4V02A

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
244
Chain Sequence
AEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDAAIGLRNLDMILGLENRIVYDILDVLEGRVPYEKALVKDKRGLSLWLLPADVIDIEKWNKTVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLESMDKRNYKVIVNRIKWEMVKRGAMLSVEDIVDILKAEIIGIIPEEPKLVDFTNRGEPIVLDEKFPASQAIIDTARRLMGESIPLKRYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 86
structure length 244
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v02A00
4PAQA 3H84A 5LD2C 4LBVA 2ZRCA 3AUYA 4TSFD 1W47A 1G7TA 3H0KA 4LHVA 2YKGA 4A15A 2QTHA 1U9IC 4Q9JA 3X2SA 1Z0DA 1ZIPA 2NO7A 3Q5EA 1N5KA 4IFEA 4G5GA 4R2HA 5FUYA 3VR5A 2W2XA 2AFHE 3SS8A 4BLRA 4MKGA 1KKMA 3BH7A 3FTQA 2XZPA 4LJ5A 1KI4A 5BQ5A 3SYLA 2GA8A 3MMPA 3FVQA 4D4KA 4HLQB 3K9NA 3LX8A 3OE7D 4GPTA 4H9GA 5JI2E 5JWOA 3EASA 4GP6A 5JJLA 5DIFA 1CF4A 3GLIA 2OCYC 3D7MA 1B0UA 1A2KC 4D81A 1NP6A 4PTLA 2DWPA 3A1WA 1JR6A 1E2DA 2BM0A 1AIPA 1XTJA 3I8XA 2IEZA 2WKPA 3QEJA 3K09C 1PVOA 1W48A 2GWHA 4GMDA 2IYWA 2ZE6A 2ZR9A 1ZCAA 4FIDA 4M9ZA 3UANA 2ZI3A 3VHXA 2XOKD 1G64A 4KFTA 4D4MA 2WAXA 1G3IA 4B3GA 4MKFA 1UFQA 1CJVC 2PMDA 2HYIC 2CJWB 5BXQC 1T5IA 3E1SA 3IPXA 2GJ9A 1ZIOA 5J4VA 4WA7A 4D25A 1DEKA 5DHFA 4AKIA 3TR0A 2AX4A 4V03A 4R7ZA 3EPLA 4V0OA 2JLXA 1RW4A 3KQKA 1X3SA 1GNPA 2IL1A 1XJ0A 3U44B 2NQ2C 4LY6A 3NKVA 1SVSA 3RNLA 4ZDIA 4OHXA 4KSCA 5FH9A 3KQUA 2YV5A 3QKSA 5H1YA 2VL7A 5JJIA 4Q4LA 3GLGB 3I61A 2HDNB 3R9WA 2YVUA 1QHSA 4CW7A 1EK0A 2FSFA 3ECCA 1IY0A 2P65A 3VQTA 2CCJA 2IA5A 1E2KA 4NCJA 4TZ0A 2BOVA 1N6KA 3HU3A 2EQBA 2I3BA 2JLRA 3EZ7A 2DY1A 3OEEA 5CIWA 1XTSA 3CUEF 3FMPB 3U7FB 1KTVA 1E2MA 2F1HA 4QHYA 4E22A 1E2LA 4PQFA 2AD1A 1PUJA 4QM7A 2CL7X 2HF8A 4OL0A 5CJPA 1N6PA 1NI3A 2BWJA 4GOJA 1LNZA 1Q12A 2BBTA 4JLVA 3T06B 1SVLA 3AF0A 1XD8A 4LJAA 4PHGA 1G1MA 1KJWA 3DO6A 3IBGA 3DM9B 3GLIE 1TTTA 1HY3A 3W6PA 4IW3B 3NC0C 1W1WA 3QOFA 5IDVA 2YOFA 1RKBA 4KAXA 5F3WB 2PJZA 1MRSA 2KWIA 1CIPA 2ZJAA 3SEAA 4O0MA 5E7IA 3PEUA 1YRAA 4I1OA 1G16A 1GRNA 1GAJA 3CH4B 2D06A 4M1KA 1ZD9A 3DKVA 4B47A 1A5TA 1KAGA 3U3RA 1IN8A 5CDFA 1GDDA 4DIEA 2AN9A 2QQEA 4Q21A 2NO9A 2Z0MA 1W44A 2ZRBA 1NVXQ 3BIFA 2NO1A 2R44A 1T6NA 2EWVA 2WHXA 4QC2A 5C1BA 2CL6X 4GT1A 1VYUA 5LD2B 3LXRA 2JAQA 4Q7LA 1T3HA 5AJXA 1YR7A 3QNUA 4QGHA 3VKWA 3ZVMA 2WJHA 1MABB 3FMIA 1PJRA 2Z43A 3B82A 4NKRA 2CLDX 1T0HB 1SGWA 2IYUA 1U8ZA 4K8OA 1XP8A 1PZNA 2ATXA 4BWYA 2PX0A 3U3JA 3TJZA 1QHXA 3SQXA 1MKYA 1FZQA 1ZNYA 2GAOA 2WMOB 2IXFA 3LD9A 5G3ZA 2IYLD 4URXR 4WIAA 1Z29A 2J45A 2JJ2D 1ZYUA 1PLJA 4LDJA 5EP1A 2A78A 2OXCA 4HYYA 4Q1AA 5KSPA 2IHYA 3TAHA 3O47A 3I32A 2GETA 4URUR 3BGWA 1MABA 2BCJQ 2A2ZA 3ZLJA 4ZPXA 4C9BA 1GVNB 1VG0B 3A1VA 1Z22A 2GRJA 1ZNZA 2O52A 4DLWA 5FOSA 4HDOB 4L16A 1G6HA 5JI3E 1MT0A 5ELXA 2BJWA 3KKMA 5HE8A 4BLTA 2QE7A 1E9AA 4HSEA 1CJUC 2VLIA 3BWDD 3H86A 4RVCA 4QFMA 4X8MA 4Q00A 2H8KA 1Q1ZA 1AGPA 5TV2A 4EJSB 3SYNA 1YZKA 3K8YA 2C96A 3E5HA 2BMJA 4YC7A 4DZZA 4DDTA 1E99A 4BFTA 3RVBA 1R6BX 3K0CA 4M9XA 2E9SA 2FSHA 2ZR0A 2GDJA 2ERXA 4B3XA 4P4TA 2OSBA 2WSSD 2PT5A 2V9PA 3K09A 3OIVA 1VIAA 2W6JD 1NLYA 4I81A 2P3SA 2AK3A 1E0SA 4EJSA 4L8GA 5K8TA 2BHRA 1G8HA 3VX3A 2ZJ8A 1FQJA 1ZUNB 1KI8A 4DLYA 4MRNA 3K0EA 1JQLB 3P1JA 4MA4A 2VHTA 2IHBA 2UKDA 4WW0A 4HEJA 4C0JA 1XZPA 3SOPA 3AEZA 3WBKA 3WNDA 3H1TA 4KBFA 3SZRA 2V55B 2EFEB 2LKDA 4NCIA 1ZC4A 1Z47A 2WJJA 3LLUA 2V1UA 1E4YA 4MGZR 2H5EA 3Q7QA 1XMSA 3EXAA 3Q3JB 1ZD8A 4PC1A 2JASA 4DKXA 2FX3A 5GJBA 2QAJA 2OM2A 3KJEA 4Z8XA 3WYGA 2MMCA 3UK6A 2Q9AA 4Y0AA 3U7EB 3AVQA 1P75A 4FMDF 4PC6A 1E9SA 4RSGA 1KO8A 3RRMA 1XTRA 3TQCA 1L2TA 5C4MA 1OV4A 1R5NA 4IDNA 3AVYA 3VNUA 4YXWD 2LCFA 2XJ4A 2DFKB 2CDNA 2VEDA 4EKDA 1GKIA 5BN3A 1L4YA 2PJRA 2WJVA 2QEQA 3I5YA 1ELOA 2F55A 3QKUA 5FUVA 4CDGA 5KHOC 4QM6A 1FQKA 3KB2A 3CRQA 2NO0A 1X8LA 4W7SA 2VSFA 1KI3A 2HEIA 4JLBA 5UKDA 1N3BA 2ZJ2A 3ADKA 1S3GA 4NDZA 1L7VC 5LB4A 4BZXA 2D7CA 3NBYC 1BMFD 3FHTA 3G5UA 1EXMA 3FDIA 3NVAA 4PO8A 4TTRA 2JDID 4KO8A 3TUIC 1J8MF 3TIFA 3M0EA 2OFWA 4PHHA 4B34A 2J0UA 3EG5A 1QZXA 2X19A 1IXSB 2XGJA 2B92A 2VF8A 4ON9A 4EPXA 5KOYA 1XEWX 1SXJA 1UKYA 1DAEA 3MJHA 5FBLB 3IBYA 1L4UA 1QRAA 3SE0A 4D4JA 4IDPA 4GZLA 1HYQA 4OHYA 3B13B 1G18A 4LRWA 2ZSAA 4LHWA 1XEWY 1BS1A 4IDHA 2MSDB 1G5RA 4JBWA 3TW4A 1O3YA 2ZRJA 1E79A 3EPJA 1AN0A 1P9WA 1IY1A 1XWIA 2C04A 3B1YA 821PA 2FEMA 1UEJA 1LFDB 4M22A 4U5XA 4TMKA 2ANBA 4DDWA 4YMVA 1RC8A 2PEZA 2PX3A 1GG2A 3GJ6A 2FN4A 2WWFA 1EWRA 1J8YF 1NSFA 5P21A 2ZM5A 2QT1A 4H1VA 1C4OA 3PG5A 4J0QA 1U2RA 3TK1A 2ASEA 3W34A 2FGKA 3ZQ6A 4B32A 5BW8A 2CK3D 2ORWA 1YR6A 1E2GA 4U02A 1KIMA 4LZZA 1R10A 2H7VA 3LLMA 2ZRIA 4PX9A 3MUFA 4V0KA 3KDSE 1G6OA 2WWXA 4EPVA 2BBWA 2QMHA 2GCOA 3SFVA 1MV5A 5KPJA 1NSTA 3NBFA 1EX7A 1R0YA 3QVUA 2O0KA 4TLCA 1U0JA 3VAAA 4X8OA 3D31A 5LBIA 2OESA 1UEIA 5TARA 1P2UA 1OIVA 2ZRAA 3CIOA 1N6RA 3UMFA 4C2UA 3SFZA 1GZSA 4WBSA 3HJNA 3WHLA 1E9BA 1QDEA 5L3SA 3PFIA 1Q1EA 5DISB 3VTKA 5FPKA 4P3YA 3X1XA 1EFRA 1E9RA 1U90A 4LJ9A 2H18A 2ZE7A 3BBPA 2JIZA 1OB5A 1SULA 3WP0A 1SXJE 1OXXK 3EWAA 2AHOA 1KKLA 1FX0B 5JCZA 3QXHA 3KKPA 1S0UA 1AZSC 4QG7A 1EFUA 4XWOA 1G8YA 5C4GB 2HLDD 1CR0A 1XEFA 4MRSA 2UZ3A 3R8CA 3DMDA 4LHZA 2NO6A 4TL9A 4RD2A 1E2NA 3QXSA 1QHHB 5DN6A 4MYCA 2D4HA 2ZANA 4WZBE 3CPJB 3TE6A 5K8LA 3HP1A 4Q4JB 3CKLA 1AQYA 4FINA 3N2EA 4KCGA 2VBCA 3VR3A 2XSZD 2IS6A 3QVVA 2XNDA 1FFHA 1LS1A 1RRGA 5HE9A 3CF2A 1NF3A 3THWB 3K0SA 4LJYA 1ZW6A 1SKYB 221PA 5LB2A 1E2FA 3L43A 2FV8A 4JT2A 1QHHA 3NH9A 4OQMA 3LDAA 2CNWA 1UBGA 4PAOA 1G9XA 1D6JA 2X2FA 3UMSA 4Q4JA 4HLUA 2FFAA 2F1JA 4IOMA 3WMEA 2CBZA 3DMNA 1WE2A 1PLLA 1JEEA 4B3FX 2JGNA 1NG9A 3A36A 3RS3A 2ZETA 4FXPA 4OHWA 4EPWA 5KYKA 4TSFA 4KSBA 3AKEA 4ITRC 2ZRMA 4DT1A 2O8CB 4ZCMA 3AQ4A 1S96A 2GZDA 1AKYA 2JA1A 2YC4C 2CVFA 2VSXA 2ZPTX 4JL8A 2QAGC 1N6NA 3BD9A 4Z8YA 2YWHA 1CJMA 1HEIA 2WMNB 2ZU6A 4LYFA 3J81k 1AZTA 4D2IA 4PR0A 5DH9A 2DCUA 2ZJBA 2AD5A 3BXZA 2R6AA 1FNMA 3OAAD 4C4PA 2NPFA 2XZLA 4TL6A 4ZCLA 3B1WA 4ACAA 2P5TB 5JBQA 1TX4B 1MH1A 4M4SA 5HPYB 5EXTA 1MR3F 3W8RA 1IM2A 2DFLA 3LFUA 4TLAA 2YWGA 4S35A 4LI0A 3GLFB 2MSEB 2H17A 4ESVA 1T5LA 1CU1A 2HUPA 5FOVA 1AJEA 3S1AB 4ZDKA 4NCHA 2P5SA 4KHZA 1ZD1A 1VDZA 2IF0A 4TYYA 1E2EA 1ZUIA 4ZCIA 3HPQA 2ZEJA 1CJTC 3HYTA 3KUCA 4I99A 4M1SA 1ZM4A 4MGIR 4TTQA 4WXRA 1G3RA 1YR9A 4AG6A 2A7QA 2CHVA 4B48A 2JLVA 3LVQE 1IBRA 1LTQA 1OJLA 5KUTA 3B1XA 2IX3A 2JJ1D 5IF9A 1D5CA 1GUAA 3S1AA 2BVNA 2FFQA 3NEYA 1V5WA 2EFHB 4BE7B 2WICA 2FNAA 4HLDA 1E79D 5EJEA 2OFXA 1QHGA 4TZ6A 4MKHA 3BB1A 3CRMA 2IXEA 4QBIA 4PPNA 1VYTA 3BAFA 3B8HA 4LCBA 2QA5A 5FPSA 3RRZA 4ZKDA 1OH7A 3UIEA 3CX6A 4MGYR 5EP4A 3RS2A 2KI5A 2WM9B 1IOZA 1GOTA 2J41A 3NHAA 2W0SA 3T34A 3QI2A 4KLNA 1I2MA 3ZYCA 4TMWA 3IIMA 1II8A 1YZGA 1Z28A 5FL7D 4LPKA 1KZ7B 5M04A 2P2LA 4QBHA 1WP9A 3TSZA 3N70A 1BKDR 4EIWA 3RLFA 1SHZA 5E95A 2IYVA 4Q9IA 2EYUA 1OH5A 4P32A 2N1BA 2WKRA 3R20A 3KL4A 4K46A 5FTKA 3FMOB 4YMTA 2LKCA 1FPMA 1GILA 2ZUCA 3OIWA 2OLJA 2REXB 1VIYA 1HE8B 1LY1A 5EZ6B 3CNOA 4E07A 3K70C 1HQYE 2W2VA 3GLHB 4B33A 3B1ZA 2K5UA 2P6NA 2BKUA 1EFRD 1ZINA 3NHBA 1SQ5A 1PV4A 1KK3A 5FTJA 1ZNWA 2IYYA 2ODWA 4Q4AA 1N0VC 4CRWB 3ND8A 2D7DA 3MWJA 4MH0R 5L3RA 2GJSA 3R9IA 4DCUA 3D8BA 1N5IA 4N0DA 3MWKA 3RS5A 4C0BA 2IWRA 3LXXA 1CRQA 5GJWC 5KSOA 2A9KA 4TL7A 3QKRB 5EZ5A 3CWQA 1U98A 2GK7A 2RGGA 2O8BB 2PH1A 5KNCA 2G77B 4C2TA 1IN6A 1YKSA 3WY9A 1F60A 1T4GA 4DWJA 4RJLA 3SC3A 1W0KA 1K6MA 2ZI5A 2O0HA 5DN6D 5FBWB 1T3LA 5BYKA 3ZS8A 1OXTA 1IY2A 4DUGD 3PJRA 4D26A 2JLWA 1DOAA 5J4HA 1ZC3A 4TMTA 1VHTA 3PUVA 1XBTA 1F5NA 2IBMA 4DC9A 5TMPA 4PZZA 1TL7C 3QKRA 4QL3A 5KNDA 1FMLA 3VR6A 1E0KA 2O8BA 1XPUA 4XD7D 1G5PA 2ZRDA 4BFWA 4TQUS 4CZ2A 5K8UA 1KI7A 3GJ8A 4BUJA 3GPLA 3D3QA 4FWIB 4L15A 2ATVA 4DDVA 3SBDA 3DHWC 3C15C 2ZI6A 3IHLA 4A2WA 1ZP6A 2ZUDA 3A58B 2AKAB 4OK5A 1NKTA 2BJVA 1Z8FA 3U3MA 2FE4A 1NN3A 4OJKA 1FTNA 2H16A 3RHFA 3IQXA 5GJVC 4PZYA 4Y0VA 1LF5A 3AUXA 3H2YA 5LDDC 1E0AA 4A0HA 4W5HA 2XAUA 4OKSA 1SZPA 1W46A 4IKEA 4BFXA 4GP7A 2CE7A 4P4SB 3T5DA 4CEJB 3R7WB 4DLVA 1OF1A 3FPAA 3SU8A 2FDCA 3CNNA 3WNCA 1KSGA 3TKLA 1T91A 2JLQA 3EPKA 4DJTA 4FCVA 1AGRA 3AVPA 3K9HA 2WSSA 3CWZA 2C9CA 2Z83A 2PCLA 2W6JA 3R8FA 4JLDA 4RZUA 2VP4A 4IEIA 1W4CA 4DSOA 1N6LA 3LWNA 4P4SA 4CEJA 2B21A 3MCAA 1GWNA 3AH8A 3U61B 1X1SA 2BMFA 3SQWA 2YOGA 4W9MC 2C9OA 3R9XA 2A3RA 3B1VA 5L8VA 4F92B 4XOIA 3IGFA 2VIIA 4QXAA 4XVRA 1E2JA 3QG1A 1CR4A 4I1SA 2QPAA 4UXHA 4IVRA 1XCGB 2I4IA 4L4UA 4Q03A 5E7MA 4P0TA 4EAQA 2ZI4A 2YHSA 3V4FA 4GBMA 2VQSA 3I73A 2FMXA 1RVDA 4LGMA 2ZYVX 4KFUA 621PA 4R2IA 4B73A 2QMEA 3QE0A 1GL7A 4JLNA 421PA 1Z2AA 4GRAA 3ZVRA 2HYDA 5GADl 2JCSA 5J4LA 3L2OB 2CJWA 4MITA 4UJ5A 2A5DA 2AXPA 2C95A 4EQ6B 3K70B 4QHTA 1LV7A 4YXWA 2X77A 4GL2A 4NE2A 1HA3A 4CT4B 2ZRGA 4ZDWA 4TMVA 3U44A 3ZIAD 4TMZA 2GTPA 4DVGA 3ICQB 2QM7A 5AK0A 4HUQB 1IONA 2XEXA 4ZDJA 5AR1A 3P4YA 2RGXA 3ZZ0A 1ONBA 1N0WA 2WWIA 4Q5IA 3BFXA 2R6FA 2IUUA 4GZMA 1TU4A 4ESHA 3GLGA 3EC2A 4NCKA 4PQYA 4V0MA 1YZTA 4RKEA 1WA5A 3TMKA 1GP2A 1S1MA 3QBTA 2CVHA 4KYIB 1BMFA 2F3RA 4JLKA 3FE2A 4B3CA 4BLQA 2VF7A 4I4LA 1UBEA 1Z0JA 2JDIA 2Q9BA 4W5JA 2QPTA 1OFUX 2G1JA 3KXIA 4XIGS 4HUQA 1FP6A 1Y63A 4Q1EA 4BGDA 1SVWA 1AM4D 4GOKA 1OYYA 3LVRE 1K8RA 4GMXA 2AWOA 4Q1FA 2NOAA 2UZIR 4IDQA 4LUCA 2RGNC 4JL5A 3U60B 2GVDC 1OKKD 2Q6TA 2FEOA 2WOOA 1II9A 3QPVA 2IW3A 2P67A 1P3JA 4LC0A 4D0LB 1NN0A 3X1YA 2MSCB 3ZQJA 1KSHA 4IFBA 1TMKA 4UNPA 4HDQB 1EGAA 1FOEB 1W0KD 1S4QA 2F43B 4RY2A 3RYTC 1HE1C 3AF3A 4ARZB 2YJTD 2EWWA 3O8BA 4AY2A 2PZFA 2JATA 4A0RA 1OH6A 3W5JA 4ASUA 1R8SA 2BIFA 4Q7MB 2OXRA 1KK1A 3PV0A 2A5YB 5FBQB 1NKSA 3BH0A 4OHVA 2G6BA 4V0NA 2IXGA 1U99A 3QJYA 1CEEA 4MGKR 2F43A 1KO7A 1DAIA 2NGRA 1KI6B 2CLCX 2CK3A 3X1DA 2O8DB 2RGCA 3BC1A 3CF0A 4NYIR 1U9IA 4JLMA 4NYJR 1DAHA 4JYBA 5J47A 5SZIA 4G5RA 1ZU4A 3GLGE 5JEEA 1SKQA 4IVQA 3ADDA 3X1ZA 2F9LA 2J9RA 1ZM3A 1BYUA 3L0PA 1XD2B 1KO4A 2ODEA 1KI6A 3KFXA 3Q9LA 3QBVA 2O8DA 2WIAA 2YWEA 1JEDA 1Q57A 4B71A 4XTRA 3U5ZB 2BM1A 3IEUA 4OI0A 2IWHA 3FB4A 5B64A 4NL4H 1CP2A 1KAOA 3T1OA 1XMJA 2GXSA 2G9NA 5CDFE 1XD2A 1P2TA 3CPEA 4F4JA 3PQCA 3T5GA 1CTQA 2QSYA 1H8HD 4PPQA 2GESA 2HLDA 2QP4A 2ZS9A 3NH6A 3WXMA 5FTNA 4QJ4A 2ZAMA 4JLPA 1KYIA 5CJ2A 5FR2A 4O3MA 3PR1A 5DSZA 1VG1A 5E7JA 4OK3A 1W2GA 3KKNA 4OQXA 3KB1A 2ZJ5A 5SZKB 4EFNA 2VP6A 3CO5A 3BH6A 1XCMA 4CGZA 2FPKA 4HB2A 4DCNA 3MAAC 2ZJZA 3WYFA 4Q1DA 4QGFA 1E0JA 2CE2X 3GEIA 3P26A 2XSZA 2OAQ1 2GNOA 2EYQA 4PPFA 3GEHA 5JS8A 3ZD7A 2WWHA 1NVUQ 1W4AA 3WYAA 5AJZA 3ASZA 3CF6R 1KMQA 4UJ3A 5J40A 5F9FA 5DI3B 2QROA 3AKDA 4OBEA 4JJKA 1HV8A 1EESA 4POAA 1D9ZA 2LWIA 3WMFA 5TXGA 2W58A 1OPXA 5AWFC 5EE5B 1KHTA 1CXZA 1KY2A 3THXB 3QXXA 1ZMXA 3W3ZB 1OT3A 2VP9A 4LBWA 1P5ZB 2GF0A 3LA6A 4JMPA 4PSKA 3LW7A 4KI0A 4Z51A 2J0VA 3AM1A 3OHMA 2ZITA 4DLRA 5DGXA 3REFA 5DI3A 4LPSA 2OEPA 3TVDA 1UDWA 1WQ1R 1RRFA 3ICEA 2G1KA 2QGZA 4L5BA 4MDEA 4MRRA 1G20E 2QTFA 4GFDA 4LYJA 4KYUA 3KZ1E 4AIIA 1W0JA 2YOHA 5B2ZA 3GP8A 3OAAA 4A36A 4QJ5A 1J70A 5D3MB 5G41A 3RRNA 1II0A 3K70D 1Z6AA 5FOXA 1XPOA 1XXHB 4RD3A 3QKTA 2WPDD 1MOZA 5KO2A 2J3EA 4LHYA 1KDRA 2DPXA 2BKEA 1GFIA 1P62B 3I4LA 1A7JA 3PVSA 2WKQA 3OEHA 3PEWA 1VCOA 4Q1CA 4JIMA 4II7A 5CB8A 1E96A 1GNRA 1WDTA 1P9NA 4GSYA 3TRFA 4DBLC 1QHYA 1JB1A 2IYRA 5D3MA 2CL0X 1Z83A 3W9YA 2A5JA 2WJYA 4LSGA 2FSIA 2D62A 4P4UA 1NNEA 1CLUA 1NL3A 2W6ID 1KK0A 1G8PA 3WNBA 3KJIA 2QNRA 4RCZA 4FD2A 1F3OA 1F2TB 2ZRHA 3A8TA 4DEYA 5F9HA 4Q1BA 3SYKA 1BYIA 3L82B 4HI0E 2JJ1A 3HU1A 1DVRA 3A4NA 1K5DA 4TLDA 3B60A 3Q72A 1I4LD 4FWTA 3T61A 2Z6VA 3HR8A 3MFYA 3I3SR 2YWFA 4HB0A 4W5WA 1XB2A 4HAYA 2ZIAA 3PEVA 1NMXA 4NYIQ 1I4DD 2R6GA 4B6FA 1E2QA 3LY5A 2A5GA 1XMVA 4NZYA 4NYJQ 3RAPR 4BLPA 4C0SA 5DNYB 4URYR 1F2TA 2Q3FA 2D2EA 1JQJC 3ASYA 4IOKA 4ASUD 4OI2A 3RWMB 4UNRA 2QU8A 3ADBA 2VP2A 3FKSD 4L9WA 1G7RA 4TMXA 1QVRA 3DEFA 5JJKA 2HXSA 1UBCA 1JJVA 2YINC 5IT5A 3I5XA 5AJWA 1VTKA 2H57A 3F3YA 1G17A 3OF5A 5JSZB 2N42A 3KXLA 3IIKA 4DSUA 5FL7A 1D2EA 2GJKA 1JECA 4MYHA 4NBSA 5EXSA 3PIRA 2HJVA 3T12A 4FMCB 1W49A 5FUXA 1NIPA 2ZSDA 3A1UA 1TADA 2IUSA 1XTKA 5JZVA 2XXAB 1GKYA 4ZO4A 1JXOA 1NJFA 3C5HA 5FPHA 4JVLA 2OCPA 4KXFB 2OCAA 4A8JC 2QTVB 4ABYA 5JSZA 3KQHA 3VKGA 3VR4A 1FP7A 2CHQA 1H8ED 1KSFX 2H92A 4IXMA 2QRZA 3K9LA 2RHDA 3U3KA 4B74A 4HAZA 1VKJA 4WOPA 4YLGA 4CIDA 1TPZA 4TQAA 3P32A 3IUYA 1SVOA 3TVTA 4BFUA 2B6HA 3LNCA 2ZI9A 4HAXA 1ZCBA 3ZZUA 3TSOA 4JT4A 4UQOA 3BFVA 3GJ4A 1NN5A 4F4IA 3TQFA 4RZ3A 2ONKA 4E5UA 3UWOA 1OYWA 3MLEA 4DDUA 2B7BA 4MUAA 2XB2A 4AD8A 3REGA 2GAAA 2V7QD 2PLFA 4US2R 4TWZA 1EFHA 1XDBA 1WF3A 2GXUA 1JR3D 3O8DA 4DUGA 1E1RD 1OXSC 1K5GA 1FX0A 2ZS7A 5LPNA 1R5OA 3LX5A 4KFRA 2WAYA 3P4XA 1J7KA 3HDTA 4QJ3A 1N0UA 1PUIA 2ANCA 4XD7A 2C99A 1Z0FA 5H68A 1UPTA 4KU4A 5CK4A 3U6BA 2VSOA 4QOSA 3UMRA 4Q47A 2WIBA 4PZLA 3GJXC 4YQFA 4JLJA 4XH9B 3LBNA 5JECA 4N0EA 3NBXX 721PA 3QF4B 4AK9A 3THYB 2KBFA 2ZSEA 2IUTA 4LC1A 4BRWA 3THWA 1G4UR 1JAHA 5CITA 3UG7A 2R8RA 3FOZA 2BC9A 4FI3C 2VO1A 1OHHA 1M7HA 3HR7A 3AKCA 3K1JA 3OFND 3GJ0A 1G4AE 2OAP1 2VA8A 4KFSA 1GNQA 1RJ9B 1KY3A 1T8UA 1W0JD 4NHOA 1TEXA 3DZ8A 3QF4A 4MKIA 3WRYC 4XVQA 3KQNA 3THYA 1KDPA 3NWJA 4O2LA 4NP6A 2ZRNA 2AWNA 1OIXA 2O8CA 3EPHA 3W90A 4M21A 3GJ5A 3GQBA 2GCPA 2A30A 4FMCF 4HATA 4Q18A 5CYPA 3ZVLA 1WRBA 1ZM2A 2C98A 2EW1A 4OQLA 3HPRA 1QHIA 3THOA 1RPZA 3U7GA 3OEHD 1Z0AA 2W0MA 2ZYUX 4C0AC 4EPTA 3CRRA 3L0OA 1LS6A 1RJ9A 4A2PA 2ECKA 4PHFA 4B76A 4FMBB 4C30A 3FHCB 2O8EB 2X2EA 5B57C 3C14C 1GRRA 4BEBA 1DAFA 2NTYC 2YC2C 3W6NA 2V1XA 1P61B 4DLUA 3ND9A 2GBLC 3KKQA 4G5OA 1T3SA 2JEOA 1VPLA 4DHEA 3K0AB 2XJ9A 3VHLB 1BO6A 3GLFA 3LQRA 1S2MA 2QN6A 1XZQA 4A0GA 3W8NA 1W5SA 1KI9A 1YR8A 5KTYA 2QPOA 2O8EA 1HT1E 2O8FB 1KI2A 1XD9A 4Q02A 5GVSA 1E69A 1V43A 4B2LA 1E32A 1GITA 4PSAA 3TNFA 3K0AA 4H1UA 4G1UC 4QGAA 3ONWA 5DI9A 2IS1A 2BDTA 4GOXA 1KSJA 2AXNA 3GFOA 2ZJYA 2DBYA 4QHSA 4URWR 2PEYA 5FL3A 3TAUA 4WZ6A 1SKYE 5TDHA 2ZR7A 3KXKA 4DB4A 2O8FA 3L0SA 2FPLA 1X6VA 3TLXA 1UBFA 1KJZA 3ZIAA 4BFSA 1H65A 3C7KA 3IPYA 1KZGB 5IK2D 3CRVA 1O87A 4OQFA 3KTAB 3QY0A 1FMJA 1G5TA 1GM5A 3LW8A 2PZGA 4DRZA 4AYWA 5FI1B 4Z1MA 121PA 1XF9A 2WWWA 1W4BA 2BMDA 2XITA 4D6PA 1G8GA 2BBSA 4TQ9A 2IYTA 3K53A 3CNLA 2RHMA 2CCKA 3LO5A 2EFDB 2J5XA 1EG7A 2OT3B 2HT6A 2RGAA 2J0SA 2C03A 4LV8B 2GCNA 2ZQ5A 4ZIRB 1UDXA 1W36C 1CR1A 5SZHB 2FGJA 1GKUB 3KTAA 3F5FA 3B78A 3N2IA 1EFTA 3LRPA 1J2JA 4NONA 3M1IA 2ONJA 2GXAA 2VP0A 3B9PA 3QENA 4O25A 2WOJA 3JZMA 5FOWA 2RGDA 2IS4A 1A4RA 2FZLA 5C46F 1OKKA 2PL3A 1UKZA 3DOFA 2NZJA 4MQBA 3GLFE 3AF1A 1E2HA 3VU9B 1D8TA 5FOUA 2WJIA 2F6RA 4TTPA 4F4CA 2ZE8A 3GLHA 2XNSA 3RS7A 3ZVNA 2GKSA 5EQTA 3RS0A 3AF4A 4XSHA 2W83A 4URVR 2DWQA 4US1R 1D9XA 5CLLA 3MWYW 3TBKA 4NCNA 4D82A 3E70C 3AVWA 1IJEA 1F2UB 5KSZA 1E3MA 5A5GA 1NY5A 4M1TA 2BEJA 3MD0A 1JJ7A 5EUMA 3P27A 2Z4SA 2N46A 2J7PD 3D6TB 1QBKC 2QAGB 2CMKA 2Z4RA 1US8B 3VU9A 1DELA 1TNDA 4FCWA 5C18A 1PLKA 2ZVQX 2OILA 4M1OA 1WMSA 2XX3A 2FF7A 1T8TA 2QP9X 1F48A 4US0R 3EA5A 2FWRA 4RKFA 2FPMA 1F2UA 3IILA 3C8UA 1DG1G 4NYMR 3BE4A 4YMWA 1NBMD 3OZXA 4JSTA 3EZFA 1W2HA 5F2EA 2QMOA 2ORIA 4R71A 2OLKA 3EC1A 4AYTA 5FPYA 2QAGA 1US8A 5TVKA 5JWRA 1KI1A 2EVWX 4EFMA 3W3AA 4C0LA 5IRCD 5HTKA 3C41J 2AFIE 6Q21A 1MO6A 1A82A 1OHHD 3SI7A 1F6BA 5FTMA 1SVKA 1G21E 4HAUA 1TUEA 3QSYA 2AK2A 4DXAA 2CCGA 4KITB 2VHQA 1P4SA 3I92A 3QEOA 1ZNXA 4NU0A 3OESA 1OE0A 1U81A 2FSGA 5CLQA 2EFGA 2VP5A 5EE3A 4HB4A 1KOFA 3K0FB 2CLSA 3CONA 4X8HA 2W2TA 2NZ8A 2OUKA 4TT3A 2ZXUA 2R6CA 4LJ7A 3GLIB 2GJAA 1N6HA 2GZHA 2QI9C 1M34E 2RAPA 5KDDA 2CXXA 5KDOA 1H8HA 1XEXB 2GBLA 4K81B 1AA9A 3GLHE 2NPIA 3R7WA 3L0IB 2ZE5A 3RRYA 4LYHA 4F7WA 2FH5B 3EW9A 5J4KA 5L3VA 3CR7A 1XCPA 3ZGXA 2PCJA 1QG4A 2ZJOA 4NTZA 1Z08A 3K0FA 2WWYA 1TAGA 5CM8B 1DS6A 3TH5A 1VG9B 4MRPA 1QVAA 4JBXA 4OHZA 4M9QA 1XEXA 3CPHA 1P60A 5IHPA 1R5BA 2G83A 2P6RA 1MRNA 3K0CC 5FI0B 4IXNA 4CEIB 4DLXA 4U7DA 2FOLA 1OFIA 2CHGA 3FHOA 2ZYTX 1Q1QA 5B30A 3U3OA 3RC3A 1EX6A 1JPNA 2O0JA 3ADCA 2KJQA 2RGEA 4EJSC 3T35A 3SDZA 1TQ6A 1YVDA 1YJ5A 3QKSB 1KO1A 1D2MA 1DTSA 4HAWA 3SJAA 4G01B 1W36B 1E4VA 2R9VA 1CKEA 1G41A 4QBGB 5DHAA 3SJCA 4N1AA 4CEIA 4YONB 4DEXA 5HCIA 1IAQA 1FUUA 2OHFA 3PENA 4M9SA 4UXIA 4JVSB 3UATA 3WRXC 1HURA 1OSNA 1TF5A 2ZU0C 2GEDA 3NBZC 2ZROA 4LJ6A 1W7AA 1NY6A 1DADA 1P9RA 3W6OA 4OI4A 4D0NA 3ZDQA 1NMYA 3NEJA 2L0XA 1BIFA 4JSYA 4B2IA 4CT5A 5EE1A 2X8AA 2BMEA 3HU2A 1DBSA 2IS2A 4PANA 5JMTA 2BV3A 1Z06A 2GK6A 1COWD 2F9MA 3BB3A 4JJZA 4QNMA 3VFDA 4EQ6A 1OFHA 2VYFA 4Z1MD 1Z6TA 2R2AA 5HCNA 1P2SA 2WPDA 3AVTA 2WZQA 2V3CC 4LHXA 2J7KA 1AKEA 1N5JA 4MYUA 3KJHA 4LJ4A 3QPUA 2NMVA 1HT2E 1KJYA 1E2PA 1MO4A 1LF0A 1N5LA 3EAQA 4NMMA 3CBQA 5FUWA 4XWKA 1ZUHA 4F38A 4KVAA 1G3UA 2AKYA 3BFKA 3SHWA 2D3WA 3NG1A 1OFTA 2R62A 1IXZA 2W6IA 3FGNA 2NIPA 4C0QC 3T1QA 1E9FA 2IYSA 3AP2A 1GSIA 2I1VB 4Q19A 5FPTA 1VHLA 3TUZC 2XZOA 4PC2A 2GVZC 2F1IA 1JAIA 5KSYA 4NYMQ 3BERA 4RZXA 1Z0KA 2GILA 4A4DA 1CULC 3KQLA 1R4AA 5EP2A 1E1QD 3Q5DA 4C3ZA 3AKYA 3P20A 4IEEA 1S9HA 1ESMA 2GEVA 3MGCA 2R6DA 4XSGA 1WCV1 1M8PA 2JLUA 4B2PA 3FKSA 2P6UA 1NVVR 1I4TD 4D80A 4XJXA 4A6PA 3QXCA 4JS0A 4PO1A 4D4LA 3AVUA 521PA 2ZRLA 3NDPA 5FBVB 1SXJC 2IYZA 4HZIA 5BN5A 1Z6XA 1Q44A 2OFOA 1IN4A 4FMDB 4IOJA 4ARZA 1LW7A 4PSVA 4V0LA 3GD7A 5TB5A 4UNNA 2ORVA 4JKIA 1GRQA 2FJUA 3EZ6A 1FNNA 5A4JA 2GHIA 8OHMA 3EA0A 2G0TA 1FUKA 3F0TA 4B3BA 2QQ0A 4OK6A 1BH2A 1Z2CA 3UPUA 1SVMA 2F7SA 2W00A 2WWGA 4DCSA 4M1MA 3UXMA 4V0ME 4IVPA 2HCBA 3JZAA 2QT0A 3I1FA 2KB0A 1J90A 1W4RA 2QG6A 2XTMA 1IN5A 1ZRHA 5BYJA 3IO5A 4A1FA 4YMUA 4PPGA 1AS2A 3GEEA 5BWMA 1YZLA 1YRBA 5HKKD 3SBEA 1H8EA 4EPRA 2HF9A 2SHKA 1RFLA 5BN4A 3WBJA 1J99A 3PUWA 2ZVPX 3C5CA 2VPPA 3RDPA 3V4RA 4A92A 2JLSA 3RS4A 3EIEA 3M4YA 1UM8A 2E1RA 3AP3A 4IHQA 4Q9HA 2J46A 2ODNA 4ACBA 3GJ7A 2EFCB 1OIWA 1SHKA 3O8RA 4TT3D 4QKQA 4CEHB 2NG1A 3CM0A 2OBNA 4DSNA 3N5CA 5KNBA 4RCYA 2KBEA 2FZ4A 5GVRA 1Q20A 1ZVQA 5D3QA 4XVUA 1E9DA 1YU9A 4BLOA 2RKOA 3I62A 2JJ8A 3PUZA 4A82A 2QGNA 1VCNA 2V7QA 5FOTA 2J87A 4P31A 4B3DA 5JHHB 5F98A 3F8TA 4Q48A 3U7HB 4BEJA 1JR3A 1E1RA 3B85A 3KJGA 1OLOA 4TLBA 2WJGA 1KNXA 2WTUA 2XB4A 4CEHA 2C8VA 4D0GA 1RIFA 2RH5A 2WVJA 2CEAA 2PT7A 3LH5A 4G5SA 2GXQA 3O8CA 2QMUA 2J59A 3AF2A 3VR2A 2KE5A 4RFSB 3SJZA 5KU1A 5HZKA 3JVVA 3A1SA 4R9UC 4PFSA 1CBUA 2DWOA 3AGQA 5DLQC 2B7CA 2A5FA 3VX4A 1KK2A 3EIHA 3IO3A 4DLZA 4UNQA 5AUOB 3ZS9A 1M1YE 2VRWA 2GF9A 1S8FA 1DO2A 4BZQA 2QENA 3V00A 2FFHA 5DYIA 1UKVY 3EZ2A 3FFBA 3QQ5A 2IT1A 4M2LA 4RFSA 5JLJA 4JZKA 3PEYA 2BEKA 4X8LA 3TR5A 1YZUA 1G291 4G5QA 1NG1A 1CRPA 1CR2A 4KLZA 1R0ZA 4A9AA 2Y8EA 4LK2A 4B6EA 2G88A 2OZEA 4M1YA 4KV9A 3OFNA 2J0QA 4ZV4A 4R98A 3BJIC 1OB2A 4HAVA 2QY9A 1KDTA 4LWZA 1DARA 3VKHA 2REBA 3EIQA 4Q66C 2ZTSA 3CB4A 3THXA 1P73A 3CX7A 1W36D 4ZKEA 3NTUA 5KPDA 2OBLA 5DO9A 4P33A 4AKGA 1LVGA 2OCBA 1JBKA 1Q0UA 4LBZA 1I2DA 2ZRPA 1QG2A 1D2NA 4TYNA 1U0LA 4HLUC 4CF7A 4B35A 1VCMA 5AUPB 2HV8A 1GL9B 4BASA 1NLFA 2DYKA 4UKDA 1RE0A 2RGNA 3OEED 4GI7A 5DE3A 1S9DA 3Q7PA 2QP3A 2J0UB 3EZ9A 3RWOA 5FTLA 1UADA 5JFGA 2PBRA 4HUTA 1WB9A 1AS0A 3A4MA 3M6AA 1G3MA 3MWLA 1Z07A 1ANKA 1JR3E 2Q3HA 2QL6A 3MRSA 1XXHA 3T15A 4HB3A 3QUSA 5HZHA 5J4YA 3IEVA 1M6NA 1R0WA 4JLOA 1SXJB 2B8WA 4PC7A 1Q3HA 4TN1A 1NIJA 1UF9A 2QM8A 5H70A 3SJBA 4LV5B 2D2FA 2VTKA 4OI1A 2IC5A 1JALA 3NXSA 4B43A 1NVVQ 1ODFA 2VHUA 1X8JA 3E2IA 3K9GA 4AKHA 1ZJ6A 1XMIA 2REOA 1S1CA 2PLRA 3DPUA 3TW8B 5EP3A 1Q1BA 1C1YA 4JVNA 2WBLC 3AGPA 1P72A 1Z63A 1G3QA 3B2EA 4Q9LA 4Q7JB 5GJCA 2G0NA 3KFVA 4G0NA 2OBMA 1G7CA 5E4FA 2ZUBA 1JNYA 5CM9C 4YDHB 4AYXA 4M8NE 4M53A 3DDCA 1XPRA 5E3HA 2V4ZA 4PQRA 4DB2A 1NLZA 1NMZA 1XNJA 4LOAA 1RZ3A 3LBIA 1ETUA 2AL7A 1NN1A 3DL0A 1JPJA 2B8TA 5G53C 2FA9A 3I72A 2ZS8A 5IK2A 4WVFA 1P7CA 4JKYA 3KKOA 1CS4C 2IF2A 1EFCA 3PUYA 3EARA 1RYHA 1Z6YA 1ZAKA 1XX6A 3FMFA 3ZH9B 3ZD6A 3MG9A 2GCOB 3BRWD 3IIJA 3GMTA 4BRUA 2XTZA 1C9KA 2UVQA 3WHKA 1OH8A 2ZAOA 1N25A 3AB3A 3IQWA 2Q21A 5B58C 3QG5A 4UXJA 3DM5A 3C4JA 3IHWA 1U8AA 3GCGA 4QRHA 5KDLA 1FL9A 1JI0A 5JRJA 1TF7A 1IJFA 1M74A 4IJMA 5EE9A 5L3SB 1UAAA 1P6XA 1Q3TA 2HJGA 5JHGB 1DAGA 2PZEA 1RRPA 3CR8A 2IEYA 4BQSA 4KJZA 3MJRA 4V02A 1XXHE 5SZJA 1VYVA 3BK7A 4KODA 2QE7D 2QUZA 3CZQA 1XU4A 2XXAA 1T0JB 4M1WA 1OXUA 1A1VA 1E6CA 1YHNA 4Q4HB 4KBGA 1HQCA 4CVNA 1XFAA 4RD0A 3DZDA 3QIAA 2RMKA 4KVGA 5CK5A 2VH5R 3OIUA 4PXAA 3A6PC 3G0HA 4C0HA 1RRCA 2QRNA 1DPFA 4UNSA 1M7BA 5C2JB 2BCGY 4S2EA 1XJQA 5CB6A 4TYWA 4HDCA 4DLSA 3U2QA 4CYMA 4YMSA 3IDQA 2J7PA 3CW2A 5H8WA 1WBDA 2VHJA 1R2QA 3UG6A 4Q4HA 4DIDA 2JLYA 4BPBA 2JLZA 4NH0A 1N2CE 4RD4A 1HUQA 1Q22A 1X1RA 2QSZA 3C16C 3CLVA 4F93B 4PHTA 4YDSA 3ZJYA 3L8YA 1IQPA 3AVOA 1KNQA 1Z5ZA 1X8KA 1NBMA 4RFVA 2QORA 3FYHA 1G19A 3WP1B 4ZI3A 3SNHA 1IXRC 3EWSA 1JXMA 4A2QA 2G3YA 3TSWA 3FFAA 4I1UA 3GFPA 2RCNA 4BFZA 1R0XA 2V8OA 3NC1C 3AV0B 4JYCA 4DT1B 2C9YA 3GJ3A 4MUBA 4PO9A 3NIBA 3SHFA 3UKDA 3W5IA 4F91B 2KSQA 1HH4A 2F3TA 4B44A 2ZRKA 1DAMA 2RB4A 1U0HC 4Q01A 1M7GA 1N6IA 5K8IA 5CYOA 1TF2A 3VMFA 1EWQA 1TUIA 1A2BA 1GIAA 1VG8A 1ZM7A 2DR3A 4DLTA 3KX2A 1U94A 1NVWQ 1ZBDA 1MO5A 2ZREA 1KGDA 3CZPA 4TYPA 1TQ2A 2H1LA 2Q0HA 4TLEA 1E9CA 5FR1A 4Q7KA 2V6JA 1T9HA 1XRJA 2GJ8A 1WXQA 4I1VA 1R8QA 1NRJB 4O2RA 5G3YA 2QBYB 3IKJA 4BZPA 1XJCA 1FTSA 5A0FA 2GEUA 1TEVA 3AVXA 3FWYA 5AJVB 1GTVA 1SVIA 2OE2A 4AI6A 2FFBA 1E2IA 1TQDA 3OE7A 2ERYA 2FU5C 3QPWA 3A4LA 3KUDA 3RABA 1E9EA 5JRZA 4L9SA 2YYZA 2QBYA 4FCTA 3SN6A 4AURA 1HTWA 1OW3B 2IYQA 5HR5A 3V9PA 3DKPA 1YE8A 4IRUB 2YZ2A 1DAKA 1GL6A 2ODBA 2GZAA 1XTIA 1Z3IX 2PMKA 3B6EA 4LJ8A 4WAUA 4RZ2A 4BFYA 2YNMA 3B9QA 4MRVA 3BB4A 2AR7A 3B7GA 5DYGA 3FKQA 1NBME 4IOLA 4QBFA 3WMGA 3CX8A 2C2HA 2OO7A 1SXJD 2DFNA 3B5JA 3I8SA 1Q21A 2XOKA 4EUNA 4MDFA 2Q3MA 3OIYA 2WSMA 1G8FA 2ZRFA 3LQQA 3Q85A 2IK8A 2X1VA 5AUNB 4A8JB 3JVUA 4AC9A 1L8QA 1ESNA 4BECA 4PAMA 3QXJA 4ZI2A 4AWXA 3PITA 1KO5A 5FFMA 2OV2A 3BORA 4M0LA 1N6OA 3U4QB 2HT1A 3VR1A 3TGPA 1R7RA 5EXXA 1QF9A 1YZQA 1X86B 4DSTA 4LBYA 4EDHA 3AVVA 5EE0A 1VMAA 1II8B 1E98A 2ZI7A 2RGBA 1KDOA 3G82C 1IHUA 1RYFA 3H4MA 1Z6GA 2HXYA 4FN5A 4MYTA 4DCTA 4A8JA 3RSOA 5L3QB 1COWA 1Z0IA 4OJQA 5FBRB 4N3NA 3RANA 2BBOA 2J1LA 2IYXA 5AUQA 2F1RA 4Q9KA 3DOEA 3HYRA 3L8ZA 4FW9A 2C78A 3U4QA 4BLSA 4E03A 1W5TA 2TMKA 4AG5A 3GFTA 2HCJB 1Y3AA 4LYAA 2VHCA 4DCVA 3DVLA 1YZNA 2ZYWX 1MO3A 3MSXA 5L3QA 1AQUA 4OQNA 2ZSBA 4Z54A 3NDBB 1AS3A 2I1QA 4Q4AB 4ILEA 4RD1A 3U6KA 3X1WA 2V54A 1FW6A 4WXPA 1XTQA 4NPHA 5EUQB 5JEDA 3HWSA 4JVMA 2Q9CA 4ZIRA 3A1TA 1IN7A 4XWAA 3RSLA 3RC8A 1ZM9A 4GDFA 1TQ4A 5EXPA 3BS4A 3PXGA 3PCRB 1DO0A 5JCPA 3ZZTA 4HZUB 1BOFA 1VECA 1TU3A 4ERNA 5J5CA 5TY0A 4C0KA 1KMHB 2MMGA 3T1TA 4GNKA 2D74A 2V6IA 1VCIA 2JIZD 3PUXA 1E1QA 3TUJC 2R65A 2DHRA 2FG5A 2QZ4A 1OXVA 3A37A 1CJKC 3T1VA 1DG3A 4WZAE 2O5VA 1U8YA 4A0FA 4E09A 4URZR 1ZU5A 4HZUA 1LB1B 4TYQA 4QGGA 1QHNA 4JBYA 4AKEA 1KMHA 4C7OB 1WBBA 5G40A 2C5LA 4A6XA 2DB3A 5JWHA 3LAWA 4LX0A 2XTNA 3LV8A 2P0EA 3SR0A 4QNRA 4EPYA 3EX7C 4LV6A 3ETLA 2DFTA 3CH5A 4PC3A 4U00A 4JLAA 2ZSFA 1DE0A 3QF7A 2XNDD 4BFVA 3CRW1 4OYHA 1AK2A 4JL6A 3VNVA 4RD6A 1E94E 3AP1A 4B75A 2C77A 1YQTA 2E87A 2EU8A 4HLCA 2JJ2A 1M2OB 1UJ2A 2CNWD 2OG2A 1S3SA 3Q8XB 5AJYA 3UWKA 4EFLA 4C7OA 3BOSA 2WV9A 5HKKA 5CIQA 1NJGA 4IDOA 4G3XA 2Z5FA 1UKEA 1B23P 5JS7A 1P2VA 4XTCS 4TL8A 1G7SA 5ANRB 3LBHA
chains in the Genus database with same CATH superfamily
4MQEB 1SD2A 3H84A 1WCIB 3DPSA 4RMIA 1RWOA 4I5DA 4EZIA 3RH0A 1F7VA 5K3FB 2EEPA 4HWPA 2Y77A 4LDNA 5JS1A 4A15A 2QTHA 1M76A 2B1RA 5CAEA 2NO7A 3EF3A 1H69A 1U3FA 4AJJA 4JP8A 3FYTA 3OD5A 2P62A 2O9JA 5FUYA 5GQSA 3PQ5A 1YR3A 3LWDA 2W2XA 3RIMA 5FWXB 3IA7A 4I55A 1OC4A 4RV4A 4I1YA 1BDHA 4QEKA 4MKGA 2AT1A 3FTQA 2XZPA 3O1IC 2X8WA 3G7UA 1UIMA 2FLVA 1VL5A 5CDTA 1UJ4A 2GA8A 3WRWA 2H2GA 3FVQA 4E31A 1NDUA 2X15A 3K9NA 4N0QA 3LX8A 3WMWA 4H9GA 4GX1A 4BNWA 3VO2A 4GP6A 5AVKA 5LVAA 3RIYA 1GPNA 4Z9FA 3DT9A 3X2FA 2YQZA 2PD4A 1QIHA 2AQ8A 2AJBA 3PJGA 4TX1A 4AMUA 4D57A 3ISJA 5IXSA 4MS4B 4BBZA 1MGOA 1UMDB 3P9CA 3LBYA 3IR5A 4P9NA 4WXHA 2WWRA 1NP6A 2XYPA 1UP6A 3ER8A 2CT8A 1AIPA 3IODA 3KR1A 4DR4B 4E7OA 2ICAA 3N9IA 3K09C 5D51S 4CCYA 3PNMA 4GMDA 4PGGA 2ZE6A 1DINA 3ANSA 5EA2A 3X0DA 1LWNA 2CDCA 3VHXA 2XOKD 3GC6A 3ILXA 2PMBA 4JY7A 2WAXA 4KFTA 4A8HA 3INGA 3LYUA 2YWCA 4MKFA 5EQFA 2WG0A 3M6IA 1EG2A 1T5IA 3GHHA 4EYSA 1XMXA 5K3OA 3ZY6A 4D25A 2QRHA 5DHFA 5HKOA 4HSGA 4RPJA 4CL3A 4R7ZA 1G6KA 2LGJA 3EPLA 4DRXA 4H18A 4YRGA 3DDUA 4G0ZA 1GNPA 2BSQA 2XBUA 1T15A 5CGQB 1SN7A 2BEUA 2NQ2C 3M4ZA 5IEJA 4QDZA 3NKVA 5IULC 1SVSA 3C6XA 3HVJA 3RNLA 2RFLA 2IH4A 1EFPA 3CY6A 4ZDIA 1MPTA 1E3TA 1V9LA 4MQFB 4KSCA 5F7JA 2YV5A 4A26A 4KLCA 4I9FA 2EFJA 3F6RA 3HJRA 4HUJA 3K0KA 4I08A 3WGOA 3H7IA 1FRQA 1M0WA 2P91A 5K6AA 2IUFA 1NR1A 4U7PB 3ECCA 3HUUA 2P65A 5BMOA 1W73A 1PNOA 2IA5A 2GF2A 2DTEA 3HU3A 2DF8A 2GDZA 1A9ZA 2EQBA 4MWEA 4KMRA 2MHCA 2AA3A 4MVXA 9MHTA 4N5HX 4YI5A 2F1HA 3LECA 3SS7X 1TFRA 1UXKA 1LLDA 2CL7X 3LCMA 5CJPA 5AHWA 4QWWA 5FBZA 2QJFA 5ALRA 4C3UA 1LNZA 2HDOA 4OB6A 4JLVA 2YQ4A 1NFQA 5JZBA 3HO8A 3T06B 3V3KA 1YBFA 2WF8A 3EFEA 1G1MA 1OLSB 2UYGA 3IBGA 3DM9B 1C9NA 1P7YA 3MGAA 2WG2A 4P84A 4DW8A 1HY3A 1TTTA 3NDRA 3B36A 1U2GC 1TVMA 3NOOA 4NBVA 2I1WA 2X40A 5L45A 1W87A 3E6AA 4NNJA 5DB4A 5GGXA 1VI5A 1RKBA 3T1NA 4QYSA 2AEEA 4CM1A 4O5OA 2ZJAA 3KAKA 3QFHA 1SUCA 1YRAA 3KP1A 4OXKA 3W7BA 1N57A 3CH4B 2VTDA 1YK0A 2D06A 3C85A 3RSCA 5BOSB 4M1KA 4XI9A 5KKCA 1ZD9A 3MJ4A 4GLFA 3DL2A 1SCKA 2FLKA 5C31A 2DBVO 4MMZB 2QRQA 3U3RA 2Y2UA 2O8NA 5CDFA 3WHPA 1KQGA 3D8RA 4NAHA 1ZVJA 4OP1A 3H3JA 1E3WA 2XY4A 4DV7B 2M9MA 1NVXQ 2GK4A 2PSSA 2GZSA 1O57A 2EWVA 5I7OA 5C1BA 1T36A 2I65A 3A1DA 1ULBA 2ZJ0A 3NHLA 1XJWA 3FFXA 1BJTA 2RH8A 4OSOA 2HMUA 3FYUC 4GO1A 3LXRA 3M34A 5E7QA 4E12A 1XDSA 3NU1A 3NAMA 4QGHA 5EL0A 1X7WA 1MABB 2D0OB 2BGJA 1PJRA 1RJGA 1M5TA 2PKYX 3QITA 2VSQA 3B82A 5EHGA 2CLDX 1T0HB 1SGWA 5TE9A 4RETA 4N7BA 1P1KA 4LMPA 4BAGA 2K2QB 3GLSA 4BWYA 2PX0A 4YRKA 1DBIA 3ZH2A 1NDHA 3VR6D 4YRZA 1L5YA 3KLBA 2WD7A 1QCYA 3LD9A 4QOFA 2IYLD 4RGVA 1IWBB 1SBNE 1Z29A 4PG6A 3WLFA 2HCTA 3AUAA 2PE5A 1A95A 3T35A 3Q7RA 4LDJA 2IU6A 2IHYA 4M60A 1GDTA 2BTQB 2WM3A 5FLKA 2PSEA 4M8SA 4QAJA 4E3ZA 5IYZB 4X94A 4J9UE 1OWMA 1VG0B 3DLBA 3ESXA 5EZSA 1LZKA 3GT3A 3ZDZB 3HHPA 1FVOA 1YJ8A 3BXEA 4G36A 3SBOA 3T7SA 4A16A 3PNQA 2W98A 2O52A 1WTAA 4O63O 3PYMA 5FOSA 3V6MA 3IP8A 5JI3E 1MT0A 1KMNA 2WHRA 1U8CB 1X13A 1Z34A 2H7XA 3DTYA 5HE8A 2DHCA 3MM4A 2R7MA 1H23A 3OOJA 4HSEA 2BGLA 2YMPA 4X8MA 1AOXA 1X2EA 2HCRA 2I2DA 1Q1ZA 4QFMA 5BRNA 2A0XA 3IPAA 1IQRA 3N0VA 2EJWA 1M75A 3V8BA 1YZKA 1IM8A 2D2IA 2GCGA 3DG9A 3E8MA 3DBIA 4G97A 2BMJA 2ODQA 3WMRA 4C4OA 5I5EA 2OBXA 2NVOA 3H4VA 4DDTA 1M2FA 3QEKA 4DJJA 5BUCA 4LYYA 5ARBA 3RVBA 1QE0A 4D96A 3GIWA 2E9SA 5DHPA 5LMZA 2RGRA 2JI7A 4UHBA 5JJ5A 1JEQA 3EIWA 2ERXA 4B3XA 3SXUB 2NX2A 1T0PA 3DP9A 3KLPX 2I54A 3TLCA 2UUAB 3FYCA 1V6SA 2ZIFA 2G70A 2JFVA 1VIAA 4I81A 4Q3BA 5ALMA 3N74A 5EWJA 2AK3A 1E0SA 3ONDA 3P2JA 4KDRA 2JFQA 1GNLA 4X45A 1DX6A 1JHYA 1P0FA 2LPMA 3JQ6A 3T0IA 4WLOA 1ZUNB 1KI8A 4WJKB 3BMOA 3K0EA 1JQLB 3A9VA 2G8NA 4J3FA 1DMRA 2VHTA 1DCKA 2UKDA 4J0FA 4Y1EA 3D7NA 4HEJA 4D46A 4C0JA 1AB6A 2DLDA 4DIKA 3H19A 4CWAA 1BN7A 3LHDA 1GKKA 4Z7JA 3WBKA 4TT8A 3WNDA 3H1TA 5A4DA 4KBFA 2P68A 4EB8A 2HFKA 2EFEB 2LKDA 5IH7A 4NCIA 3LLUA 1T8PA 3SZLA 1PR4A 1R66A 1XTVA 1E4YA 2C31A 2H3EA 3P52A 1V2GA 2D0DA 2JHPA 3Q7QA 3PXDA 1ZD8A 3AC0A 4YXWA 4R9VA 4E4RA 2FX3A 5DZSA 3BCUA 5GJBA 2QAJA 5AD1A 1D4OA 4Z8XA 1ULAA 2MMCA 3SJ7A 2C3MA 3B3AA 4PYQA 1Y6JA 3UK6A 2DPGA 1JEAA 1V1RA 4I1IA 3U7EB 4BVJA 4C7BA 2C2BA 5BUQA 4RAOA 4Z9YA 4R05A 1M2VA 2MT9A 3FNIA 4RSGA 3WKBA 3RRMA 5H4GA 1QU3A 3C45A 1YXMA 3IXLA 3NHRA 3ZHBA 2RK3A 1YAHA 3U80A 2X9NA 2QI9F 5DU2A 2TMGA 4YXWD 2BFBB 5CD9A 4LGCA 1QOZA 4JBLA 2DFKB 2A58A 3OE5A 2DT5A 2OVFA 2VEDA 1AQ6A 3LX6A 2Y05A 1GNTA 2X4LA 1TVKA 1GKIA 2WIDA 4EKDA 4CIYA 4Z5XA 4F3TA 3ZV3A 1ELOA 2AJ8A 1FF9A 1S2IA 1ONNA 3IEPA 5A06A 3BF8A 2PNJA 3QKUA 1U0FA 2CYCA 1RQXA 1FQKA 4KOEC 5D85A 1Z12A 3AUJB 5B58T 5IYZF 4JLBA 5UKDA 2X0NA 3F5DA 4LDRA 4GQAA 1SBQA 1PKXA 1XLUA 4KMSA 2IV2X 1JSRA 4C7KA 2D7CA 4DM7A 3PUHA 2P9JA 1XP5A 3FZYA 4YCDA 2C20A 1Z16A 3HC7A 2JDID 3WWPA 3MS2A 3FJ1A 4YRQA 4JBGA 4KO8A 1M1UA 2CFTA 4RLFA 3TUIC 1MOSA 2PL9A 3JZDA 3M0EA 4CKWA 4HRAA 3PIDA 4FB5A 3SM3A 1BHSA 2J0UA 3DNMA 5IG2A 3DO8A 4L07A 1ODJA 5EJIA 1IXSB 3CF4G 3PQ8A 5F9MA 2H0RA 2O0LA 3ZY5A 2QAIA 2H2FA 2XCOA 3GNLA 4ND1A 2Q3DA 2UXCB 4DDMA 5K2OA 1P2DA 1OCEA 3O2NA 1GXSA 5H7XA 1V47A 5LP1A 3GRPA 2O5CA 4MNTA 1SXJA 5F1KA 4PLTA 1DC5A 1HDYA 2P4SA 3L4BA 1L4UA 1FK8A 2JRLA 1YJCA 1C0IA 3SLGA 2D2XA 4IS3A 4AFNA 4NOJA 1BEZA 4DLPA 2IOHA 1F0NA 4L95C 4C6TA 2R1ZA 1E3DA 3TB6A 1Z4QA 4YO7A 1IOLA 3W2TA 1R16A 3DBLA 5K6RA 4M89A 3O1LA 4Z2YA 1R8JA 3HCOA 1LSSA 1G5RA 4MKRA 4AWBA 3A3NA 4G37A 3BK1A 1ZO8A 1BOOA 4JBWA 4MP6A 4CR7A 5CDHA 5NLLA 4GOOD 2WTNA 4EI9A 3T5PA 3GFSA 4H27A 1GCGA 2A0KA 1P9WA 3A9UA 3DAGA 2C04A 1IRIA 2B7LA 3B1YA 4MJLA 821PA 2FEMA 2PQ6A 4TTIA 2GNPA 2I7VA 1MJGA 1L1RA 1Y9EA 3NNDA 4M22A 2FW8A 3DAOA 4WTOA 4XJSA 2KS6A 3IJ5A 2KLBA 5HS6A 4AUEA 4YMVA 1GSHA 3GNSA 2FN4A 1TB4A 2WAAA 1EWRA 5L53A 4YJ2A 4N47A 2ZM5A 2V7PA 1C4OA 3PG5A 2DP4E 1U2RA 4DJ5X 2QLNA 2CK3D 2H7CA 2HQOA 3FNBA 2I4OA 1GGMA 2J48A 4YACA 5C7OO 5ICCA 5JTTA 4I3FA 5JVDF 4MSUA 1XJ5A 4URFA 1ZCZA 1XF1A 4G85A 5FT9A 1N1MA 3TJRA 4R1UA 3SIRA 4BNDA 3KOWA 1G2PA 5FO1A 1Q19A 2CJFA 2WWXA 2BBWA 2MJLA 2QMHA 3DP7A 1UBNA 4HLNA 1OOEA 4H6PA 2VWPA 1C3EA 3TRHA 4M9UA 4QLOA 3VZDA 1NPYA 1RPTA 2QRVB 3OJFA 1YHYA 2VBIA 4L8VA 3ZI7A 1UEIA 2WT9A 1V39A 2ZRAA 2B4QA 3R3SA 1DDOA 4IQ8A 3VAYA 2Q0XA 3CIOA 1N6RA 1T0BA 3TS1A 4WNCA 3UMFA 3WL7A 1ZW1A 3HJNA 4KL8S 5T4EA 3WHLA 1IIBA 3NW9A 4NCBA 3IXQA 5L3SA 1QXSA 5DISB 1VSVA 3VTKA 1G4HA 3H87A 1RAEA 2I4RA 2JANA 3K72B 4LYDA 1J8QA 3RFFA 4BMVA 4LJ9A 1RC0A 1JHUA 2H18A 4IYRA 3M6VA 5JSYA 2FRVA 3DGEC 3WP0A 4K9PA 1SXJE 4UUPA 1OXXK 1ZK2A 2NSHA 4P0PB 2HX1A 1IBLB 1BXGA 5CXXA 4GUAA 3G88A 5JNVA 3OC0A 2D5IA 3KKPA 1S0UA 3AI3A 1AZSC 2Z9CA 4NOKA 3FHLA 4F1KA 3HB4X 1NVEA 1CR0A 2EW2A 4N9WA 1RM0A 3FJOA 1OI2A 3QMWA 4HG2A 1I2ZA 3OU6A 4KYTA 2A1TR 2Q4OA 4MVJM 1HYGA 3QXSA 1QHHB 4FYVA 5DN6A 2GYYA 4M1QA 3SIPA 4EELA 3ESRA 3F98A 1T6ZA 4L1KA 3OA2A 5A6SA 2BP7A 2H1FA 4V1CB 3HP1A 3H9UA 1JHXA 2CSUA 4RJ2A 5KYGA 2NU6A 2IZOA 4KN6A 4DZTA 4FINA 5IUNC 1BMTA 1J25A 4ZGGA 5MGNA 4YUYA 4KCGA 3FG9A 1BWPA 3QEMA 2XSZD 2IS6A 3GBVA 4NV0A 1GQRA 2ON6A 5HE9A 5FUBA 2B1IA 2UAGA 3O4VA 5CNMA 3ZDRA 3ZWPA 3THWB 4R8VA 3R3WA 4FXOA 3FFTA 2P9QA 4HNRA 4PBTA 2HHCA 3L43A 1T8WA 2FV8A 2ZWOA 4JT2A 4UNIA 2FZCA 5AK5A 1QYCA 4DBZA 2CNWA 2VZEA 4CDNA 1JDTA 1X92A 1CEQA 1TK2A 3ZE2B 2OPHA 5EFOA 1D6JA 2DFVA 4MPJA 3MB8A 5CT6A 5A7GA 1Y48E 1RKUA 3S2FA 3ZGVA 4ZEVA 1U7UA 3K5WA 4XSVA 2DFDA 1CEXA 1U8XX 3BXOA 3DMNA 3O3NB 3LUCA 3OCWA 3P9NA 2D5LA 2WI8A 4FFOA 2GQ0A 5AH0A 2P4UA 1V8DA 1A9SA 2NO5A 3EEBA 1HK7A 3RS3A 5DOVA 1GLVA 3OPXA 3OT4A 4EPWA 3JYHA 2W6MA 5KYKA 4EHJA 1ZVVA 3FUCA 4KSBA 3AKEA 3J80A 2ZRMA 1CUAA 1S96A 2GPSA 2GZDA 4JUDX 3T7TA 1EAMA 2JA1A 2PX5A 4PIPA 2YC4C 1N7JA 4MWOA 5ARCA 1OTXA 1CERA 3BMQB 4Z8YA 5TF4A 1K8QA 2YWHA 3N2LA 1HEIA 2ST1A 2VHYA 3H9CA 1OAOC 2X5KO 5DH9A 4QDTA 3DV0B 4ZT6A 1JDJA 4C4PA 2OFPA 1QVWA 2FQWA 2X9QA 2XLCA 4Y6LA 4ZCLA 5K5EA 1PUXA 2P2DA 4RVSA 2NXCA 2SICE 5EERA 3ND6A 4Y98A 2G1AA 4RIEA 1RZVA 1ZITA 3U62A 2ECQA 2W4QA 3H6GA 3NHSA 3I1JA 3O95A 3W8RA 5BV7A 2HGZA 1IM2A 4TLAA 1S6YA 2JD1A 3OFJA 3EXHC 1KQ3A 4OGGA 2H17A 1SOUA 5JBIA 3CG4A 1CU1A 1ATIA 4C05A 2HUPA 3OPNA 1DQYA 5FOVA 2QVXX 4ZT3A 3OLVA 4ZAFA 3V8VA 5THKA 2RAUA 4QYMA 4TYYA 1ZUIA 1YGYA 3PFWO 2IHNA 3MB5A 3K1TA 3D3KA 1GFZA 1ZM4A 2R5WA 1EQAA 3BMNA 4QOJA 5L7TA 3KWFA 3JATB 3TPCA 2A7QA 4M83A 1DTEA 3EAGA 4V39A 4YRNA 1J07A 5CJJA 2ZJ4A 2IX3A 1OJLA 4N12A 2DHQA 3TLGB 1B76A 3TMYA 2HBRA 2P40A 2L82A 3IEIA 3PIIA 4YPFA 1U6IA 1D5CA 2VQ3A 3PRKE 2PA3A 3S1AA 1T5OA 1OFVA 1QLHA 4LN1A 4ARAA 3R7BA 3WR5A 5CDUA 2FNAA 4AJIA 1E79D 3SX0A 1JFTA 2E4ZA 4CTKA 5G1OA 1C0PA 1JDNA 4P4LA 1ZR4A 3NV7A 2HO4A 5D5QA 3P9SA 4LCBA 1RI5A 4PYMA 1PZMA 3LIPA 2Q29A 3X43A 4ZKDA 1HDZA 2CY0A 4PCLA 5IXYA 1KEWA 1BU8A 4UEWA 1EAYA 1QP7A 1RWNA 5GONB 3UIEA 3CX6A 2PYIA 1AUOA 3RS2A 1RTTA 2KI5A 2ISCA 2DULA 1EDDA 2L17A 1LK7A 2Q9UA 4WEQA 3NHAA 3V97A 3A0RB 1EVLA 1UOOA 1WPRA 3AETA 5CB0A 3DZHA 3LC1O 3ZHRA 1UH5A 2VUHB 4TMWA 3ZWBA 3ZJ4A 4MMYB 1II8A 2CV2A 2I6QA 2ZBEA 3O8QB 1RDFA 2PUFA 4L6AA 4QBHA 1UMCB 4IF4A 3KOYA 5E6UA 1BKDR 3COWA 1CIJA 2II6A 3E3AA 3RLFA 4JUAA 4ZANA 1GD1O 2Z2XA 4QPPA 1EI9A 4BJ5A 1OH5A 3ONEA 4P32A 3SY8A 2N1BA 3R20A 4L6CA 4YJHA 3B38A 1Z62A 4U9UA 4E5SA 2DQYA 3OF2A 3W4JA 4JKOA 4YMTA 2YXPX 5CEFA 4PX3A 2JLCA 3I4FA 2OXTA 3WL4A 2A92A 4C6HA 4DS3A 2OLJA 1VIYA 1HE8B 5EZ6B 2BZ0A 4M0FA 3CNOA 3OPYA 3Q9UA 3LPLA 2W8BB 3KEMA 1DKPA 4X64B 2Z4TA 2W4MA 3WIBA 2BKUA 3QY9A 4URHA 4BVEA 1ZINA 2DHDA 4UQLA 1SQ5A 1YA8A 1PIWA 4NE7A 5U1PA 4Q4AA 3KVNA 1B2RA 1J00A 1M1NA 2DY0A 3T3PB 3BIXA 4PVDA 2X0KA 3GEGA 4HWTA 5L3RA 3D8BA 3FVTA 4DCUA 2EBHX 5JBNA 1P1FA 5ICGA 1C30A 1RQPA 4KJXA 5IHXA 1CZNA 2AG0A 3UV3A 1CRQA 3FKJA 1EFLA 4RH3A 4CU5A 5BSGA 3QKRB 3IOEA 4F9TA 2XRZA 5ALNA 3C6QA 2O8BB 3MUEA 4J75A 5A03A 4C2TA 1IN6A 1YKSA 1WTCA 2XQGA 2Q6OA 3UB2A 4HDRA 1K6MA 2ZI5A 1BE6A 4HEHA 2QVLA 3GX1A 1GUBA 1EE9A 2GR9A 3MTBA 1IY2A 2PT9A 4TS4A 5DM0A 4F3NA 2JLWA 4CMKA 3ZNOA 5KNBH 4X7PA 3WZ2A 3IUQA 1JLSA 4D9CA 1EGQA 2ENWA 1Q2XA 3U37A 2O2IA 4RDXA 4PZZA 1KFEB 3VR6A 2FN7A 1E0KA 4WEOA 3TD2A 2Q5HA 4UAGA 4EABA 1MB3A 5ADHA 2JD2A 2PSFA 3ZDBA 3RUEA 1G5PA 5K8UA 1M5RA 1KI7A 1DCMA 1QGED 3MWEA 1RS0A 1XKLA 3GJ8A 3FGPA 1YONA 3IULA 4OXRA 2VTBB 5LXTF 3HACA 1BE0A 1WB4A 4NENA 4DDVA 5IJ9A 2YRFA 2H6EA 2FMTA 3FGOA 5A5VA 1RZRD 1WIWA 1TDJA 3C15C 1JIIA 1ENPA 4IO0A 2ZUDA 3GL9A 5LBUA 2VUIB 1U4OA 4KEAA 1OQAA 2BJVA 4K0RA 1YQEA 4RVGA 4B81A 1AO3A 1NN3A 3RHFA 1EVZA 2H16A 3VPCA 5J43A 4F9EA 2I4LA 1O5IA 4H6WA 4MWDA 2QKYA 3Q7IA 4PZYA 1ULHA 1LF5A 5J2TA 4OQZA 4QFBA 4A0HA 4COKA 2PWBA 2QHXA 3P8ZA 1B7GO 4I46A 4LI3X 4TRNA 3W05A 1M2OA 1W46A 2FN8A 4Y9UA 1PCXA 5GONF 5B4UA 5B6IA 2AW3A 4F3CA 3C3JA 2G8LA 3Q7SA 3T5DA 4CL0A 1BWSA 3LGAA 2HREA 3NEAA 3V1KA 3R7WB 5FXMA 2CXNA 4DLVA 1UQTA 4UHEA 4DUPA 4RM3A 2DAPA 3OKCA 3FPAA 1V16A 2XWPA 3UJ8A 1V26A 3WB2A 4XFDA 1KSGA 2AZXA 2CBGA 2GFIA 2B35A 2VDWA 5CH8A 4RYLA 3VV2A 3GRCA 3C1TA 2H1IA 3QOXA 4KWIA 4S1OA 4FCVA 1KEEB 3KYCB 4H3HB 1W93A 2AMJA 1NDQA 2CYBA 1W4CA 4CIWA 1CY0A 4P4SA 4CEJA 2B21A 3N2GB 1HDCA 1GWNA 3WK5A 1Q0LA 1PDVA 2C2KA 4E30A 2F00A 4L22A 2YOGA 4HOYA 3R9XA 4YASA 2PKRA 3ZE6A 4F92B 1MH9A 1N8KA 2ETVA 5DULA 3B3FA 2GCIA 4OXIA 4U2KA 1A69A 1K3TA 1NJ1A 2C3YA 4REMA 5AM3A 3A25A 3LDFA 3DMFA 3QG1A 5DM4A 1XCGB 2JJYA 2I4IA 2J6BA 4L4UA 3PRHA 3SC6A 3EPPA 3GFVA 4XCQA 2ACKA 4C87A 4DM3A 3DA8A 3H5NA 4RPGA 1CQZA 5HOQA 2X2PA 2IDMA 1PX2A 3I73A 4RKQA 1VL8A 1RVDA 3F4BA 2DVMA 3EFOB 1N9GA 2AR0A 3LGSA 4PZDA 3L4KA 2UYCA 1NFRA 2QMEA 3IAM1 1VLVA 1E2BA 1PW5A 421PA 1Z2AA 3L6CA 4L85A 4GRAA 4DQLA 2YZKA 3ZHTA 4ZZ2A 4R81A 4ZFNA 4ZTZB 2CJWA 3MRXA 4IJUA 5SY6A 4BO9A 8MHTA 2LVBA 1M33A 1XNGA 2A5DA 2RG7A 3N53A 3V8PA 1UXOA 3SK0A 5D86A 1AKNA 1FFXA 2CXRA 2GPAA 2X77A 4P53A 4ZEXA 4NE2A 1HA3A 1XELA 1SRQA 1F1BA 2JF0A 3E3LA 1EUCB 1IG3A 1DCFA 1ZXXA 5JSHA 3GUZA 4TMZA 2GTPA 2UZAA 1VSUA 2VDMB 5HG0A 3CZRA 4L0QA 1V5EA 3CUWA 3KBBA 4BBPA 2EL7A 3VZSA 4ZDJA 1M0TA 2FX2A 3P4YA 5AR1A 3ZZ0A 1N0WA 1SHTX 4RMHA 2WWIA 3IFSA 3AQIA 2IEIA 2OPBA 4Q5IA 2R6FA 1TK3A 1FLDA 2NZVG 3GLGA 2ZAIA 3DVAA 4QWMA 4R84A 2B2CA 3AF5A 1VGQA 1JSXA 3GPDG 3PQ7A 2JGRA 4GG1A 4INJA 4RKEA 4W9RA 3TMKA 1QZ3A 4KYIB 2FFJA 3UO8B 3V8RA 4HO1X 3OG9A 4HQ6A 5ALPA 4B3CA 3ETNA 4YYEA 3VPGA 4A6DA 7ABPA 1Z0JA 2JDIA 2Q7DA 4TZKA 1JRLA 2I6FA 4ENVA 3FPKA 1TAHA 3L02A 3NT4A 2DM6A 4XIGS 2FFRA 3FUXA 4CV0A 5CCXA 2CWDA 3ECAA 1AM4D 4AN4A 4EENA 5FCDA 4CR6A 4OYRA 1GTJ1 1LPAB 1VPVA 2Q3EA 3DAYA 4K9QA 4Q34A 2UZIR 3A6FA 3N3BC 4GXRA 2IY7A 2ORED 5D2CA 3D2BA 2Z3WA 1OY1A 4PZAA 4JL5A 1JR2A 3U60B 4JJ6A 3C98A 4LJKA 4Y30A 2Q6TA 1SIBE 2YY5A 3EZYA 2J6IA 1Y4DE 3JQBC 4KXVA 1FDTA 1THGA 1YVRA 2FSSA 2LE0A 3I09A 1EFKA 3I2FA 3ICPA 4M88A 4O33A 4R6XA 4Y7CA 3X1YA 5A0TA 3OCUA 2YHUA 3JASB 4UNPA 4ZAGA 2IDKA 2GARA 2ID9A 4GBJA 4UMEA 5AI4A 2IV7A 3R75A 3SDBA 4WASA 4I8IA 3RYTC 4M6WB 1UC4B 3AF3A 3HBFA 6PFKA 4JOCA 1DZIA 5JT1A 3BBLA 1C7RA 1XA0A 1Z2OX 2QK4A 2X9GA 2PZFA 5IT9A 1KRHA 1CF9A 3FF4A 5JFOA 1QFYA 3AI1A 3GN2A 1BQ4A 4MINA 1EGMB 2CMFA 3BJRA 1RXVA 2AZTA 1SU6A 4WUVA 1OBVA 2AZDA 1R4NB 1WXGA 2FOXA 4GKVA 4BGIA 4GP9A 2Y2VA 2G6BA 4UVDA 4V0NA 3UPDA 4Y2VA 2IXGA 1U99A 4AUKA 1YS4A 1CEEA 4D8TA 3DZCA 1JG2A 5F21A 1KAQA 2CK3A 2PMWB 3ICOA 2O8DB 1HNXB 4JDPA 2RGCA 3CF0A 1UQUA 2X23A 2YBEA 3D0RA 4LMRA 4NBUA 4MWBA 4JLMA 3ZX4A 4C1BA 4YHBA 4R1MA 5EWLA 1DIOB 2VF5X 3HWX1 1BDMA 3LQKA 3WJ1A 1R15A 4YMHA 5CBKA 4G5RA 1IJKA 3E9EA 3PGMA 1ZU4A 1K6IA 3KHUA 3OM1A 1ADJA 1E58A 1SKQA 1X9GA 3A2LA 3GLGE 2WTEA 4DMGA 4UOZA 5I7SA 2ZCUA 4K9OA 3FLMA 1QV9A 2J9RA 4RMNA 2O1XA 1XD2B 1Q0QA 3G9XA 4OGKA 3UOWA 5KYXB 3RTCA 1EHIA 3Q9LA 1P6UA 1QIDA 3NKFA 4JHXA 4WQMA 3ZV6A 4AB1A 1R0CA 4ROSA 5I48A 2BKXA 4IIFA 2E7ZA 4P93A 1OZFA 5TVGA 4DV1B 4XTRA 5BNTA 3H2KA 3Q3GE 3ZWKA 2BONA 4HVTA 5BRJA 3VRHA 4EOGA 3JYLA 4LQ4A 5DSTA 2IWHA 3UKJA 2XUZA 3H9QA 3OJEA 4DJFC 4EARA 4UTNA 3WLAA 2B99A 1X38A 1ZIYA 3NBMA 2VPWA 2BTOA 3HCDA 2VDNB 2GXSA 2G9NA 2DHEA 1GQSA 4BGEA 3CPEA 3IOMA 4F4JA 2Z98A 1CTQA 4X7MA 4X62B 1NT2A 1VZ3A 2SKDA 1NX9A 1H3NA 4PPQA 2ZS9A 3PNVA 5TC4A 1PZGA 2Y0EA 4X6UA 4LGVA 2LCIA 5A3SA 1RQ2A 4DDKA 4C5CA 1ZRNA 4UDYX 2FZEA 2FPUA 5A7FA 4DJEC 1FU7A 1LFAA 4KRYA 1USVA 4MO9A 4L74A 1DMSA 1ND6A 1UBKS 3L6RA 3NOVA 3MINB 3EMVA 3KB1A 2Y9PB 2ZJ5A 5SZKB 4OBBA 4EFNA 3BH6A 2R4TA 3QE4A 4K28A 3RC1A 4CGZA 2FPKA 1ZSYA 1ZG3A 3O82A 3MAAC 4MUMA 3AEKB 2I4TA 4GLOA 4JK3A 4Q1DA 4QGFA 4BNLA 2CE2X 4E5DA 2XSZA 2FW6A 2H7YA 2IFTA 2ZDQA 2IEDA 4J07A 4PU0A 4C5AA 1ODKA 2FTKE 1BC5A 4YN3A 3SPXA 3OOHA 3FWKA 4JWTA 3ASZA 1NAHA 1ZIXA 2NVWA 4Z4FA 2H9IA 1TRKA 5DI3B 1H3FA 1SJ9A 2JFYA 2QROA 3AKDA 2YHBA 2QVGA 4OBEA 4JJKA 4RKYA 1SQFA 3IMGA 2ZRQA 5T7BA 1GA4A 1T3ZA 3N0WA 5F1YA 1B74A 1KA9H 5JARA 4F2DA 1D9ZA 2ZYHA 4IUDS 3RS8A 1VKOA 4BC0A 4BKMA 4EEKA 1J49A 3UFXA 1KHTA 3THXB 1AUQA 4KNYA 2I3GA 4FSDA 3QXXA 4PINA 5ES3A 3H5LA 2C2MA 4XW2A 3ZW9A 1OT3A 3CVOA 3ILYA 3PUJA 3MMXA 2P78A 5FTWA 4PSKA 5D5HA 2OTCA 1Z5GA 2XCRB 3LW7A 3OTGA 3PNKA 2J0VA 4DLRA 2DT8A 1X19A 2CLEB 3OSUA 2GHRA 2GO7A 4RLSA 3REFA 3U3XA 5KC8A 4P6VF 5A9RA 1WQ1R 5EIFA 2JAPA 1NV9A 2W2OA 1L7EA 2X6RA 2G1KA 1R0SA 3IT1A 1G20E 1V1MB 4Z9AA 4EVIA 1GQ2A 3DTNA 1X1DA 1A7KA 3AW9A 1UXIA 1Y9ZA 3WLPA 4Z0PA 3GP8A 3TLYA 2OK8A 4HFJA 4D02A 1JVBA 4OX9Y 4QJ5A 1J70A 2OD7A 2IOFK 3P0IA 1WCXA 2Q2WA 5G41A 1VXRA 3K70D 4QUEA 4W4TA 3TMAA 2VWGA 5FOXA 1VB3A 4I9NA 1ZRSA 3QKTA 1SQ6A 2PGIA 4L57A 2BKAA 3FYUB 4M86A 1KDRA 2DPXA 4DY6A 2Y6VA 2YYAA 1E18A 4G5XA 4NZPA 5DOZA 3I4LA 1UJ6A 2JVJA 5FADA 1PR9A 3SZ3A 3QOWA 1OU4A 3FR7A 1QZTA 1XIVA 5E3IA 2PZMA 3JWIA 4II7A 5CB8A 3PGLA 1XVAA 4YLYA 1P9NA 2VDUE 1DG9A 4NCAA 1DIBA 2NVUB 1WHTA 2OAEA 4DBLC 1QHYA 3CW9A 3RIEA 1YGPA 2Y1LA 3NDJA 2CL0X 4M46A 4BX8A 1V8BA 4N18A 3UMYA 5LZ8A 1IATA 2D62A 1W52X 2VDQB 1CLUA 3PF9A 1NL3A 2H1RA 2W6ID 3LX4A 4FYJA 4KWTA 4OOFA 1KK0A 4CUJA 4D56A 2JCVA 4C01A 1YB1A 4K9LA 1M8FA 4FHEA 1F2TB 5AHXA 3RG2A 1ZEMA 2ZRHA 3A8TA 5I3ZA 1I10A 5C5CA 3RREA 1FDUA 1D7AA 1FTGA 3EEQA 4G24A 1N2CB 1DVRA 3A4NA 3NRJA 5IU6A 4TLDA 4AT1A 3FUVA 4RHYA 1I4LD 2P35A 3I3SR 4MJ3A 5B3JC 1S2LA 4W5WA 3FPEA 1Z0SA 1SCIA 3AB7A 3OLZA 4XARA 1T9GR 3OOSA 4NMLA 4AS1A 4B6FA 1PT5A 1PK8A 4LQDA 1H2BA 2A5GA 4NZYA 4E2FA 4EGQA 5DNYB 3CVXA 2EJBA 4ASUD 2D2EA 3ASYA 3LP6A 1NU8A 1S8AA 1WUJS 2VP2A 4IZ6A 1X7YA 2E5WA 5BQOA 3GNQA 5KYVA 4HGPA 4D79A 3RC9A 5MN4A 5TQJA 2FN3A 3NOQA 2YZNA 3QHPA 3UMCA 2YINC 4D3YA 2XA2A 4LWOA 5AQEA 2D13A 3I5XA 1N2OA 5LOVA 2H57A 4KUHA 2HA6A 3OF5A 3WWDA 4ALLA 4CM3A 3TX6A 1XQWA 4NBSA 1I33A 1BMDA 4NAVA 4FMCB 2XNCA 4UPDA 2O7NA 3VPAA 2BRUC 5KNCH 3Q15C 1M6VB 5DLEA 4BX0A 4H77A 4BO4A 1NIPA 1KRWA 3A1UA 1N8NA 1COZA 2X13A 1TADA 5CYGA 3QTBA 1CQWA 2GEFA 3E05A 4I5EA 3P5SA 1J7JA 2ZKIA 2V74B 3E1GA 3DE0X 3GGPA 3SLKA 2B9EA 2OCAA 3FUWA 4RSRA 1WHSB 4ABYA 2YIVX 3L1IA 5JSZA 4LGYA 2OB2A 3LT5A 1H8ED 2QRZA 4J6FA 1X39A 4KIUA 3U3KA 2JKZA 3UA3A 2YIDA 4B74A 3CZ9A 3BMCB 1Q84A 1OXMA 2B8NA 3V7WA 1ESCA 1F8XA 1RP7A 4TQAA 3IUYA 5DBFA 5C4IA 4O29A 1N2XA 4MTCA 2AG6A 3VAZA 1PJSA 1XZNA 2REQB 4EYQA 1CE8A 2W22A 4L4RA 1MJHA 3GJ4A 3BE8A 2QIPA 1JFFB 3PPYA 1FFCA 2ZWIA 3CUUA 3ELWA 2VZ9A 3TQFA 5B7GA 4DCOA 3UWOA 1W1IA 4K0KB 3QU7A 4DDUA 3TLAA 6NULA 4DV2B 1ZJZA 3TLKA 1H9BA 3H18A 3UXEA 1EM8B 3DDSA 1KU6A 3EGXB 5BY2A 3D8NA 3VSDA 3Q0EA 2AE1A 4D9FA 4TSKA 1P91A 4H7PA 1HSZA 1E1RD 4GD3Q 4EHLA 1OVMA 5HK8A 4ZGBA 1K5GA 4LXYA 4B3HA 5LPNA 5TJHA 3L07A 1RM3A 4EY4A 1I2CA 2NSJA 4L0MA 1GG5A 1RHKA 2H00A 3KYDB 5T4HA 2WJPA 3G89A 1TZCA 4QJ3A 3VR2D 1Y4ZA 4M7OA 4LOLA 3NTXA 3HRKA 4H59A 5AP9A 4B1FA 1ZGGA 5CDSA 3CR3C 5ESRA 5H68A 1UPTA 1UAGA 4S1NA 2OWEA 4D9HA 4QOSA 1UWVA 4O8CA 4PG4A 4DKJA 2WIBA 2HIAA 6REQB 3GN1A 1FYVA 7AT1A 1RZRA 1U9YA 2VJBA 4JLJA 1LW6E 4EA9A 4F8JA 4RJKA 5GV7A 3V4SA 1L1QA 3D6VA 3QF4B 4AK9A 3K96A 3THYB 1SD1A 3HWWA 1A72A 4QO7A 4BRWA 2KX7A 3SYTA 2QTGA 3V32A 1ZOPA 3FPBA 1KEPA 1B4DA 1K5PA 3I04M 1WLSA 2R8RA 4FI3C 4KR9A 4F4DA 5CITA 1SBYA 2VO1A 2CFOA 1JG7A 4WJZA 3K5PA 5EYPB 1GPDG 2I99A 3AKCA 2QSJA 3DBOB 4ZXPA 3RIHA 2CNBA 4OLFA 3STVA 5I7WA 5C51B 2BL4A 2G40A 1C8BA 1RZUA 3B1FA 2OAP1 3D6UA 3HABA 3L8GA 1H6AA 4MV1A 1GNQA 1RJ9B