4JS0A

Complex of cdc42 with the crib-pr domain of irsp53
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling protein
molecule keywords Cell division control protein 42 homolog
publication title Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4js0A00
4HUQB 1KJZA 4NU0A 1KI9A 3VX4A 5JBQA 1F2UB 4ZCMA 1WDTA 2QPAA 4HDOB 3CX6A 3RRZA 1XZPA 1N2CE 2PCJA 1QHHA 4URVR 3A4NA 4C0AC 5J47A 3VMFA 4NYMQ 4DT1A 3MWJA 3Q7PA 4OHWA 5EJEA 3CX8A 1GFIA 4B43A 3DZ8A 3RS0A 2IYTA 1Z3IX 1IXZA 2ORVA 2QMEA 5KDLA 1RRFA 4FINA 1KO7A 3SC3A 3IHLA 1SXJC 1P2TA 2GCOA 3A1TA 2IUTA 4BFSA 5HE8A 1S1MA 4RCZA 4C0KA 2WWYA 1YZUA 4RZ3A 1L4YA 4LJ4A 2IK8A 1IJFA 4Q01A 1J2JA 2L0XA 2ZUCA 1NJFA 3A8TA 3ASZA 4Q5IA 1R7RA 2WBLC 3KTAB 1Y3AA 3AVOA 4DCNA 2VIIA 1VPLA 1IHUA 4D4MA 2EVWX 2CXXA 2ZITA 3FMPB 4Q4AA 4LHYA 2D7DA 1KDRA 5IK2A 3SQXA 2GVZC 4DIEA 3B6EA 1G3IA 3BC1A 4DWJA 1S3GA 2ZU0C 4MGZR 4DHEA 1FQJA 3DVLA 2R2AA 2YNMA 1NVVQ 1ZNXA 1N6OA 3BB4A 1KO4A 4EFLA 4Z1MA 1KY2A 2CLCX 3UWOA 1PZNA 4DLZA 5EE9A 2REBA 3ND8A 2OXRA 1S2MA 5KSYA 1R0ZA 4LK2A 2YOHA 3GJ4A 1E32A 1MRSA 4DB2A 3HJNA 3BE4A 4IOKA 2JLSA 3REGA 3EX7C 4ZKEA 3KX2A 2WIAA 4TTQA 2GKSA 2F3RA 4HUTA 1YRBA 1KSJA 1NIPA 2PL3A 1NBME 3ADKA 3DKPA 1WE2A 3EC2A 1RRPA 1U81A 2JDIA 2WWFA 4O2LA 4YMSA 2ZVQX 4URUR 3U7FB 3U7GA 1NIJA 2D2FA 5CM9C 4M1MA 1VTKA 4XTRA 4DIDA 3VR4A 4F38A 2R6AA 1UBGA 4HAYA 4IDOA 5LB2A 1G1MA 2ZJ5A 1ODFA 2DR3A 4HDQB 4A8JB 2XOKA 3I5XA 1HA3A 1GRRA 2F9MA 2QAGB 5KPDA 4TMTA 4JLJA 5FBQB 3KB2A 2DFTA 2NTYC 4OHYA 1KHTA 4Q9HA 1QG4A 4TYWA 3EW9A 1MOZA 1OB2A 4US0R 3HPRA 3AV0B 4GZMA 4U02A 4A0GA 5DYGA 2V3CC 2GF0A 2CLDX 3T5GA 4QNMA 2F43A 4PPFA 2YINC 3OIUA 5DN6D 1UM8A 2CCGA 2H57A 3ASYA 1E2LA 2GZAA 3P4YA 2J7PA 2FDCA 2AWNA 3E2IA 4NYIQ 2EYUA 1VG0B 2KBFA 1DELA 1W36B 2O8CA 1E9DA 121PA 4PX9A 1ZYUA 5GVSA 1XTIA 4Q9IA 4C7OB 4XVRA 1CS4C 2XZPA 1G8HA 3SJZA 1VG8A 2P67A 2W6ID 1Z47A 3EARA 1SULA 2CVHA 1XRJA 3ZH9B 3R9IA 3B1ZA 1XX6A 4Q4JA 1F5NA 2AWOA 1WBDA 4HLUA 4NYJR 5CM8B 5FPHA 4L15A 5SZHB 1W0KD 3LXXA 4JBXA 1US8B 3QY0A 5G41A 2JA1A 5E7IA 2WJIA 2NO6A 4JL6A 2OO7A 1XXHB 2MSDB 4KJZA 1KNQA 1E6CA 2JLRA 3MUFA 1TUIA 3A4LA 2J1LA 3T61A 1NBMA 1HURA 1QHYA 1RJ9A 1W7AA 1VECA 3FKSD 3V4FA 5EXXA 4MKGA 1JPJA 5FUYA 1ZM9A 2QNRA 3B1VA 1QHNA 3K09A 1IN4A 3RC8A 1G20E 1LW7A 2PZGA 2C96A 2OESA 4P4SB 2H18A 3HR7A 1P9NA 2P2LA 2RB4A 5DYIA 2NMVA 3Q3JB 2ZJ8A 1NF3A 1F60A 2Z4SA 1NLYA 1OH5A 2BDTA 3HWSA 4A0RA 5KUTA 3PEUA 1DEKA 4IVQA 4LBVA 3PR1A 1KI6B 4RKEA 2C78A 2Z4RA 5FI1B 1Z22A 3CRRA 5CK4A 3ZYCA 4CEHB 3SYKA 4ESVA 3IILA 3JZAA 2YVUA 2G0NA 4HYYA 2IHYA 2ONKA 2ZROA 3I1FA 2ERXA 2W2TA 4TQ9A 2CVFA 3FHOA 3FWYA 5CITA 2AL7A 1EWRA 5AUNB 3QUSA 5TVKA 5FL7D 3F5FA 4CEIA 3EWSA 1E1RA 5IF9A 1HQCA 3SFZA 4PAQA 5A5GA 1D6JA 1GRNA 4LDJA 5JECA 2QENA 5DSZA 2OV2A 3VU9B 3IIMA 4MDEA 2H17A 1U9IA 1CRQA 1SVIA 3K0AA 4BZXA 3Q8XB 5EP4A 1ZRHA 4MH0R 4UJ5A 4V0LA 2RGXA 3BFXA 4FW9A 1ESMA 4BFZA 2IS2A 1UF9A 2GAOA 1BYIA 1ZNZA 3CWQA 3K0FB 2Q21A 1KO1A 2O0HA 1FPMA 3LNCA 3QXCA 5BYJA 3SBDA 5AUPB 1VG9B 2QRNA 1F6BA 1EFTA 4NONA 1HH4A 3IKJA 3KL4A 5CB6A 4KXFB 1KO8A 1OFIA 3NDBB 1DO2A 1KJWA 4WZAE 2ZRHA 4H1UA 4UQOA 1J8MF 1P3JA 2CJWB 4C4PA 1B0UA 3EA0A 1A7JA 3L2OB 5A4JA 3CR8A 2JJ1A 3GJ6A 2PMKA 1E9RA 2C9OA 1RYHA 4XD7A 4KVAA 1R0WA 3U6KA 1I2MA 4RD4A 1P6XA 3RNLA 4MYUA 1QZXA 1EK0A 5IK2D 2NO7A 2ANCA 1KK2A 1TF7A 4K8OA 4A9AA 3JVUA 1XD2B 2LKDA 4LC1A 3SR0A 4B6EA 5JSZB 2R6GA 1FNMA 1MT0A 4WXPA 4DSTA 4Q7MB 4YDHB 3OESA 3L0OA 1R0YA 1T91A 3GJ3A 4JMPA 1NVUQ 1CLUA 2XZLA 1VHLA 4Z1MD 2IYYA 2W83A 2MMGA 4M1OA 2I4IA 4RFSA 5CLLA 1PJRA 5H8WA 5JJLA 1GM5A 1EFUA 3THWB 3C14C 4S35A 5F98A 1UDXA 3PVSA 1IY0A 3NVAA 4AG6A 4IOLA 4DLYA 3Q5EA 2NPFA 2AN9A 3AVUA 2IX3A 2G6BA 4M2LA 3A37A 1Z06A 4LOAA 4PHFA 2V7QA 3CLVA 2DFNA 2VBCA 3U3KA 2YWHA 3ZLJA 1IN5A 1E2QA 1NVVR 3JZMA 4XIGS 1VCOA 3G82C 4JVSB 1YQTA 3BFVA 2GESA 1NN3A 4IW3B 3LAWA 3SQWA 2OZEA 3HPQA 3SYNA 4PSVA 2XOKD 1YZLA 2RGAA 4LY6A 2VSOA 1H8HA 4F4JA 4JYBA 4OI4A 1I4LD 4BECA 2BHRA 621PA 3DMNA 5FTNA 5L3VA 1O87A 1Q1BA 2FSIA 1R8SA 4Z8YA 4OHZA 2O0JA 4CYMA 3S1AA 5K8TA 4R71A 5J4HA 1PLLA 4URWR 2OFOA 3ZS8A 4BFYA 3KJHA 3QG1A 4QXAA 1BKDR 1N0VC 2J0UA 1QF9A 4B73A 1EESA 4LJ6A 5JCZA 3DEFA 5DI9A 1NG9A 1W49A 5J5CA 2O8EB 2QP4A 1NN0A 4DKXA 3DZDA 2P5TB 1HYQA 2JGNA 2QT1A 2OBNA 4ZIRB 5B2ZA 2BVNA 2PJZA 4FMDB 2EFGA 1OIXA 3U3OA 1E2NA 1OIWA 3I3SR 1S0UA 1WP9A 5FBWB 2V55B 1KMHB 3QVUA 4II7A 4HZUA 5DO9A 4A92A 4DLVA 2BBOA 4LPSA 2QTHA 4EPXA 4KFSA 3D8BA 2KSQA 3IDQA 5FL3A 1KZGB 1T3LA 1JQJC 2QAJA 2I3BA 4D0LB 3X1DA 1PUIA 2ZRAA 4QL3A 1G41A 2JAQA 2PT5A 3EAQA 4NYIR 2FZ4A 5TARA 1EFRA 3ADBA 1XCGB 3V9PA 5FUWA 4LX0A 3QNUA 4JS0A 1ZMXA 5J4VA 2J46A 4XWKA 4B2PA 1G5PA 2WJYA 2ZI5A 3EG5A 4B3DA 1TF2A 4PAOA 4QOSA 4QKQA 4JLOA 3BK7A 1NL3A 3VKWA 1A4RA 1WXQA 2VRWA 4P32A 2UKDA 5IT5A 2ZQ5A 3FFAA 4B47A 1M1YE 4OBEA 4JVNA 3BBPA 4JT2A 3I62A 3CB4A 2QMUA 2BBSA 3N2IA 4TMKA 2G9NA 1LS1A 3EPKA 4DCTA 1I4DD 3QIAA 4JSTA 2WJHA 4B2IA 1KI3A 5K8UA 1KI4A 5FTMA 4Q1DA 1NMZA 1FMLA 5G3ZA 2GTPA 4BE7B 4D2IA 2ANBA 1BH2A 1KO5A 4MYHA 2GXAA 1G6OA 1SXJD 1EFCA 2WV9A 3TVDA 4TN1A 1XTJA 5DGXA 2CL6X 4KODA 1Q1ZA 3C5HA 4M22A 1U2RA 4A15A 1YRAA 2ZE7A 4IDPA 4OQXA 2F7SA 1G3MA 1G6HA 3LXRA 3RLFA 4LYAA 2PMDA 4DDWA 3I8XA 3TMKA 2YC4C 1E1QA 1RC8A 4CF7A 2QGNA 4PPQA 1WA5A 5IRCD 2WAYA 1X3SA 2OCYC 4L9WA 3SJBA 2QROA 5AK0A 3QKTA 1ZCAA 4MRSA 1P2VA 4KLZA 5DISB 3ETLA 3TUZC 2FU5C 1ZD1A 1OFUX 4AD8A 1ZUIA 4HUQA 4LV6A 2WZQA 5JLJA 3DPUA 1OSNA 2B92A 5L3QB 1F2UA 4IJMA 4ACAA 3NWJA 3UATA 2XZOA 2VP2A 4TMXA 1N5LA 1UKEA 4ARZB 2OFXA 2GEUA 5EZ6B 1XU4A 1E9CA 4ZI2A 3THYB 2HJGA 3HDTA 3UG7A 1C1YA 3HR8A 2YOGA 2B7CA 1CR2A 2J5XA 3WHKA 1R2QA 4ABYA 1R5NA 1ZUHA 4DXAA 1HUQA 2FNAA 1BIFA 1YZTA 3C16C 1CJUC 2D74A 4DDVA 3WMFA 1MO3A 3MFYA 3MWKA 4UXHA 2DWOA 1EGAA 4L4UA 1DAHA 1N5KA 2WMNB 4G5RA 4POAA 3HU2A 4XD7D 4B74A 3THXB 1UPTA 3QENA 4R2IA 1IONA 3QBTA 1P5ZB 4MKHA 1FOEB 1N5JA 3K9NA 1KK3A 5DH9A 4D26A 5E4FA 4E03A 2WKPA 1MO6A 1GTVA 4E5UA 5LD2B 5EUMA 4JL8A 3MRSA 1ONBA 3TE6A 1G291 1PLJA 1MH1A 2TMKA 3KTAA 2V54A 4G5OA 3T12A 3EASA 1ZNYA 3L43A 2GRJA 2O5VA 2FSHA 2WJVA 3PIRA 5H70A 1PV4A 1ZBDA 4LZZA 4TTPA 4JL5A 2C99A 1BMFA 1E79D 5TV2A 3WMGA 3GCGA 1L7VC 1Z6YA 1EX6A 2FFQA 2FGKA 2HDNB 2BEKA 4EQ6B 2E87A 5JS7A 2OUKA 3GEHA 4AC9A 1RIFA 1G16A 5JWRA 1KJYA 1G3UA 1V5WA 2GNOA 4AURA 5KU1A 3U61B 2AKYA 1EXMA 4JT4A 3W8RA 5FPSA 3D6TB 1FTSA 5JCPA 2XEXA 5E95A 4A6PA 4B33A 4FI3C 4DLXA 1NLZA 3QXJA 4UXIA 4KVGA 1C4OA 3RAPR 2JASA 2QUZA 4NL4H 2V7QD 4BGDA 3F0TA 1I4TD 1YU9A 4KCGA 4ZCIA 3FE2A 2Z6VA 4LYHA 4OQNA 3B60A 3FMIA 1JR3D 2O8FB 4GI7A 3NH6A 4FMDF 4F4CA 1R0XA 3PFIA 1H8HD 2QPTA 2X1VA 1GIAA 4G5QA 1E98A 4DUGD 1IY1A 1RW4A 3VNVA 4NTZA 1Q44A 5L8VA 3TR5A 4FXPA 2HLDA 3MSXA 4A8JA 2BMDA 3IEVA 4B76A 2QAGA 3UANA 3WMEA 4G0NA 3QXSA 4ZV4A 2XTMA 4KV9A 4TLDA 1YZGA 3AGPA 3NIBA 3QKSB 3WYFA 4A2QA 2CE7A 5CIWA 3KQLA 1Z28A 1VCIA 1CR4A 4ITRC 5E3HA 3KZ1E 1KTVA 3BS4A 4MKIA 4FMCB 4HB0A 2QP3A 2QBYB 1VHTA 3ZZUA 2CCKA 3C15C 3P20A 1DAIA 3U3RA 2CHGA 4MGYR 5J40A 4Q9LA 5AJXA 1OHHA 3K53A 4HLUC 5BYKA 3AB3A 2ODBA 1JEEA 2MSEB 5D3QA 3MGCA 3RABA 4Q1FA 3RRNA 1KY3A 4GP7A 4M1YA 3U2QA 3VX3A 4KFRA 4Z54A 4C7OA 1X1SA 3RSLA 4LJ8A 1IY2A 2VQSA 1CR0A 1TNDA 1A2BA 5HKKA 1A5TA 1QHXA 1LV7A 1IQPA 3H84A 4GMXA 2ZSDA 2QE7D 3WRXC 3OE7D 5FOWA 1E2DA 4B48A 4DLWA 1FUUA 5FOSA 1TAGA 5C4MA 2ZPTX 2D3WA 1XF9A 2OG2A 3K09C 2PEZA 3CNNA 2KI5A 4PQFA 3VKHA 2GBLA 3BIFA 3IUYA 1EFRD 4RZXA 1GNRA 1TPZA 3QG5A 1XBTA 1SVWA 1US8A 4G5GA 3NH9A 4CRWB 4I1UA 1NKTA 1S9HA 4QHYA 3GJ7A 2Z43A 1XXHA 5KSPA 2IF2A 4KFUA 3H1TA 4PC1A 3MJRA 1VG1A 5F9FA 2AXPA 2HYDA 3ZIAD 1Z63A 2JLUA 4TMVA 4C0SA 1NY5A 4XTCS 5JMTA 3DMDA 2XNDD 3RSOA 5EP2A 1JEDA 4QRHA 4D4JA 3RDPA 3C7KA 3MD0A 2FGJA 4P4SA 4PO8A 4V02A 3THOA 1AS0A 1NNEA 4NMMA 1CKEA 1RKBA 2J0VA 4WAUA 2FFHA 2ZETA 1X6VA 2ORWA 3LO5A 1G7RA 3Q9LA 4L5BA 4EAQA 2FWRA 1NN5A 1E94E 1AGRA 3EIHA 2OE2A 2IA5A 2OXCA 4QBGB 2V4ZA 4BLTA 1KI6A 3LH5A 1NKSA 4OQMA 2FZLA 1TQ4A 3NBYC 1JECA 4CEHA 2MMCA 4A36A 2P3SA 2VP4A 1XZQA 1OB5A 1FQKA 1ESNA 1NI3A 3CF6R 1YZNA 3FKQA 3QKUA 1Z6GA 5BN4A 3CRMA 2ZI3A 4TLBA 5F3WB 1GOTA 1LS6A 4C30A 1E1QD 1VYUA 4Z51A 3O8RA 3EIQA 2EWWA 2BIFA 5FPYA 3ADCA 1U9IC 1Z0DA 2JLVA 2BWJA 1OH6A 1D5CA 5DLQC 1LFDB 2J87A 2PCLA 3QXXA 1VCMA 4RVCA 3A1WA 5E7MA 3SE0A 4NHOA 1R10A 1QHGA 3ZVLA 1JALA 4S2EA 4BZQA 2REOA 2ATXA 4YXWA 3REFA 2ZSEA 4BFVA 3VU9A 5H68A 2W0MA 2OM2A 4EDHA 1ZUNB 2FX3A 1NJGA 2FE4A 3KB1A 3UKDA 4ZDJA 1QG2A 3KKQA 1KOFA 2F1HA 5JRZA 1E2JA 3FB4A 4N0DA 3W5IA 4BASA 4KAXA 1YHNA 4M9XA 4G3XA 2ZTSA 2G88A 3AVPA 4HDCA 3W6PA 3B2EA 2RH5A 3K0FA 3AF1A 4ACBA 1IBRA 2YKGA 3L0IB 3L8YA 2RAPA 4NH0A 4R9UC 1JXOA 1XTKA 3THXA 4BLSA 2FH5B 3WY9A 4KYIB 4Q7JB 3ZGXA 4EJSB 4LBZA 1U0JA 5CB8A 3AUXA 4QBIA 5EE1A 2CL0X 4TYQA 3SI7A 5HTKA 1VYVA 4BLRA 2CJWA 5EP3A 1FMJA 1Z0JA 4DCUA 4MDFA 4U00A 1UKYA 4PHTA 1KGDA 4WOPA 1XJQA 3I5YA 5AJVB 4IHQA 1V43A 3GFTA 2Z83A 2JJ2A 1NP6A 2QQ0A 4IKEA 4OK5A 2IYWA 2XAUA 1OV4A 1RE0A 2OLJA 5FPKA 4ZCLA 2UZIR 5EXSA 5LBIA 1KKLA 1D9XA 1G8GA 4O2RA 3T35A 3AUYA 1EX7A 3T15A 2F1RA 1JI0A 2HCJB 4UNQA 5AUOB 4RKFA 3AM1A 1XD2A 2VH5R 2ZUBA 5JSZA 1AKEA 2WPDA 4X8HA 2VEDA 4A2PA 3HYTA 1TQ6A 3DM5A 5TY0A 2GJSA 4RD3A 3A6PC 2ZR0A 3VNUA 4DVGA 1S8FA 2V1UA 3KJIA 1OW3B 4IDHA 1X8JA 2R6CA 1K5DA 2D7CA 3K8YA 3THWA 3I92A 4ASUA 1XD8A 5KO2A 3MAAC 1S96A 1W4RA 3DL0A 4FMCF 5SZJA 4W5JA 1E2IA 2C03A 2FA9A 5J4YA 3DOEA 2DHRA 3PJRA 3PUXA 1M6NA 1Q0UA 2ASEA 5SZIA 3AH8A 3UIEA 4QM7A 5JRJA 2GJAA 2VP6A 2C2HA 2VP9A 3AF4A 2XX3A 3BH0A 4LCBA 1P4SA 2XSZA 3NEYA 1Q21A 4F7WA 2GEDA 1LF5A 4M0LA 1CJTC 2N46A 3Q7QA 3W3AA 1B23P 1II9A 3FDIA 5KOYA 4IOJA 3GMTA 3M1IA 2BOVA 4TZ6A 1HT1E 4BEJA 2VLIA 4PQYA 3QPUA 5AWFC 2VO1A 3U3MA 1HV8A 4TTRA 4EPYA 1IXSB 2RMKA 4US2R 2QM7A 1ELOA 2YYZA 4EPVA 4U7DA 1KDTA 1E2MA 4QGFA 2VF8A 2P0EA 2WOJA 3OIWA 4Z8XA 1CF4A 4FMBB 3AP1A 1R5OA 1E2KA 2FPLA 2QMHA 3KUDA 3TUIC 3VR2A 4HAWA 1X8KA 1XCMA 2VHTA 1UJ2A 3WHLA 1CJVC 1XWIA 4BLOA 2F9LA 3U4QB 2VYFA 1J70A 4PPNA 1YR6A 2ZEJA 3WRYC 3Q72A 1ZM4A 3KFXA 4CGZA 5HZKA 1CP2A 2RHDA 2O8EA 2EWVA 2Q9BA 4O25A 4BLPA 1G21E 1W36D 3I73A 1OJLA 4YMWA 2FEOA 4OI0A 4B3GA 3KFVA 4ZIRA 4F4IA 4IFEA 1MO4A 3TBKA 3GLFB 4XVQA 2IT1A 4EPWA 3NHAA 3CPHA 1KMHA 4H9GA 3G0HA 1AZTA 1W44A 4AWXA 4Y0AA 3U44B 3EZ6A 4FCWA 3P26A 2RGNA 2G83A 3K0CA 1E3MA 1SVKA 2A30A 4TT3A 1EWQA 4CEJB 1N0UA 4OJKA 3CM0A 2IC5A 3ICEA 3NTUA 2ZJOA 5CDFE 3KQHA 4E22A 4NCHA 4EFNA 2FJUA 2E1RA 1FTNA 1PUJA 1W2HA 1GDDA 4M1SA 3VKGA 1EG7A 3O47A 4AKIA 1ANKA 4MKFA 4YMVA 1GKYA 5KDDA 1N5IA 2YJTD 1AKYA 2HF9A 5ELXA 2WWGA 1PVOA 4L8GA 2EYQA 2QRZA 1G7TA 3T34A 4D25A 3P1JA 1L2TA 1T0HB 2R6FA 4W5HA 4GPTA 1N6LA 2KE5A 3UK6A 4B3XA 5FR1A 1NSTA 4DDUA 4ZPXA 1MABB 1U98A 1VIAA 1GL7A 2FG5A 2KBEA 3IBGA 4HB3A 4Q1AA 2YV5A 1MR3F 2FSFA 1Q12A 2QP9X 2X2EA 3OEHA 3B1XA 2BKEA 5JJKA 3C41J 2D06A 3NKVA 4B3CA 2XGJA 2C8VA 3T1QA 3AVWA 2VTKA 1AA9A 5JI3E 2B7BA 3GLGB 3RS4A 4KLNA 4PPGA 1ZU4A 4P4UA 4PHGA 1N6PA 2PZEA 3A1UA 3DM9B 3GJ5A 2H5EA 4GOKA 1U0HC 221PA 5EE0A 5TMPA 2X77A 3T1OA 1ETUA 1LY1A 2J7KA 1OYWA 1UFQA 1VYTA 5DI3B 3U5ZB 2ODNA 4C0BA 3OEEA 2WWHA 1R4AA 4V03A 4BWYA 3B8HA 3OF5A 1RFLA 2ZJZA 4O0MA 1ZD8A 3W8NA 421PA 1OLOA 3FGNA 1DBSA 1N25A 2G3YA 1Q3HA 1S9DA 2N42A 2QN6A 3CBQA 3QPVA 2IL1A 3GD7A 2IHBA 3K1JA 4LJ7A 5GJWC 3LBIA 3TAUA 3GPLA 4LJAA 4LJYA 3PEYA 3CNOA 5L3QA 1XDBA 4Q7KA 1OT3A 3KKPA 1YR9A 4QBHA 2JDID 3KKOA 1T8UA 1C9KA 4ARZA 1FX0B 3THYA 2DB3A 2KWIA 4XWAA 1H8EA 4I81A 4DC9A 2DCUA 3IIJA 4PC2A 4HAUA 4RCYA 1NLFA 2O8BB 2B6HA 1XCPA 4F93B 2VHUA 4RY2A 4DSNA 3ZD7A 2NO1A 1OXTA 3SJCA 4QFMA 4URZR 4H1VA 4PTLA 4LHZA 2NO0A 1SVOA 1OXSC 4WIAA 1GVNB 2LWIA 2IYQA 1VDZA 2QM8A 2ZIAA 4UJ3A 2C9CA 1EFHA 4F92B 3SBEA 3KQUA 5FTLA 1AS2A 5FTJA 3NBXX 2PLFA 3GJ0A 3M6AA 2ZYUX 3ND9A 2WKQA 1W2GA 2JJ2D 1JJVA 1Z2AA 4C2UA 2ORIA 4WXRA 1ZC4A 1FUKA 1YZKA 2ZRNA 2YOFA 3B9QA 5AJWA 4A6XA 1F2TB 4DCVA 3QF4B 4HLDA 4GRAA 3WNDA 2J7PD 3CR7A 3X1YA 2NOAA 3L82B 721PA 2P5SA 4JBYA 4TL9A 4E09A 4FCTA 4M1TA 5B57C 2C5LA 4EQ6A 4UNPA 4PAMA 4Q03A 2ZYWX 4XSHA 1TQDA 3WP0A 2NZJA 3W5JA 4IOMA 1AK2A 4Q00A 4ASUD 2W6JA 1TL7C 4JLPA 4QNRA 1A2KC 1GNPA 3M4YA 3IGFA 4C0LA 5G40A 1XP8A 3LV8A 4YMUA 1U8ZA 2EFCB 4E07A 1LNZA 1BOFA 1SXJB 3KKNA 4GT1A 4D0GA 1T3HA 2HEIA 3VR3A 4KBGA 2XSZD 3OFNA 1M2OB 2ZRCA 4A8JC 5KHOC 3R7WB 4TYYA 1Q22A 3WYGA 2PX0A 5J4LA 3I32A 2O8FA 2OAQ1 3SN6A 1NBMD 4JJZA 2GILA 1QHSA 1Z2CA 3GLHE 2CNWA 2WWWA 4DSOA 1YVDA 4AKEA 2IYVA 3K9LA 3N70A 4EIWA 1GSIA 2OBMA 4NCJA 4QJ5A 5TDHA 2OHFA 4LWZA 2VHJA 2AK3A 5BN3A 1G3RA 2XXAB 4OQLA 1IN6A 1G8PA 5CJ2A 1FW6A 5KDOA 1KMQA 1J7KA 1TADA 2WJGA 5B30A 1G7CA 2JCSA 4QGGA 1OF1A 3C8UA 4QC2A 1NMXA 1Q1EA 3QKSA 2BKUA 5JWOA 1W36C 3ZZTA 4P4TA 3LX8A 4GOXA 4B71A 3UXMA 3BAFA 4MGKR 3CRQA 2QBYA 4PZZA 2GXUA 3ZZ0A 3A58B 1G8YA 1W4AA 2JLZA 1W0JA 2GJ8A 2ZUDA 2GETA 2GBLC 4KITB 1DAFA 6Q21A 4TQAA 4IXMA 3DOFA 4PC7A 2FMXA 1KYIA 2QSZA 4EFMA 2ZS8A 4R98A 2LKCA 4ZKDA 1E1RD 1KI2A 1T9HA 2AHOA 3D3QA 3WP1B 3L0PA 2R62A 3QEJA 3G5UA 1KK1A 2ZI7A 8OHMA 2QT0A 3PQCA 4HB4A 1OIVA 1XFAA 4LI0A 3MMPA 1UKVY 4WZBE 1DAEA 1Z5ZA 2F6RA 2GDJA 4M1KA 4N1AA 3SU8A 1VIYA 2ZR9A 1W48A 1AIPA 2RGCA 1U8AA 1G19A 2JLXA 2ZU6A 2ZXUA 2OT3B 3SHFA 1NVWQ 1QDEA 1T0JB 3TJZA 1U99A 4A0FA 3B85A 521PA 2YWGA 3BH7A 3GLIE 2HF8A 2ZSFA 1G4AE 1SVMA 1WQ1R 4YDSA 5FBVB 1E2EA 3NC1C 3TH5A 2A2ZA 1II8B 2DWPA 4RD2A 3ONWA 2XB2A 2JJ1D 2QSYA 3BFKA 3D7MA 4OYHA 2ZRGA 3EPHA 4JVMA 5DHFA 3QJYA 3TIFA 5AUQA 1TTTA 1ZAKA 1W4BA 1Y63A 4I1SA 3OEHD 2WJJA 4QM6A 2WSMA 4MRVA 2J9RA 4NKRA 3JVVA 3QVVA 4OHXA 3SEAA 4US1R 2OLKA 4AYTA 3MG9A 3T1VA 1G64A 1U0LA 3B7GA 2BBTA 2G1KA 5KYKA 1VKJA 3O8DA 4BEBA 2YWEA 1ZIOA 4KSCA 3A36A 4UNRA 2JJ8A 2J59A 4P31A 3QE0A 5C4GB 3CZQA 5FPTA 2R44A 4DLTA 3OEED 3V4RA 5FOTA 2DFLA 2GEVA 2ZYVX 1RYFA 3CONA 4X8MA 2BM0A 4V0OA 4PZLA 2ZE6A 3RS7A 3HP1A 3H0KA 1E9SA 4B35A 3VR6A 2R8RA 1GG2A 1KNXA 1UADA 4LRWA 3KXIA 3WBJA 1E69A 4JLMA 3VAAA 1FP7A 1CXZA 4AY2A 1W46A 1GRQA 2QTFA 3F8TA 1YR8A 2PEYA 2G0TA 1COWA 2QL6A 1E9EA 2ECKA 2HXSA 3A1SA 4M8NE 2RKOA 5DN6A 3TNFA 5JWHA 3RVBA 4I99A 4Q4HB 1XEWX 2ZVPX 3L8ZA 4A82A 5SZKB 3QPWA 4D82A 2ZI9A 5FBLB 1G4UR 1OPXA 2WVJA 4DZZA 1BYUA 4JBWA 1E2FA 3RYTC 4PR0A 1AQYA 2F1IA 1OE0A 1IM2A 3LLUA 4YQFA 4EJSA 2BMJA 3N5CA 2JEOA 3U6BA 3LBHA 1ZC3A 2RGEA 1JPNA 1DAGA 3BD9A 2GF9A 5CIQA 4AYWA 1IOZA 3OIYA 1W0KA 5GJCA 3CUEF 2BBWA 3P27A 3FMOB 4MYCA 5BN5A 2C95A 5HCNA 2DPXA 1Z83A 5ANRB 3CF2A 2WSSA 3NXSA 5M04A 1AM4D 1Z08A 3SOPA 4RZ2A 3PEWA 3LVQE 4IDNA 4OK3A 1OH7A 1N6HA 2IYXA 3BXZA 3U3JA 5L3RA 1M74A 3FKSA 1HE8B 4B44A 5FOXA 1II0A 2I1VB 2ZR7A 2BC9A 3CWZA 3W6OA 5JS8A 1ZINA 1XPUA 3AVXA 2NQ2C 2Q9CA 4C3ZA 3AVVA 3PV0A 2D4HA 3GLFE 2JATA 2KJQA 3Q85A 2W6JD 1JAIA 4IEEA 3U7EB 3FYHA 2H92A 4WVFA 1G18A 2P65A 2R9VA 1WBBA 2IYLD 3IPYA 4GL2A 3ZVMA 2Z0MA 4YONB 3EZFA 2BJVA 4YLGA 5UKDA 1G7SA 3VQTA 3OFND 4W5WA 2ZSBA 3TVTA 2XNSA 4PC6A 4J0QA 2HYIC 1N6NA 4B32A 4B75A 1JXMA 5C2JB 2WMOB 4JLAA 4LUCA 1UBCA 1ZJ6A 2CNWD 2FPKA 3K70D 4Q66C 1UBFA 4RD1A 3LW8A 4Q1CA 1GKIA 4RJLA 5BWMA 1W5SA 1XMIA 2O8DB 2VP0A 4EPTA 3EZ2A 2AD1A 4ILEA 3W90A 4QJ4A 2WWXA 3B1YA 3GLHB 4IFBA 5AJZA 1WMSA 3QI2A 4DDTA 3C5CA 4BQSA 1N0WA 4PSAA 4GOJA 1NRJB 2J0QA 2ZI6A 3OAAA 3X2SA 1TMKA 1XB2A 4MGIR 4R7ZA 4JLKA 4XJXA 3AVYA 3PXGA 3RWOA 2IYSA 1E2HA 1ZCBA 2Q6TA 5P21A 3TRFA 2IUUA 3LFUA 1OH8A 2QPOA 4X8OA 3ZDQA 3VFDA 4DRZA 1K6MA 2G1JA 1D2MA 5F9HA 3MWYW 1U94A 2A7QA 4AG5A 5KSZA 3GLGE 2JLYA 1N6KA 4BFXA 1X1RA 3U4QA 1IN8A 2IW3A 2ZJBA 5GJVC 2JIZA 2QTVB 4P3YA 4OL0A 2C98A 1SHZA 1XD9A 1NY6A 1W0JD 3KXKA 2RGNC 4LSGA 3DKVA 3PG5A 2CK3A 2OSBA 3K0CC 1J99A 2GWHA 4CW7A 2CL7X 5IHPA 5IDVA 2DYKA 4OJQA 1DVRA 2OCAA 3GFPA 1ZVQA 1Q3TA 2J41A 3ZVNA 2ZS7A 4KHZA 2WICA 5CK5A 4WBSA 4QBFA 3TQFA 3GLFA 1CRPA 3E70C 2NG1A 4EKDA 1XNJA 4UXJA 3QKRB 3OZXA 1ZNWA 3KDSE 1GUAA 3U44A 2IUSA 1G17A 5B58C 1R8QA 2Y8EA 3UWKA 2EW1A 2WOOA 3IIKA 3MLEA 5C1BA 2WHXA 2GCNA 1E0SA 1ZD9A 2X8AA 2VA8A 4JLNA 5LDDC 1N3BA 2IBMA 4NCIA 4CEJA 4DJTA 4HLCA 1SVSA 1WRBA 5EQTA 3VR5A 3IQXA 4QHTA 3PUWA 4FN5A 1TEXA 3W34A 2H1LA 4LBYA 1E4YA 4D4LA 1M7BA 4B3BA 1DAMA 4TL7A 3X1WA 4HATA 1T5IA 4G01B 5L3SB 5FR2A 4CVNA 1XEXB 1SKYE 5HCIA 2IYZA 2D2EA 3GLIB 1E2PA 1G5RA 4HSEA 4IXNA 1ZM2A 2ZJ2A 2ZJAA 1GKUB 3DHWC 2DY1A 3PUZA 4L9SA 5GADl 2VF7A 4P0TA 1GILA 3QEOA 2RGGA 4HZIA 2QGZA 1MABA 1U90A 4BRWA 1P7CA 3VR1A 3U60B 4Y0VA 4D4KA 1XMSA 4FIDA 1PLKA 3AP3A 4ZDWA 1VMAA 2BM1A 2YHSA 1N6RA 2HXYA 3W9YA 3AQ4A 1D2NA 1NVXQ 2F3TA 3CRW1 1JAHA 1BMFD 3IQWA 3W6NA 1TX4B 3GLGA 4JZKA 4Q19A 2QG6A 1T3SA 1KK0A 4DLRA 1MRNA 4Q1BA 4G1UC 2AKAB 4CZ2A 3TSOA 4A1FA 4B3FX 4TYNA 5DI3A 1LF0A 1ZP6A 2PJRA 3BORA 4L16A 1JJ7A 3CIOA 3IEUA 1W5TA 4KO8A 1SKQA 2O0KA 4I4LA 3B1WA 1Z29A 4JKIA 2UVQA 4Q7LA 1SXJE 2CDNA 3CF0A 1M34E 2PZFA 4A0HA 3EC1A 1COWD 5JHHB 3UG6A 3PCRB 3VHLB 5D3MB 5E7JA 3QBVA 2X19A 4OI2A 4Q47A 5CYOA 4NCKA 2JLWA 4LV8B 4OK6A 3B13B 3GJXC 4LPKA 5EP1A 1QRAA 1E2GA 1IJEA 1F3OA 1S4QA 3A1VA 3GQBA 1OYYA 2FF7A 4WW0A 5J4KA 4V0ME 2FPMA 1W1WA 3KQNA 1RRCA 1FX0A 5GVRA 4TYPA 5JEEA 2ZAOA 1BO6A 3GEEA 5LD2C 1W47A 2O8BA 3NC0C 3L0SA 4ESHA 2HLDD 4JIMA 1FL9A 1KKMA 5BXQC 3FHTA 2DBYA 2EQBA 2SHKA 4DB4A 4MRRA 3MWLA 2P6UA 2E9SA 4GP6A 2K5UA 1Z0FA 1KDPA 1YE8A 1HQYE 3WXMA 4ON9A 3PEVA 4B6FA 5KNDA 4RD6A 3CH5A 1OXVA 2WSSD 1QHHB 2GJKA 4C9BA 4PZYA 2BMEA 2REXB 3UMFA 1ZIPA 5C46F 1GL6A 1L4UA 4DT1B 2FN4A 5FTKA 3WNBA 1Z8FA 1QBKC 4Q21A 3TSWA 3LDAA 2A5YB 4U5XA 4WZ6A 2QU8A 1XPRA 2IWRA 3AKCA 1F2TA 3LD9A 3QF4A 1OHHD 1YZQA 2IXEA 4C0QC 2PX3A 4Q18A 5FUVA 2GCOB 3LQQA 3N2EA 1D9ZA 2VPPA 3O8CA 3AGQA 3K0EA 3C4JA 3SS8A 2A9KA 4DLUA 1DAKA 1RRGA 3FHCB 4QGHA 4XOIA 2A3RA 3B78A 1G9XA 2ZRLA 5DHAA 5HKKD 1UKZA 2PBRA 3FMFA 2IS6A 3LVRE 4A2WA 2BCJQ 2QI9C 3K70C 3EPJA 4XH9B 3BJIC 3RS2A 1DE0A 3UPUA 2I1QA 3AKDA 3LWNA 4Q4AB 3SYLA 1SXJA 1XMVA 5F2EA 5EE3A 4GZLA 2VHCA 4N3NA 3P32A 4MQBA 3F3YA 4X8LA 1AJEA 4KU4A 1SZPA 1DOAA 4V0NA 4TL8A 3CW2A 3R8CA 1YR7A 2XB4A 3A4MA 3R7WA 5KPJA 5FOUA 4MRPA 2NIPA 4F91B 1J8YF 1P9RA 3H86A 3PITA 4V0MA 2GCPA 2CBZA 5H1YA 4AI6A 4LBWA 4HAXA 4N0EA 1W4CA 2B8TA 3R20A 4JLVA 5HPYB 2BJWA 2OCBA 2FOLA 2PLRA 4DSUA 3OAAD 3E1SA 4RZUA 5CJPA 2A5FA 3ZJYA 4NCNA 4A4DA 2XXAA 3BB3A 2J45A 2J0SA 5TB5A 3CPJB 4CDGA 2Z5FA 1SVLA 1IXRC 3RRMA 1E0JA 3H4MA 4DCSA 4BLQA 2OBLA 3J81k 4JJKA 4MUAA 1KI8A 2CE2X 5HE9A 3X1ZA 1JR3E 1IAQA 1S1CA 1I2DA 4UKDA 1HT2E 5JHGB 2H7VA 821PA 2BCGY 2JIZD 3SFVA 1P2UA 4QG7A 1DS6A 4LHXA 2Q3MA 4Q48A 1LB1B 3KUCA 4BFWA 3AKYA 2CK3D 1ZW6A 1JBKA 1DG1G 1GP2A 4IDQA 4PSKA 1KI7A 3NHBA 1GZSA 1MO5A 1OXUA 1SQ5A 4M4SA 4TQUS 3U7HB 5JJIA 3T1TA 3TW4A 2R6DA 2NZ8A 2Q0HA 3PENA 2OCPA 4MYTA 2ZI4A 4NBSA 3DDCA 4NDZA 5EUQB 3AF0A 1E9BA 2VHQA 4HAZA 4P33A 5GJBA 1KSFX 4NYMR 5EXPA 1WB9A 4GMDA 4YXWD 4V0KA 1FFHA 1RZ3A 1Z6TA 2ZRFA 2GXSA 1NSFA 4HAVA 2H16A 3TW8B 2QY9A 3BERA 3ZD6A 1KZ7B 2F43B 3CZPA 3LY5A 4I1OA 5JI2E 3RANA 1KIMA 3VTKA 1M8PA 2A5DA 4FD2A 1OKKA 2CHQA 1T5LA 1E79A 3LRPA 4BZPA 2O8CB 1AN0A 2EFDB 5G53C 3FOZA 1XTSA 4C2TA 5CDFA 4URYR 3EZ7A 3LX5A 2IYRA 4ERNA 3SNHA 1YKSA 2ZSAA 1KAGA 3FVQA 4LYFA 3EXAA 2QQEA 4PFSA 1FP6A 1OFTA 2Q9AA 4JYCA 3ICQB 4JLDA 5HZHA 3BH6A 3KJEA 5HR5A 3NEJA 2P6RA 2VP5A 4M9ZA 4Q4JB 1II8A 3AF3A 2WAXA 1F48A 1GAJA 2CEAA 2GZDA 3B9PA 4LHWA 5C18A 2A5GA 4FWTA 2WWIA 3V00A 1VCNA 1YJ5A 1QVAA 5TXGA 2DFKB 4JVLA 1SKYB 1Z6XA 4DEXA 2ZM5A 5LPNA 2V1XA 3I8SA 5DE3A 4JLBA 2F55A 2YWFA 4CT5A 2QA5A 4AYXA 2PT7A 1P75A 1QVRA 3KQKA 4LHVA 1JQLB 2A5JA 4TZ0A 4HB2A 3BOSA 4RD0A 1JNYA 5BQ5A 3UMRA 2R65A 5EE5B 1JR3A 2VSFA 4IVPA 5JZVA 1RJ9B 1KSGA 1U8YA 4BUJA 3CX7A 1G5TA 1XJCA 4LC0A 3QSYA 2C77A 3ECCA 5CYPA 3TR0A 2WIBA 1XEFA 4JSYA 4DUGA 2ODWA 2WPDD 1G8FA 3BRWD 3CPEA 1A82A 1H65A 4YC7A 2F1JA 4CT4B 4TSFA 2ATVA 1HEIA 1DO0A 2XTZA 2OILA 4W9MC 3I4LA 2J3EA 3ADDA 1UDWA 3AVTA 3MJHA 2XJ9A 4K46A 2O52A 4K81B 3PUYA 2V8OA 2HCBA 3GJ8A 3GP8A 1XJ0A 2JLQA 3CKLA 4M9SA 2B21A 4IRUB 3SHWA 2WM9B 3W3ZB 1D8TA 1NMYA 3GFOA 4PXAA 3WNCA 3TSZA 5G3YA 3QOFA 1P2SA 2GK6A 3BB1A 4MA4A 1HE1C 4BPBA 5AJYA 4KI0A 4EJSC 1XPOA 2ONJA 2BV3A 2V6JA 3HYRA 1T6NA 2YZ2A 4OQFA 1TU4A 2IWHA 4TLEA 1TEVA 2FSGA 2QAGC 1P60A 2HT1A 1E0AA 1P73A 2GK7A 4Q4HA 4TMWA 1XMJA 1KSHA 4PC3A 1S3SA 4AIIA 1CU1A 3CNLA 3T5DA 5KNBA 2C04A 4D0NA 4YMTA 1CIPA 4D81A 3M0EA 3K9HA 3NBZC 4TLCA 1M7HA 4CEIB 2AFIE 2ZRMA 1L8QA 3FTQA 2AR7A 1TQ2A 3ZS9A 3LBNA 1HY3A 3E5HA 4BFTA 1K5GA 3IO5A 1CTQA 5EZ5A 2IYUA 2QE7A 3P4XA 2OFWA 3OE7A 1E9AA 2ZRPA 4GBMA 3TLXA 1LVGA 2XTNA 2ZJYA 2IEYA 4DBLC 4PO1A 4PHHA 2ZE8A 3K0AB 4D6PA 3IHWA 1O3YA 1P9WA 1Z6AA 1X8LA 2Q3FA 3FFBA 5FUXA 4IEIA 3RHFA 1P61B 4GNKA 5KSOA 4UNNA 4GDFA 2W2XA 3GEIA 2ZANA 5KTYA 4B34A 1Z0KA 4RSGA 1WF3A 4KYUA 3RRYA 4QHSA 2A78A 2ZRIA 4HLQB 3LQRA 1TU3A 1GITA 1CULC 1Q20A 2B8WA 3ZIAA 3RS5A 1WCV1 2AX4A 2IXGA 4NZYA 4DLSA 1P62B 4TMZA 5K8IA 2XNDA 2QMOA 5KNCA 2IXFA 2ZS9A 4PO9A 1UEIA 1Z07A 4M1WA 3B5JA 3IO3A 1MKYA 2HUPA 2GXQA 4XSGA 1T8TA 1ZM3A 3TK1A 2ZRJA 2ZRBA 2ZRKA 4R2HA 3B82A 1XTRA 4MITA 1SHKA 1GWNA 1NG1A 5CLQA 4TT3D 4G5SA 4TL6A 3O8BA 1R5BA 2OEPA 1UEJA 4KSBA 1ZM7A 2RCNA 2W0SA 1M7GA 1TF5A 3LW7A 2RGDA 4URXR 3NBFA 4AK9A 1UAAA 1K8RA 3EIEA 4RFSB 2QORA 3EZ9A 4KFTA 2ZE5A 2O8DA 3QF7A 4GFDA 3VHXA 4DEYA 4BFUA 3EPLA 1P72A 3GLHA 5AR1A 4Q4LA 1D2EA 1CJMA 1Z0AA 2FFAA 3QQ5A 2WKRA 3SDZA 2EFEB 2IS1A 2EU8A 2ZAMA 1Z0IA 4UNSA 2G77B 3CRVA 1DG3A 2WTUA 3OIVA 4NPHA 4PANA 4Q1EA 2MSCB 1T4GA 2X2FA 2OAP1 3LLMA 2HT6A 1CEEA 3SJAA 1DPFA 4AKGA 1KI1A 5FFMA 5K8LA 1HTWA 4OKSA 4LJ5A 1GNQA 4FCVA 2VSXA 3TGPA 4OI1A 3R9XA 2GA8A 1DARA 1DTSA 1ZU5A 4OHVA 5JEDA 1KAOA 4TLAA 1E9FA 2FFBA 2NO9A 2IF0A 3DO6A 4ZO4A 2YC2C 2ZREA 4LJ9A 1E0KA 2ZYTX 2GAAA 4I1VA 4Q9KA 3S1AB 2BMFA 2KB0A 1X86B 3HU1A 2HJVA 4MUBA 5FBRB 2XJ4A 3QKRA 1E96A 4FWIB 1CJKC 2J0UB 3TAHA 2AK2A 3MCAA 3TUJC 3SZRA 5DNYB 2UZ3A 4NYJQ 1OKKD 4BRUA 1TUEA 3NG1A 1Q1QA 1E4VA 2W00A 3I72A 3AP2A 5FOVA 1J90A 3EWAA 3CH4B 1N6IA 3FPAA 3NDPA 1H8ED 2CMKA 3ZVRA 5JFGA 4RFVA 2AXNA 2CLSA 1SGWA 1KDOA 2P6NA 3QXHA 3Q5DA 4WA7A 1CR1A 2C9YA 4HZUB 1DADA 1G3QA 3AVQA 4JKYA 1MV5A 2N1BA 5A0FA 1FNNA 4M53A 3X1XA 3TQCA 5L3SA 1A1VA 3WYAA 2W6IA 4W7SA 1XEXA 3KXLA 4XWOA 3GLIA 2NPIA 3UMSA 2NGRA 1IN7A 1XTQA 1OXXK 4GSYA 1OFHA 4EPRA 1XXHE 1LTQA 2IEZA 2DWQA 2Q3HA 3WBKA 3T06B 2PH1A 4D80A 1UBEA 4HEJA 1BS1A 4CIDA 3BGWA 3AKEA 2BEJA 2GHIA 3ZQ6A 4ZI3A 2XITA 4NE2A 3K70B 2GVDC 4Q9JA 4C0JA 1FZQA 4LYJA 1JR6A 3KJGA 2ODEA 3RS3A 2GJ9A 2EFHB 2RGBA 3RWMB 4TSFD 2FEMA 3K0SA 3RC3A 3AF2A 4B2LA 3I61A 2CHVA 4LGMA 3IPXA 4XVUA 1AS3A 1E99A 3H2YA 1NN1A 2CCJA 4ZDKA 3HU3A 1R6BX 3IBYA 3PUVA 2V9PA 1XEWY 3OHMA 4C0HA 4ZDIA 2V6IA 5B64A 1AZSC 2AFHE 3KKMA 4Q02A 3ZQJA 1RVDA 4QJ3A 3AEZA 2ERYA 1AQUA 2W2VA 1CBUA 2AD5A 2D62A 2VL7A 4PQRA 2LCFA 4LV5B 4M9QA 5D3MA 1JB1A 3R8FA 3EA5A 4EUNA 2HV8A 2GZHA 4NP6A 3BWDD 4O3MA 1QHIA 3TKLA 2W58A 2FV8A 5EXTA 5FH9A 2ZRDA 2QZ4A 5LB4A 2QEQA 1AGPA 4MRNA 4QGAA 4KBFA 3R9WA 1RPZA 4AKHA 3D31A 4M21A 1Q57A 5BW8A 1GL9B 4HI0E 4IVRA 5DIFA 3CO5A 2IS4A 2H8KA 2RHMA 4TWZA 5FI0B 3LA6A 5FL7A 3K9GA
chains in the Genus database with same CATH superfamily
1M5RA 4KLRA 1V7QA 4E12A 5DT9A 3A9WA 1TW3A 3FRJA 4UHFA 2NVUB 4EUFA 5JBQA 2Q3CA 1BHSA 1CV2A 3GJSA 4QDTA 3VDMA 1A3CA 1WDTA 1SPBS 3LQYA 3LRTA 4WXYB 2DQKA 5HJ2A 5CH3A 3H04A 1N2CE 2Q5OA 4ALKA 1QHHA 4URVR 3DZIA 1B6RA 1RJGA 3EW7A 2O2DA 3LLCA 4NARA 4PGAA 5EJ2A 5SYMA 3T94A 1YJCA 1EHIA 4TS3A 5IYZF 4PZEA 2B1IA 3C6MA 3A32A 4DMFA 4WBNF 3PI6A 3CVJA 5EHQA 3ICWA 1BVHA 3RS0A 4Z3OA 5KNCD 3PDUA 1IXZA 5E9AA 4WNAB 2QB5A 4FINA 2PIDA 3MYRA 5DULA 3IHLA 1R16A 3H97A 4KSYA 3KSRA 1FRNA 1N0HA 1PU2A 2NUPA 1NU6A 3E23A 3EOZA 1GLGA 5HE8A 4C0KA 1JZQA 4WD3A 4EJ2A 5ICMA 4YR7A 2GPTA 4MW5A 3SKYA 1QBGA 2B5WA 2MYPA 5D7NA 1X7WB 1D2RA 4LOJA 2IK8A 3SQOA 3FBTA 3CMCO 3G8DA 1LPOA 2D2VA 2YWBA 2L0XA 4Q5IA 1R7RA 3H4IA 4LHSA 1Y3AA 3OQJA 1P8AA 4WKCA 1C3LA 3QU4A 4DCNA 1VPLA 1IHUA 2QJWA 3WMRA 2DRIA 4AECA 2XVMA 4D4MA 3OPYA 3FMPB 4J0CA 4Q4AA 2VPWA 2PD6A 1KDRA 4I9HA 3L6UA 4BN5A 3GLSA 2GVZC 3NORA 3FUWA 3GDWA 3OQ1A 3R3WA 2HWWA 3UXEA 1G3IA 4U2FA 3BC1A 1M2FA 5ITZA 3UICA 5FBHA 1OZHA 2YNMA 3EFHA 5K4GA 5AI8A 4J0IA 4ZVPA 1I3OA 4HDMA 2O3JA 2A9OA 1J5PA 4CQNA 1XCJA 1JDJA 3D7RA 2AH5A 2CLCX 3RARA 3UWOA 4AULA 4WCVA 3GXBA 5DBEX 4FTWA 3IT2A 1R0ZA 2HIAA 2YOHA 1TYAE 1ABFA 5D6NA 2FEKA 9ABPA 1B6SA 3HJNA 4KIJA 4IOKA 4FK8A 2JLSA 3REGA 3EX7C 2WIAA 4OX9B 1V48A 3A70A 4WCFC 4HUTA 4D3DA 2EZTA 1DRWA 5CT9A 3ZI4A 3EUFA 3ZEIA 1LU9A 2XUKA 2GYYA 2WT4A 4GQAA 4W82A 1EWTA 5KNBH 1HYHA 1U81A 2IW1A 2JDIA 1J0XO 4MCJA 3H3XA 2WAAA 3PZBA 4URUR 2RHGB 2XDQA 5FFFA 4FYJA 1HDIA 5A3RA 2BFEA 4MUMA 4XRRA 1N1DA 4F38A 3OTOB 1XT6A 4MMZB 2IEBA 2P9GA 4NWIA 2GX6A 1R6DA 1A69A 5LB2A 4E6EA 1RQXA 1G1MA 3ETCA 3WGLA 1ODFA 2DR3A 3AWDA 4EEKA 1QRRA 4HDQB 4A8JB 4E08A 1HA3A 2F62A 1HKHA 1VLHA 2B83A 2QD2A 1L0BA 4KEAA 1QH8A 1QB7A 3B70A 4PZCA 4TMTA 4X94A 2HMAA 2VQFB 3UAZA 1O5OA 5IVIA 3HNOA 2NTYC 3VI3B 4Q9HA 1QG4A 4D3FA 1XZEA 1J20A 3VA7A 3CBGA 3HTXA 4YJ2B 3T7RA 1GJRA 1Y4SA 4U02A 2UUOA 2JGRA 5DWQA 4A0GA 1BE1A 4EYQA 4DV2B 4HX5A 1P9OA 3BILA 3SC2A 1CNEA 1NQVA 1N2XA 4E2XA 3A9SA 2CLDX 3TW8A 2Z8ZA 2TRSB 1E6EA 3CLUC 3EF3A 4ZICA 3FCCA 2PYIA 3RF7A 4ISCA 2AN3A 1UM8A 5FNVF 5JCXA 4TUYB 5KX5B 4PNEA 2GZAA 3WKDA 3H5AA 1E3IA 1P1HA 2ECQA 1K75A 2PVCA 1EZZA 3H65A 1O6FA 2EYUA 4X91A 3FSRA 3N58A 2VJLA 5F7JA 4F56A 2O8CA 1E9DA 5CCEA 1U7WA 1ZYUA 2YZMA 1HDEA 2INGX 1XTIA 2JEZA 4Y2RA 3C4VA 5GVSA 3AXSA 3ELBA 3O38A 4KE6A 4C7OB 2IEIA 2VWPA 1YIOA 2A6PA 3EARA 5CVJA 5AQ1A 1X7GA 1RADA 3EHDA 2CVHA 1XRJA 3IEKA 2G8NA 3ZH9B 3PQFA 3R9IA 3UJCA 4BKRA 2V98A 3B1ZA 1XX6A 1F5NA 3HU5A 5FUBA 4MMXB 4AIRA 4L8YA 2IH5A 4NYJR 5FPHA 3JASA 4L15A 4UTVA 1FLVA 1W0KD 3MPOA 3DQQA 1BFDA 2AX3A 3LS2A 4I55A 5G41A 3SQNA 3F71A 1D3AA 2NO6A 2OO7A 1AHHA 2VQEB 5A2QA 1XXHB 3FDZB 2AMFA 1KNQA 1Z4JA 1E6CA 4XOUA 4EHKA 5TT1A 3MUFA 2J1LA 3DLBA 3BWMA 4DPMA 1QHYA 1RJ9A 2HM7A 2RC5A 3IODA 1TCAA 1TVKB 2CLFB 1JPJA 4NPAA 5EXXA 3FTPA 2D5LA 3RC8A 3C87A 1G20E 2BY4A 3C6XA 3OU2A 1N2JA 1CZOA 4P4SB 5K1ZA 1OX6A 1P9NA 3FAKA 4UM9D 3QFFA 3LPAA 2NMVA 3NIWA 4P4LA 3HXQA 1X92A 3MPUA 4RV9A 2YHAA 1B8UA 1RQPA 2CFOA 4KO1S 2CY0A 4W63A 1AV6A 1JMVA 4FGWA 2DGDA 1YL7A 5IAKA 2WB2A 1MVOA 4NEQA 3OZWA 1NT4A 3LUCA 3OQVA 3DZBA 2W4MA 5LNK6 4ESVA 3NM5A 4NJEA 3NIFB 1Q1NA 4G67A 4LJLA 5HEKA 1P6QA 1V16B 2IHYA 2WHYA 5A9TA 2ONKA 2VDLB 3V46A 2BGWA 1Q2UA 3I1FA 1X0XA 3N0WA 1YOVA 1X74A 4IWXA 4BDTA 2W2TA 3IEPA 3WLIA 2CMGA 1TVEA 3DCYA 4TQ9A 3WIOA 2PX4A 1CEQA 1K6JA 4ISBA 1HNXB 1MNQA 3KJNA 1T9KA 3AC0A 3PQ8A 4EA9A 4WKBA 3F5FA 4Q1VA 4RSRA 5LP1A 2J3DA 2ZIXA 1PT6A 4XB6B 5FO1A 3OZCA 1DEAA 1PK7A 3DD1A 2HQSA 3G88A 2PPLA 2XDYA 3NQ41 4PAQA 4YJHA 5DTJA 4CUKA 5A5GA 3PC6A 1D6JA 5A0VA 3Q6MA 4RSMA 5K20A 3RYFB 2OV2A 3KVNA 2HO4A 1OILA 4KQFA 1OASA 3IIMA 4HQFA 1E4OA 3ZDYB 2CVOA 2CZQA 2G7MC 4G26A 2YJZA 3K0AA 3K92A 3Q8XB 4H17A 3QLEA 4MH0R 3GA5A 3BSFA 2QX7A 3BFXA 4P36A 4CT0A 1ESCA 2IS2A 1P0QA 3CISA 1ZNZA 5BYJA 1EQAA 3LNCA 3J80A 1QCZA 2MIIA 3M9WA 2O6HA 3ELYA 3ZNNA 3A31A 1EFTA 1YS4A 3DAFA 1HH4A 3UY4A 4MVYA 5HBRA 5CB6A 1AK9A 4G1BA 1KJWA 3BL5A 5IFLA 2YRXA 4I5IA 2ZRHA 3R3VA 4XUGB 2MCFA 5GP1A 2I9PA 1J2TA 1WXXA 1P3JA 3ZHXA 2NT3A 1C1DB 2C7BA 4KE7A 3EIOA 5E6UA 5FWNA 1T29A 5IJWA 2AYYA 1L4NA 3EXHC 1SD1A 2OGTA 3EYWA 1RYHA 2OCGA 1R0WA 3VO8A 1QE0A 3HCPA 1MU0A 2Z2XA 1OROA 3O95A 3PQ3A 3RNLA 4MYUA 4BO4A 1QZXA 1K4KA 4ZO6A 2BSXA 3DF7A 2BI8A 4FJ1A 1IBSA 5EWJB 5BN1A 1B8VA 3HCFA 2Q5LA 4BP1A 3DFKA 4JP8A 1XOIA 3IDFA 4FHEA 1TF7A 3EDOA 3QLVA 5ARDA 3V1NA 1V3QE 3GC6A 3VR5D 4CGYA 5BV7A 1NQAO 2ZAIA 3M89A 3EK2A 2ACEA 5K3AA 5C0OE 1KS2A 3CCCA 2Q5EA 3L0OA 1T91A 1T6BY 3UHFA 1RAAA 4DQVA 3KQQA 3QLUA 1EYZA 4AMYA 1HBJA 2IYYA 2W83A 2MMGA 5E9JA 3V34A 3ZWQA 5H8WA 4ZU1X 2NP7A 4ID3A 2R7NA 2XCQA 4Z0NA 4YJ2F 1G5IA 1QOPB 4S35A 3NP9A 4C4TA 3X1JA 4C7KA 1QFYA 3U0BA 2ZTMA 3C2QA 4AG6A 3K9WA 4DLYA 5LKRA 2Q3BA 3Q5EA 4WI1A 3TTUA 4GYKA 2E5WA 5ESXA 4ENSA 5T4EA 3AVUA 4E14A 1WD5A 2QAIA 4TUYF 5KX5F 5C5DA 1B0PA 3BCRA 5F33A 1EVZA 3B38A 3HCWA 3UWMA 4P8RA 2AJLI 4KUGA 3U3KA 3PFGA 1JYSA 3LUJA 1NVVR 2HB6A 3ELWA 1U6IA 4MS4B 4Y1FA 3QYJA 2BMVA 4X41A 4ALMA 1D1SA 4JVSB 1E2UA 1GZHB 2EGHA 2GESA 4IZHA 1NN3A 3LAWA 1RNLA 2ZWAA 1XZJA 4JI5B 3HPQA 3N59A 2EZ8A 2GCIA 5L95A 3GZJA 3QJ5A 4G36A 2GEJA 3H2IA 3N0RA 3AZQA 3LCUA 3ZZNA 5IKMA 3B3JA 1BFUA 4RAOA 4NULA 1U6JA 2H9IA 4QPJC 3DXXA 5DNAA 4BECA 621PA 1RP1A 3DMNA 3UUEA 2GUWA 2VTVA 1RYDA 2C2MA 1BDIA 2X4GA 4TMYA 5K8TA 1O0CA 4QLOA 4BE7B 2PUCA 1MV8A 3BDIA 1PLLA 1FYXA 3D6HA 5J4HA 4YCBA 3IAHA 4XI9A 1H1DA 3ZS8A 1I0IA 5IH3A 4PXSA 4BFYA 4MW2A 3QG1A 5HM6A 1BKDR 1K9SA 3TB6A 2J0UA 3ZDZB 1AKUA 2NUAA 2Y27A 4PYQA 1TB4A 4F3NA 3DEFA 8ABPA 4O2BA 4F1WA 5J5CA 3UM9A 2AJCA 3JQ9C 3S2UA 2P8SA 4DKXA 5JNVA 5IS2A 1VKRA 2JGNA 1XHFA 1QV7A 4ZIRB 3QKIA 1ZQ1A 1G8KA 5B2ZA 3TCXB 3ENVA 1NVGA 2Y1XA 4CCWA 2EFGA 4M0FA 3WGZA 2OP0A 4Q15A 2CB9A 1E2NA 1Y5MA 3TD2A 5TRTA 1EFLA 4ND2A 3KQPA 1U3CA 3BMNA 3DEIA 2BBOA 2X7HA 5AM5A 1PVDA 1WB4A 2FF5A 4TM8A 4Y6QA 2NACA 3KEQA 4KFSA 4EO7A 3DVAA 3EHEA 3OM1A 3OZAA 3IDQA 2APJA 2IODA 3JS5A 1Y34E 1KZGB 3AMVA 4GLBA 5F7ZA 5FL3A 3RT7A 1JG3A 2WU0A 5FQNA 1EM8B 4DA8A 5KNDD 4QL3A 4HGQA 1D6MA 3T3GA 1KRHA 4GI5A 2PT5A 3QLJA 4NYIR 1V96A 1W19A 3HFRA 1PVOA 2YFHA 3IR6A 3M9LA 3NHRA 4U1RA 5FUWA 3AUUA 1CUGA 2CNOA 5JS2A 4HDRB 1PG5A 3WLEA 3EQZA 2ZUFA 3G6WA 3QU2A 5BV0A 5ADHA 3VTZA 4D46A 3ORQA 3CLTC 3UB2A 1IUPA 2K87A 4ICIA 3UAYA 2GKOA 3LM8A 4QKQA 4JLOA 3DNFA 2NV0A 5I7FA 2F4VB 3VKWA 3SX0A 2JFXA 2Z6AA 2JI9A 3PK0A 5E6SA 5CFOA 1DT5A 4P92A 1FMFA 1XCBA 2CDCA 3DAHA 1RQLA 4UEKA 5H9WA 3I45A 4Y6LA 3MQFA 2RKBA 4XASA 5KAPA 1LS1A 1L7BA 1SHJA 4EA7A 4J0FA 3C1TA 3RVSA 1I4DD 2WKSA 1X15A 3CUSA 3UWPA 3FYTA 5K8UA 1NMZA 5I8PA 2QG9A 3ZBUA 1ULHA 3ZHBA 1FMLA 2VYQA 3G2PA 4TTAA 2OD2A 4MS3A 2Y71A 3FROA 4MRMA 3C24A 1AKWA 2WV9A 2DAPA 1WVIA 2BSQA 2QR2A 2PS1A 1UT5A 1LZKA 1U2RA 2Q0XA 2ZUUA 2W98A 3DZJA 2PANA 1LRLA 3Q7EA 4IDPA 1I1NA 3HA7A 4RKYA 3ROTA 1J6UA 2F7SA 3EDQA 3SWWA 1G6HA 3OC6A 3TD6A 1Z35A 2ZM6B 1GUZA 1P4AA 4DDWA 1C30B 2B5VA 2MT9A 2PFGA 5GAJA 1E1QA 2JHAA 4PPQA 1EB9A 1RYZA 2Z95A 4YX9A 1NPTO 3EISA 2JLCA 4OU5A 4FQ7A 1YK0A 4G56A 3AZOA 1UFVA 2OVFA 1NBWB 3I52A 1ZCAA 4H31A 1FS5A 4KLZA 4CDNA 3ZK9A 1IQUA 2EP7A 4MTLA 1XCOA 4GKBA 5CDTA 1C3JA 3TG8A 6ADHA 1ZD1A 5I51A 1AF7A 1DCFA 4HUQA 3D3WB 3VOSA 4XD2A 2I7DA 2CXQA 1FBTA 3JRWA 5JLJA 2AMVA 2HSZA 4LHEA 3RKSA 5AW5A 4WCDA 3UATA 3U7QA 4JGIA 4DR5B 4YLEA 3PDIA 1MEOA 1H6AA 2CF6A 2QF7A 4G6ZA 5CX1B 3DDNA 5TX7A 1XROA 3THYB 1E9CA 6AT1A 5HHTA 4GX5A 4TS9A 2W7TA 2ODTX 4L28A 2YOGA 2J5BA 2B7CA 1NW3A 3L77A 4K9RA 3WK6A 1CR2A 1LV8A 2JVIA 3FOFC 2J5XA 2BEWA 2ZB4A 1TM4E 2Z8XA 2OHJA 4DXAA 5K51A 4XFDA 3AXTA 1CJUC 4I5EA 2C83A 3WMFA 3WGHA 1ULBA 2A9QA 2WPNA 1E59A 1K68A 3MWKA 1JKJB 1RXEA 1EGAA 1QR6A 4M9CA 1SBHA 1VBFA 2GZMA 3C1OA 4F9GA 1TK9A 3HU2A 5FORA 3W1WA 4B74A 4M99A 3THXB 5F3DA 1U8TA 4MDHA 1IONA 3MN1A 1FOEB 1T25A 3K9NA 5DH9A 2PD4A 4CKEA 3MS4A 4UREA 1EDBA 3G0BA 2C9ZA 4MR7A 5E1BA 1GTVA 1QX3A 4YREA 2YNMC 3X1KA 4E5UA 5EUMA 1M2KA 5LD2B 2HW8A 1ONBA 2NU6A 3DTVB 2VP3A 3DBRA 1PLJA 3TE6A 2FQQA 3TNDA 2B4TO 3F78A 1Q1GA 2O5VA 3L43A 3Q7IA 2YWRA 1WZNA 4DMGA 3I04A 2AG0A 1WABA 2ZJ6A 4Q3OA 4YAOA 4JL5A 2JANA 1QHEA 2O7QA 1UR5A 2YXLA 2JF0A 5A4KA 3KRTA 3GCGA 4RFLA 1QZTA 1TZBA 1WU8A 5FOQA 2RJ3A 1SC1A 1JQKA 2PXAA 1T3ZA 1Z0SA 1QH1A 2PKQO 2Q45A 3I09A 1TYBE 2OUKA 3NS7A 4N5HX 4RU1A 3TYXA 2R8XA 1GN9A 2JGIA 5EWLA 4YNBA 3IA7A 1OZGA 2GNOA 1SKBA 2WHQA 2ACWA 4Z0HO 3K16A 2ST1A 3VPFA 5JCPA 1FSZA 1RM4A 1Y1PA 1ZZEA 2XEXA 4NU6A 5TQ2B 3GNTA 2EX4A 1TCUA 1NVFA 1DBQA 3FLMA 4KVGA 3RTCA 3RAPR 4EWLA 5HGXA 2DSTA 1A9OA 4P7GA 3KEMA 1ARZA 4HGPA 3UT6A 4BGDA 1NTOA 1C9NA 1M10A 3T52A 4BJ6A 1BHO1 7MDHA 3LYLA 4IJWA 4IM7A 5F1OA 2VUTA 2OPHA 4ZCIA 3ZXYA 4LYHA 3B60A 1JR3D 2SNIE 4GI7A 3TPCA 4H4CA 3SE7A 3ZHOA 1L3CA 2X1HA 4IH9A 1M6HA 2DBZA 4YAEA 4M8LA 5DBIA 4ONEA 3MJSA 5IULC 3GYBA 1H8HD 1UMKA 2QPTA 2X1VA 3HJGA 1YT5A 1E98A 1N9GA 1PDWA 2P3LA 4S3MA 4BB6A 1IY1A 4I8XA 3X2EA 4DUGD 1R8XA 4FYVA 1SIBE 5G1PA 1GZVA 3I23A 3MSXA 4OAQA 3RTEA 3HO1A 3BL8A 4G0WA 2Z3VA 4RYDA 5AVUA 1AGNA 2C0PA 2O8VA 2BMDA 3C3PA 4B76A 4KN9S 2NU7A 3EJ6A 3QA3E 1X2EA 3GB9A 1WTCA 2OCLA 2FR8A 4RK7A 3W9BA 4G0NA 2WQZA 3QXSA 4R1TA 1QB8A 2RK3A 1DIAA 1YZGA 3QKSB 3WYDA 5BNIA 2CE7A 5CIWA 3THSA 4B3HA 4F84A 3ZNQA 3KQLA 1Z28A 2W93A 1SKUA 1VCIA 1CR4A 1GV1A 1GZ7A 1N1MA 2H31A 3ANYB 3F9RA 1G6Q1 2X9QA 3HA5A 1KTVA 4ITRC 4XCVA 5DCUA 5EFZA 1EFKA 3I58A 1M0SA 1VB5A 3ID6C 3OCUA 4FMCB 2QP3A 5B3LA 1Z73A 5K7SA 5DNEA 2QXYA 2J07A 1YR1A 3U3RA 4FFMA 2NV2B 3DEHA 4HTAA 4QPDA 1HDCA 2CL5A 1UMDA 3AEQA 4UEOA 2OBYA 3RHZA 5KJCA 1S2NA 3K53A 2JBAA 3LECA 5BYKA 1Z7YA 1PQ4A 4DQ0A 2ODBA 5M7EA 1JEEA 1V5GA 3OICA 4OOEA 2GS9A 5D3QA 3NPAA 4Q1FA 5FWAA 5THQA 1W25A 2VATA 4MKZA 1OMOA 4MB0A 3PXAA 4LWQA 5E7QA 3U2QA 3VX3A 6LDHA 4LJ8A 1KQ3A 2BDUA 4P98A 4WBXC 1SCAA 1CR0A 1WLSA 4AZVA 2DG2A 5D3ZA 4AZ3A 2DQ4A 1A5TA 3OLCX 3RUFA 3A9UA 3ABZA 2DJIA 2QE7D 1ORTA 3OE7D 5T67A 3OVMA 4RETA 3KT8A 5FOSA 5TPZA 5C4MA 3V8NA 3OD1A 2D3WA 4INAA 2OG2A 3OOEA 3R6LA 3VKHA 10MHA 5KJ6A 3ENNA 1EFRD 2EW8A 3QG5A 1TPZA 2CSUA 4R2JA 5A1TA 3PJDA 4BPRA 2FW1A 3NH9A 3K9CA 4I1UA 4CRWB 1S9HA 5EVCA 5BNZA 2AQHA 1P5HA 3WIDA 2F8SA 3WS7A 3VUFA 1QP8A 4MUKA 3ZJ4A 4LRUA 1YRWA 2J67A 1XQXA 3LDUA 3G9XA 2XMQA 3QWAA 3MJRA 2WYWA 1XG5A 2PWZA 1XKQA 3EAFA 3KQVA 3O1JC 5DF1A 4UUBA 5BQ3A 5AW0A 2CGEA 4PINA 4C4ZA 5KTMA 2V7BA 4UDXX 3L3BA 2ID8A 4ZAFA 3WHIA 1OREA 5EP2A 4CHTA 1K8QA 2DF8A 3G8BA 4MI3A 4YUAA 4IHJB 4JN6B 1YGYA 2NYRA 5AKHA 5DP2A 1Z2EA 4NMMA 5IKPA 1VJRA 3F6SA 3K1AB 2JHCA 4FR0A 1LSJA 2FFHA 3CSUA 4EHDA 3GMIA 3ME5A 3C70A 2WUDA 4L5BA 5HF9A 4CQMA 3AUTA 1IDOA 1NN5A 3D6VA 4HL6A 2XYPA 3OM8A 2IA5A 4HWOA 4QBGB 3I1JA 2FN7A 3QELA 4R31A 1GPJA 1PEAA 4OQMA 2WJAA 1KVUA 3H8WA 4CEHA 1BMTA 4NV0A 3DG9A 5BQXA 4A36A 2P3SA 2VP4A 1Q92A 3V3TA 4OQEA 1FQKA 1ESNA 3FKQA 4FDLA 4S24A 1AKTA 1Z6GA 4HNQA 2ZI3A 4TLBA 1RXWA 1E3TA 4YALA 5F3WB 1LS6A 2E4UA 5EZSA 5B1EA 3UK7A 3UV3A 2AB0A 1V8DA 4BVGA 2I66A 4RANA 4CTJA 3DDWA 4S1NA 1JLKA 2UVDA 3O90A 1D5CA 3FH0A 1L5QA 3QW2A 3QXXA 1VCMA 4RVCA 5ISMA 1W73A 3A1WA 1USWA 4RJTA 4OTZA 3DKKA 4DC0A 5ICSA 1Y8QB 4FGZA 3WV5A 4ZAZA 4AF6A 4KZPA 1BA2A 2ZDGA 3K7EA 4TV9A 3REFA 1APBA 3L4BA 3V42A 3OX2A 3WTCA 3D3JA 3T1NA 4BVEA 5K3FA 1NJ6A 4WZBB 1I33A 2FX3A 2I6QA 3F90A 3LYHA 3QPDA 4KOAA 3DBOB 3RYHB 1UDRA 1JHMA 1RQ7A 2GZ1A 1ISSA 5JVDB 2FUG1 1E3LA 1KOFA 1RACA 1XLWA 1YHNA 1GAWA 1X0VA 2P2CA 3CIFA 3B2EA 3L7MA 4G4JA 3MBKA 5BOSA 3CCBA 1DUIA 4GR5A 3WA7A 4N18A 2I7XA 2OHXA 1UC5B 3L8YA 2RAPA 1IAVA 2Q2QA 1O9HA 3DHYA 1JXOA 1XTKA 4ZEVA 3CVXA 2JIOA 1WCYA 4YAJA 3W6ZA 2OXEA 4FC7A 3AR3A 1YBHA 2OR3A 1Q14A 1RAIA 1GHTA 2Y1GA 3AUXA 4QBIA 3QTTA 4P53A 4TYQA 4FQ8A 4JI0B 2OCDA 1A8SA 2CJWA 1W1UA 3QLVC 5KU7A 3RG8A 3RSCA 1LLFA 1YQQA 1Z0JA 2A9JA 1QGAA 4Y1GA 5KJEA 4DCUA 4LECA 4ETMA 4QOFA 1J97A 3FOEC 1B14A 5AJVB 4MR9A 3HLTA 1U6KA 3QLUC 4JU8A 1WSDA 3DOOA 1OX5A 5JLAA 3JSXA 1U31A 2JJ2A 2P9CA 2R8OA 3DL7A 4N3GA 1NP6A 4OO3A 4X1YA 1NQXA 4IKEA 5TJ9A 2ZTHA 3HCCA 5I7EA 1H05A 2A9PA 5MN4A 1HK7A 2OLJA 3ZKWA 3EGVA 2R4TA 2UZIR 2AR9A 2N1MA 4QODA 1KKLA 1LBQA 3AUYA 4UNQA 1JI0A 1DBVO 2HCJB 4RKFA 3KYBA 4CLOB 3BICA 3L49A 2VH5R 2ZUBA 2FMFA 2WPDA 1AKMA 2QIPA 4FFPA 4MWCA 3HYTA 5A7GA 4A2PA 1CD5A 3DM5A 3KOXA 2GJSA 2PX6A 4GSLA 3RT1A 4UM9B 3OZ7A 2WTBA 2ZR0A 1ESEA 4DVGA 2CWWA 1V95A 2WFAA 3L0CA 1KRWA 1LDYA 1PZHA 3KJIA 1JMYA 4H1TA 4EKIA 1NI5A 5DM70 2EIXA 2XUGA 3LCRA 3EGXB 3K8YA 4K9KA 3THWA 3B8EA 3I1YA 2YUTA 2Y66A 4WN3A 4ASUA 1MOSA 4HR7A 4YAGA 1W4RA 4RJJA 2BFFA 2ZSUA 2J0EA 4FMCF 4XQEA 2C03A 3OCCA 5J4YA 3PUXA 2ASEA 5BP7A 4QPCA 3T9CA 2GJAA 2VP6A 5FP0A 3WADA 4PG7A 4E30A 2VP9A 3AF4A 4HDKB 4O8ZA 1DC5A 5D6OA 3K2IA 4EMBA 1P4SA 3VSAA 4JBGA 2XSZA 3FNBA 4PE5B 5AXDA 5JMPA 4F7WA 2GEDA 4M0LA 2COEA 3VPSA 2N46A 1OBVA 2KQUA 3W3AA 1VJGA 4RELA 2LNDA 4DA7A 1II9A 3CKKA 3ITNA 4EUSA 1XQYA 4H16A 1B23P 1JLMA 2GD6A 2FJPA 1A1SA 1C29B 1H42A 2BGKA 2EERA 3IUQA 4HGNA 4B6JA 5CLFA 2N47A 5A9SA 5FDFA 1QG0A 1J7JA 2X6RA 3FCEA 1SMKA 2X5JO 1U7ZA 2DQSA 4TV8B 1PV2A 1JXQA 5EQFA 1SUAA 3G85A 2YYZA 1B93A 1X87A 2X2OA 1ZOIA 3IKLA 2CJYA 3LUKA 4QGFA 2VF8A 2I91A 3ZU3A 3BZWA 2WSIA 4JOQA 1IQ0A 1OBCA 3E84A 1N3IA 3EEFA 3H5RA 3KUDA 3OFSA 1EK6A 2GNAA 4UMDA 3VR2A 3KCQA 2XWQA 1C9DB 5FBKA 1CJVC 4BLOA 5D1NA 2ILTA 1LQ2A 2WHPA 1YR6A 1V5IA 3ZQ4A 3Q72A 1RWKA 1SN7A 1ZM4A 4U8HA 2QUIA 4RX1A 1I32A 1CP2A 3AY3A 4URHA 3IE0A 2WYUA 3PT5A 1W36D 2L17A 2A58A 1AQLA 2FEOA 2ZBQA 1DX6A 3CS3A 1FRVA 3PPYA 2OBBA 3UAGA 1YVPA 4IFEA 1P2FA 4QUBA 1ISPA 3OE4A 3F5MA 2J33A 5DNVA 4XAQA 4ZVUA 2QD4A 3NHAA 2V7PA 5JAHA 1UFKA 3HCRA 1AZTA 2VLBA 4RF3A 3LP6A 1UWKA 4AWXA 1ZMTA 3IURA 4XLLA 1J24A 5FO0A 3U44B 3UXYA 4Q9AA 2PWBA 3DHNA 5LOVB 3PR3A 3FN4A 3O8QA 1OWPA 3ZK7A 1FYVA 4LF8B 1SVKA 1X1EA 3OPMA 3KCNA 3ETDA 1EWQA 1CUAA 2R66A 1N0UA 4RTNA 2P9ZA 1YNOA 2GK4A 1IHPA 2K2QB 2ZJOA 3KV3O 2WB4A 3ICEA 1UBTS 4KAFA 4O4HA 5AP9A 1XVUA 4KQ1A 2FJUA 4QDJA 5BNTA 4R51A 3GLVA 2TMDA 2AW5A 2R11A 4M9UA 1TUGA 1W2HA 1MQAA 1XXLA 1QPGA 4AJNA 5BR7A 3SMQA 4EY7A 5KYXA 5F76A 4PG8A 4DV3B 5DLPA 1QKKA 4AKIA 3IJPA 2D7JA 2BZ1A 3M6FA 4MKFA 4O6VA 4YMVA 1TO2E 3MA0A 1X42A 5KDDA 2YJTD 3ZU6A 4RXTA 4CLHA 2HKIA 4QBKA 2WWGA 2YV2A 1QS0B 2QRZA 4QPNA 4BE9A 2H7CA 5BRJA 1KWKA 4W5OA 2XT6A 3P1JA 4ETWA 3JZFA 1T0HB 1M0TA 2WTNA 3W7AA 1EFPB 2EOAA 4U39A 2GFIA 2HWUA 2NYUA 1GFWA 4IH1A 4MV5A 1V11B 1N6LA 1TJ3A 2AJDA 3JYOA 4TX1A 7ABPA 2DPYA 4P84A 1YB2A 4RY8A 1RWNA 1U98A 5JVDF 1J2YA 4LTMA 2R7LA 1MR3F 1ZMBA 2FSFA 4EEZA 3B1XA 2D06A 3FZYA 5FD8A 2JVKA 1H5UA 3UJBA 2WHEA 1QTQA 3AILA 2C8VA 3Q6IA 4K26A 1AE1A 1W75A 4DLLA 5JI3E 4NXMB 1JRLA 3HRKA 3HDVA 5LLTA 2Q4DA 4P4UA 4PHGA 1N6PA 3HE3A 2FUCA 2H5EA 1B3RA 5JAZA 3BTOA 5EE0A 5TMPA 1N8TA 4X65B 4R9NA 3T1OA 1EPUA 2VZLA 1QC5A 2J7KA 3VC1A 1VYTA 1G21A 4CLRA 3OEEA 4FFNA 1PBNA 2WWHA 4J2TA 1KDZA 1JSZA 1WPXA 4ZVRA 3B8HA 4AP5A 4KIWA 3T3MB 3A06A 4F04A 1RPTA 4WBNA 3DW3X 2CJPA 5KSWB 2XQGA 1C2TA 5JT1A 3CJTA 4MHTA 1GAEO 4ZA2A 3QH4A 3AI3A 2G3YA 1Q3HA 1VIMA 4TTJA 1W52X 2N42A 3Q11A 3QPVA 1ZNQO 1VLQA 3GD7A 2IHBA 4RGQA 3K1JA 4PLGA 5JOQA 2P9HA 4DAOA 4WGFA 2V7UA 4Q7KA 1OT3A 2K2WA 3GQBB 1I3KA 2WINI 1AUQA 4PX5A 4WOBA 3N0VA 4DS3A 1M6VB 5GZ6A 2XLCA 3KKOA 1T8UA 1C9KA 4ARZA 4M6WA 1FX0B 1YZYA 2OY0A 1T8RA 4PM4A 1Y33E 1SBIA 4XWAA 4R5HA 2EL9A 5BR4A 3IIJA 5DOZA 1LEHA 2IBTA 4BNDB 5DV9A 3AEXA 3NALA 4PZUA 4KPGA 1Z56C 3LMKA 1TKCA 2HK9A 3EPPA 3GNQA 4BP9A 1MIOA 1E77A 3JWHA 2VHUA 4YJDA 5C35A 5E4TA 4CIAA 4WL0A 1GUDA 3EXG2 2XMCA 1C7IA 4QFMA 4IUYA 5KC8A 3S1SA 4AZ0A 1VJ0A 3MRVA 4BTLA 2PL9A 4BDSA 5EPEA 1MB0A 2P6PA 3JYHA 4JY7A 4U3JB 5DTMA 5LZ5A 2LWIA 2IYQA 2ZIAA 4Q3DA 1D7OA 1SR8A 2C9CA 1EFHA 1R15A 1I4EB 4NR0A 4WZAA 4D43A 2IXDA 3PE3A 1V8ZA 1ZSNA 3LU1A 3ND9A 1KZHA 1VSQA 1JJVA 2HSJA 4C2UA 1XQVA 3V3KA 4AJJA 4OP1A 3RSFA 3H5VA 2HHCA 4EZBA 1N3YA 1ICEA 2QTNA 1GUYA 4E31A 4Y2SA 2BGTA 4A6XA 2JA2A 2PFKA 1ZWLA 3BRSA 3E8XA 5GM2A 3S99A 1CDDA 4HLDA 3ER8A 1T1IA 3U19A 3A6DA 2H5IA 3DZFA 4BO7A 1Y7LA 1UC8A 1O5TA 2NOAA 1PD1A 3L82B 4RA6B 4TV8F 1K7SN 1G2PA 2DCMA 5F21A 4TL9A 3JYLA 4A16A 3GUUA 1L5WA 2RC6A 4M1TA 3M2TA 3SY8A 4EQ6A 3F5SA 4J03A 2DPGA 1MTZA 4X3PA 1R0LA 2AQIA 1AK2A 3IVGA 5HDBB 1PJQA 1QUEA 3PPXA 2QLNA 3GVPA 2XGOA 1KFCB 1A2KC 2A0KA 2JFOA 2PKYX 3LX4A 2ISQA 1XP8A 1XRQA 4X00A 4YMUA 1I7QB 4G0YA 1TJPB 1QYXA 2NNWB 2Z8YA 1LK0A 4D0GA 4GT1A 1ZISA 4Y7CA 3RBVA 1P3DA 2UDPA 3SG0A 1CUUA 4KBGA 1O54A 1IUOA 3OFNA 4NAHA 4L3OA 1TIBA 2J3MA 4CLEA 2H2IA 2F8MA 1VPDA 5KHOC 3BFPA 3MMXA 3DLAA 4MO2A 3SIRA 1GPDG 2FR8C 3STTA 1I51A 2R00A 3HABA 1NBMD 4JJZA 3SN6A 3LTNC 1RABA 5CGZA 1HT0A 2CNWA 4BJHB 4HGZA 2Q9UA 1NTRA 1JLLA 2WA1A 1V7ZA 4E51A 4C6TA 2ZQYA 2JCVA 1CFZA 3AIKA 2Q3LA 3N70A 4N8EA 5ERYA 4EIWA 2HRDA 4X45A 1L5OA 5FNVA 4IIBA 5GTDA 3B3FA 3F98A 5LOVF 1DTWA 3SQLA 4OHUA 5CJ2A 1QJCA 1EXWA 3LHIA 4IDGA 2AQKA 1FW6A 2IPXA 3R3UA 4JC8A 4K1LA 3KQYA 2OBXA 3CA8A 3UPDA 5B30A 4M7OA 4RHCA 2SICE 4QC2A 1NMXA 4AUKA 4H3SA 1GGHA 4YK7A 3ZZTA 4FDUA 3WLQA 4P4TA 3MAGA 3FZNA 2J08A 2IFTA 5EPUA 2WG1A 1L7NA 2Z9BA 4MGKR 5IG2A 2YW9A 1Q7CA 2FUG6 1Y3FE 2EZ9A 2B25A 2X5KO 4D0SA 3Q3HA 5IASA 2W4IA 2P6OA 3GAAA 2V7TA 2JFGA 2H1FA 3HKBB 1G8YA 4IQ4A 2XUJA 3K32A 4DGSA 4E5NA 2B6NA 1W4AA 5EA2A 2WF7A 1YFZA 1D2GA 4XYMA 4UUPA 5K3SA 3ILVA 4OMDA 4NEHB 4PBTA 1FSSA 1U3UA 4A10A 5A0TA 1Z74A 3EGEA 2FTKE 3UA4A 2AC4A 2CXPA 4QWWA 3D3QA 4GGPA 3L0PA 3CXUA 3H99A 3RKUA 4FPXA 4H7PA 3BAZA 2QT0A 4COKA 3H0EA 4HB4A 5A4DA 4OY3A 2YVQA 1LC0A 1YD7A 1OIVA 1XFAA 3FVTA 3JRNA 4K0KB 3MMPA 1DAEA 1Z5ZA 2GDJA 4M1KA 3F9IA 4K40A 1VIYA 2R87A 2ZR9A 4N1AA 4PLHA 3SU8A 2W48A 4OA8A 3Q1LA 3C3KA 3AUSA 4HGYA 3T5BA 1Q6YA 521PA 1REQB 4QVIA 4FKMA 5BQOA 1CQJB 1GPMA 4GBGA 3TB4A 3GLIE 1XTTA 2B4RO 1K7FB 2ZSFA 4FILA 4JX9A 5J5AA 5I4IA 3P0HA 2VXOA 5C9ZA 1DKQA 2RSLA 2E4ZA 4HDSB 3HSKA 4UBOA 3JX9A 3CINA 4IXTA 2AJ8A 4TRNA 3EDYA 4K9PA 3G68A 3KSBC 2XB2A 2GFQA 3F5QA 4IX1A 3BFKA 2BFAA 2BR4A 1TZMA 2UZ0A 3CT6A 5DHFA 4P7JA 4XDHA 5AUQA 5ED0A 1SXPA 3JQGB 1ZAKA 1CC1S 1L7XA 3JQRA 4C7BA 3L7OA 4I1SA 4HY3A 3OEHD 1L4GA 5F51A 8GPBA 3WV4A 4QM6A 1XALA 2JS7A 2OV1A 2H29A 3AFHA 1YFJA 5DGIA 1UQRA 3W3AH 2OQRA 2EJCA 3MC1A