2B1QA 2EXXA 5CBKA 3VNVA 3WZ2A 4L57A 2WWYA 3KKKA 2X6RA 2GASA 3I2JA 4H6WA 2B99A 3QBTA 4LISA 4FNGA 3ZHUA 3ROMA 1SBTA 2LBPA 3OICA 4AG5A 4I9HA 1NYLA 1UXJA 4LVCA 1B8VA 3N58A 1GAQA 1R00A 5A1JA 1E6EA 3B6EA 3B48A 4I9NA 1Y1TA 3NG1A 3GRRA 1OX4A 3ZYCA 4BVGA 2FWPA 3ZV6A 5THQA 3NGMA 3GH3A 4Q9DA 2EERA 4N65A 1NUTA 3JS5A 2YASA 1CV2A 1I7NA 3IVAA 3NHMA 4Q7KA 1XDWA 2VWHA 1SURA 1EFKA 3DZ8A 1QB8A 1G5IA 1X8JA 2R7AA 1JJIA 1TC1A 3CO5A 1Z88A 4X1KA 1DT5A 3FWHA 4A36A 4JWKA 1Y3DE 2VQ3A 2E87A 3QKRA 2W2OA 3DMHA 1YTLA 2QLJA 3GRKA 5LPNA 3AMVA 1F7VA 2AKEA 3ESCA 4R5HA 1UFKA 3U3KA 4V1CI 3L7YA 4Z8XA 2H9IA 3SAJA 3I4LA 2ZE5A 4CQMB 1E3WB 4Z53A 1PQWA 3LTEA 2ZE7A 1GCIA 3DV9A 1ODIA 3EODA 3M2TA 4X7RA 4ZXFA 3WWZA 5BPHA 3IAS1 5JU6A 1K4MA 3C7CB 1TGYA 2H11A 2YJ6A 1TVCA 4MA5A 4NBSA 3H7IA 4XVHA 2PTHA 4DEYA 1MEEA 3RBVA 3OOYA 1UK6A 3I62A 1DX9A 3MB5A 3LWDA 1KBZA 1NVVR 1CERA 4U8GA 3WGNA 4XYGA 3AY3A 4RPLA 1C7QA 2J9XB 2VZ9A 5HIJA 3TLCA 4KDEA 1XK7A 1CB7A 3PFHA 4Q1EA 3A2KA 5JNSA 1P77A 2AT1A 3B12A 3LC2O 4MS3B 5AESA 2BI4A 1BXGA 3F6CA 5FHQA 1WPQA 1QKJA 2B92A 3LGXA 3NASA 1DOHA 2W00A 1B8OA 3KHSA 4AF6A 5M04A 1ODFA 2OFOA 3ANYB 3R6DA 1H3FA 1JZQA 3ZHCA 3BE5A 4X63A 3FCEA 1G4AE 2ODTX 4NZ9A 4D9GA 2O1SA 2G7MC 3GIWA 4PTLA 3UWKA 4V39A 1C9JA 1IUKA 4G3XA 4CMCA 1YE5A 5B4VA 3T54A 3S2EA 2DYKA 4F5YA 3EZFA 1J2UA 1ZK0A 3D9QX 1XZFA 1Z29A 1M6YA 3E3LA 3GBPA 4UHKA 5E9JA 3WADA 2O2SA 2PGIA 5FLEX 1KEKA 4TZ6A 4GLFA 3UYLA 4XSVA 5FPPA 2W0SA 5F9HA 1SKYE 2CYAA 4GP7A 1DWOA 4DIFA 4EAQA 1FY2A 3L0SA 1U0FA 1FYWA 1ZIDA 4IJ6A 4TTTS 1J0EA 5JSFA 3L92A 4TRJA 3OZBA 3CVJA 2XRFA 4L08A 4Q01A 4R1QA 2NXWA 2KBEA 1KGSA 2QAGA 2X0RA 1SVUA 5DKFA 1OH5A 1T3GA 1M2FA 2G70A 5E6SA 4Q24A 3AEYA 2UZ0A 1O7JA 1YOBA 1LC0A 1GDDA 1U1GA 4RF5A 5MF6A 2QI9F 3OETA 5JYEA 2V65A 3C16C 3F74A 1SAYA 1XQXA 4CQNA 3IEMA 1I2CA 4RZHA 4J94A 4KV7A 5AK4A 2Y9PB 5I45A 1PNVA 4KMOA 3WLPA 1QH9A 3GJ8A 1NW8A 4P5PA 3HB5X 5GM1A 5E6RB 3Q9UA 3KQPA 5BT9A 1OI2A 2BHTA 4JB2A 3RVLA 4BLPA 1MOQA 4EBFA 3AGPA 1U0TA 3CKYA 1N2ZA 4J0GA 3DZIA 4YLGA 1L1FA 1D1PA 1PT7A 1RTKA 3JASB 1XXHB 1EJ0A 3P2JA 3DUWA 4GLLA 1YB5A 2GGSA 3AHCA 5JE8A 2G8LA 2P5YA 5F98A 3IHWA 3JCZA 3O4VA 5CM8B 3ZG6A 5CIWA 1W4CA 1JR4A 4ESOA 1ND5A 1IEVA 1VIMA 3BSYA 1XDDA 5EUBA 3ENZA 3O4HA 3R7AA 3H1EA 3WNZA 4WBNF 4RU1A 2CDNA 2X76A 5JISA 4FLFA 1GDTA 4K9RA 1W75A 3PIIA 2ODNA 5FAXA 2UUBB 5HOEA 1UDCA 2I6TA 1T5OA 1GRNA 1WCIA 3ASZA 4R7GA 5GINE 1S3GA 3NHAA 3G1WA 1LPAB 4RABA 4IXWA 4CMHA 3VVLA 4JI4B 3I0NA 4CT0A 4F46A 1RC8A 1SB9A 4F3NA 4ZVOA 3L5OA 1KJNA 4NG5A 4DLVA 2VJQA 2FQ1A 1K6JA 3KKNA 1ACLA 5HFNA 2C5BA 2XHZA 3FB1A 3IRUA 5TS2A 3T4UA 1D2CA 4AUMA 4F4IA 4ZQEA 4RVNA 5D3ZA 1DAKA 1WP4A 3B9BA 2VJCA 3KR0A 4DTIA 3VHQA 4YWJA 4JR0A 3T95A 4AF8A 3Q8MA 3W7AA 1Z5VA 4JL5A 2RBEA 3I9OA 4RHXA 2ENWA 3T3MB 3UH0A 2G28A 4B7XA 4IXNA 4GRDA 1VP9A 1HDYA 2CFTA 2QB5A 1NUAA 3ZZMA 4HMQA 1H22A 2E48A 2J7PD 2JDIA 3FYDA 3OFSA 3ZCRA 1XAJA 1DC3A 1RHMA 2OGTA 1X3LA 3B1YA 2WAYA 4O4LF 1R6DA 3DMYA 5AVTA 3W5DA 1WA5A 1YQGA 2ZUUA 3U4GA 2V8OA 4O2BF 2PS3A 2WMNB 4OSEA 3SP1A 5TDHA 5JAHA 4CCSA 4NCBA 1TCAA 1NJ8A 4MQUA 1CVIA 3SLKA 5IJ0A 1Z3IX 4LY3A 1UZUA 3FY4A 1KXJA 2XDQB 5JT1A 4HV4A 1Q7BA 1XMIA 2J3QA 2WDZA 1KK1A 1QIDA 1RRPA 1Y82A 3N2KB 3ODPA 4MV7A 3TAXA 5KNBD 1F2TA 3NQ41 1HZZA 4O2LA 3ZWXA 4M1EA 5TPZA 2ZB2A 3REQB 4NNJA 4URWR 2O1WA 5LLTA 1T3SA 2GS9A 4QULA 2W5UA 3B3QA 4C78A 3I2IA 4MLCA 1TKCA 3B1KA 1ADFA 1VTKA 3UG6A 4BB9A 4C5AA 2FE4A 1OCEA 3R77A 1JMVA 2FFHA 4Q12A 5TT0A 4BUCA 5AVZA 4E33A 2XUIA 3MSXA 3N5CA 2FEWB 4R2IA 3C6XA 4FYMA 4WTOA 1LZKA 4UTVA 1FDRA 2ACWA 1G38A 3Q3HA 4D8UA 3NWJA 1N5LA 1YWGO 4ESHA 1ZI8A 1WV0A 1L4MA 4NTZA 1JYSA 3KM0A 5IKOA 5CB6A 5DN6D 4NU8X 1J1UA 4AL4A 3DWFA 2ZETA 2RGDA 1MENA 1J5EB 3KALA 4BLRA 1KVSA 3OM9A 4KX3A 5LQCA 5IKPA 4RADA 1ST2A 3OWXA 4PSCA 5HE9A 3W1WA 1AKMA 1BC5A 4GWLA 4BLOA 3A6DA 3AEKB 1A9QA 1O5TA 3B6JA 1N7GA 2HA6A 2AW3A 4NCIA 4N49A 4YA6A 4EHFA 3SS7X 3PZRA 4URHA 1V1RA 4FDMA 5JCXA 3A28A 1ZK4A 1SHTX 4CLEA 2CL7X 1UAYA 2IYUA 5ALZA 2VTBB 2FY8A 1V8ZA 3N3BC 4WJKB 3ILXA 4IDCA 2JHGA 2XGGA 4JLSA 3C48A 2WT9A 3LX5A 1SXPA 4FJ0A 3I04M 3ZLBA 4N3NA 5E95A 4CM8A 5AVWA 1NY5A 3EEFA 4BNWA 3V48A 1NDQA 2IPNA 2DPHA 1CTQA 1H94A 1KPGA 1R88A 2V45A 2EBWA 4FZRA 5DBGA 4BFWA 1JTVA 4D8TA 4YI3A 2V54A 3AKYA 2NXJA 3EFEA 1Q50A 1YDGA 4O8CA 1UDRA 4UULA 2IFTA 4ZWNA 4CLOA 3O8RA 2QXYA 1P9LA 1JYEA 4B33A 3OPQA 4QTUB 1NVUQ 4WL0A 2WF9A 2YZNA 1YT5A 3IIMA 4EI7A 1YGYA 4WXYB 1FVOA 4OHYA 1I2ZA 4UCFA 3KTOA 2ZIXB 4KAJA 1G2IA 3OX1A 4ZVNA 2YICA 1OF1A 1XZ8A 3GUUA 5FIUA 2XXAA 2XMBA 3PGKA 5JUWA 1C0PA 1A4IA 4NFSA 4OQFA 4PNHA 1E2DA 1KJZA 2FZLA 1IZ0A 2O0MA 2D1TA 3RTAA 5LMCA 2IZ5A 1IVYA 2JFPA 5C4MA 3PXCX 4Q7JB 1QIGA 1YBFA 1C3OA 1P2FA 2PSHA 2C5GA 4N6NA 4BP1A 3L0YA 2VPTA 3VAAA 3VXKA 1PR4A 5LOVB 3D6HA 3P0EA 2AZMA 2XUPA 4G24A 2OQ2A 1IBRA 3KZVA 1ZK1A 1X70A 4IUCS 3L5KA 3MTJA 2YZMA 4QDZA 5HHTA 2Q7DA 1RRKA 2AMYA 1YR8A 3ZGOA 2ZRAA 1ODSA 4KO8A 3TVDA 3KHKA 2JBHA 2H57A 2J0VA 2FP3A 3MWYW 3NRJA 5CA0F 2I4RA 3BQNB 3PT5A 5FEUA 4P22A 1ZCBA 1DLIA 4Z5XA 5I01A 5L6MB 3C3EA 4L9AA 2I1VB 1K86A 1G3RA 3IS3A 2EBHX 3U7GA 4MB6A 1T2VA 4QXRA 3X2FA 4DDMA 4TOIA 1KRHA 3WA7A 5DNWA 1NXXA 3ZWVA 5K45A 3EZGA 1N2XA 3FOAA 4PXYA 3E48A 5REQB 2D0IA 2A94A 5GGYA 1IY9A 4FFOA 2WIDA 1XK6A 3ZY3A 3DFFA 1OIVA 4DSNA 3GT7A 1PTJA 4YC7A 1KQGA 5JCJA 5DHQA 4GPD1 1I36A 3HB0A 2B7BA 1QGZA 3JQ9C 5KVQA 4QLBA 4RJTA 1DGQA 5C8XA 1D3AA 1W9MA 2OV1A 2EX0A 4TWAA 4AJ1A 1CUXA 4ENSA 1TUBB 1V8OA 1P19A 3U31A 4KLAA 4EG1A 3OQVA 3P9XA 1QHXA 1J4AA 1OHHA 2P5UA 5K3SA 4JBHA 1M1UA 4DMRA 5CA1A 2AWNA 1U4NA 5ANRB 4HPWA 2DM6A 2ZTMA 1SUWA 3W5JA 4TUYB 1PR9A 4AY4A 5KTMA 1MG0A 3EEYA 1RPNA 1J99A 2HLNA 2V6GA 421PA 2PA3A 3SWWA 4TV9A 2WE8A 1Z9BA 1UKCA 5TNXA 4G5OA 4HDSA 4NOMA 5A0FA 4P2GA 3CT4A 2W6MA 1JAYA 4FMDB 4OP2A 5C7IO 4K05A 3I2FA 2FXIA 2VTVA 1ZQ1A 4MVJA 2OILA 4XZ3A 4Q4JA 5IK2D 1ORDA 1N32B 2R7NA 2QVZX 3ILVA 4HN2A 3M4JA 2JLXA 1W5BA 3FNBA 1MV5A 2CBXA 4O2AF 1GSAA 1SB8A 5J2UA 2LRHA 4XARA 2G1UA 2PMKA 4YP1A 1OOEA 2ZPTX 1DJPA 3HWWA 5A2GA 4DR2B 2P2CA 2ZYVX 4ENTA 3FFBA 5G02A 1SHJA 1YCFA 4DVJA 3H1AA 3S40A 2EIXA 4BKMA 3RH0A 3WP0A 1QZXA 3OQ6A 4DCGA 1GPBA 3QLVA 1TFRA 1Y3IA 1ONBA 2QP4A 2Y6VA 4JI3B 3ZDFA 4LSWA 4TLLB 5D5HA 5KNDA 4F7WA 2Q4RA 3N0TA 1H9CA 3UJCA 4XE5A 4KODA 2OQIA 4A27A 1CYEA 4OJNA 1LH0A 1O9BA 1HC7A 2YYZA 2OMKA 3D8UA 4ER3A 1W48A 4D0RA 1OTXA 4EMTA 5DLEA 4IICA 3C6MA 3CG4A 3LQQA 3OPMA 1V96A 5HGJA 1H69A 2P4HX 4Y9RA 4L07A 3LV8A 3GVXA 3VAYA 3ZLUA 1U7UA 2HHJA 2CDRA 2NZYA 2QPLA 5AHWA 1F6BA 2A5JA 2ADMA 2MDTA 2M6LA 5KMGA 4HX2A 1RXUA 3QENA 2W2TA 3DE2X 3C8DA 4FYVA 5CCEA 5EGSA 1URPA 3ITDA 5IANA 4BAUA 4B79A 5I7FA 1IN7A 5J59A 2QTZA 3WO1A 4XGKA 2ZE6A 3IOBA 4UW9A 2BSQA 3FGZA 1RSZA 2LDBA 4G2NA 1YZNA 1MO4A 3B1JA 1YAJA 4QM6A 5LSAA 3MWEA 7GPBA 4HH3C 1FFBA 1ZIPA 3ETHA 2X2OA 1RP7A 2R1TB 5F1YA 3UKOA 4Q4CA 1V25A 2IHKA 4YUXA 2X5JO 2DWCA 3TXXA 5B1EA 2OGWA 1J00A 3E0QA 3KS9A 2FQWA 3LPLA 5JDIA 4G0OA 1FP4B 4YTEA 2I8AA 4P80A 2ZRLA 5AVRA 1FX0B 1PFGA 2JASA 4BLSA 4GSYA 4M3NA 1E60A 3H3JA 4TKVB 1N9GA 4QASA 3HI6A 4D8WA 4YCNA 3VYRB 2DTEA 4E3WA 1JEQB 4WEOA 3X43A 4BQNA 4MWZA 5EHXA 3DAGA 1WSWA 3PFFA 3PUYA 2JI4A 1A5AB 3BGSA 1B1CA 4K8RB 2EF0A 3CF6R 1VMAA 4IFIA 5FUXA 1UMBA 3RFFA 4ZDKA 2KX7A 3BWMA 1ESCA 1Z4OA 2G1AA 1EG7A 2V5AA 3B5JA 4HUJA 5J9FA 3W1EA 4GZ3A 1B1AA 1F38A 3HDVA 3NNNA 1J06A 2EP8A 1MKYA 1SXJA 2RAPA 3PNYA 4PANA 1PDOA 1TM1E 4TLDA 4EI2A 1G5PA 4MA0A 2ATEA 4PRYA 1U0HC 3NHBA 3UGKA 2X3FA 2WWHA 3M4XA 3PGJA 4GMDA 4JI7B 1D4OA 1F2DA 3K9CA 2IHNA 3W34A 2VLIA 5BNZA 1CJUC 5CT9A 2F9MA 5KO2A 1PAUA 2XYQA 1OSNA 1Z8DA 3IJ5A 4JC8A 2PJDA 5H02A 5BQOA 3C3MA 1G3QA 1NVWQ 1MB0A 5TPWA 5MN6A 4WJZA 3ZBUA 4PNEA 2EZUA 4OL0A 1BFDA 4DHEA 5JAPA 1E0AA 4ER5A 3BWBA 1A9YA 1Q77A 2AHOA 4N39A 2PM8A 2ERCA 4YNBA 5ALKA 4UPEA 1SK8A 4RTKA 1EHCA 2R8BA 3OTWA 2B82A 3VR3A 2OUKA 3C8MA 4RD0A 2XRZA 1LC3A 3DVAA 2FMXA 2WE7A 4QDTA 3UJAA 3AKEA 2RFLA 1NF9A 4R01A 2VDWB 2I8CA 1UM8A 2OESA 3VISA 2HFKA 1UJ2A 3JV7A 1VGVA 4QUJA 1JV2B 3CKLA 1OXMA 4UTOA 5B30A 3IX7A 3W2GA 1Z08A 1E92A 4L15A 4ZU6X 3IP6A 4PQRA 4IIUA 1H2XA 3BGOS 4UNIA 3JRWA 1DS6A 4RMGA 4EY8A 1SD2A 4TM7A 4XTRA 2KW5A 1GU7A 3ENQA 3JAKB 1JEEA 4E6PA 1K8RA 2XI4A 3ER6A 4E03A 5EJ4A 5JAOA 5KTPA 4D26A 2CW5A 3MYYA 5DM60 3E7PA 3W5CA 3GFBA 4HX5A 1E5VA 2NU8A 5C5EA 1RZUA 1JDNA 3BAZA 4B7ZA 5LUAA 3RS9A 2ZIFA 1I8TA 2PH1A 2W2LA 4LOKA 1LI4A 5CK4A 5LYJF 1V47A 2UKDA 1RI2A 4UOZA 3OZRA 2WUVA 1E20A 4DGQA 4P0QB 3R5XA 4ZAYA 3G9TA 1FDSA 4MR7B 1VHDA 5BN4A 3NTRA 2WLSA 2PNJA 3PK0A 5M5BA 1M1YB 2O8BB 1K3UB 2ZSKA 3C5WP 4PHGA 5HILA 5AVJA 1M67A 3K8ZA 2GUWA 4MHTA 2GJ8A 4OQLA 3SJCA 4UHEA 1Z25A 1KOJA 1N3BA 3H13A 3LUCA 4WEQA 1FUUA 2XZDA 4NOLA 3ET5A 1JEOA 3FUUA 1I14A 3M1IA 4Q02A 4RAQA 2Z0MA 3KJEA 4ENVA 1H2HA 2JLCA 5KYXB 2Z57A 2W2NA 3A31A 4YJFA 5JTUA 5CP8A 1UAAA 3FKJA 3CONA 1OGJA 2YMLA 3OKFA 3UJBA 4BWGA 4PZPA 1V6AA 5LWQA 2Y0EA 4OHRA 2GZ2A 1JALA 2FZEA 2YIJA 1JI3A 4MYDA 3V2UA 5EHZA 1RYFA 1SBNE 2DLDA 3NAZA 4OQNA 5JSYA 2RGUA 1Y37A 2BR5A 3IE2A 2PD4A 3RYFA 2QXUA 5JH7A 1ZONA 1SKUA 5C31A 1XI2A 2R8YA 4MVWA 3M6FA 1QZTA 4C3ZA 1KBQA 4C43A 4CLHA 4GM4A 5LQNA 1PEKE 4MTLA 1IUPA 2DETA 3V00A 4YR9A 3U9TA 1KH1A 1CQPA 1UT5A 3KQSA 4BHTA 1G0OA 3RWMB 2E4UA 3VSCA 3C87A 5ITZA 2XLCA 4PSAA 5IH7A 4Q4DA 4HNSA 4B3SB 1NP7A 1U7DA 4FMCF 3NOQA 5IAJA 4IUBS 1DNPA 1VOTA 2V6FA 1QR6A 3T9FA 4LJ8A 2HA3A 2CNDA 1J8YF 4OGWA 1IHDA 5FFFA 3VU9A 3WLEA 2QMHA 4ZJYA 6PFKA 1TPYA 5KHAA 2A8YA 5CDGA 4C0AC 3QZUA 4PO8A 1N0IA 4ND8A 1KE1A 2EFYA 1HZZC 2D54A 3UY4A 3WBFA 4LZNA 3A1VA 1IRXA 1QYXA 4JOCA 4F3CA 4HAYA 3HM2A 2SKCA 3KTDA 3QQ5A 5DXJA 1KE2A 3LDFA 1CNMA 3KETA 1V0JA 3PT9A 4MNTA 1DBVO 2C3UA 3BZBA 4DV6B 2BFFA 1A69A 4J3NA 3PHCA 2FW9A 3B1FA 3LF1A 1A5TA 3VV3A 3ZQKA 4R5MA 2OO7A 3U9LA 3CTPA 4JUDX 3GJXC 2LNDA 4IRUB 4UCXA 3MOSA 2J32A 1U8AA 2Q1WA 3B6KA 3CPHA 3OH8A 3L1HA 2ZWIA 3AXSA 5I8PA 2HRQA 3SOZA 4LRUA 1M8JA 4FN5A 5G4KA 3UN1A 4XVQA 3S1AA 1PR6A 2CLLB 1M1XB 1GHTA 4B7UA 2DHRA 2R62A 3MERA 4MXDA 1IBLB 2PRIA 2ZSUA 3QF7A 1KWGA 1ZY2A 2CXUA 4U7FA 1J33A 1UZAA 1WDLA 5JAQA 4N47A 1FQWA 3VNAA 4F91B 3DONA 2VP2A 3HP4A 3S1SA 2XA1A 2WD8A 5ADVA 4I8DA 2E82A 3GAFA 1J5PA 1SKQA 3GVHA 3OJOA 5JCOC 5F51A 1UMDB 4B48A 5I7WA 1SUIA 2ZYSA 1DOAA 1O87A 2ZWAA 3GAMA 4MQFB 1Y4ZA 4Q4AA 1HT0A 4V24A 4HGOA 4WN3A 5ALHA 4Z0PA 4BV9A 1U9IA 1XO1A 4LNAA 3D4BA 3VPSA 1K68A 4P7JA 1OKKA 5D5PA 3S27A 4LF5B 4DUZB 1YI0A 4BLQA 3V1LA 2F3UA 4EVRA 3COYA 3GRVA 1W46A 3BICA 2H1FA 4DLNA 1Z4QA 1IXZA 1DELA 4PXSA 3SEZA 1PW7A 4QLAA 3WS7A 4ZJZA 1YUBA 3OZFA 4HBGA 2OD7A 1Q7GA 4WACA 4UKDA 2XMRA 2JFZA 4RC9A 1TZJA 1COWD 4EG0A 5BR8B 1JIVA 4E1BA 3VPGA 3VKGA 1OJ7A 1ZP6A 3I2GA 4KYTA 4QEDA 2FRDC 2AOTB 4U6SA 4J16A 1Z0ZA 2A1IA 4RK7A 4YUVA 1KY4A 3TLGA 5KYNA 5A4KA 3VPXA 4Q3OA 3MMSA 4AMUA 4J90A 4ROTA 2P91A 2XTMA 3PV0A 3GZTB 1ZRNA 3CX7A 4JB8A 5E4JA 2HA4A 4F3RA 4JMLA 1GZ5A 4D1YA 4W7IA 2A9VA 1Q7TA 4RDXA 2FPOA 1QVRA 4D2IA 4N8SA 5KTOA 2I9KA 4FI3F 4M1MA 2O3TA 2BF4A 3UHAA 4JLBA 3NANA 4PC2A 4E30A 1O4VA 1JU9A 3TLEA 4DABA 3K1YA 2QTCA 2ZR0A 2QG9A 2QZZA 1NI3A 1HRKA 3PVCA 4TKMA 5T8KC 1JSLA 3SC3A 4AIIA 4MROA 2ZYIA 3RSLA 2NN3C 3VHXA 4RKYA 3WNQA 5LQRA 5FCDA 1JMKC 3JR3A 1U31A 1W2WB 1XAIA 3KP1A 4ND4A 3ZVRA 1RE0A 4YJGA 5EMHA 5ADHA 2JGAA 4JYPA 3MIIA 1UK7A 3OSUA 5LL6P 4B3FX 1DXYA 3Q87B 1DAHA 4JUAA 4V0MA 2PBRA 3DQQA 1D03A 1Z0AA 1GUYA 4W5TA 3N8NA 5IKXA 2F43B 1BSVA 3WMXA 1WEHA 4V38A 4FE7A 4J4BA 5DTRA 1MD9A 3WRYA 5JMTA 1Z7BA 1T36A 4FGJA 4MPDA 4ZAZA 1TFUA 3TLJA 1N75A 2PRJA 4R98A 1Q1GA 1F1JA 1KEVA 1PTJC 1CUHA 2OZVA 3M4YA 3O93A 2NU6A 4HB3A 4UNNA 2ZRFA 3SCZA 4RHTA 5A4IS 3FDZB 2XTZA 1R1DA 2NQTA 3NYIA 4MJ7A 3JARB 2YMQA 2B4AA 3GG2A 1V1MA 2VCYA 3BH0A 2BYTA 1OWOA 1U6IA 3H8VA 1DTEA 3O1LA 2R85A 2OYCA 1T0UA 4HWGA 4U4AA 2X42A 4IV5A 4PE5B 4LXYA 4F3YA 1W36D 3HL4A 4PO3X 4QPJC 1PJSA 2AFRA 3JRNA 2J6CA 4LK2A 4TMXA 4PG5A 3STYA 1WMAA 1L5HA 3IUMA 1FTYA 2BONA 2WA1A 5EE0A 4ZI3A 1ZN7A 3ZJTA 2ZTUA 3WSWA 3RHSA 4Z7NB 1ABFA 2DQSA 1B6TA 1T6NA 1A97A 1SELA 4JCOA 4S1WA 1F17A 4W6ZA 4AECA 4PYJA 4PNPA 1A72A 2K4MA 1M75A 2E5FA 1NV9A 3RKUA 2HZBA 2ZAMA 4WK4B 4DG5A 1NBOA 4YLYA 1A8PA 3M2PA 1JZTA 2VAVA 5LP6A 2QUHA 5IT9A 2FSFA 4D44A 1RHQA 2I87A 1A76A 1YK1A 1EFVB 1VL1A 3IP5A 4JLDA 4WIAA 5FT9A 4EYQA 1K27A 2CZQA 3K70C 2KMLA 4O4LA 3IURA 4IJKA 1SOWA 3F4BA 1Y42X 1IPFA 1ZIYA 4H3HB 5K9ZA 3WTBA 1Y8ZA 5B1YA 4O2BA 5F3WB 3MM4A 2UU9B 2HDWA 3QELA 3BCUA 4F9FA 4CIYA 3QSYA 3QLVC 2ETXA 3WWYA 3ZS9A 3MBIA 3R0IA 4OD0A 3BXOA 1A98A 1DX4A 5FUWA 1L4EA 2HT6A 5JS8A 3HU3A 2WB2A 1T0BA 4WWHA 3UYKA 1OV6A 3IVXA 2X0IA 4D3ZA 2AN1A 3L1IA 3WGOA 3FKSD 5FB3A 1KAHA 3N0RA 1HLGA 3C6QA 4B44A 3M4NA 3WTCA 3O92A 3ITKA 3P9YA 4QAJA 3CWZA 2IGTA 2W8BA 4LTMA 1Q84A 4OGKA 3FAZA 3IMCA 5GVSA 4B6QA 1PJAA 4ZHQA 1XPJA 3HCWA 4XOIA 3TE6A 1LDGA 1QV9A 1UFOA 5H83A 5BY2A 3A3OA 2PXCA 3TCNA 4R71A 2ZUEA 1TI7A 2WHQA 3FCCA 2V3CC 1U9JA 3GLGA 2OYRA 1KAMA 3HVIA 2OB2A 1GEGA 4DILA 3G8YA 1UODA 4IEFB 5BNTA 1YS9A 3L4KA 3NHYA 2OECA 2HWUA 4IIFA 1CS4C 5JI2E 3SQXA 1OH7A 1XZJA 2BKEA 2PMWB 3TTTA 1OWNA 2W22A 4KTVE 3TB4A 1KTIA 3KR9A 2PGAA 4K46A 3VPBA 4ENPA 1AX9A 3RUAA 4DCVA 1WW3A 2WJZB 2JIMA 3SYLA 2QBYA 4C0QC 2HB6A 2O2JA 1ULSA 4XPZA 1QO0A 2FWJA 3DZGA 1IMJA 5LBTA 3OLXA 1HYEA 5CNKA 4AO6A 3FCUB 4I1PA 2JBAB 4WERA 4H77A 5JDIC 1OPXA 3A36A 3RABA 4MVCA 4WOKA 4ZOLF 3DFKA 3UANA 3WK8A 2NTJA 2PH3A 4BMPB 3OPNA 3NVMB 3U40A 5DF1A 2NVUA 5JJCA 2B8TA 3LIPA 3L7MA 1C8KA 4BEBA 5H3LA 3NBZC 1A9PA 3BAFA 3JQ8A 4FYKA 4FZJA 4NPHA 5KYYB 3MVEA 4HGPA 1Q44A 1E96A 1W88A 4JJIA 4G5RA 4OXYA 621PA 2X23A 5JXIA 2Q3JA 3P2KA 3AJ8A 2AV6A 2Z1MA 3TW0A 3WK7A 2RHBA 2A9KA 2JLQA 2XB6A 3WYGA 2IY8A 2K5UA 2WK1A 3GV0A 4MTCA 4BRZA 4K9MA 4Q15A 3H75A 2CNLA 3JYNA 4BTEA 1PSZA 2VXCA 5K09A 1P39A 1EBBA 2B61A 3F5DA 5KPDA 2C00A 3S8EA 3HJFA 4U0JA 1JLRA 1CY4A 3BJEA 4JVNA 1IXRC 2Q8QA 4CM4A 3SF8B 5LDHA 1LGYA 3PA8A 4FC7A 3HGQA 2CHVA 4RTNA 1H93A 5FADA 3ZEAA 4ALJA 4YV1A 1T35A 4GRAA 5KHLB 3EDRA 1Z4LA 4L4XA 2X1LA 3NP9A 1JHRA 3I64A 3D0KA 4HDNB 4PCAA 2JGFA 1SZPA 4Z4IA 3F5QA 5F35A 5IW8A 3OLCX 5B1HA 1DL5A 1GQ2A 1GOTA 4KXVA 3TR6A 4HSEA 4L2IA 3WGZA 3ZE7A 5JNTA 2C1XA 5DNYB 3SBXA 3KHTA 1DBSA 1NXQA 4I3HA 2I2BA 5CA0A 3Q6IA 4OOEA 2UXDB 1TYZA 3P1JA 1YJCA 4QQFA 2IU4A 3BRWA 1IE3A 2Z5FA 1FYFA 4FMCB 5GZ6A 3M5CA 1GO2A 1UBEA 1TT5B 2G3YA 2H65A 3GJSA 4W9MC 3IUQA 1TE2A 3L1KA 5DGCA 1F48A 3U4QB 1U7OA 2FKNA 3SJAA 2HTEA 5IZCA 2A67A 1F0YA 4PEVA 5IC6A 5ESWA 4UHHA 3GT4A 4MGYR 4RFLA 1GPJA 3WB0A 5IBCA 3VJLA 2NO0A 1DQZA 3B3AA 3QFFA 4L50A 1Q0LA 1NM5C 4BNTA 5EJ5A 5TMEA 1UPUA 1KSHA 2HKIA 5CH3A 4EGCB 1Q15A 1E3TA 3CVWA 1L5MA 5JSUA 3OA2A 2F3RA 4UD6A 3JAWB 4ZCQA 2OZLB 1QDEA 1KJ8A 4DM7A 5K4AA 2ORVA 2GBPA 5LU9A 4Z7JA 2Q3DA 1G20B 2FG6C 4X64B 1XLTA 4XEUA 1L7VC 1TLTA 2K87A 1ENPA 2BHRA 3BIXA 1NE7A 2I33A 1GP2A 2P75A 3KQMA 3O73A 2IZ7A 1P0FA 3Q7TA 4KN8A 1SJ9A 4RHFA 4UJ3A 5AMXA 2FXVA 4LOJA 4P4TA 1XL1A 3DO6A 5HTKA 5JFGA 5JFOA 2FLVA 3T1HB 3ZC3A 3LZ6A 2ILTA 4RDHA 2HMSA 1WO8A 5CJPA 5HQ3B 3AEQB 1F0PA 3DV0A 4A8PA 2Y1WA 3K2IA 4MRRA 1PQUA 2QIPA 3RFUA 1W0CA 3HFJA 3N7AA 3LHFA 5DIFA 4ZV7A 4RNDB 3IPYA 1A8QA 1NZFA 1VRCA 1JNYA 1I2BA 3O8NA 2AMVA 4G4SP 5FBQB 3AUJB 1FSSA 2AJCA 4P3OA 3MSCA 4CLDA 3PC4A 2IUEA 1SO8A 2QY6A 3B5EA 1HF3A 3TG8A 1BCSB 2FNAA 3RSOA 4BVEA 1JQ3A 4O2AA 3ABSB 3THRA 2I2AA 1V9SA 2YBEA 5J4VA 1KVQA 1XALA 2CLCX 2FB9A 1U3TA 3L6EA 3VYSB 3R7DA 1P29A 5IARA 3ZWMA 3TDNA 2PQ2A 2XNJA 4EUNA 5JXHA 2C07A 1M2OA 2A3NA 3SR4A 1MIOB 2WW8A 3AESB 3OX4A 2PJUA 2ZYUX 5GONA 1R8SA 2QP9X 1RBYA 3DBLA 2Y66A 1QH1B 3P71T 3W8DA 2JVIA 4KQKA 3LCRA 1P9RA 1WDMA 4QM7A 2XE4A 1N9KA 2UVPA 1SUSA 3I6IA 1RAHA 3M33A 3G9ZA 3PQDA 2J4CA 4CV2A 4A6EA 4QTYA 3LSYA 1E1CA 2IVFA 4J0QA 2IEAA 3AP2A 3I61A 4C4XA 2C98A 3BULA 4FXOA 5KSZA 3GJRA 1U7WA 2X5OA 3T3NA 2Y77A 3C3WA 4ZAWA 5LMNB 4OGLA 3F9CA 1REQA 1T1SA 3HUUA 1T2EA 1T3TA 1ZSYA 1QVAA 2C3MA 2JF0A 4LE0A 1XTKA 2J5RA 4F9TA 4IEEA 5KQPA 2X4IA 1I7PA 5F7ZA 4WINA 3UUGA 4JITA 3CTMA 4C0LA 1B74A 4I9FA 3AUAA 2WWVD 1B6SA 3GGPA 5G0UA 2W2KA 3C3PA 4NY1A 3W0LB 1X1SA 1YONA 2BE7A 3F71A 5IH3A 2ZPUA 3E7WA 3OQHA 4YAUA 4ZQHA 2A9RA 3L7IA 5FO1A 2PV7A 5B55A 5U4XA 3OM1A 3KFLA 3EG9A 2YOGA 2X7XA 1JPVA 1MAUA 4P4UA 5DDIP 2AI2A 1YNSA 1SCUA 1KC3A 1RM5A 2I3BA 1BROA 3CWCA 5AW5A 2JEYA 3PU6A 4GI5A 4ZCLA 1JFTA 3AVUA 2VKTA 4HSGA 4M1QA 4FT2A 1WULS 2M1ZA 2LKDA 3T3IA 1T5SA 2M6SA 3D3EA 3HXMA 1HM5A 3AF1A 2CXRA 4D8XA 1L5KA 2JIOA 3RC8A 2D6FA 2EKDA 3BB3A 2QD5A 1E5LA 1C41A 3MWJA 3A1WA 2PZAA 3UJ8A 1WKBA 1T9HA 5KB3A 3THYB 1ZWKA 1W581 3KEOA 1YS4A 3FNRA 2D5CA 4PPGA 1C3JA 5JBNA 3VSAA 4NEHB 3VFDA 1TJ3A 1VI6A 3I45A 4CN8A 3G5MA 2GUGA 2CNOA 2NUPA 3PFWO 4L7VA 4E0BA 5CVTA 3ZLJA 3NPMA 3MINB 4XB1A 1DEOA 2VDOB 3GBSA 4A8JB 4DCJA 2OZKA 2HUPA 2EW2A 1BDIA 2HCRA 3M1AA 3BS4A 5KOJB 4I0WB 1FJGB 4N76A 3ANNA 4QL3A 3WDLA 5CIYA 4LTDA 4J16C 2WIBA 4RH1A 1ISGA 4XR9A 2QN6A 4U8HA 4GECA 1AD2A 1QE0A 2WAMA 5T67A 1BE1A 3VV2A 4AX8A 1SMKA 4A7PA 4IUDS 4G8CA 2NU7A 2DCMA 3OAAD 1IBCA 1Z56C 1R5JA 1W5AA 1G0NA 3EGWA 1E5QA 2QUAA 2HJ9A 1IJKA 1X80A 3S6JA 1CQJB 3ZI4A 3RF6A 4B31A 3E84A 4R8LA 3V5NA 4L8VA 1A9XB 2IXGA 4HQFA 1E9BA 3S2IA 4S1PA 5AVXA 2VHWA 2QZSA 2Y0PA 3S81A 5I4IA 3GVPA 5EPOA 3I8SA 2R68A 1SIUA 2ZT5A 4M9CA 1JQAA 2QI9C 3GJ0A 3PXEA 4UU8A 3OPXA 4O0LA 1PV4A 2CD9A 9ABPA 4EDFA 4LBYA 1Z4JA 4HXFB 2YIMA 5EZ5A 3HZHA 3GFGA 1NBEA 2SKDA 4GG1A 3UMYA 4DUPA 3RT1A 3D6MA 1GNVA 2ADFA 3R6GA 4GYKA 4KWTA 3SC4A 3D3KA 3ZWNA 3HCFA 4BAGA 4KQXA 4WHMA 1C29B 1AU9A 1WXDA 5GQSA 1GFIA 5CDFA 2XDYA 1W1WA 1N3LA 3KUCA 4Q66C 4YCLA 1ZC3A 4JU9A 2O3UA 2ZP1A 3D7LA 2NUBA 4J2TA 5CGZA 3TRDA 2JAQA 4CDNA 2P5SA 1KHHA 4X00A 3RT9A 4OF4A 4AZSA 4BN4A 7REQB 3BMNA 1F5NA 1MAHA 2FTKE 5LYJA 3WRYC 2HRDA 4BQEA 4RTLA 5DU2A 3T3HA 3GHHA 1JDJA 5EIBD 1E32A 4J9VA 2LWIA 4O0MA 3RFXA 3ZOZA 1HPLA 1W85A 1FSFA 2GARA 2H3HA 3OZEA 3OC6A 1BWRA 2PKQP 1D2AA 4N5MA 4NK5A 4WDQA 4DMUB 3A4LA 3KE8A 4O25A 1EFPB 2D1RA 2I4MA 5EE1A 4DSZA 1GTSA 1E1RA 3LY9A 3QEMA 1GKIA 2CKDA 3KKZA 4KQHA 3VZRA 4M21A 3MG9A 5ADWA 5JALA 3K1AA 5EJ2A 3PF8A 2CDAA 2OV4A 3DHNA 5LXTF 4Q9NA 1FFXA 1GNQA 1ZXBA 3M6MD 3RADC 4ZOLB 4F2PA 3R9XB 3KD2A 1GGMA 3H5RA 4RTQA 1CFJA 1FTNA 3K53A 3KSDO 3MFYA 1WDWB 2LE0A 3OIFA 5F7XA 1JIUA 3N3AC 1G16A 2PQ6A 2GXUA 3BWCA 3Q7EA 3UFXA 3KYDB 5EQTA 4CMIA 1GPH1 4PYOA 2I03A 1P61B 3X1KA 1V3UA 2VJYA 3TKAA 1QE3A 3QX9A 4MR9A 2JIBA 5FBKA 1BD3A 3ILHA 1VKOA 2B1GA 3B7PA 4MGEA 3A1SA 3BZWA 4Y0AA 2W2MA 5K0CA 4ZQBA 1T2FA 4PHHA 2WWGA 2EIHA 1U2RA 2L17A 5EE5B 1KK0A 1WJGA 2RH5A 1ZM7A 3PNKA 5AJUA 3E22B 4F4HA 4RS4A 3ZHTA 5AOVA 1ZJWA 1CY8A 5G1OA 4RIGA 1PO7A 2JFXA 1JE1A 1WD5A 1YV9A 4CEJA 4JASB 4EGQA 4Z4GA 4Y67A 5HS6A 2VT2A 3OTGA 3OFJA 1TAHA 3ONEA 3B1WA 4M0MA 2CL0X 1I24A 1OH8A 2XZTA 2YHSA 4TS1A 1NP6A 4X1OA 5F1OA 1JR3A 3A26A 4MITA 2Y1EA 4I08A 4JJEA 3Q6NA 2JLZA 1YI8A 4KQ6A 1WZUA 5CVVA 2PX6A 2VDNB 1IHPA 3G23A 1YZLA 4HDRB 4HZUA 2LXNA 4FFRA 5CJ2A 5KYWA 1YK0A 3ITNA 2CXNA 1LVUA 1RPAA 1VCMA 4YDSA 4GP6A 3F6BX 4ONEA 5DHTA 3DL0A 3DE3X 2PU5A 1P6QA 3G5UA 1L5FA 1YL7A 2BSAA 3EWAA 4AWBA 3CMMA 4UVHA 4GYJA 2UV8A 1Z0JA 3C43A 2P4UA 4AJOA 2CC2A 1Q7CA 3DBIA 1GD1O 5EERA 1YR1A 1N0HA 1P72A 3FZYA 1ZNZA 4MS1A 3QW4B 2Z2YA 4QTXA 4R2LA 5AI6A 5ERGB 3VTAA 3TSWA 1C7FA 4ZT6A 2R751 5BV0A 2HREA 4LC9A 1VXRA 3LECA 2CCJA 1P5FA 5LBIA 4OB8A 1AKQA 5CDYA 1D2RA 1UZLA 3TNYA 2V98A 2BD0A 4UM9D 5HIKA 3OCXA 2DUMA 1RQNA 2HV8A 5EJFA 3N9IA 1U4SA 1Z62A 3SKVA 4QXQA 2J0UB 3HDYA 5BN3A 3UA4A 2WABA 4FFLA 2A5LA 2PD3A 2I54A 4TZTA 4EBBA 2XY4A 4WGFA 4GF5A 4Q7QA 1UOQA 2JIDA 3F8WA 4FZ5A 6ADHA 1DC8A 3LT2A 5F9FA 3HVKA 3ZVNA 3THXB 1DMSA 1NQVA 4F3KA 2OHJA 4AM8A 1FLDA 1USIA 4JVSB 1SUEA 2EJWA 2HLDA 4PAOA 2X8JA 4R1LA 3TS1A 1AE1A 2ZYTX 5JAIA 3N53A 4IDAA 1SRRA 4OATA 4W5RA 3QY0A 4G85A 3MK31 4EYKA 1EIWA 1QCZA 5IBRA 5JS7A 2EC5A 1ZJYA 2XMZA 1CIJA 3QF4A 1ETUA 3RU9A 5HXAA 2KM1A 4KH1A 4ND2A 3L1VA 1DSSG 3DBRA 5K0EA 3K92A 4B71A 3DNFA 2FFRA 2N1MA 3WL5A 1NZJA 4FCTA 4BZWA 4MS4B 1JG2A 3MPOA 5IC4A 4Z4FA 4CEIB 5K3BA 1OZHA 4PZCA 4FOOA 4UC0A 1GAWA 1V11A 4EF4A 4FW9A 2QYHA 1PWZA 5CFQA 4F92B 3GLHE 1MGPA 3HKEB 5JZOA 1Z75A 4KK3A 3KL2A 4Q7LA 5E9AA 1DQNA 2BM9A 2G7ZA 1P8JA 4ARZA 4YDQA 1XTIA 1PWYE 1YRQA 2CFRA 4LRTB 4CR6A 2HIGA 1MXHA 2HMTA 1EFDN 4DNQA 1YS6A 1YCDA 1TU4A 3GCWA 1GPLA 2V97A 3K1ZA 2O1EA 4Y9UA 4CQJA 4HS4A 2H1VA 4B2YA 3CZRA 4TPKA 3N2ZB 3QU2A 3FETA 4U3JB 4X3CA 2NU9A 3OEHD 2ZRQA 1OREA 1XWWA 4FR0A 1V7ZA 2ZRJA 1K8XB 2WZBA 1W5FA 2BZGA 4NK4A 1NI4A 3A1EA 4L0QA 1NV8A 1P9OA 1J2EA 2CVZA 2OGZA 3HNRA 4GPTA 3CZ5A 5TB5A 5IKMA 1CVLA 1DIOB 2GRJA 4P6VF 3KAJA 5DO9A 5IZCC 4O4HB 4EO4A 1ECBA 1UANA 4IDBA 1B16A 1F12A 3PQ2A 3HRKA 2RH4A 1S0UA 4IAOA 1IIBA 1WB6A 4BMYA 3AUTA 1UM9A 2O8CA 4G2TA 4JP8A 1LK0A 1A1SA 3PWKA 1OMOA 1PS0A 4EKNB 2VYND 3CUTA 1Y5IA 3VC3A 1SR8A 4FR5A 4WESA 5DM70 1QG4A 1JILA 1BHQ1 1B2LA 2AEMA 4OHWA 4QOHA 2E37A 2QT0A 5BUQA 5ESXA 1XLTC 5HIMA 4JVLA 5AICA 2HCTA 2VO1A 4ERXA 5CD9A 1XTSA 1XPRA 2ZTLA 1TKAA 5F52A 3RTDA 4B3IA 4TV8F 1AB5A 4AJ2A 1KRWA 4FNMA 2BUCA 5JQGA 1PZEA 2Z58A 3T4XA 2PLNA 3THOA 1VKJA 3LF2A 3CH5A 1JPUA 1YH3A 3K0KA 5E4YA 1KO1A 1H8ED 2HDHA 2KB0A 1X0VA 2OGSA 3GBVA 5HEKA 5TT1A 4AS3A 2C5LA 2F1JA 4YH1A 3UUWA 2ZVDA 3L4SO 3JQAB 4M86A 3RWOA 2W90A 3VI3B 2OVFA 2AOVA 1OFIA 2FCAA 2X9VA 4H16A 4RPKA 1CE8B 3EDOA 2L2QA 1VLMA 1HR0B 3KQTA 1U04A 3WKBA 2LP4Y 4PONA 3ZWQA 2HT1A