1Z0KA

Structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGLERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding protein
total genus 57
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0kA01
5KNBA 5JBQA 1E2IA 1UKEA 3PR1A 2YHSA 4DLTA 1S9DA 3WXMA 2AL7A 1N0VC 2C04A 1AS0A 1N6NA 1NMZA 3I4LA 4GP7A 2ZI5A 2WWHA 1TQ2A 2ECKA 3NBFA 4JLDA 4D80A 1I2MA 4NKRA 2XB4A 2QBYA 4PX9A 4NCHA 2NOAA 3B78A 4D4JA 5DH9A 3AF0A 3D8BA 5FI0B 1BMFD 2JLRA 1I4TD 3QXSA 4Q1EA 3WHKA 4TYYA 4QJ3A 3GMTA 1KI6B 4PPFA 1IQPA 2ODWA 2OESA 2QE7D 4YMWA 4A36A 3OFNA 2ZSFA 1GL7A 1KI2A 3VNVA 2PLFA 4L9SA 4JVLA 3W3ZB 4Q19A 4OBEA 2GKSA 1BYUA 1GIAA 3D31A 4QRHA 1FPMA 1DAEA 2B6HA 1XPUA 4RD3A 4JJKA 2J87A 4IDPA 1Q0UA 1N6PA 4RY2A 4KXFB 5KSZA 1NN3A 4JLBA 5DISB 4D81A 3IUYA 2ZJ2A 5D3QA 4K8OA 2H8KA 1G8FA 4URYR 1Z06A 1UKVY 2ZSAA 4DCSA 5JHHB 1Q22A 4EDHA 1E2EA 2E1RA 2QE7A 5EJEA 2H92A 3L0SA 2ANBA 1EK0A 4Z1MD 1OFTA 2VP0A 3AF4A 4L5BA 1SKQA 5HZKA 2GXQA 2BC9A 1S9HA 3U61B 1E9CA 3LBNA 4NYMQ 4EQ6B 1ZCAA 5TARA 5JMTA 1KKLA 4DLRA 1AQUA 2HEIA 2UKDA 3THXB 3I8XA 4AKIA 4M9SA 5DHFA 5FR2A 3QUSA 4IRUB 2RGAA 1KY3A 5EE9A 1GNPA 1C1YA 5D3MA 3ADCA 2AFIE 3TUIC 4LJYA 1SGWA 2AD1A 3NXSA 3QVUA 2A3RA 4I4LA 2O8DA 1ESMA 4KV9A 2DBYA 3C8UA 4A0RA 2A5JA 2IYZA 4B6EA 4EPWA 1IXSB 4OQXA 1AKEA 3U3JA 4U02A 4AYWA 5JFGA 2CHVA 3SQWA 4Z51A 2O0JA 4EPXA 4Y0VA 4B32A 2YOFA 5AUNB 2J5XA 5TDHA 3SYKA 1LFDB 1YJ5A 2JATA 2W0SA 1XCGB 4MH0R 3EPJA 3U44B 4TMVA 3BFXA 2W00A 3G5UA 3DZDA 3GJ6A 5LD2B 1GTVA 2Z0MA 2JLSA 3R7WA 5EXTA 4QGGA 3B2EA 2EYUA 4Q5IA 3B1ZA 3TE6A 3H4MA 2IXEA 4OKSA 2RHDA 1DOAA 3DEFA 4EFLA 1MV5A 2CHQA 4IDHA 2OV2A 3V9PA 3SNHA 4B3BA 4L16A 1JPJA 4GSYA 1M1YE 3I8SA 2CXXA 3VQTA 2C99A 1P5ZB 3K0AA 4MYUA 1DBSA 4BZQA 4LJ5A 4TLBA 1N3BA 4PZYA 4E5UA 3IQXA 2GJAA 5HZHA 4FMDB 1MO3A 2WWIA 2BIFA 4Q4JA 2C77A 1E9AA 1P7CA 1E2LA 2ZJOA 3LH5A 5L3VA 2EFEB 2XITA 2BJVA 4XJXA 5BXQC 5JRJA 1PVOA 1NSFA 1XRJA 1DE0A 4MA4A 3CH5A 1S2MA 1E1RA 1WE2A 3WRXC 1ZM2A 1OXVA 4F93B 1XZQA 4HSEA 4NMMA 4GDFA 1A1VA 3R8FA 1TX4B 2R8RA 3SJAA 5F3WB 2BDTA 2GZHA 2QUZA 3ASZA 1TTTA 4D0LB 2CBZA 1M74A 3U6KA 4CF7A 3RYTC 1OKKD 2EW1A 1W7AA 1KJZA 2PMKA 4O0MA 1TNDA 2PT7A 2CVFA 3ND9A 2DFNA 2ATXA 2QTHA 2QAJA 2ZYUX 4A2PA 3SFVA 2O8DB 1SKYB 1XF9A 2REBA 2X2EA 3EXAA 3H0KA 4KSBA 3RLFA 4B34A 1MH1A 2OCYC 2ZS8A 4TL9A 2HF9A 4PC3A 5LB2A 4B2LA 2A78A 4NPHA 4KAXA 5HKKA 1OH6A 3TQCA 1N25A 1BIFA 2F7SA 2ZRKA 2QGNA 2Z4RA 3RWOA 2FPKA 1D6JA 4ASUD 3EIHA 3PUXA 5KSYA 1TQ4A 2O8FA 1E1RD 3RSLA 1QVRA 2ZYVX 1HY3A 1VCMA 4US0R 1JR6A 5E95A 2B7CA 1KIMA 1QG2A 3TNFA 1KYIA 1PUJA 1COWD 1BO6A 3QKUA 2UZ3A 4MITA 4G5GA 3P26A 2AD5A 4TMKA 1SULA 3U2QA 1U8ZA 3PEUA 3REGA 5KPJA 1P60A 2IXGA 1A82A 1YR6A 3O8DA 1G6HA 3OIUA 4C30A 2FJUA 3Q5DA 4OK5A 2J0SA 4ON9A 1E32A 3AVTA 1PLKA 1N6IA 4A0GA 2OILA 1O3YA 5SZHB 4C2UA 1G3RA 4HB4A 2KSQA 1VPLA 2XOKD 5FOUA 3U6BA 2GXSA 1E99A 4JIMA 4LI0A 3TAUA 1CU1A 2BBTA 4WW0A 2VP6A 4ARZA 1UKZA 2RGXA 3DVLA 3RDPA 3QQ5A 4IXNA 2GVDC 5DIFA 2IYUA 1W2HA 4M8NE 3K9NA 3A1UA 2FX3A 4RD2A 2GAOA 3CRMA 4R2IA 2A2ZA 4JVSB 3SBDA 4M1YA 3EX7C 1QDEA 1E94E 1VECA 3RS5A 3SZRA 1SXJB 2GK7A 3SI7A 2NMVA 2LCFA 2IHBA 1W48A 1J70A 1I4LD 1YE8A 3VR1A 1R10A 3B7GA 4BQSA 1M8PA 1ZP6A 1XP8A 4ITRC 5IK2D 4LPKA 1G8PA 3BXZA 1TL7C 3GLFB 5L3SA 4G5RA 2XZPA 3A58B 1BKDR 3C5HA 3Q7QA 4HLUC 1YKSA 1XTIA 2HLDD 3S1AA 1Q20A 2OUKA 4W5JA 3VNUA 1IXZA 3LWNA 2ZI4A 2YYZA 4MYTA 3FTQA 4X8HA 4H1VA 4A8JA 1AK2A 5FOWA 1CIPA 1H65A 3PEVA 3TLXA 4RFSA 2O8EA 1X1RA 2ZYTX 4BFZA 5J4HA 1J7KA 1KZ7B 4Q1CA 2WOOA 1ZNXA 3RRYA 2HCJB 1T3SA 3FDIA 3J81k 2OCPA 4QNMA 3PVSA 2CDNA 1OHHD 4LBZA 3IBYA 4L15A 4M1TA 5AJWA 5LDDC 1EWQA 2N42A 4ESHA 1P9NA 5CM9C 3CR7A 2F1HA 621PA 1IBRA 5M04A 3B1WA 2UZIR 4TTRA 3GLIA 2WPDA 3SDZA 1G41A 1YRBA 2QMEA 2HF8A 2OXCA 4YLGA 3EZ9A 2JAQA 4JBWA 2ZRIA 4PTLA 2G0TA 3GFOA 5KU1A 1M7BA 2O8CB 1VCOA 3O8RA 3MWYW 3WYGA 4IVRA 3A37A 1LF5A 3E5HA 4Q4AA 5FTNA 3HU3A 2P5TB 3IEVA 1W36C 5DN6D 2R65A 2IYRA 3BJIC 4AYXA 5G40A 3QBVA 1FMLA 4PAOA 5BN4A 4B2PA 5L8VA 2NO9A 4ACBA 5J4YA 3NDPA 1E3MA 4OYHA 4Y0AA 2XJ9A 1W4CA 2BCJQ 1TPZA 3T5DA 3T35A 3GLFA 4IFEA 1ZW6A 5HE8A 4QGFA 1DVRA 1G21E 2DY1A 4JZKA 4P33A 4QBIA 5ELXA 2VA8A 4EFNA 2DFTA 4TYQA 3CX7A 4N0DA 3K0EA 1KK3A 1AJEA 5F9FA 3HU1A 4KCGA 1W44A 4NYJR 4PQYA 4B73A 4DZZA 1UKYA 1KK2A 3OESA 4IHQA 1EFUA 1GAJA 2OAP1 3QEJA 3GLFE 2HV8A 2GTPA 4D26A 2QA5A 1U99A 3R20A 4P4SA 2F9LA 1XMVA 3TUJC 3GQBA 3WNBA 2CL0X 2NPIA 1KAOA 1W0KA 1E4YA 1C9KA 1N5KA 2WIBA 2WWFA 2ZJ5A 1FX0B 3A1WA 4EJSC 2VHUA 3HWSA 4BLPA 4EPRA 1OJLA 4WZAE 1OIWA 4KI0A 3C5CA 4WXPA 1JALA 1M7HA 1HH4A 4EFMA 5IRCD 5BYJA 2FPMA 4Q00A 4PQRA 1KI4A 5TB5A 2E87A 2PZGA 3X1ZA 3MD0A 2YNMA 4FCWA 4Q02A 1X8JA 1PZNA 5CJPA 1SQ5A 2D2FA 3QKRA 4IEEA 5EZ5A 5H8WA 2ZRAA 3GJXC 1ZD8A 1BS1A 1CR4A 2EFHB 2F1RA 2RGEA 1EFRD 4DXAA 3ZIAD 1PLJA 1RRCA 3K8YA 1TADA 3WNCA 3CNOA 5JRZA 3R9XA 4DUGA 3QPVA 2JEOA 4C0LA 2X19A 4NONA 3ASYA 1CJUC 2N1BA 3IIKA 2O8CA 3B1XA 3ZQ6A 1KSHA 4DJTA 5C18A 1SXJD 4LCBA 3CF0A 2OLKA 3K0CC 4Q4AB 2CL6X 1FUUA 4D6PA 3LX5A 3BOSA 1RFLA 2PCLA 2Q0HA 3LW7A 1RZ3A 3C4JA 3MGCA 1ZU4A 4GOXA 2HYIC 4AY2A 1IY0A 2FPLA 1H8EA 4Q66C 5TMPA 3OE7D 1KMHB 2ZRNA 1KDOA 1GNQA 2IEYA 2ODNA 2QBYB 5CYOA 3V4FA 1E0JA 3ZJYA 4JLKA 2FWRA 2JDID 4B2IA 4Q47A 1X8LA 1R2QA 3BH7A 4KHZA 4KBFA 2J9RA 2ZVPX 4UQOA 3T06B 3TKLA 3GLHB 3NC0C 1Q3TA 3QG5A 4P3YA 4EIWA 1PV4A 8OHMA 1GZSA 5GVSA 4DVGA 1Z3IX 2FEMA 1U2RA 4C2TA 5HPYB 2NTYC 4LUCA 4KLNA 4RKEA 1OXUA 1W4RA 2ZR7A 1E9SA 2J0VA 2QP4A 1YR9A 3KQNA 4R7ZA 4NYJQ 2VPPA 1Z8FA 3QENA 3KXLA 4ZCLA 4FWTA 2ASEA 1NJFA 1UF9A 2V7QA 1ZMXA 5FFMA 3V4RA 4TN1A 2QSYA 1ELOA 2ZI6A 1G5RA 3OF5A 2VH5R 3KKPA 3PUVA 1VDZA 4TTPA 5JJLA 2ZR0A 4QJ5A 2REXB 3P4YA 1NVWQ 1WMSA 4UNSA 3LD9A 3K1JA 4MKGA 3UWKA 3GCGA 4M0LA 2OHFA 4POAA 4Q4HA 4A92A 3B9PA 1X8KA 2OFWA 2FEOA 5FBRB 2KE5A 3HDTA 2D3WA 3BBPA 5DN6A 3O8CA 1LVGA 5H68A 4R98A 3AVPA 1CS4C 4NCNA 4DKXA 4O2RA 4MKHA 4BPBA 3OIVA 2YOHA 2QORA 2XTNA 4UXIA 2D74A 1XJQA 2ZITA 3UATA 2BWJA 4K46A 1TU4A 3A4NA 4FWIB 1W5SA 2Q21A 4ZO4A 3A8TA 2R2AA 1SVKA 5JSZB 1TEVA 4M53A 5D3MB 3BORA 4DLYA 1Z6GA 4MQBA 5C4MA 1IOZA 1FFHA 2Q3MA 3KJIA 5KDOA 1OYWA 1E79A 3DM9B 5E7MA 1NP6A 4XWOA 1JR3E 2IC5A 1EG7A 1NLZA 2IW3A 5K8LA 2D62A 5HE9A 4TZ6A 4LSGA 3T15A 1OYYA 1XJCA 3NH6A 2GK6A 5FOXA 2GCOA 4US2R 2ZXUA 3LO5A 1E2NA 1DAGA 3CNNA 3NHAA 3CPEA 2GF0A 2ZSDA 2WTUA 2GJSA 3ECCA 3DM5A 1VHLA 1KDTA 1G291 4MGZR 3CPJB 4V0ME 2IYYA 1K5DA 3K09C 4P4UA 2FA9A 4RZ2A 5DI3A 5DE3A 2A7QA 1G7SA 4A6XA 3KZ1E 1P61B 4C9BA 4ZV4A 1EX7A 3QE0A 3RRMA 4DRZA 1XTKA 4QGAA 3EIQA 3I1FA 1FUKA 4FCTA 2KBFA 3NIBA 4QL3A 3TSOA 3KL4A 4PO1A 4PSAA 4NE2A 3T5GA 3VAAA 2C98A 2QT1A 4HUQB 4RD6A 5CB6A 3EWAA 4IXMA 3SN6A 4D4LA 2AK2A 3ICQB 3VKGA 1HT2E 2FH5B 5CM8B 1XTSA 2D4HA 2G9NA 1GKYA 1U9IC 1AZTA 3L82B 3EW9A 2J59A 1B23P 1HE1C 3EAQA 3N70A 1EXMA 3E70C 5CDFA 1SVOA 3B85A 2GESA 1OW3B 3LXRA 1H8HD 4DCNA 4URUR 2PT5A 1J2JA 1E9DA 5EP1A 1VYTA 2QY9A 4PO8A 3R9WA 1Z28A 3U7GA 1OXSC 4ZDWA 4TL8A 3WY9A 1NIJA 2J7PA 1CJTC 2IK8A 5L3QB 2CE2X 2ZRGA 5FUYA 1XD2B 1VMAA 2P2LA 1GFIA 2V7QD 521PA 1I2DA 4K81B 2PX3A 5DSZA 4M1OA 1XJ0A 4DLZA 1CR1A 2FSGA 2V3CC 1CRQA 5FPYA 3SJCA 4QHSA 3DO6A 4DWJA 3MSXA 2IS4A 2ZE8A 2WICA 2Z4SA 3H84A 1KDRA 2QN6A 3PG5A 2ZRMA 3LAWA 1RRGA 2CEAA 2OFOA 4KITB 3BH6A 2WSMA 4LHVA 4AKEA 3L8YA 5TXGA 3W5JA 4C4PA 2FOLA 3M6AA 3ZLJA 4HEJA 4YMSA 1R5BA 2IHYA 4B3DA 1IY1A 4S2EA 3U44A 2BBOA 3P4XA 2QL6A 3SBEA 1OF1A 4LV5B 1JAIA 2GEUA 4UJ3A 5FTLA 1XMJA 3AF1A 4X8LA 2ATVA 2GDJA 2JLYA 1OB2A 3R7WB 2YC4C 3CF6R 2QAGA 2IEZA 1J99A 2HCBA 2WJYA 4PC6A 1R6BX 3FGNA 4WZ6A 1KI8A 2HXSA 4GRAA 2J7KA 1HTWA 4UKDA 4QXAA 2B7BA 4C0JA 4OI1A 3C15C 2DWPA 3HYRA 4A9AA 2BHRA 4MUBA 2XJ4A 2GNOA 4NHOA 5CIQA 2V4ZA 1IM2A 1E4VA 2YWGA 5FI1B 3AVWA 2MSEB 2EWVA 3NVAA 2CNWD 2RGCA 3CF2A 1S3GA 3V00A 4BFWA 2GJ8A 2J45A 5FTJA 1US8A 2WV9A 1NSTA 1QHHA 1ZBDA 2QZ4A 3GJ7A 3HR8A 3PEWA 1DAHA 2QEQA 3T1TA 1HE8B 2IYTA 5GADl 2O8BA 3GJ4A 1JB1A 2XZLA 3AUYA 5K8UA 4D25A 2DFKB 4CYMA 2WJIA 3PITA 2ZANA 3KUCA 1P3JA 1KNQA 3QPWA 4IJMA 4Q18A 3E2IA 4YQFA 3KX2A 3EPLA 1ODFA 3F3YA 4QHTA 3LY5A 2P0EA 3EASA 1VIYA 4J0QA 1DG3A 4LV6A 2C03A 1Z0KA 3TBKA 2RB4A 1KI7A 3VR4A 3W8RA 2LKDA 1FZQA 2Z6VA 3UK6A 3D6TB 4OI0A 4XH9B 3FE2A 4IDQA 3T1OA 4A4DA 4DLVA 5FBQB 3W5IA 1G3MA 2CNWA 4BRWA 1SVSA 2IYQA 5FUVA 3NH9A 4EQ6A 4DLWA 5KNDA 5AUQA 5G3YA 4PHFA 1U9IA 4XSGA 2BOVA 3UPUA 2FSFA 4X8OA 3KXIA 5AK0A 4XVRA 4JLJA 2QGZA 4F4CA 5AJYA 4W5HA 1KJWA 1CJMA 2GBLA 2QQ0A 4GPTA 4RSGA 5B58C 3F5FA 4QM7A 2GA8A 3ZZTA 4Z54A 1KK1A 1R0ZA 2YOGA 4G01B 1ETUA 4IDNA 1KZGB 5IDVA 2F3RA 2QAGB 4BWYA 5DNYB 1A4RA 2OCAA 4PZZA 1Z47A 2MMGA 2WKQA 1NRJB 1HV8A 3MLEA 1VCIA 4ZDJA 3KJGA 4GZLA 1AQYA 4PSKA 5KOYA 1TU3A 3DDCA 2HXYA 3GPLA 1HUQA 5EXPA 3UWOA 4FCVA 3CNLA 2V6JA 4TT3D 1FTNA 4FI3C 3WP1B 4XIGS 4A2QA 2BEKA 2WJJA 5FUXA 2W2XA 5KO2A 1RRPA 5JJKA 3EZ2A 1ONBA 1DAIA 5BN3A 4KYUA 2JJ2A 1EESA 1RVDA 2ZU6A 1X6VA 4JLAA 5EE5B 5EXSA 4Q9HA 2JLWA 3IHWA 2KJQA 2JJ1A 1M2OB 2PMDA 5ANRB 1QHXA 4F7WA 1CULC 3IEUA 3IKJA 5J5CA 4B3XA 1N2CE 3U7EB 1N6OA 5CK4A 3RC8A 2VF8A 2LKCA 1MO4A 3AKCA 3THWA 4NYMR 5BN5A 1T5IA 1E9RA 1D2MA 3AEZA 1NKSA 1CKEA 1F48A 1UDXA 4GOKA 3ZVNA 2P3SA 2D06A 1RJ9A 2G1JA 4LJ7A 1S1CA 2F43B 3CLVA 3H1TA 1G16A 4NTZA 1LY1A 5LD2C 2XGJA 3GD7A 1EFHA 3RRZA 1M6NA 2A5GA 4IOKA 1OXTA 1Z5ZA 5FH9A 2ZIAA 4LBYA 3PV0A 3NEJA 2FGJA 2F6RA 3AP1A 2DWQA 3LFUA 4RVCA 2WIAA 1O87A 4HLQB 4DCUA 4BGDA 1IJEA 4E09A 1TQDA 3HPRA 2QNRA 5JI2E 1KI9A 1OIVA 1T3HA 4I99A 4M9QA 4PSVA 1GNRA 3SYLA 2AR7A 1OXXK 3VR6A 5JS8A 4II7A 1KI3A 1G19A 1N0WA 3I5YA 4GL2A 2HYDA 2HDNB 3BD9A 3ETLA 2IUUA 2VHJA 4KODA 4A8JB 3CRVA 3IPYA 4B43A 2Z43A 3VTKA 4MRNA 4RD4A 1GL6A 1P6XA 3AGQA 4KFRA 2MSDB 1RKBA 2H16A 1ZJ6A 4HDQB 3FKQA 2QMHA 2F1IA 4HB2A 1ZNYA 4UXJA 4YXWD 1CEEA 1LTQA 1UFQA 1Q44A 2OG2A 2WAYA 3MJRA 1U0HC 4OQNA 3QXCA 3TSWA 4GFDA 1XMSA 3FKSD 4E03A 2VP9A 1MRSA 4IVQA 4ZIRB 5FPTA 1UJ2A 3BIFA 4QGHA 2JLVA 2G6BA 2I4IA 2ZRHA 3EA5A 3RS2A 2VTKA 1FOEB 4AD8A 4D4KA 4URWR 3NDBB 4US1R 3K0SA 1RJ9B 3L0PA 4AWXA 4E22A 3AVXA 1J8YF 4LK2A 2NIPA 4TLCA 3RABA 3THWB 4OHVA 3G0HA 4Q1AA 2AX4A 3QVVA 4C3ZA 4DC9A 2ZRJA 4TYWA 4V0LA 3ZDQA 1VG8A 4LYFA 4AC9A 3SHFA 1W4AA 4B6FA 1FQKA 3RS7A 5FOSA 5P21A 4N1AA 2BBSA 1E98A 2GZAA 3PENA 4HATA 1N6KA 3FHOA 3FB4A 4OK6A 1FNMA 3W8NA 2W0MA 2ONKA 1CR2A 1V5WA 3LRPA 4DDUA 1NVVR 2L0XA 4LRWA 2A9KA 3BE4A 4WVFA 3ZVRA 1QVAA 1NY6A 2WAXA 5HCNA 2HT1A 1T5LA 2QROA 2IYXA 1WDTA 2REOA 2ZJ8A 3EZ6A 3OAAD 5AJVB 1P62B 3UMFA 3QKSA 1OH5A 3EPHA 4PPQA 4PHGA 1Z6XA 2A30A 3X1XA 1JR3A 2IUTA 2Q3FA 3DMDA 4MDEA 2CHGA 2BV3A 1DPFA 1A2BA 1T3LA 1XBTA 2YWFA 4DB2A 1YVDA 3AP2A 2WWGA 1JNYA 5C2JB 5AUOB 1L7VC 4CT4B 5KDDA 1XD8A 2DYKA 4JL8A 2FF7A 1UADA 2VRWA 2H17A 3TH5A 4CIDA 2C9YA 4G3XA 1K8RA 2P6UA 5HTKA 2QQEA 2QM8A 2RHMA 1TQ6A 1MKYA 5L3RA 4PC2A 1G1MA 1COWA 3ZZ0A 2PBRA 4D0NA 1KO5A 3TMKA 1E2KA 1Y63A 3LA6A 3JZMA 3RSOA 4R2HA 2BKEA 4Q1FA 2QRZA 3FYHA 1D9ZA 1N5JA 4EJSB 3QY0A 3FMOB 4NZYA 2Q9CA 3W9YA 4DHEA 1WP9A 3TUZC 1QHGA 3WRYC 4EPVA 2AWOA 1ZNWA 2QG6A 3B82A 4C0SA 1BOFA 1EGAA 3EARA 4AK9A 4B3GA 1YZNA 2JLUA 3NKVA 1DTSA 3DOFA 1W36B 5AWFC 1EFCA 3QF7A 1F5NA 2VL7A 1FL9A 4QBFA 5K8IA 1R5OA 3ZD7A 1CLUA 5CIWA 4I81A 2XZOA 2DB3A 1SXJE 3VMFA 3W6OA 2WSSD 5KYKA 4HZUB 3QJYA 1Z08A 2ZI3A 4DUGD 3DOEA 5CLQA 4RD0A 3QPUA 3SS8A 1FMJA 4EPYA 1Z83A 2V1UA 2H7VA 3TVTA 5BQ5A 4BLQA 3AVUA 1D9XA 3CO5A 4MGYR 3CZQA 5E3HA 4ZCMA 1PLLA 1RC8A 2ZJYA 2GAAA 2A5DA 1XEWX 3BK7A 1SXJA 2BKUA 1GWNA 5J40A 4A1FA 2RCNA 4B35A 2OM2A 2AKAB 1DELA 4LOAA 1OFUX 2R6FA 3VX3A 3MJHA 1TAGA 4F4IA 2JGNA 4MRVA 3A36A 3L2OB 3GJ8A 5FR1A 3AF2A 4JBXA 4LYAA 3TSZA 4O2LA 1QHNA 2SHKA 1ANKA 4LDJA 4IOMA 2ZYWX 4QBHA 2ZROA 4MRRA 2BM0A 1Q12A 4LJAA 4P32A 1ZM7A 1U0JA 2GWHA 3T61A 3GP8A 4M9XA 4B44A 5B64A 2J41A 2I1VB 3DZ8A 1EFTA 4OHXA 1C4OA 2W6JA 2RGNC 5DYGA 1ZINA 3GEIA 1OIXA 2NG1A 1KTVA 4EPTA 1IXRC 2GXAA 2YC2C 1WBDA 1S8FA 1ZNZA 1AN0A 2C8VA 1JJ7A 4A0HA 2OBLA 2AN9A 3QG1A 4D0GA 4KBGA 1XU4A 1CBUA 1SKYE 2WWXA 1K6MA 1KJYA 1NF3A 1QG4A 4JVNA 3SC3A 1W4BA 4M22A 2WSSA 4P31A 4IW3B 3REFA 2QTVB 1JQLB 3L0IB 4XSHA 4BLTA 4LJ4A 2JIZA 5DHAA 2JJ1D 2VSOA 4Q21A 1W5TA 5JEEA 1X1SA 1Z0JA 2X1VA 5EXXA 3CX6A 3U3OA 2YINC 1CTQA 1UBCA 2QAGC 2GRJA 3NWJA 3Q5EA 3QF4B 1YR8A 3MRSA 2DFLA 721PA 1UBEA 2LWIA 5EP2A 1R5NA 4B48A 2PEZA 1XX6A 2VP4A 5DGXA 1Z6AA 4M1MA 4OJQA 4BFSA 3CW2A 1GOTA 5HKKD 1IN6A 4BFYA 2C78A 4AG6A 4DLUA 3ZZUA 4AKGA 4WOPA 2O0HA 4UNRA 5A0FA 2W2VA 3GJ3A 3IO3A 4BEBA 2QSZA 2ZETA 1GRRA 1DEKA 2AK3A 3CX8A 3U4QB 3WP0A 1KI6A 1CXZA 1FTSA 3CM0A 2IWRA 4LYJA 2CLSA 2V1XA 3ZH9B 4H1UA 2AXNA 4R71A 1MO6A 1ZUNB 2O52A 2WKPA 3KJEA 4OQFA 5JCZA 3SOPA 1RE0A 4LX0A 2R44A 4A0FA 2JCSA 4HLUA 1Z6YA 3FVQA 4AYTA 3K9LA 1EX6A 3MMPA 4ZCIA 4JLPA 2ORIA 1XTJA 2ODBA 1E2GA 1KSJA 4GMXA 1Z0DA 5EP4A 4C7OA 2AKYA 4MYCA 1E2MA 1HEIA 2VEDA 2ZREA 4ESVA 4RKFA 5FL7A 4D2IA 1ZU5A 3KUDA 4KSCA 4PC7A 4IDOA 1G17A 5G53C 2WPDD 2RGDA 5KSPA 5KTYA 1Q1QA 2AWNA 2OXRA 4LC0A 5L3QA 4RCZA 1LB1B 3CZPA 2J3EA 1NVXQ 2ZRFA 3FFAA 1SVLA 3RWMB 5FOTA 4BZPA 3W34A 1CJVC 4V0KA 4HAXA 5C46F 2RAPA 2ZR9A 4O3MA 2ZSBA 3EZ7A 3UKDA 1WBBA 1ZIOA 1ZM3A 2GCNA 4TT3A 3U7HB 3L8ZA 4W5WA 5FL3A 5JECA 4PHTA 1DARA 1OE0A 5GJWC 3ZIAA 1VIAA 2IBMA 4ARZB 3QXHA 1Z0IA 4DT1B 1IONA 4CEIB 2J7PD 3ONWA 1II9A 4G0NA 1GUAA 1P2VA 2QRNA 4DDWA 1WA5A 1YRAA 1G4AE 2BM1A 4XD7D 2AHOA 4DIEA 3KB2A 2BMJA 3KKQA 4Q4HB 2FFQA 3NBXX 1NJGA 2O0KA 4JBYA 4JT4A 1Z2CA 3LV8A 2PX0A 1XCPA 4TSFD 1T0HB 3VKHA 2R6AA 4DB4A 2O5VA 1N0UA 1XTRA 3SEAA 3AVQA 2EVWX 3LVRE 2HUPA 1LF0A 1NG1A 4V02A 2FDCA 1D5CA 2KB0A 3LXXA 1F2TB 4ILEA 4TQUS 2FGKA 4JLOA 1AZSC 1XEXA 1QHIA 1LW7A 2VHTA 1ZRHA 2X77A 4NBSA 2O8BB 1R8SA 1RYHA 1S1MA 4GI7A 4LHWA 3AF3A 5EQTA 2F3TA 5IK2A 3K70D 1DAFA 2PJRA 1QHHB 2W83A 4GBMA 1YZUA 5CDFE 3I61A 4ZI3A 3ZVMA 1VYVA 4XTRA 1AGPA 3BS4A 4P0TA 4W9MC 2PLRA 3MCAA 3CR8A 4QM6A 1EWRA 2GJKA 2ZTSA 4H9GA 1OLOA 1E2JA 2J46A 3B1YA 3KKMA 5FTMA 4CVNA 3MUFA 1SVWA 4CT5A 5J4LA 5IF9A 2ZS9A 2IYSA 4NYIQ 3K0FB 1KDPA 2ZUCA 5B30A 3WHLA 4B3FX 4BECA 3PXGA 2F55A 1YHNA 1GRQA 4Q4JB 3U3KA 3I5XA 3IPXA 4XOIA 2AXPA 1OV4A 2WMOB 4WZBE 1DADA 1E9BA 3QNUA 4LHZA 2J0UB 1P72A 4JSTA 1MRNA 3CH4B 4G5OA 1WF3A 2C9OA 1Z07A 1FNNA 2ZJBA 3C7KA 4WBSA 4BFUA 4DSNA 1DG1G 4U00A 3T1VA 3CB4A 4B71A 2X8AA 3GLIB 4FINA 4B47A 1G5TA 1UDWA 1XNJA 2UVQA 2WM9B 4KFTA 2R6DA 2V55B 2IXFA 1BYIA 2P65A 3AB3A 1T0JB 3BGWA 1E9FA 3DMNA 2JDIA 5FTKA 3GEEA 4XD7A 2ZE5A 5H70A 5SZJA 3PJRA 3AGPA 2CCGA 4TMXA 4U7DA 2Y8EA 4Q9KA 1VKJA 3EC2A 3MG9A 1N5IA 3TGPA 3CBQA 1TF2A 4MRSA 2J1LA 3IIMA 4WIAA 3K0AB 5JEDA 3PUWA 4AI6A 121PA 1XD9A 1T9HA 4QG7A 4DSTA 2QENA 3EPKA 1F60A 3B5JA 1XXHB 2WOJA 3C14C 4KYIB 1KO7A 3W6NA 3VU9B 4JJZA 5C1BA 2DHRA 4JT2A 3C41J 3FFBA 1Q1BA 3KJHA 2OZEA 1JAHA 2JIZD 4PC1A 3FWYA 3THYB 4NCJA 2WWWA 2XXAA 1P9RA 2RMKA 3B6EA 1UBFA 3NBZC 3WBKA 1CR0A 2NO0A 3PQCA 2GEVA 2RGNA 4RZ3A 3IGFA 2Q6TA 4TSFA 4Q1BA 2OO7A 3HJNA 3ZYCA 1NBMA 3MAAC 4TQAA 4W7SA 821PA 2GJ9A 3NHBA 3LDAA 3ADDA 3PIRA 5G41A 3N2EA 1GVNB 1ZC3A 5G3ZA 4ZPXA 3LLUA 4PANA 2ZJAA 4TYNA 4FW9A 2NO1A 1IN7A 4DLSA 1W0JA 1E2QA 2FFHA 2YJTD 3IILA 3KB1A 4P4SB 2X2FA 2CVHA 5K8TA 5JWHA 5JJIA 3B1VA 1Z29A 3FMFA 2V9PA 1X3SA 4PR0A 3FKSA 1KK0A 1WCV1 1XFAA 2EFCB 2PZEA 2VP2A 5LPNA 2NO6A 1WB9A 2Q9AA 1MR3F 1WRBA 1J90A 3AVVA 4PAQA 4MKFA 1NG9A 3CIOA 2WVJA 3P20A 3TR5A 4HZIA 3UANA 3P32A 1D8TA 3QKRB 1E2DA 1JJVA 1KO4A 1ZCBA 2RGGA 2IF2A 1G3UA 2XNDA 1FP6A 2Z83A 4KFSA 4R9UC 1JPNA 4Q48A 1IN8A 4JL6A 4C0QC 3M0EA 1HQYE 3AH8A 1UEJA 2N46A 4KJZA 3VU9A 4OI2A 2F43A 3QXXA 3UIEA 4PZLA 4MRPA 1GKUB 1T6NA 1U90A 3HP1A 2BMEA 1MO5A 1JECA 2H57A 1RW4A 3BRWD 3JVVA 2V6IA 1ZVQA 1E9EA 1EFRA 4HAZA 3ZVLA 2OE2A 1NY5A 3B8HA 4GMDA 3N5CA 5GVRA 4MGKR 3W6PA 4TLDA 1VTKA 3ICEA 1JI0A 5BW8A 4HLCA 1R4AA 1RIFA 3THYA 2A5FA 4LBWA 1NBMD 4TLEA 1N6RA 3TW8B 4NU0A 2BMFA 3LQQA 5B57C 2BMDA 2XNSA 3AVOA 4QBGB 4HYYA 4Z8YA 4Q03A 1Z63A 3HPQA 4BASA 1T8UA 2GVZC 4NCKA 3X1DA 5GJCA 4DCVA 1P9WA 2FZLA 2ZRPA 3PCRB 5A4JA 4URXR 1YZTA 3KQUA 3K70B 1ZYUA 4NL4H 2QU8A 1GP2A 1SHKA 1XCMA 3OEED 1MOZA 2ZVQX 5KHOC 4LHXA 3GLHE 5GJBA 1HT1E 2ZE6A 4ZKEA 3SFZA 1M7GA 1JEDA 1UAAA 1KO1A 1NLYA 3VHXA 3QEOA 4FD2A 2WJHA 1NMXA 3BAFA 4YDHB 3LVQE 4Q01A 2XAUA 1MABA 4Q9IA 2C95A 3K9HA 2W6JD 5A5GA 2O8EB 3GFPA 4YC7A 2QPAA 4GT1A 5UKDA 2FV8A 1M34E 3GLIE 2F1JA 3LLMA 3RRNA 4RFVA 4B74A 1KO8A 1U94A 3ZQJA 5FBVB 1LS6A 2IA5A 1GILA 1IN4A 2C5LA 5LB4A 4DSUA 5J4VA 1G20E 1SVIA 1S0UA 5IT5A 2JLZA 3CWZA 2JLXA 1ZD1A 3NBYC 2DCUA 2MMCA 5J47A 3NTUA 4Z8XA 2PEYA 3LQRA 4DBLC 5SZKB 3O47A 5FUWA 2ZRCA 5CK5A 1WXQA 2VHCA 3M4YA 4YDSA 2NQ2C 1G7RA 2J0QA 5FPSA 3SR0A 3A1VA 2WKRA 5H1YA 2HT6A 2ZUDA 2GHIA 3DL0A 1OH7A 1JR3D 3DPUA 4OL0A 3I73A 2IT1A 4WA7A 3RVBA 4B33A 4LJ9A 1NLFA 1XEFA 3JVUA 3EWSA 4GNKA 4KVGA 4ACAA 4QC2A 1XEXB 2QI9C 5JCPA 1NN1A 4JKYA 3GFTA 3FHCB 3GLGB 3X2SA 2VSFA 1D2EA 2C96A 1GITA 2VO1A 2CLCX 2EWWA 4FIDA 4DCTA 1DS6A 1R7RA 2O8FB 2FSHA 4C0BA 4V0NA 1G4UR 4FMCB 3VR2A 4FN5A 3CONA 3Q85A 4TL7A 3X1YA 2PJZA 2G0NA 3Q3JB 4PAMA 4TLAA 2R9VA 1FX0A 5EP3A 1E0KA 3F8TA 1W49A 1L8QA 3KQKA 3U3RA 1Z6TA 3ADKA 1P4SA 1VG0B 2G3YA 5CYPA 4BFVA 2JASA 4OI4A 2OBMA 3OFND 1XWIA 4C0HA 2OBNA 2WJVA 4DEXA 4M9ZA 3LBHA 4TMZA 1JQJC 2IS1A 3VHLB 1F6BA 4JYBA 2AFHE 5C4GB 4HAUA 1CF4A 1G18A 4BFTA 3CRRA 3RHFA 3IIJA 4EAQA 1W0KD 3UXMA 3PFIA 1LV7A 2YZ2A 3AM1A 3R9IA 2QPTA 1XPRA 2FN4A 1KGDA 2E9SA 4DT1A 4CZ2A 3ZD6A 3BB4A 1W46A 5TVKA 1YZGA 5CITA 2V8OA 1TF5A 1HYQA 2KI5A 4ZI2A 2H18A 2J0UA 3UG7A 2EQBA 3LNCA 1Z2AA 1E2FA 1OHHA 3FPAA 3NG1A 4DEYA 5JHGB 1P2SA 4QHYA 4CEHA 4F4JA 3LW8A 3VX4A 2ZRBA 3CPHA 1AIPA 4XVQA 4GZMA 3QSYA 4AURA 5IHPA 1RRFA 2OCBA 1QF9A 4OHZA 2G77B 3TRFA 3T34A 3G82C 1XMIA 3ZGXA 1JEEA 1KY2A 4TWZA 1AS3A 4ZKDA 1AGRA 4OHWA 3IO5A 2IWHA 3TW4A 2XEXA 4MYHA 5EE0A 1U8YA 1B0UA 2CCJA 1K5GA 2NPFA 2WZQA 3W3AA 1R0WA 2ZI7A 4M4SA 1FP7A 4XWKA 5BYKA 3PEYA 2G83A 2EYQA 2WBLC 3JZAA 4JKIA 4YONB 3BERA 4TTQA 3KKOA 3EIEA 1F3OA 4HAWA 6Q21A 2CK3A 4LWZA 1OFIA 3C16C 3K9GA 4UJ5A 5EE3A 4Q9JA 2NO7A 4BRUA 1H8HA 1G3QA 5JZVA 1OB5A 3T1QA 5BWMA 4EUNA 3AP3A 1G3IA 2IX3A 3CUEF 2IF0A 3GJ5A 1VYUA 5E7JA 1NIPA 1OT3A 3RC3A 3HU2A 2Z5FA 2ZJZA 2ERYA 2GBLC 3CRQA 3UG6A 1RPZA 1KOFA 1E6CA 4FXPA 4LHYA 3RS0A 1OPXA 3FOZA 2HLDA 1HURA 2PL3A 1E96A 1GSIA 1UEIA 5TY0A 4L9WA 4KVAA 4TZ0A 3LBIA 2VF7A 2B8TA 2XTMA 1Q1EA 1VG9B 2PZFA 1Z22A 3NC1C 4DSOA 1UM8A 1GRNA 3EC1A 4LJ8A 4XTCS 2RH5A 4HAVA 1DO2A 4I1SA 4DDTA 3ZS9A 1XEWY 1F2UB 4YMUA 3A1SA 1N6HA 3F0TA 2B21A 4Q9LA 2B92A 5KSOA 2I1QA 3PUZA 1XB2A 4AIIA 4M1SA 3BB3A 1XPOA 3K53A 4QFMA 3OEEA 3R8CA 4RZUA 5JSZA 4S35A 3W90A 1YR7A 4LPSA 4BLOA 1NN5A 3THXA 2YVUA 3KFVA 5F9HA 1G5PA 2NGRA 2D2EA 3TQFA 1JXOA 1PUIA 2NZJA 4JL5A 2ORVA 1FW6A 3QOFA 4HDOB 1IN5A 2ZI9A 4HB3A 3D7MA 2VLIA 1G8HA 1A2KC 3E1SA 2R6CA 3BWDD 1T8TA 1GDDA 2YWHA 1TUEA 2RGBA 3FMIA 3I3SR 2ZRDA 3OIWA 3Q7PA 1Q57A 1U98A 1JBKA 1BH2A 4G5QA 2DPXA 2W6ID 1W1WA 2XTZA 3TAHA 3TJZA 4URVR 3UMSA 3OHMA 3MWKA 1II0A 4Q7LA 4CRWB 1KNXA 2YWEA 4V0OA 5FBWB 1CJKC 4YMTA 1E1QD 4LJ6A 3TK1A 4IOJA 3TR0A 1G7CA 2GEDA 4LBVA 2VYFA 4NP6A 4A82A 2CL7X 2IYWA 4HZUA 3A4LA 2P6NA 1AA9A 4KFUA 4XWAA 4OJKA 1IY2A 3KFXA 1QHYA 2ZU0C 4OK3A 4RCYA 2VIIA 1TUIA 2EU8A 1V43A 5E4FA 2RKOA 3RANA 4QNRA 1IAQA 4V03A 2I3BA 2CK3D 3EG5A 5DO9A 4CW7A 1RYFA 1GG2A 3U3MA 3AKYA 2C9CA 4A8JC 4DIDA 3FHTA 4JLNA 3GLGE 3OIYA 3VKWA 1ZD9A 4PPGA 4RZXA 5CB8A 2ZAOA 4BLRA 5EUMA 3QIAA 3L0OA 2GXUA 3AQ4A 5KDLA 2GILA 4UNNA 4IOLA 1H8ED 1E2PA 5FL7D 1P75A 3I72A 1W0JD 3AKEA 1TF7A 3QKTA 4L8GA 4RJLA 1A7JA 1R0YA 2VHQA 1XDBA 1QRAA 4FMCF 1KSGA 2FFAA 4CDGA 4DLXA 3RS4A 1OFHA 3EZFA 4JYCA 4N3NA 4U5XA 5EUQB 4ABYA 3MFYA 4CGZA 2CMKA 2HJVA 4TYPA 5EE1A 4YMVA 5J4KA 2ZAMA 3MWJA 4QKQA 4D4MA 4TQ9A 1OH8A 1KKMA 3DKVA 4PO9A 4HAYA 3DHWC 2C2HA 5KPDA 1T4GA 4LC1A 2R62A 5DI9A 2QM7A 2W58A 3BFVA 3H86A 2XNDD 1F2TA 1NKTA 2IL1A 2GF9A 5F98A 4JMPA 3K0CA 4RD1A 2ZEJA 1T91A 1ZM4A 2K5UA 4IKEA 2ZQ5A 2PH1A 4NH0A 5JWRA 5LBIA 3WBJA 4F91B 1NL3A 4MDFA 1SXJC 3VFDA 3MWLA 1KAGA 4C0AC 5F2EA 5GJVC 4LV8B 3P27A 3WNDA 2VP5A 1YZKA 1LS1A 3VR5A 2JJ8A 1QHSA 1FQJA 2Q3HA 1G6OA 4F38A 3KQLA 4M2LA 3ND8A 4OQMA 4G1UC 1R0XA 3A1TA 1US8B 1N5LA 1IHUA 3GEHA 1JXMA 4PXAA 2P67A 2ONJA 5DLQC 2QT0A 4Q7MB 2W6IA 221PA 1LNZA 2XSZA 1MT0A 5L3SB 4Z1MA 1X86B 4LZZA 3M1IA 1XZPA 4BZXA 1UPTA 2BEJA 3KKNA 3S1AB 4D82A 2Q9BA 4N0EA 1AS2A 3Q72A 3CKLA 2IYLD 2JLQA 3KXKA 1L4UA 2FMXA 2R6GA 3OZXA 4FMDF 3B60A 4HB0A 1Q1ZA 3B9QA 4CEJA 3UMRA 4URZR 2H1LA 3OAAA 4ZDIA 1OKKA 1XTQA 4BLSA 5HR5A 5JLJA 4HDCA 1DO0A 2ERXA 2A5YB 2OEPA 4I1OA 1G64A 4M21A 1QBKC 1I4DD 3OEHA 1P2UA 3KTAA 4TL6A 4L4UA 2V54A 4WXRA 4BUJA 1L2TA 2MSCB 2BJWA 3AKDA 4KU4A 4OQLA 4CEIA 3SQXA 2OAQ1 1GKIA 2QMUA 3WYAA 3BC1A 5KNCA 2H5EA 1U0LA 1XXHA 3I32A 1YZQA 3H2YA 4WAUA 5JWOA 4NYIR 2BVNA 4E07A 1KMHA 3U4QA 3BB1A 1OSNA 2FZ4A 2ZM5A 3LX8A 4HLDA 1E2HA 4JVMA 3SJZA 4JLVA 1G8YA 2FU5C 4GP6A 2CCKA 1W47A 4P4TA 1NMYA 5HCIA 2EFGA 2QP9X 3QI2A 3AV0B 1XXHE 4Q7JB 3PUYA 1VHTA 3NEYA 4IEIA 1ZM9A 2DWOA 5JS7A 2ZS7A 5FOVA 2CE7A 1WQ1R 3GJ0A 4ERNA 3RS3A 3CRW1 3ZS8A 2XB2A 3HYTA 3B13B 4QOSA 2ZSEA 5SZIA 1W36D 3OE7A 3K09A 1S4QA 3FMPB 4PHHA 1Z0AA 2OFXA 2KBEA 5AJXA 3SHWA 2QPOA 3HR7A 4GOJA 1U81A 2XOKA 5CLLA 3K0FA 1AKYA 3EA0A 2ANCA 1II8A 2WJGA 2GETA 3AUXA 1YU9A 5KUTA 4HUQA 5CJ2A 1R8QA 1CP2A 2WMNB 2FNAA 4Q7KA 4UNPA 1IJFA 3KTAB 1E0SA 2D7DA 2VSXA 1HQCA 2ZPTX 4IVPA 3P1JA 2FE4A 4EJSA 2ZE7A 4LY6A 4TMWA 5EZ6B 3BFKA 1NNEA 4OHYA 2FFBA 3RAPR 1NVVQ 2IS2A 3SJBA 3Q8XB 2XX3A 4JSYA 1ESNA 1SZPA 4LGMA 3QXJA 1G9XA 1ZUIA 2ODEA 2KWIA 1E1QA 4X8MA 2VQSA 5AJZA 5FPHA 2G1KA 1NBME 1TMKA 1AM4D 5B2ZA 3WMFA 4CEHB 2JJ2D 2JA1A 3SU8A 4XVUA 4I1UA 3SYNA 2BBWA 4LYHA 1KHTA 4BFXA 2CJWB 4A2WA 1QZXA 3WMEA 5AUPB 1A5TA 2D7CA 5JI3E 1P2TA 3T12A 3A6PC 4CEJB 4AKHA 4EKDA 3IQWA 3KDSE 2OLJA 3VR3A 1G7TA 3TVDA 4A6PA 1DAKA 2GZDA 1KI1A 1TEXA 3K70C 4HUTA 3O8BA 2PCJA 3THOA 2ZRLA 1P73A 4G5SA 1SVMA 4V0MA 1YZLA 1S96A 2GCOB 4HI0E 4MKIA 1U8AA 3U5ZB 1VG1A 1DAMA 1G8GA 3OEHD 4C0KA 2VBCA 2BCGY 1YQTA 4UNQA 4ASUA 2G88A 1S3SA 3A4MA 4KO8A 4F92B 4A15A 2TMKA 3D3QA 4MUAA 1ZC4A 2ZUBA 3Q9LA 4KLZA 2F9MA 3RNLA 5E7IA 1PJRA 5DI3B 2WWYA 4DDVA 1KSFX 4O25A 4B75A 2XXAB 3AVYA 3ADBA 2FSIA 5TV2A 3WYFA 3SE0A 1NI3A 2QP3A 3N2IA 3TIFA 4FMBB 4NDZA 2QMOA 3X1WA 1E0AA 1E69A 1CRPA 3QBTA 1BMFA 3IDQA 2QTFA 4TMTA 4ZIRA 2IYVA 1HA3A 4MGIR 5FBLB 2DR3A 4Q4LA 1J8MF 4PQFA 1VCNA 3KQHA 2WHXA 1MABB 5AR1A 1Q3HA 421PA 2XSZD 4B3CA 4B76A 2ORWA 4Q1DA 1GM5A 1ZIPA 1F2UA 3DKPA 4YXWA 4PFSA 3U7FB 4JLMA 2NZ8A 5DYIA 2W2TA 1SHZA 1L4YA 4JS0A 4I1VA 4BE7B 4PPNA 5FPKA 3GLGA 4M1WA 2FG5A 2OSBA 1UBGA 2CLDX 4ZDKA 1ZAKA 3WMGA 4NCIA 1ZUHA 4AG5A 2IUSA 1E79D 1KMQA 2YV5A 2GCPA 1Q21A 1Y3AA 2B8WA 3IBGA 1GL9B 1II8B 1XD2A 3I62A 3CWQA 2CJWA 4QJ4A 2EFDB 3U60B 2YKGA 2P5SA 1W2GA 3IHLA 2P6RA 1Z0FA 1D2NA 1NN0A 1NVUQ 2HJGA 3GLHA 4UXHA 4RFSB 3QKSB 3L43A 4IFBA 2IS6A 3BH0A 4C7OB 2OT3B 3QF4A 4M1KA 1N6LA 3I92A 4BEJA
chains in the Genus database with same CATH superfamily
1P5JA 1K7XB 3FTEA 3AWIA 3R3VA 4NJEB 3W9BA 4DLTA 2C2KA 3G9XA 3B2QA 1RWWA 1CUVA 1N6NA 1EE9A 4RV9A 4LF7B 1D0VA 1YO6A 2ZI5A 3HZZA 1QQ6A 4RQTA 4NKRA 1J8DA 2I6GA 3OPQA 4XX0B 5BORA 2VZ9A 2NOAA 4S12A 2R6ZA 3WLKX 1J0XO 2PKYX 5K3EA 2MSNA 4PFKA 2VFAA 3AF0A 3PXCX 3V42A 1BMFD 1Z82A 1I4TD 5GINE 2A67A 3PVZA 1WKCA 4TYYA 1FPQA 4GX1A 3G2PA 2XNHA 4YMIA 2AG1A 1IQPA 4NECA 5LYJA 3ZI0A 3ASVA 1B26A 2OESA 1JLHA 1Q7CA 4J9UE 3OFNA 5CJJA 1JDNA 3HXKA 3EVNA 2XGOA 5D6NA 4KUHA 2A0UA 4OBEA 1CPYA 4TTSA 2QUAA 3F8SA 3GOHA 4UUPA 3H2IA 2PQ0A 4YR7A 4RHCA 1GU7A 1FJXA 2G28A 3GPBA 1DAEA 1PK8A 2BDEA 2NUTB 2P40A 1XPUA 2J87A 3E3LA 4QDTA 3WB1A 3RE1A 3OOWA 4B3SB 3RG2A 1HZZC 3RSCA 3WKAA 5DMXA 3MB5A 3H1EA 3G9TA 1NXOA 2XLBA 3IQEA 4JCOA 4AJJA 4D81A 4F3TA 5AVSA 5D3QA 4CM4A 1CUIA 1H9AA 2ZBFA 3I5MA 3UT0A 2PZAA 4X6LA 1G8FA 4MR7A 4URYR 4ZDJA 4HBZA 3GYBA 2PRYA 5T3YA 3LK7A 3RV4A 2UYYA 5K3OA 3N8GA 1UKVY 1WHTA 3RWBA 1JMKC 1X7WB 1TO1E 3BMOA 1J0EA 4E4RA 3HCAA 5EEGA 5ILGA 2QE7A 4W9NC 4DAOA 3BXOA 1CS0B 1T3ZA 4JN6B 4HADA 1M76A 3UGTA 1ZH4A 3V4SA 2WUEA 4X66B 4WKBA 2VP0A 2CFTA 5KVAA 4X1KA 4Z9YA 3WB0A 1FVXA 2JI6A 5T6BA 4XQCA 3LBNA 4XWGA 4ARSA 3LCMA 5M2QA 2G76A 2BE9A 2ST1A 1T2EA 1ZCAA 5DGTA 1HMPA 1KKLA 3G2MA 1AQUA 2HEIA 3IOYA 2J08A 5CR9A 3W04A 3THXB 1ZJZA 4M9SA 3VZSA 5FR2A 2H08A 4QUEA 1I7QB 3GRUA 2RAUA 1WD5A 1L5SA 2FW9A 3K94A 4C4OA 2QVGA 3PEEA 2ECPA 2WT4A 1MAAA 4PXSA 1EVQA 2D0IA 3TZKA 3ADCA 3CLTC 4RVOA 2FUCA 2AD1A 3N28A 2VG8A 5D86A 3AESA 4DIMA 4QVIA 2DBYA 1DOHA 2FW8A 2A5JA 3C8UA 4UMFA 3PBKA 5KYXB 1V4BA 4B6EA 3ZCRA 5JFGA 2CHVA 5KOJB 4B32A 3I2JA 2NUTA 5LQMA 1Y9AA 2D8AA 3P4UA 3SYKA 1RM3A 1WVMA 1IWOA 2W0SA 3D1JA 3H19A 5JAPA 3QU7A 4RABA 1ISIA 1VJ1A 4IICA 3IOEA 2W00A 2OCIA 5LD2B 3ZGZA 4TWIA 2A0XA 2GZSA 3R7WA 2DQKA 5EXTA 1Z8DA 3P7MA 5TF4A 1G2OA 2BL4A 3BWYA 3OCWA 5K3AA 3B2EA 4Q5IA 1LH0A 4ESEA 4MR7B 2IXEA 1AH2A 1LSUA 2RHDA 1TA9A 3DEFA 2CHQA 1X7WA 2FCRA 4XYMA 1TGVA 3C8DA 3H2HA 3K9WA 3V9PA 3KG2A 4A0QA 1JPJA 2AHRA 3QYAA 4ZYLA 2C99A 1CS0A 3N8IA 1P5ZB 4UZFA 3K0AA 1AUVA 1T5BA 3Q6MA 3KZVA 1DBSA 2W6NA 4N0PA 4WT7A 4G23A 2YNMD 4X9XA 4G1VA 1N3BA 4PZYA 4TLBA 3W6UA 4BZQA 5M34A 1B7GO 1EYZA 5AK3A 2X7HA 2BIFA 5AM0A 3ZW7A 10MHA 2IHNA 1PJTA 2WU4A 4YP5A 1YB2A 4JWTA 5BSVA 5L3VA 4NR0A 2EFEB 3MMXA 1W85B 2A88A 2JH9A 4F1KA 1C0KA 1F0NA 5BSUA 1NURA 3OTIA 1V2GA 2XUQA 1YS7A 4LGYA 2PO5A 3WRXC 1ODIA 2GPAA 3WYEA 2VUHB 4MUHA 4ZQFA 1TX4B 2R8RA 1KBZA 1T24A 4AWBA 1JEOA 5ARCA 2GZHA 2H4ZA 2WV7A 4D0LB 2CBZA 3PFFA 1P0QA 1DKRA 3QUCA 3UJDA 1HC7A 2Q5LA 3AM5A 1W7AA 1YZ3A 2RJNA 3W7BA 1TNDA 5C8XA 3SX0A 1OWOA 2NXWA 2ATXA 4J90A 4A2PA 5IT0A 4S0XA 3QOWA 2CJXA 1MH1A 2ZS8A 5JSHA 3TNLA 1KXZA 4P54A 1KJJA 2RGWA 2FW0A 4TV9A 3ZX4A 5HKKA 2B1QA 4OO3A 4I5EA 1N25A 4RLQA 3W2EA 2ZRKA 3VXKA 1DP4A 1OVMA 1PCXA 2WR8A 3WV5A 3VC1A 1N2CA 5KSYA 1J2TA 4ARVA 5ED0A 2O8FA 1KEZA 1UOQA 3DE0X 1MB4A 3V8MA 5JVDB 4BB0A 1QVRA 5K8JB 1HY3A 1VCMA 2FWMX 3T9EA 1AKMA 3O2SB 2B7CA 1EX9A 4L0QA 1KYIA 3I5UA 2X13A 2XTJA 4IZOA 3QKUA 2UZ3A 4MITA 4G5GA 3P26A 1QO7A 2AD5A 1P2FA 1N32B 5BVGB 1VMEA 1XFDA 5CXSA 3PEUA 1I6KA 5KQSA 1PIWA 2IV2X 3UAXA 4B3IA 3FWPA 1GG9A 1F8XA 3EQ7A 1A82A 4L5IA 2R1ZA 4E2ZA 1JEQB 2NXNA 3GT7A 5ECWA 4QYMA 1X9HA 1G59A 3G7NA 2NSLA 3AVTA 1T1SA 2PRKA 3ZGNA 5ICSA 2QLFA 1FXUA 1X14A 4RPHA 1VP9A 5SZHB 3BVPA 4IIXA 1V37A 4C2UA 5LU9A 3OPYA 1VJTA 2QLNA 3BSWA 1ZO8A 1CU1A 3IAAA 3C5EA 5KX5A 5F12A 2VP6A 4ARZA 3O9VA 4N7RA 1UKZA 2BFFB 1JXAA 2D0DA 3CEJA 4L8FA 1GSHA 3DVLA 3FNRA 5AOVA 4ZVKA 3PCTA 4IDAA 3RDPA 1CLEA 3EFBA 4FFOA 4BNKA 3PR3A 1EFKA 2IYUA 3BL8A 4GMKA 3K9NA 4G26A 2B78A 1CY4A 4ENUA 2GAOA 3CRMA 4JVSB 3ADPA 3EX7C 3DDWA 3T3PB 1BCSA 1T6XA 1VECA 4WSOA 5EWMB 1SXJB 4M8LA 2W6OA 3NOXA 5KQRA 2V0GA 5K3SA 4B3HA 4EY3A 3EZLA 4I5GA 4KNYA 3JQAB 1J70A 3KR9A 1I4LD 1UXKA 4ROTA 3L5OA 4EL0A 3VR1A 2IJGX 4OAQA 2VRCA 1ZP6A 5ICMA 3BXZA 4FHZA 3GLFB 5L3SA 4G5RA 4IJVA 5ILOA 5IAJA 3A58B 1S2DA 1BKDR 1O9GA 1RXIA 1YKSA 3QBDA 1ZWKA 3WAGA 2H1OA 5IF3A 2FDXA 3CV3A 4O4LB 3H4VA 3DNFA 2XMDA 1B42A 3KWMA 4W4TA 5T6MA 2JH3A 2ZI4A 3U26A 3OIFA 3DUFB 4DL9A 1JKJB 3LDFA 1WCIA 4L9RA 1AK2A 3N53A 2VRNA 5FOWA 2XF8A 4YYEA 1B0PA 2G0AA 4WESB 1R8XA 2YVLA 3BFJA 1NBHA 2WQZA 1CR6A 3VR4D 4FFSA 5GIPE 1FP1D 4I1YA 5J4HA 2AYXA 1J7KA 3WGLA 4CMJA 4ALMA 2AYYA 3DUWA 1JHZA 3WGMA 2HCJB 1UXOA 5CT6A 3FA2A 1YRYE 4Z0PA 4ZCTA 1MAVA 3J81k 3ORRA 2OCPA 5TPZA 1FTGA 2I34A 2RHOA 2BH2A 5IVHA 3IBYA 3DP9A 3GGOA 4PNEA 4F04A 3Q1KA 3QHPA 3UW1A 2DPHA 2NTEA 1VLMA 1V6AA 2XE7A 4YRZA 1P9NA 3F4KA 5THQA 4ENQA 1ST2A 2F1HA 1IBRA 5C81A 1KY4A 2IEBA 1AV7A 2DH5A 3P0IA 5E6UA 3HBAA 5BN1A 3OFVA 1MNQA 5FHQA 3R9XB 1G41A 5IBRA 3BICA 1M1NA 2RC6A 3QFFA 3LQ2A 4JBWA 4EKIA 1D1TA 2C4NA 4JB3A 3USZA 3RIMA 2FB9A 1TUGA 3PD0A 3GFOA 3RC7A 5KU1A 5HRAA 3D5QA 1MQAA 5BSTA 2ZSJA 3O8RA 4EF4A 5EWMA 3WYGA 2IHJA 3KP1A 1WCXA 3JD2A 3VZBA 1J5PA 4Q4AA 5FTNA 4IDFA 2RE8A 3FYSA 1D03A 4U2DA 3WDLA 1W36C 2BZ0A 1P7PA 1VPWA 2YWBA 4NK5A 1ZJ4A 4U7FA 2X8BA 3BJIC 2QV7A 3ESXA 4HSGA 1ZMRA 4AYXA 3NS7A 3LRTA 5G40A 3BE5A 3QBVA 1FMLA 2H4JA 5ELLA 4KK4A 4P8RA 4WI1A 1QK3A 3F4BA 1I7NA 4I36A 3KM0A 1BXGA 3QVGB 4YJ3B 3QJGA 1LX6A 1MIHA 4N3CA 4JFRA 4Y0AA 3RBZA 1YAHA 1X1DA 2FR1A 1TPZA 3A9SA 3EEYA 3KL2A 3L79A 2NZVG 4M9RA 3IQIX 3NOOA 4EF5A 1X13A 2RH8A 4QGFA 3UXYA 3ZDBA 4WESA 2QN1A 3LPDA 2QMQA 4WKGA 4JZKA 4P33A 1K6IA 2IELA 2AZMA 5GAJA 4D9GA 1RJGA 1UK7A 1FX1A 3Q98A 3RU7A 3V8RA 2IYNA 4YEDA 4KN9S 4N0DA 1L4GA 3AU8A 3UYLA 4CV3A 2FQXA 1R5JA 4KCGA 5C7LO 1C7FA 1KK2A 2R8XA 5JAOA 5C8YA 5J9FA 1GAJA 4R8VA 3GLFE 1Y9EA 4NZPA 1CZHA 1TZJA 3LRXA 1BSVA 1MNAA 1YGPA 2Y77A 3Q3GE 3GJQA 4B6QA 5B6IA 4D26A 3CQ9A 4P4SA 3DAFA 2F9LA 3KPYA 3TUJC 3QVWA 3ZVKA 1Y7LA 1F12A 1RI5A 2NPIA 1ZKDA 2NZXA 2AF3C 2VHXA 1LPAB 2YQ4A 3NVDA 4WY5A 5K7SA 4CM5A 1T4DA 5FADA 3DZCA 3EE6A 4GM1A 1UWKA 4K26A 3E27A 3NHWA 1W34A 1WCYA 3KYDB 4QO8A 2ZQYA 1EUDB 3X43A 1I3OA 2WWFA 1RYEA 1FX0B 4L6IA 4CIAA 3KR1A 3QWBA 3L49A 1PJSA 1NZFA 4MW9A 2ON6A 3DOOA 4X41A 1OJLA 4DZRA 2VT2A 4B81A 1M34B 2HJWA 3NW9A 5CW1A 1MEOA 3DE1X 4PZDA 5EINA 1XE3A 3F6EX 5BYJA 3KVOA 1OTHA 5CXUA 5KHLB 1JHOA 4GKBA 1EDEA 2WSIA 4Q00A 4LQ4A 1F8GA 5TB5A 1XWFA 2E87A 1KXJA 2YNMA 1DC8A 1PYDA 1X8JA 1IPEA 3M4NA 1CDOA 3ICCA 4JJIA 4RHYA 3WGYA 4YT4A 2PN1A 3GZNB 5AXDA 3L4BA 1GKLA 4LHEA 3GJXC 1I7LA 2IIVA 2YY5A 1U8UA 4OGWA 3THRA 1BXKA 2RGEA 1C9NA 3UAWA 2FPUA 1EFRD 4IF4A 4MMXB 4D7AA 4EJMA 2VDWA 4MUYA 3ZIAD 3OLZA 1QHEA 3ETEA 3EVZA 3WLMA 3CNOA 1FNDA 4DUGA 4MPTA 3QPVA 4R1UA 1JH9A 3O91A 3WQHA 2BJHA 1KF0A 1X1QA 2D1FA 2HPVA 3GL9A 5DW0A 2H0RA 1EAMA 2MIIA 1U1EA 3UHOA 3KHUA 4MYSA 2I1LA 5KJEA 4HRVA 3ZY6A 1A9SA 3B1XA 3DE7X 1BD3A 1XHLA 1KEVA 4DR6B 3ID6C 1KSHA 5F51A 4RHFA 4NBWA 1U7UA 1YOVA 1N9KA 2J32A 4AN4A 1KIFA 1KJ8A 1ZGGA 5I9IA 3BOSA 5ECDA 7MHTA 4FDTA 1KC1A 4MQUA 4RHXA 2YN2A 3R40A 4AZ0B 3WQQA 3RVLA 4NE9A 4FNMA 1UMBB 2FPLA 2GERA 1UH5A 3P9RA 4QBKA 3RSFA 3TBFA 1T1GA 1KMHB 2ZRNA 3GMSA 3O8LA 5ESXA 4N6OA 4DJTA 1VE9A 4XIFA 4XIJA 2FWRA 1RCFA 2M9MA 3EJ6A 2XZDA 4TWRA 1X8LA 4Y9SA 4YRJA 4FEEA 1NNI1 3GT4A 3PNSA 2PUGA 3E9ZA 2J9RA 2FW7A 3TKLA 3DCJA 3GLHB 4EIWA 1NTOA 4P3YA 4MQFB 8OHMA 1Q0RA 1A8PA 1MVLA 3D3WB 1SUEA 1RLTA 3CVOA 3QLUC 1GA6A 3T1HB 5HPYB 3IB3A 2NTYC 3DVAA 4RKEA 2W2KB 3GIWA 2I76A 1JG3A 1RQ2A 3NHMA 3BF7A 1X1BA 1JWBB 1W4RA 3GVCA 2LCQA 4NQZA 3ZG6A 1KR5A 1PEYA 2ZR7A 1PJ4A 3IEPA 4FHCA 1U5BA 4K9LA 5JXGA 3KQNA 2PUWA 3GFGA 4E5PA 4B4KA 2APJA 3GROA 4GDMA 2VPPA 1E4OA 1Z8FA 3E81A 3QENA 3ZWXA 5IJZA 3KXLA 3KPVA 1RQNA 2NLOA 4KIJA 4LN1A 2H2WA 1UF9A 4TUYF 3U48A 4ZJPA 2ZWMA 1CY0A 3LP5A 1PL6A 1JFRA 3HZHA 2OAEA 2I29A 3AEYA 2JG3A 1OWMA 1PBNA 3DL7A 2XVZA 1XMXA 3PUVA 1TJ3A 1SO8A 4QJ5A 2REXB 2Q1TA 1Z5NA 3QOYA 2ZYIA 3MT7A 4FS3A 4H7HA 4K9RA 3WRXA 4C3OB 2V3WA 4UNSA 1WV0A 1PWHA 1XK6A 3GCGA 1Z6ZA 4FEYA 3FSGD 4M0LA 4R2KA 4GOMD 3M2PA 3TAXA 2OHFA 4YRGA 2QLLA 3K0HA 2JVJA 4P35A 4A92A 4BLUA 5BPHA 4HOYA 2FUG6 2FEOA 2MYTA 4B6GA 2KE5A 3BBPA 5DN6A 2IP1A 4K03A 3RS8A 1LVGA 1KP2A 2F3SA 1SBYA 1NUAA 1VLQA 1O5TA 1CEQA 2GI4A 4O2RA 3RB8A 2FR0A 1RWVA 1GARA 3P9KA 4MKHA 4KMSA 1LRKA 5FORA 4RTLA 1UP7A 3UATA 1J39A 1VHWA 1ZN2A 2DOKA 4F9FA 4M0UA 4C07A 4QU5A 4R2JA 6REQA 2Q21A 1DIBA 1Q3KA 4DE5A 1FRZA 1SUDA 2Q07A 1UBOS 3AHHA 1Z35A 4O59O 4ZOLB 4H3SA 1Q15A 4DQLA 2BUCA 2UYOA 5KTRA 3KJIA 3B1JA 4YQZA 3CNEA 2GN4A 2JKZA 5IULC 2OQVA 5JR3A 1XJCA 3HWRA 2CLEB 3EZNA 4US2R 4U8HA 2ZXUA 3INGA 3LO5A 1I0LA 4IHAA 3C6ZA 2OYRA 1N4DA 4H7EA 3NHAA 3GX1A 1RRMA 3QU9A 1YHZA 2ZUFA 1QIJA 4Z0TA 3V34A 3NAMA 2PBZA 3DM5A 1VHLA 5JSYA 2ZBUA 4RZ2A 5DI3A 5I4CA 3M5CA 4H27A 2WVGA 1P61B 4KDRA 3JWIA 3TRJA 4FUQA 3RNOA 4BNFA 3ODPA 5ES4B 1M66A 3QE0A 4DRZA 4F3NA 5FWXB 5IVPA 5JNSA 4IF6A 1EE2A 3AR3A 2OFFA 1P80A 2PV0A 3QEAZ 3HB7A 2GOYA 3U3ZA 1DGQA 4IRMA 3LC7O 2DC1A 3NIBA 3DKKA 3H6KA 2GCGA 4PSAA 3W5HA 4WNYA 3UQZA 4C4SA 3BZWA 2FZWA 2Z1DA 3DE4X 2VT3A 3DA8A 3O93A 3QHAA 4GLJA 4IXMA 4KE8A 1TVCA 1CUAA 2GJ4A 4TQGA 5DWVA 4B6OA 2G1PA 1SEVA 1HT2E 1XTSA 2D4HA 2DQSA 2DSNA 1XZFA 1AV6A 4RDXA 3L82B 3H5RA 4EMBA 2OGTA 2ZYRA 4MW5A 1E7MA 2J59A 1DOZA 3X3HA 4NOKA 1WHSB 2A59A 3BJRA 5CDFA 4BWFB 1H22A 4DCNA 3VSBA 3RRXA 5BVHB 1PHPA 3KR0A 2PT5A 4K9OA 4FW8A 1Z8HA 4CTKA 2XUOA 3S5JA 4PO8A 3R9WA 4RAOA 4DAEA 1JKIA 2R7NA 2YXDA 4BO6A 3D5TA 1UBUS 4UPVA 1B1AA 1I2DA 1FFYA 3GG2A 3K30A 1TMOA 5HJ2A 1XJ0A 1DQSA 4QE3A 5KCZA 1Y6JA 3GIDA 5HF8A 5FPYA 4GMGA 4OGFA 3S27A 1HTTA 2IXBA 2Q8PA 3LAWA 1GU1A 2CEAA 2R8BA 2Z95A 2V7WA 3QA9A 1NVKA 4NMWA 4PYQA 4UU1A 2WT9A 5CNKA 4RFLA 1YULA 3TLMA 3V7YA 5DPMA 3VOAA 4AO7A 1BOOA 4AKEA 3N75A 3R3XA 4FYHA 5TXGA 4C4PA 5KX5F 3ZLJA 1PWYE 2C7OA 3E82A 3OM9A 4GVLA 3FLBA 1MGPA 2R7KA 4S2EA 3KAKA 2AH5A 4BATA 1Z4OA 5C7YA 4G5YA 2F9FA 4KXUA 3U44A 1OF1A 4LV5B 4MUKA 5I3ZA 5FTLA 1XMJA 1FJGB 4ZO8A 2CUTA 5A3VA 4HWRA 2JLYA 1VLZA 4FKBA 3L7YA 1RYYA 4HFRA 5F5XA 1M2OA 2HCBA 3W2FA 4C6HA 3MUEA 3VPHA 3O90A 4WZ6A 5LNK1 3I28A 3GRAA 5HWSA 1KL7A 2J7KA 3L7AA 3NUQA 4KACA 4QXAA 2HQOA 4OI1A 1Z62A 5HYVA 5BPFA 2IXDA 4MUBA 2XJ4A 2A1UB 2JEYA 4NHOA 3DNPA 3MLAA 1DEAA 4PXYA 2V4ZA 4EG1A 1IBCA 3T3HA 3KEGA 1TZ2A 1V1MA 3AINA 1CZUA 2EWVA 1MJNA 4H77A 3T7EA 2HHHB 1Y80A 3LK6A 2YZNA 4KDFA 4UBOA 3E22A 4M7WA 2YMPA 3WKEA 2E85A 4IWNA 5CFRA 2WV9A 2QZ4A 4D9IA 3EY4A 4FHGA 4CLHA 1NVBA 2CDAA 4CL3A 3KJXA 1DAHA 1L3CA 2QEQA 3B51X 3JQBA 4H6WA 4S1TA 4BE4A 4BRSA 3I04M 4K9SA 4BIMA 1JEYA 3GJ4A 2PA3A 1JB1A 3UAYA 2J5RA 3AUYA 5K8UA 2Q5CA 4D25A 2MOKA 4CYMA 2ZANA 4L4ZA 3BUSA 2PUVA 3OX4A 1PP4A 4Q82A 3LVFO 3RVNA 4Y2YA 3VC3A 2W6CX 3OECA 3E2IA 4I8IA 3AZPA 4YQFA 3AL2A 2PWAA 3EPLA 2VSYA 3BMOB 5CW2A 2P0EA 3BSYA 1HQKA 3HWX1 3DW3X 1WQ3A 3P2KA 3EYAA 2EW8A 3DWEX 4X1IA 5JQGB 3QLTA 4LV6A 5KVSA 2C03A 1Z0KA 3NIFB 3IA2A 3L05A 4KMRA 3RUHA 3W8RA 1A8SA 1FZQA 3UK6A 4OI0A 3D6TB 1X1TA 2Z30A 5A9SB 4A4DA 5B3JC 6AT1A 4L75A 4X1OA 3UMCA 1N2OA 1DI0A 4TMYA 2IYQA 2VDOB 3PXEA 4QUBA 3NGXA 2R8OA 1R50A 5CA1F 1R37A 5G3YA 1JEQA 2BOVA 3UPUA 4D9NA 4K0RA 4ZOAA 5I5EA 3PFHA 4X8OA 1QR2A 4XUDA 1T1IA 2IYPA 5AJYA 4Y9UA 1UDAA 1SCJA 4Z54A 4X3PA 3ZOZA 1YQ9A 1R0ZA 1F0PA 3LU1A 1BE6A 1L4NA 1ETUA 5JC1A 4JASB 1CE8A 3UJ8A 3UTDA 1N9GB 3OA0A 1A4RA 1AGYA 4OL9A 3QPAA 4G65A 2MMGA 4Y2PA 1F0KA 2AEEA 2EJTA 1VCIA 2M6SA 3MXOA 4HDMB 3H9CA 4GZLA 4RD6A 1AQYA 1EFVA 5G0SA 2ZUTA 3ZU2A 1JFFB 4ME6A 1J0AA 4O4HB 3DDCA 1J56A 2O06A 5DYNA 4ALNA 5G0VA 5C5IA 1E66A 1NE2A 4FCVA 1M2VA 1FFDA 5GGXA 1NVTA 4C4TA 2O59A 2XDQA 1I1OA 1NYQA 3PNMA 4HAIA 2WJJA 4FFBB 4JX8A 1ONBA 1DAIA 3BTUA 4YRAA 1Z5PA 1MVNA 2W90A 3L5KA 4RY0A 4KYUA 3MNFA 3ZV5A 1U0BB 1ZRNA 1X6VA 5EXSA 2DBRA 3OQ1A 2QTVA 4PRLA 4Q9HA 3TD2A 4F5DA 4F11A 2XR1A 3NZEA 4B6JA 4WINA 2KJQA 5I8ZA 3L18A 1N77A 2ZTHA 1OX5A 4XGKA 4F7WA 4QDXA 3IKJA 4FYWA 1PVDA 4LZAA 4WKCA 1FLAA 2IH2A 2IYAA 5CK4A 1QORA 2PE5A 3RC8A 3EXHC 1ZAYA 3GEPA 4KN6A 2LKCA 3AKCA 1RJDA 2OENG 3KLNA 5JSFA 1HL7A 1LDBA 3W2HA 1UDXA 4JNCA 2D06A 4TV8B 1RWNA 2OYSA 4K9MA 4RNDB 2UUPA 1JBEA 1G16A 3CLVA 1LY1A 3V8NA 2XGJA 4H6VA 2OHGA 3GD7A 2I1WA 3DOCA 4AM8A 1DBIA 3GJTA 6ADHA 1OXTA 1KMCA 2XMZA 3KKLA 4I9UA 4M76B 5CLGA 1MAWA 4HTAA 3K6JA 2BGLA 2NX2A 4W1RA 3IKVA 4Q4DA 3ULKA 3AP1A 4DCUA 4RF4A 1N8KA 1O87A 3CVYA 1PR5A 3FOCA 5BT9A 3BREA 1X2EA 1S8AA 1JVNA 1KI9A 2XKBA 4LRSB 5JI2E 5C7OO 4GR4A 4LXGA 2Z9CA 4II7A 3QZUA 1DZIA 1N0WA 5NULA 2JZCA 4HX2A 4AO8A 3I5YA 1ZW1A 3HCPA 1O2DA 1WW3A 4KODA 3WG9A 1VRWA 1GQSA 5TX7A 3HEBA 5CFOA 4B43A 3PS9A 1NQWA 3A6ZA 1WMEA 3GUZA 3MOGA 1FFAA 2IU4A 3PQFA 4HP8A 4RS4A 3SXUA 3EAFA 4RD4A 1P6XA 2BGJA 3DBHB 1PTJC 3ZDDA 3V4ZA 2QD1A 1RKBA 3FPGA 1DJNA 2JNWA 5AJTA 4AJNA 4J0GA 5AW2A 5FFNA 3IXQA 4UTOA 1KH1A 2HU5A 2F1IA 2F8SA 4HGZA 2ZIXA 4YXWD 1ZGBA 1WETA 3STTA 3RYCA 4LYYA 4RH3A 2XA1A 1U0HC 2HRZA 3TSWA 1U04A 3C43A 3L6UA 1IEQA 4MGHA 2YJ5A 3S7ZA 1FNBA 4Y3UA 2X42A 3U0VA 2XCLA 1LDMA 4IVQA 4EHLA 3D3JA 4QGHA 2PS1A 3CUTA 3DMYA 2JLVA 3RTEA 4X5OA 3EA5A 3VR5D 4ZEOA 5B1EA 4J16A 3HCBA 1EVYA 1T6ZA 4WZBA 1FOEB 4AD8A 1MA0A 2L17A 2QB5A 3K0SA 1L7PA 3L0PA 3ETDA 2LCIA 4ZHSA 1E63A 3V6LA 2A5LA 1G9TA 4FSXA 2O2CA 1OX6A 2GF2A 4IIVA 5LKRA 4Q1AA 1VKRA 4G4SO 5HQJA 5A7FA 5BMVF 2AX4A 4YK7A 1GG8A 5A71A 1CY1A 5IUJC 1M0WA 5FF9A 4D97A 4TYWA 5AW6A 3ZDQA 2VQDA 4QTTB 2YWCA 5LJLA 4OHMA 1YACA 1GPLA 1DJPA 1S2IA 2RBKA 4M1EA 2OV3A 4WQMA 4YH1A 5P21A 4S0ZA 4B85A 1NQTA 3PENA 2C2MA 2XCOA 4IUCS 4X92A 3UK1A 5FRDA 1GZVA 2AR0A 3U37A 2W0MA 1V5WA 3V8BA 4DDUA 4GX0A 4IMRA 4KQEA 3RYHB 4QOHA 2J9XB 4WVFA 5B7NA 5CAEA 1X7YA 4H08A 4RQAA 5HCNA 1T5LA 1WDTA 3OAAD 5AJVB 1QIDA 3SR3A 1DWUA 3GCDA 3DF9A 5FBZA 1VPDA 3KCQA 1SBCA 4QPJC 1CB7A 1ADCA 3G0IA 4LZJA 5EWLB 3DMDA 4LXUA 1XBTA 1T3LA 4YPOA 2B82A 3H5LA 1IVSA 2AXQA 1BGVA 4QFCA 4MAAA 3WK6A 1L9XA 1PT8A 3I0NA 3PB3A 1LDYA 3W5SA 1NMEA 3NTRA 4QARA 4DCGA 4QQFA 5BSWA 2Q2OA 3ZD8A 4CT4B 4GVPA 2DYKA 2I4RA 1UADA 3N2GA 2H17A 2CNLA 4FDMA 3EXFA 3SC4A 4MZDA 3MT8A 8ABPA 5K20A 2H3EA 1BDMA 1QXSA 2PDAA 3MJDA 4PC2A 4D9KA 4LMPA 2NN3C 3MTBA 1KO5A 3WMRA 4OIMA 3I1JA 1EXNA 3JZMA 2H8GA 5AICA 4RH0A 3VR6D 1C7RA 1N7GA 3IPCA 1ZXBA 2AIRA 3DAPA 1I4EB 2PZLA 2X0NA 2BKEA 2F67A 2R00C 1JG1A 2X8JA 2QRZA 1A9PA 1D9ZA 3BCUA 4QDKA 5ALDA 4V1CB 3CR3C 1GFSA 4CFZA 2JAUA 1D4OA 2AQIA 1QHGA 1VLJA 3BTSA 4EGCB 2MSWA 4FHFA 3MF4A 1EVIA 3HKBB 3MCWA 4AK9A 2PSSA 2C07A 4R2WA 4DNXA 3HFSA 1Q2UA 3RRFA 4EJFA 3O3CA 3KAJA 1SQ0A 1FYDA 1RLIA 2OHJA 2W4QA 5DX1A 5AWFC 3SM3A 1ADGA 1F5NA 1FL9A 2VL7A 2Q8QA 3EISA 3BDIA 5K8IA 4FZVA 3ZD7A 1CLUA 4WKPA 2R1VB 3WO0A 2NZWA 1X7GA 2HM7A 3O3MB 4JP3A 2XZOA 4UEJA 2EZ9A 4WK2B 4KV7A 5J2TB 3DD5A 4AY4A 2FEWB 4HWPA 3PC3A 4OLBA 1TRHA 2CFCA 1TW3A 3ELYA 1BN6A 4EHNA 3GXBA 1Q7GA 4ZU3A 5TPWA 1BNCA 4MP3A 3QPUA 1JHVA 4NBLA 1FMJA 3H9JA 4N7JA 3ZWPA 2FN9A 3TVTA 1IZZA 4BLQA 1EVJA 1QMGA 3FRJA 1BJKA 4UCQA 1K98A 1PLLA 3GI1A 3FI0A 3LZCA 3VR3D 5BYAA 5L3ZA 1RHRA 3IAS6 1KKUA 2A5DA 3NONA 4PR3A 4DW8A 1SXJA 1L7EA 3QLJA 3VA7A 3OCCA 3KE9A 2F62A 4GZ3A 5J40A 2INGX 4GVXA 1CQPA 2LVBA 2QZJA 2YJ6A 3L06A 2AKAB 2FKNA 3LOQA 3WQSB 2R6FA 3VX3A 1KMNA 1ZXXA 2RGUA 1E7YA 3OZ7A 4H7KA 4MRVA 4WCVA 1J0DA 3W3AH 2R4QA 3GJ8A 4U3JB 5CB0A 1HLGA 1NI4A 3BWEA 1E2UA 4OXKA 4JBXA 5AM5A 4LYAA 3DFKA 5MN6A 1WOMA 1WSDA 3O7WA 1QHNA 3CLTD 3LT4A 1M2KA 5L9AA 4DA4A 5LQCA 4LDJA 2VRBA 3IOCA 4OM8A 5CT4A 3WL4A 2ZROA 1WMAA 3RBAA 2I6QA 3RVSA 5PGMA 5KI6A 3UH0A 2BEVB 2GWHA 2FQQA 3QNWA 4FPXA 1O97C 1S4MA 4M9XA 4Z6KA 4FFWA 2X8WA 2I1VB 3DZ8A 4WFJA 3ZXSA 5IEBA 1XR3A 4C05A 1Q1AA 1NVMB 4RSRA 3D2AA 1OIXA 4QXPA 4DLPA 2VAWA 1VFPA 4CR6A 3WLEA 5E6SB 3PNBA 4DOMA 2QTMA 4S1VA 1VIVA 5KAMA 1IUNA 1CVRA 2C8VA 3KZKA 4MYDA 2OBLA 2J9FA 4KBGA 3L0BA 1PGOA 4ZYUA 3DFFA 3KYDA 3M4ZA 2NUPA 1U3UA 4DMCA 4FC6A 4HUJA 1NF3A 3SSMA 1QG4A 2V5AA 2Z6AA 1W4BA 4M22A 1U4NA 3EGXB 1QYWA 2J4FA 2PX8A 1C1XA 1I80A 3L93A 1A5ZA 2EBHX 1HDIA 1U0TA 4HYEA 3NRJA 4JJAA 2ZKLA 1JEJA 3JALB 1GPYA 5A0TA 1R66A 2BFBA 2JIZA 1D3AA 4Q21A 1C1HA 1TK9A 1W5TA 1I30A 1TJPB 1XHFA 1UQUA 4MUIA 4PY2A 4YJ2B 2NAFA 4JC5A 2Q46A 3X1MA 3Q5EA 1W93A 3LP8A 4A03A 5JD5A 4X63A 2XCRB 1QWSA 4JK3A 2DFLA 3HCDA 1PFUA 1U31A 2C4TA 2PGJA 5EFZA 2LWIA 1FUIA 4B48A 2PEZA 3GRRA 5DGXA 3SICE 1Z6AA 3OQIA 3I2KA 3GMDA 3CW2A 4H3HB 4MMZB 4MW7A 2WM2A 4KGDA 2AG6A 1SIOA 2R8YA 4R9NA 4BFYA 4F12A 4H16A 1Q6ZA 2VTVA 1T26A 2I6FA 2HHCA 2ZB3A 5KTSA 3CW8X 1EDOA 1RHQA 3GJ3A 2IDZA 1NBWB 4WXMA 1EB9A 4OKNA 1G21A 2XWQA 1ECJA 3GF4A 5CRIA 2RI0A 4B7XA 3B6MA 2ILVA 3TEJA 3BJEA 4ZICA 3D6JA 4CNQA 1P77A 1KI6A 1ONOA 3O73A 1C5KA 2OY0A 3WP0A 1RLOA 3LHFA 3TQTA 3LC0A 4XOUA 4UAJA 2IWRA 1DUSA 3H0CA 4K88A 1XMOB 4LYJA 3VV2A 3OJWA 4XB2A 1ES9A 1VHQA 2WKPA 3KJEA 1DIOB 2BZGA 1OBVA 2C2WA 2R44A 2WABA 2JCSA 4RPIA 1Z6YA 3FVQA 1REQB 4FZJA 1H0HA 2FPXA 3K9LA 3GRPA 4OSOA 4C6SA 2CFRA 3L6EA 4ZCIA 3AXSA 4JLPA 3U17A 1HR0B 1ZHOA 2ORIA 1OYOA 3KOYA 4GMXA 1ZESA 2DFVA 3H2KA 4C7OA 4YROA 3RK0A 4OBXA 2PL5A 2V65A 2ZREA 4TMFA 4BMYA 4ESVA 4MCIA 3LZDA 3DLAA 1U65A 1ZU5A 5BQFA 4R1OA 3AKZA 4IGEA 1RLMA 1ZBQA 1ZH6A 4KSCA 4PC7A 4MK4A 4OJNA 1WSWA 2X0DA 4KQ6A 5KSPA 1PDOA 5KTYA 2EIXA 4YBZA 4UCFA 5FQNA 2PYIA 2ZAYA 3GDHA 4KO2S 1Q7BA 1S3IA 2Q50A 3FKJA 1P0CA 4FWBA 4I0WB 2W8BA 4U2EA 1CFJA 1LBIA 3INNA 5H5JA 2HWKA 1M34A 5JFOA 3DDSA 2QZPA 2Q0SA 1U7XA 3CZPA 5EWJB 5EJ9A 4MO2A 4BB6A 3ZJVA 4OAOA 3W7VA 1KOGA 2IU0A 1SVLA 4X6YA 5E3JA 3NNDA 4O08A 3RWMB 2ZB2A 1JU3A 1ADFA 5FOTA 1JLKA 3L8CA 3MK31 3A6DA 3HRIA 1E7RA 5KYWA 1E2BA 5HFAA 1FMFA 3HU5A 2D5LA 3TLCA 5FA5A 4CLOA 3M82A 2Y71A 4C3VA 3R76A 3L8ZA 1KPIA 4W5WA 3TRDA 4PINA 5FL3A 1X1CA 5I8WA 1G2QA 1LLFA 2VVTA 1NNLA 3A1EA 1HE3A 2F1OA 4W9NA 2OO5A 3LCUA 2O7QA 1Z0IA 1AURA 1KH2A 3PRHA 1A96A 1IONA 2WYWA 3AFOA 5JAQA 4CEIB 3ONWA 1PN3A 3T9BA 1DBVO 1SIWA 1N1DA 1GUAA 4G0NA 1QIHA 2PX6A 4QQNA 4RPJA 5F7ZA 1MA3A 3RSSA 2VJAA 1KEEB 1YRAA 1T1JA 3SVTA 4BU0A 4P7FA 3KKQA 1PT5A 3GZTB 2CNBA 2O0KA 1U0SY 3MAJA 4L0DA 1QWOA 4BQOA 4DQDA 4EHJA 3OU7A 4WY2A 3P2JA 2PX0A 1XCPA 3KSDO 4QAJA 2PR2A 4DB4A 2O5VA 2Z2YA 4NU5A 4YCJA 4ZT6A 1H2XA 1N2BA 1S7GA 4UVEA 3SEAA 3D9QX 2EVWX 4UZSA 4HKTA 1N7HA 1NG1A 3I3OA 4JROA 2AC4A 4PG6A 1SU4A 1BVRA 5IU6A 4JLOA 1V1MB 3EHEA 1VBMA 2O8BB 2VAXA 1NYRA 1RYHA 4LI3X 1ZX1A 3CLUC 3QM1A 3EH2A 3WC4A 2F3TA 5IK2A 4L2IA 4DG9A 1UFKA 3DR3