1Z0KA

Structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
b'TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGLERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0kA01
1Q21A 1A82A 1DPFA 1KO8A 1ZBDA 3K9HA 2ZUDA 1UPTA 2WWFA 1CLUA 4C7OB 3EC1A 3LO5A 3PUWA 5FOXA 2IBMA 3L2OB 4AI6A 2KSQA 3NWJA 1I2MA 1P9NA 3QPUA 2CVHA 5LDDC 1SXJE 3WMEA 4B71A 3AVYA 4TSFD 2NPIA 1YR6A 1GDDA 1T6NA 3ECCA 4ARZB 4KVGA 1L7VC 1ZJ6A 4RCZA 1KI3A 3FMOB 4DUGA 1ZC4A 3ZS8A 1WA5A 1D9XA 2QN6A 1E9FA 4LPKA 2IYUA 1OXSC 2R6GA 4CW7A 1KOFA 3B7GA 3CNLA 1H8ED 1YE8A 2QORA 3FE2A 4HAVA 4C2UA 1ZNYA 4YDSA 2QT1A 1II8B 1OLOA 2GJ9A 1XCMA 4LDJA 2P3SA 2HXYA 1T0HB 1GITA 2Z5FA 4JLKA 2P67A 3NBFA 1X8LA 4BE7B 3GJ6A 1XNJA 1F2UA 4POAA 121PA 2VHQA 3GP8A 5LD2B 3PV0A 2AWOA 1PLJA 4JJZA 1ZIPA 2QAGB 4TQ9A 1GUAA 1NIPA 4PSKA 2CCKA 3ONWA 5KDOA 1ZNXA 4DRZA 1Q1QA 1COWD 3RAPR 4D0GA 5DN6D 2ZRIA 2PX0A 4NMMA 3RHFA 3T15A 4BLTA 5JRZA 1FL9A 3LBIA 2FEMA 3TVDA 3RS3A 2KE5A 2HDNB 2CNWD 4P4UA 2WJGA 3UANA 1MT0A 2F7SA 4EFLA 3ETLA 1N0UA 2J41A 3QENA 4IXNA 3BFKA 2W83A 1G8PA 3EIHA 2CJWB 3KJHA 4GZMA 3QOFA 4A2QA 1N0WA 4JLBA 1QZXA 4URWR 1XFAA 3GJ8A 4PQRA 3AB3A 2NO7A 4S35A 3H4MA 4B3DA 4EFMA 1R0XA 3ZGXA 5KNCA 3GJ4A 4PQFA 4B43A 1DO0A 4HLQB 3KQNA 3HU2A 1OIWA 4DC9A 4JT2A 1B0UA 2V1XA 1CEEA 4DCSA 3TW4A 2RMKA 5CITA 3TKLA 1FTSA 2OUKA 4LV6A 2FSGA 3WNDA 3UMFA 2ZVPX 221PA 2KB0A 4E5UA 1IJFA 2ONKA 3QF4B 2OEPA 4GPTA 4KSCA 1B23P 1NN5A 4Q4AA 3P4XA 1NVUQ 3MWKA 5B64A 2ZJZA 1AN0A 3Q8XB 2KI5A 3U4QA 2WOOA 2VSFA 1Z08A 1NIJA 2J7PA 3IIKA 4IVPA 4JLAA 3WMFA 2VSOA 3HU1A 5IF9A 4A8JB 5EP2A 4QHTA 5UKDA 2JLZA 5LB2A 2FFHA 3KKNA 1JALA 4LBWA 4AC9A 3ZH9B 2ECKA 1GOTA 3O8DA 5FTKA 1KMQA 5C46F 2R2AA 5AUOB 3GLGE 3LXXA 4FMCF 4HEJA 4JIMA 1X8KA 4PAMA 3RSLA 2G3YA 2VLIA 4NDZA 1XF9A 4LJ4A 1KY3A 5KNDA 2KJQA 4KLZA 2DYKA 3NVAA 2ZJOA 4UQOA 1E2KA 1M8PA 5JRJA 2ZE7A 4EKDA 5JCPA 3FWYA 1H65A 3CNNA 5FOWA 3PEYA 1XEFA 3WYGA 4LJ8A 3RC8A 5KOYA 3AH8A 2Z43A 1P60A 2WJVA 1Q1BA 4IW3B 3ADCA 2A78A 3RDPA 2JLQA 3OE7A 1XJ0A 3BD9A 3W6NA 1Z0AA 1Z0JA 2DWQA 3SS8A 3CF6R 1S1CA 3UMSA 2O8DA 2V4ZA 3AUXA 2X19A 4I1OA 1KO4A 3AVPA 2QMUA 4RZ2A 3DMDA 3Q7PA 1DG3A 4WXRA 4A0RA 1II9A 3BK7A 1GAJA 4D26A 4ZCIA 4KFUA 1XD9A 4AY2A 2ZITA 1A2KC 2V7QD 2Q9CA 1P2TA 3U7HB 4Q21A 2P0EA 1E2NA 4WOPA 5H70A 2FSIA 4PTLA 3BORA 3F0TA 2BJWA 3FFAA 1JJVA 2GNOA 5B30A 2EFEB 2VF8A 3HJNA 3GFTA 4WZ6A 2ZJ8A 4DLVA 5SZKB 4D0LB 2WJJA 1QDEA 4TQAA 3V4RA 1EG7A 2G83A 2QAGC 3IBYA 5LB4A 2P6NA 2ZI7A 3X1WA 4DDWA 2G0NA 4F93B 4L16A 1IQPA 2CLCX 1XD2B 4JMPA 4Q9HA 1JQLB 4LJ6A 1EWQA 3C4JA 2B92A 1G6OA 1YQTA 3EZ9A 4TSFA 3EPJA 1F2UB 3KKPA 2QQEA 4YONB 2FOLA 3B85A 4B2IA 5E7IA 4PC3A 4Q1FA 3OIVA 1T5LA 2YNMA 4LC0A 3EASA 4M9XA 4DJTA 1RRPA 2HXSA 2FU5C 4Q1BA 2WHXA 5AK0A 2XGJA 1G5TA 2BMJA 2FJUA 2JLVA 2XEXA 3K0CC 4YMWA 3MWLA 1VYVA 1H8EA 1WQ1R 3K70D 1M74A 4QOSA 2ZEJA 2CEAA 4DT1B 1MRSA 5CJ2A 1KTVA 3QG1A 1H8HD 1E9RA 2ZTSA 3CZQA 2NO1A 3HR7A 2ZRLA 2ZRJA 5HCNA 3S1AA 4EDHA 4OBEA 2X8AA 1HV8A 4RD6A 1E4VA 1RIFA 1W4BA 4HAXA 2WSMA 4M1OA 4MRRA 5KUTA 4BFXA 4IFBA 1NNEA 1I4LD 1XMJA 3I8XA 3AM1A 3AF3A 2ZSEA 2WMNB 4V0NA 1COWA 5DN6A 3ADDA 1KI7A 1AK2A 2ZXUA 3A1VA 3CRMA 4NH0A 4EPYA 3N70A 3OF5A 3T1VA 1R8QA 2BDTA 4WIAA 2CNWA 2J59A 5JI3E 2XZOA 3EZ7A 3K8YA 5DHAA 4A1FA 1S96A 3EPLA 4MRSA 1AQUA 1M7GA 2JLWA 1F2TA 5FTMA 5TXGA 1R5NA 1KZGB 3CRW1 1G6HA 4LC1A 4NU0A 1KSGA 4CEJA 2AHOA 1MO4A 5TB5A 1JBKA 1E79D 4CEIA 2GCNA 3H1TA 2E87A 4ZKEA 4A8JC 4OJQA 1NVWQ 2MSDB 5FL3A 4B2PA 2ZRMA 3CWZA 3FMIA 4PO1A 1W1WA 4KYIB 3GLIE 2B8WA 2JAQA 4EPTA 3U4QB 4RKFA 4GI7A 4PHTA 4F4IA 1N6PA 3P32A 3DOFA 4IOLA 2H57A 3M6AA 5HCIA 3THWA 4HDOB 4DSNA 4JLPA 721PA 3OIUA 3KB1A 5DNYB 5D3QA 2O0KA 2H17A 2UZ3A 5DIFA 1QVAA 3NEJA 3KZ1E 1CR0A 2Q3HA 2WJIA 2ORWA 3VNUA 1CR1A 1OFIA 4NONA 2Z83A 3T1OA 4IVQA 3KTAA 4B3FX 4Q4HA 5EJEA 4B3BA 4PPNA 1JXOA 2FWRA 1FQJA 2FSFA 1W4AA 3QKRB 4QL3A 2ONJA 5JSZA 3FTQA 2DB3A 2G1KA 2JIZA 1U94A 2ZSFA 3T5DA 4ERNA 2WVJA 4OL0A 2F9MA 1O3YA 3BIFA 1PLKA 1E2DA 1ZUNB 2VF7A 3U6KA 1XTQA 2VP9A 4YMUA 3FGNA 3FHTA 3T1QA 3SJCA 3BS4A 3R9IA 3T12A 3WNCA 2YWFA 2IHBA 4GOXA 2KBFA 2L0XA 1N6NA 1TQ2A 2EFCB 2D3WA 3C5HA 3LDAA 1VG9B 2F1RA 4RFSA 1EGAA 4DIEA 1PLLA 1T91A 1UDXA 4K8OA 5CYOA 4EQ6B 2DFNA 2XNSA 1FW6A 4FMBB 1Z6GA 2O8CA 2VHUA 4AURA 3PG5A 1BMFD 2GETA 1FQKA 1AKEA 3B1WA 3AV0B 5F2EA 3ZQ6A 3GLHB 1S9HA 2EU8A 3Q72A 1Q3TA 4J0QA 3AGQA 3GJ7A 2JJ8A 4LJ7A 4MKHA 2C5LA 2IXEA 4V03A 4EPWA 2IL1A 5J4KA 2CCJA 3K9GA 1I2DA 1OF1A 1YRAA 2AWNA 4QBFA 1AZSC 4Q00A 1Q3HA 1U9IC 4LHYA 1XZQA 1QG4A 2O8BB 2H18A 1IXSB 5E7MA 3TUJC 4OQLA 4OHXA 1US8B 4RD3A 4DDTA 2QGZA 4D2IA 2H1LA 2FA9A 2DY1A 4Q1EA 1VG8A 1N6RA 5C4MA 4MKGA 3QKSA 4JVLA 1DO2A 1UAAA 1N5IA 4IDNA 4PC7A 3BGWA 3PR1A 3DDCA 3CPHA 2EVWX 5SZJA 4D0NA 2V7QA 4Q4JA 4GT1A 4KSBA 1KI6A 3O47A 1R8SA 4O2LA 4WA7A 3RNLA 2C95A 1E9BA 3W5IA 1YR7A 4D6PA 2FE4A 3QEJA 4BUJA 4L4UA 1P5ZB 2ZETA 4TTRA 2IUSA 3RRMA 2OFWA 3BAFA 3ND8A 3W3AA 1S4QA 2CBZA 4KAXA 4GBMA 2QM7A 4YDHB 1DAKA 3NH9A 5K8UA 1G3QA 2GESA 2Q21A 2ZAOA 4WZBE 1Q0UA 2PZFA 1HQCA 4QJ3A 1BH2A 3FB4A 4I1VA 3UATA 1G7SA 3RS7A 4G0NA 4OI0A 3GFPA 2J0UB 3L8ZA 4KFTA 4EIWA 3LWNA 3UIEA 4K81B 4M1SA 4AIIA 2RGNC 2FV8A 2HUPA 5G40A 3SYKA 2YOHA 1SHZA 3BH6A 4Q9LA 1RC8A 4MRVA 2AR7A 4PR0A 2OCBA 4GSYA 1QF9A 3CO5A 3EPHA 4XVUA 1IM2A 1E99A 2ANBA 2P2LA 2RAPA 1YRBA 1JR6A 4E07A 1EFCA 1P6XA 3P4YA 2XXAA 2V55B 1H8HA 1QHXA 4QHSA 4U7DA 2ZI9A 4C0KA 4US2R 3H86A 2F3TA 3AGPA 1FP7A 4BZXA 5L8VA 1TNDA 1EX6A 2XJ9A 1TMKA 2O8FB 1QHHA 5IRCD 5EP1A 5EZ5A 4JKIA 1E4YA 4A2PA 1VG1A 1GSIA 1E9SA 3VQTA 1XMIA 1MO3A 2QP9X 4M53A 2EFDB 3HYRA 3UXMA 2QP3A 4BFTA 3EPKA 3LY5A 1PUJA 2GKSA 2G6BA 2ZRDA 3LVQE 2Q3FA 1YZTA 2PH1A 4AKIA 1AGRA 4JJKA 4WW0A 5DI3A 2VRWA 5TARA 1FTNA 1KSJA 2J45A 2PZEA 1HE8B 1IHUA 1QHNA 1GM5A 3CRQA 3CRRA 2OESA 5TVKA 1NSFA 1W46A 4MGKR 4D80A 2DWOA 1N5KA 1Q1ZA 1KJZA 3CX8A 4I99A 4IOKA 4TLBA 4AKHA 1E79A 5HPYB 2EYQA 1R5BA 3EZFA 1KZ7B 1HT1E 3KXKA 1W0JD 1XU4A 4US0R 2ZUBA 1A2BA 1CJUC 3CUEF 2A2ZA 3KXIA 2V9PA 1ZCAA 2GBLA 1CKEA 5KPDA 2HEIA 2VHTA 1U2RA 4AYWA 4DSOA 1ONBA 4FINA 2FEOA 1E32A 1G3RA 2RKOA 1PV4A 3WBJA 1FX0B 4AKGA 1NG1A 1DEKA 3RRNA 4YXWD 3C7KA 3NG1A 2FG5A 1E0AA 2G88A 2C9OA 1D8TA 3HP1A 2ZS7A 2XTNA 4L8GA 4UKDA 4C0LA 1LFDB 1Z6YA 4Q4LA 5AWFC 2D4HA 3QVVA 2W58A 1DADA 3NBYC 4DEXA 3RC3A 2F43A 1G8HA 3HPRA 1PVOA 2GZAA 3LQQA 1EK0A 4NE2A 1J8YF 4TLAA 1VTKA 3BOSA 5KSYA 1OT3A 2R9VA 3GCGA 5A0FA 5EE3A 4JYBA 1R7RA 1KI2A 2CHQA 3PFIA 4HB2A 1UEIA 3TE6A 1SHKA 1SKQA 3LLMA 1Q20A 2OCYC 4MH0R 2REOA 3AP3A 3BC1A 4Q01A 3U3OA 1JB1A 2J46A 2P65A 4O2RA 3R9WA 4LY6A 1XTIA 5AUPB 4EPVA 2JEOA 3SBEA 2QE7D 1VCIA 1KJYA 2VP6A 1IXRC 3UWKA 1NJFA 1EFRD 1XBTA 3N2EA 3I32A 1N6OA 3CX6A 3H2YA 1IY2A 3QIAA 1NMXA 4EFNA 4HATA 1MKYA 1G3MA 2EYUA 3CPJB 3LX8A 2WAYA 2WKRA 1DG1G 3QKSB 1JXMA 4XVRA 1BMFA 1AA9A 1N6IA 3U7EB 4DSTA 3X1DA 1AIPA 4PHFA 3DZ8A 2FGKA 5AUQA 5K8TA 3U60B 4IXMA 3B78A 4LCBA 2GEVA 3T06B 3C16C 4PSVA 3EWAA 3RS4A 1KI6B 4M21A 1XP8A 1A7JA 2KWIA 2OLKA 3U44A 2CE2X 4YMVA 4QBIA 3TBKA 4RFVA 3G0HA 4TLDA 4BLRA 1KSHA 3BJIC 3LBHA 5L3SA 1U81A 1DAGA 3R7WA 2D2EA 1Z8FA 3A8TA 1YZQA 4GZLA 5BWMA 5K8LA 2YWEA 3KKQA 2MMGA 1NN3A 1G1MA 1G291 4M0LA 2A9KA 4IVRA 2VL7A 2Z0MA 5EE9A 4JS0A 2YWHA 2BMDA 3CW2A 1HURA 1E9DA 3TH5A 1LF0A 4BQSA 3I61A 4N0DA 1E94E 4NTZA 1OYYA 4UNRA 1XCGB 4KBFA 1UM8A 1OIXA 1VECA 2J87A 2ZRHA 1RJ9B 4M8NE 4DDVA 4GDFA 3KB2A 4EAQA 5J4HA 3DKVA 1JPJA 1N5LA 1G4UR 4JBWA 1ODFA 4JLOA 4V0KA 4LV8B 3A1SA 2VSXA 4RVCA 4JL5A 4TMZA 1X8JA 2FH5B 1XTSA 4OI1A 2P5SA 1BYUA 3C5CA 2JDID 1KKMA 2QEQA 3IEVA 3R8CA 2CLDX 4WAUA 4BPBA 1S2MA 2YKGA 1QRAA 1LY1A 4HAWA 4A92A 4QG7A 1GL9B 2UKDA 1ESMA 1OHHD 4LHVA 2IWHA 3BWDD 4ESVA 4DCUA 1GL7A 1KNXA 3AVTA 1WXQA 4A0HA 3VU9A 4Q5IA 3H0KA 3VR4A 1EFHA 2QQ0A 2Q0HA 3NBXX 3SC3A 4LBZA 3SN6A 1N6LA 1W44A 2HCJB 2I4IA 2VYFA 3IHWA 3RANA 5JHGB 4KU4A 1NMYA 4G5GA 5CIWA 3VX4A 4G5QA 2BCGY 1NY6A 5FUWA 4D82A 2ATVA 3UPUA 1KHTA 1PUIA 2MSEB 2BIFA 1GRRA 1E9EA 1L2TA 2ERXA 2EWWA 2O52A 4URZR 3T5GA 4BRUA 4MDEA 4FMCB 1Z28A 3SZRA 4QGFA 4PC1A 4A4DA 1QHIA 4NCKA 3A4MA 1LTQA 4A15A 5EXXA 3X2SA 2WWIA 3WBKA 4DHEA 2IS1A 4LZZA 1W49A 2CMKA 3K0AA 4TMVA 1KGDA 5FUYA 4C0SA 4NBSA 2CK3D 4XD7D 2FPMA 5LPNA 4URUR 2RHMA 1XXHA 3RABA 1SVSA 2RGEA 3LQRA 2CL6X 1IOZA 5DHFA 3B2EA 3VKWA 3MFYA 4I1SA 2V6JA 4RD1A 4HI0E 3F3YA 3ZIAD 2QPTA 1PZNA 4FI3C 4B3GA 3QVUA 1NLFA 2QRNA 1GFIA 3SOPA 2BBOA 4A36A 3LD9A 3REFA 3ZD6A 1XEXA 3OAAD 5AJYA 2AK2A 3DHWC 4L5BA 2Q6TA 3AVWA 1XPRA 4FCTA 3MUFA 5HTKA 2F55A 1S3GA 2ZVQX 1CF4A 4PC6A 4OHWA 4BFSA 3QQ5A 2H8KA 4L15A 1KK2A 4UJ3A 5D3MB 2ZREA 2WPDA 1GKIA 4W7SA 1XXHE 4DLYA 3OIWA 2OZEA 3IPYA 1W0JA 4M9SA 4G5OA 4ZIRB 2NTYC 4RZXA 3KJEA 3FDIA 2ATXA 4IOMA 1SQ5A 5CB6A 3GLFA 2AXPA 3D7MA 2G0TA 4UJ5A 3WRXC 4ZV4A 4FMDB 4YXWA 4XTRA 1Z0FA 1HT2E 2HT6A 4NHOA 3IKJA 3SYNA 4B75A 1P61B 5FPKA 1E96A 2O8EA 3KQLA 1OSNA 3I5XA 2IA5A 2WSSA 4XVQA 1SKYB 4QBGB 4LSGA 4Z8YA 4HUTA 1G9XA 2GXQA 3BH7A 3GLGA 2VHCA 4NL4H 4Q19A 2CHVA 3K0FA 5EXPA 2IS6A 4LI0A 3FKSA 1LB1B 1YJ5A 3DMNA 3K09A 3OESA 4KV9A 1E3MA 1Z07A 1ZCBA 5CK5A 2AD1A 1R5OA 4KHZA 2OSBA 1ELOA 2P6RA 1QHYA 2VA8A 5C4GB 1E6CA 3GLFE 1ZVQA 3CH5A 2YINC 3VR3A 2QPOA 4DBLC 3Q5DA 1FOEB 4KVAA 3LVRE 3K0EA 1NN1A 3FOZA 2ZPTX 2QMOA 5GJCA 4CEHA 2F1JA 1NN0A 1U0JA 2FDCA 5LBIA 2QE7A 1W48A 4M4SA 5IK2D 5FBWB 4DLUA 1EFRA 5CDFA 5JI2E 4PHHA 2AFHE 2ZJBA 3CM0A 2JGNA 1XB2A 1P3JA 3KFXA 4GP7A 4HLUC 2ZYTX 2UVQA 2FF7A 1GWNA 2BKEA 1OXVA 1VHLA 2JATA 2REBA 4NYMR 4QJ5A 2Z4SA 1KNQA 2GILA 4NYMQ 4C9BA 1QHSA 4A6XA 4BGDA 2XOKD 4I4LA 1SXJB 3RLFA 3MGCA 4JYCA 4K46A 3THXB 1BKDR 2DWPA 5L3QB 3Q5EA 5CDFE 3I92A 2QSZA 3C8UA 3QXSA 4KYUA 4Y0VA 1XJCA 5K8IA 1HEIA 1NLYA 2BKUA 2W2XA 3B1ZA 3B1YA 4PQYA 2W6JA 3LXRA 4GFDA 2LWIA 4FD2A 1E0SA 4TL8A 3IEUA 5SZIA 4BEBA 3BBPA 4JLVA 1E2QA 1N0VC 2Q3MA 1ZMXA 2ZRPA 4ZO4A 4W9MC 3L0OA 5JLJA 4BFUA 1GILA 2B7BA 3C14C 2XX3A 2OFOA 1TADA 1JECA 4A0FA 2VIIA 3AP2A 3UG7A 5DO9A 3VU9B 5J40A 5EXTA 3GQBA 2VPPA 5DISB 2D7CA 1DAMA 3HPQA 5FTNA 3SFZA 1ZM7A 4E22A 5FI0B 1CJVC 4DSUA 1FFHA 1RFLA 1WCV1 2JCSA 2ZRGA 1G41A 4ACBA 4Z8XA 4MRNA 4OK3A 5FPYA 2JDIA 3AUYA 4C4PA 2HLDD 3LH5A 5FL7D 3BERA 4PX9A 5KYKA 1OXXK 2WICA 4M9ZA 4ASUD 3ZD7A 4Z54A 1MR3F 1YZNA 5LD2C 1G3IA 3K9NA 1OHHA 3JVUA 5JBQA 2FX3A 4HUQA 4N1AA 1SVKA 1KSFX 1Z83A 4MUAA 1AS2A 2CE7A 1DS6A 2QG6A 2QGNA 3D6TB 4MUBA 5EQTA 2ZAMA 2QTHA 2QAJA 4FIDA 4UNNA 5FPHA 3QBTA 3RVBA 2D62A 3RWMB 2ZSBA 3GJ5A 1W0KD 1KDTA 3R8FA 2XNDD 4C0HA 5E95A 1II0A 2BM0A 1XRJA 2RH5A 4OK6A 2GEUA 1J90A 2X77A 3GLHE 5C2JB 5F9HA 1KDRA 3SJBA 2NGRA 2OV2A 1NLZA 2ZI6A 3UMRA 3KQHA 3TNFA 4LHZA 4EJSA 1E2GA 1MOZA 5G3YA 3THOA 3A1WA 4XSHA 5TV2A 2ODBA 2IXGA 3CBQA 1GKYA 3W8NA 2BV3A 5F9FA 1N6HA 2JLRA 1GP2A 4ACAA 3VKHA 3DOEA 4E03A 3KDSE 5FI1B 2CK3A 5J47A 2PEYA 1TPZA 3AF0A 1C4OA 3BE4A 5GJWC 3RWOA 3TSZA 2XJ4A 3TAHA 2JJ1D 4G3XA 1T3LA 3AP1A 1S9DA 1DTSA 4S2EA 4C0JA 3NH6A 3CKLA 4Q1CA 2Y8EA 4TT3D 2IYQA 2IS2A 3TW8B 3ZIAA 1BIFA 1E2IA 1FMJA 1GRQA 2HF8A 2NQ2C 3ADBA 1AQYA 3GLIA 3WRYC 1UBCA 1EFUA 4W5HA 2J5XA 3EXAA 5FPSA 1RRGA 2OLJA 3OAAA 1KAOA 4A2WA 5KPJA 3ZJYA 1M1YE 1G7CA 2G77B 2XAUA 1KKLA 4URVR 3ICQB 1VDZA 3EIQA 4HB0A 4NYJR 1WDTA 2EFHB 4TMWA 5EXSA 4ESHA 1W7AA 2KBEA 4IOJA 4GOJA 4NYJQ 5KO2A 5KSZA 2X2EA 4DDUA 4BFVA 5G41A 3JZMA 1W5TA 4H1UA 3V4FA 3ADKA 4RKEA 3SQXA 2C98A 3NXSA 3ZVNA 4Q4AB 3EA5A 2J7KA 2IYZA 2A5YB 3KUCA 1CJTC 3OEED 4AG5A 2C96A 1W36B 2ZIAA 5EE5B 2FSHA 3Q3JB 1JI0A 2GTPA 1R0WA 4CDGA 3T1TA 2RHDA 2PMKA 2H7VA 2IYVA 4CT4B 5AJZA 2OG2A 3AKYA 4CF7A 1G5PA 3IIMA 4MYCA 2ANCA 1YKSA 2NZ8A 1IN8A 2I1VB 4AYTA 1BS1A 2NO6A 4HAUA 1T9HA 2VHJA 4B6FA 3MJRA 1RZ3A 1F60A 2W2VA 3B1XA 3M1IA 1SXJC 3B9PA 3VTKA 1D6JA 4TLCA 4MYHA 4M2LA 4DCNA 2AK3A 1G17A 2PX3A 3IUYA 4C2TA 5JFGA 2N46A 3BB4A 5EP3A 1C9KA 2GXSA 2B21A 1FNNA 4CYMA 2E1RA 1KI4A 3CRVA 5SZHB 3U3KA 4NCHA 4B76A 1W47A 1XTJA 4H1VA 2AXNA 2YVUA 1MRNA 3EAQA 3EZ6A 5IK2A 1VKJA 1ZINA 4YMSA 1UF9A 1X1RA 4P0TA 3CNOA 1T3HA 5BN3A 1HE1C 1CBUA 1U90A 4XWKA 5J4YA 1W4CA 4LK2A 2CXXA 4C3ZA 2IYLD 1Z2AA 2ZRBA 2O8DB 2C99A 4X8MA 3SHWA 3WHLA 3KQUA 2DFKB 5H1YA 2ZI3A 1XTRA 3REGA 4FWTA 1OB5A 4EPRA 4OHYA 3QE0A 2IEZA 2R62A 4MGIR 3ICEA 5KDLA 3DKPA 1NBME 1OW3B 3MLEA 2HJVA 1NY5A 3J81k 1VYUA 2XOKA 4O3MA 2GRJA 3PEVA 1XEWY 3N5CA 2ORVA 1OPXA 1XX6A 1J99A 4F38A 2PZGA 5CK4A 5AUNB 1HH4A 3B6EA 1KYIA 2GVZC 1P2SA 2GZHA 2ZS8A 1TF7A 1RE0A 1P75A 4GL2A 1NVVR 1N5JA 3IBGA 4Q18A 2YZ2A 4PC2A 1NVVQ 3EC2A 1F5NA 4JLNA 5FUVA 1VCOA 1UFQA 4TYWA 3I72A 3CLVA 1NJGA 1XJQA 5E7JA 1VIYA 2RGXA 3AVOA 1SGWA 4HAZA 4BFWA 5C18A 5CB8A 4P4SA 2Z4RA 2GK6A 4IHQA 1AJEA 3SEAA 1ETUA 4R7ZA 1TF5A 2HLDA 3B8HA 2BEJA 3F8TA 1N3BA 4RD2A 4ASUA 1TU4A 1IXZA 1U8ZA 2QU8A 1KJWA 2R44A 4IDHA 3THYA 2YOFA 4KBGA 1M2OB 2E9SA 2GCOA 5AR1A 4UNQA 4HZUA 3S1AB 4BWYA 1UJ2A 2N42A 1KDOA 1Z47A 1BYIA 4NYIR 1KIMA 1L4UA 4NKRA 5ELXA 3EWSA 2AD5A 1W0KA 1ZD8A 4NYIQ 5DGXA 4ZCLA 2OM2A 1WE2A 1G7TA 1ZD9A 2XNDA 3WYAA 1OH8A 4QJ4A 3FPAA 3T61A 1E2FA 4YLGA 1LNZA 821PA 3OFND 3VR1A 3AKCA 1J7KA 4KXFB 4M1YA 2BWJA 2JLSA 1OIVA 3U61B 3LFUA 2XB2A 1YR8A 4GNKA 4LJ9A 2PT7A 4P33A 4DB2A 4AK9A 1CJMA 1W4RA 4IEIA 1JAHA 1NVXQ 3D8BA 3SYLA 4BASA 2P5TB 4Q7KA 1F2TB 2IYWA 3TGPA 5ANRB 1U0LA 3W9YA 1LS1A 2F6RA 1UBEA 2OAQ1 1JAIA 4DUGD 4QM7A 1R2QA 3A36A 4V0MA 4F92B 2D7DA 4CEJB 4QXAA 4KLNA 1F3OA 4LYHA 4CEIB 1GL6A 4TL9A 1UADA 4BLQA 3GJ3A 1G5RA 1SULA 3P26A 4MGYR 521PA 5DSZA 3RSOA 3AVQA 4PSAA 1FMLA 4NCJA 4IKEA 4C7OA 3EZ2A 1DBSA 4DLWA 3QI2A 3THWB 3P1JA 3P20A 1U8AA 4PXAA 3QNUA 2HF9A 2ZJ5A 1UKEA 4ARZA 1KMHA 2FNAA 3FMFA 2VO1A 1EXMA 4ZI2A 1UBFA 4HSEA 4V0ME 3CIOA 3KTAB 4Q4HB 2GXAA 3NC0C 1NSTA 3PCRB 3BFXA 5JSZB 4TYQA 4NCIA 1X3SA 2ZRKA 3A4LA 1TL7C 1OFHA 4B6EA 1T4GA 2PCLA 5GVSA 4D4MA 4TMXA 1IY1A 1IJEA 4JLMA 3IO3A 4PPFA 1EX7A 4XOIA 2MSCB 4HDCA 2BBWA 1NP6A 2R6DA 2C2HA 4LGMA 4N0EA 4F4JA 3U5ZB 1YVDA 3GEEA 1GRNA 2GJ8A 4C30A 5IDVA 3QJYA 2Q9BA 4PPGA 1CR2A 5M04A 2BC9A 3SHFA 2QAGA 4R9UC 4B3CA 1KK1A 2IF0A 3K1JA 2JASA 621PA 1YZGA 1KI8A 2OBMA 3MWJA 1KK0A 1WMSA 4V0LA 4RFSB 1XMSA 3UKDA 3WMGA 3SR0A 1NL3A 1FNMA 4U00A 3FMPB 2BMFA 1BO6A 1YZKA 3BH0A 2O8CB 2ZSDA 4DIDA 3RS0A 4A0GA 2WZQA 4KI0A 1IN6A 4D4LA 1CRPA 1WP9A 4PO8A 3E2IA 3QPWA 3QXJA 4US1R 3VAAA 1GIAA 1A1VA 4F4CA 1G7RA 1AS0A 4HB4A 3CB4A 3SQWA 2IC5A 3K0CA 4A82A 3DM5A 3PUXA 3LBNA 4LWZA 2IWRA 1FUKA 2VP5A 5J4VA 2CJWA 2FZLA 2IS4A 3QG5A 2AKAB 2R6AA 1NKTA 4TTQA 4ZPXA 3WYFA 2GHIA 2QPAA 3CR7A 2ZI5A 4B33A 3U3MA 3GD7A 4XWAA 3ZVMA 2F1IA 4BZPA 2ZE6A 2QRZA 2J7PD 2ZRCA 1AS3A 3MMPA 3LW7A 3R20A 3KUDA 3NDBB 1X6VA 4KFSA 4Q4JB 3TJZA 4AWXA 1HA3A 2D06A 4RY2A 3VX3A 2RGDA 1OB2A 1Z3IX 2IYXA 3AVUA 5GJVC 1WBDA 2QL6A 3SJAA 1KO1A 3PITA 3TQCA 2DFLA 4IDOA 3QF4A 5B58C 3QKTA 1U99A 1OKKD 2AL7A 2HYDA 4V0OA 3KKMA 1XWIA 2VEDA 1Q22A 4D81A 5HKKD 3V00A 1NI3A 4N3NA 1G19A 1Q12A 3M0EA 3TQFA 4BECA 1QVRA 1X1SA 2HV8A 3D31A 3K9LA 3THYB 1NG9A 3BB1A 3FKQA 4TTPA 4A8JA 2HYIC 3PVSA 4TYPA 1TUEA 3AF1A 3VHXA 2ZANA 1JJ7A 1UKZA 1I4DD 5JJLA 1ZAKA 1KY2A 1SKYE 2TMKA 4BLOA 5CM8B 5BXQC 4BFYA 3EW9A 3A1UA 1QHGA 1TEVA 2WKQA 1KDPA 2ZU6A 3LV8A 1HQYE 2W6ID 4OQXA 2DR3A 2QP4A 2DHRA 2IHYA 2J3EA 3TR0A 3I1FA 3K70B 1FZQA 2C9CA 3F5FA 2WWHA 5P21A 2XXAB 1LVGA 4HAYA 4KO8A 3MG9A 3I5YA 2WWXA 4ITRC 1Z6AA 1MO5A 2B6HA 2WJYA 2JLXA 1OH7A 2XTZA 3WHKA 1ZD1A 3OZXA 1QHHB 2FN4A 2V8OA 2R65A 1TEXA 3V9PA 3W34A 2WMOB 1ZU5A 5DH9A 4BRWA 1GVNB 3OFNA 4GRAA 3Q7QA 4LBVA 2YJTD 1K8RA 3AQ4A 2BVNA 2ZSAA 1TAGA 1TQ6A 3KJGA 8OHMA 2F3RA 3U3RA 2GF0A 4LHXA 4MDFA 3VNVA 2QMHA 2PLRA 3IO5A 5DI3B 3SI7A 3B1VA 3HR8A 2PJZA 1EFTA 1KMHB 2QSYA 3HDTA 4ZCMA 1A5TA 1PJRA 4XTCS 2GK7A 2GF9A 3BFVA 4M1TA 4AD8A 5E3HA 3WY9A 4OHZA 5JJIA 4NPHA 2A30A 4R71A 5TMPA 1I4TD 1S0UA 4GP6A 3CX7A 3IIJA 3A6PC 3NIBA 1G20E 421PA 1N25A 1ZM3A 1CULC 4OQFA 4ZDIA 1ZNZA 2GZDA 2QZ4A 3Q9LA 2V3CC 3SFVA 1K6MA 5KSPA 1U9IA 1UEJA 2GWHA 1XD2A 3U7GA 2GCPA 2QMEA 3K53A 1JR3D 3CF2A 4YQFA 1TUIA 4JVSB 4LYFA 3CZPA 4W5JA 6Q21A 3U3JA 3AVXA 5CYPA 2O5VA 4UXJA 1RRCA 4DB4A 2F43B 3UK6A 1G18A 2CDNA 2O0HA 4U5XA 4P31A 5JEDA 5A4JA 3TSOA 1V5WA 2H5EA 3RRZA 3R9XA 4TYYA 4F7WA 1T3SA 1DELA 1IBRA 4DT1A 4BEJA 1ANKA 1EWRA 1Z0IA 3VFDA 1Q44A 3M4YA 4R2HA 1LS6A 2OO7A 3DL0A 2WOJA 1IY0A 2XSZD 1CU1A 1E69A 4L9WA 4OYHA 1AGPA 5BN4A 5IT5A 4LX0A 2RB4A 4ZDWA 3U2QA 4RZUA 3TMKA 2SHKA 5JCZA 1RW4A 2CHGA 4HLCA 4PPQA 4M22A 5HZHA 3SDZA 5G3ZA 1TU3A 5GJBA 3PEUA 2GJAA 2A5FA 1CR4A 4NCNA 1CS4C 3HYTA 5BN5A 2ZJ2A 2PT5A 1W5SA 3RS2A 2EW1A 4FCVA 4B35A 4B44A 5EE0A 2I3BA 2RGNA 3QXHA 4MITA 2FFQA 2WKPA 1NBMD 3NKVA 5F98A 2WWYA 3QBVA 1Q57A 2AN9A 3QKUA 4C0QC 5HR5A 3KL4A 2BBTA 3U44B 4MQBA 4GMDA 2RCNA 3I73A 2WAXA 2J0QA 1Y3AA 2YC4C 3T34A 3NHBA 1OXUA 2ZJAA 1HY3A 1HUQA 4IRUB 4JKYA 2ZU0C 1VCNA 4MKIA 5L3SB 4FW9A 1OV4A 1MV5A 3KFVA 3W3ZB 3R7WB 1RVDA 3L8YA 2GEDA 1JEDA 3E1SA 1Z0DA 3ZQJA 3FHOA 1Z6TA 2JIZD 2ZRFA 4Q66C 2LKCA 4W5WA 3WNBA 2ODEA 3AEZA 5AJVB 3HU3A 2NO9A 1W2GA 4PZLA 4ON9A 4PZYA 4D25A 4B3XA 4QGHA 3A58B 2AX4A 2V1UA 1KI9A 1T0JB 1P73A 1YR9A 1M7HA 1ZUHA 2JA1A 2VTKA 3K70C 1FPMA 4QRHA 3SBDA 2ZR9A 1J8MF 4DCTA 1Z5ZA 2ZS9A 3CH4B 4JSYA 4RD0A 4CRWB 4QHYA 3QKRA 1OKKA 4MYTA 3TVTA 1GNPA 3KXLA 4FWIB 4AYXA 2BCJQ 2BEKA 4GMXA 4JSTA 3P27A 5HKKA 2ZRNA 2X1VA 4R98A 4P4TA 4I1UA 1F6BA 2BBSA 2D74A 1DAFA 2WJHA 2ZR0A 4WBSA 5FFMA 2IEYA 2OXCA 2PBRA 2VP2A 1S3SA 5FOTA 1VCMA 2J9RA 4IDPA 3VHLB 4D4KA 1GKUB 3IGFA 3L43A 4TMTA 2OCPA 4LOAA 4Q1AA 5EUQB 3FVQA 4IEEA 3DEFA 1CJKC 3TUIC 2CL0X 4PZZA 1RYHA 1VIAA 5JWRA 2XZLA 5FUXA 4KJZA 4LJYA 3IPXA 4RCYA 2PEZA 4TQUS 1E2EA 4EQ6A 2W6IA 1P9RA 2A5DA 2J0SA 4Q9KA 1TQ4A 1P7CA 2OILA 4FN5A 2VH5R 2X2FA 2ZE8A 3GLHA 1E0KA 4TLEA 2GJKA 2DBYA 4M9QA 4MKFA 4G1UC 2A3RA 5JWHA 1O87A 1WF3A 3QY0A 3A4NA 4B48A 4RSGA 5KDDA 2B8TA 2GBLC 3AKEA 1ZM4A 1W2HA 1C1YA 3LRPA 1WBBA 1ZP6A 1XMVA 4M1KA 3K0AB 4V02A 2CVFA 1P4SA 4QM6A 2O8BA 2ZYWX 3DO6A 3EIEA 4ABYA 3QSYA 1G8FA 5EUMA 4FMDF 5FOVA 1US8A 2VP4A 3T35A 1XXHB 5DYIA 3DM9B 1FP6A 3I8SA 3PJRA 1Z6XA 2XITA 3FYHA 3I3SR 3TUZC 3FHCB 3GJ0A 4LYAA 4TL6A 4Z1MD 1ZYUA 3O8RA 4WXPA 1NMZA 4LJAA 1E2LA 2ZE5A 1XEXB 5JWOA 1S8FA 3SU8A 2VBCA 4WZAE 5JS7A 2NOAA 2PLFA 4KODA 3OIYA 5BYKA 5FH9A 4OJKA 5JZVA 1K5GA 3MRSA 1XEWX 4XD7A 5H68A 1CTQA 1OH6A 1M7BA 2LKDA 2WIBA 1XPUA 5CIQA 2CCGA 4TZ6A 2ZR7A 1P2VA 4Y0AA 3ZZ0A 4YC7A 4ZKDA 1P9WA 2DCUA 4DZZA 1DAHA 4IFEA 3TLXA 2ERYA 4QKQA 2V54A 3KKOA 1VPLA 2EWVA 2ZRAA 3JVVA 4UNSA 2XB4A 3GLFB 2FMXA 2ODWA 3B9QA 1Z06A 3X1ZA 1D2NA 3X1YA 1JR3A 1TF2A 1Z0KA 5A5GA 1RKBA 1MABA 1ZM2A 1OYWA 1R4AA 2ZI4A 4C0AC 2P6UA 2O8EB 1ZUIA 4PHGA 2J0UA 1E98A 3QUSA 2W2TA 4Q9IA 3SE0A 2UZIR 1JPNA 1AM4D 3IQWA 1R6BX 4IJMA 4TN1A 1OFTA 2PL3A 1XTKA 3VR5A 1UKVY 1JNYA 1XD8A 3NTUA 3U6BA 3D3QA 3GLGB 3K0FB 1CXZA 3C15C 4O25A 2ZROA 3FFBA 2WV9A 4EPXA 3LAWA 1R0YA 2GA8A 3GPLA 3L82B 3X1XA 1DARA 4A9AA 2PJRA 3B13B 1E2MA 3LA6A 1OXTA 2OBLA 1RPZA 1U98A 4QNRA 4JVMA 2OAP1 1XDBA 1JR3E 2IYRA 1KI1A 4FXPA 1ZW6A 4B34A 3NC1C 3E5HA 1ZNWA 2D2FA 2XSZA 5E4FA 4CEHB 3TRFA 1G4AE 2OT3B 4Q02A 4DLTA 2O8FA 5KSOA 2NG1A 2QENA 2OBNA 2ODNA 5CLQA 3SNHA 4B2LA 1WRBA 3W5JA 3ASYA 4TZ0A 3A37A 3TK1A 5DYGA 2R6FA 4XJXA 2JJ2D 4LRWA 2C03A 1VHTA 5DLQC 4AG6A 4I81A 2HJGA 1NBMA 3W90A 5FR2A 2G9NA 4AKEA 5TY0A 3IHLA 5JECA 3W6PA 1UDWA 3AF4A 1GTVA 2XZPA 5AJWA 4JLJA 3QF7A 2Q9AA 1DE0A 2W00A 2GJSA 4ILEA 1SVWA 2QT0A 4OI2A 4KITB 2J0VA 3UWOA 3O8BA 4G01B 1DOAA 4GOKA 4Q1DA 2QTFA 1G8YA 3SJZA 3QXCA 2FFBA 5AJXA 1SVIA 3KX2A 3TAUA 4HDQB 3U7FB 5KNBA 1UKYA 3GJXC 1E1RD 1G21E 5H8WA 1Z22A 1FX0A 4UNPA 2RGGA 4JL6A 2J1LA 4Q48A 3EX7C 1E1QD 4NZYA 1DAIA 1LW7A 1N6KA 3BRWD 4MRPA 5L3VA 2ZYUX 2HT1A 1Z29A 2W0SA 4M1WA 2R6CA 5FPTA 5HE8A 1SVOA 2I1QA 3H84A 4O0MA 3PQCA 1E9CA 3I4LA 3ND9A 2GAAA 2AKYA 1GG2A 5FTLA 4KFRA 1UBGA 4LV5B 2WWGA 2WTUA 3HWSA 3IILA 3KJIA 4HB3A 2IK8A 4Q7JB 2GXUA 5KHOC 5FOSA 2R8RA 4HUQB 2RGAA 4LHWA 2EFGA 2F9LA 1GNRA 1SVLA 1R10A 2A7QA 2IW3A 5HZKA 3EA0A 2QTVB 3VKGA 5TDHA 2BM1A 2HCBA 2XTMA 5B57C 3ZZTA 4XWOA 1VYTA 3B60A 1WB9A 4QGGA 1LV7A 1G16A 2QNRA 4JT4A 3IDQA 4E09A 3QPVA 4RJLA 2NPFA 1XPOA 1CIPA 2DPXA 2CLSA 3GFOA 2FPKA 4XSGA 1FUUA 4JBXA 4B74A 3ZYCA 1QG2A 5FL7A 2ZQ5A 4HLDA 1X86B 4OHVA 2QUZA 2QBYA 2H16A 2NZJA 1MO6A 4YMTA 1E2JA 1GNQA 4CZ2A 5IHPA 3DZDA 4EJSB 2YWGA 4PAQA 3RRYA 3CONA 4MA4A 1SXJD 1D5CA 5JMTA 2FFAA 2C9YA 4HZIA 5FBVB 3LLUA 4JZKA 1G3UA 2BOVA 4UXHA 1KAGA 3AKDA 4BZQA 1CP2A 2LCFA 3OEHD 2F1HA 2RGCA 2QA5A 4X8OA 4B32A 2YYZA 5JS8A 2ZUCA 1DAEA 3L0IB 3GLIB 2W0MA 4Z1MA 1T8UA 1IAQA 4X8HA 3UG6A 2GVDC 4Q7MB 1RJ9A 1IN5A 5GADl 1CRQA 1MABB 4DWJA 4HLUA 3GEIA 3DPUA 3K09C 4C0BA 2JLUA 1D9ZA 3LNCA 2B7CA 4II7A 3VR2A 1JQJC 3GMTA 1P62B 4H9GA 5EE1A 4CIDA 3ZVLA 1NRJB 1W36C 4LPSA 4A6PA 4OK5A 3ZLJA 2JJ1A 3PEWA 1NF3A 1F48A 5DE3A 2WWWA 4TT3A 3TSWA 3BXZA 5EZ6B 1GZSA 2NO0A 1IN4A 3MAAC 1ESNA 2REXB 5FOUA 3KQKA 5J4LA 3VMFA 4F91B 1EESA 3PUYA 1M6NA 3BB3A 3NEYA 4X8LA 1AZTA 3QEOA 1A4RA 5JJKA 1BOFA 2IF2A 5F3WB 2IT1A 4HYYA 1IONA 1E9AA 4OQMA 4DEYA 4CVNA 4DLXA 4P32A 4QC2A 2JLYA 1Y63A 3WXMA 2C77A 4ZDKA 3RS5A 2V6IA 2ASEA 2YOGA 4BLPA 4XIGS 4UXIA 1II8A 1TX4B 3OEEA 4OI4A 4QBHA 2O0JA 3E70C 3L0SA 1E2HA 1U8YA 2VP0A 1E2PA 1YU9A 1J2JA 2FZ4A 2WM9B 1Q1EA 2MMCA 3N2IA 4OKSA 2GDJA 3ASZA 4OQNA 1Z63A 1YHNA 1S1MA 4IDQA 4G5SA 4XH9B 3TIFA 3IQXA 4M1MA 1DVRA 2WPDD 4U02A 1AKYA 1OE0A 5CLLA 3TR5A 5FR1A 3K0SA 1LF5A 4EUNA 1P2UA 1XCPA 1TQDA 2IUTA 3B82A 4P3YA 5KTYA 2BJVA 1KO5A 2JJ2A 4JBYA 3W6OA 3LW8A 4CGZA 5HE9A 4DXAA 2Z6VA 1RYFA 4QNMA 1XZPA 4NP6A 1L8QA 3PUVA 4LYJA 2OHFA 4MGZR 3ZDQA 2QY9A 5CM9C 5JEEA 2YHSA 1ZRHA 3OHMA 4BFZA 2WSSD 3PIRA 5JHHB 4R2IA 2IYYA 2OXRA 1U0HC 1NKSA 1ZU4A 5D3MA 1N2CE 2WBLC 2NIPA 4Q03A 2N1BA 3RYTC 2ZJYA 2ORIA 3A1TA 3FKSD 4PAOA 1OH5A 3MCAA 4ZDJA 4Q7LA 4ZIRA 5C1BA 1VMAA 1T5IA 2YC2C 2QM8A 3CPEA 1D2EA 2CL7X 3G82C 3MWYW 4TWZA 1RRFA 4URYR 1E1RA 4Q47A 1W36D 4Z51A 4RD4A 2A5JA 1JEEA 2BHRA 3O8CA 2QROA 1R0ZA 3EG5A 3NBZC 1E1QA 2OE2A 4FCWA 4D4JA 2IYSA 3ZS9A 1J70A 5FBQB 2H92A 3CWQA 3QXXA 2IYTA 2QI9C 2VQSA 3NDPA 4ZI3A 1T8TA 3CF0A 4Q9JA 3PUZA 2IX3A 4EJSC 4QGAA 4DVGA 1KO7A 1VG0B 3I62A 3B5JA 4P4SB 4PO9A 5EP4A 5L3RA 4QFMA 4TYNA 4URXR 2WIAA 4LBYA 3JZAA 1D2MA 1P72A 4LUCA 4JL8A 2QBYB 2PCJA 1K5DA 2FPLA 5G53C 5FBRB 3W8RA 2DFTA 4MYUA 1HTWA 5BQ5A 4PFSA 2PMDA 1ZC3A 5BW8A 2C78A 3LX5A 4JLDA 5DI9A 3VR6A 2GCOB 2FGJA 5J5CA 2RGBA 3DVLA 5BYJA 2C8VA 1ZIOA 4JVNA 3PXGA 4HZUB 4DKXA 2NMVA 3AVVA 5CJPA 3GEHA 3MJHA 2IUUA 3ZVRA 1V43A 1OFUX 3CR8A 4DLRA 4WVFA 2ZYVX 1QBKC 4RZ3A 4B47A 1IN7A 4TMKA 2A5GA 3C41J 3OE7D 2OFXA 2IXFA 2K5UA 3AF2A 1SVMA 5FTJA 3WP0A 1M34E 2EQBA 2W6JD 3MSXA 5KU1A 4KCGA 1YZUA 4DCVA 2BMEA 3ZZUA 4TL7A 5GVRA 4L9SA 3MD0A 2G1JA 5B2ZA 4B73A 1MH1A 1L4YA 3Q85A 4DLSA 1SXJA 3EARA 4G5RA 3G5UA 3THXA 5L3QA 1ZM9A 1G64A 1Z2CA 4LJ5A 4DLZA 3NHAA 1OJLA 2GAOA 4PANA 1TTTA 4CT5A 5FBLB 1G8GA 1HYQA 1KK3A 3PENA 4BLSA 1E0JA 1SZPA 3OEHA 3L0PA 2OCAA 2YV5A 2ZM5A 2AFIE 3WP1B 1YZLA 2C04A
chains in the Genus database with same CATH superfamily
1IM5A 4O1IA 1NLUA 1A9XA 1DPFA 1Y7PA 1ZBDA 1A5SB 2H4XA 3C43A 1V8BA 3DOHA 3U7QB 4A6EA 5L51A 2YV4A 5E2AA 3KHUA 4HH3C 3LO5A 2Y1CA 4E51A 1RBMA 2GZ1A 2IBMA 2HWWA 2EJWA 3AF5A 2JLCA 2WIDA 3IVGA 1C0KA 1PZXA 3CT4A 5LDDC 4ETWA 1O96B 3IEMA 1U2GA 4H6XA 1GTJ1 3QE9Y 2I03A 1GDDA 2GBCA 1RADA 3AWDA 3L6CA 4BAZA 4DLAA 3W06A 2AJTA 4F12A 3CNEA 5CH8A 3IQGX 3WGTA 1XTPA 4DUGA 1OLXB 2X1LA 1CF2O 1D9XA 2DBVO 1E9FA 1UC5B 4LPKA 4BNDA 4D9NA 5AW6A 5CTAA 5JNUA 1KOFA 3STHA 3DTNA 2D5IA 1B7GO 4H59A 2NUAB 1Z2EA 4C2UA 3FE2A 4HAVA 1NNSA 2CMFA 4P36A 1OLOA 4J0KA 2TSYB 1KP2A 4QSMA 4AZ0B 2NVBA 5JSUA 4C07A 1T0HB 5CDSA 3LHSA 4QIHA 1AKMA 3TVYA 5HDBB 4FYHA 1NI5A 1VLHA 2AVDA 2VHQA 2XLCA 2KM1A 1QGOA 3EBOA 3N58A 3NTRA 3P9IA 4JJZA 4BKQA 1ZIPA 2BGWA 1GUAA 1UJBA 4L8FA 4P7FA 5JZSA 3NM5A 4GI5A 2BF4A 4H18A 2PNJA 3FBGA 2CCKA 1Z5UA 3R77A 3GZNA 3DA8A 4K87A 3IQFA 1MAHA 1M10A 1J8VA 4MB6A 1Y1PA 2Q5EA 1OX6A 2PX0A 2B83A 3T15A 2B4YA 4GBED 5LYJF 3OQJA 2VPIA 5IH3A 3G88A 4I8XA 3FPKA 3LBIA 3B8EA 4M1QA 3H97A 5AHRA 3G2JA 3WRWA 2HK7A 2VYND 1DKOA 2HDNB 4DV5B 2CNWD 4WACA 4FZVA 1F8YA 3JASA 4IX9A 4K2HA 4DJ5X 1N0UA 3DDWA 5FF9A 2WU3A 2J41A 1X7GA 2JLBA 4FYVA 5BRJA 2CDCA 4XYGA 1XJ5A 3BFKA 3AHDA 2TYSB 5ALTA 2PYIA 4CV1A 1VKZA 3MQFA 4YRMA 2I7CA 1SWWA 4B40A 2CJWB 3MYRA 2QL7A 4GZMA 4A2QA 1B15A 3F6BX 3FF1A 3IDAA 4JLBA 4B31A 2ZFUA 5JJBA 1DTEA 1XFAA 3KBOA 3USCS 4ZK6A 4S35A 1SCJA 3H4MA 3PFKA 4ZYZA 4BXOB 1SB8A 5G2OA 1C1HA 3MWEA 5H81A 5KNCA 3DV9A 1R8XA 1S2OA 1J5EB 2X23A 1QGDA 3A2LA 1LDMA 1YAJA 4NR0A 3C1TA 1B0UA 2HA0A 2XYGA 4ZMSA 4DCSA 4XVUA 4G85A 2QD5A 1IWBB 1TVKA 1GUYA 3ZY5A 1WV0A 2JLAA 2OORA 5G02A 3V1LA 1FTSA 2V9CA 1D5WA 1GU0A 3GPBA 3U49A 4E5UA 3PHCA 3SHTA 1QU2A 3I6IA 5KQSA 4UBNA 1NVUQ 3G2LA 1O97C 4S1VA 2ZJZA 2SECE 2GSDA 3I6YA 1ZOSA 2HHJA 1FU4A 1YA8A 4ATNA 2D00A 4BJ6A 1A9QA 5TPWB 3NRJA 5DWVA 4IVPA 4BO5A 5JMPA 5HZMA 3C87A 2DR2A 5IF9A 1EH5A 4C7JA 3HVHA 4DWVA 2X0EA 5UKDA 2QLNA 2JLZA 1RJWA 2B20A 2BFMA 2FFHA 4BN0A 1JALA 2PT6A 4X3CA 4AC9A 3C39A 2AJCA 4IIJB 3IMKA 5FTKA 5EG5A 2QU7A 5AUOB 3IDOA 3LXXA 3VPSA 2FHPA 4OY3A 4WOCA 4D9EA 2OZLB 3HFSA 3LC1O 4O4JF 3W5CA 3I34X 1KY3A 2Z5GA 3GLRA 3LP5A 1X0XA 4KLZA 4P81A 5AJHA 2EG5A 3SEZA 5JSQA 4BYGA 3GGPA 5EUBA 4EKDA 7ABPA 5JCPA 2R96A 3NHSA 1T1EA 3PP8A 1DIAA 4PLZA 1JFFA 4B80A 1G5FA 1JE0A 3WYGA 1P17A 2AN3A 4LMAA 4LJ8A 1X7ZB 3BICA 2NXNA 2VWQA 2Z43A 2HF7A 3KP1A 2WJVA 4IW3B 4G25A 3K8OE 2CLOB 1ODLA 4GM1A 4X20B 3B12A 1KOGA 3KYCB 1XJ0A 2DG2A 3H7IA 1JA1A 1Z0AA 1Z0JA 4ZHSA 4ZCRA 4RDIA 3UMSA 2Y76A 3AUXA 2X19A 4ROTA 3C3MA 1U2EA 1GV1A 3C3WA 2V7GA 1I33A 2QLFA 3OX3A 4UCXA 4EHNA 3EFBA 1OI4A 1RM3A 4DWWA 5DTMA 4HRAA 4WZZA 1CCWA 4LYGA 4MVJH 3VZSA 4CLXA 4HX5A 1A2KC 1Q7RA 2Q9CA 3EY9A 1G42A 5EYPB 2XT6A 1J8DA 1P2TA 3DLAA 1AV7A 3ZE7A 4BO8A 2XMBA 4NESA 1ZD5A 3WK5A 1E2NA 3K1YA 5H70A 2FSIA 4PTLA 4E1VA 5I4KA 3ZKAA 1QG6A 3QYAA 1ULAA 1JJVA 2GYVA 4KACA 3SVTA 4CF6A 1ZXLA 1ZOPA 2EFEB 1ZS9A 2VF8A 1L6RA 2M98A 2P30A 2ZJ8A 4J0IA 5IJ0B 4ZPJA 5SZKB 1GUDA 4D0LB 4XB2A 4JBNA 1EG7A 2G83A 3EWIA 3IBYA 5FT9A 5FNZA 2P6NA 1VHDA 2E18A 3N8GA 3UUWA 3NIFB 5TF0A 3HRIA 4DYVA 2APJA 1NQAO 4JMPA 3CGGA 3YASA 3CZ5A 1CK4A 2G08A 2B92A 3TZHA 3EZ9A 1I6KA 1P39A 1XQYA 1TA9A 4MPDA 5EOVA 2BP7A 3KKPA 4I9HA 2VH1A 1H2XA 2XUOA 5F1PA 4PC3A 3VXKA 1W8DA 4Q1FA 1R6TA 2HFJA 3OIVA 2YNMA 1Y3BE 1PJSA 3PGA1 4D98A 4M9XA 1N3IA 2IV7A 3AHGA 4Q1BA 5H9VA 2WHXA 3DE6X 1SUAA 3GP3A 1N2OA 2X5NA 4NV1A 1G5TA 3MS4A 4HTFA 2EF1A 1QLJA 1LVHA 1U1FA 2I7DA 3L1UA 1WQ1R 4PFKA 3K70D 3GP8A 4MGHA 1M74A 2NZYA 1NWCA 4XVHA 5CJ2A 4HADA 2GPAA 3VSAA 1E9RA 4V0SA 1KVTA 3NHKA 3RAJA 2J3HA 2ZRLA 1IK6A 2IYNA 2E4XA 4PYOA 3WADA 1YA6A 4J6FA 1Q0QA 4N3BA 4R54A 4RQAA 4D8YA 1PR3A 1RIFA 2BFFA 1Z6PA 4HAXA 4MRRA 4X44A 5D01A 2K7ZA 3NKFA 2OPHA 2CGEA 3SVLA 1QPZA 2ZKLA 5EWMA 3P9YA 4D8WA 1UT8A 3L6UA 3ABIA 1CJSA 5BQXA 2I6GA 2Y1DA 1UH5A 2FEKA 2YYSA 3HBFA 1KI7A 2ZXUA 1HFKA 1BW9A 4BVFA 3CRMA 4EPYA 3ZZNA 2GERA 1T0UA 4ZOLA 4N3CA 2VYNA 2IBSA 3IOEA 3G0DA 1R0KA 2CNWA 5CX1B 1XROA 1Y98A 1S96A 1Y6RA 2IY8A 1UDBA 4LDRA 3A2NA 2BKXA 4N5IX 3WOVA 5JXJA 2G80A 1W1UA 1SEPA 5DM1A 5A5EA 5BUZA 4TWIA 2XBMA 3EJWA 3T5BA 4LC1A 4XIJA 3JQDA 3EEYA 1I0IA 1E79D 1NXXA 2CXHA 2I67A 1NVWQ 2TECE 2MJLA 4NFYA 3I4CA 4V2UA 1W1WA 1P45A 4KYIB 2JAQA 3UF0A 4NENB 3HK2A 1HXHA 4EPTA 3NIDB 5FWAA 5C8DA 5IM5A 1M1NB 3DOFA 3GUVA 1TTQB 3P32A 4IOLA 4Y1RB 4HDOB 1GCIA 1W88A 4FYYA 1P5HA 2XB9A 1XYVA 3IQIX 1RI1A 4FDLA 2FAXA 4EKIA 2V6GA 4FNMA 3L1JA 5D3QA 1RDFA 5FLKA 4QWMA 1XQ9A 2UVPB 1H2WA 1GG8A 1WCYA 2IZ6A 3N2GB 5DV9A 2XBLA 3PC3A 4IVQA 4ZAYA 1VE7A 5MGNA 2FWJA 3F5SA 1J0EA 1UC9A 4TTVA 4X7BA 4PIVA 3QKRB 2Y1KA 1OAAA 4IY1A 4M0PA 2C8KA 2JIZA 3HABA 4ERNA 2WVJA 3ELYA 2VFAA 5BQ3A 3G02A 3B6KA 5ARCA 2G7ZA 3F46A 5LVAA 1RXCA 3ETDA 4U6SA 4JLWA 4NZ9A 3PNLA 3WGNA 5EFOA 4J1QA 3DVAB 1SBNE 4PU0A 2TMDA 2GM5A 1AXEA 1GZ7A 2HMTA 3FZQA 4TXMA 2VBGA 2M1XA 4WL0A 3WNCA 2IHBA 1CR6A 4GOXA 3OJFA 3T0GA 2KBFA 3LHFA 5B4TA 4ZAWA 3EGDA 3ZN2A 3LDAA 4F5DA 1VG9B 5E2IA 3NANA 4IFTA 4P8RA 1CNFA 2WNSA 3PQ4A 4DIEA 1PLLA 1T91A 1UDXA 4K8OA 5CYOA 3ZU3A 3N07A 1QGZA 1ZMTA 5JZMA 2Q3CA 3K5HA 4XR4A 3TGWA 4WADA 1XMQB 1SR8A 2VHUA 1U6JA 3JQ9A 3RHZA 3M4ZA 4FCCA 1JEAA 1FQKA 3AOEA 1S9HA 5HXAA 4OLJA 4BNWA 3MC1A 2Z5LA 3M5DA 5IBPA 3CUYA 4LJ7A 2JJ8A 4YJFB 4UTRA 2W2OA 1BTOA 2VDUE 2V59A 3T5MA 1F4PA 1P5RA 1LBIA 3ISJA 3PJFA 2VA9A 2Y1XA 3DZIA 4QBFA 4I0WB 1MW8X 4Q00A 1BD3A 2AEFA 3G23A 4ID9A 4LHYA 2VQ6A 2V7UA 4YN3A 1NOIA 5CVCA 3REQB 1DCMA 1QG4A 4CN9A 1ORWA 5IBQA 4X1IA 3TUJC 1FW8A 2XMGA 4LRYA 3WK4A 1PV2A 4CPDA 4L2IA 3DKRA 4M9RA 1N6RA 1CC1S 3L6DA 4LYDA 4MKGA 4Y9SA 4C87A 4CL3A 5K0ZA 3ZE1B 1L5LA 3L4BA 3MBIA 2FZVA 3PR1A 3IX7A 3TQOA 3CEAA 1U3TA 3LUPA 1CJCA 2X58A 2YV3A 3N8IA 2EVWX 5SZJA 1E4EB 3BJEA 4H15A 4I9NA 2WTMA 4UEQA 4IQGA 4RE5A 3RD5A 4WNYA 5LXTF 1R8SA 4O2LA 1QBGA 3RNLA 1GQQA 4BO3A 1YR7A 4DUPA 1FDSA 4M36A 2EZ9A 5HFNA 1TCBA 2WG0A 4YRIA 4B09A 1T2AA 4TWAA 2RGRA 1P5ZB 2ZETA 1Q7TA 5DM60 1QTQA 4C4XA 4TTRA 1U7XA 1IBKB 1LI4A 4M9UA 4RMNA 5BW5A 4KWCA 2CEKA 2JI6A 4BJ1A 2VQ3A 5CG1A 2QUIA 2JC3A 2PM8A 4KAXA 4BNUA 4D9KA 4YJ2F 4B2YA 3CSSA 1BDJA 1GQSA 5CFQA 3DQQA 1SKMA 3PXUA 4DZRA 2ZAOA 1Q0UA 2PZFA 3DEZA 3C98A 3OJ0A 4GYJA 4HDMA 1XAHA 1ZPDA 5M5BA 3A1EA 2WYVA 1ZIYA 4FDUA 3UATA 5IAAA 3OQOA 9GPBA 3H2ZA 3L8MA 4F84A 2ZGVA 3L8ZA 4WE3A 1PF7E 4EIWA 4GH5A 3PHLA 1NC3A 1KZ9A 4M1SA 1E6EA 3VNBA 3IH5A 2JAXA 2V6BA 5EJAA 1VA4A 3ZV4A 4F6CA 1TA0A 2XWJI 2OCBA 4B6JA 1KL7A 1XZGA 3JATA 2F17A 3CO5A 3DBOB 2A0XA 3VDXA 1NYRA 1UMBB 1IM2A 1E99A 1Z7BA 1PVDA 1ZY2A 2NSJA 2W4MA 3KOWA 3FGPA 4G26A 4JDUA 3NOVA 3K9QO 5CHEA 3I9KA 4AMVA 3DZBA 3P4YA 4AAYA 5JAQA 2ZI9A 4C0KA 1M9NA 2W43A 4CIYA 3MWGA 3PGVA 2F3TA 1TZCA 4KN6A 3TLYA 2JZNA 4UFNA 4NOKA 3J7AC 5J1SB 1DRVA 4R51A 2XJ9A 1ISGA 3WWDA 1M2GA 3RC1A 3JQQA 4KH0A 4KE6A 4R9SA 5A7GA 1LPBB 2AMYA 4H77A 3UJBA 3ZWXA 3VUEA 3OE4A 5BV2P 4BNZA 1R6UA 2WVAA 5AQEA 5EP1A 2E4WA 5EZ5A 4G4GA 3O3OB 3SG0A 4Z4IA 1J6UA 1GSIA 3OOSA 3DZGA 4IIXA 1K1EA 1OREA 4KR3A 1MO3A 4HL6A 2QP9X 4GP9A 3VR0A 1X7WB 4M8KA 3EPKA 3LY5A 3OZCA 2A9OA 2HA4A 3JALB 3UB2A 2DGDA 2X7XA 1E8DA 4AKIA 1G21B 4JJKA 2OGZA 4ML3A 1K9VF 4WJKB 2J5KA 4ZQHA 3NJ8A 1WY5A 1X80A 2XIQA 5TPZD 1THTA 3E9ZA 4O4JA 2O1SA 2Y77A 1GKLA 3WKAA 3CRRA 2ILVA 2DUWA 4ZV9A 1NSFA 3P8ZA 4UDNA 4HO1X 5FBKA 4CU2A 1XDUA 2FF5A 2JL1A 2V9ZA 1A96A 1U2DC 1Q1ZA 4KB5A 1Y81A 2WUDA 4TLBA 4BNMA 3TRDA 1E79A 2JIDA 3JWHA 2BM9A 2BELA 2EYQA 1R5BA 2FWBA 2YYAA 3KXKA 3OX1A 2C3UA 4US0R 1ABFA 1A2BA 2OXFA 1KF0A 2VDKB 4BMSA 4QUBA 5AW2A 4OEHA 5GY7A 3ESDA 4DSOA 1SC1A 3B3FA 3DMTC 3FETA 1P29A 2FEOA 1G3RA 3G0BA 1LGYA 2E6UX 5HIMA 4AKGA 1W85B 4LOKA 5DKFA 3UOWA 1KS2A 3WWCA 1ZICA 4X00A 5A3QA 2FG5A 1P0MA 3S55A 1V6CA 4LISA 2XTNA 4BQEA 1YE5A 1G8MA 1Z6YA 4MUIA 3G1WA 1UBUS 1TMGE 1EK5A 3C5WP 4G0YA 4BOYA 4F2WA 1QU3A 1EDOA 3BRCA 3NBYC 4N39A 4WLNA 1SQSA 1JIQA 1ORTA 1FXWA 2GZAA 2B8NA 3LQQA 4NE2A 2OXEA 1GQOA 1OT3A 1XZKA 4BWFB 3RRFA 3AOGA 4L57A 3M8KA 5EE3A 1R7RA 4L4RA 1DUVG 3L7DA 6LDHA 1R9JA 4ZVRA 1M0EA 5KI6A 1PFYA 4C0XA 3HCPA 4CMEC 1NPDA 4MJXA 1Q20A 2DH5A 2JFFA 3K92A 4KIFA 4FHGA 4Q01A 3U3OA 3FSJX 4CT0A 4DJJA 1C2YA 2FPGA 1AF7A 3O6VA 3RC2A 5CRIA 4ZT5A 1HDYA 3NT5A 4EUFA 1A98A 5AUPB 5GZ3A 1KFJB 1XA0A 3KQMA 4EF4A 3SBEA 1PSZA 1NR5A 4CCWA 2Z56A 4YP5A 1KJYA 1TIPA 2VP6A 3T95A 2QN3A 5L6LB 1NJFA 1RKQA 2J67A 4QT0A 3NALA 2ZUSA 3EISA 3P96A 3WWPA 4HNTA 1DCFA 2R6JA 4ENWA 1SCUA 4DJAA 1M34A 2WKRA 1MZVA 4J3NA 2DJIA 4Z7OB 1DG1G 4M7RA 1MC4A 1JXMA 2O50A 4KE8A 3GA7A 4XVRA 4BJ5A 4DSTA 4DR7B 1AIPA 4RGVA 1L5QA 4S1TA 2FGKA 1PT7A 2XTAA 4IXDA 2WSLA 3GELA 3LRTA 1SOAA 3EWAA 3MTQA 1KRHA 1XP8A 5CR9A 5ED0A 5JDIC 4MI6A 4YMVA 5U1PA 3ZH2A 4L3WA 2W48A 1YJQA 4W63A 4DCCA 4ZEVA 3EPHA 5F3RA 1NTRA 1TOAA 1H69A 1I6LA 2ETXA 3LBHA 3AUSA 1DI0A 2V5UA 1G4HA 3QY9A 4UVEA 3A8TA 4GZLA 4JGBA 4LE0A 5K8LA 1OH8A 2BE9A 2YWEA 5IT4A 3KB6A 1G291 2WU8A 2WILA 2A9KA 4IVRA 5EE9A 3RUEA 1VE9A 5B37A 2J30A 1LPOA 1MW9X 1TTPB 2ZSJA 5IAOA 1XCGB 4FOPA 2KLHA 4KBFA 4CI0B 1GT6A 4F5YA 1EJ0A 2J87A 3RIHA 4LXUA 2C20A 2WZDA 3P2JA 3KB2A 3HVUA 1PFWA 3HHEA 1DIRA 4Q24A 4Z86A 4CCAA 2A9PA 3TCXB 4BO6A 2E4YA 1HFJA 3OPVA 4P93A 4QUAA 3Q8MA 4J4HA 1EBBA 3PC6A 3A9RA 1V41E 4E15A 4K88A 5IVIA 3GARA 2PGXA 2X22A 2D1SA 4MCIA 4OI1A 2R85A 5I4IA 4NOLA 5TSDA 1IUOA 3ANLA 3C5CA 1W6RA 2PPLA 4EJFA 1IEQA 3JQAD 1IHOA 5F3DA 3GF4A 5E6RB 2D13A 5LQDA 3R8CA 3VOBA 1BQ3A 1U3GA 3IUSA 3H99A 4UCWA 4FFDA 4WJLA 4YRGA 1VI6A 3ABOB 2Y1OA 4ZOBA 2QD3A 2PUEA 5IYZF 4A92A 4QG7A 1INLA 4BP1A 3MAJA 4XLLA 1E62A 1QOPB 1LDEA 1UKAA 6ADHA 3FUUA 3MELA 4FK8A 2JIQA 4Y6LA 1NXPA 5IAEA 4EZEA 5AVWA 4EENA 3TG2A 3ELBA 2HZBA 1ZMBA 3PEEA 1GL7A 4I14A 1J0DA 1KNXA 4KIUA 1JQBA 1WXQA 4P7GA 3VU9A 5KYTA 5I7OA 3AVTA 2GMWA 5GP1A 1BXGB 3NBXX 5HHTA 1DQZA 1YMVA 4UU1A 4TLLB 2P4HX 1Y1TA 3G2HA 1IQUA 2VYFA 4K26A 4UREA 1Z5WA 5JHGB 2H1WA 2PHZA 3RYFB 3F6CA 5CIWA 3EWNA 1C9NA 5K0FA 2AUTA 1FVHA 3EIWA 3OHPA 1YONA 5FWYB 1B8PA 4D82A 1A77A 2FHSA 3UPUA 1WMDA 3LKBA 4PLWA 2MSEB 2X8JA 5T8KA 3UA4A 2ZATA 1L2TA 1E9EA 2ERXA 2O52A 4IBOA 4LDNA 3R7LA 4BRUA 2HEGA 4OAOA 2Y0DA 3SZRA 2LBPA 4R8VA 4NCKA 4YRBA 1LTKA 3A0RB 4U1RA 5B7PA 4A15A 3K9BA 3X2SA 1ZR4A 4DHEA 3KE8A 2IS1A 4RJJA 3AEUB 3NYRA 5JYCA 1KFKB 2P8JA 3T9BA 2L19A 1XZCA 3U4AA 3JQ7A 5D7BA 2CMKA 2EZTA 1QIKA 3AR8A 3WYBA 1XVLA 4C0SA 1YQUA 2FK8A 4ZWNA 4FGLA 3T0IA 5LPNA 2G63A 1N2CB 3JSXA 2WIKA 5DCLA 1F9EA 1R3DA 4RGBA 4QQFA 4YUZA 2GCGA 2IVFA 2W2MA 2RGEA 2XMPA 4TS3A 3SZGA 1IOZA 3AONB 3RJ9A 3WLFA 1YJBA 1BX0A 4DQVA 5C1OA 1HF3A 5K0SA 3VYRB 4HI0E 4W99A 4DQKA 3NBKA 3OZIA 2B6NA 2QRNA 3QVOA 2WJWA 3NVKI 1QCDA 3CSDA 4ZICA 1WZIA 3REFA 5TPZA 4ZT2A 1E59A 4KWEA 1WXGA 5DRTA 4L0QA 3G8DA 5GZ6A 5A2QA 5AW8A 2Z1NA 3CC8A 2ZVQX 4X94A 4B6PA 1M1UA 1XCOA 2PAFA 2QZPA 5BNTA 1CF4A 4U7GA 2FSVA 4AO6A 2H8KA 3FWHA 2O14A 1KK2A 4I50F 1SWVA 2YY6A 4KXUA 4QUKA 4UJ3A 3TXAA 3ZY3A 4RDXA 4ZYYA 4W7SA 4AJJA 3C0KA 3OIWA 4ND5A 3G68A 3A9VA 1DV1A 2H5LA 2OO5C 4XX0B 4EB0A 4ZIRB 1M5UA 3KJEA 3EOZA 2BRUC 2ZJFA 2ATXA 2Z8YM 2PQ0A 1F38A 1PQWA 2OQRA 4IOMA 3GLFA 3S8MA 2QN9A 1JMVA 2G0TA 3P4UA 3D0QA 3LYAA 5AOCA 3WRXC 4ZV4A 2YZGA 1GA4A 1Z0FA 1IIBA 2IODA 3NHWA 4IMIB 4CL2A 1SG0A 3OWOA 3MT8A 3MA0A 3DEKA 3KQLA 4QICA 2GAIA 2DPMA 4GLJA 5IVHA 2ZIUB 3ZGZA 3PKIA 5EMHA 4XVQA 4D8VA 4R3WA 4B0PA 1HMYA 4J3FA 4LC9A 4N6GA 4C2AA 1Z7EA 2FR1A 2FN3A 3RW9A 4F3YA 5J3JA 5TQ0A 3FNHA 2PXXA 4NL4H 2CHVA 4A91A 1RKXA 3L7JA 3SEQA 2ODAA 1D1QA 3FKSA 3O3CA 3L1VA 5ALMA 2ASVA 2WSIA 3IELA 4DLPA 3OESA 2XNHA 4LGYA 4JI2B 2AD1A 1Q6YA 1T9CA 2DUJA 2ON6A 2VA8A 3LE8A 4L6IA 3VH3A 2P6RA 2WF8A 2YINC 1WCIB 1WMFA 2MSWA 3HVJA 5DP1A 3R5KA 3SS7X 4JJ6A 4JV5B 1NN1A 3NFYA 2RSLA 3MSCA 4XWYA 4AJKA 1SVUA 1WKBA 2G28A 3ZNQA 4KQIA 3DXXA 2F1JA 4JU9A 5KOHB 5IK2D 4NOJA 2VVTA 3D6MA 4UDYX 3JARA 1CX9B 4MS3B 5AVJA 2IOQA 3C7CB 4DLUA 5ITWA 1QVWA 1K9SA 5JI2E 4A10A 1G6Q1 4NG4A 3ULKA 4FJ1A 5B3JC 4ZVKA 3KFXA 3EXIB 2RHWA 2FN9A 3WICA 4MI1A 1LUAA 2VS1A 2UVQA 3PFCA 1GWNA 4F1JA 1QRDA 3M1LA 3GJYA 3IT0A 1B8NA 1ZGZA 2JATA 2REBA 4NYMR 5DTJA 3LT1A 2GHRA 3ND7A 3H9CA 3G8AA 2BHNA 3PDJA 1BDBA 2GILA 2DKFA 4IF6A 1BHQ1 2R1UA 2QOEA 1SXJB 4HGOA 3MGCA 1RLJA 4JYCA 4ARUA 1CETA 4PLGA 3A9CA 5ITZB 4QEKA 1LJUA 3HZOA 1E7SA 3VC3A 2JI7A 3I92A 2QSZA 4C14A 3C8UA 2OCKA 3Q3GE 4ZAFA 5K3CA 1DWOA 4HOYA 4Y0VA 3X1JA 1HEIA 3B1ZA 4PQYA 4JFAA 5CFMA 5KJ1A 2HCFA 2XYRA 3AW9A 3ET5A 4QLAA 1A9XB 2LWIA 3KEGA 1K75A 2GEKA 1VL6A 3IEUA 3OIFA 4IZOA 5IVDA 5AM0A 1V96A 3BBPA 4RX1A 2Q3MA 2P9BA 4INOA 4XB6B 2VT2A 3RIGA 4W9MC 5JLJA 5ES3A 1BHJA 4BFUA 5LIPA 2OFOA 5JVDA 1JECA 4QARA 1V5FA 1TO2E 2N9UA 2VBFA 4WOKA 4W1QA 4A0FA 5B6PA 3M6IA 3BTVA 5BWLA 5MN6A 1JT2A 1NRIA 2YH2A 1Q3KA 2VPPA 2EKDA 3NIWA 4S1PA 4RETA 3HPQA 5DISB 3VH2A 2YXNA 5IUNC 1IPEA 1ZUWA 1N2BA 3IESA 1FFHA 4G9BA 4DSUA 3E9EA 1U7WA 3R2JA 3CLTC 3JAKA 3USZA 2Q4TA 4YUVA 3IDSA 3ITKA 1T9GR 3ORQA 4MARA 4QTTB 3RVOA 3UT5A 4BNDB 5CG2A 2PLNA 4PX9A 1OXXK 3GR6A 4QBKA 4M9ZA 1DQYA 4ASUD 1XGKA 1EFVA 1IBSA 4YUYA 2IKQA 4DV2B 3VKFA 5K3EA 1G3IA 4DPLA 3OZFA 3CX3A 3ZVKA 3JVUA 1P2BA 5CDYA 4MUGA 3FZGA 2REQB 4MW9A 1SVKA 1TT5A 2XDQA 1B8UA 4MP3A 4NV3A 4OBWA 1GZ6A 3L0CA 1JBEA 2QIOA 1J8QA 5GIPE 2WC1A 2G5CA 1CLEA 3HSKA 5E4TA 5ILGA 3GGDA 3D6TB 3TOZA 4YJHA 5ENVA 3A70A 4UNNA 3VC1A 1FDRA 1Z17A 1PL7A 3FMVA 2XNKA 3QBTA 4XKJA 5D86A 5DK6A 3RWMB 4OJMX 3BEDA 5C53B 1KDTA 1RAFA 3RUDA 4KMSA 4C0HA 4QO8A 3GZNB 3KKLA 3L41A 4PNEA 1BC5A 1XZIA 1L7EA 2BM0A 4ZARA 2RH5A 2Y27A 1J90A 1G55A 1WABA 1OBHA 2HNAA 3EAFA 4K05A 2HSJA 1RZUA 1LLDA 1WLSA 2FRDA 1KDRA 3UJ9A 3HZZA 1BMQA 1EWVA 3CLRC 3WDLA 1DMSA 4RTOA 1EFAA 1K98A 2FX5A 4OLBA 4LHZA 2GTHA 1Y34E 2XF8A 4BFCA 4ZRDA 5AXBA 3OZSA 4LRTB 3NHUA 5FFNA 4BLVA 3CBQA 3JASB 3TL2A 3IAUA 1JIIA 1W8IA 4XVCA 5F9FA 4ACAA 2DT8A 1VLZA 3LCVB 3P9PA 1OZGA 1BN6A 5EY5B 3SAJA 4IQ8A 2PEYA 4ZYXA 4XQCA 2LDXA 3L93A 5GJWC 5CX4A 1PFKA 2ZBRA 3TAHA 3W2HA 3FSRA 4ILKA 1I2BA 1S9DA 3HDVA 4C0JA 2JGMA 3NH6A 4AM8A 2IY7A 1WPXA 4TT3D 5EWLA 2IYQA 1J2EA 4AN1A 5JYDA 1P1BA 2NQ2C 2BZSA 3L8DA 1ILWA 2Q4RA 1UJMA 2HH9A 3A6HA 3O83A 4EEXA 1T4DA 2J5XA 2QRMA 5A9TA 1SBQA 3RRBA 3FLMA 1M73E 1EX9A 1KY5A 1LWOA 3WIBA 2AHRA 4A2WA 4CM8B 3UXYA 4QNNA 4F3TA 2SKCA 5F64A 3IR7A 3JD3A 4U8GA 2DTDA 4HRYA 5EHIA 1PFGA 1L5RA 3GNLA 4U7JA 5ILQA 2GN2A 5KVVA 3EIQA 4HB0A 3HACA 1TVKB 3GBPA 5DBOA 2Q6KA 4EL5A 4X90A 1PDOA 2CXOA 3R7DA 2G5GX 1ZIDA 3FCXA 2FZCA 1Z8HA 4Q3CA 4AJIA 4DDUA 4IDFA 1QKKA 3V4FA 1JDBB 1FP4A 4WNAA 3SQXA 2XNCA 3HCCA 4DPMA 4G1FA 4O2AA 1EFKA 2BY4A 2C58A 2W11A 4L0MA 2IYZA 4TMYA 3KUCA 3IEPA 1AK1A 1CJTC 3GAZA 1NW4A 5CCDA 1USVA 4TPKA 4Y2TA 4AG5A 3AEKA 5EE5B 3R74A 1LZLA 2FSHA 4R1MA 3BT7A 5F7XA 1NUHA 1A3CA 3N7AA 4I6JA 2IYVA 4CT4B 1U8EA 3N86A 4N6NA 4MLZA 3KR2A 2CZGA 2ANCA 4LF9B 2RI0A 1YKSA 5DEIA 3DMPA 3FDJA 2ZSIA 4OQYA 2XVYA 4PTYA 1BS1A 2NO6A 5K99A 1T9HA 1ZLXA 4Q6WA 2GN1A 1F60A 2QM3A 3Q8LA 4CMKA 1E18A 1SXJC 4ZI5A 5TNXA 1K6JA 1Z8NA 3ZXIA 4L1KA 1PT5A 3ONDA 4MYHA 2EBWA 1IDN1 1XCLA 2GEJA 4MLPA 5AP9A 3VPFA 4DCNA 2Q1SA 4OIFA 5JFGA 4OGWA 1XRQA 1C9KA 1IUNA 1L7DA 2MOKA 3AX6A 3OT5A 1TRKA 3QVTA 4MQLA 3TNJA 1GR0A 2PS3A 2E1RA 1C1XA 4JCOA 1KI4A 4YAEA 4C5CA 4FQ7A 3U3KA 1JFFB 3O95A 4NCHA 1Q0SA 4HP8A 4L28A 2HN9A 3TR6A 5LMZA 2Y2UA 1AB5A 2NZVG 5IK2A 5BMVA 4YMSA 1ZINA 5KQRA 4TTJA 4EG7A 5KNLA 2PGJA 4P0TA 1T3HA 3PVCA 4L6CA 5JOQA 3FPFA 2I2WA 4LK2A 3PJDA 4E31A 1W30A 2J9XB 3MUEA 2IYLD 1IB0A 1U2GC 1E64A 2CVOA 1BHO1 2DFKB 5H1YA 5B1YA 3JWIA 2I71A 3D7NA 3LL7A 4OHYA 2J9FA 1UPFA 3FNRA 3QE0A 4MEAA 1JJIA 3ICEA 1E3LA 3HUEA 1PYGA 5DN9A 1UPXA 3BGSA 3OPYA 1KETA 5T4FA 3RU9A 2C4WA 3T4EA 4ZT3A 1KBZA 1MIOB 2ZJ0A 5KJCA 3PEVA 4O3MA 1OFUA 1CZUA 1JZQA 3T0FA 3AC0A 3NJRA 4C20A 1O2DA 3N5CA 3K15A 3W5BA 2G0AA 2EBUA 1Z39A 2B2XA 2O9JA 4R5MA 1QK5A 3N8DA 4MVJE 1JYEA 1Q1AA 5AUNB 3B6EA 3K5WA 1G66A 1ARZA 2ILTA 4MV9A 5CPFA 5F5NA 2PKYX 1KYIA 3IB6A 3N05A 3ZNNA 3H1AA 1Y4DE 5K2OA 1U3VA 1L9XA 3L49A 1W5EA 1MB4A 2PR2A 2WM2A 3E9CA 4IXWA 4TUYF 5EKXA 4ZTBA 4KMOA 3I04M 3WY9A 2Q1TA 3KV3O 1Y9JA 1NVVQ 4DBVO 1UOOA 2OYSA 2D2XA 3H9QA 2GPBA 4JLNA 3MJFA 3VR6D 1KJ9A 1XNQB 2FWMX 2VJYA 1OQAA 5TVGA 2H65A 3I6ZA 1BS9A 1TAQA 2EERA 3DHYA 3CLVA 2QL5A 2ZWPA 3OKAA 2Q28A 2BP7B 3GB9A 4GNRA 4OOEA 4O63O 3CEJA 2GVNA 4R3UC 2ECFA 4YRSA 5C18A 1H2EA 3D1LA 2FFRA 2IHNA 5CB8A 2V8BA 3M3HA 2Z4RA 3DYVA 4IRXA 4P4SA 2PZLA 5JSKA 2IIPA 2X3YA 3NORA 4R7ZA 4TX1A 4ARAA 2DTXA 3FTFA 3GJQA 2JJQA 3PR3A 5HF6A 3JQRA 5ECGC 3F8TA 1TUBB 4HTFB 4ASUA 1BU5A 3WWEA 5JPIA 3VC2A 5A6SA 2J9ZB 2XCRB 1U8ZA 1Q50A 2QU8A 1JSXA 3OBBA 2W71A 3MCVA 4CKXA 3I1YA 3GN1A 1XRPA 3THYA 2IUYA 2COUA 4WQMA 3VNRA 3RFUA 1RHRA 4N3GA 3DUFA 5AR1A 5AW5A 4O6VA 1DJOA 4G1BA 3KIPA 3DNFA 4JROA 3VPXA 3V42A 1SXIA 3E05A 4NEHB 2XPCA 1DMRA 3NONA 1FMFA 3PXDA 1DDIA 2BFFB 2QTGA 1L4UA 4NKRA 5DRYA 3EWSA 5K8CA 2H3HA 4P2BA 5EWMB 1KQNA 3VO2A 1ZD8A 4ZCLA 1TVCA 4OBBA 1ZD9A 1A7AA 4ZVUA 1V37A 3IE2A 1IFXA 3IEKA 2XCIA 4ZHQF 1JQKA 1LNZA 3W9UA 4FB4A 4L4YA 1IJBA 3DNPA 3O73A 5AKIA 2B4TO 1J7KA 3UMCA 3RFFA 4MPPA 1Z6ZA 3EUEA 3ZCVA 4CG0A 3OM0A 1BW9B 2OORC 4XQEA 5BV1A 1JWBB 1FRNA 3QX7A 4ZOLB 3U61B 4CGYA 5BSWA 3LFUA 1CRWG 1JDBC 4BQQA 1XQWA 1J2UA 1YR8A 1ABEA 1YI8A 4GUDA 1UXJA 2PT7A 4JX8A 3RSSA 4E5VA 1YQWA 3GMSA 4R1NA 5DGCA 4F2GA 1KS9A 1WZCA 1W4RA 3EBPA 3UUFA 4P2GA 3ZU5A 4BKMA 3QUCA 2IYWA 4X6LA 1LS1A 2F6RA 1UBEA 3NWPA 2DQ4A 4G4IA 4KMMA 2UYHA 3BREA 4MS4A 3DLCA 2LV8A 4JDPA 1VSVA 1UADA 5ALDA 4BLQA 4WWHA 3H8WA 3CWCA 3QNWA 3KQVA 3LC2O 3RSOA 2WEKA 4AUKA 4AJ4A 5ALQA 4PSAA 1L9KA 2A9RA 4IKEA 4BMXA 3U4QB 4BB9A 3BA1A 1BWPA 2JCYA 1JR4A 5DCWA 3ZLBA 1A04A 2QN7A 4XQ9A 4UHDA 2HU2A 3CJRA 1ZRSA 5DBEX 1VJGA 1QGYA 4JQCA 3QE2A 2HF9A 1BFKA 1P18A 4AKTA 3L7NA 5L4SA 1KMHA 3O03A 4GX0A 1UOPA 1EXMA 4ZI2A 2BEUA 3H9BA 4FHEA 2OTCA 3RYIB 4YLYA 3M9LA 3NPAA 4KSYA 5AIBA 3NLLA 4XPIA 5C8YA 3FPHA 5CU7A 4IHAA 3JD4A 3PCRB 1NSTA 2NTJA 1I2AA 1SHUX 4E88A 4BHTA 3G1UA 4DIMA 4EBBA 3A4LA 3HJAA 3R3VA 3GBVA 4O3FA 2QD4A 1X42A 3AEQA 3OFKA 4G4JA 5GGXA 1NXSA 5EA2A 5CD9A 1GJRA 3IO3A 5EXDA 4OBXA 2C2HA 4N0EA 1UFRA 3R7FA 1YWGO 1JIUA 1HRKA 4RXTA 4TVBA 1CNMA 2GNPA 1SUPA 3V4VB 4ARIA