4JS0A

Complex of cdc42 with the crib-pr domain of irsp53
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4js0A00
1KK2A 2R2AA 5JFGA 3BRWD 2D3WA 2GF9A 3E1SA 3OF5A 4CEHB 1VCNA 1DELA 3UIEA 4YMSA 3RDPA 3ETLA 3REFA 5DHAA 4MUBA 2A5GA 1KHTA 4BLSA 4D0NA 5K8UA 3THOA 1IAQA 3CF2A 3BH6A 2GRJA 1W0KA 4M1OA 1LVGA 1E2PA 2XTNA 5FUYA 1EG7A 1BO6A 4BFTA 2ZQ5A 1XWIA 2NPIA 1DAGA 1ZUIA 4EPRA 1R8SA 1ESMA 3T1VA 3P4XA 5D3QA 2YNMA 4F4JA 1TF2A 2JDID 1ZM2A 1R2QA 3DVLA 2O0JA 2IK8A 4BLQA 4PC1A 3W8NA 4LPSA 4DT1B 2A9KA 1F6BA 1DO0A 2GJSA 1KI6B 3HR8A 3TK1A 1FZQA 4EQ6A 3QKUA 2BOVA 2UVQA 3GJ3A 4RZ2A 521PA 4ON9A 3FHOA 2ZU6A 2D4HA 1MRSA 1HT1E 1CR1A 2ZI7A 3SBDA 2Z43A 4MRRA 4YONB 1XTRA 4JT4A 1WBDA 1Z6TA 4XWOA 2X1VA 1XMSA 2BMDA 3PV0A 4IOLA 4V0NA 4Z51A 2V3CC 1SHZA 4TYNA 1YKSA 3NBZC 3NC1C 4PZZA 4UXIA 4EPVA 1ZAKA 1J8YF 1GDDA 3LVQE 5JEEA 2Q3FA 2Z4SA 3GFOA 1WRBA 4IEIA 2CCGA 2NTYC 2QSZA 4LJYA 4US2R 3SYLA 1L8QA 1NVVQ 4B3DA 3HJNA 4D4MA 2WWIA 2AFIE 1JB1A 4IFBA 3DZ8A 1F2TA 1OT3A 1XXHA 5G53C 5KNCA 1A82A 1KK0A 3IDQA 4MYTA 2CCJA 1BH2A 3CX6A 1EX7A 4C3ZA 2NG1A 3UMFA 2G0TA 2RB4A 3EZFA 4KODA 1M7GA 2BEKA 3T35A 1US8B 4H1UA 2W6ID 2IYWA 1UKYA 5JI2E 1O87A 3W6OA 3E70C 1T5LA 4DVGA 4KO8A 3KQHA 1CBUA 4AG5A 3ICEA 5KSPA 1G1MA 5F9FA 1IBRA 3LW8A 4Q1CA 4F93B 4IOKA 3PVSA 1YJ5A 3SE0A 3X1YA 4V0OA 5CITA 2IEYA 2ZAMA 2G6BA 4QFMA 2JLWA 2WJYA 4G1UC 4DDWA 5JCZA 4LY6A 1X6VA 3RS4A 1RRCA 2R8RA 3EC2A 4HAVA 4GSYA 3ASYA 2ZJYA 2GVDC 4WOPA 2EFCB 3QQ5A 4XSGA 4Q02A 5SZIA 1A7JA 4CZ2A 3PITA 4JVLA 2IWRA 3TQCA 1EX6A 4DCTA 1JECA 2BKEA 1G3QA 1FP7A 1UF9A 1U90A 5DN6D 4LGMA 5LB2A 5J4LA 1BMFD 1XEFA 4DBLC 2DWQA 2Z83A 4AD8A 1IN5A 3M6AA 5GVRA 2RMKA 2IC5A 1F2UA 2IS6A 1XZQA 2ZVQX 2GWHA 1JR6A 2ZANA 2QPTA 1FNMA 3QOFA 3ADDA 2ZUDA 2OBMA 1GL7A 2NPFA 4P32A 1JBKA 2VP0A 4M1TA 1NMXA 5F3WB 1R0WA 4TTRA 3EWAA 3BBPA 3MSXA 1OH5A 2AD1A 4BGDA 3CZQA 2KI5A 3A36A 1OB5A 2CE7A 4URZR 5EP3A 3C14C 4Q03A 1N5KA 1HA3A 1U98A 1XU4A 3W5IA 1NVXQ 4GMXA 1AKYA 3KTAA 4B74A 2IW3A 3LXRA 3OE7A 4C0HA 1K8RA 2ZSBA 4NH0A 1U0LA 4RFSA 2W6JD 3GLFA 4TZ6A 5FOSA 2B7BA 3K0FA 1P2SA 2AR7A 2QL6A 5KPJA 1Q1BA 1X1SA 4CEJA 5E3HA 1AJEA 1FQJA 1E2QA 3QJYA 4I81A 3DMNA 1XPOA 4I1SA 1SXJC 2N42A 1KSJA 4OHYA 2JCSA 2ZYUX 3ZGXA 2D74A 3VKHA 1KYIA 5TV2A 4F7WA 1VG1A 1NLZA 4OQMA 3CH5A 2IX3A 4OQFA 2FE4A 2HCBA 2FGKA 1D8TA 3X1ZA 3MMPA 2ZS8A 4CW7A 3HR7A 2BBWA 1XMJA 2WKRA 1Q22A 1UKEA 2F1HA 5TARA 3A8TA 3I1FA 3SBEA 3OFND 1U94A 4M9XA 4HAWA 3A4LA 2OZEA 2ZI6A 1S9HA 1F60A 4GNKA 4WIAA 3W6NA 2ZR9A 3EXAA 4HLUC 1R0XA 2IYVA 1KI7A 3QF7A 4DLVA 2HT1A 4PO1A 3K0CA 2AWNA 4UKDA 1SULA 3FVQA 4B47A 3TLXA 2QP9X 1ZD9A 1AA9A 1E69A 3CWZA 4AI6A 1M74A 1OF1A 4GRAA 1YR8A 2IYXA 2VSXA 2QPOA 2WVJA 5CDFE 3UPUA 3U4QB 2F1JA 4QL3A 5BW8A 1HEIA 2G9NA 4DIDA 2OHFA 1VPLA 4AKEA 3L0IB 4MKGA 1XP8A 5IT5A 1N6KA 2V7QA 4LYHA 4Q4AB 2QU8A 1OIXA 1DAFA 2DFTA 1G3UA 4GBMA 4OHVA 1LTQA 3MWLA 1OFUX 1ZM4A 3CX7A 4B6EA 3R8FA 4M9ZA 3A1WA 1RRPA 4XIGS 3QXHA 1E9CA 1RFLA 2FDCA 2DB3A 2ZM5A 3TW4A 3KJGA 3LDAA 2PBRA 4PAQA 3OESA 3K0EA 4QRHA 3DL0A 1TADA 4TMZA 4PC6A 3IIJA 3MCAA 2LWIA 1OIVA 5DHFA 5B58C 2P2LA 5HCNA 1QZXA 1ZW6A 3HDTA 4Q66C 3SHFA 1SVKA 2QENA 4UNNA 2G1JA 3KQUA 1UDXA 2Q0HA 1PUJA 2QG6A 4Q7KA 2PLRA 2ZITA 3EASA 1ZRHA 2KBEA 1GL9B 3A4MA 4CT4B 1SVIA 2IYUA 4Z8XA 1S1MA 4Q19A 1J2JA 4HAZA 1OXVA 3LD9A 4C9BA 3C41J 1Z07A 1E2LA 4KAXA 2Z0MA 5KU1A 3NKVA 5UKDA 2ZJZA 2DFKB 4QHSA 4HUTA 4GDFA 1Z6AA 4Q7LA 1HV8A 3IO3A 3QKSA 4FI3C 3QPUA 4LHVA 4KV9A 1BIFA 3QXXA 3C5CA 5BYJA 3KQKA 2CEAA 2AHOA 1N5JA 3N5CA 3WNBA 2OG2A 2QPAA 4GZLA 2ZREA 2GK6A 1MKYA 2ZSDA 2QQ0A 1OYWA 2GCPA 4M1WA 5SZHB 4QKQA 1NN5A 2QN6A 2WICA 3ZYCA 4A92A 4EJSA 2ZRGA 3R9IA 1ZC4A 4DWJA 4DSNA 2D2FA 4W5HA 1W47A 4WBSA 1TU3A 1T8TA 3LBIA 2O0KA 1YHNA 2HJGA 3K70D 2GEUA 3NXSA 2WWHA 4A0GA 4BEJA 4R2IA 4LSGA 1IY0A 3RSLA 1XXHE 2FH5B 5L3SA 3TQFA 5JJIA 3LRPA 4X8MA 3LQRA 2XEXA 2Q3MA 1XCPA 1ZVQA 2VF8A 3KFXA 1G4UR 1II8A 1CJUC 1ESNA 3OE7D 4DCVA 4PHTA 2LCFA 4WW0A 5JLJA 1E0AA 1P2UA 1Z6XA 1JNYA 2ZE8A 2RGXA 4XTCS 4YXWD 3IBYA 2FEOA 2GK7A 3PENA 3AVXA 3GCGA 2AX4A 2ZS9A 2FWRA 2O8DB 2IXEA 2RGGA 2H57A 2GZAA 4QNRA 4ZDIA 1CS4C 3X1DA 3K1JA 4MGYR 3LO5A 2CL0X 3FKSD 4OQLA 1E2NA 2PT7A 2P6RA 3QVVA 2I1QA 2WJIA 3H2YA 1IOZA 5TXGA 2QAGA 2VTKA 4IFEA 5FR2A 3K0SA 2CL6X 2ZJAA 3CRRA 2J0UB 2B8TA 1OFIA 4AYTA 4NCHA 1SGWA 5TY0A 2YWEA 3EAQA 3GJ6A 1OH6A 4DDTA 1N2CE 3TBKA 4HB3A 2O8BA 2ZE7A 4DSUA 1OXTA 4B3XA 1MH1A 4LHXA 3X1XA 1S0UA 2VIIA 3OAAA 4DUGA 4EKDA 5HPYB 3THYA 5JS8A 2P6UA 3GFTA 3P26A 3I32A 5TMPA 4EPWA 3AUXA 2F43A 1KI3A 4EAQA 1W4BA 1VCOA 5G3YA 3P32A 4A1FA 3EPKA 2J59A 1EWRA 4CGZA 3AKDA 1FL9A 3SR0A 1HURA 4AKGA 1G5RA 5JJLA 3MWKA 1GRRA 4TQ9A 1P72A 2GF0A 4BZXA 3UANA 3THWB 4LYJA 4RFVA 2J5XA 3IPYA 2FPMA 1XTKA 2C03A 1OXSC 1VKJA 2C99A 5CLQA 1GTVA 2OILA 1IM2A 3GLFE 3GLIB 2WIAA 2OO7A 3TIFA 2PX0A 4LWZA 3O8BA 4LJ9A 4OI2A 2GESA 3DDCA 4F38A 4EPXA 2RHMA 3IILA 1ZP6A 1OB2A 4C2UA 5FL3A 1NSTA 1HH4A 2CLDX 3KJIA 4I4LA 5KDLA 3NIBA 1XFAA 3VR1A 2W0SA 4RCYA 3VNVA 1TUEA 1YZNA 3B13B 1E3MA 3OIWA 4E07A 3R20A 2HF8A 3OZXA 3ZJYA 2W2XA 1X8KA 1UBGA 1SKYE 2XNDA 1XRJA 3L0OA 1U8YA 2NO9A 3NBYC 1JI0A 4PHGA 3AVPA 1KSFX 3GJ4A 3GLGB 3JZAA 4N0EA 1N5LA 1P3JA 3PUZA 5EE1A 1UDWA 2QSYA 4NZYA 2ZS7A 3EPLA 1XF9A 3QXSA 3CPJB 4HUQA 4RSGA 4QBHA 2GCOA 4US0R 3VU9A 1W1WA 1ZIPA 3U3MA 4A0FA 2ZJ2A 2RGNC 4M9SA 1OYYA 2FSHA 3O47A 1SVMA 2QT1A 4RCZA 1FPMA 3KUDA 2ANBA 5FTLA 5JI3E 4M0LA 2PCLA 2QA5A 3KJHA 4TYWA 3GLIE 4MKHA 4A8JB 1XTIA 1MV5A 2EFHB 1OSNA 3BAFA 2ASEA 1F3OA 1E2EA 1CJVC 1EFHA 3RAPR 3HPRA 1GOTA 1NN1A 4JKIA 4US1R 4XJXA 2P5TB 2VA8A 3EWSA 3KDSE 4A2QA 4URWR 5EZ5A 2FN4A 2V55B 3KKOA 3H1TA 4XWAA 1CIPA 3RYTC 2IXFA 2HXYA 1FP6A 3WMGA 1U9IA 3KUCA 2GBLC 4MQBA 5KDDA 4DT1A 3B5JA 2BJVA 2IS4A 1NF3A 3DEFA 1KOFA 3CWQA 4XSHA 1E9SA 1CR0A 2F9LA 2P0EA 1NN3A 3T61A 4NKRA 2XSZD 4PO9A 3WBJA 2F3RA 3K9NA 2BCJQ 3A1UA 3JVVA 4B6FA 5TVKA 3U3KA 4ZV4A 4MKFA 4OKSA 3BERA 2F1RA 3KZ1E 4Y0AA 2WKPA 1C4OA 4LUCA 1UBEA 2O8EA 4BE7B 3M0EA 3VKWA 1VYVA 2A2ZA 2OLKA 3OHMA 4H1VA 4KI0A 3G0HA 3ICQB 3I72A 4UQOA 1IN7A 5FBWB 4B33A 3U7HB 5B2ZA 1KZ7B 2YKGA 3FMPB 1P9RA 2HXSA 1W48A 4CIDA 2V6IA 3FGNA 4AY2A 3CUEF 1IHUA 1R0ZA 1L4UA 3JVUA 2FPLA 2DFNA 2IYQA 3CX8A 1N25A 3TSOA 4LJ7A 1OW3B 4V0KA 3KX2A 2DCUA 4E5UA 4NDZA 5J4HA 3B7GA 1FUKA 2FA9A 1I2DA 1UBFA 2R6DA 4TLBA 5HE8A 2FMXA 1KI4A 3U7GA 4B76A 4HDOB 3WP0A 1RPZA 4D25A 2O8FA 1US8A 1NBMD 1X1RA 4LK2A 2BM0A 1Z8FA 4LBWA 3UG6A 1N6LA 2W6IA 1KJYA 2I3BA 2P6NA 2QEQA 1E94E 2CVHA 2NIPA 3CZPA 1MO6A 1II9A 1W44A 4TYQA 5B57C 2ORIA 3AM1A 2A3RA 4MYHA 5EXTA 1G7SA 4FMDB 5CJPA 2ERXA 2F55A 3TR5A 2DWPA 1ANKA 4Q7MB 3LFUA 4PPQA 3AVYA 4URVR 2F6RA 2YHSA 3WYFA 1R8QA 2GETA 1L7VC 3PUWA 4IW3B 4LJ4A 2ODWA 3DO6A 3TUIC 3MWJA 4NP6A 1GP2A 1G3IA 3PG5A 4AK9A 4GMDA 2C9CA 4PQFA 1QHIA 4TL7A 4DXAA 5J4VA 1GSIA 4HAYA 4NYJQ 2BJWA 2BHRA 4ZKEA 1G5PA 2R6CA 4OJKA 4C0BA 5C18A 1BMFA 1GUAA 1YZLA 4KXFB 1T91A 3NBFA 1KO1A 4QHYA 2NO6A 4ZO4A 3AV0B 1ZD1A 4U00A 3KFVA 1UADA 1XD2A 1SVWA 2ECKA 3MAAC 4NYMR 4R9UC 1OE0A 5EE3A 2C77A 1G16A 4URXR 1RRGA 3I3SR 4B32A 4URUR 3LH5A 2GHIA 4K81B 1G8PA 2VHCA 4C30A 2Z6VA 4RD4A 3ECCA 4KU4A 5FTJA 5DI9A 1Q12A 3CRQA 1UBCA 4QM6A 3GJ0A 2H7VA 1A2BA 2ZJ8A 3EZ6A 4TL8A 1QDEA 4QJ4A 1UKZA 4PC7A 2W6JA 2EFDB 5IHPA 3RRNA 3WRXC 2C96A 3LV8A 1KNXA 2R6AA 3TJZA 3VFDA 2X19A 4B2PA 4Q9LA 1EFRD 4O2RA 4X8LA 1J7KA 1IY2A 2G77B 1C1YA 1AZTA 3ZIAD 2ONKA 3WMFA 4HDQB 2G1KA 1OLOA 2CMKA 1OJLA 1H8HD 4JBYA 2WAXA 2ZVPX 3C7KA 4PSKA 5DSZA 1MO4A 2F1IA 3VAAA 3BWDD 3ZZ0A 2ZETA 3KXKA 5F98A 1N0VC 4NHOA 1S8FA 1GVNB 4LV8B 2WOJA 2B8WA 3OFNA 1SXJD 1E1RD 4BLPA 1YR9A 4IJMA 1IQPA 4JYBA 1P9NA 1EXMA 1SXJB 2P65A 1SQ5A 1X3SA 4UXJA 5JEDA 3NC0C 3SJAA 4QM7A 1Q3HA 3DPUA 3SQXA 4JLPA 8OHMA 4P4TA 2J46A 1PV4A 1X86B 4JLAA 4F92B 4KITB 1FW6A 2REOA 2WJJA 3IKJA 3BOSA 4XOIA 4FINA 3OIVA 1M8PA 2XITA 1RVDA 4LJ6A 1M7BA 5L8VA 3U4QA 3TAHA 1E98A 3NG1A 2XZLA 3Q9LA 1E0SA 4P4UA 2CL7X 2CK3D 3ZZUA 5FOWA 4TLCA 3WYAA 4Q4AA 4WZAE 4DLUA 3FMIA 1TF7A 2MMCA 3QG5A 2QBYB 2FU5C 721PA 2VHQA 4D80A 1GILA 3T5GA 1KK1A 4OQNA 5EP4A 2ZYTX 5AJYA 1JEEA 3GEIA 1BKDR 1OIWA 5J40A 2YZ2A 1PVOA 4RKFA 4WZBE 3I61A 5C46F 1VHLA 1UEIA 1WE2A 1NJGA 1PLJA 2PZFA 2CXXA 3QNUA 4ACAA 1NY5A 2PJRA 4Z54A 3BC1A 3HP1A 3THXB 4N1AA 2X2FA 1ZNWA 1G17A 4A82A 1M2OB 2G3YA 1J70A 5A5GA 3FMFA 3ONWA 5GADl 4RY2A 4D26A 3GQBA 4BZQA 1VTKA 2WJHA 1A5TA 3KB2A 2G0NA 3BFVA 1RRFA 2QY9A 5CK4A 1ETUA 4DC9A 1GFIA 3QEOA 1NMYA 4OK3A 4FWTA 1KY3A 1NI3A 3LLUA 2FX3A 3MD0A 1XX6A 5JWRA 2ERYA 3LBNA 3OIUA 1YU9A 3BFKA 3PEVA 2QP4A 3K09C 2H18A 4G5SA 4DLSA 4Q9KA 4RD0A 4CYMA 3AVQA 1V5WA 1Z47A 4G0NA 3RVBA 1QG2A 1Z83A 2NO1A 3QSYA 3B1VA 3W34A 2VO1A 4WZ6A 3SS8A 2BEJA 2KB0A 1KI9A 1ODFA 5FI0B 1G8YA 2QTHA 1E2HA 4KLZA 4M9QA 5C2JB 2P67A 1AIPA 4LHYA 3FMOB 3ZDQA 3AUYA 4LC1A 4Q48A 2B21A 3B85A 5GJCA 1AS3A 5AUQA 4LPKA 1PZNA 3WY9A 2G88A 2ODBA 5BYKA 4AURA 4BFZA 4WVFA 4QBIA 1YZKA 1NVVR 5EUQB 5JZVA 1QG4A 5CIQA 1LNZA 4KFTA 5DIFA 3S1AA 4Y0VA 4KVGA 2LKCA 3U60B 1G20E 1DADA 1OXUA 4I1VA 4LBVA 1E32A 4L4UA 1AGPA 1E99A 2GJAA 4Z1MD 1JR3D 3IO5A 4PXAA 2CLCX 3CRMA 1RZ3A 1LB1B 2AFHE 4F91B 2J0VA 4QBGB 3B78A 3WHKA 1NG1A 4YXWA 1NP6A 3MJRA 2RKOA 3H0KA 1FMLA 1N6NA 2O8DA 4OBEA 2BV3A 1WXQA 1DG1G 4FCWA 1OPXA 2RCNA 4NYIQ 5JCPA 1W0JD 1TX4B 2JLYA 4RVCA 4TLEA 4EUNA 2REXB 3SJBA 3FKSA 2BCGY 2PCJA 2YVUA 4JBWA 4RZ3A 4DB2A 3OEHD 2IBMA 1R0YA 2IUSA 1U8AA 3TNFA 3KKQA 2NQ2C 2J0UA 1CJTC 3TMKA 2WWYA 4WXRA 3GJ7A 1Q57A 1R5BA 3QXCA 3CPEA 5KNBA 2KE5A 4RD2A 2GBLA 2IA5A 4CDGA 3B8HA 1VYUA 3IQWA 5CIWA 2JJ8A 2ZRKA 4W5JA 5JBQA 4ZI3A 4II7A 4ESVA 2AD5A 2OFXA 3R7WA 2AL7A 3SEAA 1U2RA 2VYFA 3LQQA 3IPXA 3O8RA 2FSFA 2QI9C 4BLOA 1UFQA 2QMOA 1VYTA 2KSQA 3WMEA 4PZLA 4UXHA 3Q72A 4C2TA 4LZZA 4ZPXA 4R2HA 3SZRA 1Z3IX 2WMOB 2DBYA 5FPYA 3ADKA 1ZBDA 1E4YA 3MRSA 3TSWA 1KAGA 4Q4JB 5E95A 3H84A 1ZJ6A 1QF9A 2C8VA 1KSGA 3SNHA 1E4VA 2C78A 3ZQ6A 1VMAA 4GL2A 1DO2A 4HSEA 2ZJOA 4PX9A 1WQ1R 1BS1A 2XOKD 3UG7A 1S3GA 3B9PA 1YR6A 2A5FA 3GLIA 2IF2A 2O52A 3QF4A 2QNRA 4HEJA 4GZMA 2YV5A 1QHNA 2VEDA 4NU0A 1S9DA 1IY1A 5EXXA 5CB6A 1AZSC 3LY5A 4TTQA 3U3JA 2C9OA 3M4YA 1JJ7A 1ONBA 1IN4A 3RRZA 2E1RA 1NSFA 2IXGA 4KVAA 4K46A 5FUWA 4R71A 2MSEB 1ZC3A 4GPTA 4KJZA 1DS6A 2IHBA 2WM9B 5CJ2A 2WWFA 4DSOA 1U0HC 4BASA 1KK3A 1XJQA 1ZNXA 2WWWA 2ZRIA 4URYR 3NVAA 3I5YA 1ZU5A 1L2TA 2AXNA 3CPHA 5GJVC 3KXLA 2PX3A 3P20A 2HUPA 2JA1A 5LD2C 2KJQA 4IXNA 2EWVA 1HQCA 1W46A 3DOEA 4LCBA 1Z5ZA 1FX0B 2WTUA 3DM9B 1JAHA 5EE0A 2IYLD 2GAAA 2GKSA 3NTUA 1E9DA 5HZKA 3IQXA 1IJEA 1QHGA 2MSDB 3GLGA 3CNNA 4IEEA 1ZYUA 2DWOA 2GJ9A 4PC2A 4HB0A 3PEWA 2E87A 2BM1A 2QMEA 3AGPA 1I4DD 1P73A 3A4NA 4JLMA 2NZJA 3AVUA 1D6JA 3SJZA 2DPXA 1JPJA 3KKMA 3V00A 3L8YA 3DM5A 3NEJA 2V6JA 3BS4A 2OXRA 3AKYA 2IS1A 3I92A 4OYHA 2A30A 4TN1A 4OI0A 1PLKA 3F8TA 4LC0A 4UNPA 3SC3A 5BWMA 5FFMA 4CT5A 1XTQA 4LV5B 1OHHD 3GLHB 4A8JA 3LLMA 3B1ZA 4M1SA 3FTQA 4MH0R 1G3RA 1SVOA 5K8IA 5IDVA 1UEJA 4XD7D 4BQSA 1G8FA 3VMFA 3GD7A 3C8UA 1KIMA 2FJUA 2J45A 4AYWA 1RJ9B 4BRWA 1VIYA 1IJFA 3HU3A 2RHDA 3MLEA 3ZVLA 1NVUQ 2ZRDA 221PA 3CF6R 2ZRCA 4DSTA 4E09A 2JIZD 4MRSA 5J4KA 4I99A 3FDIA 4AC9A 3VR5A 3D8BA 4KFRA 1YVDA 2ZE5A 3PXGA 2ZYVX 2QORA 3BXZA 4UNQA 2FZ4A 2H5EA 3FFAA 3B6EA 1JAIA 3BIFA 2OLJA 3I73A 3VKGA 1VCMA 3BGWA 3QY0A 1E96A 5JSZA 1T9HA 3Q5DA 3T15A 2JLUA 2XSZA 4OQXA 2JEOA 1V43A 2AWOA 3AF0A 3VR4A 3KTAB 5EXSA 1CXZA 3BFXA 1YQTA 1TTTA 4RZXA 1ZD8A 1E79A 2JJ1D 1CR4A 2SHKA 3PUYA 1JEDA 1XMVA 6Q21A 3FFBA 2A5DA 4OHXA 1O3YA 5EUMA 3LX5A 4C0QC 4PQRA 2KWIA 4UJ3A 2BMEA 1QHSA 4D4LA 5D3MB 4DLZA 4MRNA 4V0MA 2HF9A 1Z2CA 2OEPA 4LX0A 4WA7A 4TSFD 2V1UA 1D9XA 3T1QA 2OESA 1E2IA 1XZPA 1DAEA 4M53A 2B7CA 3VR6A 1E2KA 3MWYW 1KSHA 1RW4A 5ANRB 3EZ9A 1JALA 1GWNA 2W0MA 3BB1A 4S35A 4E22A 4MA4A 4LI0A 3VTKA 4PZYA 4Q9HA 5A0FA 3DZDA 3W6PA 3EC1A 2FFHA 3ZS9A 1NIJA 4MITA 1EGAA 2D2EA 5H8WA 5G3ZA 3KKPA 3AKCA 2CBZA 3L0PA 1B0UA 1NBMA 4GFDA 1GIAA 4PPNA 4Q5IA 3IEVA 5LPNA 5EQTA 3CNLA 2J3EA 3QUSA 5SZKB 4OK5A 4MGIR 4O0MA 4MDEA 4KLNA 4LV6A 3L43A 3RABA 3T5DA 4B75A 5J4YA 1LS6A 4DLYA 1W4RA 4E03A 4X8HA 3U6BA 3DMDA 3AVOA 3G5UA 4L9WA 4LBYA 5DLQC 4JSTA 1W2GA 2A78A 4RZUA 1G291 1RIFA 1ZCAA 2FG5A 4IDHA 4KSBA 3K9LA 1I2MA 2OCAA 4QJ3A 2K5UA 2GTPA 3AP3A 4DZZA 1E9RA 1KO8A 4LJAA 1HE1C 4POAA 1VHTA 4C0JA 3WXMA 5E7JA 4D6PA 3B82A 4CVNA 4LOAA 2WV9A 2ZR7A 1KDRA 3P4YA 5KOYA 2XZPA 2OM2A 1SZPA 1YE8A 1HTWA 1D2NA 1Q21A 2O8CB 2QM7A 4JYCA 1JQJC 5JECA 3DKVA 1DTSA 2AKYA 1LY1A 4TMKA 3BH7A 2FSIA 4B43A 2IT1A 4Q7JB 1R5NA 1P9WA 5FBVB 1NG9A 2WPDD 5KPDA 1CKEA 4G5QA 4U7DA 3MFYA 4NBSA 2NO0A 1YRAA 2GXSA 2TMKA 1LW7A 4O25A 4TQUS 5KDOA 4MKIA 3QI2A 3LA6A 3RRMA 4GP7A 5J5CA 4B3FX 4TLAA 4C0KA 2O5VA 1DG3A 4XTRA 2WSSA 3QKSB 3IBGA 1Z0FA 3VX4A 3PUXA 4DCNA 5JHHB 1ZM7A 2PEZA 4A2WA 4CEHA 4PR0A 1P2TA 1Z0JA 2HV8A 5KSZA 4G5GA 2Q21A 4ASUD 5JWOA 4P33A 5FH9A 1FFHA 3K9GA 3NHAA 5C4GB 4EIWA 1EFRA 5TDHA 2E9SA 2JAQA 2VP6A 3HPQA 4IVQA 4HB2A 3ZIAA 4BFYA 2GZDA 3DKPA 4TYPA 4ZCMA 1OV4A 3HYRA 4MYCA 1G19A 3TGPA 1G18A 1H8HA 4YMVA 3KL4A 2VP5A 1MABB 4JJZA 1E1QD 1K6MA 4FMCB 3T06B 3QVUA 4BECA 2WWXA 2EQBA 4PC3A 4D81A 1BYIA 3TE6A 1P5ZB 3RS0A 1SXJA 1E1RA 1TEVA 1E0KA 5JJKA 2N1BA 4HLQB 2YWGA 4D2IA 1VIAA 3CO5A 2C5LA 2ZTSA 4HZUB 4U5XA 1KI6A 2H8KA 3FHTA 3LXXA 2FF7A 2J87A 3IHWA 2HLDD 1KGDA 1N5IA 2OV2A 4TT3D 4JS0A 1E79D 5KSYA 3GLGE 4L9SA 3IUYA 3U5ZB 3CIOA 1XEXB 5FBLB 2NOAA 3KJEA 1IXZA 2JASA 3PQCA 2ZJBA 5AJWA 4CEIB 1TQ4A 1F5NA 4IDOA 5FR1A 2ZRBA 3BJIC 4HLUA 2EW1A 1COWA 2P3SA 4P4SB 2V4ZA 4JBXA 2CK3A 4O3MA 1R6BX 2ORVA 2GILA 2QBYA 2JJ2D 3AF3A 3K0CC 5KYKA 4F4CA 4FN5A 3CONA 2QE7D 4DB4A 3U61B 4JL5A 3NEYA 1NNEA 1A1VA 1U8ZA 2QAGB 3B1WA 4NPHA 2XZOA 2GEDA 4Q00A 2NZ8A 3A58B 3L8ZA 5FBQB 1LV7A 2DFLA 3E5HA 5DI3B 1XMIA 4TZ0A 4QHTA 4DLRA 1E9AA 2OE2A 1L4YA 3THXA 1GNPA 4A6XA 5BQ5A 3SYNA 1ZM9A 2ZI4A 2R6GA 3FKQA 2H1LA 3NDBB 2PL3A 4FW9A 4HATA 2YOHA 1R5OA 3FB4A 2B92A 1Y63A 2OBNA 2VLIA 5DISB 4Q1AA 3U2QA 3WNDA 1T0JB 4YC7A 3SJCA 4NYMQ 1FOEB 2NO7A 3WP1B 5KSOA 3I8SA 2XXAB 1QRAA 2J41A 3ZD7A 1J90A 1OFHA 1KJWA 1T3HA 3IGFA 1P4SA 2FPKA 3E2IA 3Q7QA 4MRVA 5FPTA 4KHZA 3VX3A 2IL1A 1KMHB 4M1KA 4RD3A 4UNSA 1IONA 3DHWC 1P2VA 4ITRC 1Z08A 3PFIA 3W3ZB 4OK6A 4A6PA 5HKKD 1AGRA 2VP4A 1D9ZA 4WAUA 2BWJA 121PA 4JVNA 4FMBB 2VHTA 2Q9CA 3AP2A 2YC2C 1G7RA 4PTLA 1KTVA 2QUZA 4PHHA 3B2EA 3EA5A 1RE0A 4TMVA 2EU8A 3NH9A 2CHGA 3AF2A 4OI1A 1LFDB 2GJ8A 4N3NA 1DAHA 1NVWQ 3U44B 4V0ME 5AJXA 3B1YA 1WCV1 4ACBA 1Z0AA 2ZUCA 3B9QA 3NH6A 1QHHB 5GVSA 4L16A 3SI7A 2VP9A 4F4IA 4AWXA 1H8ED 2XB4A 1DARA 1XCMA 2J9RA 1XJCA 1P75A 1WP9A 4MDFA 4KYUA 3CH4B 4FMDF 4ZIRB 5IRCD 1KI1A 3BH0A 4LDJA 3I4LA 3D3QA 2W2TA 5CB8A 3ADCA 2FV8A 1KDPA 4QGHA 2FGJA 5H1YA 4FD2A 2ZSAA 4JL8A 4BUJA 4NMMA 3ADBA 2GAOA 2HEIA 2AKAB 4A0HA 4AIIA 4Z1MA 4JZKA 1JR3A 1NBME 3RWOA 1W5TA 2WSSD 1CJMA 2ZI3A 1SVLA 2IYRA 4BLTA 3BORA 4HI0E 2HDNB 1GAJA 2EFGA 2YYZA 4AG6A 3QKRB 3AVVA 3PEYA 5L3QB 2CE2X 1TUIA 4M4SA 4M8NE 1GG2A 1SHKA 4DLTA 3W90A 3EZ2A 4ZDKA 2CJWB 4NCKA 1W0JA 3T34A 1TPZA 1NKTA 4Q47A 2Y8EA 4HZIA 1ZNYA 4MGKR 3RS5A 3C16C 3AB3A 3OEHA 3GFPA 3K8YA 1PLLA 5L3VA 3V4RA 1NL3A 5BN5A 2JLZA 3Q5EA 2O0HA 1MT0A 2OBLA 4ERNA 3AF1A 4KCGA 4C7OB 4NCJA 3CRW1 4OI4A 3RLFA 1DOAA 2J7PD 4FCVA 2YWHA 4NYJR 2PH1A 2A5JA 1A4RA 4B34A 1NN0A 2QZ4A 4A4DA 1MRNA 4ARZB 1EFCA 1OKKA 4PQYA 1YR7A 4LJ8A 5F9HA 2IHYA 2IYYA 3Q8XB 1KKLA 4YMWA 4B35A 2GXUA 5DO9A 3K0AB 2QAGC 2MMGA 4TQAA 4TMTA 1HY3A 4L15A 1TU4A 1E9FA 5E7MA 1JJVA 2PMKA 3P27A 4YQFA 1MO3A 4FIDA 2LKDA 4XVRA 5G40A 2DYKA 3CM0A 4YDHB 1COWD 5CYPA 3NDPA 3NWJA 3RS2A 2F7SA 2GDJA 3TVTA 4Q4JA 3Q7PA 5DYGA 1IN8A 4D4KA 4PANA 2JGNA 4B48A 5FOXA 2IF0A 1DEKA 4YMUA 2I1VB 1SVSA 4YMTA 1YRBA 2QMUA 4PSAA 3V4FA 3WNCA 2ORWA 2XOKA 1XPRA 1NY6A 3RWMB 2PMDA 1XEWY 2Q9BA 1N6PA 2VF7A 1MO5A 3PEUA 3QBTA 2O8EB 4EPTA 5C4MA 1KMQA 1I4TD 3SFZA 3N2IA 4GOKA 4PFSA 2OFWA 5M04A 2FNAA 5E4FA 5LBIA 1KO4A 1W36C 2XB2A 2Q6TA 5EJEA 821PA 3MJHA 3GJXC 4Z8YA 4KBFA 1Q1QA 4M1YA 3LW7A 5CM8B 4HB4A 1UM8A 5EP1A 2ZRNA 4YLGA 3BE4A 1LF0A 1EFTA 2FEMA 4ESHA 1Q20A 1Z0IA 4QOSA 1SXJE 4QG7A 1I4LD 4Q1EA 2V8OA 1GITA 3CLVA 2AN9A 4IVRA 3RANA 3ZH9B 1FX0A 2O8FB 2GXAA 4B73A 2Z4RA 3I62A 3KKNA 3MGCA 5P21A 5EP2A 3K9HA 4JJKA 4J0QA 4PPGA 3TH5A 1P62B 2IEZA 3CF0A 5J47A 1G9XA 1HUQA 3QXJA 1KNQA 3OEED 2CLSA 3QBVA 5LD2B 5AUNB 4ZDWA 4PO8A 1MOZA 5JS7A 2JATA 2HYDA 4LYFA 4B2IA 3PCRB 5FTNA 3EA0A 4Q18A 2CVFA 4FWIB 2BBSA 1G8HA 2FFAA 4K8OA 1Q0UA 3X2SA 4W7SA 2X8AA 3UATA 3I5XA 3AEZA 5AK0A 1M34E 2XX3A 2I4IA 5IK2D 5FOVA 3GLHA 3CKLA 4OL0A 1ZINA 2V54A 3H86A 3U7EB 2ZYWX 3ZQJA 1OHHA 4QJ5A 5FUXA 4LHWA 1G6HA 1Z0KA 3OIYA 4Q4HB 2BBTA 1ZU4A 4A2PA 4OHWA 3J81k 2RAPA 4IOMA 3ZVRA 2OAP1 4XD7A 3IHLA 3LVRE 1E2DA 2RGNA 4JLOA 2HYIC 2GVZC 4WXPA 1RJ9A 4Q1DA 3PJRA 1Z29A 1TMKA 3GEHA 1DAIA 1Z0DA 1P61B 2L0XA 4BFSA 1FUUA 3EIEA 2PZGA 1XD2B 1WDTA 4EPYA 2JIZA 2ZE6A 3EIHA 1TF5A 4N0DA 4G5OA 4C0LA 4QGAA 3EPHA 5FTMA 5B30A 2PLFA 1R7RA 4QXAA 3RS3A 1DAKA 4QGGA 3LBHA 2WJGA 3CRVA 2BC9A 1KJZA 2OCYC 3QPVA 3A6PC 3BD9A 1N6HA 2WHXA 2CDNA 2CNWD 3VHLB 2JJ1A 2WIBA 1EK0A 2B6HA 1A2KC 1XBTA 1U9IC 5AJVB 1XDBA 3T1TA 2OUKA 2VHUA 1HT2E 2R9VA 5D3MA 1OKKD 2BVNA 4LYAA 4B71A 1W0KD 5F2EA 1R10A 1WMSA 2ZI9A 4DKXA 4TSFA 2ANCA 2C95A 2XTZA 5LB4A 1S1CA 4G3XA 1N3BA 4L8GA 2VH5R 3T12A 2DHRA 4M22A 5IF9A 5DYIA 5DNYB 3KQNA 3SU8A 1JXMA 5FUVA 4B3BA 1GNQA 2ZPTX 4LJ5A 5BXQC 3U6KA 1OH7A 3C15C 3JZMA 2JLXA 1GNRA 5KO2A 4GP6A 4OHZA 4ZI2A 3AGQA 1G5TA 1NIPA 1Z6YA 2BMJA 2NGRA 4BFXA 2D7CA 3BB3A 2ZRLA 1E9BA 3THWA 4X8OA 2ZSEA 4NCNA 5FL7A 5AWFC 4EQ6B 1G8GA 5JRJA 5HR5A 1JR3E 1D5CA 2VHJA 4P31A 3K53A 5JRZA 3ZLJA 1W7AA 2FFQA 2UZ3A 4PSVA 1JXOA 1CJKC 3EG5A 2QM8A 1H65A 4GOJA 4JT2A 2W83A 1ZM3A 2WJVA 3A1VA 3CNOA 1VG8A 1XEWX 1IN6A 2BDTA 2OSBA 2UZIR 4QGFA 1WF3A 3AKEA 4DDVA 2ZSFA 4G5RA 3HWSA 4NYIR 1XPUA 2NMVA 4JVMA 2GEVA 1Z28A 1Z6GA 2RGCA 3U3OA 3UKDA 3F3YA 3F0TA 1VG0B 4A0RA 2JLSA 1E2JA 4TL9A 4JLVA 1TQ6A 5K8TA 2YOFA 1AKEA 2XJ9A 2WKQA 5AR1A 4LBZA 3WYGA 3AF4A 2YWFA 4IKEA 1F2TB 3NHBA 1XXHB 2CCKA 2D06A 2Q3HA 2WOOA 3VNUA 1NLYA 3W5JA 5KUTA 4KYIB 2G83A 2O8CA 5BN4A 1AS2A 1B23P 3LWNA 3SFVA 2QQEA 2J0QA 3LAWA 1WA5A 3KQLA 1IXSB 5DGXA 2YINC 4A9AA 3P1JA 2PJZA 1KI2A 5A4JA 2QP3A 2HCJB 5CM9C 4MYUA 2WPDA 3VR3A 3V9PA 1EESA 3UWKA 4ZKDA 1KKMA 2N46A 4GI7A 3W9YA 4DHEA 5ELXA 3R9WA 4PPFA 4JL6A 3L2OB 3EZ7A 5HZHA 2ZRFA 1OXXK 2VP2A 3QIAA 3FHCB 2WZQA 3LX8A 2IUUA 3VR2A 2ONJA 5FOTA 3A1SA 1BYUA 4ZDJA 1CR2A 2ZU0C 2ZRAA 4QC2A 3C5HA 3UMSA 4PHFA 3SQWA 5EXPA 3UXMA 1GZSA 1W4AA 1UAAA 2PEYA 1E2MA 1FQKA 1KO5A 4ASUA 4C4PA 2C98A 1Q1EA 3KB1A 4B2LA 2IWHA 2VQSA 1OH8A 3SYKA 5JHGB 1TAGA 4IRUB 1T5IA 4V02A 1VG9B 3WRYC 1M6NA 3H4MA 1F2UB 2P5SA 1MABA 4JIMA 4DCSA 1CULC 1GRQA 4LHZA 2GCNA 4NL4H 3IIMA 1E1QA 1YZGA 2FSGA 2VSOA 3CR8A 3EARA 3AVWA 3MG9A 1ZUHA 1K5GA 3UWOA 1XD8A 5BN3A 3K70B 4ILEA 4P0TA 2ZIAA 3REGA 3S1AB 3WBKA 5AJZA 2QMHA 5FPSA 3GEEA 1W2HA 2ODEA 4B44A 4HZUA 2ZROA 4AKHA 2ZXUA 2ZEJA 2D7DA 5SZJA 2VSFA 4JKYA 1QHYA 4NONA 4BFUA 1GKIA 4LRWA 1Y3AA 2J0SA 2ZI5A 2HLDA 3EW9A 4HLDA 4JSYA 3PR1A 4V03A 2WMNB 4TT3A 3GLFB 4RFSB 4QNMA 3B60A 1KDTA 2AK3A 4G01B 1XEXA 4IVPA 5DH9A 3K0FB 3GMTA 1WB9A 1R4AA 2R44A 2QAJA 2R62A 4CEIA 3FE2A 3LNCA 4CEJB 2V9PA 1UPTA 4W9MC 1FTNA 1GRNA 2YOGA 2ZJ5A 4P4SA 3U3RA 4A15A 1ZNZA 4A36A 1M1YE 4KBGA 1F48A 2RH5A 2QTFA 2YC4C 2W00A 4BLRA 2JJ2A 1NJFA 4DLWA 2V1XA 421PA 1W5SA 3GP8A 1CEEA 2D62A 2QE7A 2VRWA 3L82B 1OFTA 1G41A 1N6IA 1AN0A 2H17A 3GLHE 1DBSA 2OXCA 1N0UA 5CYOA 2ZRMA 5DI3A 1AQUA 2CHQA 2EWWA 5HCIA 4RD1A 1CRPA 3R8CA 1SKYB 2RGAA 2F3TA 3FYHA 2BKUA 2J1LA 5FL7D 3VHXA 4HYYA 4O2LA 2DY1A 2QTVB 1G64A 3R7WB 3A1TA 4D0LB 5FBRB 2R65A 4Q01A 3SHWA 1VCIA 3ND9A 1LF5A 5FPHA 2XXAA 3VQTA 1N0WA 4BWYA 3UMRA 3IIKA 4IDNA 1Q3TA 1S96A 2FZLA 2GJKA 4NTZA 2V7QD 5GJBA 1P7CA 3D6TB 1U81A 3GPLA 4PAMA 4I1UA 3TR0A 1MR3F 3RHFA 3QEJA 3X1WA 1KMHA 3ZS8A 4XVUA 1T8UA 3Q85A 5TB5A 1G21E 3AQ4A 4TMXA 2ZAOA 2DR3A 3RS7A 2WBLC 1ZMXA 3N2EA 4Q4LA 1ELOA 1UJ2A 1DE0A 4R7ZA 1QVAA 3TAUA 5HKKA 1TQDA 3CBQA 3W3AA 1G3MA 2ODNA 3QF4B 4M1MA 2X77A 3SOPA 4EFLA 2CHVA 2EYQA 1YZUA 3PUVA 1M7HA 4EFMA 1TEXA 3U44A 2OCPA 3U7FB 5EE9A 3K09A 1HYQA 4D0GA 3ZVMA 3PIRA 4XWKA 1ZUNB 4TMWA 4V0LA 3F5FA 3EIQA 3HU1A 2ATVA 1G7TA 1QHHA 3TRFA 3RRYA 2ZUBA 4D82A 4P3YA 1QBKC 2Z5FA 1RKBA 1H8EA 4Q9IA 2QROA 4ZIRA 1P60A 1N6OA 4HAUA 1DPFA 1GKUB 1S2MA 4D4JA 3HYTA 4Q9JA 4Q1BA 1Z2AA 3QPWA 5KNDA 1HQYE 2OAQ1 3CR7A 4UNRA 5AUPB 2BIFA 1DVRA 3MUFA 1W4CA 4BRUA 1W49A 2W2VA 3BB4A 1Z63A 4TTPA 2YJTD 4DJTA 4FCTA 3KXIA 3RSOA 2EVWX 4TL6A 3QKRA 5FPKA 5L3QA 2H92A 4H9GA 3K70C 1EWQA 1NLFA 1J99A 2AXPA 4Q21A 1G4AE 2JLVA 1CF4A 2CJWA 4TLDA 2J7KA 1K5DA 1CU1A 4EJSB 3HU2A 4JLJA 5DE3A 2QRNA 4CRWB 5KHOC 4DEXA 5JWHA 1T0HB 3D31A 3TUZC 3FPAA 4FXPA 4QBFA 2X2EA 5EE5B 3O8CA 2XGJA 5CLLA 1E2GA 3AH8A 4DIEA 3TVDA 1LS1A 1QHXA 3BK7A 2JLQA 3L0SA 1VDZA 4C7OA 1Z22A 1ZIOA 1D2EA 4ZCLA 2GA8A 1Q44A 4EDHA 3AVTA 1CLUA 1PJRA 5L3SB 3T1OA 3EX7C 5B64A 2J7PA 4RKEA 3GJ5A 4ARZA 3G82C 4XVQA 3TW8B 2ATXA 2ZR0A 1DAMA 1XTJA 1II8B 4B3GA 4JLKA 5FOUA 2C2HA 2HJVA 1KY2A 3K0AA 1E6CA 1SKQA 5E7IA 3EPJA 3D7MA 2XJ4A 5C1BA 1PUIA 621PA 4YDSA 1GL6A 4DRZA 1XTSA 5FI1B 1T6NA 2JDIA 1AS0A 2MSCB 1II0A 2GXQA 1CRQA 2IYSA 4DCUA 2C9YA 1NMZA 3SDZA 4KFSA 3TUJC 1UKVY 4ZCIA 4AYXA 2IUTA 1KDOA 1X8JA 5JSZB 4HLCA 4JLBA 2OT3B 5CK5A 3ZZTA 1C9KA 4FMCF 1Z06A 1S3SA 1FTSA 4GOXA 2H16A 5HE9A 3FOZA 4Q1FA 3QKTA 1T3SA 4I1OA 4MUAA 3RNLA 3OAAD 3RC3A 4S2EA 4DUGD 4TYYA 2O8BB 2VL7A 2ZRJA 4OJQA 1NRJB 3THYB 4UJ5A 2RGBA 4EFNA 4IXMA 3ASZA 2GNOA 3O8DA 4BEBA 2F43B 1X8LA 5FTKA 1FMJA 3QE0A 2FOLA 4DDUA 2XTMA 1J8MF 1IXRC 2RGDA 1TQ2A 2OFOA 1HE8B 4TWZA 2PZEA 2XAUA 4IOJA 1U0JA 3NBXX 1XD9A 1WBBA 5H70A 2GZHA 1CTQA 1YZTA 1G6OA 4NCIA 1TNDA 1BOFA 1GM5A 1W36D 4KFUA 3R9XA 1GKYA 4M21A 2QGZA 2EYUA 4NE2A 3GJ8A 2BMFA 1W36B 1FNNA 3DOFA 4GT1A 1RC8A 2EFEB 3N70A 3UK6A 3ND8A 1KI8A 1P6XA 2A5YB 2IS2A 4KSCA 1XNJA 5AUOB 1JQLB 3RC8A 2KBFA 1AK2A 4ABYA 4BZPA 2HT6A 1T4GA 4W5WA 2XNSA 1U99A 2JLRA 2Q9AA 3B1XA 4RJLA 4CF7A 3WHLA 2IYZA 3OEEA 3A37A 1N6RA 1RYFA 4BFWA 2QRZA 5EZ6B 5G41A 1KO7A 1RYHA 2QT0A 2F9MA 1XCGB 3QENA 3M1IA 4M2LA 1T3LA 2WSMA 1AQYA 3W8RA 4DEYA 5KTYA 4U02A 2A7QA 4B3CA 5IK2A 1Q1ZA 2R6FA 2QGNA 4BFVA 1E0JA 1VECA 2VBCA 3CW2A 3ZD6A 4DLXA 1ZCBA 3I8XA 4PAOA 4JLDA 4Q4HA 2AK2A 2ZRPA 4HDCA 2PT5A 2XNDD 3CB4A 4AKIA 3C4JA 4RD6A 1CP2A 5DN6A 2RGEA 4EJSC 5K8LA 4JMPA 4BPBA 2WWGA 4C0AC 1QVRA 1G7CA 3SN6A 1E9EA 1YZQA 2FFBA 5L3RA 4IDQA 2ZRHA 4IHQA 5CDFA 1AM4D 5JMTA 4A8JC 2C04A 2WAYA 1TL7C 4MRPA 4JVSB 5GJWC 3QG1A 3TKLA 1NKSA 1S4QA 1XB2A 4HUQB 2GCOB 4MGZR 1KZGB 2BBOA 4XH9B 5HTKA 5H68A 3TSZA 3VU9B 3Q3JB 3ZVNA 4JLNA 1XJ0A 1KAOA 2REBA 1D2MA 2UKDA 1E2FA 5LDDC 2OCBA 4C0SA 1EFUA 4L5BA 2VPPA 3FWYA 4R98A 2W58A 3IEUA 2IYTA 4HAXA 2CNWA 4IDPA 1JPNA 3AP1A
chains in the Genus database with same CATH superfamily
4YA6A 5JFGA 1J8FA 3ZNQA 4EG7A 3UIEA 1M5RA 5CPFA 4EKIA 2PUJA 1KHTA 1U2PA 1O4WA 2V0CA 3CF2A 3PUHA 4MLPA 1HNZB 1XVAA 3PHGA 3T8YA 3ZWBA 2XTNA 1T34A 5C9ZA 1FCJA 1BO6A 3WYDA 4BFTA 3PBKA 5IABA 3CG4A 1DAGA 3U5TA 1X3LA 2QZSA 1ESMA 3B6MA 2BN4A 3P4XA 2IPNA 4GYWA 1GU1A 4F4JA 2JDID 4N6GA 5IVHA 3PK0A 3PKZA 2O0JA 2IK8A 2O1XA 1T8WA 4NJEA 4Y30A 4BVGA 4PC1A 3RJTA 4H1WA 1TZCA 3F3MA 5DBIA 2XKJE 4EBBA 3OCJA 1PFUA 2A5LA 1DO0A 1B26A 5AKYA 3GJZA 5K3FA 3D3KA 2AA3A 1FZQA 2I6SA 1F20A 4EFKA 2C9BA 3GCWA 3TLYA 4B8ZA 3ZLTA 4ZYLA 1CIJA 1NC3A 4NMLA 4RZ2A 2NTEA 5AKJA 521PA 1ZZGA 2XMCA 3A1DA 2D4HA 4EB3A 4LNUA 4NENB 4M8IA 1CR1A 1TJ4A 3BMQB 1SCQA 1ZOOA 4BX2A 1TB4A 3UKJA 1RNLA 4YONB 4DMHA 1DKLA 4PYMA 1Z6TA 3D6UA 3ER6A 2BMDA 1YZHA 1ZN9A 3PV0A 4J6FA 4V0NA 4DN6A 1RM0A 2H07A 4DL9A 2UZ0A 2YVLA 3IP7A 4PZZA 5BSRA 5DNCA 1ZAKA 4FNAA 5H9WA 2NZXA 4H6XA 4C2BA 4GR4A 5AH0A 3URMA 1XQWA 4IEIA 1MAUA 2CCGA 2NTYC 5JXIA 5I01A 2AJBA 1RQLA 9LDTA 3I5AA 3RTDA 3HJNA 4DV5B 4Q9NA 2WWIA 4WKGA 3WWZA 1ZRSA 2QLBA 6YASA 3HLTA 4CMEA 4DC0A 1FSPA 1PE0A 2PLNA 2PX8A 5IW8A 1KEWA 1KK0A 3IDQA 3V4SA 5KNBH 4WCDA 3CX6A 3OQIB 3P0FA 3L6UA 4FN4A 1EX7A 3CZ9A 2RB5A 4PLPA 4LEIA 4TRRA 3VC1A 4CL0A 3C4QA 3EZFA 4KODA 5ALGA 3G1TA 4MUMA 2W6ID 4X85A 2BGIA 4N5LA 4BC0A 5JXJA 5HTOA 4EZBA 4MV1A 1Y81A 5JI2E 1O87A 2YWDA 1DRVA 2WP0A 1XAJA 3RVLA 2AFHB 3W6OA 3PDCA 3FJ1A 4QA9A 4Y2JA 5IHXA 2DZDA 5KSPA 5F9FA 1IBRA 4Q1CA 1GTG1 3CN9A 2IXBA 3FCYA 3G5MA 1YJ5A 1CJBA 1QCZA 3PRJA 2LPMA 3R7LA 1CZOA 1FDRA 2ZAMA 4MVJE 2VF5X 2D5CA 4QFMA 3CRNA 4Q3EA 3V1KA 2JLWA 4JVOA 1PK9A 2W2LD 4EHLA 4G1UC 2GZ1A 2QD5A 1VKZA 5EJ9A 4KX3A 1IQRA 1Y1PA 4LY6A 1GA4A 4N40A 5JOQA 5FWXA 1L6RA 1HKHA 3OWXA 3MMSA 5CB0A 2R8RA 3EC2A 3AJRA 3ZHBA 3M3PA 3RVOA 1JTVA 3IOCA 4UAUA 3OEWA 4FR2A 1TMYA 1EUDA 3FGPA 1J25A 3AIIA 4OP3A 4KPGA 3Q6NA 3L9WA 1I3KA 1A7JA 4UARA 4HDMB 2OYCA 4CLRA 5JTTA 2YFQA 4BQEA 3WO0A 4N7JA 1A5ZA 3NCHA 2VT6A 2C4HA 1GJRA 1V71A 2VUHB 3NZEA 3D4OA 5TT1A 3CGWA 2XBMA 5DN6D 3EPPA 1UBMS 5J4LA 3ER9A 2FFJA 2RAFA 4K9OA 1N8KA 3QTBA 3CLRD 4BZZA 1IPFA 1J97A 2VT3A 4R2KA 3VU8A 2OCKA 3EA4A 1NUSA 5EJ8A 2IS6A 2PPLA 2PXCA 4GYKA 1GCOA 2G08A 3I28A 2ZANA 3PIIA 5TQ0B 3UENA 4DY6A 4K9MA 2X0NA 1JR6A 2P6OA 4DA8A 5DF1A 3HXMA 1UPUA 1KARA 1JBKA 1DJLA 1GYQA 1SIOA 1GNLA 2CVPA 2G40A 2VP0A 1JEJA 3L02A 3OPYB 1R0WA 3T0GA 5F3WB 1NRIA 1G8KA 1KYVA 2CNBA 2GPTA 3CSSA 3TJRA 1VLQA 1KKUA 4AY5A 4CT0A 5DTEA 3GPCA 2MYPA 1P4GA 2V7XA 4ND5A 5EMLA 1OA1A 3NIWA 5B3KA 1HA3A 1U98A 1V8DA 5CYGA 3CLHA 2G8LA 5F21A 1EP9A 3GLTA 5LQCA 1AKYA 1ZJ5A 3R3JA 4YT5A 3WGZA 5ALFA 1U0LA 4RFSA 5B1EA 2ZCJA 4NIMA 3K0FA 4ZEOA 1P1CA 1SOVA 3PQ5A 1RKVA 1VMDA 2SBTA 1AJEA 2AHRA 2QW8A 5T8KC 4I1SA 2PMBA 2JCSA 3DQQA 3QOWA 3ELUA 4HQOA 4H17A 4ZA2A 1JHMA 3AR9A 5C4IA 1D1TA 4U6QA 4F7WA 4OQMA 3WK4A 1U0GA 2BEUA 4GC5A 2FE4A 2HCBA 2XMGA 1D8TA 3OZAA 3OEYA 1UDRA 3W4KA 1FMFA 2BGNA 3ELDA 4CW7A 1XDUA 1PQYA 3E53A 3KLOA 1XJWA 3PDHA 3RLIA 5A4KA 4W63A 3ZCTA 2R47A 1QAOA 3LVBA 5DX8A 1UKEA 2Q5IA 3SBEA 3G59A 1WXXA 2BY4A 5CNIA 4TS3A 4X3PA 4ZAWA 4AY6A 4GE3A 1A72A 1CUJA 1FSFA 1LZKA 3MW8A 5DCYA 1UMCB 4JP3A 2B4RO 2ZI6A 5HK8A 1N2HA 1VSTA 4EI9A 3EXAA 5CIYA 5CX1B 1JSRA 5T6BA 5JSHA 4EHAA 2HT1A 2EKBA 3FR8A 1JA1A 2GCIA 1Q7EA 2FSVA 3L0YA 3S81A 4B47A 1SULA 3FVQA 4M7WA 5ALSA 3QELA 3TLXA 3A1NA 3KLBA 1AA9A 4L51A 1O89A 4AI6A 1C3XA 3ZUGA 4BKUA 2IYXA 3KZCA 5DYYA 3RYFA 5BUZA 3HACA 1PS9A 3WVNA 5EWMA 2F1JA 1Z34A 4AMVA 2ZJ3A 1TRHA 2G9NA 1K86A 4GO1A 4WNCA 1P1HA 1VPLA 4IDBA 1QRTA 4CIAA 1P4RA 5BMOA 1KEZA 2V7QA 5LZ2A 4PWYA 2PQ2A 4IH9A 2QU8A 1E5DA 1GGNA 1DAFA 3JRXA 4BV9A 1OX4A 2DSTA 3CZ5A 1G3UA 3FPBA 4RPKA 1SQ0A 1UXIA 4U9HS 3K6SA 3WK7A 1SG9A 3NP7A 3CX7A 4B6EA 4PZ0A 3TNJA 1U7UA 1RFLA 2DB3A 1UBRS 3TW4A 5GZ1A 2IH5A 2QMYA 3P9QA 1TK9A 5C34B 2O3RA 1TADA 2J5RA 5IJAA 4E12A 3IJPA 4N8EA 4PC6A 4ATNA 4EJ2A 2C07A 4BCDA 2CJPA 2QLMA 2VKQA 5EIBD 4FEYA 1SQ6A 3PYXA 3EXG2 1AHIA 1F0PA 4C0WA 5B58C 1RBYA 2P2LA 3I0NA 2FPSA 1TLFA 1VL6A 3PVCA 3BJMA 2CBXA 2G63A 2QENA 3D0KA 3W5CA 4UOEA 3KQUA 1QFZA 3MINA 2P9QA 2PLRA 3DE0X 2KBEA 3A4MA 3DFKA 3SJUA 4RGQA 3ZE6A 3LBYA 1C7RA 2E5WA 1XIVA 5LUAA 1S1MA 1U4SA 2PT6A 4IV5A 3SLKA 4D44A 3SYTA 3ZI4A 1K2VN 2Z0MA 4AN4A 3NKVA 1ILEA 3D0OA 4WWHA 1MJGA 1MRZA 3OZCA 4QHSA 4KO2S 4HUTA 5JCXA 4NR0A 1Z6AA 4B3RB 3IO3A 4FI3C 2MINB 3I9JA 3N1UA 4C87A 4KV9A 4U39A 4UFOA 5EYPA 4JQZA 5HZMA 3UW3A 3WIUA 5IWAB 2CEAA 3KQKA 3FX2A 1M2VA 2FVYA 1TAQA 3LHDA 3WNBA 3FSGD 4CMIA 2VZEA 1EM8B 3I1IA 4DCMA 5LIPA 1QKIA 1Z5WA 3F73A 1GPNA 2GCPA 1W0CA 4KUHA 2FKNA 4M1WA 4QKQA 5ADWA 5IFKA 1NN5A 1SO8A 1GY8A 2RHWA 3QTTA 4EJSA 6REQB 9MHTA 4A8PA 3LYHA 3LGAA 3R9IA 1ZC4A 4DWJA 5C5CA 1BD4A 4AP6A 1TM4E 5JMWA 4YRBA 1F2DA 3BBLA 1DX9A 3S1SA 1W47A 2QRKA 4GPIB 2ZIGA 4XEUA 2OBBA 3VGJA 1T8TA 3O9MA 5B7QA 2GEUA 3GFBA 3H5IA 3S5UA 3BIXA 1DBIA 3ZI0A 1E18A 2AR0A 3MJCA 1NVBA 1EB8A 1UCFA 2XF8A 1KYXA 1Q2UA 1BDBA 2UZ1B 3JD1A 3RSLA 4F97A 5AVQA 3B6KA 2JPDA 5ITVA 1N78A 3K9QO 1FB5A 4OJNA 1M6WA 1W93A 2NYUA 3LRPA 4X8MA 2XEXA 3PUJA 4RA9A 5L4NA 4FZ5A 3DW3X 1G4UR 2GAFA 1QWSA 1ESNA 3OE7D 4C7XA 1UJ5A 5A4AA 2F62A 4LI3X 1Z6XA 1RQGA 2G07A 3Q0IA 4OV6B 4OAQA 4YXWD 1GN9A 2BFCB 4H08A 2FEOA 2GK7A 1O96B 2H2HA 5KQLA 3U7QB 3IUNA 1Y9AA 3WFIA 2X8JB 2FWRA 2FRXA 3I0ZA 2HBQA 4YAJA 2H57A 3NTXA 3O3OB 4LCEA 4U8HA 4HK4A 3S8EA 3DTTA 8ABPA 5THKA 4DMFA 1KMMA 1IG0A 1DQZA 1QV6A 2CL0X 3N2YA 3ZE9A 3UMYA 2P8JA 3DKRA 3TRJA 3QVVA 4BV8A 5ESWA 4PWZA 5CH3A 1AUPA 2PZMA 3H2YA 1WD5A 1YO6A 2B20A 2GM9A 2QAGA 2VTKA 4JUIA 2G5PA 4UM9D 3MT8A 5FR2A 1ENOA 2CZGA 3K0SA 2V6MA 2W8BA 2BFWA 2CLLB 3EZYA 1HOXA 4FGLA 4AYTA 4CM7A 1Z15A 5LOVA 2HRRA 1V6CA 1SGWA 3ZCQA 1JA9A 1FDUA 1GGFA 2IZ5A 2YWEA 3F8WA 5AJTA 3V4LA 2R79A 2AEFA 4UM8B 4X6LA 4HB3A 3EUFA 4DLKA 2B99A 2JB9A 2OL4A 4DSUA 5C81A 2X5NA 3HB1A 1S0UA 2O2DA 1ATIA 5IZ4A 1MB0A 1UM9B 2HXGA 2P6UA 3G9XA 2HK7A 1IY9A 5JS8A 3THYA 3OOJA 1C9EA 4EPWA 5J1SB 4KOEC 2C5GA 1FA9A 1SBHA 4MYRA 1WL8A 1EGVB 2Z5VA 4OIFA 3ENKA 1OLSA 4CN8A 1ZCFA 2YHIB 1UZNA 2C42A 3EPKA 4X62B 1D0SA 1FQWA 1QO0A 1YBFA 3VOBA 1RQ7A 4F8EA 4DRYA 1FL9A 5I48A 2L17A 3SR0A 1PZHA 4IIGA 4MR8A 1D4AA 4IZ6A 1DT5A 3ORFA 2CUNA 3ZDYB 1OI4A 1PNOA 1W30A 1W76A 3QA9A 4BNZA 5JYDA 3ON5A 2GF0A 3ZK9A 2R1ZA 3SC2B 1Z5UA 2VSYA 5F9MA 4O5AA 3IPYA 2FPMA 4LKRA 5FBKA 1NMQA 1TFRA 3KAJA 3A9CA 1TDJA 1VKJA 3L1UA 4J1SA 5CLQA 5I9SA 2VQFB 4EDHA 3ERCA 1BU8A 4KYVA 2GUGA 3BXOA 2X15A 3Q0EA 2V4MA 4H60A 2OO7A 2LCIA 4M1QA 5DM1A 4F3KA 1L4GA 2CXHA 5CAEA 1NQAO 1FUIA 3PC3A 3VV3A 4CG1A 4ZRMA 1NZFA 1UPXA 2CLOB 2ETVA 1V37A 4CMAA 3IILA 3JWHA 1WABA 3L93A 5LDGA 5C1OA 3JASA 1NSTA 3KJIA 3EVBA 3OTIA 3W7VA 4YX9A 3V7NA 2BZSA 2Q45A 1PG5A 7ABPA 2FPIB 1CUDA 2AZ4A 4Q15A 3ZUPA 5BN1A 9LDBA 1YZNA 4EY8A 4LDAA 1FXWA 1NT4A 3MTQA 3KYCA 4BMOB 4TKVA 4YDQA 5CDHA 3RKRA 1PL6A 2HF8A 1TM1E 1V1JA 3MOSA 2YN4A 1CY8A 1L5ZA 2VNHA 1SKYE 4MWCA 2HIMA 1HQKA 1Z13A 3U0BA 4ALIA 3A6FA 2FQXA 1AGNA 5JPCA 1XELA 1JQKA 2O3TA 3DQZA 3ANYB 3EUWA 3GT3A 3BMNA 1RBQA 3AVPA 3GJ4A 4KRXA 1B43A 3VHQA 1LK7A 1U1FA 1XZIA 1YJAA 3DE5X 1A2OA 1N5LA 3ETJA 4IIBA 4N0EA 3UMJA 4CWAA 2NQ8A 1XZNA 2ZS7A 3PQDA 4FHEA 3AHEA 1A9RA 3CPJB 3NDIA 2FW1A 3JW8A 2GCOA 4HUQA 4QBHA 4NCAA 3MELA 3H9UA 1X80B 1L8AA 2YJ6A 5EJ7A 1BAPA 1OYYA 3O47A 1SVMA 2QT1A 3C74A 3L7MA 2AEMA 4LQ4A 3KUDA 1IZ9A 1FSSA 2HMAA 4WSOA 2AFIA 3T5CA 2QT9A 2G4CA 4CM6A 2QA5A 2NV6A 4Z4HA 1I0ZA 3TQRA 4QREA 4V0QA 4B5LA 4DE5A 4YRMA 1B6TA 3I2KA 2O0LA 4IGFA 1YULA 2D13A 4MUHA 4C4AA 2HGZA 1TIPA 4W9NA 4OBWA 3HPRA 1J1ZA 4YMLA 4US1R 1Y42X 2ETXA 2HSEA 2TECE 2YW2A 3NHUA 2BSQA 2D2XA 2FN3A 4J9VA 2JK1A 3BX1A 3IUBA 2V55B 3IOEA 4Z86A 1VHJA 1WCWA 5AXBA 5C8ZA 1ZXBA 2DT8A 3MCTA 1C4XA 2BI8A 1UIMA 1I1OA 2GD1O 2HUNA 3UB2A 1KOGA 4PZ9A 1DFGA 4EGQA 4U5QA 2HU8A 2GBLC 4MQBA 3WXBA 5KDDA 3HCAA 3B5JA 1LVHA 1IHXA 3JQ8B 4M0PA 1GDTA 1DWPA 3GFRA 3ICOA 4DCGA 4WJZA 4KQJA 4NXMB 1KOFA 2AT1A 5B7NA 4HTAA 2JBWA 5K4GA 3PPVA 4MUKA 1NN3A 1ZMBA 5AIAA 3SIPA 2CMFA 4JR1A 1YKGA 3K9NA 1CUHA 2GBGA 3SOZA 1NJ8A 1OTYA 4B6FA 4JODA 1T8SA 4MKFA 5AI5A 1E7RA 3GGGA 1TZ2A 3N6VA 2JI4A 3NPMA 3R23A 4M9UA 4O2BF 4NENA 4X0EA 3BMQA 5I8ZA 1PIWA 2PGAA 1P8JA 1IH8A 2WKPA 3D0RA 3PTZA 5DLPA 3T9BA 3T3HA 5JAUA 4BE7B 3T5PA 1RC1A 3EYAA 1BDHA 4TWRA 4UBMA 3VKWA 1F0NA 2NAPA 2OLKA 3QVKA 4KI0A 1PS0A 3WNZA 4UQOA 5CG2A 4F5ZA 3JQBA 5FBWB 3U7HB 4XDHA 2VHWA 2C4UA 4P2BA 3W06A 1C14A 3IYLW 2PANA 4IWYA 2UAGA 3G2IA 4BAGA 1WU8A 2Q5HA 4JI2B 1I8TA 2B4KA 1G0NA 1PS8A 3JVUA 1R0ZA 5G0TA 3NYQA 4MKZA 4BQRA 2IYQA 3CX8A 4N47A 3QFTA 2HWYA 3PXXA 4XJSA 4V0KA 3RSGA 3KX2A 6GPBA 4JIGA 4M9CA 4MUYA 4NDZA 2ODQA 3RUDA 4DFDA 5J4HA 1FUKA 2R6DA 1UBFA 4Q16A 4TLBA 2GK4A 3OQIA 5DYNA 5HE8A 3U37A 3UJDA 2Z6UA 3U7GA 2RHGB 4HDOB 3WP0A 5CA0B 1KZ1A 4GM4A 5JC8A 1FIUA 3TLEA 1X1RA 4B7UA 4LK2A 2BM0A 3LDUA 4LBWA 5CEEA 3COWA 4CMHA 1N6LA 1N32B 2CFIA 3V3TA 2J5BA 1T3ZA 1EUCB 4WLVA 3EEYA 3KOYA 2BH2A 1E94E 3MNFA 5A4IS 4X66B 5KYVA 3WLMA 5BWNA 1CZLA 1II9A 2AE1A 2PKEA 3VYRB 4BO1A 1ZK2A 4TYQA 5B57C 3PNLA 4L4RA 5GY7A 2ZTHA 4AJ2A 1F4VA 3HXPA 4OX9Y 2ERXA 2GN4A 4GNRA 2PUAA 1BWPA 4Q7MB 4ND2A 4ECEA 3CUWA 2WYOA 2HDOA 3WISA 3O1IC 4QYSA 1PK7A 5D01A 2GETA 2ZJ4A 3AR6A 4LJ4A 4PS1A 1VIDA 2ODWA 3DO6A 4K3UA 2FRDA 1ZGCA 3NBKA 2JKYA 4LRSB 2GSDA 4MB6A 4G4SP 1G3IA 5ICFA 1OWPA 1P2BA 3FIUA 3AI7A 1I36A 4HDMA 9ATCA 1JBEA 4KMSA 4PQFA 1U02A 2DM6A 4TL7A 5L7TA 1GSIA 3LZCA 1PW5A 2HSJA 2FHPA 3MYYA 4D9BA 3DAPA 3VH3A 5LSAA 5CA0F 2AJTA 3EGEA 5C1IA 2CGEA 4NYJQ 4ZKEA 1PGPA 3R6DA 2XLBA 3JYOA 3HSKA 1ZOIA 3JQPA 3R41A 4PINA 5JNWA 4EH1A 1G8AA 2PJUA 5TQ0A 4ZO4A 1DUIA 2QUBA 3R6GA 2CLKB 3BZWA 3HXTA 3KWMA 3FZYA 3CKYA 3OUZA 1L4LA 2WFLB 2ECKA 3MUEA 1ZA1A 3V8VA 3OPYA 4B6SA 5EE3A 2WU8A 1VBMA 1X0XA 4GEGA 3I3SR 4URUR 4W8HA 4UPVA 3KDAA 4H77A 4K81B 2I6UA 3AKZA 2X6RA 1D5WA 3KB6A 1P4AA 4CIXA 4QDZA 1ZR2A 3KU1A 3ECCA 3M33A 4JB8A 3KXDA 1NNUA 3HXLA 1GU0A 3CRQA 1MUUA 4UU1A 5FKJA 1L7XA 2MT9A 2H7VA 3H8JA 2IU4A 4QM6A 3EZ6A 4TL8A 4KMOA 4JN6B 1YB1A 1ZH4A 4QJ4A 4L5IA 5IC6A 2EFDB 1B16A 2O2XA 3D6JA 4OLFA 5TEVA 3LV8A 1A76A 3QHQA 1R8JA 1FW8A 2BKLA 3K7EA 4QSHA 5CFRA 3HV2A 4Q9LA 1EFRD 5K7SA 3O8NA 1T0UA 3OZEA 3ZIAD 1X7XB 2ONKA 1Z73A 4HDQB 3G13A 2FMIA 4ZAVA 2M6KA 3RUCA 3UK0A 3WMFA 4IIUA 4QYMA 1H8HD 2HMSA 4JBYA 3SK0A 2XWBF 2A0UA 4X20A 5ALJA 5DSZA 1MO4A 4PX2A 4J76A 3ZZ0A 5F98A 5IH3A 3B7WA 2A0FA 2D8AA 4NHOA 1S8FA 4LV8B 2B8WA 1KAHA 3LQFA 4TXHA 4DMUB 3OFNA 4RS3A 1UMCA 5AVXA 4BLPA 4E1BA 3C1AA 1T8PA 5ILOA 1P9NA 1RXVA 5CX1A 2BR5A 3BTUA 3FPHA 4DDVA 4CPDA 4QTXA 5KBYA 3DPUA 4OHYA 4LMRA 2VZ9A 4DPKA 3OUTA 1F0KA 5HUHA 2PSSA 4LSZA 1PV4A 1QVZA 3HQ4O 4FCCA 4LX8A 4YUVA 3VVLA 4F92B 2F8MA 3HSSA 3EGCA 2WJJA 3CEMA 5SYNA 3BOSA 1YUMA 1SXQA 3DNMA 1M8PA 4LJ6A 2YUTA 1M7BA 1V4BA 2ZJ6A 3H5AA 3EH2A 3DKKA 3KVNA 4I1YA 4U2EA 1E98A 2B4QA 4UZEA 4YCSA 2XUKA 4ZFNA 4MV9A 2YHUA 1IBMB 3NG1A 3G8YA 2XZLA 2WQZA 1U3GA 4ONEA 3Q9LA 1E0SA 4P4UA 4JJGA 2CL7X 3QE9Y 1LU9A 2GD6A 5M5BA 3ZLBA 3CH7A 2HDWA 3FMIA 1MJNA 1TF7A 3M4JA 3R44A 5LXTF 2FU5C 4UHBA 1N2ZA 2VHQA 4BYMA 1YHYA 2PG3A 2VJQA 2O4UX 4IIHA 4LZLA 1M72A 4R81A 2A0YA 1AKRA 1KP9A 3QRWA 5GZ6A 5CT9A 3P9SA 1WW8A 3I61A 2RHBA 5AI0A 5FULA 1VHLA 1O9BA 3L05A 3ZTTA 4U6NA 3I3OA 5D3ZA 4D9FA 3U4DA 3E9YA 2PJRA 4Z54A 4FYWA 3BC1A 1C41A 4N1AA 2F9FA 5F78A 3PC7A 2OO5A 4IDDA 2VJDA 3JD2A 1MAVA 1UK7A 1J70A 1M0SA 2G3YA 3JSXA 4GG1A 5JATA 4UUBA 2QIOA 3RG2A 1VTKA 3TTVA 2J33A 4HXYA 4FGZA 1JHPA 4NEQA 2G0NA 2QY9A 5F77A 5CK4A 3ZWAA 1ETUA 1GSHA 2P6MA 1NMYA 3AB7A 3EGWA 3R3ZA 4RK4A 4XM1A 1EDDA 2BFFB 1SKBA 3RSHA 1C8BA 4FWTA 2PUGA 3H2SA 2A67A 2WUGA 4D57A 5EMKA 2Y77A 1XXLA 1K89A 2O2GA 4JP5A 5CB4B 1N1GA 5KVCA 4YJ2F 3BFKA 5EQFA 1NBHA 1BOOA 4QOHA 2FETA 2AMJA 3RK1A 4GOND 4CCWA 4G5SA 4DLSA 5ALEA 1UQRA 2MINA 2PH7A 1Z83A 1KJ9A 2NO1A 1E3LA 4E11A 1GZHB 4JC8A 1SJ9A 3QSYA 1QGED 3SS8A 2XVYA 5MHTA 4GMGA 1QK4A 2HC9A 1KI9A 3WGJA 1EGQA 1EM8A 3DBIA 2N0SA 1YI1A 1R9JA 4BQQA 2QXTA 3IE1A 5CUQA 5BOSB 3DMFA 3AUYA 4BO2A 2VYQA 5GJCA 2IOHA 2QTLA 4LPKA 2VK2A 5BYKA 3C3PA 2YJ3A 3CLKA 3ZE7A 3OZRA 1O97C 1WZNA 4H31A 3UAOA 1YZKA 2I8AA 2QRQA 5JMOA 2QN9A 1LZLA 1WO8A 3IXMA 5EUQB 2HAEA 5EUBA 4DLBA 4KIWA 1UJCA 4GLLA 4UZFA 2HQ1A 1CUIA 2UZ1A 1LNZA 4KFTA 5CM2Z 1U7ZA 3BYZA 3R2JA 2TSYB 1G20E 4ROSA 5JCOC 2B83A 3HC7A 4JJFA 2NNWB 2WT9A 3I39X 5KB3A 5HDBB 3HB5X 1KJNA 4KWEA 5ECDA 4XRGA 3U49A 3RNOA 4BNVA 2YXPX 1U28C 3U4HA 1CHDA 4IIEA 2IZZA 2J30A 4U0KA 3SDBA 4CF4A 5L40A 1TYEB 4F91B 2Q6OA 4LF8B 1WSWA 1RMQA 2BFCA 3X2FA 1O96A 3U7QA 3D64A 3DHVA 4GICA 3H0KA 4N9WA 2K2QB 5KU7A 1U1CA 4EBFA 2BV3A 3IALA 2O2JA 3K2IA 2IE8A 2DAPA 2FX5A 1OPXA 1GGHA 1UINA 2RCNA 3PGVA 4MP3A 4TTVA 2J6CA 4RVCA 2C4KA 2JGJA 1QSGA 2EKLA 2QKYA 1POXA 4I9GA 4UEQA 4L73A 4X90A 3NJ8A 5AICA 1G1AA 3SJBA 3B5IA 3ECSA 1UJBA 2BCGY 2JJQA 1FRFS 2YVUA 3FKSA 4RZ3A 3NGLA 1R6AA 1YVRA 3OEHD 4FI3F 3K9FC 1U8AA 3NEAA 4DB2A 4NQZA 2X2OA 2EJWA 4P86A 1GG8A 1EG2A 1EWTA 2J6BA 1JJBA 2PT9A 1G6KA 4NNPA 1P29A 5ALZA 2R6JA 1M10A 1KFBB 3PB3A 2OXEA 1D1SA 3CPEA 4BBPA 1Y3FE 2KE5A 3N2KB 2OK7A 1XK7A 2IA5A 2XE4A 5D1NA 1NW6A 1RAHA 4CDGA 4YLYA 4Q3CA 1H6CA 1GGJA 2Q1WA 4LYDA 3AK4A 5AK5A 3T7RA 4W5JA 2Q1YA 1TLLA 3K0HA 5CH8A 1PJAA 1DT3A 5JBQA 5DLYA 1UM9A 3OHSX 3KE9A 3TZ6A 2QTVA 1OV6A 1USKA 2G36A 2WQ7A 3IR6A 3LQQA 1E6EA 3IPXA 3VZRA 2FSFA 4FFPA 3WK9A 1Q91A 1UFQA 2G9RA 4AMUA 5A7FA 4YCNA 1FFAA 2KSQA 2YHIA 5BO5A 3OJLA 3I12A 5LUBA 1H1DA 4DLPA 4J7AA 3OZGA 5NLLA 1NJ2A 2Q2NA 1R12A 4EEXA 5DYTA 3SHQA 2CD9A 1BX1A 2BDUA 3C3KA 3SZRA 1R3UA 4KRFA 1Z3IX 2UVPB 2WMOB 2JIRA 1E4YA 3TSWA 3IB3A 1KAGA 4RSRA 5E95A 4E7PA 2HQBA 1E1KA 1ZZEA 4AMYA 1ZJ6A 1KSGA 3SNHA 3ZQ6A 4H0NA 1VMAA 2XQGA 2BGRA 4F8JA 2WA1A 3BDAA 3NPAA 5DBOA 1DO2A 2CFRA 2ZJOA 4PX9A 3ZV3A 4DABA 2XOKD 3RU2A 2F8TA 1S3GA 1KBOA 2JI7A 2A5FA 2C4MA 2IF2A 3O1JC 2I4MA 3QF4A 3U26A 4H16A 4CF5A 2YV5A 2QM3A 4ZALA 3ABIA 4NU0A 1S9DA 4XDZA 3VISA 1QFSA 1CV2A 1AZSC 2WDPA 5HF9A 4DNPA 4ZVOA 1S01A 3SM9A 2C9OA 2YQ4A 1JJ7A 1RPNA 3HDQA 3BGIA 3JAWB 3PFBA 4F3CA 1KJJA 1EAYA 1FP4B 3ZY2A 5FUWA 5I4CA 4LKOA 2FPIA 2MSEB 2O8FB 4GPTA 5A6SB 1GD1O 3WWPA 3C3MA 4DSOA 1FRQA 1U0HC 3H2GA 2VJKA 3NHLA 3D3EA 3UJHA 4G0ZA 3VOTA 3EH1A 2J32A 3KXLA 5LD2C 1RWNA 3OO1A 1DQSA 1T5OA 4OU5A 5HEKA 4IXNA 2OA0A 3DOEA 4HGOA 4OMCA 5JVDB 4L57A 1XQ6A 2WTUA 5BV0A 4WK4B 1AF7A 1FFBA 3OMXA 3SVTA 1NRWA 4RKQA 4LOHA 5JE8A 3V6LA 5HZKA 3RC2A 1IJEA 2FW8A 2YMLA 1DX6A 1DDGA 1OA0A 1Y4ZA 2FQWA 1Y8QB 5U4XA 5D7BA 2E87A 3UAWA 4JLMA 4FGWA 4PVCA 3FCAA 3M5DA 5EKDA 5EMHA 1JQ5A 1U9ZA 1KJ8A 3WB2A 1M1YB 1QMPA 4XCVA 3KKMA 2VH2A 3NEJA 3QVGB 3BS4A 1V7ZA 3INRA 4NS1A 4OYHA 1NUHA 2A30A 2BKAA 3W9BA 1WDKA 1Z0UA 3WNQA 4OI0A 3RBXA 3F8TA 4ME6A 5JAZA 4JOSA 3DTVD 4CT5A 1XTQA 1JT2A 5KVQA 1T9ZA 3B1ZA 1XLWA 3O7WA 3V1TC 4Q3AA 4UCQA 4YRNA 1PJTA 4MH0R 4H3VA 1JMYA 2VI5A 5K6AA 5L7WA 1H93A 5GPBA 4N7MA 1R0SA 3RO7A 4ER6A 4KR3A 4FE4A 2O0MA 5BQPA 3GD7A 3NVMB 3SKYA 4LRTB 1MGOA 2VS1A 3P97A 3N3AC 4QEKA 1BVHA 3E03A 2J3HA 3CY6A 4BRWA 3LECA 4RKYA 4OQPA 4J3NA 1XDDA 4F5WA 5I9LA 4Z1OA 3MLEA 3ZVLA 4JR2A 1UXJA 3SC4A 4G0OA 3WRXA 4Z9FA 3DQPA 3HS3A 2PIDA 3PRKE 2PMWB 1YVDA 2ZB3A 2D2VA 3KLNA 4QQ8A 1DBQA 1EJ2A 4YRJA 4XQ9A 4I4CA 1GQ2A 2PGOA 3FFAA 4EM6A 2P5UA 4HWOA 1E6LA 1GAWA 3FOCA 3I73A 4HQ0A 5KOIA 1N1MA 3O3CA 5DGDA 3ZGVA 3AY7A 1FK8A 2H2DA 4JFRA 5JSZA 3T15A 3U39A 3CYFA 2AWOA 5IBQA 2IP2A 3VR4A 3O84A 5HUJA 2V5VA 4RA6B 1PTKA 1B0PA 4QARA 1TTTA 3DBVO 1ZD8A 1E79A 2JJ1D 2QRPA 4XIIA 1BMDA 3JRNA 2NSYA 1XMVA 6Q21A 4AQYB 3LOPA 3QMVA 2JFZA 3NIFB 3AC0A 3BXFA 4KXMA 4OHXA 2DTDA 2HKIA 1AX9A 3EQ8A 1QP7A 2ZUUA 3MCZA 3WJ2A 1JHAA 1JKJB 4BVEA 3ICVA 4DA9A 2QTZA 2PLAA 4GBED 4M7OA 5IKPA 3K20A 3SIWA 4WLOA 4QT0A 4YJKA 5LLDA 1D9XA 4WKCA 1CT9A 4M53A 3VR6A 2QLTA 1ICEA 3PC8C 2NUAB 3EN0A 5KJEA 4ZOAA 2HRQA 4K03A 3BWEA 2VDKB 3ZLUA 5JV5A 3EZ9A 4QICA 1KERA 3C8HA 4E2YA 4CKCB 3BB1A 5FEUA 3F7TA 3L4KA 4MA4A 4LI0A 2H0RA 4DJJA 3ACCA 1NU8A 1P5FA 1ZGGA 5EINA 5A0FA 4BMZA 4N7BA 1NP3A 1SBQA 4YROA 1XCOA 3H05A 4FC6A 1JP7A 2FFHA 2Q41A 4XGIA 1NIJA 4MITA 5CXSA 5AMXA 1J2EA 2D2EA 2YV4A 4JT8A 1DC8A 1ISIA 5B6PA 2CDCA 1SKUA 3AKCA 2OGZA 3GAMA 5GAJA 1YOVB 3FXAA 1NBMA 4N6NA 4R16A 1T8RA 2BLLA 2OV1A 1XNQB 2OBYA 4JXKA 5TGTA 1C80A 1EUCA 4Q5IA 2H29A 5LPNA 1CEQA 1UBOS 2EQ5A 1TAUA 2J3EA 1CG6A 4QJBA 4M99A 3RJ5A 3VUEA 4EY6A 1J8VA 3DWGA 1U8FO 4O0MA 4EJ0A 4MDEA 3T5DA 3L43A 1L5NA 4B75A 3Q9SA 3N2LA 3ZCXA 1GYPA 3T3IA 3C48A 1YE3A 3DZGA 1ZD4A 4X8HA 1NATA 3OP4A 5P8WA 2A0XA 3UMMA 5B53A 3VV2A 2R8PA 1DKOA 4LDZA 4E32A 1FYEA 2ZAYA 4B4KA 3EBPA 2QTMA 4G0XA 4LZWA 4M83A 4MGEA 3F96A 2VBGA 4O1MA 2OCAA 4V1CB 3OQVA 4DZZA 2GTPA 3J7AC 2J6IA 4C0JA 2ZYRA 3EULA 4LJAA 3OWHA 4POAA 3WXMA 1OILA 5JD4A 4DV6B 4X5OA 5C7OO 2YZMA 2O54A 2H1RA 5U4QA 2W37A 1KDRA 4ZYTA 1V6SA 3KKEA 3N8GA 3JD0A 2UYYA 1OZGA 4XPZA 2XZPA 2JRCA 3CGGA 5CBKA 3G8BA 3MA0A 1E66A 1UQUA 2GYYA 4BMSA 1L7AA 1N8NA 2BHLA 4JYCA 4OMUA 1Z16A 1WCXA 2HCFA 4R8LA 1ENZA 2VAPA 4CQMB 2BR3A 4MAMA 4UVEA 2FSIA 2YV2A 1XZGA 3MWDA 4Q7JB 4RQBA 1YR1A 1P9WA 1ML4A 1PFKA 1A4IA 1WZUA 2I7VA 2P41A 4H3KB 5ECWA 2QTWB 1WTAA 2HZBA 2DLDA 2B1GA 3MFYA 4G5QA 3RFTA 4NBSA 4BNXA 3T7DA 4A73A 4O25A 2AQKA 3IAS1 3UB3A 1YACA 2L18A 3G85A 1EDZA 3VH1A 4EHIA 3ET5A 2IUYA 4RQTA 2I67A 4MKIA 4G9EA 1K63A 5D2CA 3MBKA 5E3IA 3RRMA 4C3UA 3KQYA 4TLAA 5CG1A 1BE8A 4QVGA 2QLFA 3OJ0A 4AS2A 3COYA 2O5VA 1SU6A 2J3MA 4KXWA 4BX3A 2WB2A 4RHYA 1RRMA 2GHQA 3IBGA 5I7UA 2XCSB 3PUXA 2PEZA 5AKKA 4A2WA 2UUPA 3OU6A 3OZSA 4KTTE 2Q2VA 1JFSA 5KSZA 1ZO8A 2Q21A 3N59A 5JWOA 4IHJF 3GYGA 1KEUA 4EL5A 3K9GA 3TM5A 1KYQA 3C3BA 1X7XA 2Y1DA 4HFJA 4UUOA 3WQBA 1XDGA 1XMOB 4LY3A 3IUPA 1FE8A 2CFOA 4I5IA 1ZG3A 3E35A 3TGPA 1VDMA 3ACBA 2FMFA 1QJCA 2ZGVA 2YASA 2ZBUA 4MICA 1KQ3A 4L1KA 3DVQX 1MABB 4JJZA 1DRUA 4KNVA 1S3IA 2HPVA 5KKCA 3D9QX 1NPTO 1SG6A 4I4IA 4S2UA 2I76A 4FMCB 1F7VA 1GO2A 1X13A 4BECA 3CISA 1M2JA 1C1HA 4GPAA 2HY7A 1E1RA 1E0KA 3ZBQA 2R6R1 5EKUA 2VKTA 3CO5A 2ZTSA 1KI6A 1JAXA 2FF7A 1RLTA 2J87A 3HMKA 3LXXA 4GX1A 4PBTA 5FPQA 3ODPA 3UJ6A 3JD3A 1KGDA 3LUPA 3JAMA 3AO0B 3GUYA 3FFXA 4HWKA 5EKXA 4BU0A 2EHDA 5F23A 5IM5A 5ADHA 2NZ2A 3T1YB 4QOEA 2R60A 4L9SA 5G4KA 2NOAA 3MQFA 1SXIA 1NM5A 3K32A