1Z0KA

Structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGLERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0kA01
1N5KA 1NI3A 3EA5A 3QXXA 3RRZA 4B76A 1K5GA 1AK2A 2ZJAA 2KWIA 2GHIA 2ORVA 1NIJA 2ANCA 2UZIR 2W2TA 1OH8A 5JJLA 4DHEA 4DUGD 4EDHA 1U8YA 2FZLA 2JAQA 4LWZA 5FPHA 3BD9A 5AUPB 1UKVY 3AF4A 1E0AA 2GILA 2VP6A 421PA 2I1QA 5JRJA 4ZDIA 1RIFA 2ZYUX 1DG1G 4X8MA 1ODFA 2JA1A 1GL7A 4NZYA 4TTRA 2ZRLA 1Z08A 2PJRA 1R4AA 2IYXA 4TYYA 3ZZTA 2HUPA 4QGAA 2CK3D 4LI0A 2GCOA 1ZRHA 2NOAA 2RMKA 1XMJA 3Q72A 3EPLA 4G1UC 2KJQA 4LCBA 3GJ7A 3T12A 5FUVA 5KU1A 1G8FA 2G6BA 4LYAA 1JXMA 3FYHA 3TVDA 1MABA 4EJSB 1BIFA 3GEEA 1ETUA 1ZM9A 3I3SR 3QF4B 4DCVA 2F3TA 3RHFA 1HY3A 3AKEA 1E1RA 5IRCD 2NO0A 3WP0A 2W00A 5SZKB 4ZDKA 1US8B 2JLVA 2FEOA 3QPWA 4CW7A 2ZAOA 1OW3B 3T34A 3TSZA 2YYZA 5H8WA 4DEXA 1Q1BA 2GVZC 3I1FA 4LJ9A 4S35A 1KSJA 2W2VA 3IPYA 1XEWY 2QP3A 3OZXA 4Q21A 1RJ9B 5BN4A 5JWRA 1E2QA 2OT3B 1NLZA 2ODWA 1UBFA 3LW8A 1Z0IA 1LV7A 2B21A 4EFNA 2V6JA 2W0SA 2YWGA 4FXPA 2QAGC 4Q19A 5GJCA 2R8RA 3I4LA 2QG6A 2X2EA 1KI7A 1UF9A 1LTQA 1XPUA 4IVRA 2F43B 2IUSA 4C0JA 3AP1A 1OLOA 3D6TB 3HYRA 5EP2A 3GEHA 5H68A 3QBVA 3H2YA 2VP5A 5BYJA 2V55B 2VSFA 2QTHA 4DB4A 1KY3A 1CXZA 4JKYA 4TLBA 1AZTA 4BE7B 1TX4B 5GJVC 1PLKA 4G3XA 4URVR 4PAQA 2RHDA 1EX7A 2GK7A 3TW8B 3AH8A 4KAXA 1MKYA 2ZSEA 3E5HA 4KCGA 1T5IA 1W47A 4C2TA 1MRNA 2DY1A 3LFUA 1SQ5A 4TMKA 5FR1A 2WKPA 4POAA 4A92A 3ZZUA 1Q1ZA 3C14C 5E7JA 4EJSA 1XBTA 3REFA 2QMEA 1UKEA 3P4YA 1DAIA 4MYHA 2VP9A 4G5RA 2FGKA 3SYNA 2QENA 2MSEB 2DWQA 2GXQA 4R2IA 3V4RA 2IT1A 2FN4A 3NBYC 5FOWA 4BPBA 2PMKA 4JLJA 3QG1A 1TQ2A 2C5LA 5L3QB 1S2MA 2BEJA 3VR6A 1RJ9A 1JJ7A 3GFPA 1G3RA 5HE8A 4F91B 5DNYB 4RCZA 4AG5A 4I81A 3B78A 5J4YA 1A82A 2QPTA 3OIVA 2IYQA 4RZXA 5FTJA 4AKEA 3SZRA 1W0JD 3GFTA 5DI3A 1Q44A 2GEDA 4W9MC 3EPHA 1TU4A 4LYFA 1F3OA 1P72A 2WPDA 3DKVA 2ZUCA 3KKMA 4LHXA 5LPNA 1VG9B 1W36D 5HPYB 5FFMA 1K6MA 4L4UA 4NHOA 1CF4A 4HI0E 3ZS8A 3K0SA 3EZ7A 2CDNA 4KXFB 3KDSE 1N2CE 3BFXA 1BH2A 2I3BA 1JBKA 2AFHE 3PEUA 3B1XA 3NBZC 4ERNA 4ITRC 2WWWA 1ZU5A 1OKKA 5FH9A 4HAXA 5BW8A 2FFBA 3BORA 1ZBDA 2HDNB 1F2UB 1P2VA 2J87A 4TMTA 2IS2A 1R10A 1XMIA 1XMSA 5DHFA 3CIOA 4ZIRB 2YHSA 3EA0A 3L0OA 3KFXA 3Q9LA 1CTQA 2RGBA 2C98A 3KJEA 1ONBA 2PLRA 4LJYA 4QM6A 2QP4A 5B57C 3RANA 1OIXA 1Z0FA 1EXMA 3L0IB 3TUIC 3DM9B 3TR5A 4FMCB 1Z6YA 4XJXA 3I62A 3BH0A 1RRCA 2JLQA 2OE2A 3SJAA 1WBBA 2GWHA 3FFBA 4M1OA 2NPIA 4LY6A 1GKYA 4RCYA 3NC1C 3WXMA 1JR3D 4DVGA 2WWIA 721PA 3FTQA 5C1BA 1NBMD 2FZ4A 4JS0A 4F92B 4LHWA 4K81B 4TSFD 1TF2A 1ANKA 1G9XA 1VHTA 1YZNA 3EXAA 5F2EA 5BWMA 3FFAA 3CM0A 2G3YA 4NYIQ 5EUMA 2JCSA 2ONKA 4CIDA 2BBOA 2OO7A 2OV2A 5FPSA 4KBGA 4BLTA 2FV8A 1DAEA 1ZM7A 2FWRA 3M6AA 2MMGA 4QRHA 4JSYA 3SJBA 3BC1A 3TR0A 3W9YA 5JMTA 2GZHA 3GD7A 1XXHB 5FL7A 4DCNA 3B13B 4L16A 4LC0A 1ELOA 2REBA 4Q7KA 4A0GA 2ZETA 2GF9A 3U44A 2NIPA 2ZRBA 4Q01A 2O52A 1Z8FA 3I5YA 3B1WA 4FWTA 1LF5A 3U3JA 3IQXA 3MFYA 2GTPA 5CB8A 1E2EA 3AVVA 1IJEA 2XZLA 4TMXA 5JHHB 5K8LA 3BB3A 1GTVA 2JEOA 1HV8A 1OFHA 2WSSD 3QXCA 4Q5IA 3ZVMA 1G3MA 2X1VA 2FA9A 4Z54A 4QGFA 3NHAA 4Q1DA 1HA3A 5SZHB 3SNHA 5JJKA 2OCYC 4JBYA 2ZRHA 4ZIRA 2ZSAA 1XJQA 121PA 2HLDA 3CZPA 1G1MA 4GZMA 3THYA 1XZPA 1E9FA 2C96A 3K70D 4D26A 2IUUA 1TL7C 4EPXA 3B5JA 1T4GA 4ASUA 1KKLA 2RGXA 1ZC4A 1KJZA 2FPLA 2H18A 1KJWA 1X8JA 2RH5A 3B8HA 3ECCA 4MGKR 1P7CA 1NLFA 1KO1A 2CCKA 1EK0A 2F1HA 1P9NA 4URZR 5L3SB 4DDUA 3ADBA 2EYUA 2BOVA 2P3SA 4KYIB 4PANA 4XWAA 2IA5A 1NSFA 2PZGA 4HATA 2LKDA 2Y8EA 4WAUA 4QOSA 3UG7A 1F60A 3TVTA 2F9MA 4OJKA 1N5JA 3M1IA 3D31A 4I1UA 4A2QA 1DPFA 2NO7A 2RGNC 2YOGA 2W6JD 1C1YA 2BDTA 4GI7A 1GFIA 4GOXA 4DDTA 4Q4JA 3ZLJA 4UQOA 3GPLA 1XMVA 1Z6TA 1XF9A 3UWKA 5FPKA 2ZE8A 2YOFA 3SJCA 5JCPA 1QG2A 4U02A 3A1SA 5HE9A 3HPRA 1F48A 4A8JC 2JDIA 2QGZA 4FI3C 2WOJA 3IKJA 5JSZB 1OXUA 1PLLA 3CUEF 1DS6A 3G82C 1LFDB 1N6LA 1CR1A 4TLDA 4HB3A 4BFYA 1MH1A 2RKOA 4WOPA 3K0FA 1AS2A 3B6EA 1XEFA 4HDQB 3K9GA 3LNCA 2F1JA 4Q9KA 3UWOA 3QKSA 5C18A 1E3MA 1R5NA 3NWJA 3RWMB 5KNDA 2J0VA 2JJ2A 2ERYA 621PA 4XD7D 1D8TA 2MSDB 4M1SA 1Z6XA 1JR6A 3G0HA 2R65A 1Y3AA 1ZMXA 2A5GA 4LGMA 4MRSA 3B85A 1FX0A 3LD9A 5J47A 2EFHB 5TB5A 1CP2A 1OFTA 1RZ3A 1RPZA 1RYHA 4ZCIA 5KDOA 4JLVA 1DE0A 3C41J 4L9WA 2ONJA 2GEUA 2IYYA 3W6NA 5G53C 3V4FA 5LD2B 2ZJOA 2ZXUA 1WP9A 4J0QA 3RABA 1Q3HA 4A6XA 3PITA 1FQJA 3GLIE 2W2XA 3IDQA 4MYTA 1IXRC 4B3XA 5AUOB 4O3MA 1UAAA 3QXSA 3TQFA 2I4IA 4JKIA 3MUFA 1YHNA 3QEOA 2ZR7A 3CH5A 2QSYA 1HT1E 4B6FA 3GLHA 4QBIA 1ESNA 4NP6A 3T35A 3A6PC 3CLVA 3FHCB 3KFVA 2Z43A 3OESA 1ZM3A 1I4TD 1UEIA 3MSXA 4TQ9A 2BJVA 4HZUB 3A1VA 3AP2A 3P1JA 4PO8A 2O8DB 2VHQA 1XRJA 1P62B 2HYDA 2HT6A 1GL6A 1YZUA 4PZLA 1HH4A 3A36A 3Q3JB 2O8EA 1QHNA 1CBUA 1CULC 1FL9A 221PA 3A8TA 3AV0B 5E95A 3U3OA 2EYQA 2VSOA 1F2TA 3NEYA 2OBLA 4C3ZA 2JATA 2ORWA 4OI4A 4M1TA 1NVVR 2Q9AA 1ZCAA 1NNEA 3SQWA 2OILA 2GAAA 4FD2A 1VECA 3KX2A 4YMSA 4C0HA 1LF0A 4CT5A 3LX8A 2A78A 2QU8A 3CR8A 4IOLA 4B3CA 2YKGA 1FMLA 3PUVA 4BZPA 2ASEA 1G3IA 4BLOA 1PVOA 4F4JA 1S8FA 1A4RA 2J7PD 4I1OA 2HCBA 3EZ6A 1E32A 1JR3E 3DHWC 3GJ8A 4B73A 3I61A 2X2FA 1NBME 1JEDA 4BLSA 4US1R 3OAAD 4MRNA 1NY5A 2EWWA 2KB0A 3PCRB 2FSGA 3AF0A 4FW9A 2C99A 3T5DA 2P65A 1JAIA 1Z0AA 3TUZC 5DGXA 3T61A 2J0SA 2FFHA 1TQDA 2PJZA 2J41A 1UDXA 2KE5A 3IO5A 1G7RA 4JYCA 1CKEA 1OXXK 2WKQA 2OCBA 3T06B 2ZVQX 2RB4A 3P27A 4TMVA 2CE2X 5FBQB 3CWQA 5P21A 2GZDA 3AVYA 3KQNA 1ESMA 2KBFA 2PT7A 2QTVB 2FFAA 3QSYA 1YZKA 2VBCA 2DYKA 3EASA 4YMUA 4PPFA 1EFRD 1SVLA 1W2GA 3K09A 2WWGA 3BFKA 1ZVQA 5CYPA 5EP1A 4JLAA 4MITA 4MKFA 4H1VA 2XB4A 4HUQB 3K0EA 1CR4A 2FG5A 1T3SA 4QBGB 4NYJQ 5CK5A 2ZANA 5EZ6B 3VR5A 1X3SA 5EP3A 1G3UA 1OT3A 1N6PA 4L15A 4TTQA 5EUQB 2V3CC 5M04A 1E2DA 4DSTA 2ZI3A 1DELA 3T15A 2W83A 5BXQC 3O8BA 1R7RA 2V54A 5KOYA 2JLSA 5KO2A 2QRNA 2A5DA 2XX3A 3O8CA 2O8CB 1WXQA 3ZH9B 2FMXA 2ZRMA 3U7HB 5DIFA 4MGZR 1G6OA 1Z2CA 4PPQA 4DLVA 5A5GA 2Q21A 3WBJA 1WA5A 4ZKEA 4NU0A 2QN6A 1WB9A 1RVDA 3FHOA 1JNYA 3RS0A 4M2LA 1WMSA 2DFNA 4ACBA 3BERA 2AL7A 3BRWD 3L8ZA 4PX9A 4Z1MD 2C8VA 1QRAA 1QDEA 3EWSA 5LB2A 4PPGA 2YVUA 4NCNA 1E96A 4AKGA 1Q20A 4JVNA 4M9SA 3QXJA 2IL1A 1IM2A 1TQ4A 3MWKA 2BV3A 4Q02A 2PT5A 3SS8A 4LPSA 3VR3A 1D9ZA 4Q7JB 5AJYA 3DVLA 5KSOA 2BIFA 1N6RA 3LLUA 2VF7A 4WZAE 4TYPA 1R6BX 4US2R 3R9XA 1Z29A 3NTUA 4HDCA 4FINA 3IGFA 4NCHA 4A4DA 5TMPA 4M21A 4C7OB 1YR9A 2ZIAA 1D2EA 4JIMA 1E2IA 5EE0A 3U6BA 3IEUA 1R0XA 2HYIC 4G5OA 5CYOA 1IN4A 3QKRA 4IEEA 3AM1A 3S1AA 5C2JB 3I73A 5EE5B 3CNNA 3HU2A 3FMFA 1GDDA 2YOHA 3AF3A 1L2TA 4A0HA 3EZFA 1FTSA 1YR8A 4NYMQ 3WYFA 4RD3A 2PEYA 4X8OA 1T5LA 4AK9A 3OFND 1VPLA 1H8EA 4TN1A 5JEDA 4Y0AA 2XNDD 4PR0A 2FFQA 2BBSA 2N46A 3K70C 3OE7D 2P6UA 4KVGA 1E9RA 2V9PA 5DI9A 4K46A 3U3KA 3NKVA 3QI2A 3DKPA 4MKGA 1R2QA 1GILA 4IFEA 1AKYA 2H8KA 2WTUA 1S3GA 1TAGA 2AK2A 4IRUB 1KTVA 3SOPA 3WYAA 5DH9A 1N6HA 2KI5A 3MAAC 1RE0A 2WIBA 3DOFA 1KHTA 1CLUA 3GLFA 4CT4B 1GNPA 1SXJA 1GUAA 4TYQA 3QXHA 1SHZA 1VYTA 4FIDA 1U98A 3O8RA 2G83A 3TUJC 5JS7A 1PZNA 3X1ZA 2BEKA 3THOA 1OH6A 4U00A 4AG6A 4D81A 3AVUA 2QQ0A 4LV6A 4RZ2A 2P5SA 2YNMA 2B92A 3TH5A 3W6PA 2NZ8A 5AJXA 2JLWA 2GCOB 4M4SA 3V9PA 2GJ8A 5TDHA 1II8A 1X8KA 3T5GA 1N5IA 1ZNXA 1MO3A 1MABB 4OKSA 1IBRA 4R7ZA 4C7OA 1AN0A 3HPQA 2QPAA 5CIWA 2LWIA 2VL7A 2CVHA 1CJKC 3T1QA 1JAHA 5J4LA 5JHGB 3X2SA 4RJLA 4I1SA 1XTSA 1LS6A 1NMZA 2FOLA 1GNQA 2GA8A 2D7DA 1JQLB 3K8YA 1ZNZA 2J1LA 4OQMA 3GLGA 1Z63A 1GNRA 3KXLA 3NXSA 3ZVRA 5GVSA 1GVNB 1P9RA 3SQXA 1FP6A 2XNSA 5TV2A 4KITB 1S1MA 2V7QA 1IXZA 3W6OA 4DEYA 4C0LA 4HLDA 3KJGA 1A7JA 2G9NA 2HV8A 2NTYC 1XPRA 2ZRJA 4CEHB 4W5JA 2V4ZA 2FX3A 4Q66C 1NKTA 3WNDA 2REOA 1RRPA 1X1SA 3AUXA 1ZCBA 1W0KD 4EJSC 2ODNA 4JVMA 3RSOA 1NJFA 4OQFA 2WJIA 1KSFX 2BMDA 4JL8A 2P67A 3H86A 4FMDB 4EIWA 3OEED 2GETA 1J99A 1ZUIA 2XITA 1Z07A 3LX5A 1GL9B 5SZIA 2JLZA 4OK3A 2CEAA 3MJHA 4MRVA 2DB3A 1IY1A 2Q9CA 2ZSFA 2ATVA 3EAQA 3EG5A 5CK4A 3TJZA 2BWJA 1NN1A 3RDPA 3K9HA 1KAGA 1AM4D 2YC2C 3FDIA 5AJZA 5C4GB 5BN5A 3IIKA 2P6NA 5C4MA 3RWOA 2CBZA 3GQBA 5HKKA 2ZJZA 2REXB 3DL0A 4TLAA 5DE3A 4S2EA 5FUYA 1N5LA 1SVKA 2QROA 2ZVPX 1M2OB 2DBYA 3BAFA 3LRPA 3B1YA 3MLEA 4ZCMA 1MR3F 4XTRA 2FEMA 1XCGB 3X1WA 2R44A 4D25A 1YZGA 5FTKA 1UBEA 4YQFA 1CU1A 1UM8A 1GIAA 1MV5A 3KKQA 1J2JA 1HT2E 2OLJA 4TT3D 4C2UA 4Q1FA 3BGWA 3W90A 4ZKDA 2VSXA 1QHSA 3SFZA 1R0YA 3I72A 1NN0A 4IEIA 4PQFA 1J8YF 1J70A 1TF5A 3AUYA 2OSBA 4RSGA 4XWOA 3IUYA 1PV4A 4NONA 1EGAA 5G40A 4JLMA 4HYYA 4QBFA 2ZTSA 1I4LD 2WKRA 1IN5A 4M8NE 5DHAA 2NO6A 4CEHA 4LK2A 4EAQA 2CLDX 5DN6D 2O8FB 3IPXA 4FMCF 3CRMA 1DAGA 2EFCB 2J46A 4L9SA 4TQAA 5DI3B 2WAXA 3GFOA 2CNWD 5SZJA 4N3NA 3R9IA 2WJHA 2OBMA 3AKYA 4B3FX 1D5CA 5C46F 1G7TA 3UG6A 1FP7A 1J90A 2VPPA 2PLFA 4DKXA 3DM5A 3BK7A 3H84A 4OJQA 1PUIA 3CF2A 5EP4A 3SBEA 3TMKA 1IONA 2OFOA 1KAOA 3VTKA 1KK0A 1W1WA 4HAYA 4KSCA 2IXFA 1KMQA 2V8OA 2J5XA 1EX6A 4IVQA 2CL0X 3O8DA 1ZD1A 3B1ZA 1HQCA 1M8PA 3QPVA 4YXWD 4B34A 1E0JA 2GBLC 4DXAA 1M7HA 3GJ4A 3K0CC 4YONB 5FOXA 4PSVA 1XTIA 5A0FA 3VNUA 5TARA 2P2LA 4HLUA 4LZZA 1KDOA 2IS4A 2FPKA 3WMGA 2GJAA 4Q1EA 3PEYA 1ZUNB 3UIEA 5J40A 4PPNA 2IEYA 1N6NA 2XAUA 1XP8A 1KZ7B 3DEFA 3IILA 4DLRA 2AWNA 1XXHE 3VU9A 2H5EA 1T3LA 1XDBA 1H65A 1XTQA 3QG5A 2C77A 2A3RA 2XSZD 2ZR9A 3U4QB 1VYUA 2H7VA 3NH9A 1OXTA 2IYLD 2JIZD 4PC2A 1UDWA 4TQUS 2XTMA 4GL2A 1UPTA 2R6AA 3ND9A 2CHVA 4QKQA 5B30A 2C9YA 1BS1A 1XD9A 5IT5A 2PCLA 1DARA 1YZTA 3THWA 2QGNA 3SI7A 4NYIR 3CPHA 2IYWA 2O8FA 4LJ8A 1XCMA 1Z47A 1ZM2A 3HP1A 1CJVC 1TF7A 2OXCA 4DSNA 3ADDA 3TBKA 4HEJA 1GOTA 4OHZA 3OF5A 2XTNA 4Q9IA 4EKDA 3I8XA 5F3WB 4QL3A 1E2PA 1NKSA 4MGYR 4Q7MB 3RVBA 3OEHD 5L3VA 1E1QD 3I8SA 1G7SA 4B44A 4PSAA 5JI2E 3W3ZB 4V0ME 4C0BA 3U44B 2NO1A 3BH7A 3CX8A 4GZLA 3UANA 3U6KA 1MO4A 3Q85A 5F98A 3QEJA 1GAJA 2MMCA 1R5OA 3D8BA 3FKQA 3ZIAD 3UMRA 1XTRA 2OCPA 4KBFA 2ZI4A 2HXSA 5HZHA 4G5SA 2YWHA 1YU9A 2B7BA 5HCNA 4TL9A 2D7CA 1MRSA 2BJWA 1GG2A 1G4UR 1N0UA 1IJFA 1E9SA 4MYCA 3THYB 2BHRA 2D2FA 4N1AA 5AUNB 2F6RA 5G3ZA 3U4QA 4D2IA 4RD6A 4KU4A 1KO5A 2VHUA 5FTNA 1R8SA 1P2TA 3LV8A 4M1WA 2P5TB 4F93B 4IDNA 4BFSA 2XJ9A 1BYUA 1TUEA 2ZQ5A 2PBRA 4RD2A 1E6CA 3CWZA 4R9UC 1COWD 4Q4AA 5D3MB 2CCJA 1FZQA 2XZOA 1Z6AA 4UXHA 1KIMA 1JXOA 1VMAA 3B9QA 1T8UA 1W4BA 1N6IA 4MH0R 4ON9A 3UPUA 1UFQA 2YWFA 4P33A 2OM2A 3N2EA 3MG9A 1KZGB 4Q4JB 4M1YA 2QT0A 1E99A 2WAYA 4Q4HA 2VA8A 4LJ5A 3NC0C 1PJRA 1YR6A 2E9SA 3R9WA 1IAQA 2QA5A 3PJRA 1E79D 1UADA 3TW4A 2XXAA 4B6EA 4QG7A 1QHHB 4LV5B 2DWOA 1OB2A 3IHWA 4DLWA 4MDFA 5J4VA 1TU3A 2CJWA 4PQYA 5BN3A 1FNNA 4E22A 3K0FB 3C5CA 4KFRA 2WWHA 2QZ4A 3LH5A 5E7MA 3QKSB 2AN9A 4RY2A 1KI3A 3B1VA 5HTKA 1G5PA 4Q48A 1UEJA 1XNJA 3TAHA 3ADKA 3LDAA 4Q1AA 1R0ZA 1BMFD 2BCJQ 3VR4A 2OAQ1 5AK0A 4W5HA 3ZYCA 4OI2A 3U5ZB 1D2MA 4N0DA 1FX0B 3QPUA 3B82A 4MYUA 4A9AA 2B7CA 1CJMA 2Q3HA 4IDPA 2GK6A 4GOKA 3NBXX 2UVQA 4WZ6A 4TL8A 4X8LA 1SKYE 3AGPA 1W44A 1OHHD 3SJZA 1U8ZA 4HB2A 2VLIA 1E9BA 5CLLA 4OHYA 1W4AA 3MWYW 3SU8A 5KSZA 2ZE7A 4W5WA 2N1BA 2D06A 2TMKA 3B9PA 3RRNA 1YJ5A 3THXB 4GDFA 2AKYA 2SHKA 4IOKA 4PC1A 3MWJA 2ORIA 1E1RD 2QMOA 5GJWC 5D3MA 2EVWX 4PC3A 1N25A 1LY1A 3TAUA 1HUQA 2IYUA 3PUXA 3GLHB 1M7GA 3EPJA 1KI1A 3W5JA 2RGAA 2F7SA 4AYWA 1V43A 1EFTA 4UNSA 3QOFA 4NCJA 4XOIA 3GJ3A 3NHBA 1NY6A 4WZBE 2QSZA 5LBIA 2HXYA 4EPVA 4DLYA 2O8EB 4O2RA 1G64A 2F1RA 3BOSA 1S9DA 5F9FA 2FH5B 5LD2C 1E4VA 2QRZA 1QHHA 2C95A 1F2TB 1S4QA 4IHQA 5CM8B 1AS3A 1TEVA 3UKDA 4D4KA 1R5BA 1OSNA 4QFMA 3RS3A 3RRMA 5CDFE 3FPAA 3QF7A 5FOTA 1W2HA 3VHXA 1VIYA 2XJ4A 3QKUA 3P26A 4Q4LA 1BO6A 1E9AA 3T1TA 4FCTA 1DAHA 1SVWA 1VHLA 2FSIA 4Q7LA 4LHYA 3K9LA 2GDJA 2H17A 1L4YA 5BYKA 4Q1BA 1QF9A 3PEWA 4FWIB 2WJVA 1NN5A 3HU3A 5KYKA 2ANBA 3KTAB 2Z0MA 3IHLA 4LBWA 3TQCA 3LW7A 3OIYA 3V00A 3RYTC 3NH6A 5K8TA 1HTWA 1OJLA 2CHQA 2ZRFA 2DR3A 3UK6A 1DOAA 3EPKA 4F4CA 1W5SA 2QT1A 1AA9A 3TIFA 3VR2A 3AVTA 1EG7A 4ZDWA 3LVRE 1WQ1R 3WHLA 2GKSA 4PFSA 1KI9A 2F9LA 2ZI9A 3EX7C 1JPJA 1SKQA 2QPOA 4A6PA 3THXA 1KO7A 5ANRB 2ZUDA 3E1SA 3ZVLA 4V0LA 5JWHA 2YC4C 1I2DA 4BFUA 3I32A 2QL6A 2B8WA 4BZXA 4O0MA 1XJ0A 5EQTA 5UKDA 3FHTA 5JWOA 3A4MA 1LVGA 4DCTA 1E9DA 3VMFA 1G5RA 3LLMA 4BQSA 3HR7A 3TE6A 2CXXA 2NMVA 1ZIOA 2VRWA 4TYNA 2ZR0A 2R6DA 3U60B 4AY2A 4MUBA 2HF9A 3QJYA 1JB1A 1RRGA 4RZUA 4BUJA 4ZI3A 2F55A 1GKIA 4M22A 2WPDD 5AR1A 2P0EA 4PAMA 5IF9A 4PXAA 2WZQA 1U94A 1ZC3A 1NSTA 4OK5A 1A2BA 1XEXA 2PZEA 3MRSA 2QE7A 1DTSA 2XOKA 1NVXQ 2W6ID 1XWIA 2BBTA 4L5BA 4NCIA 1OFIA 2ZJYA 5KNCA 2ZI7A 3HDTA 3A1WA 3KTAA 1UBGA 1Z22A 2DHRA 1DO2A 3IBGA 4NCKA 1M1YE 2AFIE 2ZE6A 1OXSC 4LOAA 3KKNA 1OKKD 5FUWA 3LA6A 3K0AA 1FUUA 1QVRA 3U61B 3BFVA 4DUGA 1KI6A 4RFVA 1OYYA 5FR2A 1WF3A 1ZP6A 6Q21A 2Q6TA 3WNBA 3OEEA 2WWXA 4UXJA 1JEEA 1Q0UA 2R62A 3GJ5A 4B2PA 1G18A 2JJ1D 1KDTA 3N5CA 5EXSA 2GAOA 2ZJ5A 1U8AA 1G3QA 5JRZA 2Q3MA 1T91A 2DPXA 2V6IA 3VKGA 2B8TA 1RC8A 1GRQA 1XFAA 4RKFA 3CX7A 2ZITA 2IBMA 2IHYA 5JJIA 1X6VA 4D6PA 4JJKA 4MDEA 2WJJA 2O8BA 2A30A 4TLCA 2IHBA 5CJPA 4KYUA 4A8JA 1DAKA 4D0GA 3M4YA 2CK3A 4KFTA 1M7BA 3HR8A 3LBNA 1U9IA 1W48A 4JL6A 4IW3B 1GKUB 3L2OB 5LDDC 3SYKA 4K8OA 3QKRB 4B2LA 2GJKA 3BJIC 4IOJA 3S1AB 1SXJC 4DLTA 4CEIA 4URYR 4XVUA 5JS8A 1DO0A 1ZW6A 4IOMA 1NF3A 1VIAA 4BFWA 1X86B 5AWFC 3U3MA 3AVXA 1KDRA 1S96A 4IXNA 4DLZA 4DC9A 5EE3A 2A9KA 3C15C 1EFHA 2GCNA 1P4SA 2WVJA 4O25A 1PLJA 3QUSA 2L0XA 1Y63A 4KHZA 5DISB 3CNLA 4Z51A 2FU5C 1AGPA 1E2MA 1Q1QA 2C04A 4JLPA 2ZYWX 2ZRPA 1TEXA 3QVUA 1W4RA 4LX0A 4PSKA 1G291 5EXPA 4Y0VA 1E98A 3HJNA 4Q18A 2WJYA 3H0KA 3U2QA 4UKDA 4YDSA 4DDWA 1OH5A 3ZZ0A 1E0KA 3C7KA 2ZI6A 1KNQA 2CNWA 3OIWA 4IDQA 3GLFB 3KQKA 1G20E 1W49A 4Q1CA 3GLIB 1SXJB 1Z2AA 4GT1A 1G8PA 4QXAA 3CW2A 3DDCA 1GITA 1W36B 4WW0A 3LQRA 2ZU6A 5JCZA 4AYTA 5JZVA 4IXMA 4TL6A 1Z3IX 4BLQA 3NVAA 4B3DA 3EW9A 3FMOB 2HLDD 3BH6A 3QKTA 1HQYE 2ZJBA 2ZRCA 3FOZA 1RW4A 4FMDF 2RGDA 1B0UA 4N0EA 3TNFA 1II8B 1NMYA 4DBLC 3VFDA 1FW6A 2VP2A 4RVCA 4A1FA 1OXVA 5L8VA 2ZAMA 1M74A 4JYBA 3AF2A 2EU8A 3AQ4A 3BWDD 3MMPA 3EZ2A 3CF0A 4MUAA 1Z0DA 4MQBA 4UNRA 1ZIPA 1BKDR 4KLZA 2X19A 1WBDA 1P3JA 2FJUA 4QGHA 4XSGA 4A2WA 3GLGB 1EFCA 1HEIA 4LHVA 3CRW1 4ILEA 1QHXA 1KK2A 2CMKA 1XCPA 2GJSA 4IVPA 2ECKA 4JZKA 4BFTA 4NKRA 2ODEA 4NDZA 4P4UA 5J4HA 4HAUA 4AD8A 2ERXA 1C4OA 4YMVA 3T1OA 2QMHA 3WMEA 4DZZA 4HSEA 1U0JA 1XTKA 3I92A 5JFGA 4DLUA 3VKHA 4U5XA 4DIDA 3FMPB 1FMJA 2IC5A 1U81A 1DAMA 2B6HA 1AIPA 5EZ5A 2QY9A 3IO3A 4JJZA 2DFKB 4GPTA 1W0JA 4OQXA 4FCWA 5GVRA 1QHGA 2D3WA 4GNKA 3SR0A 2Z83A 2JJ2D 3GLIA 1ZINA 2GESA 5DSZA 4V0OA 4TZ6A 3TRFA 4LJ6A 2EWVA 1UJ2A 1S3SA 3D7MA 4KFSA 3RSLA 1CEEA 3GJ0A 2CCGA 3VNVA 4F4IA 3UMFA 4Q9HA 3VHLB 3Q5EA 3KB1A 1ZM4A 5EE1A 3GMTA 3ONWA 2Z4RA 4FMBB 4US0R 1X8LA 1Z83A 3OIUA 5K8UA 2GXAA 1KO4A 3IQWA 4IJMA 1MOZA 4LPKA 3WRXC 2BM1A 4OQLA 4XH9B 4PHGA 3IEVA 1VYVA 2CVFA 3EWAA 4EPRA 1O3YA 3Q5DA 3ZIAA 4CZ2A 3F3YA 3OHMA 3RRYA 2BKUA 3FWYA 3LBIA 3AP3A 3ZVNA 2AR7A 1YQTA 5H1YA 4QJ5A 5TVKA 2EFEB 2PMDA 1JPNA 4UNQA 3ICQB 3WNCA 1GP2A 1YRBA 4DSOA 3JZMA 3PQCA 4URXR 4EPTA 1KSHA 4AWXA 3A1UA 1IHUA 1XD2A 4U7DA 5FBLB 2OAP1 5IHPA 3ASZA 4HLUC 4HZIA 1AS0A 3N70A 3RC8A 3NBFA 1WRBA 1JR3A 2WIAA 3O47A 4WA7A 2QBYA 1CRPA 3B2EA 2NPFA 2AX4A 1NBMA 4TWZA 4TSFA 4LHZA 4X8HA 3NDPA 1DEKA 4DRZA 4WXPA 1UKYA 3TGPA 1LW7A 3QY0A 2JLXA 1W46A 2KBEA 2GNOA 4LBZA 4JBXA 4LUCA 1E2GA 2J7KA 4LYHA 3CZQA 5KTYA 3PIRA 1II0A 2HCJB 4URUR 4C9BA 2IF2A 2OZEA 3DMDA 3KB2A 2C78A 4B71A 5EJEA 4AI6A 3W8NA 1IXSB 4OYHA 2Q3FA 3PXGA 1U2RA 1VCNA 2J9RA 1NMXA 1E79A 2WICA 1CJUC 3CPJB 5JECA 3DOEA 4D4LA 4P4SA 5KNBA 1X1RA 3EC1A 4B3BA 2G77B 1KI4A 2J0UA 4DCSA 1Z28A 2ZM5A 2YWEA 3RS2A 2HT1A 3KKOA 4JBWA 2EW1A 3WBKA 2PH1A 5HR5A 4M9QA 1QZXA 2OEPA 2XGJA 1BMFA 2X8AA 2ZRDA 2WSSA 5AUQA 3IBYA 3AVOA 3VU9B 2ZROA 2PX3A 3EIEA 5JI3E 2ZU0C 4P31A 1SVSA 2GZAA 4HAWA 1U99A 5CIQA 2AWOA 4IDOA 4C0KA 5D3QA 1KMHA 2ZS8A 2VP0A 4UJ5A 4LJ4A 4UNPA 2FF7A 4V0KA 5TXGA 2VYFA 4E03A 3K9NA 2BBWA 4DIEA 1AQUA 1OHHA 1P6XA 4LJ7A 3R7WB 3D3QA 1VG0B 2HJVA 4BGDA 4TYWA 5FOSA 2WBLC 3GJ6A 1K5DA 3LAWA 3CONA 4CRWB 4WBSA 3THWB 4DSUA 1Z0JA 3KUDA 1KJYA 5AJVB 4A0FA 1DVRA 5E4FA 2R6FA 3FGNA 1JALA 3FKSD 4QNMA 2X77A 4V0NA 4XIGS 2W6JA 1KY2A 5DO9A 4MKIA 5BQ5A 5KPDA 4KJZA 1BOFA 2W58A 5AJWA 4EPWA 4YLGA 4RZ3A 4ZI2A 1LB1B 1G8YA 4NH0A 1RKBA 3SDZA 3ZGXA 1E2KA 1S9HA 4EQ6A 4XVRA 4M0LA 2H16A 5HCIA 2WWYA 1SVMA 1SZPA 4Z8YA 5CB6A 1P60A 1AZSC 1XJCA 2G0TA 2NG1A 1G7CA 4B3GA 1D9XA 3L0SA 2ZS7A 4PAOA 1E69A 1RYFA 1XX6A 4YC7A 4LBYA 1QHIA 4ABYA 2OXRA 4XD7A 3IIJA 5A4JA 3A4LA 3MJRA 3SE0A 4XWKA 1N6KA 2JLUA 1E2LA 3PFIA 2RGCA 4WXRA 1SVIA 4B43A 5FBRB 4D0NA 2OFWA 2PZFA 1N0WA 3MCAA 3TKLA 3P32A 4BRWA 4JSTA 1EESA 1E4YA 4E09A 1YR7A 1Q22A 1NP6A 5IK2D 4EPYA 4BZQA 3R8FA 2ZE5A 2YJTD 2ZPTX 1NVUQ 2IW3A 4JLDA 4KFUA 1CJTC 2A2ZA 4P4TA 4RD4A 4UNNA 2AD1A 3R7WA 1LS1A 5FUXA 5FBVB 4KVAA 1CR0A 2QAGB 2FPMA 3FVQA 4G5GA 3AKCA 4Q4AB 1L4UA 1CR2A 4GP7A 3RLFA 3QF4A 3ZD6A 1F5NA 5GJBA 1OFUX 3CKLA 1W7AA 3T1VA 1M34E 4DWJA 2C03A 1EWQA 5FI1B 4BWYA 1MO5A 1S0UA 1CS4C 2HEIA 5JLJA 1H8ED 3SHFA 3TLXA 3VX3A 1US8A 2ZS9A 4PZYA 4Q4HB 4URWR 3ZQ6A 2JGNA 4HLCA 5E7IA 3PVSA 3TK1A 2NZJA 1P61B 1HE1C 3C5HA 4P32A 4A2PA 4CVNA 2XXAB 5H70A 3PENA 3RNLA 3U7FB 4IDHA 4Q00A 2CJWB 3L43A 4OL0A 2OFXA 3CPEA 4R2HA 1KO8A 2ZEJA 2ZYVX 3CB4A 1TTTA 3ZDQA 2RGEA 1XTJA 2ZRGA 1L8QA 2HF8A 3CH4B 1NLYA 3BBPA 3GLHE 4MKHA 1V5WA 1FQKA 3U7GA 3AVQA 3ASYA 1SXJD 3QIAA 2CE7A 2BCGY 2Q9BA 2P6RA 2OLKA 4HUTA 4BLPA 2N42A 2F43A 2J45A 1T6NA 1GSIA 1G5TA 4DDVA 3B60A 1P9WA 2W6IA 4M1MA 3ND8A 2AD5A 4JLKA 4G01B 1FFHA 2J7PA 4OHXA 3AVPA 4HLQB 1GWNA 3BS4A 2J59A 3L82B 4B32A 2R9VA 4GP6A 5LB4A 1J8MF 3OAAA 1TQ6A 1A2KC 1SGWA 1QBKC 1G8GA 1ZJ6A 1TMKA 1T8TA 2IEZA 3QNUA 3C4JA 4UJ3A 2PEZA 4NL4H 1E0SA 4BEJA 3ZQJA 3CO5A 2QAGA 2ZRIA 3KZ1E 4QGGA 4QJ3A 3JVVA 2GRJA 2JJ1A 2FE4A 3L8YA 1H8HD 2LCFA 4Q9LA 4II7A 2IS1A 3C8UA 4GOJA 5FOVA 3WYGA 2O5VA 3KXIA 2WM9B 4LC1A 1IQPA 4PC7A 4JT4A 3KQHA 5DLQC 2H1LA 2VIIA 1NRJB 3CNOA 1WDTA 1ZD9A 2V7QD 5FL3A 1EFRA 5G41A 3VAAA 1T0JB 3SC3A 4HAVA 1P75A 3KJIA 1DADA 2ZJ2A 1OB5A 3VR1A 1G6HA 3QQ5A 2E1RA 3CBQA 2QAJA 2VHJA 1E2JA 1P2UA 2GBLA 5L3QA 5DYGA 3K0CA 2VHCA 1P2SA 1T9HA 2CL7X 3WRYC 4BFXA 1RRFA 1Q12A 1HYQA 1EWRA 4EFMA 4JLBA 3NDBB 2O0KA 4OI1A 3VX4A 4DLSA 2R6GA 1CRQA 3RS4A 1B23P 2GCPA 3ICEA 1MT0A 2XB2A 4E5UA 1TNDA 5J5CA 1F6BA 1UKZA 1IOZA 2AKAB 3WHKA 5EXXA 3DO6A 4XSHA 3PR1A 5KUTA 1A1VA 1KI2A 1IY0A 3TSOA 3ZD7A 4ZCLA 5HKKD 2WHXA 4P0TA 2ZRKA 1T3HA 1YKSA 4JMPA 5B64A 3AB3A 4QM7A 1YVDA 2WJGA 1KNXA 4MRRA 4Q9JA 1IN7A 4Z1MA 4ZO4A 4JL5A 1KK1A 3PUZA 1F2UA 4GRAA 1P73A 1SULA 2BC9A 1DAFA 2ATXA 4C0SA 521PA 2IYSA 2J3EA 4BEBA 2IK8A 4P3YA 3NEJA 3GJXC 1W4CA 3X1XA 1P5ZB 2QEQA 1A5TA 2E87A 3SN6A 1YZQA 3B7GA 5GADl 2BMJA 2G1KA 2ZYTX 3NIBA 3U3RA 3PG5A 3GCGA 1KYIA 3Q7PA 1U0LA 3CRQA 1II9A 4CGZA 2YINC 5FOUA 2O0HA 5FTMA 1G41A 2WMNB 4AYXA 4OQNA 2OHFA 4KO8A 2IYRA 2VP4A 1JJVA 3LY5A 2G1JA 1SHKA 3R20A 3A4NA 2VQSA 4JVSB 1OV4A 3EZ9A 2UZ3A 4PZZA 2QM8A 4BRUA 2IYTA 2BVNA 3LBHA 4OBEA 3OFNA 1VCOA 1XEXB 3CX6A 2XNDA 3C16C 3K53A 1C9KA 4CYMA 2Z5FA 3K09C 1XXHA 1G21E 4QHTA 2OG2A 3OE7A 4W7SA 1U9IC 4AIIA 4BFVA 3QBTA 1ZUHA 1BYIA 4MRPA 4QNRA 2W0MA 3AVWA 1FTNA 4JLNA 3MWLA 3K0AB 5B58C 4A15A 1KI6B 4F7WA 3DZ8A 1KKMA 1AGRA 4M1KA 4RKEA 8OHMA 4KI0A 1I2MA 2A5YB 4TZ0A 1FOEB 2GVDC 2C9OA 3SEAA 3M0EA 1Z0KA 2FSFA 3P4XA 4HAZA 4PTLA 5FPYA 3BB1A 2JJ8A 1Q1EA 2NO9A 3ZJYA 1TADA 1ZYUA 2F1IA 4R71A 1E9CA 4B2IA 2RCNA 2V1UA 1JECA 1D2NA 1QHYA 4ZV4A 2O8BB 3BE4A 4A8JB 1OF1A 2XEXA 1YZLA 4NTZA 3F0TA 1OIWA 2JLYA 2VO1A 1QVAA 4PHFA 1G17A 3GLFE 1OH7A 4ESHA 1K8RA 1SXJE 2G88A 4V0MA 4NYJR 5L3SA 5JBQA 3PUYA 4TTPA 1XD8A 2YZ2A 2GJ9A 1N6OA 4WVFA 1PUJA 4ZPXA 5FPTA 3RC3A 1G16A 4B35A 4F38A 4CEIB 4AKIA 1E2NA 2JLRA 2Z6VA 4O2LA 4TL7A 5B2ZA 3EC2A 4DJTA 2FDCA 4GSYA 2BM0A 2NQ2C 3KL4A 1XB2A 4D4MA 4YMTA 3LVQE 2VHTA 5CITA 2IS6A 5FI0B 1XU4A 2BMFA 3KUCA 3G5UA 1YRAA 2WWFA 1ZNWA 2VH5R 2ZI5A 2D74A 2WMOB 1G4AE 1KDPA 3JZAA 3REGA 2YV5A 5JSZA 4HB4A 1UBCA 1Z5ZA 1SKYB 3NG1A 5KDLA 3RS7A 4YMWA 4Q03A 3CRVA 4ZDJA 3W34A 2DFLA 2OBNA 4A82A 5KPJA 3GLGE 3QENA 1JI0A 2CHGA 2FNAA 1WCV1 1W0KA 1GM5A 4AC9A 4DB2A 2QNRA 3W5IA 1VKJA 4NBSA 3WY9A 2JASA 2WOOA 4JVLA 2QTFA 3WP1B 3QVVA 3EIHA 3KQLA 3SYLA 1YE8A 1VTKA 1VCMA 2IWHA 5KSYA 2GEVA 2RGNA 3J81k 2DCUA 3WMFA 3HYTA 3I5XA 2QUZA 2QQEA 5FBWB 5TY0A 3TSWA 4A0RA 2GXSA 1Q3TA 4MA4A 2D2EA 4FCVA 2A5JA 2OUKA 4PO1A 4I4LA 2DFTA 821PA 2FGJA 2IYVA 2XTZA 2CLCX 4LSGA 4XVQA 2F3RA 2PCJA 2OCAA 4HDOB 3SHWA 1IN6A 1ZNYA 1O87A 3LQQA 3VKWA 3PEVA 4Q47A 2CLSA 4PQRA 2KSQA 2J0QA 4EUNA 1NL3A 4KLNA 1J7KA 2EFGA 2UKDA 3IIMA 2AHOA 2VF8A 2IYZA 2R2AA 1W36C 1E9EA 4NYMR 4C0AC 3AGQA 1EFUA 4M9ZA 5K8IA 4TT3A 4CEJB 4LRWA 1AQYA 5FTLA 1GRNA 2QORA 3EARA 5HZKA 3X1DA 2IXEA 5CJ2A 4PHHA 5FL7D 2AK3A 2QMUA 3L0PA 3LXXA 4HZUA 1ZAKA 2HJGA 5J4KA 1QG4A 2CL6X 2MSCB 1M6NA 2I1VB 2O8DA 4R98A 2IX3A 4AURA 3FB4A 4BASA 4D4JA 4KODA 1W5TA 4QBHA 1NN3A 1KSGA 1OYWA 1XZQA 3LWNA 3MGCA 4QJ4A 5DN6A 5ELXA 4AKHA 2ZRAA 4ESVA 4G0NA 4G5QA 4MGIR 2EFDB 5CLQA 4LYJA 3FKSA 4D82A 4DT1B 2GF0A 1NVVQ 2C2HA 3CR7A 4GBMA 2BKEA 1HE8B 4QC2A 4ARZB 4NPHA 3R8CA 4GMXA 4EFLA 4TMZA 4RFSB 4WIAA 5JEEA 1MO6A 3RAPR 4IKEA 2XZPA 2Z4SA 1L7VC 3E2IA 2AXPA 1NIPA 3BIFA 4YDHB 2PX0A 5DYIA 4D0LB 1E2HA 2D4HA 3SFVA 2RGGA 1RFLA 1R0WA 3KQUA 1Z06A 1NJGA 4I1VA 1AKEA 5EE9A 4ASUD 4YXWA 1AJEA 4UXIA 3GP8A 3P20A 2ODBA 3H1TA 4C4PA 3UXMA 3A1TA 3DPUA 3KKPA 1CIPA 2A7QA 4LV8B 5CM9C 1T0HB 3X1YA 2ZRNA 1IN8A 4TMWA 4V03A 2G0NA 4ACAA 5E3HA 5CDFA 2O0JA 2ZUBA 1S1CA 5KDDA 2XSZA 4H1UA 1E2FA 4CEJA 2WSMA 4OHVA 1KI8A 2JIZA 2GXUA 3E70C 2QM7A 5IK2A 1N0VC 3KJHA 1VCIA 1XD2B 1ZU4A 2D62A 4NE2A 3Q8XB 2JDID 5F9HA 1NG9A 2QBYB 4HUQA 4JT2A 1R8QA 4B47A 1N3BA 3QE0A 1HURA 4GFDA 2V1XA 1OPXA 2ZSDA 3AF1A 3HU1A 1GZSA 3A37A 3ETLA 3DZDA 4LDJA 4OHWA 4TLEA 4D80A 3EIQA 4XTCS 3FE2A 4DT1A 2O8CA 1DG3A 5L3RA 2C9CA 4B75A 1TUIA 2Q0HA 2IUTA 4FN5A 4ARZA 1JQJC 1OE0A 3OEHA 4M53A 4KV9A 4RFSA 1E1QA 4DCUA 3AEZA 3HWSA 2IWRA 2EQBA 4L8GA 4OI0A 1Q57A 1NG1A 3PV0A 4P4SB 1G8HA 1U0HC 2RHMA 4CDGA 4DLXA 4C30A 2J0UB 2IXGA 3UMSA 3KXKA 1ZD8A 4LJAA 1D6JA 1IY2A 1SVOA 3K1JA 4B74A 2DWPA 4I99A 3MD0A 3N2IA 1GRRA 1U90A 2BMEA 1Z6GA 3JVUA 3FMIA 4QHSA 2NGRA 3CRRA 3F5FA 4LBVA 1KOFA 3DMNA 4Z8XA 3W8RA 1NVWQ 4OK6A 2H92A 1LNZA 1Q21A 4B48A 2ZSBA 2K5UA 4GMDA 1KGDA 2ZJ8A 3A58B 4JLOA 4V02A 2WV9A 2R6CA 3VQTA 2VEDA 4H9GA 1KK3A 1KMHB 3K70B 1XEWX 5EXTA 1FNMA 2QP9X 5G3YA 3W3AA 3CF6R 4M9XA 3UATA 4RD1A 3U7EB 2A5FA 3ZS9A 1DBSA 3BXZA 2AXNA 1WE2A 1FUKA 1OIVA 4A36A 3F8TA 5KSPA 4B33A 3PUWA 1FPMA 2PL3A 4IFBA 4PC6A 1G19A 3RS5A 3SBDA 1COWA 2LKCA 4C0QC 4BLRA 1I4DD 2VTKA 4PHTA 1XPOA 1VG1A 2IF0A 4BECA 5KHOC 3AKDA 1H8HA 3BB4A 2FSHA 1TPZA 4CF7A 2ZREA 3LO5A 4RD0A 4NMMA 1VDZA 2QI9C 3GEIA 2OESA 4E07A 3Q7QA 2H57A 3H4MA 4PO9A 1VG8A 2QE7D 4HB0A 2XOKD 1E94E 2RAPA 3LXRA 5IDVA 3ADCA 4BFZA 4KSBA 4QHYA 4EQ6B
chains in the Genus database with same CATH superfamily
1NI3A 2PGJA 1U8FO 1JDBB 1RXIA 3JQAA 3OFVA 2EIXA 3PHBE 3QXXA 4ALIA 1A9SA 3WWZA 4B76A 4EGAA 1KF0A 1QH9A 1BCRB 4WZAB 1SKMA 2GHIA 2HWYA 1NIJA 2P7IA 2UZIR 4RAOA 1QIJA 3JYHA 4BPRA 4XJSA 4FQ5A 4ZN6A 1CT9A 4IIXA 1K8QA 4DHEA 1C1HA 3PLNA 4NBKA 2WU0A 1OWOA 3BD9A 1MDFA 3LOUA 1U8EA 3VGPA 1U02A 3MWGA 2NW6A 2E4UA 5JAOA 1OGJA 4KPUA 2VP6A 4GI3A 3Q6IA 4G0YA 4Y7CA 1RIFA 2ZYUX 1TCVA 1VL5A 4X8MA 4L6AA 1PK8A 5EJGA 1KARA 5BV1A 2DC1A 3IR7A 1YB2A 1GNSA 2JA1A 1NW9B 3BRCA 3EE6A 3NIFB 5AOAA 5IJ9B 3OCVA 5B12A 3KVOA 2JRCA 5BY2A 4BGUA 1GKKA 2ZRLA 6PFKA 3EXIA 2FPGB 5EVJA 3ZE0B 1TM5E 1GUYA 4ISBA 1NBAA 4KDFA 4LI0A 5CG2A 1R6DA 5AW7A 1GO2A 2NOAA 4Z9FA 1WXIA 1XMJA 4K1XA 5TGDA 4RTRA 1WPQA 1C2TA 3EPLA 3KSAC 2DBVO 4G1UC 1EXDA 1S02A 5K3FB 3T12A 2OK7A 4F9FA 1CJCA 3G5LA 5KU1A 1G8FA 2G6BA 1Z5GA 4QPZA 1GU1A 1JWLA 1NUAA 1K68A 2BE7A 1NR1A 1JKXA 3AKEA 2JK0A 1E1RA 3AM3A 2QD3A 4HNSA 4X97A 2H2DA 3KQSA 2W00A 2G9VA 2OV6A 3I76A 5TF0A 1HMPA 5AQEA 1HFWA 1US8B 1ZSYA 2FEOA 4O4JA 4AT1A 1RNLA 3GEDA 3TSZA 3VPXA 3PF8A 1M2EA 1TIPA 1E3WA 4BFCA 2GVZC 2JHCA 2WNIA 1PGJA 4X85A 5TT1A 3IQIX 5I8WA 2NN3C 1REQA 4I8IA 3IPYA 1XEWY 5DBHX 4OP3A 1RJ9B 5ECGC 3SZGA 5AUOB 2OT3B 4UZFA 4O59O 3TEMA 2D5LA 1Z0IA 1LV7A 4N7BA 3ZHRA 1XK6A 3OLZA 5KCZA 4EFNA 3DOIA 1M67A 1IEQA 1P1CA 2YWGA 1I01A 1MHTA 2BMWA 4QXQA 2W2KB 2XY4A 3UJAA 2FP4A 5GJCA 4AP9A 3LT1A 4KAJA 3E53A 3ZW8A 1WXWA 3K2BA 1E1YA 1AK9A 1LTQA 3VUFA 4Y6SA 2QAIA 2QRMA 5ITZB 5F9MA 1ZN2A 4WEOA 4ZJZA 3I2YX 3SFTA 3AP1A 5A2QA 3HYRA 3U4MA 1YS4A 4Y6GB 3P97A 4GZ5A 2H3HA 1BXZA 1EIZA 1VLMA 1Y3CE 2FKAA 2MYUA 7REQA 1QLWA 2QJWA 3IKMB 4B85A 1W94A 1ILWA 1K66A 4G85A 4JKYA 1FYDA 4HDNB 4K7JA 1AZTA 4OVKA 4ZRDA 5MN6A 3UOAB 3KZVA 3UH1A 1PLKA 4G3XA 1DTWA 1D6SA 4EZEA 4URVR 3LHIA 1KDZA 3DDOA 3TD9A 3WLTA 3EOAI 3TW8B 1WTCA 3AH8A 4HQ0A 4XXHA 1WZEA 1MKYA 2MHCA 3LOPA 4KAXA 4R01A 5GV8A 4LJRA 2ZSEA 3M5PA 4KCGA 3W9UA 4YCBA 4L07A 3HXQA 1NXOA 4HGYA 3M5DA 2Z4TA 2WKPA 5T6BA 1W88A 4BNFA 3ZZUA 5JSFA 2NU9A 4Z4EA 2ZJ6A 4DKJA 1Q1ZA 2QTAA 3C14C 4EJSA 5I7EA 3R5TA 3ESXA 2QMEA 3WSTA 5F7OA 4RDXA 1DAIA 3CJQA 1IATA 4KG7A 4G5RA 1GCIA 2FGKA 3ECAA 5A05A 4UUOA 3EGCA 3Q8MA 1OX5A 2GXQA 4MI9A 4WJKB 3D4PA 2CMDA 1VXRA 3OZBA 1GGNA 2IT1A 4YRPA 3ITKA 5FOWA 3ZX4A 4JOSA 3DYBA 1TKAA 3HB5X 3SXUB 2R3SA 2WMDA 2PBFA 2X8JA 3UBMA 3TECE 1J0CA 4D3DA 1TQ2A 4X44A 4YJKA 1P1KA 1X80A 2I4OA 1EDEA 4F6CA 4P0PB 4F91B 1BS2A 5ALDA 1PZGA 4RCZA 3B9BA 2I4TA 1H2RS 2QPTA 3OIVA 1TTHA 1ZGZA 5JTUA 3IESA 2G1PA 1EWYA 1JAYA 1W0JD 3AYZB 4HRAA 4YAGA 1EZZA 3F6SA 1D6NA 4NG4A 5HFNA 3DXFA 1UFVA 3OJ0A 4LYFA 1P72A 1T5OA 3KKMA 4HMQA 1K4KA 4LHXA 4XVHA 2VXCA 3QA3E 4COKA 5LPNA 1W36D 2D0DA 2BEWB 4L4UA 2CJPA 2C2MA 1R6UA 3LYUA 1YIOA 3HDGA 1CX9B 2J9FB 1GL3A 2RB5A 5IZCC 3O83A 4E1AA 2I3BA 1JBKA 3PEUA 3TIVA 2B9EA 2V6GA 3B1XA 1HLFA 3NBZC 4ZZ3A 3NJ4A 5THKA 3MJCA 2ZTUA 5A0TA 3OJFA 3HTXA 3BORA 1ULHA 1TB4A 1ZBDA 1F2UB 1OA1A 5IYZF 5K0NA 1W5BA 3E82A 2IS2A 2ZWMA 5CH8A 3H11B 1TZ2A 3O4IA 1YR2A 1XMIA 4YROA 2OQIA 2P6PA 1L4MA 1QIMA 1RZUA 4JH0A 1TKCA 4TS1A 2YHSA 2GCEA 3L0OA 5AI8A 3MHPA 4DUZB 4Y1GA 1ONBA 3EULA 1VI6A 4QM6A 1P39A 2QP4A 3S28A 3O2NA 4RQBA 1XAGA 5EVCA 2ZP1A 1BGXT 4LAFA 2OA0A 2DECA 3TUIC 3TR5A 4FMCB 2BZ1A 3OQBA 1WL8A 2HJHA 4BNWA 3I62A 2VWPA 5D86A 1FX1A 1V8OA 2YRWA 4FGWA 2N75A 4JHLA 3I05A 5JZBA 3SJAA 4OUDA 3FFBA 4M1OA 5A9RA 4LY6A 1GKYA 3D3JA 1KPGA 4RCYA 1EVIA 1M54A 3S40A 1JR3D 2X9LA 2BRUC 3D6MA 3ZU3A 4DVGA 5F52A 3ICCA 3JQPA 3WGYA 2Y1LA 4OEHA 1NBMD 2FZ4A 4HF7A 3X1KA 4F92B 3T3GA 2PVSA 4TSFD 2ORED 1VHTA 1YZNA 3L79A 5D8DA 3EXAA 4BKPA 1GAEO 4P3PA 5C1IA 3FFAA 3CM0A 3HKEB 5EIEA 2A1TR 2ONKA 3OKPA 1WCXA 4CIDA 2G8NA 4ONEA 1K9SA 4CL2A 2FV8A 1DAEA 4MVJD 4ND2A 5ALHA 4HEA1 3DZIA 4FN4A 4QRHA 3TR0A 3HN2A 3BC1A 3FPCA 5JMTA 3B12A 3GD7A 3TQHA 5I7VA 3CUKA 5HKBA 1BOOA 2WDPA 5FL7A 5TIIA 5B4UA 1SEVA 1W8IA 2REBA 1Z6PA 3AJDA 3K9QO 3UT0A 4EY4A 1PWHA 4O0LA 2PA3A 4HSGA 3S1SA 4FIZA 2K6GA 3Q7TA 4B0OA 1P2DA 2VUUA 1NQTA 4Q01A 3K5HA 2AF4C 1YBFA 3N8GA 3P0FA 5GV7A 4N6NA 4IIFA 2JI6A 2CJYA 3BL5A 3N75A 1VMEA 4HTFA 1IJEA 2XZLA 4Q7EA 1V1MA 2FQQA 4TMXA 3O90A 4D3XA 5K8LA 4FDLA 2IHNA 3ROXA 3P9IA 1HV8A 1OFHA 3ETGA 4QYIB 2OO5C 2HF2A 3T7TA 4Z54A 1VZ3A 4CQNA 3PXDA 2PUCA 3SNHA 5B7NA 2Q99A 2ZRHA 1N92A 3ZBPA 3ZWPA 1SC1A 1GV0A 3CZPA 4ZIRA 4F60A 3IPAA 2CSXA 1XZPA 1GGMA 2C96A 5CLGA 4Z4FA 1Q84A 1QSGA 1FRVA 2AE2A 3HA5A 1JW9B 3B5JA 3DDHA 3P9YA 4ASUA 1HE5A 1Y5NA 2FWBA 2RGXA 3NO4A 4ZZIA 1RC0A 5JPDA 2H18A 1KJWA 3ECCA 3H5NA 3A9RA 1XVAA 1NLFA 1KO1A 4WNYA 1EK0A 1P9NA 5L3SB 4KYIB 1HDZA 3SF0A 4TTTS 2XYQA 4IQFA 2B61A 5ILGA 3ZWQA 2P3QA 1HOTA 4IIGA 3WB9A 5B7PA 1JKIA 5AKGA 4ZCSA 3TSCA 5JQGA 1JLLA 1F60A 3JTMA 2HOQA 5DNVA 4GH5A 4WESB 3D31A 4ZYVA 5BV8A 5BVGB 2NO7A 1YQWA 1C1YA 4KVZA 5E3IA 3ITDA 4S2UA 1GFIA 4GOXA 1JJBA 2CLMB 5L53A 3ZLJA 1AD2A 3UENA 4HNQA 4DWWA 3GPLA 1WB4A 3IJPA 3D3WB 4IDGA 3ZJ4A 1HDOA 4X60A 5I8ZA 3B36A 4FGLA 3KPUA 2AFRA 4E51A 3FRHA 3LFTA 3DBHA 1QG2A 3PHIA 4NQZA 4X54A 3BJEA 3FUUA 5K1ZA 4BC1A 4BCCA 4D9JA 1QF6A 1IBMB 3QKIA 3FLAA 1FU8A 4KACA 3CUEF 4FJ0A 1QV9A 4U2DA 1LFDB 2W11A 2DWUA 2HKIA 4FU0A 3VJMA 5B1EA 5AXCA 4BFYA 5L6LB 1MPXA 4G8CA 1SC4A 4U39A 3Q10A 3U3ZA 3K0FA 3QVOA 3O8LA 4PN7A 4DR6B 3LNCA 4EUHA 4GZ6A 4ME6A 3UYLA 3UWOA 2QS9A 1DBWA 5C18A 1R5NA 1X7YB 3UK0A 2A84A 5FEMA 3TNDA 3NVMB 4MVJM 3L02A 2OAEA 1D1SA 2P11A 4BWGA 621PA 3CSUA 3E9MA 3MTAA 4EUFA 4M1SA 4DHWA 2RFLA 1H05A 3U4CA 2EV9A 3AERA 2B1GA 2V6BA 3KCQA 3ORHA 2XWJI 2QHXA 1ZMXA 3OCUA 2OENG 2Y0CA 2IDKA 4LGMA 4P4GA 2DX7A 2Q9UA 1PVDA 4IG9A 4AKSA 5JW6A 4JJAA 1RYHA 4ARVA 4EY5A 4L9WA 3C41J 1IK4A 1LSSA 4YRFA 3QBDA 4CLEA 3W6NA 2DKFA 3V4FA 2R86A 1FLNA 2JFXA 4KQGA 3INNA 4BXOA 3HG7A 3OMXA 1H6DA 1FQJA 3GXOA 3UK1A 1GLNA 2W2XA 1H5UA 2D8MA 4FDMA 2CMFA 4ZPJA 4B3XA 4B84A 2IZ5A 3EX7C 2RHBA 4JKIA 2HMTA 3E5MA 1NXPA 5A7FA 1YHNA 2YL2A 1PWZA 4BB0A 2JJQA 2Y2VA 4DR2B 4DUYB 1Z75A 4N47A 3IVCA 4WJZA 1PL6A 1ZSNA 3L8GA 5IC4A 1CUGA 2Q2OA 1NVDA 4J2OA 1LJLA 1E5QA 1PR6A 1X7WB 1ZN9A 1I4TD 1ZM3A 1UEIA 2Y6VA 2ID9A 2H4HA 1O1YA 4IJWA 4M7WA 1RWOA 3P5SA 1JDPA 2HT6A 1YZUA 3DE2X 4X63A 5AQ1A 3FCEA 4KQ1A 4PZLA 3A36A 3Q3JB 3KAKA 2O8EA 4OFZA 1EJ2A 2EYQA 4RH3A 1YSCA 1V2GA 2VSOA 2P2ZA 1F2TA 2OBLA 4I3HA 2ORWA 1MJGA 3FR7A 2IEIA 1L4EA 1Y8QB 1KRXA 3SQWA 3G8AA 5I3ZA 2GAAA 4C7OA 5CCEA 2EGUA 3ZR4B 3MRXA 4CT5A 3LX8A 2A78A 1YIDA 3CR8A 1PNRA 1NU6A 3PUVA 5I4BA 3FRIA 2ASEA 3CZ4A 1J39A 4GR5A 2XT6A 1YULA 4IILA 1CP3A 2WT4A 1CDZA 3R3WA 3QUBA 3EZ6A 3GBPA 4JWKA 4R40A 4YIKA 1JR3E 1FFBA 3GJ8A 1Z5UA 3TSAA 3IE0A 1Q83A 1NBME 4EY7A 5D5QA 5TQVA 4BLSA 1EFDN 4E4TA 2FRVA 2J5RA 4YRJA 3BVPA 3PCRB 4HDAA 4DA7A 3MUOA 3E1KA 4RZSA 1Z0AA 1ULSA 1B43A 2CNNA 2Y4OA 3EGDB 4QYSA 2VDKB 3WL7A 2BM9A 2LV8A 4XARA 5KOHB 1UDXA 2QUBA 4IDDA 1JG6A 1O4VA 2O7NA 4NFHA 3RVSA 4E46A 5EKXA 4BVLA 1GG9A 1RI4A 3JALB 3PGJA 4ILKA 1XG5A 2CB9A 2OHOA 3HN6A 5H9WA 2PT7A 3KSBC 4O2AB 1O96A 5FNVF 3DP7A 2LGJA 3FPLA 1IUOA 3BFKA 3V7NA 3SQOA 1GCOA 1G5QA 1U2GA 2XUFA 3V6LA 5DNDA 4MITA 4MKFA 4GPBA 3LF1A 1ODIA 4MV1A 1I0IA 2VP3A 1SCNE 2YJZA 3I1JA 3Q5GA 4RMNA 5MGNA 1T3SA 4QBGB 5FBZA 4BDSA 4NYJQ 3VR5A 2ZANA 1GV1A 1X3SA 2H06A 2PN1A 5HP4A 1N6PA 4L8WB 2V3CC 4DSTA 2DZDA 2VZ0A 3PJEA 1RMTA 1DJMA 2OGTA 4MDYA 2QRNA 3TM5A 3QEAZ 1XHLA 4UBKA 4LG1A 1FIUA 4IQ8A 4FDUA 2FMXA 3F73A 1IBLB 1RHKA 1FSZA 1X94A 4RYLA 4W8HA 3SHOA 3JZIA 3EHDA 4X1KB 3SNKA 3TRJA 1UBOS 3CINA 3COYA 3DNPA 3WLFA 4PPQA 3WYNA 1VRWA 4YUWA 5C3UA 2PGOA 3WBJA 4CQMA 1WA5A 4ZKEA 1PJ2A 5BWCA 2QN6A 4UVGA 2C3UA 1CVIA 4RKWA 1D7OA 3RYHA 3E5NA 1V16A 1X9GA 3E9DA 1RVDA 3ENWA 3QITA 4QJIA 1JNYA 5CPBA 1U7HA 3RS0A 2DFNA 2RK4A 3EAGA 2ZWAA 4GEGA 1OWNA 4IV0A 3CN7A 3W4IA 5FQOA 1MVOA 3BRWD 3L8ZA 2EZUA 2HIGA 2Z2IA 5DKFA 4L9AA 3TB6A 4B3HA 2J3JA 4JBLA 5T8KC 3QVTA 5IS2A 2IZ1A 3IP8A 2X4DA 5JXJA 9LDBA 4AS1A 2Q1YA 4R31A 4EEKA 2Y77A 1C4WA 2WA2A 3GX1A 3NGXA 3IA2A 2Z2YA 1E96A 1Q20A 4YACA 2A1UB 2C8JA 4M9SA 4ZI7F 3WKCA 3NS7A 2WU8A 3MWKA 3S68A 2PT5A 3OURA 1XRPA 1SIUA 3ZV6A 3BGDA 4LDRA 5IASA 5KSOA 4LGYA 1N6RA 3WLMA 5IT4A 1G60A 1ECGA 1Q6ZA 1QOPB 4IPTA 1RPNA 4MW2A 4R8VA 1R6BX 1RRVA 3F4LA 4O1MA 4WZAE 3R9XA 1Z2NX 4H0CA 1ID1A 3NTUA 4G84A 2MSWA 3DBOB 3CVOA 2VKQA 4NCHA 1C8KA 4XWTA 2R6R1 4JGBA 4LTMA 4XM0A 1G21A 1CEXA 4KNVA 4BHTA 2CVPA 1E6KA 1SZDA 1ZITA 1INLA 5CYOA 3CLTC 5HJEA 4FOLA 1YGPA 1X3LA 4QJBA 3VH4A 2EC5A 3G59A 2AFIB 5AVJA 3UT5A 1PK7A 1T8WA 3CNNA 4IKOA 1QB8A 1GDDA 3R5JA 2VHYA 1L2TA 4H0FA 1NZDA 2PL1A 2Q1TA 1UL1X 4RX1A 2F3QA 1JVNA 4NYMQ 4F4HA 4X8OA 1PTJA 3CGGA 3Q4GA 4AK9A 4OHCA 1SKAA 5KYXB 2NUTA 1VPLA 1H8EA 4KGXA 1UH5A 1J8FA 1I2AA 3HDVA 4BMCA 4RSRA 5ITSA 2CV1A 4YAOA 2N46A 2GPTA 4G0PA 2P30A 1GSHA 2MDTA 3KYDB 1OGYA 1E9RA 2V9PA 5KOYA 4CM8A 2Y1OA 2W9XA 3NKVA 2V6FA 4FSXA 2ZIFA 5CPFA 1DQSA 2VHWA 4IFEA 5IAGA 2H8KA 1UZAA 4UAVA 2G5CA 4Q34A 2IUYA 2IIBA 1QX4A 3VH1A 3HFJA 1UBLS 5DH9A 3MERA 2KI5A 1N2JA 3L4BA 3DOFA 3NFYA 1DCMA 1C9EA 2I54A 4WCFC 1VSVA 4K40A 4CT4B 3C1UA 1JDJA 1TCBA 3R3HA 4M6WB 2FWPA 4P38A 3VMMA 5K3OA 1DZ3A 3GPCA 4FIDA 1P77A 2PSFA 4CBVA 4EGJA 1WSWA 1XVIA 2G83A 5JMWA 1NKVA 2J30A 4BN5A 2CD9A 2PAFA 2XKJE 3THOA 4U00A 4C76A 3GF4A 3IP7A 4BTEA 3P2OA 1YQXA 3DF9A 2P41A 3I6IA 4RZ2A 3HN7A 4W6ZA 1ETHA 4DIUA 3GQBB 2IYAA 5CLHA 5AJXA 2JLWA 1M2JA 1Q7CA 3HB4X 3UVEA 2GCOB 4ER6A 4M4SA 1H9CA 4GKKB 1TTPB 2GJ8A 4YGYA 3GRKA 5LYJF 3I37X 4P0QB 1WG8A 1ZNXA 3IT0A 1TZMA 2XE6A 1ODCA 4Q3AA 2AW5A 2FUEA 4KREA 2QXUA 1IBSA 3BJZA 4ABTA 5FO1A 2R60A 1T25A 4HWRA 4PZ0A 5CIWA 3T1QA 3EGEA 3TRIA 1CJKC 3K30A 4BMOB 1XTTA 4J6EA 1XMOB 2VF2A 5ALEA 1XTSA 3DS8A 3L8HA 1NMZA 4EP1A 1SA0A 4YP5A 1CERA 4OQMA 3B52X 4LRYA 3KFLA 2DPGA 1GNRA 1G20B 3NXSA 4F5WA 3ZVRA 1FP6A 1ADJA 1M76A 2CNOA 2C3PA 2XNSA 3CKMA 1X7DA 3ENVA 3LQ2A 1Q3KA 4FFBA 2V7QA 3KKEA 1QO0A 4QTYA 3TLCA 3ZGNA 1DEOA 1N2EA 4DN6A 4O0MA 4DL9A 1UIRA 5JXHA 1A7JA 4FGSA 4EJFA 1LBEA 3DTVA 1C1DB 5C34B 4G65A 1ESEA 1AKTA 3PUKA 3W6ZA 4Q3DA 1O6GA 4W5JA 2QKYA 4MHSA 4O33A 2FOXA 4K5QA 3RJTA 3G7UA 1ZH2A 3QV1A 5FJJA 2REOA 3K2IA 3WDKA 5CEEA 2WHEA 2CFTA 4WFKA 3IJ5A 1X1SA 3AUXA 4O4LF 1LTKA 4FC7A 3PNQA 1N4AA 3R76A 1RXEA 2ODNA 1OAOC 2FDXA 1LX6A 4D4IA 2WSIA 1M5TA 2WJIA 1KSFX 2BMDA 1UP4A 4H3KB 5AO9A 2P67A 4TV9F 1VBMA 2R1UA 2JB9A 4QQKA 4OM8A 3WAJA 3S2EA 1EVEA 1ZMTA 1WPXA 2XITA 5PGMA 3LX5A 1ISFA 2FR8C 2VJBA 5HBGA 4LFBB 2HF7A 3WYBA 4MRVA 4W99A 1SVUA 1LCIA 3E9ZA 3MRVA 1UAYA 2PT9A 2Z5LA 3EAQA 1CY1A 2YBDA 2BWJA 3OU6A 5CK4A 4WINA 3LUCA 3U9SA 1W87A 4LDZA 1KAGA 3CEJA 2DH5A 2QYTA 3E0XA 3QWHA 4G81A 4DM4A 5AJZA 3GPBA 2BT4A 2F62A 2OMKA 3GAZA 2CBZA 4QATA 3RWOA 6ABPA 4GGMX 2REXB 3DL0A 3QIVA 4OOFA 2W8ZA 4MS4A 3FMGA 3TL2A 1N5LA 2PD6A 4E1BA 2NLOA 3H0CA 3HJAA 1GAQA 1JI3A 2YMLA 4BATA 4XTRA 3BWMA 1M10A 4GXNA 3DE3X 1SUFA 4JT9A 2RDMA 3NJRA 3H9EO 3QY9A 5HRUA 5D6OA 4WKCA 1RKUA 2YWJA 1UM8A 1Z0SA 4HFJA 1MV5A 4OH7A 3KWFA 4ZO8A 3RBXA 5KS2A 3AWDA 1YAJA 4J0CA 1OLXB 2OCGA 4PCLA 1NURA 3BGWA 3RSGA 4MS1A 3LXUX 3FGOA 1UWKA 2CBXA 4S1WA 2YN4A 3IE2A 3CLKA 5CBPB 1J8YF 5E2BA 5AW3A 5B1SA 3KHUA 3DMRA 2PGDA 3OLCX 5LMNB 4FFWA 1PV4A 4M0EA 3J81A 2EATA 2ZTSA 3MELA 1I4LD 1FNCA 1IN5A 2OHIA 3RUIA 4TV8A 2ZYIA 4BNDA 1YVPA 3C97A 1LC3A 4ZJUA 4LK2A 3OPYB 5DN6D 2CLDX 7ABPA 4ZEXA 2VSYA 5K6AC 3CRMA 1DAGA 2P90A 3RWBA 1UXIA 3DQPA 3GFOA 3HUFA 2VYVD 2XQJA 2YS6A 1IHOA 1D5CA 3IP6A 5FT9A 3WGLA 3UG6A 1JLRA 2OHXA 1LBTA 1U8UA 3OZ7A 2PLFA 1K8YB 1U1EA 4QARA 4WVLA 4ZAGA 1Q1AA 1T9GR 2CFCA 3EBLA 5JFOA 1PUIA 3VSDA 2O1WA 1HSOA 1IONA 4H7FA 1KAOA 3PHHA 3VTKA 1KK0A 1W1WA 2VJAA 1UODA 4HAYA 4M8LA 2EZTA 4KSCA 2PRKA 2V8OA 5KZMB 3R75A 2CUKA 1SOAA 2G09A 2NWQA 2RCYA 4G0WA 5K3EA 5KYWA 2YXDA 5J58A 3QVSA 1JHPA 1ZD1A 3HKCA 3O8DA 2HWXA 1M8PA 3M89A 3R3JA 5ALIA 5SYMA 4B6PA 4EMTA 3FVVA 1M7HA 4YONB 5A0FA 3S99A 5G4KA 4B3RB 1XTIA 1EVQA 4HLUA 4YQYA 5F7ZA 3DVRX 4NLLA 3PI6A 4O4IF 3UIEA 2YHIB 1ZH8A 4PPNA 5CFOA 2W2OA 1CUYA 1N6NA 4OHMA 2XAUA 5A4KA 1KZ7B 3DEFA 3S2SA 3VZBA 2AWNA 3H8SA 1V6SA 2H5EA 3ULKA 3C43A 4FFDA 3C3WA 5AVOA 1XTQA 1GQFA 3JQBA 1EI9A 4AWBA 1ZGJA 4MZXA 2JBAB 2WJ6A 3NH9A 1TCUA 2IYLD 4OCZA 1L3CA 3WS7A 1I1OA 1SO8A 1E7MA 2FZVA 1R3DA 4KPGA 5C52B 3UMBA 3HV0A 1RM5A 3SF8B 3D8SA 1UPTA 2DSNA 3TJRA 5GZ6A 4EA9A 2G71A 3GLUA 4ENVA 5DXAA 2V9CA 3E7WA 4QKQA 3KPJA 2PWYA 2G9UA 3ESAA 4CDNA 2C9YA 4H31A 5FTWA 3LQKA 3FYSA 1X7GA 3MBIA 3MTIA 4JDUA 4PLGA 2W71A 4OU5A 5JLAA 3TQTA 4BNLA 5JSKA 1YZTA 2QGNA 1W5AA 3JQGB 4FONA 1H0SA 3CGWA 4WQMA 3TQIA 3CPHA 1VE7A 2O8FA 1ZGCA 2WUFA 5K4HA 1CJVC 4R1PA 3GFQA 3S55A 3ZPXA 4EKDA 2XTNA 2FSSA 4Q9IA 2FW9A 3I8XA 1KFBB 5F3WB 2V58A 1NKSA 3D54D 3OTGA 3TQRA 5ER9A 3VPHA 4Q7MB 3RVBA 3W3AH 2FPIA 3B5IA 3HGTA 4YEDA 4EQZA 1G7SA 3SZUA 4KGZA 3KVRA 4IICA 4EBFA 3A32A 2HMAA 4GI5A 3U44B 5JPCA 3DFZA 3EUAA 3E22A 2JBHA 4G2TA 3V3TA 4YY3B 1X87A 2GFQA 2WILA 1YQQA 2RONA 1Q15A 2C54A 3BQ9A 1T26A 3HKBB 1QPZA 3R3YA 2B35A 4NPAA 5KYUB 3DEHA 4ARIA 1SBNE 2F59A 1OROA 2NPOA 5IP5A 3NMUF 2GN2A 3QEJA 3L7IA 1GAJA 2MMCA 2Q5CA 3P19A 4CN8A 3ZDAA 4IJUA 2NO5A 4ZVSA 1JDVA 3PQ2A 2BEVA 1C0LA 3T1YB 2ZI4A 5HZHA 2I71A 3DV9A 4QU0A 5HCNA 2IXAA 1W6RA 4IRMA 4TL9A 4UUNA 3VJLA 4RACA 3ZIUA 3USZA 1W85B 1JF8A 4GR4A 1QK4A 1IJFA 1E9SA 2YDXA 4R0VA 3FSEA 2H4WA 2BHRA 3FFXA 3KP1A 1KMMA 3EUWA 2D8AA 4RD6A 4CM6A 1STOA 3PQ6A 4KU4A 1IBKB 1C3OA 2X13A 3C6MA 2Q29A 3MK31 1WXXA 1I51A 4G5FA 5GMOA 3S70A 1FDUA 3G0OA 3VKUA 5L95A 1P74A 4F93B 3ML1A 5FBKA 1PFWA 2XJ9A 1TUEA 2Q0SA 3ABSB 4U2GA 5HG0A 1MBZA 5JADA 3CWZA 4ZT5A 3C3MA 4MAAA 5LDHA 1COWD 1QUEA 5AW6A 3CR3C 3R3SA 2XZOA 3HYNA 3NHYA 4ND8B 3GNQA 4UXHA 3KJXA 4R9RA 1JXOA 4MH0R 1W4BA 2PZAA 3AI3A 4R1UA 4X3OA 5TQ0A 5BVHB 4G1BA 5IHXA 2KS6A 1UZNA 3U31A 2E48A 3I28A 4P33A 3OU7A 2HDHA 3N2EA 5EJEA 5HKAA 1VE5A 5T4FA 1PJ4A 2X0IA 2QVZX 3NC4A 4LJ5A 3NC0C 2M6KA 4EJ0A 3O91A 1SUIA 3LE8A 4I9NA 2XW6A 1BE6A 2ZGVA 3KLBA 3PPYA 4V0RA 1YR6A 3NM4A 2P4EA 2PKQP 4Y2JA 4YAFA 5CNJA 1U28A 2QA5A 3PICA 3RIXA 1UADA 3S2IA 5JANA 3V8NA 1LBIA 1GFWA 4E13A 4HDSA 2ZWOA 2PXXA 4KIWA 3ONEA 4B87A 7GPBA 4DXDA 2B34A 2RK3A 1JQ3A 1LXCA 4ZOCA 2P62A 4I3FA 3LG2A 3DFMA 4KFRA 5DFAA 5K6TA 1V25A 2AN9A 2HZ7A 1F6WA 3HP4A 2SECE 5EFZA 1NR5A 2WWVD 3HHEA 1G5PA 4FEAA 4Q48A 4S12A 5IJZA 4Z2AA 3LPAA 3TAHA 3ADKA 2CNLA 2OCLA 3LBFA 3COZA 1BJKA 3ZYCA 3PC2A 1ZH4A 3H9JA 1X1EA 5IABA 2P9ZA 1OAAA 2R87A 1XT6A 1QBGA 2CXQA 1U5BA 4G07A 4IO1A 3VYTB 3JD3A 3HLKA 2WFLB 2RHWA 4MYUA 4A9AA 1MX3A 4TKMA 3VHQA 3FA2A 3WWYA 3RYIB 3HA2A 4GOKA 4A23A 3H5RA 3N87A 4IDAA 4X8LA 4J94A 2VNHA 3KETA 1W44A 1OHHD 5K0LA 3K96A 4HB2A 1RMYA 2FI1A 2JGAA 1HDXA 3NI2A 2AE1A 1LPAB 4K86A 5GONF 2KQUA 3HY4A 3E9QA 4OHYA 4Q0MA 1SD1A 4GDFA 3ES9A 2CDAA 4L9RA 1SBTA 3TOZA 3CG0A 2CHFA 2X0RA 3MWJA 4BRSA 3TLZA 2X42A 2HIHA 2QMOA 1MC5A 2CF5A 5D3MA 4PC3A 3KOUA 1HUQA 3TAXA 3X44A 2DKNA 1M7GA 1F2VA 3EPJA 3QPCA 2JHPA 2VNJA 2YQ4A 1Z4KA 1V43A 3L9WA 4NCJA 3IMGA 4X90A 1IFXA 1E3SA 4XOIA 3ECSA 4YJHA 3QFFA 2J5BA 3QE9Y 2VTVA 4X64B 1NQ5A 4JROA 2QSZA 3OM0A 3JS5A 1LV8A 3PTZA 5JYBA 2A57A 5KQSA 1WY5A 1EFKA 1QV7A 1RYMA 3USES 1YTUA 2IVFA 1OBVA 4DLYA 2JAOA 2G07A 2FWMX 1VLZA 1G64A 2F1RA 1AT1A 4RMJA 4BV8A 2FH5B 5LD2C 1ZMOA 2AFHB 1O0CA 1X0VA 2PXAA 4OIFA 3DCJA 5I01A 4N65A 4YPFA 5CG1A 1MX9A 1JXQA 1R5BA 4AJHA 1J23A 1NWHA 2F48A 3ZOKA 5FOTA 5CDFE 1TECE 5HMMA 1XUOA 3VHXA 5AESA 3BMQB 5LZ7A 4FLMA 5KYYB 4QXOA 3DDUA 1LC0A 1BO6A 3COSA 5IDQA 4IY1A 1BW9B 2C2BA 4LHYA 1V9LA 3NPAA 1N8KA 4ZYUA 1L4YA 3A06A 4Q1BA 1E3EA 1NQUA 1TM1E 1U2PA 2BMVA 2E5LB 1G0NA 2A67A 2YCBA 5E9QA 2XIQA 3KPWA 3KTAB 1NATA 2VZLA 2Z0MA 1UANA 4XWGA 3DE5X 1PDVA 3T7JA 3FJYA 4MQ6A 1NVGA 3NH6A 3STTA 3SIWA 1DX4A 1Y9EA 2WIFA 2RKWA 2PWBA 2CHQA 2ZRFA 5FOQA 3LT5A 5IJWA 2XDAA 4JJEA 1FXWF 3RYFB 4NMLA 3V1TC 2G25A 1AA9A 5JUWA 3TIFA 3VR2A 4JDPA 4PYKA 1EG7A 4UTPA 2GKSA 2YX1A 2F9LA 2ZI9A 1SKQA 1PG0A 3ZKWB 1A9OA 1KO7A 5ANRB 5CB4F 3THXA 2AF3C 2ZUDA 5AOVA 3H4VA 1WHSB 3KOMA 1F14A 1SKBA 5JWHA 4EHFA 3ER8A 3EJ6A 1JG4A 3G0DA 4BFUA 2GK4A 1N1EA 3M49A 4O8CA 4Z9XA 3W5AA 2UUCB 4GNRA 3GIDA 4FYIA 5EQTA 5UKDA 5AHOA 2WYVA 2XWSA 3A4VA 3RFTA 3TLAA 1QJ4A 2XDYA 4BQQA 1PZFA 1VQ1A 1YZFA 2QLBA 3V2UA 2HK9A 4UQLA 2FZ5A 1GKLA 1DV2A 3VMFA 1G5RA 4XYBA 2MCFA 2FR0A 3JV7A 1K6XA 3BA1A 4X1IB 4TYNA 2R6DA 3FF4A 1ECJA 1TLLA 2YMMA 4MUBA 5HXAA 1DC4A 1MAVA 1A95A 2VQ6A 1QTRA 1ZONA 2MINB 2V7TA 2YJGA 4O2BA 3CSSA 2PMCA 3T5BA 1K27A 3UAGA 2WZQA 1U94A 3PWKA 5DULA 1Q14A 4ICIA 1JG7A 2EQAA 4YCLA 1A2BA 1XEXA 2XMZA 4AJ9A 3MRSA 2VATA 1DTSA 1EK5A 1NVXQ 1YBAA 5BT9A 4ZQFA 3BREA 4RIHA 3S7TA 4DNFA 3LQ1A 1OFIA 1JSXA 3EK2A 2B69A 2BTEA 4BIMA 5KNCA 3TG8A 4RZIA 2IV2X 1CRZA 2YJ3A 1YQEA 1W4ZA 1DO2A 3FUXA 3IBGA 1I94B 3FSGD 2AFIE 3R09A 1B14A 4M1QA 3RFCA 3DNMA 2SKEA 3JQFC 6YASA 1FFYA 5KQPA 3FH0A 1FUUA 2YTZA 3U61B 3KPYA 3BFVA 4QSHA 1UZLA 1E5XA 2GPBA 2ZJ7A 3PVCA 4LDPA 4RFVA 3WFJA 1XO1A 4OYRA 1R4MA 3OZVA 1WF3A 2ZWPA 4JFRA 4PYQA 4AJOA 1IJKA 1DTEA 3WNBA 3ZHUA 5CH3A 5G0WA 1RXUA 4Z5XA 3JWIA 5IJ0A 1Q0UA 4AF6A 2R62A 2R8YA 4GM4A 2ZJ5A 3EMBA 1R0BA 1KP3A 3QHAA 2HMSA 1BDJA 1XFAA 3AU8A 4JP8A 5JXIA 2C92A 3RJ9A 1G2OA 2ZITA 4LMRA 1A77A 2VRNA 2IHYA 1WPRA 3S2FA 3WKAA 1AG9A 4B7CA 4IIJF 1OGIA 2RG7A 4D6PA 2PO5A 5J2TF 1EB8A 2O3JA 1RM3A 4KYUA 4KFTA 4XA8A 1VI5A 1U9IA 1ORTA 3G8BA 4KQMA 3FYUB 4TVOA 3UUEA 1W48A 5AW2A 1HWYA 2LBPA 3H8WA 1M6YA 1P4RA 2J3DA 3TPZA 5JARA 3DAPA 4LZOA 2I7TA 4TVKA 2P6OA 5EA2A 4E2WA 5LDDC 3SIRA 3ZDXB 2HCFA 3NWBA 1UC9A 3DL7A 4KSYA 4AECA 4TN5A 3TWOA 2W6NA 2A7XA 1WSDA 4AF7A 1P1RA 3GH1A 2VDJA 4HQ6A 5AVTA 2DQZA 5AM4A 5JS8A 2EX1A 1ZW6A 4HL6A 3U1TA 1AMNA 4DMKA 2WE7A 3I4FA 1IIRA 2GN0A 4BFWA 3QFCA 1GQOA 4RTQA 2BM8A 1YRHA 3T38A 3C15C 3EDMA 5AM0A 1ZN8A 1JDZA 4WACA 4DS3A 4H1WA 1L8XA 4DW8A 2J9XB 4OF4A 2OBFA 3K9CA 4Z51A 1VJCA 1QZZA 1UEXC 1AGPA 1QX3A 2GD6A 1CDEA 3BMNA 3P94A 5LBUA 4AJ4A 5BQXA 1QKKA 3QVUA 3F97A 1W4RA 1Y1TA 2AX3A 4GZ3A 4X00A 1M8FA 3IBFA 4PSKA 3HGQA 1G291 1NQVA 2E2WA 3K8ZA 2V98A 4Q18A 1YCGA 2WJYA 3CF4G 1B42A 3WL3A 3IQGX 1EVJA 4LKOA 1E0KA 2HO4A 2R84A 2ZI6A 3OIWA 1MGOA 1P8JA 3OPYI 4RF4A 1G20E 1K89A 1N7GA 1W49A 5ES3A 1Z2AA 2LRHA 3SR0A 5JRZA 1P7YA 2HU7A 2R751 3V33A 2B98A 1QM5A 1E8DA 4ERXA 2CNDA 3JYOA 3TQQA 4KQ6A