4V02A

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
244
Chain Sequence
AEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDAAIGLRNLDMILGLENRIVYDILDVLEGRVPYEKALVKDKRGLSLWLLPADVIDIEKWNKTVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLESMDKRNYKVIVNRIKWEMVKRGAMLSVEDIVDILKAEIIGIIPEEPKLVDFTNRGEPIVLDEKFPASQAIIDTARRLMGESIPLKRYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 86
structure length 244
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v02A00
1ZIOA 1ZUIA 3PUVA 1IQPA 1YJ5A 3UMFA 2WTUA 1BO6A 2GAAA 3K9GA 4PFSA 4P4SA 4Q4HB 1QZXA 2CHQA 3EWAA 4PPNA 2VA8A 3GJ5A 3ZIAA 1DVRA 1WRBA 2GF9A 3AVQA 4GDFA 3WXMA 1QHHB 4NYJQ 1XNJA 3KJEA 5J4HA 5CM8B 4Z1MD 2JLVA 2HJVA 1MRSA 2CBZA 2ODWA 1G9XA 2Z4SA 2Z6VA 2KSQA 2ZI3A 4IDPA 4AC9A 3RS0A 821PA 4ZDJA 2AD5A 4OI1A 4PO1A 2R9VA 2GJ9A 3SYLA 3OFNA 1Q12A 1G4UR 2AKAB 2FU5C 1OPXA 1OXSC 1E9BA 4EKDA 3AH8A 2BHRA 2QMUA 3L43A 3IILA 1U0LA 5SZHB 1E32A 1KI3A 1N2CE 1Q44A 1E2NA 2WICA 2WIBA 3MWYW 4IVQA 4JL8A 3THXB 1G3RA 3C7KA 4G3XA 5FTNA 3QKUA 5IF9A 1COWD 1Z6XA 4AKIA 3EZ7A 1GRNA 1NKSA 3MD0A 2OLKA 2W2VA 2BMDA 2IYZA 1OXTA 4LPSA 2NIPA 2REOA 3CPEA 4NE2A 4DDTA 2QN6A 1Z22A 3CUEF 3K0FA 3VR6A 4GI7A 1JNYA 1WA5A 3QPVA 1BYUA 1HV8A 1HURA 1J70A 4BLSA 3S1AA 1KY2A 1NG9A 1KDRA 2OSBA 2QSYA 2FGJA 1E2FA 1HE1C 3FKSA 5C4GB 3LXXA 2FSHA 1GL7A 3BH6A 5JSZB 5C2JB 4M8NE 2RKOA 4BRWA 1XD9A 3SN6A 4DSNA 5LD2B 3VKGA 4IXNA 3U7EB 2JLQA 5CK4A 3GJXC 5HE9A 4KO8A 1KI1A 3QY0A 3KFXA 4FXPA 2XXAB 3GP8A 2GCNA 3IO5A 3VHXA 4IDQA 1KO8A 3QI2A 3U2QA 2QP3A 2F1RA 1PLLA 4LJAA 1MOZA 4Q4JB 4DZZA 1I2MA 1FPMA 4Q18A 1E79A 5KPDA 2A78A 1LNZA 3GJ0A 2FE4A 3TUJC 1G19A 5C46F 2CLDX 2VHCA 1WE2A 4O2LA 4B3DA 2JJ2A 4B75A 3BH7A 2YOFA 1CRPA 2KJQA 4JKYA 2IUUA 1F2UB 3ZD7A 4KFUA 5KTYA 4NU0A 3C8UA 1CBUA 3HYTA 5TVKA 2AXPA 1GKIA 3C16C 4JLAA 2JASA 4DSTA 1V5WA 4HUTA 5B30A 2XOKA 4R71A 2X19A 4NCKA 3TW4A 4A0FA 2GK6A 1R8QA 3SZRA 3PR1A 4LBZA 1IHUA 1CU1A 3VU9B 4Y0AA 3G0HA 2GK7A 4A82A 2CVHA 4QGFA 3I62A 1YR7A 2XGJA 1M8PA 2WWFA 3EAQA 4BFUA 1K5DA 4YLGA 4C0AC 2YINC 3WRXC 4P4UA 5ELXA 1NJGA 1FX0B 4I4LA 2N46A 4HAVA 4M1KA 4BEJA 1XP8A 3VR5A 1W47A 3GJ3A 1JR6A 3HWSA 3SHWA 3CPJB 2MMCA 1FP6A 1U8YA 3AF1A 1Z2AA 3V4RA 4JLDA 2JAQA 5KNDA 4GZLA 1NBME 1W44A 4AY2A 3HR8A 1G7TA 5L3VA 1VECA 4UNSA 3SU8A 4BFVA 4B3FX 1W0JA 1E9EA 2OXCA 3EPLA 1P4SA 4LV5B 1FTNA 2GETA 4QJ5A 1XXHB 3ZS8A 4CYMA 3KQUA 1OT3A 4B74A 3WNBA 3LH5A 3BJIC 1XEWY 4L9SA 4PO8A 4DDWA 1O3YA 2IYWA 5FPYA 3IEVA 4OQLA 5EP3A 1JXOA 3IDQA 3VFDA 4HDQB 1SVLA 2QA5A 3P27A 3AB3A 1PUJA 1T3LA 4CZ2A 4N3NA 4B3XA 2OCBA 1NI3A 3T35A 1DO0A 1HEIA 1U2RA 2HUPA 1KO1A 1WBBA 4KI0A 2D3WA 2AN9A 5EE5B 4C0QC 2HCJB 2REBA 3AF0A 1U8AA 3KUCA 5GJCA 2O0HA 3W6PA 1E1QA 5CB8A 4RD6A 2FDCA 3AP3A 5BN4A 3CNLA 3PVSA 1ZM4A 5C4MA 2RGNA 2PJRA 5D3MB 1C4OA 2KBFA 1UPTA 4D0GA 4Q7MB 3TJZA 3CH5A 5J47A 1FOEB 4BZQA 1RRGA 3NIBA 1XWIA 1U8ZA 4IW3B 1M2OB 3T1VA 1PLJA 3T5DA 1JPNA 1XJ0A 3C15C 4QHYA 4B32A 1F3OA 5JEEA 3GD7A 1ZAKA 2C8VA 3A58B 4UNNA 1NMZA 3PIRA 3A6PC 1M1YE 2IYTA 3K1JA 3TRFA 4FINA 4TLBA 3IHWA 2FG5A 1KO5A 3FMOB 1JI0A 4AD8A 5FL7A 2IS1A 2DPXA 1N6OA 1HE8B 1AS0A 5JFGA 4LC1A 2IXFA 4ABYA 2VTKA 1KI7A 3LX8A 3QIAA 4PTLA 1KMQA 3PUZA 4MGYR 2RGNC 3RSLA 4CDGA 1GFIA 2PMKA 4FMCF 2O8CB 1T8TA 3NH9A 5AUQA 3NEYA 3Q7QA 1KI9A 1VG9B 3SOPA 4TT3D 2XAUA 2OFWA 1KK2A 2P3SA 4JBXA 2CCJA 2G9NA 3TIFA 5CLQA 2ZANA 3AVUA 3CF2A 2F43B 4TSFA 4Q9HA 1TL7C 3AKEA 1IM2A 4U7DA 2XSZD 4B6FA 1YZNA 2J45A 4GT1A 1BMFA 2QE7A 4I1OA 3THWB 4MKFA 1E9RA 1EK0A 4TMVA 5CM9C 4DSOA 4PAMA 3B1WA 3VQTA 1Z0FA 1XPUA 2OM2A 4TZ0A 1E2HA 2JJ8A 2IEYA 3A4NA 1XU4A 3L8ZA 2ZRFA 1N5JA 1KSJA 1E2IA 1EFRA 2BMJA 2FNAA 3U3OA 4NYIQ 2RHMA 1DOAA 1LFDB 1RRFA 1Z5ZA 2ZS7A 3O47A 1XD2B 3DOFA 2P6NA 2YWGA 3LVQE 3ZZTA 1MV5A 2EFCB 2GJSA 3LFUA 3WHLA 4ZV4A 1Z2CA 1XJQA 2ZR7A 4Q47A 1KSGA 1W36D 2J3EA 2NZ8A 2AWOA 4I81A 3MUFA 3PEUA 2G3YA 1X8JA 2V55B 1X1SA 2CNWA 3LY5A 4F4CA 5KU1A 3OEED 2O8EA 3TLXA 4PSAA 2QTFA 3THYB 2ZIAA 5KPJA 1AK2A 2H18A 4LK2A 3KQKA 4ASUD 3B60A 5CDFA 2O8DA 8OHMA 2QZ4A 4OHWA 3G82C 2R6FA 1R7RA 5JRZA 1KMHB 3WP0A 2BEKA 2G6BA 4F91B 4UXHA 2AWNA 4HDCA 1LS1A 2ZRLA 4UNPA 2ZRPA 4W5JA 2CDNA 2FEMA 3REFA 2D62A 4JYCA 2FSFA 4D0LB 2RAPA 2J7PA 2RH5A 4KCGA 5H8WA 3FFBA 4FMDF 2LKCA 4BEBA 1OYYA 2XTNA 3HU1A 5H70A 2OZEA 2QP9X 2IEZA 1F6BA 2JLSA 3PQCA 1XMIA 2OAP1 4LDJA 1YHNA 3ND8A 4DT1B 4GP6A 1UEJA 2P65A 4Q48A 1TUEA 1CR1A 4Q01A 5M04A 3QXCA 4MYCA 2GEDA 5LB4A 4DSUA 4O3MA 1AQUA 1CIPA 2I3BA 2KE5A 1ESMA 3VX4A 1P60A 1KI8A 2XB4A 4TLAA 1E94E 1NVUQ 4YMWA 5HKKD 1IAQA 2D06A 3FPAA 4GNKA 1KI4A 2CE7A 2PLRA 2QQ0A 3HU2A 4IOJA 1ZBDA 2IS4A 4L8GA 2PJZA 2ZETA 1W1WA 1NJFA 4TTQA 3Q3JB 4URUR 4RJLA 3KX2A 2FPKA 5FOVA 1H65A 3V9PA 1QHXA 2WV9A 1WCV1 1Z29A 1ZM3A 4ARZA 3QKSA 3GLGA 1DAMA 2PCLA 1KIMA 5JI2E 5LPNA 1AIPA 2ZXUA 1E6CA 2EFGA 2BC9A 3B82A 2GXAA 1KJYA 1G8YA 2GBLA 5FUYA 3AVPA 1OXVA 3DZDA 3E70C 1ESNA 5KUTA 1W36B 1E2JA 3QF4B 3EPKA 2WJGA 1RYHA 3FGNA 1CR2A 3CZQA 3KKNA 3BB1A 5F9HA 1QHYA 4JBWA 3IUYA 2D2FA 1Q20A 2F55A 3LBIA 2E87A 5EE1A 4G01B 1Q1QA 2HCBA 2QQEA 2PCJA 3B1XA 1WBDA 3U6KA 4NZYA 2V1XA 5FPSA 2ORVA 3RDPA 3SJAA 4QOSA 2O0JA 3KZ1E 2KBEA 2P5SA 3OIWA 1Z0AA 1IN4A 3GJ8A 3AP1A 3RSOA 3FB4A 4KAXA 4Q21A 3EXAA 3PUXA 4B43A 3K70D 2FX3A 3AVTA 2NQ2C 4RZ3A 2J5XA 1KSHA 3BERA 3E2IA 3LQQA 4Q02A 1E0JA 2AK2A 1WDTA 3E5HA 1GNRA 3W5IA 2GBLC 2ZQ5A 3LD9A 1PJRA 4IVRA 4M2LA 1T5LA 1UEIA 5EXTA 3TSZA 4ZIRA 3ADDA 1ZJ6A 3WBJA 5DI3B 4XTCS 4MITA 2O8FA 3Q5EA 4QGGA 3T1QA 2ZRBA 3LVRE 1G7CA 3TK1A 1W0KA 3B8HA 5EZ6B 4F38A 2OCPA 2F1HA 2ZITA 2JJ1D 3ZLJA 4PHTA 3LAWA 1GKYA 1EX6A 2J1LA 3I32A 5L3QA 1OHHD 4LJ9A 1ZNXA 4IKEA 2AHOA 5SZJA 2GZDA 1KKLA 2P5TB 2XEXA 2G1KA 3JVVA 1IY1A 1X8LA 2G0NA 3OF5A 4II7A 5FBVB 1N3BA 4WOPA 3TKLA 5BN5A 3CO5A 4ZCMA 4FN5A 4OI2A 1JB1A 3WNCA 5JCPA 2YZ2A 4DCTA 4OQXA 1W2HA 4JLOA 4QM7A 4AYTA 3AKYA 4IEIA 3BIFA 4LY6A 3GPLA 2YOHA 2EYUA 3QBVA 3VTKA 4LGMA 2XNDA 1AS2A 1GWNA 1HY3A 2R6AA 3EZ9A 4Q4AB 4HAYA 2FWRA 1YR6A 1OFTA 1JQJC 2V4ZA 4PHHA 3U4QB 3TSWA 4KV9A 1VCIA 2R6DA 3DL0A 1KK1A 4NL4H 1YE8A 4AYWA 3GJ4A 2ZRCA 2ATXA 2HDNB 5F3WB 1T9HA 1GRQA 5FBWB 4HI0E 2FV8A 4BUJA 3QXJA 2VP2A 3PUYA 3TQFA 4NONA 5E7JA 3ECCA 1W7AA 1P9RA 1SGWA 2NPIA 2XZOA 3CONA 2WSSA 1NP6A 1XEXB 2IK8A 3GFOA 4ILEA 1Q1ZA 4BZXA 2AD1A 2Z83A 2QPTA 1CS4C 3FMFA 3UIEA 3B1YA 2NO0A 1Q1BA 3U7FB 1MO3A 3MAAC 4V02A 3WYGA 1IY0A 3QKRA 1OIXA 1OKKA 3WYFA 4URVR 1Z8FA 2CJWB 4MRRA 1HT2E 1Z0KA 3CX7A 4BLPA 3MG9A 1X86B 5L3SA 1ZD9A 1QRAA 4LBVA 5AJXA 5H68A 5FPHA 3TW8B 3VNVA 1Z0JA 4D4MA 1U0HC 4MGZR 4NCJA 4C0SA 2OILA 1T4GA 2V7QD 3WY9A 4YMUA 3I5YA 4IJMA 1QDEA 2DFLA 1I4DD 4BFZA 3U5ZB 2K5UA 1JBKA 5CLLA 1RRPA 2WZQA 2GESA 1S8FA 1W2GA 2CCKA 1P2VA 2JGNA 2HLDD 2BDTA 3TR5A 1OIWA 3NG1A 3NBXX 3D6TB 4R9UC 5J5CA 1AM4D 5JWHA 3N2EA 2LCFA 1RJ9B 1Z6TA 1W49A 2QENA 2QP4A 1D6JA 5FR2A 2CK3A 2GHIA 4KBFA 5EXXA 4QGHA 4LJ7A 5KO2A 3Q8XB 1E9CA 1Q0UA 4ZI3A 2JATA 1ZC4A 1ZU4A 3DKPA 4P4SB 1NRJB 1KYIA 2AFHE 2X77A 3FMIA 1ZW6A 1R2QA 4IOLA 3DHWC 4I1VA 1GIAA 1K8RA 5FTLA 5TXGA 4HSEA 1FW6A 3QSYA 3ZD6A 4OQNA 3EZ6A 1G7RA 2GZAA 3HR7A 3KUDA 1VTKA 1FQJA 3QENA 2GEVA 1JR3A 1E2GA 2J0UA 2OESA 2G88A 1HH4A 621PA 3OIYA 4X8LA 1BYIA 2OG2A 3ZDQA 4ACAA 2W58A 1RE0A 3FHOA 2O0KA 2CL0X 5K8IA 3PEVA 4P3YA 1GL6A 2CMKA 4ON9A 3ZVMA 2VSFA 2BIFA 2QPOA 2HT1A 4XVUA 1W5SA 2D74A 4DLZA 2GCOA 4XD7A 1RPZA 1GAJA 1M7BA 4ACBA 4PQYA 3WMGA 1TEVA 1IN7A 3KXIA 4C30A 4DDUA 3L0PA 5TB5A 4M1OA 1AA9A 2LKDA 1SHZA 2EFEB 4MRSA 2W6IA 5J4VA 3H4MA 4OKSA 5DGXA 3K0FB 2C04A 1TF2A 3MJRA 5SZIA 1J2JA 2ZE6A 1ZUNB 4Q7KA 3K0AA 3F5FA 2B21A 4JVNA 3WHKA 1KAOA 1U0JA 4M9ZA 2VP9A 1B23P 2C03A 2C9YA 3I3SR 1VHTA 3IBGA 4MYUA 1R0ZA 1NY6A 1P72A 2BJVA 3PJRA 2VP5A 2OBMA 3QPUA 3KTAA 4V0LA 3DKVA 2EFDB 2VSXA 1CEEA 1CKEA 3KJIA 5CYOA 3HP1A 3K09A 2GJKA 2VF7A 2ZYVX 3MWJA 1DEKA 4LI0A 3ONWA 3AF2A 1KJZA 5JBQA 1X1RA 2KWIA 4UXIA 1IBRA 4LRWA 4Q66C 1ZYUA 4A6PA 1OHHA 4YMSA 3MSXA 3NEJA 2VL7A 4IRUB 4GSYA 5FI1B 3WP1B 4OQFA 3AVWA 4JLJA 3T34A 1G291 2IYQA 2ZS9A 4JT4A 2J46A 3CZPA 2PX0A 3EC1A 3K70C 4PQRA 4QFMA 5B57C 2IYRA 2OXRA 5JEDA 2PMDA 4PSKA 1OH6A 5CB6A 2WAYA 2VBCA 2BVNA 1XPRA 1N6PA 1ZUHA 2FZLA 5DE3A 521PA 1W4RA 2ZRDA 1AQYA 1KZGB 1RKBA 4RCZA 4GZMA 3FVQA 3L8YA 4IFBA 3OEHA 5J4YA 1SXJA 1VG1A 3EIQA 1N6RA 2J0SA 3A8TA 3K09C 2QT0A 1EG7A 2HJGA 1H8HD 4WZ6A 3NHAA 4EDHA 2W83A 4QHTA 4WBSA 4UNQA 2RB4A 3W34A 3OE7D 1AGRA 4IEEA 4LYFA 3NWJA 4G5OA 3RS2A 3P26A 5P21A 4ZO4A 2ONJA 1E96A 1OFIA 3KJHA 4DHEA 4OYHA 1T8UA 3KL4A 2F6RA 4HZUA 4YXWA 1E2QA 2QGZA 1U94A 3SE0A 5DN6A 5FL3A 4CEHA 3PV0A 1DARA 3EZFA 3AGQA 1HQCA 4QBHA 5EXSA 1Q1EA 2ZVQX 3P4YA 3UK6A 4A2WA 4WXRA 1P7CA 4N0EA 4HZIA 1NMXA 1G5PA 1S9DA 1XMJA 1TMKA 2QT1A 2I1QA 1XEWX 2ZJBA 1GG2A 3NH6A 5IK2D 4EPXA 3R8CA 3SI7A 1SXJC 2IYYA 4WW0A 2JEOA 2SHKA 2ZR0A 4M22A 3X1ZA 1N6IA 1D9ZA 1VCMA 4IVPA 3PG5A 4R98A 3BFVA 2W0SA 3EWSA 3SJZA 4B6EA 5GVSA 3ICEA 3BE4A 2WHXA 3GLGE 5F2EA 2FH5B 3EIEA 5BXQC 2VRWA 2I4IA 3LDAA 4NCNA 2PZFA 2HXSA 1VDZA 3U7GA 4UNRA 1A7JA 4NCIA 4U00A 1KO4A 4DJTA 2CVFA 4M1SA 2N1BA 1G3UA 4EQ6A 1LTQA 5FPKA 1BS1A 2VSOA 1G3QA 1D2MA 3ZQJA 2OBNA 5LB2A 3K0SA 4KFTA 3RLFA 3W6OA 4P33A 1QHHA 1P6XA 1Y3AA 2C98A 1XB2A 1LVGA 4G5GA 1E9SA 4Q1AA 4KLNA 3K0EA 1OIVA 2PEYA 5LBIA 4XVRA 4A15A 1GM5A 3BAFA 1G6OA 1FUUA 4JLVA 2BCJQ 4HLQB 4KSCA 5CIQA 4D4KA 1FNMA 1UM8A 2GXSA 1E99A 4C0KA 2EQBA 3KB1A 1II8B 3FWYA 2CLCX 3EA0A 4MUBA 1E1RA 3CR7A 1FZQA 1UKVY 1R8SA 1G5TA 1TUIA 4PAOA 2JLUA 2J41A 5EJEA 1IN6A 5AUPB 2DWQA 4BGDA 1W4CA 4GL2A 4PC3A 2PT7A 3CF6R 4PO9A 4DLRA 2ZRHA 2YJTD 4DUGD 1FNNA 1HUQA 2AR7A 4AG5A 4LUCA 1BOFA 4MGIR 2VP4A 2WIAA 3R7WA 1R0WA 2ODBA 4HLUA 3FTQA 3GFPA 2JLZA 2OE2A 3BB3A 4RFVA 4BFYA 1GRRA 1IONA 1T91A 2J0VA 4HUQA 5L8VA 3QJYA 4WIAA 1SKYE 1R5NA 3OAAD 4IOMA 1EFTA 3CH4B 3M0EA 4HATA 1GSIA 2YKGA 1EFCA 4OI0A 3CWQA 1ZRHA 3MRSA 1Q3HA 1HQYE 2H1LA 3R9XA 2RHDA 3U7HB 4DLSA 1MRNA 4QKQA 1SVOA 4LV6A 1XF9A 4L16A 1MO4A 2D7DA 5G53C 4PANA 1E69A 1LB1B 2H8KA 3QBTA 3MWKA 5FTJA 2BM0A 2ZJZA 1P75A 3UWKA 1TPZA 1M7GA 1UJ2A 4LYJA 2F1JA 4LJYA 4R7ZA 1Q22A 3GLFA 3CF0A 3WBKA 4HLUC 1CR4A 2Q9BA 4CEIA 4KVGA 4TMKA 1YVDA 3BH0A 4QJ4A 3SR0A 1J99A 3FHCB 4NHOA 5HE8A 1Z6YA 2ZTSA 3J81k 4NMMA 5LD2C 1M7HA 3B85A 1A5TA 4MH0R 4P31A 3W9YA 4Z1MA 4NYMR 2UZIR 2NZJA 3CNNA 1AZSC 4YDSA 2B8TA 2ZJ5A 3BORA 5K8LA 2O8EB 3VR4A 2ZRAA 4PPGA 2BM1A 4CIDA 1DTSA 4EIWA 2ZUCA 4BPBA 2BOVA 3L0IB 2O8DB 2ZUDA 2YYZA 1XPOA 4Q4LA 4US2R 2CHVA 5G3ZA 5E95A 2ZS8A 3RNLA 4IOKA 2ZSFA 4LV8B 2JDID 1COWA 4PQFA 1AN0A 1XRJA 1KJWA 3OHMA 3TSOA 1UDXA 1CXZA 1P2UA 3HPQA 1Z06A 1Z6AA 3PENA 1T5IA 3NC1C 1SVWA 1ZNYA 4LYAA 1NBMD 1W4BA 3V4FA 4EFMA 3QOFA 2V54A 4PX9A 4WXPA 5BWMA 5C1BA 1OJLA 4GRAA 1TAGA 1XTSA 1WMSA 2F3RA 4TL6A 1NIJA 2CXXA 2WPDD 3RANA 4FD2A 1NN0A 1PZNA 4G5QA 2FMXA 3GLIA 1BH2A 1U90A 1W46A 1YKSA 2RGDA 3EASA 4CEJA 1E2EA 3IQXA 2XX3A 4B44A 1PV4A 4XWKA 2P6UA 2J9RA 2ZI9A 4LHZA 2X1VA 3DMDA 2ZRJA 3EC2A 3F0TA 4NPHA 4IFEA 4QBFA 3O8RA 1TNDA 2JA1A 1D2EA 3KQHA 4EPVA 1VKJA 3LO5A 4KODA 5EUMA 3X2SA 3U3KA 3KKQA 4D4LA 5JHHB 4URZR 2QAGA 2ZJ2A 1QVRA 221PA 2IHYA 1R5OA 1TQ2A 4E03A 1JR3E 3CRRA 4ARZB 4OHZA 4LOAA 4Q7JB 1GUAA 4BRUA 5JECA 3GLGB 4RKEA 5JJKA 2OUKA 5D3MA 3E1SA 4FCVA 4BFTA 4IXMA 2VH5R 2W2XA 2HF8A 4TN1A 1WQ1R 1FMLA 721PA 4UQOA 6Q21A 4RVCA 1LW7A 3KJGA 5UKDA 1SZPA 2HYDA 4PC2A 1UKYA 3A4LA 1Z3IX 2GKSA 4NBSA 1T0JB 1JEDA 2R62A 4CT5A 1Z0DA 5FOUA 3EARA 5BW8A 3RHFA 1Q21A 3KXKA 4POAA 1Y63A 1Z63A 4YMTA 4QHSA 3CRQA 2RCNA 4B2IA 4TMZA 3W8RA 2IHBA 1ODFA 4DCSA 4ZCIA 2OFXA 4RD3A 1G20E 3K53A 1F2TB 2QAGC 2H92A 3AF3A 1HA3A 1E4YA 1XMSA 2QY9A 4HAXA 4HDOB 5EUQB 4LCBA 4Q1FA 4EAQA 4TYNA 3R9WA 2D4HA 4ZI2A 3ZYCA 1TTTA 4B2PA 4LJ8A 3RS4A 3TH5A 4MKIA 2HXYA 1HTWA 3Q9LA 4LJ5A 2GTPA 4DXAA 3H1TA 2O8CA 4PC6A 4TWZA 3VKHA 5D3QA 2YC2C 2GVDC 3C4JA 4XSHA 1U9IA 4ZIRB 4Z54A 1ZM9A 4EJSB 3EW9A 3SQXA 2VPPA 5FI0B 4D81A 3KDSE 2O8FB 4OK3A 1CF4A 2BWJA 4IDNA 2ZRKA 1Z28A 3VR2A 1OFHA 4MQBA 2QROA 2IF2A 1MABA 4RD2A 2ZUBA 2PT5A 2ZJ8A 3L2OB 4KXFB 5JZVA 2GJAA 3HJNA 4PZLA 3CB4A 1WB9A 1J90A 2NG1A 3TUIC 1SQ5A 3NDBB 4G5SA 1R6BX 1N6LA 2HYIC 4LHVA 2H5EA 1RZ3A 1N6NA 2RMKA 1XZQA 3SJCA 2ZYTX 3ETLA 5E7MA 1YQTA 2NPFA 1GILA 2JCSA 3A1VA 1DG3A 2MSCB 3OAAA 4K8OA 4WVFA 1SKYB 2IYVA 3GEEA 1AKEA 2W0MA 4MYTA 3TBKA 2WWGA 2ZI6A 1XD2A 2EWVA 1NLYA 4MGKR 2HEIA 2P0EA 4EPWA 5HZKA 4W9MC 4Q19A 1U9IC 4ZKEA 2W6JD 3BBPA 1N5LA 4O25A 1SXJE 2REXB 3SBEA 2YWHA 4M1MA 1L8QA 3CRMA 3I73A 3FE2A 3TAHA 4TMXA 4A0GA 5DNYB 4LHYA 1DE0A 3KKPA 3VR1A 2DCUA 1NN3A 2JLYA 2JIZD 1IN8A 1Q57A 3NBFA 2QM8A 2C5LA 2ZJAA 3EA5A 2WWIA 4DLVA 4LYHA 1L4YA 1XTQA 1IJEA 4B73A 1VIAA 2RGEA 3W8NA 1G8HA 1KDOA 2V1UA 1CJTC 1XBTA 4RSGA 2EYQA 3PFIA 2FFHA 4Y0VA 3T12A 3O8CA 4AYXA 1OE0A 4AKEA 1N25A 2OHFA 3U60B 2NGRA 2WKPA 1MO6A 4ZDWA 2FFAA 1JEEA 3VAAA 5J4LA 5FUVA 4MRPA 1XTRA 1QG4A 3LA6A 4XSGA 1GNQA 3AVOA 4Q1EA 3A4MA 4TYYA 2OLJA 4NP6A 1DAKA 3R20A 421PA 4JLMA 4V0KA 1EXMA 3SDZA 1H8ED 2UZ3A 1XFAA 1ZNZA 4TYWA 4O2RA 4Q03A 5EE3A 2Q9AA 3ZGXA 4PHFA 3D7MA 2OT3B 5IRCD 4TT3A 4J0QA 2XTMA 1TQ4A 1S2MA 4L9WA 2IXGA 3EIHA 2IYUA 121PA 3VNUA 2W2TA 1FUKA 2GVZC 2A3RA 3ZJYA 1LV7A 4LSGA 1M74A 1JAIA 5GJWC 3NC0C 2XSZA 5CK5A 1WXQA 1I4LD 1JQLB 4Z51A 5IHPA 4RY2A 5JWOA 3U6BA 4NTZA 2C77A 2RGGA 3IBYA 2BKUA 5J40A 4FWIB 4GOJA 1FP7A 3ZIAD 2DB3A 4A92A 1ZC3A 5AUOB 5FFMA 5KOYA 3CW2A 1ZP6A 4TYQA 4LX0A 5HCNA 4DLYA 2YV5A 1E2DA 5EE0A 1PUIA 2QG6A 2C78A 3T15A 3AVVA 2O8BB 4GOKA 3KQNA 3I4LA 4E5UA 3A1WA 4M9XA 3N70A 1RYFA 3SS8A 3VKWA 4S2EA 1KTVA 3B13B 4DBLC 4M9SA 3OFND 1V43A 4TL7A 3QF4A 5A0FA 2H16A 5CYPA 4AWXA 2BBSA 4A8JA 1Z07A 2WAXA 4C9BA 1TQ6A 4B47A 2IYXA 1YZKA 4JSYA 1G64A 2R2AA 1OF1A 2C2HA 2DFKB 2J0UB 4US1R 3OEEA 2AKYA 2ZJYA 1Z0IA 5G41A 1ZM2A 2FF7A 4FCWA 1R4AA 1SVKA 4A2PA 5JI3E 4JMPA 4ASUA 1ZNWA 3ZZUA 3QVVA 4MRNA 1EFHA 3AF4A 3LV8A 5KNBA 4PR0A 4RD1A 3QXHA 1E0KA 1KNXA 2YNMA 2AXNA 2WBLC 1OB5A 2GCOB 2RGXA 4HB4A 1UKZA 5IDVA 3L0OA 1G8FA 4JLBA 3FKSD 3RABA 3RRZA 4JKIA 3PEYA 2WM9B 5KDOA 1KI6A 2QSZA 1W36C 1AKYA 3K9HA 4JS0A 4UJ5A 1OB2A 1IY2A 3BGWA 1A1VA 2QAJA 3SYNA 3DO6A 4A8JC 4B3GA 3VR3A 1RW4A 2J87A 1G17A 2XZPA 5G3YA 1SULA 1ZIPA 5TY0A 2OCAA 1C1YA 1GKUB 1SVIA 4KYIB 4WZBE 3U61B 4NCHA 1CP2A 2H17A 3CKLA 3LWNA 1EGAA 2FJUA 3UXMA 1XJCA 4BWYA 5FH9A 4OJKA 3IIMA 1G21E 1E79D 4QXAA 3KTAB 1G3IA 3GLHA 3O8BA 1UF9A 3GLFE 3IPYA 3U44A 3G5UA 1KOFA 4EFNA 2GDJA 3IGFA 2QBYA 4OK6A 4XVQA 2ZI5A 1G8PA 2JJ2D 4KFRA 3EX7C 5HKKA 1S1CA 2J0QA 5GJBA 5FTKA 1ELOA 3F3YA 4KVAA 3W5JA 3TNFA 5CITA 2OBLA 1D5CA 2VF8A 5TMPA 1US8A 3PXGA 4TMTA 2XOKD 4RFSA 3C14C 5DSZA 3UATA 4PZZA 3AGPA 2IXEA 3DM5A 3GJ6A 3T1OA 5TDHA 3T1TA 4RZ2A 2CL7X 1YZTA 1ZINA 4Q4AA 5KSYA 3AUXA 1CLUA 1S0UA 2R65A 5FBRB 4LBWA 4P32A 3H2YA 3RS3A 4B34A 4QJ3A 5BN3A 4QG7A 4P4TA 3U4QA 2VQSA 2B6HA 1I2DA 4URXR 4FIDA 4E09A 2ERYA 3I72A 3SFVA 1IN5A 5JWRA 4MYHA 4D25A 2C9CA 2BBTA 2H7VA 3NXSA 4M4SA 2ECKA 4JJZA 2WSMA 4H1VA 4S35A 1KO7A 1NL3A 1RFLA 2Y8EA 3PCRB 4C0LA 5EE9A 2WVJA 2DY1A 5EXPA 1OH8A 4JL5A 2VLIA 1FFHA 3X1DA 1XEXA 4FW9A 4HB0A 4K46A 3UG7A 2BEJA 2ORWA 4JL6A 1TU3A 2DYKA 2B7CA 4W5HA 3PITA 1W0JD 2IC5A 3I5XA 1BIFA 3QG5A 2G83A 4OHYA 4AKHA 4Q1CA 3S1AB 1JALA 4HZUB 2ZU6A 3GLIE 3RAPR 2OO7A 4QBIA 2EWWA 4DEYA 1TF5A 1KDPA 2VIIA 3V00A 3ZVNA 3P1JA 2ZSDA 3W3AA 3AM1A 2GRJA 5DHFA 1GTVA 3BWDD 4LC0A 1GZSA 2QORA 1YR9A 2WWWA 2ZE5A 1KNQA 2F7SA 2QGNA 3SFZA 3B5JA 4URYR 1P61B 2JJ1A 2YOGA 3QEJA 3MWLA 4BLQA 3B9PA 1EWQA 5K8TA 1G3MA 1E1QD 4HB2A 4NYMQ 4H1UA 3TE6A 3MLEA 1DBSA 3TQCA 2ZE7A 4NDZA 4B48A 3ICQB 1O87A 4JLNA 2HT6A 4TMWA 4AURA 4GFDA 3SQWA 1QHGA 1RJ9A 4OK5A 5CDFE 2QRZA 5JJLA 1JAHA 3WYAA 4EQ6B 4CT4B 2ZJOA 1XZPA 2YVUA 2NTYC 2WMOB 2BKEA 1A2KC 3B1ZA 3FDIA 3OIVA 3SBDA 1Q3TA 4MA4A 4QNMA 4ZPXA 1Z83A 1VMAA 5FOTA 1E0AA 1C9KA 4X8MA 1JECA 3I92A 5AUNB 5JCZA 3KB2A 3O8DA 2XZLA 3I8XA 3RVBA 3FOZA 1NVVR 2GAOA 3EZ2A 3Q5DA 1OXUA 1XTKA 1OV4A 1HT1E 2C95A 3L82B 1KDTA 5FL7D 5GJVC 2QM7A 3QKTA 3IHLA 4QBGB 3LXRA 3ND9A 4XIGS 1ZMXA 4ESHA 5JMTA 1NSFA 2ZI7A 1G7SA 2WKQA 2ANBA 1TU4A 3H86A 4XJXA 3U3RA 1FMJA 4C0BA 4JT2A 5J4KA 2L0XA 1QHIA 3HYRA 3DMNA 1N6KA 4KHZA 4B2LA 1G5RA 1AZTA 2P6RA 3FKQA 1TEXA 4DB2A 4HAZA 4A2QA 3P4XA 3B78A 2TMKA 4XTRA 3QUSA 2F1IA 1KZ7B 4TL9A 1NF3A 4L15A 1NNEA 1QBKC 2IYLD 3NHBA 2ZE8A 4V0MA 3R9IA 2ANCA 4DIEA 2Z43A 1QHNA 2OAQ1 4TSFD 1MR3F 1DAEA 3BC1A 4HAWA 3LX5A 3IO3A 3R7WB 1P5ZB 4M1WA 3N2IA 3L0SA 1BKDR 3DM9B 1R10A 1BMFD 2QE7D 4JIMA 2ZVPX 4DLUA 4IDOA 5DISB 5EP4A 1MKYA 2DFTA 2ZRNA 1S3SA 4HUQB 2ODEA 1KK0A 4MRVA 4C7OA 3P32A 3T5GA 1T3SA 4P0TA 1EFRD 4BE7B 4URWR 3K8YA 1YU9A 4C2TA 3ZQ6A 5FOXA 4Q1DA 2AK3A 4OQMA 2V7QA 4PAQA 2CL6X 4Q4HA 1R0XA 5KYKA 2PLFA 4BLOA 2F3TA 5TV2A 3EPHA 3T61A 2AFIE 4LPKA 5BYKA 4G0NA 1VIYA 3KFVA 2BBWA 1JJVA 2HLDA 2O52A 3AV0B 2CNWD 4LHXA 2VP6A 3DOEA 3A1TA 4K81B 2ZEJA 1F5NA 4FI3C 4B3BA 1P62B 2E1RA 3TVDA 4EUNA 1DAIA 2QEQA 1UKEA 3GLFB 4M21A 4QGAA 3DZ8A 1KY3A 4D82A 3WNDA 3ADKA 4DCNA 4CEIB 1VCOA 2QPAA 2ZAMA 1PLKA 5AJVB 5KSOA 5JS8A 4MKHA 1W5TA 1CRQA 4D6PA 2BMEA 3SEAA 4H9GA 3THXA 4I99A 1NSTA 5LDDC 3BD9A 1RRCA 3RWOA 1XMVA 4A6XA 4OBEA 4EPYA 3IIKA 4WAUA 4BFWA 3CBQA 3JVUA 2DWOA 4DCVA 3ZS9A 2EW1A 3B9QA 1E4VA 1ZU5A 3RS5A 3AKCA 2WOJA 4XH9B 1M6NA 1P2TA 2IL1A 2J7PD 2O5VA 1RC8A 4QRHA 2FSIA 2ZR9A 4E22A 5FUWA 1GDDA 4B33A 2XTZA 3ASZA 1XCMA 4LZZA 3IIJA 3I1FA 1OH7A 1AJEA 2FA9A 3LBNA 5SZKB 1G6HA 5FTMA 3MGCA 1Z47A 1KI2A 2ZREA 4JVSB 1HYQA 4I1SA 5JSZA 4D26A 4ERNA 2ZI4A 4YQFA 3UG6A 3RRMA 1JJ7A 4C3ZA 3CLVA 4F93B 1UAAA 4BFXA 2JLXA 2XXAA 4FCTA 3TGPA 1FTSA 3AVXA 1AS3A 4TZ6A 3M6AA 3SYKA 1Z08A 1IXRC 2B7BA 2GXQA 3Q7PA 3WMFA 2PEZA 2WKRA 3GLIB 2Q3HA 3NTUA 1QHSA 4Q4JA 4TLCA 3RS7A 3W90A 4DEXA 2WWHA 3QVUA 2A9KA 4ZCLA 4M53A 1J7KA 2WJJA 4CEJB 2QMOA 5B58C 4B35A 1CULC 2Q3MA 4XOIA 3LNCA 3A1SA 2ZROA 4U02A 1NN1A 2YC4C 1VYTA 3ADBA 1F2UA 2DWPA 1E2LA 1MT0A 2QTHA 1P73A 5CJPA 2F9MA 2IWHA 3W3ZB 1E2MA 1E2KA 2ZPTX 2QAGB 4GMXA 2FPLA 5KDLA 4PPFA 4O0MA 3QXXA 2EU8A 4LJ6A 5HCIA 3SHFA 1SVMA 5AJWA 2A30A 2Q9CA 3H0KA 4B71A 1S4QA 3NBYC 3I61A 1SKQA 3VU9A 3LW7A 2JLRA 5L3RA 1T6NA 1DS6A 4UJ3A 5KNCA 2WJIA 3NDPA 3ADCA 2A5GA 3RYTC 4DCUA 4RZXA 5FBQB 2MSEB 3ZZ0A 4Q7LA 1FX0A 2GA8A 4AIIA 5AWFC 2DR3A 4M9QA 3LQRA 2XB2A 1L7VC 4F7WA 2C96A 1II8A 4Q9LA 3RWMB 1QG2A 1II0A 2VEDA 2G77B 5F98A 4HLCA 4NYJR 2GILA 2PZGA 1TADA 2GJ8A 4PC1A 4A0HA 2NO6A 3AKDA 4ZKDA 2RGAA 3GJ7A 1H8HA 4XWAA 2Z5FA 1B0UA 3QXSA 4YONB 4RKFA 3MJHA 3OE7A 1U81A 2CEAA 3TMKA 4PC7A 5CIWA 1XXHA 5GADl 2WJVA 3A36A 4UXJA 4KYUA 2VHUA 3RRNA 3X1WA 1W0KD 1A2BA 3K9LA 5E7IA 4Q1BA 3C41J 2OCYC 1S3GA 3IPXA 2LWIA 3UKDA 4RD0A 3NKVA 4TLDA 4F92B 3HU3A 2EVWX 3GLHE 2BJWA 3A37A 2AX4A 5HZHA 3BFXA 2FFBA 3BRWD 4AG6A 3GCGA 4YMVA 3LW8A 2ZSEA 5IK2A 1EESA 1VHLA 4RCYA 3K9NA 4IDHA 3QF7A 4DLWA 1RIFA 4QNRA 1MABB 2ZRGA 3BFKA 3X1YA 3RC8A 4LBYA 3B6EA 2GZHA 2XNSA 1JPJA 2R6CA 2YWFA 2QMEA 2XNDD 3QKSB 2QL6A 3R8FA 1NY5A 5BYJA 2PX3A 4JYBA 1T0HB 2A5DA 2ATVA 4A9AA 3CWZA 2Q6TA 1DAHA 1TX4B 5DI9A 4US0R 5B64A 4DC9A 4EPRA 1PVOA 2CCGA 4W7SA 3GMTA 3AUYA 1E0SA 1CJVC 4LHWA 2ODNA 5TARA 2Q21A 2PH1A 2QTVB 3HPRA 1VCNA 4QC2A 3BS4A 1CR0A 5EP2A 5AJZA 1P9NA 1DADA 4D80A 1GOTA 1OSNA 4KITB 3FFAA 3B7GA 3QE0A 2B8WA 2R6GA 3N5CA 2WSSD 4M0LA 1DPFA 3ZH9B 2P67A 2V8OA 1OFUX 1U98A 1F60A 2IT1A 2X2EA 2N42A 1N5KA 1N0UA 1CJMA 2ZRMA 4BLTA 3FMPB 5E3HA 1VPLA 4Q00A 1YR8A 1OXXK 3C5CA 2BCGY 2WWYA 5JS7A 1R5BA 4C2UA 1OKKD 4KSBA 1L2TA 5KSPA 4DKXA 1OYWA 4N1AA 1ZCAA 2G1JA 4JBYA 2A2ZA 4Q9IA 2WWXA 2GXUA 1KGDA 2VHQA 2V3CC 1D2NA 4C0JA 3OIUA 4JVLA 3U3MA 1EFUA 3D8BA 4QL3A 2VHJA 1UBCA 1QVAA 2BBOA 2V9PA 4JLKA 4DLXA 4A0RA 4DUGA 3VHLB 2F43A 2QRNA 3LLMA 1IOZA 3DEFA 4XWOA 1X8KA 2XJ4A 1FL9A 4FWTA 4HAUA 5AJYA 2C9OA 3THWA 3HDTA 2ASEA 5ANRB 5L3QB 4YDHB 3UPUA 1IXSB 2KB0A 2J7KA 1XTJA 4BZPA 4M1YA 2MMGA 1VYUA 4B3CA 1GL9B 4C4PA 3PEWA 2IUTA 4MKGA 1UDWA 3QQ5A 3UMSA 3DPUA 1G8GA 2IWRA 2CK3D 4AI6A 2QU8A 2IYSA 2Q3FA 3DDCA 5DIFA 3REGA 4U5XA 4D0NA 3IQWA 1E9DA 5JRJA 2WJHA 2GEUA 2A5FA 1DAGA 5JLJA 2Q0HA 3GEHA 2A5YB 3A1UA 3TVTA 2B92A 4BECA 2V6JA 4M1TA 4WZAE 1JR3D 4NH0A 5A4JA 1NVXQ 4TYPA 1LF5A 4KJZA 3MCAA 2FPMA 3THYA 2NO7A 3UMRA 2PBRA 2QMHA 4Q9KA 1G18A 1ETUA 3ASYA 1NMYA 1E98A 4ESVA 4BLRA 4A8JB 1SHKA 3GFTA 3EG5A 5K8UA 1KMHA 1UBFA 1MH1A 1F48A 3VMFA 2FOLA 1OH5A 1IXZA 2CE2X 2X2FA 3KKMA 1KKMA 3EPJA 4XD7D 5JJIA 2YWEA 3B1VA 1XDBA 5DHAA 5CJ2A 1UADA 1P3JA 4HLDA 4L4UA 1WF3A 1W48A 2OEPA 4V0ME 5JHGB 3Q72A 1VG0B 1LY1A 3AP2A 2C99A 3M1IA 2W6ID 1F2TA 4N0DA 3M4YA 2ONKA 4PZYA 2ZYUX 4JLPA 5HR5A 5KSZA 5FUXA 4F4JA 3SNHA 3RC3A 4EPTA 3QKRB 4YC7A 4FMCB 4V0OA 2JDIA 4V0NA 4TQ9A 1SVSA 2H57A 4DT1A 1ANKA 3CRVA 3IEUA 1E2PA 3D31A 1YZLA 2UKDA 2Z0MA 5L3SB 2FFQA 2R8RA 3SJBA 1DG1G 2D7CA 1KI6B 1NBMA 4KU4A 4PSVA 4V03A 4EJSA 1N5IA 1XCPA 3SC3A 4CGZA 3CM0A 5F9FA 4X8HA 1DO2A 1GITA 1EWRA 2ZM5A 1OW3B 5DYIA 4UKDA 3ZVRA 1EX7A 2I1VB 3CNOA 3QEOA 2IS2A 2A5JA 2WPDA 4MDEA 4TTRA 2IX3A 2NOAA 3H84A 5GVRA 5KDDA 5EQTA 1XD8A 1XTIA 2CHGA 4JZKA 2EFHB 1NIPA 4BASA 1KHTA 3AVYA 1ZD8A 4TQUS 5FOSA 4JJKA 2G0TA 1NVVQ 3GLHB 2QUZA 1UBGA 2A7QA 3THOA 4KLZA 4G5RA 3U44B 1NLFA 3CR8A 1MO5A 2QBYB 4DWJA 4Z8YA 1DAFA 4D2IA 2GNOA 1I4TD 4WA7A 5AR1A 2XJ9A 4L5BA 2GCPA 4CVNA 4ZDKA 1K6MA 2NO1A 3B2EA 4DRZA 1J8YF 4RD4A 1US8B 5HPYB 1NKTA 1UFQA 2PZEA 2XITA 2D2EA 3PUWA 4RFSB 4AK9A 4EJSC 3CPHA 4DB4A 1IJFA 2VYFA 3NBZC 3OEHD 1OLOA 1SXJD 2WMNB 1RVDA 1G1MA 3W6NA 2W00A 1QF9A 4IHQA 2R44A 4TQAA 4NYIR 1G16A 1D8TA 4OI4A 1YRBA 3JZMA 3NVAA 3GEIA 4ZDIA 3LLUA 4HB3A 5EP1A 2IBMA 4BQSA 2NMVA 2F9LA 4TL8A 3CX6A 1N0WA 1NLZA 3X1XA 4D4JA 3LBHA 4CRWB 1II9A 3K0CA 4Q9JA 4LJ4A 4YXWD 1P2SA 2GF0A 2IF0A 3T06B 5DN6D 1J8MF 1GVNB 3CRW1 2DBYA 4OHVA 3BXZA 1W4AA 4TTPA 1KK3A 1E9FA 2FN4A 3QPWA 5DI3A 4FMDB 5A5GA 3Q85A 2HV8A 2QI9C 4LWZA 3K0AB 4I1UA 3K70B 1ZM7A 4RZUA 4DLTA 1TQDA 4A36A 1D9XA 3BOSA 5DYGA 1S96A 4GMDA 3U3JA 3MFYA 3JZAA 2RGCA 3BK7A 4A1FA 1U99A 5C18A 3KQLA 2GWHA 4G1UC 2J59A 5DO9A 1X6VA 2PL3A 2UVQA 2BMFA 1YZQA 3ZVLA 5AK0A 1LS6A 1ZCBA 3K0CC 4OL0A 1NG1A 2OFOA 1CJKC 4Q5IA 5FR1A 5H1YA 2RGBA 1Z6GA 2V6IA 2WOOA 3KKOA 3QG1A 4HEJA 4JSTA 2NO9A 2ORIA 3WRYC 1AGPA 4E07A 3TUZC 4W5WA 1VYVA 2IUSA 1KSFX 3D3QA 3RRYA 3MMPA 2FZ4A 4JVMA 3F8TA 4PPQA 2IW3A 4GBMA 3CIOA 4NKRA 4GOXA 1UBEA 3P20A 2O8BA 5DLQC 4HYYA 3AQ4A 2Z4RA 3UWOA 1N6HA 4PHGA 5G40A 4CW7A 2E9SA 4QM6A 1XX6A 2W6JA 1R0YA 1CTQA 4Z8XA 5FPTA 2DHRA 1YRAA 1DELA 2MSDB 1SXJB 1T3HA 4OJQA 4R2HA 3TR0A 4CF7A 1E1RD 5FOWA 2ZSBA 4DIDA 3AEZA 4X8OA 3FYHA 1NVWQ 2JIZA 4GPTA 4ITRC 4AKGA 3OZXA 2VO1A 1A82A 2YHSA 1ZVQA 1A4RA 1XXHE 3TAUA 1TF7A 2AL7A 1XCGB 1E9AA 1X3SA 4A4DA 2BV3A 4MDFA 1JXMA 4OHXA 4MUAA 3UANA 3VX3A 4PXAA 4FMBB 2KI5A 1ONBA 5HTKA 3C5HA 4GP7A 1GNPA 3GQBA 2CJWA 1YZGA 2FSGA 2ZYWX 4CEHB 2FEOA 2ZSAA 1M34E 1GP2A 1FQKA 2DFNA 4B76A 2ZRIA 4DVGA 3DVLA 3QNUA 4KFSA 5E4FA 5B2ZA 1K5GA 3BB4A 4R2IA 4KBGA 1S9HA 5IT5A 1YZUA 1LF0A 1XEFA 1S1MA 4F4IA 3FHTA 3IKJA 3CX8A 3KXLA 5EZ5A 2QNRA 2VHTA 1P9WA 2WJYA 2CLSA 1G41A 5BQ5A 2VP0A 1L4UA 3WMEA 1H8EA 3LRPA 4DDVA 2JLWA 2IS6A 5FBLB 2OV2A 1E3MA 5DH9A 1WP9A 3OESA 1N0VC 1KAGA 1VG8A 2IA5A 2ERXA 4TLEA 2P2LA 3I8SA 1CJUC 1ZD1A 1NN5A 2ZAOA 4C7OB 2HF9A 4C0HA 4EFLA 2FGKA 2ZU0C 4BFSA 2X8AA 1G4AE 5KHOC
chains in the Genus database with same CATH superfamily
1ZIOA 2DF8A 4W5OA 3BM5A 4CQLA 1RXSA 3R3UA 4RVNA 4BNZA 4IIFA 1C1DA 2OKCA 1W5FA 4UVDA 3UMFA 3ICCA 1SUCA 4NR0A 1UK6A 2AOVA 4EY3A 3UVEA 3R7NA 1DCMA 1R0RE 4DPKA 5IXSA 4P4SA 4MJ7A 4Q4HB 1MO2A 2CHQA 3ZV5A 3LQKA 3IYLW 1DVRA 4GDFA 3AVQA 3GH3A 1E7SA 3KJEA 3WS7A 2ZULA 1GNVA 3VBEA 3V2IA 2YHAA 4J9UE 1OWPA 5JRDS 1X1EA 3EMBA 4LTNA 4ZYXA 4K6CA 2VWQA 2WJ4A 3NHRA 2CBZA 4ZYLA 2EBHX 2ODWA 1G9XA 2KSQA 3RBAA 4XM0A 2WG2A 5FNVF 4AC9A 2BKVA 4KLAA 3WR5A 4PO1A 3IAM1 2R9VA 1Z4LA 4RELA 2GJ9A 3ESYA 3SYLA 3OFNA 2ZWMA 1I4WA 1OPXA 3EF3A 4EKDA 3AH8A 2Y76A 1LUAA 1Y5LA 1ODJA 2UYGA 2FMFA 2LVBA 5TQ2A 3EIFA 1Q44A 1NRWA 2AEJA 1VOTA 1V4BA 3KXDA 3MYYA 4G3XA 1QZTA 3I9KA 1Z6XA 1KHHA 2AEFA 3LLSA 5AHXA 4AKIA 4U63A 1A8HA 1BCRB 1NKSA 1IWPB 2VC2B 4HGNA 2OLKA 1ZN9A 4HMPA 4J0HA 4S0ZA 2BMDA 1KH2A 1T3ZA 1OXTA 2BEUA 2IYZA 2PKYX 3L7DA 2BDUA 3DUWA 4OKIA 5EERA 1U5BB 3CPEA 4DDTA 2TS1A 1Z22A 1Z5NA 3SSAA 3GRCA 4GI7A 2WI8A 3QPVA 4BHTA 2G1PA 1X2EA 1J70A 4BLSA 5KOHA 2O7VA 3R1IA 3IH5A 1HYHA 3D3JA 2OSBA 2QSYA 3TVYA 3LIPA 5CNKA 3B7PA 1OUMA 3JQCA 4CLHA 4P0QB 1Z2NX 3DDWA 1GL7A 4UUNA 4ZMSA 4QUGA 5EC8A 4RHYA 3SSOA 4F5ZA 3KQQA 5JSZB 3GLQA 4RKRA 3FYUC 3IP7A 5FPPA 1FFEA 2HSGA 3H19A 2PUHA 3TRKA 4AZ0B 2RB5A 1JG6A 2PMFA 4N82A 4RDCA 5CK4A 3RFXA 3ZE9A 1B0ZA 3QY0A 1RKXA 2HMWA 1BROA 4AL4A 5ALNA 4UQLA 2IHUA 3F4KA 3VHXA 1B3BA 1KO8A 5EZQA 1QE5A 5D5HA 4K87A 5J2UB 4FFSA 4XYMA 1DPGA 5HGJA 4WZBB 2X4GA 3WRXA 1KYYA 1A95A 1ZJZA 2GYUA 3M9XA 5KREA 3ZN2A 4ARVA 1I2MA 1EH5A 2FUG1 4QOGA 1QCCA 1HGXA 1Y8AA 4YCAA 4ARSA 4UBOA 1LNZA 3D8TA 2JLCA 1TEHA 5C8YB 5AVKA 1MC1A 3O1HB 2CLDX 4MJXA 2H2WA 1QIDA 3VVLA 1QWOA 3QBJA 3ZE8A 4B3DA 2JJ2A 4B75A 1BE6A 2GZ3A 1CRPA 1WZIA 1KOJA 3WGNA 2NYRA 4COOA 3D7LA 1D1PA 4FLEA 1PFUA 1WCIA 3BE5A 4W9NC 3C16C 4HUTA 1RXWA 1YK1A 2JASA 1V5WA 1Z5UA 1GQSA 2FFJA 2XOKA 1F17A 4YPOA 1KZYC 2AQKA 2IE8A 4R71A 4A0FA 4NBRA 5JATA 4LBZA 2H85A 1DT3A 2VA9A 2WSBA 3DYBA 5GONB 3G0HA 1FDSA 4X1OA 2F67A 3DLIA 1ABEA 3HXTA 4A82A 3I62A 1FNBA 2OUIA 2WJ3A 2P9HA 3D2CA 2XGJA 2AW5A 3EAQA 5JR3A 2AXEA 5A4FS 3RJTA 1K5DA 1FNDA 1C7FA 4HNAB 4FS8A 3FOBA 3GRFA 1NJGA 3LC0A 3OTWA 1I2BA 3WNVA 4PGHA 1XP8A 4CR8A 3D7NA 4YUWA 3VR5A 1SK9A 4C08A 4WLVA 1W47A 3GJ3A 3TIIA 3HWSA 1NVAA 3HFJA 5CH5A 3SHWA 4P08A 4BTEA 2MMCA 2R8EA 2W43A 3CV3A 1M6WA 3BG5A 1MMFB 3KE8A 1Z2AA 1NWHA 4H27A 4UDNA 3UJ3X 2JAQA 3A6HA 4OJYA 4CPDA 5AM2A 3GIWA 4GPEA 3PXEA 5KNDA 3FPKA 2H1IA 2C2BA 5ITZA 5H3LA 4YCMA 3W5AA 1DDIA 3WC4A 1G7TA 1CDZA 2R4UA 5C1PA 4EX6A 1EBUA 4KPYA 2OXCA 4HDMA 4PV7A 3LC7O 4J1TC 4MLCA 4QJ5A 3H2SA 4D46A 3KQUA 3D4LA 4DWVA 3A6KA 1Z36A 4O5OA 4U9HS 3O0DA 2QN2A 1J5EB 1SG9A 2QLMA 1QH0A 2WR8A 4PLFA 4D6YA 1XDDA 2ZJ0A 4YRLA 3CISA 4P80A 5DM70 3WIDA 1EBBA 4OQLA 4WK0B 4G0OA 5EP3A 3WE7A 5BR7A 2C42A 5EMMA 3F6CA 3DZIA 2QA5A 4OJTA 4F4DA 3AB3A 1PUJA 1KYVA 3L4BC 1NAIA 1VI5A 4O63O 4PBSA 4DCCA 3IB6A 4B3XA 1NVGA 3PTZA 1P1IA 4M0PA 4F5WA 1HEIA 3MJFA 1LBIA 1J1ZA 1U2RA 2Z30A 4LTDA 3TD2A 1KO1A 5DJ5A 2X86A 4IFIA 4YJHB 2D3WA 2AN9A 3FZYA 4C0QC 2HCJB 3DOIA 1UQTA 3AF0A 1U8AA 4P5DA 2ZUUA 1RLUA 4GG1A 4JJFA 1EUCB 5E1MA 3VR6H 3ZJVA 5EHNA 4L0MA 4GI5A 2P3QA 2IITA 2FSUA 2A4MA 2O4CA 4XJSA 2X9QA 1E1QA 4EB3A 2SBTA 3T1TA 3CO0S 1GNTA 2FDCA 3OTIA 5K6AC 1ADFA 3ROPA 3CNLA 3OO1A 5E8RA 1NUHA 3O7WA 5LIRA 1HSZA 3TFOA 3QEBZ 4R1NA 2FG7C 1C4OA 1YA8A 2CJXA 4LNUA 4OUKX 2RFLA 2VTEA 2Y3IA 5G2OA 1LRJA 4RNDB 2ZR8A 4BZZA 1J49A 1E18A 3M6LA 1RYNA 1W8DA 3AW9A 2F4NA 3ZWMA 5J47A 1FOEB 2WT8A 1EQ2A 5DNDA 3TEFA 3TQOA 1XWIA 4IW3B 3UHFA 4P54A 3IEIA 3T5DA 1PLJA 3KQYA 1JPNA 3SS7X 3T94A 4EA9A 3K2IA 3RK4A 5JEEA 2OO3A 4LGVA 3PC7A 4DQUA 2P2NA 1ZAKA 3GD7A 2B3TA 1M10A 2C8VA 2BUBA 2LE0A 3K96A 4C43A 1TB4A 1M1YE 4HJRA 2VATA 1SXQA 2Q6LA 4FINA 1OXMA 3CTMA 4XM2A 1DDOA 4QQNA 2LW7A 3E4DA 1IUOA 3JWPA 2FEAA 4HFJA 5FL7A 5C5DA 1KJIA 3OSZA 4GDMA 1HI9A 2DPXA 1H5UA 4EHHA 1YE5A 3Q41A 1HE8B 3T9FA 1KBOA 2IXFA 1V8DA 4DM4A 1KI7A 4TGLA 3WLQA 2P69A 1GAEO 2FP3A 5U4QA 3PUZA 1WZNA 1F0PA 4CDGA 4WEOA 1WPRA 3ZJ4A 2BSQA 4OXNA 4FMCF 4HPWA 2EERA 3RWBA 1VG9B 3WO1A 3E1GA 3IB3A 3M81A 4CCYA 1V8FA 2YWCA 1DKPA 2OFWA 1E61A 2P3SA 4MARA 4ZJYA 3DEJA 1F4PA 4GHWA 1R0KA 1U0RA 3PI6A 1TM4E 2G9NA 4N3CA 3STYA 1VE6A 5CLQA 3TIFA 2BFMA 3AVUA 4CV3A 3WL6A 2B61A 4OH1A 3SM9A 3DFFA 1W4ZA 1IM2A 3F96A 3OT5A 4FJ0A 2F8LA 3FUWA 1D2GA 4B6FA 2HJSA 3DAFA 4Z2YA 4CMJA 5KNLA 1Q6YA 4YALA 2J45A 4GT1A 1PWZA 3HJAA 4BO8A 1TMOA 2BI8A 1EK0A 4KN8A 3T1HB 4OX9Y 2A0FA 5EJ8A 4TZ0A 1XPUA 3L6EA 2OM2A 1PBTA 3WAJA 3GY0A 2W2KA 4DV4B 1QO7A 3L8ZA 3VUEA 2ZRFA 3HGTA 3K2BA 4C6RA 1KSJA 3GD5A 5THQA 3DVAA 1N7GA 4COKA 3NOOA 2P9JA 3H2HA 1QO0D 4MHTA 2V8BA 4LRXA 5AVWA 1XD2B 5DF1A 5KOJB 1O96B 2XKBA 1L4BA 3LQ4A 3OQJA 3ZZTA 5L3ZA 3UWMA 3LFUA 3GI1A 2ZR7A 1KSGA 3CZMA 4ZVRA 1DWUA 1XLUA 3JQQA 1YXMA 2Q5QA 3WGHA 4GSLA 1VKNA 2CNWA 3O4IA 2ECFA 2G25A 1VLHA 3PRKE 4KKXB 3RYIA 4NPCA 1CX9B 4LJLA 5KU1A 1ZMOA 1DU4A 3PDJA 1EK5A 3OEED 3HKBA 1XMXA 2JBHA 1EUDA 1UP4A 4MV6A 1XCBA 4V0SA 2O8EA 2JVIA 2QTFA 4PGMA 2QXUA 2ZIAA 3OQIB 1QPZA 4KC0A 3EFEA 1DTEA 4L73A 2QZ4A 2B35A 3M33A 4LXXA 2D5LA 5FHQA 1N8SA 1ZOOA 1IZ7A 3O0TA 4L50A 3F78A 1R0BA 1YACA 2ADMA 2P9CA 3PWZA 3P96A 2XGGA 4C7JA 3QNMA 3M5WA 4HUJA 3LCUA 2NP7A 1EUYA 3ZBTA 4R1OA 3FGOA 4OA8A 2N3ZA 4YTEA 2FP4B 4PZ0A 5JFTA 1XZGA 1UC8A 2BGTA 3EQ2A 3M34A 3OM1A 4HDCA 1LS1A 5DRTA 5FYQA 3GFVA 5HYVA 1YL5A 2ZRPA 4W5JA 1PJCA 2FEMA 4C78A 3HNRA 1X7GA 4ZOLA 1IN1A 4Y0NA 3E03A 4JK3A 3K2EA 1C3EA 2CMDA 4KV7A 2RH5A 1RBZA 4PICA 3Q8MA 4KCGA 5H8WA 5EZYF 3UOAB 2PUEA 2XTNA 3NHFA 4FCCA 4GLLA 4AIRA 4BKMA 1PNTA 5I47A 1F6BA 5E1OA 1E3TA 1NI5A 2AFVA 2DPYA 3CHYA 1FC0A 1XHFA 4X1IB 5E1BA 4Z0TA 2ZCVA 3PE4A 5E4JA 1GPAA 1RWWA 1V3TA 4IFTA 4BX9A 3TDNA 2P65A 4CMIB 5B7PA 5JS1A 1J8FA 3PYXA 4O4LB 4EYSA 2EL9A 1ABBA 4HL6A 4Q01A 1NE7A 1DQZA 3EH2A 5LB4A 4O3MA 4B81A 1XOIA 3LKBA 5FEUA 2I3BA 3TKAA 4HNHA 5LP6F 1TPYA 1QZ3A 2OTCA 3MTBA 4F6RB 4F1WA 1M67A 1TYEB 1YO6A 3G5AA 3OOHA 1XTVA 5F2OA 1LI7A 1WU7A 1NVUQ 1VBMA 1Y1SA 3A9WA 3BZUA 4M87A 4TLAA 2JI4A 3EISA 5CCEA 5IG2A 5LM3A 1XU9A 2CE7A 2PLRA 3SLRA 3HU2A 1EZ1A 1ZBDA 5EMKA 3ODGA 4ESOA 3FPFA 2NN3C 1ZIYA 1YOBA 2F59A 3EDMA 3OU7A 2C2XA 3Q3JB 3IJ5A 4E46A 3AONB 6AT1A 1QTQA 1HOTA 3V9PA 1JKJB 1QHXA 2WV9A 4YRPA 3LWBA 1ZM3A 1U7UA 2QD4A 1MX1A 2P2SA 3V48A 5IC5A 4Z7OB 3A1NA 1A7UA 1OROA 3FA2A 1DAMA 3FCXA 2VJMB 1KIMA 4GGPA 3COWA 2ZXUA 1FB5A 4FFBB 5LPNA 1OLUB 1JMVA 3HKCB 1NV9A 3OLZA 3TTUA 4B6GA 4RXUA 2KLBA 5FUYA 2X6TA 1OXVA 2V7TA 2ZBRA 4RSMA 1Z8HA 1ESNA 1KAQA 3FGNA 3CWCA 3QOXA 1CR2A 2C3MA 4WLFA 2AF4C 4YJ3F 5FUMA 1X38A 4PTYA 3BXHA 5F9HA 1HDGO 3KLNA 2D2FA 3GUCA 3QSGA 3FG9A 3LGAA 4OTZA 5FYDA 3ELUA 2UUAB 4IJVA 4EI2A 1Z2OX 1A0OA 2PCJA 2W6PA 3B1XA 3ZNNA 3LO8A 3LX6A 3BL8A 4JU9A 4AX4A 1MZPA 1DJLA 5FPSA 1QGUB 4J0DA 3RDPA 3FVTA 3U3XA 2CFIA 2IQ5A 2PVPA 5AVTA 2KBEA 1JJBA 3D6AA 1Y42X 3KKLA 1Z0AA 3R6DA 3GJ8A 3B7WA 4YQZA 4ZVLA 1ZN8A 1I5RA 2LPMA 3FB4A 4KAXA 4MWSA 4ZA2A 4ILKA 3I2YX 3EXAA 2IH5A 1XTUA 2X40A 3LXMA 2FX3A 4K9LA 2J5XA 1KSHA 2UYHA 2Z04A 1Z7EA 2ALJA 2PBLA 2XYQA 2ZTVA 3MJVA 3NRCA 4WI1A 1XAHA 2K4MA 3R09A 4WOJA 5C34B 4DLLA 4EG8A 1F7UA 4OXIA 2ZZMA 3ABOB 4J3FA 1T5LA 5TC4A 4DA7A 5EXTA 1NW6A 3R0QA 1GFWA 3LGSA 3E81A 2XT0A 4EWLA 3GNLA 4HQ0A 4KO3S 3HUUA 2I65A 4U1RA 2AJ8A 2GB4A 3NS7A 1KETA 1KQOA 5EZ6B 1T13A 4FI3F 2OCPA 2F1HA 3EVTA 3RTGA 1NQWA 2H7YA 2ZITA 3X2FA 2CHFA 4BNKA 5DASA 1FZTA 1EX6A 3NVMB 2ZYHA 3I32A 4I4NA 3FNGA 2YV4A 4LJ9A 1XN4A 3ZE0B 3BMCB 4FNAA 1T9KA 1HC7A 1Q0QA 3BBLA 4GEGA 2EG9A 2RGRA 4OQ4A 4PY2A 4Z2AA 3RQIA 1RJFA 5IAKA 4MYRA 5FBVB 1IY1A 2G0NA 1CDDA 3AUKA 2BHNA 1N3BA 5HOQA 1FDRA 3E61A 1TW2A 3TOSA 4ZCMA 3CEJA 2QM0A 1JB1A 4OF4A 3WNCA 5JCPA 4GOLD 5ADVA 4LY6A 4IEIA 3BIFA 3ZU5A 1P1HA 3DMFA 3UTCA 1TVMA 4C20A 3FUTA 4YHHB 4CU2A 5K6RA 3DQPA 4LGMA 1NNSA 2GM4A 5HSGA 4R2WA 3ZHUA 4HAYA 2FWRA 1VC2A 3OF3A 4PIMA 5E9JA 5K20A 1DRUA 2H3HA 3QA3E 3C3CA 2V4ZA 5I9SA 1QG0A 3TQQA 5EPEA 3ZY3A 2PE5A 4FBLA 3MCVA 2D1TA 1BQ4A 4BEVA 5BYAA 2Q3JA 2DFDA 1A77A 2UYQA 2Y1OA 3MSCA 5FWNA 3RARA 2IP1A 1PL6A 2RH4A 4O2AB 1DJOA 3F97A 1FYXA 4JXZA 4DNQA 1WTAA 1LQ2A 4LMBA 2EFJA 2JGRA 2FV8A 5REQA 4G6ZA 1LDYA 1UH5A 2FPSA 2Q46A 5A5DA 3QVSA 1Q0ZA 1VM6A 1P9RA 1W7AA 3R5JA 5CCXA 3HEMA 5L7TA 5BSRA 1QX3A 1XEXB 2QG4A 4YV1A 2C7PA 1D8AA 1T43A 2EZUA 2I4TA 4O1IA 4XEUA 4LOLA 3USCS 4FLFA 5AK3A 4ZEVA 3GLVA 2Q2NA 1VJCA 3RE1A 1K97A 4S1TA 3UPTA 1NP3A 4ZHQF 2Z08A 1RLIA 1PO7A 1W52X 1ZVJA 2YJZA 4ZV7A 5IT4A 3A06A 5AVXA 2ZIXB 3GO4A 5JIBA 2HC9A 3WK8A 3MAAC 3C97A 4V02A 3SX4A 4NJMB 5KQLA 4YGXB 1OIXA 1Z8FA 2PT9A 1JDNA 1N8KA 1ZRNA 1HT2E 2FRXA 2XYGA 4BLPA 4W63A 3WLPA 4I55F 4G0PA 1NJ2A 4OKNA 4RMIA 1ZD9A 4RZHA 2UXCB 1UZUA 4IP0A 3AT1A 3C3PA 5ANRB 5A3JA 2I7CA 2HRDA 1XKQA 3F47A 4DJDC 3IBTA 3EPRA 2OXFA 3WGLA 1JSCA 1QYXA 3ICOA 1QU2A 3EGDB 3UWSA 1T4GA 2RI1A 4C03A 3KWMA 4YMUA 2E82A 1QDEA 5ALJA 1V9SA 2FUG6 4LSWA 1Y5NA 1NC1A 2JW5A 3VI4B 3KLPX 5CLLA 1RRPA 1M3SA 4HWOA 1W9HA 1LDEA 1P7WA 4GU5A 4QJBA 4Z1OA 5B7GA 1N33B 5BP7A 1S7GA 1UPCA 5EJ7A 3GR6A 3TR5A 3NG1A 3PHIA 3NBXX 3S4YA 4ONEA 4R9UC 5CEEA 3DBLB 2CNNA 3N2EA 3IMGA 3JQAA 2NZUG 1L5NA 4CQLB 2LCFA 2QP4A 1C1DB 1PL8A 1ODSA 5KTMA 2GD2A 4I4TF 3AEUA 5EEHA 3AXSA 4K40A 4QGHA 1E7MA 4ZI3A 1EFPA 2JATA 1ZU4A 3IOEA 4P4SB 3LNTA 2NVWA 5MF6A 1K7FB 1YVRA 2X77A 1SOAA 3FMIA 1XT6A 3V8EA 3PFCA 1R2QA 4YJGB 3ZD6A 3QSYA 3MINB 2FQYA 4HTAA 1LK7A 1RQNA 1YDMA 5LFAA 1VTKA 1VL8A 3QENA 2GEVA 2HDOA 4LIPD 1E2GA 2JGMA 4FT4A 3Q7TA 2OESA 2G88A 4D9JA 5IMSA 1O97D 4RTSA 2C7RA 4NCAA 3OIYA 1JAZA 3ZDQA 1WG8A 4D2IA 2EGUA 4D3ZA 3KQPA 2H4JA 4GPIB 4CKWB 5C4MA 2ZUEA 4RK0A 3DZGA 2VUHB 3WLTA 2VDLB 3I6MA 1VIDA 4NICA 4BMOB 3ZVMA 4JWKA 3EXEA 3IKLA 3GMIA 2D74A 4E7OA 2YVKA 3UWDA 4XVUA 2I80A 2X0JA 3ITEA 2O05A 1GAJA 3LVFO 4PQYA 4HWGA 3WMGA 1L7RA 1NNUA 1IN7A 4GMHA 2RI6A 1BN6A 3EODA 4JA2A 4C30A 1UFOA 3OFKA 2IPXA 4GGOA 4U9IS 1AA9A 3C3EA 1KEPA 4MRSA 2W6IA 3H4MA 2WB4A 3X1MA 2AJBA 4Z0PA 2Z2KA 5SZIA 4Q7KA 1UOOA 5TT1A 2OQVA 4DA0A 3K0AA 5KOHB 3B6JA 5LOVA 2ZPUA 3IAFA 1N2XA 4JB0A 3OQMA 3TXXA 4LWQA 3W5BA 5HP4A 1AHIA 2Q7DA 1CJCA 1B23P 3RC7A 2P11A 2H6EA 2BFDA 4OLBA 2X8JA 2BGJA 1NY6A 4MYDA 2ISQA 1SBCA 4RLQA 3T7KA 3KTFA 1RQXA 3TCNA 1U8EA 1PTJC 2J6CA 4V0LA 4D45A 3P19A 4F9FA 2XCLA 4MGHA 5CYOA 1V1RA 4QUHA 3K09A 3S3TA 3V34A 2CF5A 3SJ7A 1QKKA 1THGA 1UP7A 2CFOA 3CSDA 4RV4A 2EQAA 4EB6A 4QDUA 3TR6A 1M2FA 4RADA 5T6MA 2KWIA 4UXIA 1JHXA 4Q66C 3JD2A 5HZGA 4FZ5A 4YIKA 1HR0B 3MSXA 1P0MA 1G60A 3WLLA 2VL7A 3DE7X 5H02A 5JDCC 3ER9A 2DHCA 5CPFA 4JLJA 3T34A 3JTEA 2IGTA 4RZIA 4U2DA 2ZS9A 4YUZA 3KEOA 4JJ4A 1GU0A 3CZPA 5EKDA 5EMHA 4X6LA 3UGKA 2IIVA 3I12A 5IEJA 3ESCA 1ORRA 1Y34E 3HBJA 3DJYA 3I1IA 4X7RA 4QWMA 4BUCA 2PMDA 1UZMA 2ACVA 1J2TA 4YUXA 1JQKA 3V42A 1N2SA 3V6MA 4BNWA 2BVNA 3HUFA 3JYNA 1E1DA 2FZLA 4HQNA 4N3AA 3PQ6A 3BJEA 5DE3A 3WFIA 4JQZA 3OTHA 1AQYA 1KZGB 2OGSA 1NLMA 1YQEA 3AV3A 2PZMA 3M4NA 1X2BA 4IFBA 1P2BA 3OEHA 4EJ2A 5J4YA 5LJLA 4X66B 3NIWA 3KOWA 5CT9A 4IWYA 1ECFA 2GT1A 4N5HX 3UCEA 4HGZA 1Y4ZA 3UB3A 3FWHA 1FJGB 2HJGA 5DYNA 4WZ6A 1MJGM 1OC2A 1TA9A 3WV5A 4DUPA 3E3NA 4QAQA 1RQGA 3GGGA 3SQNA 3OE7D 1TEZA 4JDPA 5F7ZA 3A7EA 3ZDFA 1TYZA 4BQPA 2UDPA 3NWJA 4G5OA 4PLYA 3DDZX 1NU6A 1C81A 2XKJE 4AU1A 4ZO4A 2LRHA 4KJXA 1AKWA 1NX9A 2FE1A 2PFGA 4JMLA 1T1IA 3CGGA 2VTBA 3KL4A 2HHLA 4HZUA 3IDZA 3ZCXA 1EDOA 3R6TA 3AFMA 4Q24A 5HW0A 1U94A 3BF7A 3QPDA 1Q3KA 1U7DA 3WMRA 4N6GA 4UPEA 4J1QA 4X45A 5I7AA 1N0HA 4W9NA 5EXSA 1FTGA 3ROGA 2C0PA 1Q1EA 3A2NA 4RU1A 5ITZB 3P4YA 4N7JA 1NYTA 1EVQA 4MCHA 5JAIA 2CSXA 1AB5A 2YXNA 1NMXA 1S9DA 3QE3A 2PJUA 3T99A 1Q7CA 1J42A 2SCUA 4RJJA 1GG2A 1YK0A 1ICIA 1P2DA 2R1UA 2YWDA 3ZHBA 3PIIA 1SXJC 3FDJA 1SKAA 3VKUA 4C06A 3C7AA 3UBTA 2Z9DA 2YQZA 3WZ2A 1VCMA 3DAOA 4F72A 3RVOA 1I6MA 4AXBA 1TVKA 2B1JA 4OLFA 1F38A 2YTZA 3DV2A 1NHWA 2JGAA 1S2OA 3JQFA 4XYBA 3ICEA 1KVQA 2FH5B 3EIEA 5IJ0A 5BW6B 4IIYA 4YRSA 4V3BA 4H7DA 3BJMA 1TM5E 3U7GA 1C0LA 4M8SA 4UNRA 3L6RA 4NCIA 3F7NA 5G0VA 4FHCA 1BX1A 4ZREA 1UINA 2VDVE 4DPLA 3SHOA 1YVPA 1G3UA 3UAOA 3VGPA 2VXBA 2PV0A 4RTMA 1UQUA 2YVLA 2JIDA 2VSOA 3KQSA 2IS1A 4S1VA 4DR5B 3NBMA 3SWWA 3LUJA 4V2IA 4AMVA 1LQUA 5KAMA 2OXTA 3W1VA 3CZAA 1QV9A 3AIMA 4BNGA 4HBGA 3JAWA 2PR2A 4AZSA 1A9TA 1XB2A 2YN2A 1ADBA 1E9SA 3U13A 1RQ2A 1W30A 3E82A 4YHBA 4LNUB 1WCXA 3B6KA 2BYTA 2VAWA 2FTKE 4TKVA 4PHCA 4A15A 1GM5A 4IG4A 1GRCA 3EEOA 3ENWA 4HLQB 2O5CA 2J67A 5AW9A 1FNMA 1UBLS 3HUDA 1UM8A 1X7WA 3AEQB 2XUAA 5ENZA 2UVPA 4A03A 3ORYA 1DOZA 2CLCX 5H80A 1K9VF 4CFZA 2PD6A 4NK5A 2LP4Y 1UKVY 1G5TA 1K2WA 1XLTA 3GDOA 4YPFA 5F1KA 2GK3A 4EG6A 4PAOA 3TZLA 3W0LB 3UMMA 2Q5CA 1ZK0A 4NVRA 3A25A 1UEXC 4TS4A 2DWQA 1FW8A 1W4CA 4GL2A 2XUHA 3CF6R 5K0EA 1P80A 2ONCA 2ZRHA 3B9BA 1HQKA 1HUQA 3IPLA 2Q27A 5LMUB 3IHKA 3TLYA 4ZYYA 1BOFA 1A9QA 3D3EA 2WIAA 4LXHA 4MPRA 8LDHA 4LNAA 1R0WA 4AJJA 5LJIA 3VO2A 4LDNA 3FJ1A 3KYDA 3RVSA 3AR8A 4YASA 2G70A 2M6SA 1MJ5A 5ALDA 4RFVA 4CCYB 1GRRA 1IONA 5MGNA 1ZZGA 1MAAA 1NJ6A 2J0VA 1FEZA 4KAFA 3AJ9A 4F3TA 4LXIA 4WIAA 1JU9A 4NXMB 1BWRA 4FYMA 1F5SA 1EFTA 3AHEA 3CH4B 3M0EA 3STWA 1GSIA 3CT4A 1TZKA 1EFCA 3D64A 3DTYA 1EWTA 1HF3A 3G02A 3X2EA 4C4RA 2IVZA 4OI0A 1IPEA 2H1LA 2CXNA 2I03A 5IDWA 3ZGYA 5CLFA 1ICEA 4KX3A 1BXRB 3PNVA 3RYCB 2PPLA 2JJMA 2XDQA 2V7BA 4IV5A 3WB1A 4QKQA 1O6CA 1MO4A 3PZBA 4RULA 3INNA 5G53C 1E69A 4KNWA 1QP0A 3PQ8A 2WHRA 3AJDA 3AHFA 2WB2A 1P75A 1Y9DA 2VOEA 3H9BA 4RA9A 1M33A 4WX2B 1M7GA 1DIGA 3TFWA 4U7TB 3DVAB 1WEKA 1J9ZA 4X85A 3O2NA 3E15A 1C9MA 1PNQA 2P7IA 3AR5A 3JX9A 2WUFA 3M4JA 4JNKA 5BPFA 1P9LA 1JLSA 3DBOB 3HVKA 4IDCA 1Y9AA 3TIVA 1CR4A 1IHYA 1GPWB 1O08A 1YVDA 2HREA 4QJ4A 3LPDA 3SR0A 1ZWKA 4AUMA 4P0PB 1ZGHA 3E2MA 4LOJA 3SD7A 1ODCA 3N75A 4E08A 1TIPA 1Z6YA 1V9CA 4PZEA 4NMMA 2N75A 5FLKA 3JPYA 3HY3A 4X71A 1T8WA 3B85A 2ZQZA 1A5TA 2B5OA 1O9HA 3OUZA 5HILA 3RYIB 2VWPA 3T4XA 4BYGA 4D42A 2J5RA 2NZJA 3LCRA 2Q5JA 3A6ZA 4GZ5A 4QGBA 2QQ5A 2YUTA 1H0HA 1EUDB 5K8LA 4X00A 3QVGA 4GWLA 4K88A 4BAGA 4A8JA 2O8EB 6PFKA 4CIDA 1DTSA 3UAGA 4EIWA 2QKYA 3A14A 1TT5B 3AFNA 1O95C 1OGYA 2ZUDA 1WCYA 2Q2QA 2YYZA 3PXUA 1SA0A 4PFJA 1XPOA 3BIXA 4BX2A 1SEVA 1NF2A 5E95A 4X95A 1PVVA 2ZS8A 3DF9A 2GNPA 2IP2A 4IOKA 2WF7A 2XKAA 3D59A 3MMNA 4R2KA 4ZU6X 4BMSA 3ZEIA 5EQJB 4Q3LA 3TMYA 1UDXA 5EJ2A 4N40A 1CXZA 1P2UA 4OJNA 2QIPA 4FSXA 2X0NA 1W75A 2WK1A 2X22A 3II6X 5BVGA 4ZOLB 1SVWA 1X14A 1ZNYA 2GX6A 3WV4A 4QTUB 1NBOA 4BNJA 3V7NA 1Z7YA 3V4FA 1EHIA 1H1LB 2E1PA 2N0SA 4WXPA 5BWMA 1KJNA 2BPOA 3S8MA 5AM1A 3LUFA 4GRAA 1Y7HA 5J1TB 1D09A 1QYVA 4R84A 2CXXA 1KFEB 4TL6A 1JDZA 2Z6AA 1PZXA 1AKUA 3O8NA 1Y98A 4FD2A 5TIIA 4KTVE 2FMXA 3H1EA 1ISMA 4UMVA 4D9GA 5THXA 5ED4A 3FF1A 3GEDA 1XE3A 4G24A 4P7KA 1WB5A 2AUMA 2I62A 2YCLA 5FV7A 4EKYA 5H16A 5DHQA 3VH1A 4GRIA 5AIAA 1VKZA 4W1RA 4RWEA 1RPAA 3IQXA 3O83A 3TD9A 1R6TA 3E9YA 1PV4A 1X0XA 1M6VA 2PKQP 3URKA 2E7ZA 1PSWA 2ZI9A 1YV9A 3E8XA 3H9GA 4TWIA 4X0EA 2YN0A 4IFEA 4X60A 3TL3A 1YH3A 4CKBA 4V1CI 3KQHA 1VJTA 3NHYA 1XZDA 3R0VA 1Y6JA 3QELA 4DDKA 4JR1A 4D4LA 4ZVNA 1UODA 2YV1A 4RYLA 1ZSVA 2ZJ2A 5DHPA 5A5FA 4ZVKA 3WB0A 3PNPA 1NXSA 5FORA 2G9UA 5C8VA 4E03A 3FROA 1JR3E 2C3PA 3CRRA 3R0ZA 2Q1SA 2OK8A 3K6RA 4Q7JB 5JECA 4CUKA 3ETNA 4ISBA 4PNEA 3LHKA 3RT7A 5D3MA 4BFTA 3OCCA 3KHTA 2PBFA 5FRDA 4UTPA 4OXKA 2QRQA 3A1EA 3BWCA 2W2XA 4Y2VA 2HF8A 3CXRA 1FMLA 6Q21A 2B3DA 4FB4A 1GDHA 1CNEA 5F7OA 4HN9A 3IE0A 1SQFA 3KELA 4ZWNA 5JAQA 5B3JC 2HYDA 2YNMD 4PC2A 3AF5A 5ER9A 4NBSA 2GKSA 5TMBA 1T0JB 1T26A 2G76A 1JEDA 2C97A 1V8BA 5FOUA 1CZHA 1DP4A 1WW3A 1LNSA 1Q21A 3G0OA 1RI1A 3KXKA 2AV6A 5KCMA 4DVJA 4EYKA 4YMTA 4QHSA 1Z63A 3QLJA 2W2OA 1RM3A 2HHAA 1FS4A 2Q28A 3M5PA 2OFXA 2Q2VA 2DH6A 4RD3A 2IHTA 1G20E 3K53A 2QAGC 4IGEA 1K7CA 4Y7CA 3AF3A 4HWTA 3TBFA 2XCOA 4HDOB 3H3XA 2JA2A 4LCBA 4Q3CA 2GRAA 5DYTA 3WIUA 3C6ZA 1L7NA 3R9WA 1I3KA 4D92A 1MCZA 4MOWA 2P0AA 4IIJB 4B2PA 1AO0A 3TH5A 1HTWA 3ANNA 4J6FA 2VYVA 4FBMA 3WQQA 5ELMA 4PLTA 4U7HA 5CFPA 2O8CA 1BD3A 2W2MA 5D3QA 1VKRA 4GXNA 1M2EA 4N8DA 3M7IA 2I8AA 4XSHA 4IWNA 4IXWA 3IQZA 4GI1A 1T6YA 2EGGA 4H1TA 4E5KA 1JDVA 2C1EA 5KQGA 3LDHA 5KB3A 5DBGA 4F06A 4RQUA 5BSFA 5BO5A 3BJRA 3JWJA 3VR4H 1RKQA 3G8YA 1OFHA 4MQBA 3QVJA 2INGX 1H6AA 1NVEA 1Z74A 2Z3VA 4FYXA 4KXFB 4S1OA 3MMZA 3T5MA 2GJAA 2NSYA 2WJAA 1J90A 4XVHA 1KFKB 1SQ5A 4G5SA 1EGVB 1N6LA 2H5EA 5JXHA 1A7AA 2RMKA 5E9QA 5K0TA 4AO8A 1OX5A 5E7MA 1UBRS 1GILA 2JCSA 4UFOA 1YJBA 2JH8A 4RHUA 2ZSHA 1BS9A 3HCEA 4XFJA 1AKEA 1RYDA 2AJTA 1WNTA 2H1WA 2H1HA 5HQTA 5ILGA 4DNPA 4P1ZA 3KU1A 4F46A 5JFOA 1V7ZA 5M3BA 1V48A 2GD6A 4J1NA 3CH6A 3BT7A 4EPWA 4NXNB 2A1UA 4JEUA 4W9MC 3WIVA 1RRKA 1XQ1A 4J03A 1DZIA 4UUPA 5L53A 3DFUA 4D9IA 4GVPA 3CRMA 4A27A 4XQGA 1F6DA 2XODA 4EP1A 4DJFC 4ER5A 4A0GA 2AC2A 3U1TA 1M66A 4LHYA 2WTNA 5DNYB 3G9UA 4G26A 5J43A 2DCUA 5E6UB 1PAUA 5FO0A 2JIZD 1IN8A 3DE3X 1FSPA 3OOEA 2ZJAA 3EA5A 4F5EA 1PT8A 1WHTA 1NUSA 1PT7A 1XTQA 3M6FA 2ON6A 3JARA 4A5SA 4QYIA 4WXMA 3T5CA 2PGLA 3K15A 2V1UA 1XBTA 3WLHA 4M76B 1KZ4A 3PFIA 4R2LA 2GARA 4C2AA 1GN9A 2C5HA 2HCTA 2C4WA 5AI0A 4CMEC 5BSGA 2XQGA 1CY2A 1N25A 3GPCA 4ZC8A 2NGRA 3WWEA 3LHFA 4JI7B 4ZDWA 1E77A 5KVSA 1CUFA 2H7CA 3OEWA 4MAFA 2WJWA 1SKMA 4MGEA 4MRPA 3LA6A 2Q4EA 4XSGA 1E5VA 1RHKA 2RC6A 2Z2YA 5K45A 3R7LA 3GK3A 4RMGA 3CEHA 3UT5B 4AVYA 4CMGA 4TYYA 2ZVDA 4NIMA 1I3CA 1DAKA 1MB9A 4NP6A 5ALPA 3L8MA 3ZC3A 421PA 1I7DA 1OBVA 3DOCA 5E0OA 3TSAA 3GFRA 4K9SA 3WBBA 3ZTYA 1S8AA 2ZDGA 1FDVA 1UWCA 1ZNZA 1AH2A 1BKYA 1T36A 4Q03A 5EE3A 4QUKA 3ZGXA 2EJTA 1XQ6A 1SB8A 3BUSA 1UDCA 1GPBA 3ANSA 4QPNA 3IA7A 4TT3A 4J0QA 3M6IA 2R8PA 3UGQA 3GLTA 3WYEA 4L9WA 2C4MA 3U0VA 3LOUA 3MLBA 2XA2A 5CA1F 3W04A 4NI5A 1NR1A 2JEYA 3RUIA 3LYHA 4E1AA 3S5JA 4D0RA 3U0BA 1TAUA 5AM5A 4Z0NA 1NW4A 2Y0BA 1WXQA 3EZYA 1I4LD 4XZ3A 5CK5A 4Z51A 2WUWE 3D54D 4NTZA 4HQOA 1GAWA 2C77A 2HU8A 2XAAA 4MTCA 1YQGA 3UUGA 3LHIA 1FP7A 3ZIAD 5G02A 2Y05A 4LVOA 4RHCA 1FMCA 1JGTA 3ELDA 1WD5A 4R2JA 4TYQA 4DLYA 3CX4A 4JEMA 4DR4B 1LWNA 1PUIA 3BDAA 4K2AA 3T15A 3IQDB 3O4VA 4GOKA 2O8BB 2XQJA 3ETGA 4M37A 4M9XA 3ZDEA 4MB6A 1ULBA 3ORFA 3AEUB 3U4IA 3QIVA 1IK4A 1O0SA 2MJLA 2YDXA 1ZO8A 2OBBA 3NCTA 2R87A