4JS0A

Complex of cdc42 with the crib-pr domain of irsp53
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
b'MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4js0A00
4B35A 1E0KA 3TVTA 3KQLA 5GJBA 1HE1C 1P60A 1G20E 4R9UC 2ZJBA 2EU8A 1OXVA 2IXFA 5DYIA 2QN6A 2WICA 2Q3HA 3P27A 2Z0MA 5JLJA 1CLUA 2UKDA 3GLFB 2R65A 3QEOA 2YJTD 2Z4RA 3P20A 4DEXA 2AX4A 1WA5A 2ZI6A 5FTKA 4A8JC 2G6BA 3OEHA 1AGPA 3SQWA 2YWEA 2NZ8A 1M6NA 2FN4A 4OHZA 4EJSA 1M7BA 3W8NA 1IM2A 1Q12A 1XMIA 3RWMB 2WPDD 4I4LA 3KKOA 1V5WA 2NO7A 2RGNC 1LB1B 1CRPA 2QU8A 2O8EB 4IOMA 2EWVA 4HLDA 4V02A 4NYMR 1SXJD 4Q9JA 4IJMA 4A6PA 1HE8B 1Z0JA 3QPUA 1NKSA 3SFZA 5EQTA 1T8TA 721PA 1M7HA 2F6RA 2RGEA 1TAGA 2O8DB 4KCGA 2FSGA 5B64A 2Q9CA 2YV5A 3LLUA 3ND8A 4PQFA 4S2EA 3A6PC 1G1MA 3W6OA 2GETA 2HXYA 4V0OA 3R8CA 2WKRA 4GRAA 4MDEA 3EX7C 2JIZA 4UNNA 1PVOA 1GSIA 1ZYUA 2DY1A 3RSOA 3QSYA 4JBXA 1KO5A 4L4UA 2QTFA 3AF1A 1NMYA 4GT1A 1OXTA 2OE2A 4NZYA 3VR2A 4D82A 1IY0A 1KO7A 3NG1A 1UKYA 2BHRA 3GLGB 3THYA 4YONB 3LVRE 1UM8A 1N6OA 1W0KA 4KU4A 1IN8A 3T15A 1G4AE 1GIAA 1TQDA 4UXIA 1P2UA 3KZ1E 4O2LA 1TQ4A 1AM4D 1VIAA 4DDWA 1SVMA 2ZSBA 1VG1A 5J47A 1SULA 5F2EA 4B2LA 3RVBA 1E2FA 3HR8A 2ZQ5A 3GEEA 4A2QA 3HPQA 3DEFA 1HY3A 2D7DA 1NVXQ 1E1QD 5B58C 3SZRA 3PVSA 3FB4A 1SXJE 4WBSA 3WBKA 3THWB 5H68A 4LC0A 2GILA 4BZXA 5KNCA 4MYCA 5LB4A 4RJLA 1MABA 1HV8A 4AK9A 4JLMA 2CE7A 3AVPA 2XB2A 2WWIA 1KIMA 1XRJA 3AH8A 3M0EA 1U0HC 3S1AA 1G8FA 4KVGA 3F5FA 3N2IA 3EZ6A 4BLTA 1H8EA 3B5JA 4F4CA 4Y0AA 3Q3JB 2J45A 4OKSA 3RRYA 1K5GA 2WJVA 2OLJA 1E2JA 3FOZA 4CZ2A 1G21E 3SS8A 3U2QA 3IQWA 4TYQA 3L0PA 3A1VA 1K8RA 2WSSD 5FUWA 5CDFA 1XXHB 3QUSA 1XD2A 2ASEA 5FTLA 1U9IA 4ABYA 4UNRA 3WP0A 1GL6A 4LV8B 5AJWA 1Z6GA 1U81A 1A1VA 2CVHA 1NBMA 4MGIR 1E0SA 2IEYA 2NO9A 1W46A 5JBQA 2OO7A 2QE7D 3EZ7A 4C4PA 2JLWA 4LJYA 1AS2A 3QXSA 4PQYA 5JZVA 3KUDA 1NJFA 2O5VA 2FOLA 3A1SA 1AS3A 1D5CA 4K81B 4PO1A 5EZ6B 3THXA 1KAOA 3CR7A 3K9NA 4TMXA 5GADl 3K0AB 3D7MA 1O3YA 2ZYTX 4C30A 4D0GA 4PHFA 4U00A 3SEAA 4EDHA 4B3FX 1S2MA 1UKZA 1HH4A 1DO2A 1E2EA 2G83A 3SJCA 2QMEA 3MMPA 4D6PA 5FI0B 5F9HA 3B1WA 1W0JD 2OFOA 4Q19A 2GBLA 1SQ5A 4Q03A 2KSQA 4IVPA 4TMWA 5E95A 4GDFA 1OFHA 4LHWA 4AWXA 3AVWA 3OE7D 2ZRDA 3KDSE 3AKEA 4A6XA 4HAYA 3C7KA 4Q7KA 2P0EA 4B3DA 4KFTA 4EFNA 2JEOA 3U60B 4FW9A 1IAQA 4O25A 1YRAA 2GCPA 4AC9A 4B44A 4A15A 1YJ5A 1NVVR 1E2GA 3MGCA 3H86A 4ASUD 4EFMA 2CLDX 5DIFA 2OZEA 1G6HA 4C0BA 1XTSA 1ZC3A 3WP1B 2AWOA 4URVR 3E5HA 1HEIA 3Q7QA 4EPWA 3OIVA 5LPNA 1G8HA 2DWQA 2QMUA 3AF3A 4LHVA 1G17A 4AKEA 1KI9A 2KBFA 2XITA 1ZBDA 1KAGA 2CNWA 1C4OA 1WXQA 2V7QD 1YE8A 4GBMA 2AK2A 3W5IA 3FKQA 3BH6A 4MRSA 4TLDA 4DDVA 5FOUA 2JLSA 5M04A 2VL7A 4RFSA 1JEDA 5FOVA 5FPTA 5TARA 1NIJA 2J7PA 3B82A 2FEOA 5P21A 2V6IA 3LA6A 3BFVA 2IYXA 3V4FA 2HYDA 3ECCA 1GNPA 4G5QA 1X1RA 2QP9X 1FL9A 4PO8A 4GOJA 5D3MA 4O3MA 2QRNA 1SKYB 1R0WA 4Q7MB 2IS6A 4TYNA 2BC9A 3QJYA 3FHCB 5DE3A 3SYKA 5FR2A 4TZ6A 2GK7A 4BLQA 4A4DA 5JEDA 3RANA 1U8AA 2WIBA 1FOEB 4MKHA 2V8OA 4L5BA 4ZKDA 5HZKA 2XZPA 2BDTA 1P9NA 3U7FB 4DLTA 4JVMA 2EFGA 2DBYA 3MSXA 3TQFA 3TBKA 5JFGA 5DN6D 1UBCA 1XMSA 3K1JA 1PZNA 4R2IA 3TW4A 3UKDA 1YQTA 3KJGA 1OFUX 4QFMA 2Y8EA 2ZJAA 1XZPA 2VHJA 1IN4A 1G3UA 2E87A 1EFHA 1D2EA 821PA 2RGCA 3WRYC 3BORA 2H57A 4V0MA 5KO2A 3BJIC 3K8YA 1SVSA 2ZTSA 4LRWA 3T06B 4LOAA 2O8FA 4Q9LA 2I4IA 3MJHA 4X8LA 1OXSC 2WPDA 4CF7A 1J8MF 1VCMA 4EPYA 4FINA 5FBRB 2QTVB 1PJRA 2GF0A 2JGNA 4Q4AA 1II8A 5TY0A 3B85A 1SXJA 1T5IA 4JLAA 1SVOA 2GNOA 3ADDA 5FTNA 4IEIA 2WTUA 4BZPA 2NZJA 3OIUA 3H1TA 3IHWA 3IQXA 2JASA 1K6MA 3QF7A 4BECA 3IBYA 4OI4A 5JSZA 2PJRA 1NY5A 4P31A 3WNBA 2ECKA 3LNCA 1EK0A 4CVNA 3HYTA 2GWHA 1VYUA 2ZEJA 1G18A 1G5RA 1TMKA 4NDZA 3NDBB 4PFSA 4ZKEA 2IYVA 1JAIA 2A78A 2OM2A 1E4VA 1F2TB 3AGQA 3K0CA 4I1SA 3Q5DA 4M1TA 4OJKA 4R7ZA 1R8QA 1XCPA 2UZIR 1QDEA 4D4MA 4TT3D 1Z6YA 3GLHB 5KTYA 1ZUNB 4M1KA 3MAAC 4G3XA 3EIQA 2WJIA 1RJ9B 4B71A 1G41A 1EFTA 4OL0A 5UKDA 5IT5A 4D81A 4PXAA 3ICEA 3RYTC 3LBIA 1ZIOA 4XSGA 3Q85A 3UXMA 1E79D 3C4JA 1ZNXA 1E9RA 3QQ5A 2IX3A 4BFSA 5GVRA 1BS1A 3C16C 1N6RA 621PA 4KJZA 3K0FA 3U4QB 1W1WA 2OCYC 2AR7A 3IPYA 1KO8A 4QBGB 5AR1A 4KHZA 4E07A 1ZD9A 3KB2A 2ZRGA 2HF9A 2GZHA 5FPSA 5BN3A 4Q9HA 4RKFA 2ZRAA 3MWJA 4URZR 3ZDQA 2CE2X 3CZQA 1Z0FA 4TYWA 1CKEA 1K5DA 3K70D 3U44A 2V1XA 5JS7A 1CRQA 1NLZA 1MV5A 3KTAA 1DOAA 1L2TA 1IONA 1UF9A 3A1WA 4MGYR 4KXFB 1G3RA 4C0AC 4GZLA 1NSTA 3EPHA 3BE4A 2J0UB 5CLLA 1ZP6A 1JI0A 1ZVQA 1R0YA 3OF5A 3ONWA 4FD2A 2WSSA 3VR3A 2RHDA 1M74A 2IWRA 2W2XA 2BCJQ 3RNLA 2FSFA 3I73A 1MO5A 4TMVA 2ZETA 3W8RA 4NL4H 1JJVA 4BRWA 4HAVA 4QBHA 4POAA 1S9HA 2UZ3A 4XWAA 4BRUA 1XBTA 4KYIB 3ZVLA 4DLZA 3RC8A 4AY2A 4EJSB 2QE7A 3H84A 4C3ZA 2BEJA 4MYTA 1D2MA 2D3WA 1F2UA 2JLRA 2YWGA 1JR6A 4OBEA 2GEVA 4W5HA 4JVLA 3REGA 1LFDB 4AKGA 1P3JA 4JLNA 4LBWA 4Z1MD 1E98A 4KSBA 5TMPA 1YZNA 2GDJA 4D2IA 4HAXA 3D31A 2RGGA 2JLYA 4LJAA 4B3GA 3RSLA 2VF7A 3GPLA 4JLJA 4RZ2A 2ZJYA 2P5SA 1DG3A 1P2VA 1Y3AA 5L3SA 1XEFA 1Y63A 4TL6A 3SYNA 1WMSA 3KUCA 3L0IB 2O8BA 1W0JA 1E2KA 5KSPA 1TUEA 4B48A 5FPKA 1Z0AA 1VKJA 3AKCA 1EFCA 2Q0HA 4M4SA 4UJ3A 3OE7A 5J4LA 3THYB 2GJKA 5FTJA 4D4JA 3FDIA 5DI9A 4Q4JA 2D7CA 1U99A 2IC5A 3TR5A 4BLPA 3EWSA 2ZYWX 1DAFA 3C5HA 3WY9A 1FNNA 4NH0A 5AJVB 2GVDC 4PHTA 4CT5A 4NYMQ 2XXAA 4HUTA 4DCVA 4ASUA 1JXOA 1J70A 4XWKA 3NKVA 4JJZA 1NJGA 4DXAA 1DAIA 2C78A 5DI3A 2AL7A 3AV0B 1GFIA 2V54A 4U5XA 1Q1EA 2G1KA 2V6JA 3A4MA 4CYMA 1XWIA 1KZ7B 2BVNA 5CK5A 1N25A 4EFLA 4DEYA 4DIDA 1MABB 2IYSA 2ZRIA 2BBOA 2V7QA 2JLQA 4G5GA 1OIXA 5EE5B 1KSJA 1QVRA 2W2TA 3TW8B 5FL7D 3S1AB 3SNHA 3ZJYA 3QKSA 3BAFA 4PX9A 3R9XA 5E4FA 1KJWA 2O0KA 2QY9A 3C41J 2HLDA 2IF2A 2WHXA 5EXTA 3GP8A 4PSVA 4BFZA 4YMWA 4FXPA 1A2KC 1ZAKA 2SHKA 1U8ZA 1GDDA 2BEKA 2AD5A 2VP0A 4Q1BA 5FOTA 3DZDA 3SBEA 4C0QC 1PLJA 2GVZC 1IXZA 1XD2B 1AKYA 3EZFA 3A1TA 4YXWD 4HZIA 4D26A 3AVXA 1NVWQ 1G5TA 2YWFA 4PHHA 1SHZA 3NVAA 2JA1A 4OHXA 3ASYA 3FWYA 4JKYA 1IY1A 1RW4A 1L4YA 3I92A 2QP3A 3ZVRA 4ARZA 2ZVQX 3R20A 2XB4A 2CL0X 4C0LA 5AJYA 4ZCMA 3THXB 2PT5A 2YWHA 2WMOB 3FMFA 3NC0C 4BWYA 3EZ9A 4GNKA 5J5CA 2FX3A 3QKRA 2AHOA 3SC3A 1N5IA 3B13B 3IEVA 1FPMA 1HYQA 1KI6A 1N6NA 3WYFA 2P5TB 2PEYA 3ZVNA 3V4RA 4JKIA 4LYJA 1OXXK 5FOSA 4PPFA 1ZM7A 2DHRA 1U98A 4LWZA 4A0FA 1D6JA 2PBRA 5EXSA 3SYLA 4QGFA 1Z47A 3KFVA 4B6EA 2FGKA 2QQEA 3OIYA 1W36C 1CULC 2LKCA 3I61A 1A82A 1HUQA 3U3JA 4HB2A 3DOFA 1F5NA 1NN1A 1YZLA 3CWZA 4KAXA 4NKRA 4RFVA 4A2WA 2KE5A 5TXGA 1R2QA 1Z0KA 2FNAA 1NIPA 2J7KA 3ZVMA 3LW7A 1KDTA 4XVRA 5AUOB 1KI3A 1EX6A 4TN1A 3T5GA 1EG7A 2CK3D 3CZPA 1Z6AA 4A2PA 2X2EA 4DDUA 2TMKA 5EXXA 1KMQA 3AKYA 1E2QA 2CMKA 2QI9C 4O2RA 1Q44A 4PZLA 3M6AA 3LRPA 3ZS9A 3O8RA 1C1YA 4QGHA 4I1VA 1LY1A 4NYJR 4J0QA 2FPKA 3NHBA 4TT3A 3FYHA 1DVRA 4DIEA 2PLFA 4DLRA 2BOVA 5KNBA 5ANRB 3WMFA 4PPGA 1E6CA 2RGXA 3BC1A 5KHOC 4OK5A 1E69A 4XVQA 4GP6A 3TVDA 4PC1A 3U3OA 2IYYA 3FKSD 2FFQA 1W4RA 4DWJA 4P4TA 5KPJA 1G19A 4RFSB 1E79A 2I1VB 4H9GA 4XIGS 1QHSA 4BUJA 3PJRA 2PMDA 1CR4A 3I5XA 1N2CE 3SHFA 1TF2A 2LWIA 4A82A 4AG5A 3IHLA 1OT3A 5D3MB 4Q02A 5HKKD 1SGWA 4S35A 3GJ4A 4JT2A 4IVRA 1KKMA 4PANA 3TJZA 5SZIA 2QMHA 1A7JA 1DE0A 5SZHB 4JLPA 4F4JA 3KJHA 4MRRA 2OCAA 4RCZA 2RAPA 4URUR 3KQUA 5DH9A 3WNCA 3F0TA 3AVVA 3QXHA 2CVFA 1P4SA 3ZIAD 4RD6A 2BBSA 4M8NE 5EZ5A 3ADCA 1WBDA 4QC2A 4KODA 2QEQA 4GI7A 1E2PA 2ZUBA 3B6EA 3QXXA 4F91B 1ZNWA 1H8HD 5TDHA 4FWTA 2CL7X 2IBMA 4PHGA 1CJVC 1KNXA 5A0FA 3ZYCA 1OSNA 1SHKA 3H2YA 2IHBA 1ZCBA 3SQXA 2QT1A 2E1RA 3F8TA 1RRGA 2B8TA 3GEHA 4B74A 3T35A 2XX3A 5CYPA 2C04A 4N1AA 1XTKA 5AUNB 2O8FB 1XJ0A 3AF2A 3TQCA 1DS6A 3KKQA 2VPPA 1Z06A 4L16A 1NN3A 2P3SA 1MR3F 2ZSFA 1I4TD 1II8B 4Q4AB 2JLZA 4QNRA 1SXJB 4P4SA 1OXUA 4MRPA 1BIFA 4A0GA 4F7WA 4A36A 4Z1MA 1XJCA 3SFVA 4JL6A 1IN7A 4YMVA 4C7OA 3A4LA 1HT1E 3AVQA 3PUZA 5FI1B 2YINC 1RRPA 1NY6A 1Q0UA 5JSZB 4C0SA 2GRJA 4LYFA 2OFWA 5TV2A 2B92A 4ZPXA 4I81A 2JCSA 4UNPA 4B75A 4KVAA 4RZ3A 3U7EB 3T61A 2J3EA 3OIWA 3OEED 5CJ2A 2QM7A 2ZRBA 3EASA 3T1TA 5FH9A 5FPHA 1LW7A 5CM8B 2BBTA 5SZKB 3GLIA 3OAAD 4WXRA 1TTTA 5IK2D 1AQYA 4QJ4A 4CW7A 3VAAA 2C9CA 3PEUA 1ZD1A 1OB2A 5J40A 1R10A 2F55A 3SBDA 3UANA 2EQBA 4WOPA 5DHFA 3ZS8A 4MQBA 3BERA 4HB0A 1KJZA 1VCOA 4G1UC 4BEBA 4FMDF 3PEYA 3NWJA 2P65A 3CB4A 4MKGA 2AD1A 1Z3IX 2KWIA 4L15A 4P33A 1GG2A 3PUXA 5LBIA 1KSFX 2R6GA 4PC2A 1MO3A 1W2GA 4OHWA 3K0FB 2ZYVX 1TL7C 1E94E 2QAGA 5DYGA 1J99A 3D6TB 4ZDIA 4KITB 2QG6A 3U3RA 3UG6A 1E9CA 3OHMA 4B76A 2ZI9A 1NRJB 3LLMA 3NDPA 4LX0A 3LO5A 4FCVA 2IS4A 2O52A 1L8QA 2FZLA 5EE0A 5EE1A 5FL7A 5EP2A 1ODFA 5JJKA 1GAJA 1KI7A 3U44B 3NBZC 1W4AA 1TU4A 1XD8A 4UNSA 3KTAB 4UXHA 5K8UA 1XEWY 3B1YA 4PPQA 1O87A 4B32A 4QM6A 2GF9A 3VR5A 4QOSA 3GFTA 2PMKA 1A4RA 4M1YA 2CCGA 3NTUA 2YOGA 2ZR9A 3CF2A 4M1WA 2H18A 5H1YA 3DDCA 4G01B 2BV3A 3UG7A 4YXWA 4B6FA 1GRNA 1KI2A 1LTQA 2N46A 5FUYA 4EPRA 5C18A 3VKHA 3ZZTA 2HT6A 1GKUB 2HDNB 2YOFA 5BWMA 1JR3D 3PIRA 4NPHA 2BMDA 4CEJA 1Q3TA 2VYFA 2LKDA 1CJKC 1YZGA 2ODWA 1EFRD 5ELXA 4Q21A 4JVSB 1F2UB 4B47A 1E96A 4YLGA 5FOXA 3AGPA 3ZZ0A 3Q9LA 1GTVA 1CXZA 4MITA 2C03A 4MYUA 4JBWA 4NU0A 4QNMA 1DARA 2HEIA 1GZSA 3N2EA 2P6NA 3WHKA 4D80A 2A5FA 1RIFA 1KTVA 2ZRJA 4DUGD 1M7GA 3P1JA 5L3SB 1KI4A 2IYUA 1U0LA 1US8A 4W7SA 1XMJA 3JZAA 2O8BB 3K0EA 3MFYA 1XU4A 4TQAA 1Q3HA 1CP2A 3CBQA 4XJXA 1OV4A 2YYZA 3B1VA 3D8BA 3KJIA 5EE3A 3L2OB 3AUYA 1OH7A 4Q4JB 1CF4A 2ZE7A 4RCYA 3GLGE 1CJUC 3TAUA 2PX3A 3U3KA 1LNZA 2HUPA 4LYAA 2ZE6A 4V0KA 4R71A 3RDPA 2VHTA 3RRZA 3TAHA 2C9OA 2JLVA 1G5PA 4AYXA 2XXAB 4NCNA 1JR3E 2CK3A 2F1IA 4BFVA 1FP6A 2IHYA 2WWGA 1G7TA 1S3SA 4OQNA 1VG9B 5DI3B 3JVVA 4OK6A 3SHWA 3P32A 4MRNA 4BPBA 1CEEA 1UKEA 2J0VA 2CEAA 2Z4SA 3JZMA 1BMFA 4ERNA 3SN6A 2C96A 3B1ZA 4GOKA 2YC2C 2FWRA 3EAQA 5J4YA 1QVAA 1G3QA 4WXPA 4E5UA 2GCOA 4C0KA 1AZSC 1N5KA 2X8AA 4V0NA 3SJBA 2JAQA 4PR0A 3QKSB 2W0MA 4ACBA 4C2UA 4ESHA 4YDHB 1M2OB 5KDLA 2Q9BA 4V03A 2IWHA 1FTSA 1N6HA 4PO9A 1CR1A 4TLBA 2J46A 4TTRA 1E2DA 2NPFA 2O0JA 2DFTA 4Q9IA 4DT1A 4US1R 1OIWA 3VTKA 5HKKA 2WKQA 3LX8A 1T0HB 3FVQA 3GEIA 4NTZA 2FEMA 5BW8A 4FMDB 5G3ZA 5HCIA 3Q5EA 4MKIA 2BMJA 4LJ6A 3LXXA 4P3YA 4L9SA 3QPVA 1XXHE 3GFOA 4NCJA 2J87A 1IY2A 4DLWA 1RRCA 2BM0A 1CR0A 2D4HA 4H1VA 1DAHA 4M53A 2ZS8A 4M9ZA 4RD0A 4XH9B 2Z83A 1R7RA 3ZIAA 4G5SA 2OXCA 3WMEA 1GM5A 1WCV1 5JJLA 3VHLB 4ARZB 1E2LA 3K0SA 2FG5A 4ZCIA 4LCBA 2ZS7A 3X2SA 3ZD6A 4NYIQ 3CNLA 3KL4A 4YMSA 4K8OA 2ODEA 1H8HA 2XEXA 1FZQA 1NF3A 2QUZA 1LS6A 1N6PA 1UBFA 2QORA 1YRBA 4TLEA 3QKRB 4DCNA 2BMFA 3B8HA 2F3TA 4OHVA 1ZM4A 3L43A 3K09A 4YDSA 1KI6B 5D3QA 5DISB 1TEVA 5G41A 1E9FA 2KJQA 3IPXA 5HCNA 4DRZA 3I62A 4QM7A 1FX0B 1AA9A 2H1LA 2QA5A 3W90A 1WB9A 2GJAA 1IOZA 2IA5A 1T8UA 4BFTA 3DKVA 3EC2A 2OLKA 1T3LA 4Q1EA 2OBLA 4PAMA 2W58A 3T1QA 4A8JA 3T5DA 5B57C 3AKDA 3DKPA 3W6NA 2YC4C 3QNUA 3VU9A 3SOPA 5JCZA 1ZINA 2J5XA 3RS2A 2MSEB 1LF5A 4F92B 2RGNA 3OEEA 4X8OA 1R5NA 1TNDA 1XEXA 2FSHA 3V9PA 3QXJA 5BYKA 4AKHA 1ZU4A 3NHAA 2XNSA 4Q4HA 3OAAA 2R44A 2ZVPX 4H1UA 1UDWA 5IK2A 1QF9A 3EZ2A 5CB8A 1DG1G 1KGDA 4FCWA 3TH5A 5JS8A 3FHTA 1NN5A 2OT3B 4WVFA 3VR6A 2Q3MA 4JJKA 1TQ6A 2G3YA 4QL3A 1VYVA 3C14C 4N0EA 1RYHA 5FL3A 3ZD7A 2VRWA 1KJYA 2MMCA 1Z83A 4TLCA 1G3MA 4LJ5A 2ZI3A 3IEUA 2PL3A 3QG1A 3TUZC 3LXRA 4N3NA 1E9DA 4DC9A 2MSDB 4BLOA 4IDPA 4LHYA 1T91A 2C5LA 3CX8A 4DSTA 4PAQA 1Z5ZA 4MA4A 4M9QA 4GMXA 5CK4A 3L8YA 5LD2B 2AFIE 2V1UA 4HAUA 5G40A 3GJ8A 1SKYE 4C0HA 2F7SA 4TQ9A 1TF7A 3CRRA 3UMSA 3EG5A 2G1JA 4ZI2A 1RE0A 2JJ1D 3RRMA 1OIVA 3MWLA 3U5ZB 4NYJQ 1ANKA 1E1QA 2ZJ8A 3K70B 2ZRLA 1T3HA 2VP4A 2ZRFA 3VR4A 3TMKA 2XZOA 3CPEA 1GVNB 3KJEA 1ZUHA 4URYR 4JLKA 4HB3A 2NPIA 1YKSA 3RC3A 1B0UA 5F98A 3BK7A 1X3SA 3CF0A 5JCPA 1HT2E 4CEHA 2CLSA 3A4NA 3MD0A 4TYPA 3FFAA 3QKUA 3AUXA 3ASZA 3BH0A 2I1QA 2ZRNA 2EFCB 1CIPA 4R2HA 3PG5A 4KFUA 4AI6A 4JYCA 3VX4A 4IDOA 4UKDA 3ZQJA 1JR3A 1NMZA 4LYHA 5L8VA 3LBHA 2WZQA 2ZAMA 3X1YA 4Q5IA 5CJPA 2WAXA 1E2MA 2WMNB 4Z51A 1KDRA 4Y0VA 2ZI4A 3KKPA 1G3IA 1UADA 3BB3A 3FMOB 4P4SB 5JRZA 2B7BA 3VKGA 3NEYA 3K53A 4IOLA 2X77A 4HLUC 3IGFA 3MJRA 5F9FA 4NCHA 2AFHE 4C7OB 2NQ2C 1OFIA 3CM0A 2ZJ5A 3CIOA 4RD3A 1RRFA 4DUGA 2GEUA 1OKKD 1KY2A 2WOOA 2RH5A 3BWDD 3SU8A 3CPHA 1CJTC 3DMNA 1XCMA 2HV8A 4CDGA 5DGXA 2VHUA 3WYAA 4PPNA 3QF4A 1E0AA 4DLXA 1WRBA 3GLIB 1Q57A 2VP5A 2NG1A 2EFDB 1X1SA 1XPOA 4U02A 2GESA 3FMPB 3R7WA 3I4LA 4LV5B 4ZDWA 3PV0A 3WBJA 4NONA 3G0HA 2WIAA 3H4MA 1IXSB 2W00A 2ZANA 3U3MA 1OH6A 4JSYA 4DHEA 1GRQA 5K8IA 2QGZA 1TUIA 3GJ5A 3VR1A 3GJ0A 3EA5A 1NL3A 1KMHA 4EJSC 4WZ6A 2OXRA 1Z6TA 2VSXA 2GA8A 3TGPA 4HB4A 2ZR7A 1W49A 3ADKA 3PUYA 1VIYA 3DM5A 3QIAA 4RVCA 3WYGA 3CNOA 2DPXA 2QAGB 3RABA 4IDQA 2IYQA 3DHWC 5FTMA 1QHIA 2ZYUX 2Z6VA 3HDTA 1XZQA 2D06A 1RYFA 4HLQB 3K9GA 1NVUQ 5FR1A 1XTQA 1KK2A 2ONJA 3ZGXA 4DCTA 1XNJA 3SJZA 1M34E 2D2FA 1PLLA 1HTWA 3QY0A 3CNNA 1ZNZA 3Q8XB 1OJLA 5TVKA 2J0QA 1FUKA 4OQFA 1VECA 4B73A 3BIFA 2WWFA 1DAEA 2Z43A 4BFXA 1TEXA 5L3QA 5FPYA 4CIDA 1P73A 3DZ8A 1VPLA 3EA0A 3MWKA 1KZGB 2FU5C 2Z5FA 1W5SA 1WP9A 4BASA 1GNQA 2ZRHA 2VO1A 4NYIR 4Q1DA 1BOFA 2OBMA 4MGZR 1W0KD 3HJNA 4EAQA 1II9A 4NCIA 2FA9A 2ODNA 3B78A 4HLCA 2J0SA 4EQ6A 4TTPA 2DCUA 4URXR 1S4QA 2DFKB 2DFLA 2R6DA 4B2PA 1XDBA 1PUJA 3I72A 4CEJB 4A0HA 5B30A 3BFKA 2IW3A 2FDCA 3TR0A 4BFYA 5L3VA 1COWD 1KKLA 1P62B 3EWAA 4WAUA 2CLCX 3E70C 5JHHB 1CU1A 5DNYB 3BGWA 1QHNA 1P2SA 4XTCS 4A9AA 1UEIA 2G9NA 1E4YA 2A2ZA 1RVDA 1Q20A 4BLSA 3FTQA 2GZDA 3CRVA 3LH5A 4NE2A 1HA3A 4WA7A 5BQ5A 2GJ9A 4A92A 2A5YB 3T34A 1UBGA 1ZM2A 4OI0A 1KDOA 1UKVY 3DOEA 4M22A 3SJAA 1L7VC 3P26A 1DPFA 4HYYA 3HU2A 3IBGA 2WAYA 3ETLA 5DN6A 1US8B 1YZQA 4E22A 4FN5A 1XTJA 5EP4A 4QHTA 4I1UA 1ZNYA 1R0XA 2GXQA 4JL5A 1YU9A 1Q1ZA 1UBEA 2RKOA 1S3GA 1JQLB 1XB2A 2NTYC 2H92A 3A37A 3QXCA 2QP4A 3DO6A 4AD8A 3OFND 4UQOA 1U9IC 5LDDC 1YR7A 2IL1A 2CL6X 1QBKC 2PZEA 4EUNA 2VP6A 4RKEA 3GJXC 2OCBA 2WKPA 3QI2A 4M9XA 4HATA 1W7AA 1T3SA 3UIEA 3EPLA 1ZW6A 2BIFA 2OESA 4W9MC 3MUFA 4G5OA 2V9PA 3TNFA 3KQHA 1NBMD 2ZIAA 2ZXUA 4D0LB 3BS4A 4B3BA 4OHYA 3B1XA 1ONBA 3ZZUA 4GL2A 1Z07A 4LGMA 3R9WA 1W36D 2NO0A 3BB1A 2ZPTX 1VCIA 2ATXA 4XVUA 2FE4A 3KKNA 5JJIA 1S0UA 3PENA 2QTHA 1P61B 4IKEA 4IW3B 4OI1A 3VQTA 5JRJA 2GCOB 3KQKA 4Q9KA 4A1FA 2OV2A 1P5ZB 2QQ0A 4M21A 1RZ3A 2R8RA 3AB3A 5EP3A 1PUIA 2QENA 4JYBA 2AN9A 8OHMA 4IDHA 1FFHA 1EX7A 2GBLC 1VMAA 2IYTA 2O0HA 4DT1B 1SVWA 3VX3A 4ZDKA 5G3YA 3CUEF 1TQ2A 3RS5A 5HPYB 4FMBB 4LBYA 4MUBA 4O0MA 3BD9A 3BH7A 3LQQA 4RSGA 1J90A 3W34A 2WWYA 1N6LA 1CS4C 2YHSA 1KY3A 4OQMA 4PC6A 2IYZA 1KO1A 2JJ1A 5CDFE 1X86B 1F60A 1GKYA 1OE0A 1NN0A 4NHOA 4RD4A 1T9HA 3ICQB 5FBWB 4EPTA 4LJ8A 1NBME 3HWSA 5EXPA 4QHSA 5EP1A 1QHXA 2W2VA 3REFA 2CBZA 3N5CA 2GCNA 2REBA 2DYKA 4QJ3A 5TB5A 4HAWA 4KBGA 4IVQA 2A5DA 1ZCAA 2FGJA 4HDCA 1MKYA 3FPAA 2XNDD 4HI0E 1OYWA 5AJXA 4A0RA 1R6BX 2FSIA 4D4KA 1GL9B 3GCGA 3PEVA 3RS0A 4QKQA 4IDNA 2VHCA 3QBVA 1IXRC 3BXZA 4QXAA 3W5JA 3X1XA 3U6KA 3AVUA 2A9KA 1KHTA 3NH9A 1MRSA 4OK3A 4DCUA 3B7GA 2AXPA 1DEKA 5DHAA 2IUUA 5EJEA 4DLSA 1BO6A 3LAWA 4B2IA 1NMXA 1VG0B 1G8GA 4JLVA 1P9WA 5FBVB 2AKAB 3VMFA 1S1CA 2KB0A 3NEJA 1OFTA 1Q21A 4A8JB 2F3RA 1Q22A 2MMGA 3T1OA 1KSGA 2C95A 3PITA 4ZO4A 1OKKA 3RS4A 3NIBA 3VU9B 5F3WB 5HE9A 2ZM5A 3MCAA 4Q47A 4URWR 4M1OA 2DFNA 1FMLA 2VP9A 1XEXB 1EWRA 1BKDR 2QRZA 521PA 2WBLC 1Z2AA 1VCNA 1LF0A 2ZREA 1G291 2VIIA 4Q4HB 4B3CA 3IDQA 5KNDA 3QBTA 3LQRA 3CH4B 4TMZA 4IXNA 4Q7JB 1GP2A 1WBBA 1E3MA 2G88A 4GFDA 4ACAA 1VDZA 1JJ7A 2J0UA 1GOTA 4TSFD 1B23P 1CR2A 3UWOA 1JB1A 2JJ2D 1CJMA 1AQUA 2XGJA 2W0SA 2DB3A 2GJSA 2I3BA 2XAUA 4E09A 4GPTA 5KYKA 5J4HA 4E03A 1W5TA 3PUVA 4LI0A 2R62A 3NBYC 3PCRB 4UNQA 4LC1A 5CIQA 1NLFA 3UATA 3M4YA 2N42A 5CIWA 1YR6A 2PLRA 2JDID 3TKLA 3L8ZA 3G82C 1SXJC 3TSOA 4Z54A 1JAHA 3U7HB 4D25A 2O8CA 1VHTA 1J8YF 2F43A 2ODBA 3R9IA 2E9SA 4YMUA 4B34A 3P4XA 2VLIA 4XWOA 4LSGA 3SDZA 3Q72A 4DSNA 1DO0A 3CLVA 2EYQA 1Z6XA 3CPJB 4RD1A 3WHLA 5GVSA 1GKIA 1IQPA 4IOJA 2PEZA 1IN6A 1MRNA 4Q1CA 1TF5A 1DAKA 1FNMA 3RLFA 3HU3A 4FIDA 4JMPA 3LWNA 3K0CC 1G4UR 2BWJA 2ZU0C 3AVOA 4CEHB 4Q66C 2YKGA 2V4ZA 3FMIA 4NMMA 2ZI7A 1W4CA 1YZKA 5G53C 4QRHA 5JMTA 1XPUA 1UFQA 1EWQA 2EVWX 3I8SA 2YNMA 3DM9B 1ESMA 1M1YE 2K5UA 4ILEA 1R0ZA 4RY2A 2J9RA 4CGZA 1YR8A 2ZUDA 3A58B 1U90A 1BH2A 4V0ME 1COWA 2A5JA 1N5LA 4ZIRA 2W6JD 4P4UA 2XTZA 3GLFE 2D2EA 4HDOB 1T0JB 3GJ7A 3W3ZB 3AF4A 3RAPR 4Q1AA 4ZV4A 4WZAE 1P7CA 4EKDA 5HTKA 4JLBA 4XOIA 1KDPA 1BYUA 2WVJA 2GAOA 3BB4A 3RS7A 4YC7A 3F3YA 2PZGA 4EIWA 5JWRA 1KO4A 4D0NA 2V55B 5IRCD 2WSMA 2IUSA 4DCSA 2VF8A 2W6ID 3LBNA 1JQJC 2BM1A 4LJ4A 3I1FA 2NO6A 3OZXA 1EGAA 4PTLA 3GMTA 3QPWA 5E3HA 3QF4B 4LV6A 2XTNA 3PUWA 3RRNA 2GAAA 1N6KA 2YVUA 1Q1QA 4RZUA 3RS3A 4Q01A 4V0LA 4X8HA 4L8GA 1OPXA 3K9LA 3R7WB 1VHLA 3NC1C 2CJWA 1YVDA 1E9BA 1KK0A 3AP2A 3TRFA 1Z8FA 1AGRA 3OFNA 2DR3A 1OHHD 5AWFC 1IN5A 1MT0A 2XOKD 1FMJA 4LZZA 4QG7A 4HDQB 5KOYA 3IIMA 2REOA 3TK1A 1F6BA 2Q3FA 2FFBA 5K8TA 1E2HA 1OLOA 1ZM9A 3VKWA 4TYYA 1N6IA 2J1LA 1QHHA 1KMHB 1E9AA 2AK3A 4I1OA 2WV9A 3RWOA 2ANBA 2Q21A 1VYTA 2QPTA 3NBFA 4JLDA 5KPDA 4OI2A 4HAZA 1JBKA 2ZSAA 2VHQA 1I2MA 2QPAA 3KFXA 4P32A 3BBPA 3PEWA 2A30A 1R5BA 1MH1A 1JXMA 2ERXA 4ZDJA 3CH5A 2FJUA 2B7CA 2G77B 2PCLA 1J7KA 1MO6A 4BQSA 3BFXA 1ZJ6A 3J81k 3TIFA 4JT4A 3UMFA 2ONKA 4KYUA 1XPRA 2C99A 4X8MA 2BKEA 5L3QB 3LFUA 1Z08A 2A3RA 121PA 3JVUA 3AVYA 2IS2A 3LV8A 2CHVA 2OEPA 3TLXA 4XD7D 5KDDA 3FKSA 4TLAA 3C5CA 1XD9A 2BCGY 3SE0A 3ZQ6A 1ZUIA 3U7GA 4Q00A 4HEJA 1U2RA 4M9SA 4UXJA 1RPZA 1TU3A 2J41A 4EQ6B 2HCBA 2ZI5A 3VNVA 3CKLA 1W4BA 1WQ1R 3I8XA 3WRXC 1CBUA 4EPXA 3WMGA 1G8PA 2NMVA 1E0JA 1EESA 1S1MA 5BN5A 4FI3C 2GXUA 2ANCA 2XTMA 3HP1A 4MUAA 1F3OA 4MGKR 3PR1A 4OYHA 5AJZA 2B6HA 3CX6A 4Z8YA 4CEIA 4W5WA 2H8KA 4GZMA 1RKBA 2XNDA 5AUPB 1R5OA 3O47A 2J59A 1F48A 3FE2A 1ELOA 1D9XA 2RB4A 1G6OA 4Q7LA 3CWQA 3EW9A 1X8JA 3B2EA 3RHFA 5C2JB 2OFXA 4JZKA 1QHYA 4HUQA 4HZUA 2W83A 2XSZD 4YQFA 2AKYA 2GTPA 2P2LA 3TSWA 1XX6A 1Z0IA 2HLDD 2QNRA 2R6AA 4LPKA 1QZXA 5IHPA 2FPLA 4IHQA 4GOXA 2L0XA 1Z29A 4DB4A 2H16A 5DSZA 3QEJA 4DB2A 2QSYA 2WWHA 1OB5A 5E7IA 2R6FA 1XJQA 1ZU5A 4FMCF 4OJQA 3E1SA 3QVVA 4PZYA 1CTQA 1XEWX 4JBYA 1E2NA 5KSZA 4AURA 3E2IA 3C8UA 3HYRA 4ZI3A 3VNUA 2GKSA 3KXLA 2AWNA 4R98A 2ZSDA 2X2FA 4QHYA 2HYIC 2QBYA 4D4LA 4DJTA 1XFAA 2DWOA 1ZC4A 1KK3A 1KNQA 2PJZA 421PA 4DKXA 2ZJOA 3IO5A 1DELA 4GSYA 3PQCA 5L3RA 4QBIA 2BMEA 3IKJA 3IIKA 1E9SA 3BRWD 4KLNA 4TSFA 3AF0A 1I2DA 1WE2A 1QRAA 3CONA 4JLOA 2IS1A 1HURA 4TZ0A 2AXNA 4KO8A 4WW0A 1FTNA 2JJ2A 1MO4A 4JSTA 2IUTA 1SZPA 1ZMXA 3TSZA 4DSOA 3P4YA 1A2BA 3ND9A 2IXEA 1E2IA 1KOFA 2C9YA 2WWWA 3CRMA 4JS0A 2R6CA 2EW1A 3KB1A 3T1VA 5JI3E 4LHXA 1YZUA 2JDIA 1N5JA 2VA8A 2XJ9A 1G9XA 3GLFA 2ORWA 5CYOA 2IF0A 5EUMA 3U61B 1Z63A 1G7SA 2C8VA 3GQBA 2R2AA 1T5LA 1W48A 1YHNA 2PZFA 3O8BA 2ERYA 1JPJA 2RMKA 3LDAA 5CM9C 4B43A 1GRRA 1G16A 1UJ2A 2OHFA 3A8TA 4M0LA 4US2R 3QG5A 1X8KA 3CR8A 2XJ4A 221PA 2WJJA 3QE0A 1WDTA 3AP1A 3KXIA 2O8EA 2C2HA 3NXSA 2HJGA 1IBRA 2RHMA 3W3AA 4IRUB 1V43A 4ON9A 2ZRCA 5LB2A 4WIAA 1A5TA 1AS0A 2CXXA 3NH6A 3GJ3A 2IEZA 2O8DA 5B2ZA 1NG1A 5JECA 3LY5A 3UMRA 4KBFA 4YMTA 2BJVA 1I4LD 2CHGA 4QGGA 5KSOA 4OQXA 3L82B 3PXGA 2HJVA 2D74A 3B60A 4RZXA 1N0VC 5IF9A 1JECA 5K8LA 2H17A 1AJEA 4PAOA 1ZD8A 2ZE5A 3UK6A 4DSUA 3MG9A 2QT0A 5BN4A 2W6JA 3GLGA 1N0WA 4TL8A 4XTRA 1JEEA 1NLYA 3CO5A 1XTIA 5JWHA 1H65A 1DAGA 4DBLC 2WJHA 5SZJA 4DLYA 1YR9A 5LD2C 1ESNA 1HQCA 5C4MA 2WJYA 3LW8A 1E1RD 2RGDA 3I32A 1EFRA 2RGBA 3CX7A 1Z22A 4AIIA 5FBLB 3EXAA 5JHGB 2ZRMA 5JI2E 2GZAA 2ZRPA 4TQUS 5KDOA 4TTQA 5H8WA 5AK0A 3K70C 2RGAA 3O8CA 1FQJA 3AQ4A 2W6IA 5FUVA 3VHXA 1NNEA 4KLZA 2JLXA 1XMVA 3THWA 1DAMA 1S96A 3FHOA 1JALA 4ZCLA 3L0OA 1JPNA 1II0A 1U0JA 4Q4LA 2VTKA 1J2JA 5E7MA 2CHQA 4II7A 2YZ2A 4KFRA 2PH1A 2V3CC 2R9VA 1OHHA 2XOKA 4FCTA 5GJVC 4NCKA 4BLRA 2WM9B 1QG2A 1T4GA 4LJ7A 5FUXA 3LVQE 4GMDA 3QOFA 1P6XA 4FWIB 2VEDA 2FF7A 1GL7A 2OSBA 1SVKA 2FFAA 4F38A 2F1JA 2FPMA 2H7VA 2P6UA 3EIEA 2ZSEA 2NOAA 1S8FA 5GJWC 1G64A 2IK8A 1LS1A 1TADA 1RC8A 3QENA 1XXHA 2O8CB 4BEJA 2JJ8A 4FMCB 2F43B 3GLHE 5FFMA 2CCJA 3X1DA 4IXMA 1R4AA 4DVGA 4F4IA 4IFBA 2NIPA 5CLQA 2ZROA 3OEHD 1VTKA 5BXQC 5HR5A 5JWOA 2ZUCA 1HQYE 3DL0A 5E7JA 4C0JA 1S9DA 1OYYA 4LY6A 1FP7A 1IHUA 4RD2A 2BJWA 3HPRA 1Q1BA 3T12A 1KK1A 1X6VA 4B3XA 4LPSA 4P0TA 2EYUA 4M1SA 1OH8A 1ZM3A 3I3SR 1NP6A 5CITA 1P75A 4PC7A 1AN0A 4PQRA 3K0AA 4XD7A 4G0NA 2VBCA 1ZRHA 3AEZA 2G0NA 4AYTA 1N0UA 2DWPA 3H0KA 2CDNA 4MRVA 5DO9A 2QL6A 2GEDA 5EE9A 3WNDA 2H5EA 4BZQA 4HSEA 4EPVA 4PSKA 2JIZD 2X1VA 1SVIA 4L9WA 4PSAA 2GK6A 5KSYA 1XTRA 5KU1A 4ZIRB 3EPKA 2OAQ1 2ORIA 3KX2A 5A5GA 2XZLA 1Z2CA 1UDXA 4CRWB 2JATA 2QAGC 1KI8A 2PX0A 4W5JA 2PT7A 5DLQC 4U7DA 1GITA 4LHZA 2QPOA 1OH5A 1P9RA 1LV7A 1LVGA 2VQSA 1XP8A 1GILA 3LD9A 4QBFA 2F1RA 4MH0R 4UJ5A 4AKIA 3ZLJA 1JNYA 1OF1A 4KV9A 3IO3A 4JIMA 1M8PA 2OBNA 2ZR0A 3KKMA 3QVUA 3I5YA 4DDTA 5BYJA 1XF9A 1G7CA 3EC1A 2XSZA 3CF6R 2OAP1 1TPZA 3GFPA 2RCNA 2CJWB 3GLIE 2ZAOA 2FH5B 2A7QA 2ZU6A 1QHGA 4KFSA 1NG9A 1PV4A 2UVQA 3DMDA 4LJ9A 5H70A 4LBZA 1D9ZA 1N3BA 2Q9AA 3MRSA 2VH5R 1D8TA 2CCKA 1QHHB 4B33A 1H8ED 2NGRA 3MWYW 2QZ4A 1GNRA 2WJGA 3ZH9B 5J4KA 4M1MA 2ZE8A 2P6RA 3SI7A 3UPUA 4KI0A 5FOWA 4K46A 1QG4A 1WF3A 2A5GA 1W2HA 3OESA 4IEEA 1W36B 3VFDA 3MLEA 1MOZA 3TUJC 1KSHA 3HR7A 2GXAA 3N70A 2REXB 3FFBA 3FGNA 1P72A 4NP6A 4KSCA 1DBSA 4JVNA 3X1WA 5J4VA 4C2TA 3ADBA 1NKTA 4LDJA 2FV8A 3IUYA 4TMKA 1DADA 1PLKA 3B9PA 4TWZA 4C9BA 3GD7A 1NI3A 4NBSA 2MSCB 3A36A 5AUQA 3EARA 5CB6A 1U94A 2QAJA 3THOA 1KI1A 3X1ZA 2WOJA 2PCJA 1IJEA 4TMTA 1KYIA 1YZTA 2EFHB 2VSFA 3O8DA 1SKQA 5HE8A 4MYHA 4G5RA 4M2LA 2D62A 2OUKA 2HCJB 5C4GB 3U6BA 3KXKA 2JLUA 2OCPA 4IFEA 4PZZA 1FX0A 3EIHA 2HF8A 1W44A 2IYLD 4CT4B 4TL9A 2F1HA 4QJ5A 2KI5A 4ITRC 3CRQA 2YOHA 2FFHA 3SR0A 1BYIA 1UEJA 2IT1A 4Q18A 2B21A 3GJ6A 1C9KA 3IIJA 2P67A 2ZRKA 1E9EA 1G7RA 1E32A 2GJ8A 2QGNA 2Q6TA 1RFLA 4I99A 4LBVA 1AKEA 2NO1A 4Q1FA 2VSOA 3CRW1 2QMOA 1GWNA 2ATVA 4LUCA 5A4JA 1U8YA 6Q21A 1DTSA 1UPTA 4OQLA 2BBWA 3V00A 4PC3A 4CEIB 2HXSA 1ETUA 2HT1A 3HU1A 3AP3A 2IYRA 1BMFD 2QSZA 4DLUA 3W6PA 4AYWA 4BFWA 3KQNA 1R8SA 4LK2A 1X8LA 2KBEA 4Z8XA 2EFEB 3PFIA 2F9LA 2X19A 3BOSA 5FBQB 3WXMA 1UAAA 2IXGA 2ZJZA 4GP7A 4WZBE 1I4DD 3UWKA 1F2TA 2OILA 4HUQB 4HZUB 2EWWA 3K9HA 3AM1A 3IILA 2ZITA 1D2NA 4IOKA 1AZTA 3AVTA 1Z0DA 4DLVA 3A1UA 3GLHA 1NVVQ 1SVLA 2CNWD 3QKTA 4XSHA 4BGDA 3C15C 1RJ9A 1FW6A 1E1RA 3W9YA 2QROA 3G5UA 5KUTA 1EXMA 3EPJA 2QM8A 4MKFA 4MDFA 1G8YA 2N1BA 1EFUA 1W47A 2GHIA 5JEEA 4Q48A 3D3QA 3B9QA 1NSFA 3DVLA 3R8FA 2WWXA 2ZS9A 2LCFA 2FZ4A 1XCGB 2FMXA 2J7PD 4JL8A 4QGAA 2ZJ2A 3U4QA 2QBYB 3CW2A 4N0DA 4BE7B 4US0R 1E99A 4DZZA 3Q7PA 3LX5A 5C1BA 2BKUA 2C98A 5C46F 5IDVA 5EUQB 2VP2A 2C77A 2ORVA 1ZIPA 4HLUA 2GXSA 1AK2A 1IJFA 3TE6A 1OW3B 4F93B 3L0SA 3M1IA 1FUUA 1TX4B 4BFUA 2F9MA 1P2TA 2G0TA 1AIPA 1GUAA 4TL7A 2B8WA 3TUIC 3NBXX 2IYWA 3DPUA 1L4UA 1Z28A 4AG6A 5HZHA 3K09C 5GJCA 4ESVA 2OG2A 1T6NA 1FQKA 1VG8A
chains in the Genus database with same CATH superfamily
2V6BA 2FHSA 3TVTA 2ID7A 1ZBQA 4E2WA 4K7JA 1E1CA 4ZMSA 2X5XA 3V97A 1Y6JA 2IXFA 4H18A 1OUMA 3QE2A 2QX4A 1EP1B 1QQ7A 5EZYF 1UOEA 4F11A 2Q5CA 1QIFA 1CLUA 1NUAA 4M0UA 1ZIXA 1ENPA 2XUKA 3PDUA 2YJTD 4P7JA 4M1QA 3P20A 4DEXA 3LY9A 1RPTA 1ZH0A 3UKJA 1TT7A 4IY1A 4J7CA 2VBIA 3DXZA 1DJLA 5KJCA 4YV0A 3OPQA 4OLJA 1TZCA 1QP4A 1AGPA 2YWEA 1NXWA 2HI0A 2NZ8A 2FN4A 1FQOA 1ZRNA 4HDKB 5E1DA 1M7BA 4OHZA 3CBGA 4D3YA 5C37A 4ZD6A 2C0CA 2IOFA 1Q7BA 1Q12A 4K6OA 2W93A 4REQA 2PUBA 1PQYA 1ACLA 3QRWA 3T0IA 4DCMA 4ZYVA 1LB1B 1PKEA 5B2EA 1BVUA 2JD2A 3B70A 1IZ8A 1B0AA 3UT6A 2WD7B 1IBKB 4KDCA 3NHSA 4A6PA 1HDZA 1PNQA 3S27A 1KAHA 3VJLA 5EQTA 4B45A 1T8TA 2J6IA 3ST7A 4E5KA 5DFAA 5EPEA 5CJJA 4KCGA 5IBCA 3ACCA 5JBNA 3LLUA 5H3CA 2HWXA 4V0SA 1O9HA 5CFOA 4PQFA 4S2EA 1MEEA 2AN1A 5DB4A 1G1MA 2PXAA 4JN6B 5F77A 3R8CA 3PSAA 4WINA 1EBBA 1FNSA 2BF7A 2QYTA 5CLGA 3ZQUA 3EX7C 1I6MA 3VUEA 4RIFA 3RSOA 2AQIA 3SKVA 5KWVA 5L51A 1YKFA 4QJBA 4L4UA 1JLSA 1DC7A 3QFTA 1TAUA 3J81A 2ZYGA 3RYFA 2ZUUA 3MWEA 3GLGB 4UTXA 5KJ1A 4KU4A 4EY7A 4GX0A 3ROPA 5GAJA 1GIAA 3IBTA 4UXIA 2XBMA 1M3SA 2XQGA 1NJ8A 4KK3A 5JC1A 4QU8A 3TR6A 2GTHA 2QLJA 1ZK2A 3F4KA 3NJ4A 5B3AA 4BAUA 4TQGA 1AM4D 2IHJA 1KP2A 1VIAA 3DD1A 3NHUA 4FKMA 3RBXA 1Z38A 4DDWA 4ZMRA 3AEUA 3ESRA 3H2HA 3M6XA 1JG2A 4RUKA 2JHPA 3ILSA 1E1MA 3W8DA 3KOYA 4MUXA 2C4UA 1E2FA 1K0FA 3OJOA 3HPQA 2V9ZA 3A9CA 5L9AA 4TUYF 1NVXQ 3FB4A 1QWSA 1SXJE 3L6OO 3PZBA 4GOOD 3SHVA 1HYEA 4F72A 1THGA 2C9ZA 1UZLA 1E1YA 2P9YA 4Y6PA 5TGZA 4BZXA 1UAYA 5KNCA 3IE1A 4W8GA 5EKUA 3AI2A 3QUTA 4CKEA 1YR2A 3BCRA 5G1PA 3OHSX 3AVPA 3QBEA 4JLMA 1JHRA 2WWIA 2XE7A 2DR0A 3RTAA 4EK9A 1U0HC 2ZJ3A 3OUZA 4TWJA 4KVGA 3V8VA 3F5FA 4OMDA 1CJCA 3NANA 4P7GA 4Y9UA 3PC6A 3B5JA 4IV0A 1ORVA 4OQZA 3VO9A 2WJZB 4JI5B 3U4MA 2EP8A 4OKSA 5TE9A 1VI6A 3GFSA 3UPTA 1D7OA 1E2JA 3U9TA 4TVSA 3FOZA 2O05A 5FD8A 1G21E 1FTGA 3SS8A 2HCRA 4CZ2A 3L0PA 3H04A 5I51A 5FUWA 1U8EA 2MSNA 4KIJA 2WJPA 3VPFA 5FUMA 1U9IA 2G9ZA 2O2XA 3X1KA 1PZXA 3WSWA 2ISSD 4B3HA 3LZ6A 4MGIR 4GE0A 3LOQA 5JEEA 1P31A 2LXNA 3COYA 2OO7A 3UWMA 4MW9A 4JGIA 4WCFB 1AS2A 2WF9A 4LXTA 2G4CA 5JZVA 4LNAA 3TQSA 4EI7A 2NSJA 5AVQA 2W6ZA 3BHIA 1MBZA 3EXG1 3LS2A 1E61A 4B8YA 4IUCS 4K81B 4DHWA 1J2EA 2E6KA 4L9RA 4Z3OA 4JUIA 4BE9A 1XVTA 2ZCVA 4ZZ2A 4DPMA 5GADl 5ECDA 3BMNB 2XDQB 4KVFA 4FDLA 4C30A 3WKEA 2HQOA 5FUQA 1KWGA 1YFLA 4FB5A 5JUWA 1D07A 4D0GA 2JIOA 3EMVA 4YRGA 3TJRA 2FZWA 1HH4A 2O9JA 2JEZA 1DO2A 2QMEA 4FBGA 4XUEA 2A5LA 3IVXA 1POWA 5I9LA 3K0HA 4YREA 3B1WA 3SPXA 4YWJA 5L6LB 3PHIA 2XMGA 2ZLBA 3I4FA 1W75A 4CG3A 4GDFA 4IVPA 4IJ5A 4ZQEA 4B82A 3AVWA 3CZRA 4P0QB 1NXPA 1DBPA 2ZRDA 2G40A 3OE7D 3UCEA 1QO7A 2GN4A 4HAYA 2NU9A 3V4LA 3ZY4A 4L8LA 3C7KA 2O7QA 2P0EA 4YNBA 4I3FA 4EFNA 4NBTA 1RLOA 4UARA 1Z0SA 4BB9A 4PONA 1TCVA 1UM9B 4AC9A 4B44A 4R8VA 3V34A 4XPIB 3DLPX 1E2GA 1WD5A 1J0EA 1PHPA 3FBWA 4E1VA 1JL3A 3L92A 1EA5A 4A1OA 4KGVA 3HYLA 5DIFA 2LPMA 4LXGA 4LY0A 3W06A 1UQRA 1VGQA 1XTSA 3R0JA 5AKIA 1A8SA 3WICA 4IIUA 3HDGA 4RMNA 2D1QA 4TRMA 2AWOA 3RJTA 3WP1B 3RADC 1J33A 1YULA 1WVMA 2WAOA 1HEIA 1PGNA 1I14A 3GDGA 4INOA 4ZA2A 1MJHA 5FLYA 5LPNA 4DR6B 1KJJA 5BSGA 7MDHA 2BRUA 4LHVA 4IZ6A 4S1WA 1KI9A 4WN9B 1YI0A 3VOBA 3UFBA 3TQRA 1C4OA 2O2DA 2C42A 1WXQA 3VO2A 3LY8A 2V7QD 1SIBE 1YE8A 2I2DA 2YV1A 2ZSHA 2AR9A 4QWWA 2PRKA 1YV9A 3QWHA 3WNQA 1Z5UA 4MRSA 5SICE 3ZIUA 3G17A 4P7BA 3RD5A 3ZQ4A 3AOEC 5FOUA 4BMSA 2VL7A 1PV2A 4CMKA 3HFGA 3ETJA 4HWKA 2EAUA 5TARA 3U40A 2C29D 4I4TA 2J7PA 4JQYA 3PL1A 4DMFA 4EHIA 3FDJA 1SQ0A 2GBIA 5C34B 1E1LA 1PR9A 1HYGA 3V4FA 5HRAA 4PO8A 2K2WA 2PRJA 2V7PA 3TNYA 5D3MA 4GOJA 4M1EA 2IUFA 4UE3S 1SKYB 2IS6A 4TYNA 4BNYA 4OAPA 4R1NA 4F4FA 4ZK2A 5KIAA 3HBNA 2RH4A 3F6BX 5B3LA 4BZZA 2PS0A 4TZ6A 4K87A 4A4DA 2G71A 3AXSA 5JBIA 4KE7A 1IJBA 3RANA 3VNRA 4Z6KA 2DPGA 1GDTA 3HCWA 2WC1A 3P94A 3STYA 1DC4A 2BDTA 3NRCA 4GX2A 4TM7A 5J2TF 4CPDA 1QAOA 4H6VA 3Q87B 4ZODA 5JMOA 4EVRA 3MSXA 3TQFA 4EG3A 2XWBF 3E3NA 1T9ZA 2GS9A 2PQ2A 3G7UA 4R2IA 3TW4A 1KQPA 1PG0A 2JFPA 5M34A 1Z15A 4E14A 1T5TA 4QFMA 3UGTA 3E9QA 4QJIA 4IV5A 3GIWA 3FCCA 1XI2A 2E87A 2EWMA 1WUTA 1KVTA 3OOJA 1U2DA 1EFHA 1D2EA 1K6XA 4IMIB 3T9EA 1ZRSA 3GA0A 2FP4B 3EY9A 4GXNA 4V0MA 5KKNB 2O0LA 3PK0A 4EHLA 1SVSA 2ZTSA 2IIQA 3F4BA 3L1UA 4LDNA 1LBSA 3MJHA 4X8LA 3IAFA 3RSQA 4EW3A 3O3OB 2EZ4A 4JC0A 1VCMA 2XH8A 4D9FA 3DQPA 3B20A 4IR7A 1USUA 3AIOA 1PJRA 2NSHA 3BSYA 4Q4AA 1II8A 4MUYA 2H5JA 2NAPA 1T5IA 2PL9A 3B85A 4MLZA 3ADDA 2GNOA 2WTUA 1RABA 3K2IA 3OIUA 3IHWA 2XMBA 3DT6A 2GBFA 4I5IA 5BW4A 5BR8B 1P9OA 3JCZA 4QDXA 3IDSA 3VZDA 3RRJA 1A0OA 1NY5A 4D3DA 2ECKA 4RSMA 2IV3A 3GVIA 2XGGA 4TTTS 3ORYA 1AHHA 4LKOA 4CVNA 3HYTA 2IZ6A 1NXTA 2GWHA 4ER6A 2GLUA 3BRCA 1TMKA 1Z33A 4RBNA 1K4MA 1V3UA 2IYVA 2OM2A 3AGQA 4I1SA 2X9QA 4WEQA 1EVJA 2IBTA 1IEWA 1I1QB 3WOVA 3DMRA 3N59A 2HIHA 4R7ZA 4X20B 3V2HA 1XCPA 4HQNA 3CVUA 1ZLXA 5HIIA 3GRCA 4XGRA 1QDEA 2FPIA 3H2BA 1R9NA 2DSNA 2NUTB 3KS9A 3DUWA 4G4GA 5HA5A 3TLKA 1CEYA 1S3IA 4IIYA 4QREA 1Z6YA 5KTYA 5JTTA 1DINA 4HFJA 3EIQA 2WJIA 5TSDA 2XMPA 2VJMA 3K4QA 4D81A 3G0OA 4XGIA 4F86A 2HSJA 4OEHA 1Q7EA 1ORIA 2MDTA 1STOA 4LOJA 3K20A 2VDPB 2HHCA 4XSGA 1ODKA 3Q85A 5EKTA 3C4JA 2D3TA 3ELBA 1HYBA 3NT5A 4BNWA 2IX3A 3DBRB 5GVRA 1QRSA 1P0CA 621PA 1NBHA 1AMNA 3U4QB 1W1WA 2OXEA 4C6TA 4XI9A 2AR7A 1EVEA 5IC6A 1X2EA 5G0SA 3ROMA 4IG4A 3GRRA 4HAIA 5DNYB 3B5EA 2G25A 2JGIA 4JBNA 5FPSA 3DE0X 2WMYA 4Q9HA 5BN3A 4P92A 4L5CA 4KRXA 1ABFA 2ZRAA 3DB2A 5AVVA 1EM8B 3HRKA 3FKJA 4ZYTA 1P1CA 4URZR 3JSAA 4FFSA 3I30X 3ED1A 4WLFA 1P2FA 1R74A 1MGPA 1EG2A 1ADYA 2QL7A 3N6VA 1UFKA 2C4WA 2GEKA 3F2IA 1MV5A 4HEHA 3MT7A 3PCXA 2DQYA 4WCVA 1DOAA 2WWTA 1VKOA 1IONA 1UF9A 3A1WA 4MGYR 1G3RA 1N8TA 4FCCA 3UAZA 2XV1A 4RC9A 2F00A 3JWJA 2IQ5A 5LZ4A 4R3NA 4O3FA 2JB9A 4MS4B 2Y71A 3ONWA 4YRLA 3LK7A 3M6LA 2X42A 3RNLA 3KOWA 3LHKA 2FYTA 2HMUA 3ZKWB 4ALIA 4HAVA 4QBHA 3FIUA 1NULA 2WF7A 5ALMA 3ZVLA 5ITZB 3DJYA 4C3ZA 5HGXA 3UMGA 2XZTA 4MYTA 1D2MA 1PSWA 3E22B 1USWA 1MPTA 3NFYA 3LF2A 4YQEA 2I6SA 2JLRA 1JGTA 5D51S 2EDCA 3UJ6A 2OQIA 3ZHYA 4YCSA 1Y5IA 2D1SA 3QJ5A 3REGA 3LUJA 4S0ZA 4Z1MD 1JDSA 1K66A 4MUEA 5TMPA 3SR4A 4ND8A 1VB3A 3RSSA 4HAXA 3EXFB 4WH0A 4KN9S 3X2FA 1C81A 1PEKE 2WTEA 5T5QA 3TTXA 1WPRA 2XBLA 1DOHA 3KXPA 1I7LA 2I34A 3GPLA 5J9FA 5A9SB 2JAOA 3BWYA 3E7WA 1Q14A 3FDZA 4CKXA 1DEOA 4UAJA 3V4PB 1N92A 5L3SA 1MO2A 2AZ4A 3KUCA 1O95A 2PGLA 3QP9A 4OUDB 4B79A 5JW6A 4C14A 2O8BA 5KSPA 3ZLVA 2X9LA 3I5UA 4XM2A 4B48A 2IUEA 5FPKA 1Z0AA 3DDSA 4D7AA 4Y2JA 4UJ3A 3OE7A 4AKTA 5FTJA 5KOHA 3GZJA 5AHKA 4I4TF 1YDEA 1UWKA 3OCVA 4Q4JA 3DBLA 2ALJA 3DBHB 4H27A 3TR5A 4C20A 2FDXA 2HMVA 1BN6A 2PUFA 4LVCA 2H3EA 3RFVA 1FNNA 3WY9A 4BNTA 4GEGA 4NYMQ 2E3JA 3IPAA 4OD0A 4W5RA 1RM5A 1J09A 4XWKA 3HFSA 2NSDA 3C24A 1PJCA 1FP4B 4LMRA 4NSNA 1DAIA 5YASA 2V54A 1B0PA 4E2XA 2RARA 4V24A 3INTA 4U3JA 2DFPA 5AP9A 4RQBA 4N54A 2QM0A 2FX2A 5AOVA 3VNBA 4KP7A 4QARA 4DIDA 2UV8A 3OQIA 4GUDA 5DWQA 3SDSA 1Q6YA 2QZ9A 2V7QA 3ZD9A 2SECE 4G0PA 4LOLA 4RFLA 4HGRA 3TI9A 4BS9A 1H85A 2WTNA 4R6XA 1P80A 3BAFA 3F5MA 4E12A 4Y2PA 2H1OA 3F7OA 1NA5A 1KJWA 2O0KA 3ZI4A 2WHXA 3GP8A 4YH1A 4PSVA 3GU3A 1WY7A 4BVKA 4HDNA 1CQXA 1ZAKA 4OLAA 1GDDA 2XA9A 2AD5A 5FOTA 3NTQA 2ON6A 1AQLA 3H2ZA 3HZOA 1IXZA 5L40A 1BMQA 2OSVA 4FDVA 4MHOA 1ATZA 4D26A 3IAS1 1NVWQ 3NPMA 1KJIA 1HOTA 3AUFA 3ODPA 1D4AA 1GA6A 1UJ4A 2CDBA 3HJRA 5E4TA 4KWIA 1XYVA 3FWYA 4W63A 2C57A 3OCCA 4N65A 4C03A 4X6YA 2H54A 2VJPA 3RBZA 4EG8A 1A77A 4DQXA 1ZJWA 4KE9A 4CMGA 3H2JA 1CUGA 2RGRA 2QP3A 5EIBC 1HMYA 5FFFA 4EYOA 4DJ5X 2VUUA 1VYHA 2Z5VA 5ESWA 4O0LA 4ZCMA 2I9PA 4QEZA 1J1IA 3THXB 1HT3A 1TXGA 1E3EA 2DHCA 2EHDA 2WMOB 2YWHA 3FMFA 3WMWA 3DKRA 1VBKA 3WK6A 2OBFA 1TKRA 4GNKA 1M72A 3DEKA 4UC0A 1RKVA 5JSHA 4AS1A 2AHOA 3N2KA 2ZAYA 1V41E 3PI7A 5LP1A 2UZ4A 1NQTA 4PYOA 1EAMA 4MMXB 2JGEA 3IBCA 3ROZA 4BNGA 4JXZA 5CFPA 3ZVNA 4KAAA 3V4RA 4Y2XA 4DPKA 5CEEA 1OXXK 1SXQA 2O07A 5J63A 4MQLA 5FOSA 3D6HA 2DHRA 1EFLA 2DJIA 2BFFB 3T5BA 3V1UA 4A0FA 4A10A 4GVXA 2PBRA 1NP3A 3ROXA 4I36A 2JBAB 3KFVA 1HG0A 3OIYA 1PYGA 1CULC 4HQRA 3DWFA 2Y93A 3FLBA 4HVTA 3KR2A 5EPUA 1Z4OA 4NKRA 1ZITA 3CWZA 4KAXA 2KE5A 5TXGA 1Z0KA 3IOYA 4H60A 1V5IA 4E6PA 4OA8A 3K1AA 4BQNA 2M6RA 2OAEA 2X8JB 4EG4A 4F71A 1PQ4A 3HZZA 2A58A 1EG7A 1E7MA 3T5GA 4Z4IA 3K6SA 2WIJA 3C3WA 3SXUA 2C7QA 2VWQA 2PVSA 2TMKA 1G20B 2ZXEA 2W9XA 3ME5A 4FTWA 4CM9D 2QZZA 1JA0A 5H80A 1EUDA 4M89A 5J5AA 4GS5A 5BV0A 4N03A 3LRPA 1VRWA 4EL5A 3CLRC 1C1YA 1HE3A 2WFLB 4I50A 1P1JA 4IMJB 1LY1A 1UBHS 4NENA 1JEQB 2ZTUA 3MTEA 4PLCA 4HBZA 4J6FA 1ZI8A 1L9XA 5G4LA 1R15A 3FYHA 1V8PA 3TKAA 2B25A 3OZVA 4PPGA 1TZ2A 3BC1A 1ZEMA 1D6SA 3CMCO 4N5HX 3FOFC 4WGGA 3WGHA 4GP6A 3S2IA 1QIJA 3A6HA 4BQQA 3VVCA 5F23A 4LWQA 4ONEA 2V7BA 2G63A 1Q84A 2AOUB 2B3TA 2IYYA 2W6CX 3BWCA 1QGUB 2BY4A 3B2QA 3FKSD 4YP6A 1G19A 1Y7IA 1Y9DA 3NM4A 4RFSB 3VBEA 4S05A 1QHSA 4MP6A 5AK3A 1TZJA 3I39X 2PMDA 1CR4A 1I2AA 3SHFA 5JAPA 2LWIA 4G1BA 4A82A 3O1JC 3O8QB 4PG4A 5C8YB 3K5WA 5HKKD 4HV4A 1SGWA 3N07A 3CCFA 1PR0A 2DBRA 3GJ4A 3K6RA 4GI5A 1JDJA 2F8MA 3LC2O 1X7XB 3GFFA 2DUWA 4FSXA 1KTIA 2UUCB 1J21A 3INNA 4JLPA 1CNMA 5K0EA 5BXYA 1EP2B 3L77A 3NNDA 4AX4A 4E3ZA 1A98A 3EVTA 5DNCA 3H9EO 3V4ZA 2ZULA 2RAPA 4TLLB 2WSIA 1LRJA 3DW1X 1JFRA 5DH9A 3H3JA 3F0TA 3QELA 4MB0A 1MN6A 1K8XB 3GI1A 1KMCA 5LKRA 4M8NE 3ADCA 3Q7TA 5LP6A 5IXJA 4JQCA 1O7JA 3KJFA 4E2FA 4GI7A 5F4ZA 4U4AA 1YNOA 4G0VA 1ZNWA 1I10A 2CSUA 3VC2A 1W87A 4PIVA 3J7AC 3JAKB 1WS6A 2O06A 3EVCA 3BL5A 1E3TA 1XQ6A 3DE5X 2ACKA 1GY8A 3IUMA 5A0FA 3WYCA 1ZGAA 1R8YA 3RHTA 4PLZA 2X0DA 2QT1A 3V9AA 4OXXA 2FPPA 1V1RB 5BOVA 3RLIA 2J85A 3ZWWA 4EF6A 2HEGA 4OFWA 2XX3A 1QTQA 4N1AA 1VPDA 1XJ0A 4WECA 1L5MA 1IZYA 1P1KA 3M1YA 3TEJA 3TQCA 3EBPA 1EP9A 2DLNA 1MJFA 1R4MB 1Z06A 3DYIA 4L16A 1NN3A 4QEDA 2R4QA 1MR3F 2ZSFA 3E7DA 3CZAA 2CLMB 1I4OA 3TQQA 1BIFA 4HVCA 1Q1NA 4Z1MA 1QMPA 4EEKA 2WQZA 1IN7A 4YRMA 3OO0A 1HT1E 2CUKA 2ZOSA 3FLMA 2O7NA 3K6KA 3SSAA 1UMDB 5IMBA 3BILA 2IV2X 2GRAA 1GQ2A 1XZCA 3O95A 1DJOA 4C0SA 4Q3BA 4CKBA 2WUEA 4ZPXA 4UEWA 2EQAA 2VPYA 3GUCA 4IZHA 1AV7A 1MQAA 3ZOKA 1IY8A 3GK3A 4B75A 5CIYA 3D3WA 4IZOA 3U7EB 2BUBA 4PTZA 1RAIA 3ADPA 3OIWA 3T61A 3COVA 2WWRA 1HEYA 3CLHA 4MYSA 3ZCUA 1E5DA 1NUSA 3FSEA 1LW7A 1TTTA 3GLIA 2P6OA 4EJ2A 2QT9A 4UQLA 3ZE0B 2OVBA 1W93A 1Y9JA 1NZJA 1QC5B 1Z5OA 3P9KA 4I1RA 4ZVQA 3VAAA 2R2GA 4ZQIA 5KKAA 4IMPA 1Q0QA 4AUEA 1BHO1 2DMRA 4DAEA 4YUZA 1NX9A 5EHZA 1EI9A 3AETA 3VR6D 2F55A 2Q1SA 3KJNA 2EQBA 3UANA 5DHFA 4MQBA 3BERA 4HB0A 1KJZA 2W4MA 1AGNA 4G1UC 5EFZA 3NWJA 1SC3A 1QAQA 2H31A 2P65A 4EYKA 2PJUA 3F49S 4N0MA 4MKGA 4L15A 2KWIA 4P33A 1Q50A 4YALA 3VRHA 3HLKA 1FVOA 5U9CA 1W2GA 3AR6A 5EMLA 2G0AA 4HDMB 3K0FB 1QYCA 3WGIA 2EBHX 2O7SA 1GTMA 2QAGA 3EG9B 5JU6A 1J5PA 2J8ZA 5DYGA 1S7GA 1FSGA 2QG6A 1JLLA 2QL5A 3LDUA 3UG6A 5IM5A 4L85A 4S04A 1AG9A 1E5VA 1NRJB 1I3OA 2ZI9A 3QWFA 3ND7A 4FIZA 3LO5A 2B30A 4AMGA 4B5KA 2R48A 1IB0A 2O52A 3E58A 1YQXA 2A86A 2FZLA 1CQIB 2IOQA 2Z5LA 4JT9A 5HBRA 3SX0A 5EE1A 4DMHA 1ODFA 5BSFA 3B1KA 3PL5A 5K6TA 4XFKA 5DSXA 1KI7A 4Z4HA 4JBHA 2MYPA 3VV2A 2Q49A 1TU4A 5KMGB 3KTAB 1DDIA 3E9RA 5K8UA 3B1YA 1RU3A 1WKVA 3GUHA 1O87A 2NADA 1Z8DA 1QLJA 1ZL2A 1JWLA 3GFTA 3LCUA 2JIDA 2PMKA 1LJUA 3GGOA 3HP7A 2A1TS 5GINE 1E7RA 3QUQA 4HF7A 2X2OA 3B6KA 5EIEA 2ZR9A 3G0GA 1G2QA 2Q5EA 4QDZA 4RTNA 2H18A 4QSMA 4G01B 3FR7A 2B4RO 3IXMA 3HO1A 1MW9X 1W88B 3C8DA 5D8DA 4B6FA 4RMJA 4JXKA 4NPAA 1QVZA 2F1OA 3VOAA 5C18A 3ZZTA 4OB7A 4DNFA 1LZKA 3GQVA 2O19A 1YD7A 5BWMA 2O3UA 3QWBA 3PIRA 3DLBA 4CEJA 2Q3LA 4JBIA 1Q3TA 5A3QA 2F59A 1CJKC 5F76A 1AQNA 1GN9A 4PCVA 3IQHX 1VSVA 1C0IA 3KUUA 2Q3JA 1LTKA 3EFBA 4HBGA 4JVSB 3MCTA 3FF4A 3MTGA 5FOXA 3AGPA 3FAZA 3UUWA 4IYJA 3IT2A 3Q9LA 1GTVA 2BT4A 5BV2P 3GBSA 3GG2A 1R0LA 4MITA 1TZMA 3KVYA 4MYUA 5LP6F 3M82A 3VR6H 4D8YA 2P6NA 4I50F 3UOAB 4HEA1 2SKEA 3RFFA 2ZRJA 3NHKA 5E0KB 1H93A 1M7GA 1QFXA 2V98A 4NEGA 2IYUA 1H5QA 2YXLA 3LLSA 1CY0A 3JZAA 2J3QA 3HEAA 3TZCA 4C22A 2OB2A 5BSRA 2X2PA 1CP2A 4Z0TA 1W9HA 1Z62A 3KOMA 4NG4A 4WKPA 2YJNA 3F8WA 4XJXA 1KEZA 1L5HB 4DMUB 1AB5A 1ZN2A 3KJIA 1QNFA 3UH0A 1TW2A 5DIZA 2ZTLA 1PZGA 4BVAA 4JLUA 1NJ6A 4BKPA 1OH7A 3C6ZA 3GP3A 2ZE7A 4RCYA 1MZPA 5BSUA 1CJUC 1IEQA 3GLGE 1BDHA 2YW9A 2PX3A 4LZWA 4QT4A 3L7IA 1E4EA 1LNZA 4AB1A 3WGQA 3AZOA 2C61A 1NI5A 3JASA 3OT1A 1F20A 3O73A 3EGWA 1T5HX 3M6IA 2EX1A 3KQVA 4LMBA 4BFVA 1M0EA 2JANA 5AT1A 4ZYZA 4NFYA 4CM9A 5BVGB 1VG9B 5DI3B 2E48A 3EUAA 3GT4A 4QUAA 1QFJA 3SHWA 4F1JA 1XU9A 1GL3A 4MCJA 4E1BA 5GZ3A 3CLSC 3LWZA 3UAVA 8MHTA 2DPHA 3W5UA 1WETA 1VLQA 3GYBA 1USKA 1U3CA 2ILTA 3K0BA 4J2OA 3ZGLA 1X39A 1YZHA 2IPOA 1J24A 2B0CA 3AC0A 3HSYA 2FWRA 5J4YA 1F0YA 1QVAA 1ZD2P 3DWEX 1ZQ1A 1G3QA 3ZHQA 3EMDA 2CMDA 3M9LA 4E5UA 2GCOA 1EH5A 2VDKB 4EOGA 5ICEA 4BWFB 1JE0A 1HNNA 4V0NA 1VHWA 1BA3A 3DW3X 3SJBA 4RL4A 1YFJA 2RCYA 3D7LA 4ESHA 5A4KA 4YDHB 4L02A 1M2OB 4V03A 1B2LA 3S8YA 4JEMA 2CDAA 5ALZA 3ZHBA 4TTRA 1E2DA 4ZICA 3ZH2A 1H1LA 2BKLA 2DFTA 4DT1A 1P8JA 5HKKA 1D2CA 2ZT8A 5EWMA 4NOKA 1O54A 3GEIA 4RSRA 5JDCA 1M76A 3PNYA 4H1TA 5D5HA 2F67A 1YU6A 16PKA 3ETCA 3SLKA 5HCIA 3NHLA 5CDTA 2BMJA 2P5UA 1M75A 1V71A 4TM8A 4NCAA 3QPVA 3GFOA 5A7FA 2YYYA 4DLWA 1QQ5A 4R0NA 4F06A 1QCDA 1I1HA 1V9CA 2GZ3A 4JNCA 3KQOA 1E5QA 1XYGA 4RD0A 4XWYA 3V46A 4XH9B 2Z83A 1M2VB 1V16A 3P5BA 2QLLA 4QULA 4EO9A 2F17A 4G5SA 1IQUA 2NVOA 5AI8A 1WCV1 4GZ6A 2Z6UA 1QYDA 2YV3A 1T5OA 3F7NA 4KPUA 2MIIA 1HLDA 2E5WA 4RIEA 4RVSA 5T4FA 4AMBA 3ZD6A 2H4FA 2ODEA 4U6NA 3R4VA 4CMIA 4WACA 4R2MA 4HWTA 1EXNA 4EZEA 3QKRB 5ALTA 2GH1A 3UOWA 1D8AA 4B80A 4DWOA 2F3TA 4OHVA 4F0JA 3K09A 1YK1A 5G41A 4II3A 3ZBQA 4TSKA 3ANXA 5IM4A 1F4VA 5ELMA 2OCGA 2JHAA 2PBZA 1L4GA 5EHQA 2QD4A 1E9FA 2Y1DA 2ZSIA 1YQUA 3HGQA 4NEQA 3I62A 4WBNA 1NC1A 1FX0B 1AA9A 3TDKA 5AYVA 3W79A 4I7EA 1H2YA 3SWWA 1WB9A 1P33A 3EHEA 1GNSA 2J5KA 2XQJA 3B9RA 4UZEA 4PLHA 5EJ7A 1TGYA 1X1AA 3G5AA 3QH4A 4YHBA 3WO1A 4UM9B 3KKEA 4QO7A 1OMOA 1UBUS 4DJJA 1B76A 1L7DA 1A5BB 3FB1A 2YN0A 4LXXA 4PGHA 5DNWA 4MVJH 3AOGA 3T5DA 2X0RA 5TJHA 1TYZA 2I4NA 3AJ8A 2G76A 1J2RA 3W7AA 1AZWA 3L9WA 4JJ8A 3N7UA 1MIOB 1XQVA 1ZINA 2D4AA 1O89A 4RVGA 1LF5A 1RJDA 3H7IA 4Q3NA 3EYAA 2ZK7A 1TNDA 3R0XA 2CHFA 1XN1A 3DULA 5HZGA 1I94B 1MUUA 3JSXA 3W7BA 4AKHA 4I1YA 1WBJB 4Z7JA 5KYNA 3NHAA 2XNSA 4CM4B 1W5FA 1UDWA 4GD3Q 5D3ZA 3LCVB 4H7JA 5JH7B 3ZHSA 1PK7A 4OIMA 4RTOA 1JA9A 4PRKA 4UEKA 2LW7A 2L17A 1DG1G 1QRDA 3TH5A 5CB8A 5JS8A 4RULA 4D9HA 1RWMA 2FRXA 4RANA 2UYQA 4WVFA 3MCUA 4O2BA 3VR6A 1Z4JA 5LZ5A 1HSOA 1WB6A 3M33A 1TQ6A 2A84A 4NFHA 1GD1O 5TC4A 1C41A 2I2CA 1DJMA 1VYVA 5FL3A 4AJ9A 1CY7A 4KUHA 3UAOA 2MMCA 1Z83A 3MS4A 5CB0A 2BKXA 1G59A 1DQZA 1NASA 1ZA1A 3QXGA 3FPHA 4JGGA 4QD3A 3LXRA 4N3NA 1XTZA 2HJWA 1I6WA 4A8PA 4DC9A 4IDPA 1T91A 2EHJA 5AVWA 4MAAA 1XQXA 4MA4A 1AT1A 3VH2A 1T5DX 2QN8A 4GMXA 1CVIA 3IAM1 1OLXA 4L5YA 3ER8A 3L8YA 1GPWB 2XA2A 2FEPA 1QLHA 4HAUA 2YHIB 4YRFA 2P4SA 1FUEA 1SKYE 3F71A 5JJ5A 1NAHA 4TQ9A 2PM8A 2KYRA 2VHXA 3UMSA 2V65A 3KAKA 1IBCA 1XVAA 1EU1A 1OJ7A 3RRMA 3U5ZB 4KOAA 4NYJQ 1C4XA 2ZRLA 3QPDA 2VP4A 3MYRA 1NU6A 1GVNB 4NBKA 1YKSA 4GICA 3TRDA 3RC3A 3MINB 3N9IA 4K05A 5F98A 3BK7A 1WMDA 1ADGA 1AHIA 3T99A 3ZHUA 3A4NA 3MD0A 4TYPA 3C3DA 3FFAA 1EBFA 2NZXA 2EDAA 4OO3A 4XUCA 4EG0A 1LPNA 3BH0A 4FYYA 1IL0A 3C70A 1WVGA 3PG5A 1U3UA 1KYXA 1ZMRA 3EK2A 3S40A 3ZDXB 4BDTA 4CN9A 2AIRA 3G5MA 1CLEA 2RONA 4JYCA 3T7SA 3RU7A 1PJ8A 1P1RA 1I30A 3OI7A 4LYHA 2PRZA 3LPLA 3MWDA 2DQ4A 3C5EA 2GN6A 3JD2A 3K96A 4OREX 2WMNB 3IEIA 5KWSA 2R3SA 3FVVA 5CCXA 3ESZA 3TCKA 1CERA 3MTDA 1T1EA 3HY6A 5TX7A 5CAEA 1MAUA 4BO3A 1UADA 1KBOA 3D4BA 4IOLA 3K53A 3FCSB 3UHAA 3CWCA 1DG9A 1XRQA 3MJRA 2H4WA 4F2WA 4I5FA 1T9GS 1DKPA 2NQ2C 3FCUB 2Q4DA 1OFIA 4W82A 5CLFA 5EZQA 3QA3E 2ZJ5A 1NVEA 3JARA 2GEUA 1OKKD 3IIEA 4NZNA 3WIUA 3PXDA 4OGGA 1TTPB 1KY2A 1YAJA 2Q2QA 2O1SA 3MJTA 4O2AA 3E05A 4R1MA 4S1VA 3CPHA 2FZGA 2PX4A 5ULLA 3SU8A 3M2PA 3SIPA 5JVDA 2ZJFA 3WYAA 2IEGA 3TOVA 4JP1A 4NLLA 3WQBA 2I3DA 3ZLUA 2ID4A 3I0NA 3CRNA 3N76A 1Q57A 2VP5A 4G07A 4IIBA 3D0QA 1X1SA 1FC0A 3AEKB 3Q3HA 5EMJA 3C1TA 1GGNA 4LV5B 4ZDWA 2ZYSA 4FQ5A 4AY4A 2GYUA 2QRVB 4MGEA 3VU1A 1U2TA 1W5BA 1JQ3A 1OA1A 4ML3A 1OH6A 2JGDA 1BA2A 5A7GA 4QOGA 2PNFA 1KF0A 2ZYDA 3K8QA 4C21A 5AKLA 4YYEA 1U02A 1QSGA 4WOBA 3RSCA 2YIDA 4WZ6A 4H6PA 5EJMA 2VSXA 3TGPA 5C5IA 4DM7A 1BX3A 1QGED 3N8NA 1KEPA 3ADKA 4EYEA 2BLNA 1M5RA 3DM5A 1DIOB 1J0BA 3QIAA 5A3SA 1ATIA 1E6UA 4J2HA 2YFQA 2QJOA 2AJ8A 2H5LA 4KYTA 2B20A 2D06A 1U8FO 4B6RA 1KJ8A 1VJTA 2K87A 5FUBA 1SJ9A 3THRA 3CSSA 3ZGXA 2P2GA 5KJ6A 1M34E 2Y77A 1PLLA 3QY0A 3CNNA 1DUVG 5IDXA 4DLLA 2BGKA 3ESQA 1RWXA 2YBDA 4MAFA 4MP8A 2EIHA 4MWTA 4EX7A 3B38A 5DGTA 4YCMA 2J0QA 3KD3A 2HFJA 3L41A 4RWZA 4JY7A 3PXXA 2XCOA 4Q0MA 5IM4F 5FJIA 2AHRA 2FJ0A 1TYDE 5K3OA 4CR6A 1P73A 3QX8A 2X4GA 4I19A 5MGBA 3DZ8A 4FC6A 2HF2A 3HKEA 2BPOA 2HKIA 3MWKA 4WBNF 1QIIA 4KPYA 2Y3IA 2HY7A 4OHKA 2NVUA 1W5SA 4DG9A 4BASA 5AJHA 4RADA 5TQ2B 2VZ8A 3Q11A 4C87A 3I2HA 1NBAA 5THKA 3HJNA 3LDHA 5IUKC 4AXBA 1HNZB 5FLEX 2ODNA 5HDQA 4EQ6A 2Q5OA 2DCMA 3AOEA 3TM4A 4ZGGA 2Y1KA 1WNTA 1UXIA 4DV7B 4ZQCB 1DHTA 3IQGX 2Y05A 2C00A 1XF1A 1ZUD1 4U7HA 1PL6A 3ZHZA 3TR0A 4DYDA 5L3VA 4WAUA 4EZIA 2Q5IA 3GDFA 2CLCX 1UT5A 3E70C 1CU1A 2QD1A 3Q5GA 3C6BA 2YYSA 3EF1A 3GAMA 5DYYA 4PYKA 3UPDA 1YTLA 5AW0A 5CNMA 4KQEA 2C4VA 3EPRA 1TO6A 2X9NA 2A2ZA 3LYUA 1BVHA 1GFWA 1H9AA 1GCGA 2HTFA 5C3UA 2H1SA 1QANA 3KSDO 1SY7A 5AMXA 3USES 4RDXA 1WDWB 1E18A 1TM1E 1H2HA 5C51B 1UBGA 1SG0A 1CV2A 1KDOA 3FPFA 5BP7A 3DOEA 2ZUVA 1XK6A 3NT4A 4O2BF 2IHZA 2HSGA 3HB5X 5DN6A 3RU2A 3HKBA 4FN5A 1C9YA 3P9ZA 2AV6A 5EIBD 3HYNA 5BQPA 4PTYA 3N53A 3WLNA 3LM8A 3LY7A 4FUQA 2AFIA 2H92A 5K3AA 2NQTA 3A37A 3EISA 1JKMA 3UYKA 5B3JC 3GT0A 4AD8A 3OFND 3DE1X 4MLPA 4QU0A 2C1ZA 1V7CA 2XDWA 3HTXA 2X76A 1TEHA 2VJNA 3GJXC 5CYFA 4TXMA 1VZ2A 3UIEA 1ZW6A 4DBVO 3QOYA 3SQLA 4W9MC 1KKUA 3BM5A 3COWA 2ZIAA 3IELA 2NU9B 3TCNA 3EXHB 1MU0A 1RAAA 3QHAA 3ZZUA 4DMRA 1Z07A 1UKAA 1D2HA 1YJAA 2QS9A 1B41A 1VCIA 2VCYA 3IMFA 1DCKA 3BTSA 2XYGA 5CXXA 1DCFA 5E6SA 2NXJA 5JJIA 4XDYA 3PENA 1XCJA 3V7NA 3VU3A 1P61B