3MPOA

The crystal structure of a hydrolase from lactobacillus brevis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
262
structure length
240
Chain Sequence
IKLIAIDIAQATIDAVQAAKAQGIKVVLCTGRPLTGVQPYLDAMDIDGDDQYAITFNGSVAQTISGKVLTNHSLTYEDYIDLEAWARKVRAHFQIETPDYIYTANKDISAYTIAESYLVRMLIQYREVSETPRDLTISKAMFVDYPQVIEQVKANMPQDFKDRFSVVQSAPYFIEVMNRRASKGGTLSELVDQLGLTADDVMTLQGNDLTMIKYAGLGVAMIDEVKEAAQAVTGVAAAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted hydrolase of the HAD superfamily
publication title The crystal structure of a hydrolase from Lactobacillus brevis
rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 262
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3mpoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mpoA01
1TJ3A 3OPXA 4HAIA 2JAOA 2MU1A 4FFDA 5ALWA 5ALVA 2RBKA 5ALNA 4UMEA 5AKEA 3L8GA 2HI0A 2IOHA 3EF0A 1IWOA 4NWIA 5AKKA 1ZRNA 2OYCA 1Z5GA 1AQ6A 3QU2A 4EEKA 3N8GA 2I33A 2D2VA 1ZJJA 1ZD2P 5IT0A 3DAOA 1U2TA 1RPZA 1RMYA 3IRUA 2W4MA 1Q92A 3ZW7A 1QQ7A 4UM7A 5AW0A 5AI5A 3P96A 1U7OA 3KOOA 1RLOA 5ALEA 2OM6A 5ALSA 5AM5A 1L7MA 3ESQA 5ALRA 5IS2A 3FGOA 3KZXA 5AK3A 3WK5A 2PKEA 2HOQA 4KX5A 2FPXA 1PW5A 2G0AA 3EF1A 3SKYA 3UMBA 3I6BA 1WVIA 4I9FA 3B9RA 1LTQA 2IYEA 4G63A 1Z4OA 4XE5A 4UW9A 4PNHA 4HGQA 2B8JA 2CFSA 3WGUA 1QQ6A 1YJ5A 4Y2TA 3BWVA 1ZD3A 5AW9A 3A1CA 4XOUA 3ZVNA 4AP9A 2P9JA 2GHTA 4OCZA 5ALHA 4BX2A 4DW8A 4FYPA 5FP0A 1VFPA 5AVYA 3A3YA 1Z4JA 3KD3A 2GMWA 3WK6A 2EARA 3WK4A 1ZS9A 5AW3A 3U7HB 4BEWA 3DDHA 3BA6A 3L8FA 3ESRA 5AK6A 2OBBA 3FPBA 3S6JA 1S8OA 1RKVA 4XPZA 5AI0A 4CNQA 2HHLA 3MPOA 4NABA 3L0CA 2AGVA 3SD7A 2FI1A 2B8EA 2YN4A 3MN1A 2IOFA 1KYTA 3DNPA 4F71A 4IG4A 4YCLA 3W5DA 1QH9A 1QQ5A 2O9JA 3UM9A 2P11A 3SMVA 1XP5A 1RQNA 5AESA 3E8MA 5ALTA 2BDEA 3L8HA 3SHQA 2QLTA 1J8DA 1X42A 3FPSA 3KBBA 4Y2PA 4KYTA 2YJ3A 4Y3UA 5AI8A 2VKQA 5AKIA 2B1RA 4B6JA 4Y2XA 1L8OA 2JAWA 4UU1A 3PGLA 2DQSA 3QU5A 1YS9A 1Z4PX 2I54A 4EENA 1FEZA 5AIBA 3QUBA 3OCZA 4C4RA 5AVZA 3QGMA 5AKLA 2YMQA 3OCXA 3A1EA 2R8YA 3ZVLA 2I6XA 1K1EA 5AM0A 2B0CA 4Y2JA 5ALQA 2JGAA 5JJBA 4KNVA 3PCTA 3NASA 1YDFA 3E84A 4DFDA 1ZRMA 1RQLA 2G1AA 2WF6A 4CF3A 5AK5A 3MMZA 4UAUA 2YMLA 2G09A 5ALUA 4ZEWA 2B1QA 3PDWA 2WM8A 3U19A 2W11A 4HGRA 3GYGA 2AUTA 5AW4A 1F5SA 3NAMA 4UMVA 1SWVA 2R8ZA 3ZVMA 1WZCA 2R8XA 4E88A 2AH5A 5ALOA 5ALDA 5AIAA 4RESA 3NUQA 2GO7A 2GHQA 4Y2VA 3ZTWA 3I76A 2OA0A 3ZI4A 3OCWA 2O2XA 1RDFA 2C9MA 1XVIA 3A1DA 4EZEA 3L0BA 4EELA 2C8LA 3J7TA 3AR4A 3NIWA 5ALIA 1YV9A 5A3SA 5AKHA 4YH1A 2BDUA 2JARA 2RAVA 3I1YA 4EX6A 1N9KA 4BEVA 2R8EA 3L1UA 4UATA 2YJ6A 1L7OA 5AVXA 1NRWA 2C8KA 3ONNA 2HF2A 5AKJA 3EWIA 4F72A 4OHFA 4GIBA 4O8CA 2ZBFA 5AM1A 2ZBEA 2ZBDA 4J03A 3OCYA 4Y2UA 1Z4MA 4HGPA 3L8EA 1EK1A 3L1VA 1JUDA 4QQFA 3DV9A 2FPUA 5A3RA 4UAVA 2YFYA 5AI6A 3VAYA 4OFZA 2B82A 3W5AA 3FVVA 5AICA 5ALJA 1RRCA 2FEAA 4MWOA 4MUMA 3B8EA 1O03A 2WF8A 3I28A 4HYTA 5ALYA 1N8NA 2FPRA 4JDPA 2HDOA 4I9GA 5ALXA 4GXTA 3U7GA 2AMYA 1L7NA 1CQZA 4UMFA 2YY6A 5AVQA 4ZEXA 3WGVA 2PR7A 3NALA 3R09A 3FZQA 3QLEA 1RC8A 3L7YA 4BYGA 3W5CA 5AVWA 1S2OA 2WF9A 2YBDA 4J2TA 3WKBA 1MH9A 4UMDA 3ZWDA 5AVSA 2C4NA 4Y2SA 5AKYA 3UMGA 5AKGA 3L5KA 5ALFA 4OD0A 2ZXEA 2HX1A 3MC1A 1T9ZA 4JB3A 3N28A 1RLMA 1RMTA 2G08A 2MSNA 3N5KA 3TLMA 1ZD5A 2C88A 3U7FB 4G9BA 2QYHA 3WKAA 5AW2A 3F9RA 3L0YA 3ZU6A 4RETA 1WPGA 1EK2A 1CR6A 4NV0A 5T41A 2NO5A 4Y2QA 2GFHA 3U13A 1L7PA 3IJ5A 1Z5UA 4AS2A 2WF7A 1QYIA 1RKQA 2Q5EA 3ET4A 4XQ0A 2HCFA 3IB6A 3WKEA 2RARA 3R9KA 4ZEVA 4BX3A 1RLTA 4Y2RA 3CNHA 2YMPA 3WK7A 1SU4A 3WKCA 4CF4A 3B9BA 3QXGA 4YGYA 2YJ5A 3CZ4A 3QU4A 3QU9A 5AKXA 4KX3A 2WFAA 1YNSA 3RF6A 3PGVA 2ZBGA 2ODAA 3OCVA 5AW6A 1ZD4A 1LVHA 2W43A 5E0OA 2JAUA 4KNWA 2ZOSA 4DWOA 2ZG6A 3N1UA 2P69A 3FM9A 4YCMA 3E81A 3ZX4A 2FUCA 4UU0A 3WK8A 3NANA 3QNMA 5AK4A 2NYVA 4NAVA 2YMMA 5AW8A 3WK9A 1RMQA 2P27A 3EPRA 4UM5A 2EATA 2I7DA 3AR8A 1Z4NA 3AR2A 4C4SA 4HGNA 1Q91A 4L6CA 2NO4A 2Q4RA 5AI4A 1L6RA 4KN8A 5AW1A 3AR9A 3ZX5A 3M9LA 4UARA 2WF5A 2FPWA 4DCCA 2EAUA 3HLTA 1XPJA 3NRJA 3QYPA 5AW5A 3KC2A 3U26A 3R4CA 3HYCA 5AI9A 2I34A 3OCUA 2G07A 2HEGA 1SWWA 5AM2A 2IA5A 2WHEA 4BNDB 1Z88A 2FUEA 1ZOLA 5AKZA 4BKMA 5A3QA 3SLRA 1NF2A 1VJRA 1Z4IA 1L8LA 3U7EB 5ALPA 4UASA 4H1WA 5AVVA 1Z4QA 1T5TA 3QU7A 3AR3A 1Y8AA 4C4TA 1U02A 2I55A 1U7PA 2FPSA 2CN1A 3M1YA 4HGOA 2YJ4A 2FDRA 5AVUA 4CE6A 4EX7A 1Z4LA 4L57A 1TA0A 2B30A 3ED5A 1WR8A 1T5SA 2CFTA 2Q4TA 5AW7A 2PQ0A 4YIKA 1J97A 4BNDA 2G06A 3UMCA 3SKXA 4BBJA 4YIHA 3RFUA 3SF0A 5ALLA 1O08A 1TJ5A 3WKDA 5ALZA 3QX7A 3QUCA 1YMQA 5AVRA 5IT4A 2HSZA 3N07A 4YCNA 2RB5A 3E58A 3QUTA 4BX0A 3W5BA 2HO4A 2IOFK 2G80A 3AR6A 5ALMA 5AHXA 5AM4A 2CFRA 2BY4A 1Z4KA 4L6AA 3QUQA 4IFTA 2X4DA 3ET5A 3KDPA 4FE3A 1U2SA 5ALKA 4QJBA 4Y2YA 1VJ5A 3ZUPA 2HF7A 3D6JA 4NFLA 3ZWKA 1TE2A 1TJ4A 3AR7A 1NNLA 3ZTYA 3AR5A 3K1ZA 5ALGA 4AS3A 3OTQA 5AVTA 4CF5A 1RKUA 5AM3A
chains in the Genus database with same CATH superfamily
1R2QA 2AK3A 4XASA 2GBPA 1OA0A 3OPXA 3E0XA 1FRFS 3DEZA 4RH3A 4W9NA 3EHDA 4ENQA 5CBPA 4Q7MB 4O2BF 1HR0B 3UGJA 4JYBA 4CF6A 3K0AA 1CW2B 4P3OA 3NNNA 1WUKS 1FFSA 4UEQA 3ZLTA 3ZZ1A 3TRFA 4BMVA 2AFHB 2HI0A 3DHWC 3GFVA 5KDOA 1E3TA 3BL5A 2VJKA 1PL6A 2DVMA 3CY6A 3L6OO 4GXRA 4JT2A 3B9PA 3LHSA 4AF8A 3QYAA 3W5HA 3ZKWB 3U7IA 4HQ0A 1OPXA 1WIWA 3FCOA 2UUCB 3OQHA 3Q3JB 8ATCA 1IHUA 1JHXA 4L07A 3T7EA 5GJBA 2O4CA 4LY3A 1YZUA 2C5AA 3OZSA 4OM7A 2JDIA 4OJQA 1P1HA 5IJ0B 1P73A 1S6YA 1E59A 1OVGA 1OVMA 2X0FA 2HY7A 1ZRHA 2G28A 2W4MA 1BDIA 9GPBA 4M6WA 2VC2B 2E2WA 3GW8A 3HYSA 1TX4B 3QWAA 4U2KA 5BW6B 4IS2A 4QGAA 4UTPA 2AJDA 4KN9S 4M8SA 1GYRA 1O8CA 1QIIA 2FX3A 3WJ2A 3AJDA 1SK9A 1ONSA 2HQRA 3DZCA 1VSVA 1LRJA 3IXLA 2HJSA 3NV7A 4H16A 4RVSA 4RHFA 1DKNA 2WVHA 3B1WA 3HRHA 4QRHA 3KKNA 1M7GA 3VKWA 1DWUA 9ATCA 3PKJA 3HVIA 5DHTA 1DC4A 4KX5A 3NV9A 4RSHA 3S4YA 4ZO4A 2RD2A 2J9GA 3KOXA 5J63A 3E35A 1QGUA 3IRVA 1LJ8A 1O5OA 2QNBA 1FU4A 3INYA 4DWVA 1TW2A 1T3HA 1YVEI 4FUQA 3I9NA 4TYMA 4DSOA 4I6JA 5U4QA 2ZRKA 2P9QA 1ZBQA 3GHYA 4PGGA 3CUUA 1VL0A 4KWIA 3ELBA 4MW0A 3T1YB 1RXVA 3LBNA 4U7PB 4MKZA 1FCJA 3CE6A 4YJGA 4D4LA 5T7BA 1B6GA 3RS0A 5BVGB 3VKHA 1F60A 1QQ6A 1INLA 1WQ3A 1O96A 4V3BA 2IYVA 4N39A 1P4SA 4LDNA 4EMTA 1MJNA 1L4MA 4BFUA 1HEIA 1X15A 2UUOA 5HTKA 3RU7A 3WTCA 3ZHUA 2VQ3A 3ABOB 3L43A 3R0IA 2A5DA 4OCZA 2QYTA 3KX2A 2YBEA 1MVNA 1VFPA 3BXEA 5FNVF 3TMYA 2R87A 2VXYA 3BD9A 3VH3A 1Z4JA 1VSTA 2EP8A 5DV9A 3UXYA 2PX8A 5CGQB 1UDWA 1KI7A 3UOWA 3U4DA 4DLNA 1BDMA 2YDYA 2DHEA 5LCXA 3PYMA 2R66A 2Y1EA 4XIYA 4YRFA 4CMAA 3U7HB 2ZBPA 3NT4A 1TAQA 4JWKA 4YUWA 1EYZA 1IK6A 4OK6A 3JQFC 1J0BA 4YRQA 3G0HA 1UZLA 1AM4D 1Z47A 2DUMA 4H1VA 3TDNA 3TFOA 2PWYA 2IIBA 1S8OA 4XPZA 5MN5A 3I23A 1ZMTA 3SD7A 2QMYA 3VUFA 2F4NA 2ZVDA 4FFBB 2JFGA 3VZSA 1KK3A 4S05A 4PQYA 3M9WA 3QI2A 3UK2A 2DLCX 1XZJA 2IL1A 2RAUA 4IG4A 5T8KA 2XQIA 4XB1A 4N40A 2AR9A 5CLHA 2P65A 2RGEA 2ZRBA 3ON5A 4MW9A 3SMVA 3UV3A 1F0NA 3H9GA 4S2UA 1JXMA 4JXKA 3L8HA 4JLBA 2B8TA 5F9HA 4IZ6A 4RTPA 4RA6B 3GPCA 2IK8A 4CMCA 2OGUA 3QA3E 4QWWA 3LBFA 3CX8A 2LW7A 2CXRA 4NENA 4AJ1A 1R4MB 1B6RA 3GV0A 3I3OA 1DIHA 5DX8A 5AI8A 3SOPA 3V33A 4A2QA 4DABA 5J43A 5L6MB 3RTCA 4QE3A 1II0A 2IPXA 1W25A 2WUEA 1L8OA 3ZG6A 1NYLA 4B8ZA 1O0SA 4UZFA 2WRZA 1C3XA 2F67A 1RYMA 4BVKA 1E60A 4WRRA 1G4AE 2PLNA 3MWEB 3H5RA 4Q48A 4DVGA 4DTIA 2YVUA 2I54A 2QRJA 1LRKA 3PF8A 2NU9B 3ISTA 5CLIA 3GDFA 3AQ4A 4AXBA 4N48A 4V2UA 4RKEA 4DA4A 4D97A 3P2EA 2QLMA 3PQEA 3VVBA 4GX0A 2DPLA 1SUEA 1E7SA 1AK1A 3BE4A 2AG1A 2QP3A 3WIUA 1E77A 1CP2A 1PGJA 2VZEA 1RYYA 3I73A 1JWBB 3UT5A 3GLIA 1YVPA 4GGMX 2X23A 3NOVA 1QIEA 2IEDA 4Y9RA 1HDYA 5AOAA 3D0QA 4KSBA 1ZRMA 4L0MA 4Y0VA 1U2RA 3DMRA 4YJHA 5CIYA 1N8TA 2O2IA 4GPIB 2G9NA 1JG2A 3H1PA 4Y9UA 5FT9A 4EG0A 1QZXA 1UBEA 4LZZA 5DHQA 4QAQA 4O4LF 3D6VA 4MLCA 4G1BA 5LNK1 2B1QA 4PS0A 1P4HA 3TEMA 1GGMA 1YKFA 2IUYA 4JUIA 621PA 1PDOA 3TIGA 5CPFA 1KDYA 4D6PA 3EA5A 3ETLA 3EC2A 3JD3A 4IMJB 4CMJA 3TGPA 2IEIA 5C9ZA 2QLLA 5EIEA 2CLCX 1UCFA 4GHWA 4WBNA 1ADBA 2RHGB 4IQFA 2ZQYA 1RBZA 2R8XA 1C1DA 2V7TA 2D54A 1UQTA 3DTVB 3NIDB 1X1SA 3EULA 4KP7A 4R1MA 3E2IA 3DTYA 4MQ6A 4BVAA 2Q6IA 2ES4A 4QQNA 4RJ2A 3UUFA 3GZTB 1LS1A 1ZU5A 4BE9A 1RTTA 3LYHA 1JDTA 9LDBA 1JDBB 1KETA 4TS1A 3QF4A 3RAFC 1XDGA 4QPJC 3DGFC 5KQLA 2C8JA 2XGSA 1Z2DA 3PUVA 3F3MA 1H2XA 3TW0A 1IG3A 1FQKA 1GN9A 1I51A 5K8UA 2PUFA 5BSMA 1WP9A 1U0NA 2DKOA 2NQTA 3D8TA 1VKHA 5H70A 5HQJA 3VH1A 3I1YA 4CR7A 5ICMA 4AWBA 4IUYA 1PZFA 2Q5OA 3A6PC 1UEXC 4UATA 1LK5A 1D6SA 1M5TA 2EKPA 3ROFA 1NMZA 3EDYA 3V1TC 4QX6A 3T41A 4G41A 2PKQP 3GA0A 4GW3A 3SJZA 3GK3A 4IDDA 8ADHA 4PNEA 3GWGA 2RK6A 2VJYA 3GAFA 1O95D 3LP5A 3ONEA 4JI0B 5DTQA 4Z1MD 1G17A 1ORVA 1KK2A 2A0KA 2ODNA 2EKQA 4HQFA 1KK1A 4KI7A 4RACA 1I01A 2IYRA 2MTBA 1N3IA 1E64A 1HG0A 1VGRA 2J33A 3TVYA 1NFFA 1J99A 2I7CA 1IWPB 1ZGJA 2GZAA 2VDNB 1EWTA 4L9SA 5PGMA 4ZHQF 3R8CA 2QD1A 3M70A 3RGWS 2A1UA 3PHHA 5C4GB 2DBZA 4ZK2A 1U94A 1UWVA 2GYUA 2NUPA 2VPPA 3KUKA 2BW0A 2OTCA 2ZYHA 4B6EA 5A6SA 2WA1A 2QJOA 1KP9A 1O95A 4YAGA 3MOGA 1YJAA 1AS2A 2OORA 2SECE 3IPAA 4Z1MA 5A2QA 2FUG6 4JJEA 3W7AA 1A2KC 3VQTA 1GGFA 2QJWA 3FPLA 1RCTE 2PANA 3C41J 3T5DA 4EDFA 2IDKA 4HYTA 3TKAA 4XFDA 1T5BA 4PANA 2BRUC 4WLEA 4QFMA 1MUUA 2BFDA 4CYMA 3GJXC 1DXYA 2NTVA 5CA1B 2W42A 3RYHB 3UN1A 2QAGC 1F12A 1XPUA 1JAZA 1QKKA 2TMYA 4G89A 3WL8A 3COVA 5IYZA 4ODIA 3KLNA 2ZI3A 3WYFA 1TTTA 3AF1A 4R41A 4JMLA 2HA7A 4XQ9A 3ND5A 2AI2A 3E7PA 4ER6A 1NW8A 2DT8A 2R6R1 1NQUA 3CHYA 5I8ZA 4CM9D 3S2ZA 4EA6A 1N8KA 5CR9A 2P62A 3RSOA 4DBLE 1JEOA 1Y3IA 3CZRA 3UHOA 3E03A 3EZLA 5JH7B 2ZR8A 5HF6A 1N3BA 1GUFA 3ZWOA 1RYHA 3K70C 3I62A 1T25A 3RHZA 3ZXIA 5MFPA 4Q01A 2XUJA 5JUWA 2NV2B 3GJZA 1G0NA 3G6WA 5EJIA 3F3YA 2H4XA 1I80A 1UKCA 1K8QA 3OPYB 1CS0A 2C94A 1JB9A 4DLYA 2ECFA 2BYTA 2QJTA 1BX1A 1O5TA 3CX3A 4XSVA 4I55B 4CUJA 3BFJA 3N0TA 1KWGA 1FFXB 4CM9A 1YUNA 3R0XA 4P33A 1NVEA 4ZOCA 4XJVA 5LB2A 3U3JA 3ZDRA 3BKWA 1QC5A 3DKVA 4F2PA 4N9QA 1KI2A 4AS2A 1FFGA 1ISPA 2A9QA 4QHSA 4OFXA 1WB5A 1XLUA 3HU2A 1AQLA 4XYMA 4ZICA 4CG2A 1B1CA 2Z4RA 4YB8A 1THTA 4KV7A 1DJNA 1SIUA 3IB6A 3WKEA 1TU4A 1TIKA 2WKRA 3DNFA 2HW8A 3PLNA 1QIGA 5EMHA 1E0JA 2ZJ1A 1DAHA 1PEYA 4DEXA 1AKMA 4WKCA 1W36D 4A0SA 1U3CA 2O8DB 2ZS9A 5EZYF 3JAKA 4Z53A 3PDIB 4JWTA 5L3SA 2WIBA 3W6UA 2YV1A 3R0ZA 1BXZA 3EJWA 3L6DA 2DLDA 3ZGXA 2WFAA 1ATZA 1NUTA 2YXDA 2I3AA 5EJ7A 4C5CA 1JU3A 4FBGA 3K92A 5E0OA 2JAXA 3F6YA 4PYLA 2CCKA 2XWSA 4UHFA 4NBLA 3OPNA 3KDSE 3PLRA 4N5MA 3RSCA 3CE9A 5MGNA 2I2AA 4Z3OA 3X1ZA 3WAKA 1VB5A 2W7TA 1GZHB 1MP0A 1A5TA 1D2HA 4R51A 4X93A 5LZ5A 1R74A 3H0CA 1M7HA 4FJ1A 5FBQB 3SM9A 1J0XO 1FU7A 4UU0A 3OQVA 1I30A 2WHPB 4BP3A 3SZLA 2HFJA 2I03A 2ZI7A 3B1KA 5IDWA 4D44A 1ZKMA 1DTWB 3ZY6A 4K2HA 4RDXA 4S12A 4YFYA 1ZLXA 3PRKE 4I50B 1WZUA 2ZWAA 4EUKA 3ORFA 2QS9A 1I2AA 4OGWA 4EGQA 4F6CA 3GJ8A 4YFVA 2JGIA 4RV5A 4UULA 3WGQA 4KQWA 1T8PA 3FF1A 3DE3X 3BFKA 4OH1A 2HQOA 3NPMA 2ZIAA 1X39A 3PS9A 3ZDCA 4M0FA 4N12A 5EJ8A 1SNYA 2XRFA 3EAGA 1T4BA 3F7MA 3QRWA 5GTDA 2O8CB 5CFZA 1QS0B 3IP6A 3MWGA 3OOJA 5KTOA 4C0AC 4TKZA 3JRWA 2G6BA 4S24A 1UMBB 1FJGB 4LNHA 4N65A 4C87A 5A9RA 2BGRA 2POCA 2P7IA 2V9PA 2G07A 1GPUA 5K20A 2XODA 1I3MA 3OOHA 1JZSA 3P2MA 3UB2A 3AH8A 2WHXA 2PKQO 4UM9B 1I3NA 1KMHB 2XRYA 2QN6A 3R9XB 5LA6B 3VO8A 3NIFB 4KOAA 3UHFA 3K0CC 2HDNB 4B40A 3HUDA 1W47A 4PLWA 5K3FA 1NF2A 3FOEC 4HHEA 3WL3A 4RHYA 1LKZA 4HQRA 3N2LA 4UVDA 2F90A 1PX0A 5B57C 2Y6UA 2YRXA 3TS1A 3DSRA 1QQAA 2Z08A 1H9BA 2ORIA 1DG9A 1U6KA 3DB1A 1Q1NA 3SX2A 4EMSA 1YXMA 2QZ4A 2AWNA 2AFIA 3O31A 3WFIA 3R6TA 5GWXA 1U3DA 3EZYA 4U7JA 3IP8A 4DIUA 4W82A 3UT0A 3M4XA 5KVQA 4JQOA 2W8BA 1ZISA 1E1RD 4CE6A 3UF0A 1EGVB 2XZTA 1V25A 4QARA 5B5SA 3H6KA 2Q6VA 1IH8A 3AHDA 3BMNA 3LKBA 3LSYA 3E5RA 1QP7A 3A4TA 4JUCA 1LNZA 2OGWA 3SHTA 3CZPA 1KTIA 1UQUA 1JKMA 3H8WA 5MF6A 3NBKA 5FWYA 3B8HA 1GPWB 1NLUA 3GJYA 2C9ZA 6NULA 5GIOE 1X1AA 3MK31 4M98A 3BSSA 3SJUA 3MUEA 2WWVD 2IHZA 2J09A 2XADA 2Z3ZA 2H6EA 4JBYA 3M3DA 5AVRA 3VGPA 4C4ZA 2PQMA 3CEHA 2F8TA 4IJUA 2A9OA 1ISHA 1JILA 2BMJA 2ARKA 2Q50A 3CO5A 1OF1A 1SUPA 3OLZA 1EJ2A 4HZUB 1P5JA 1E1RA 1QE3A 4EGAA 1AQUA 2G80A 2VQ6A 2R1TA 2JJYA 1HNZB 3FFBA 4DAOA 3G7UA 3KUUA 4KH0A 2IWHA 5BQXA 1U0TA 1J0AA 4IFTA 3V4SA 5LMCA 5B30A 1NE7A 4CN9A 1PJSA 1CRZA 2FA9A 3BFVA 4ZJPA 5C80A 1K2WA 2ID4A 3HJFA 1PG5A 3ZWKA 1GQ2A 1H0SA 5D3MB 1EXWA 4TUYB 3JYNA 4MO9A 3GLFE 1Y5NA 3AR7A 1DUIA 4GMGA 4E94A 1QANA 3H8SA 1G63A 1W8IA 3OX3A 3N58A 3SBEA 3ZNQA 5JC1A 1RXEA 2NXWA 3VVLA 1ZR4A 2UUBB 1SFRA 1KI6B 3FFXA 4D9HA 1WA5A 3TIIA 4DZTA 2FVYA 3H1FA 2GXQA 3MS2A 3SNHA 3C3JA 2FW1A 4CF5A 2Q2OA 3M34A 3GHHA 4IO1A 3HB1A 4NOLA 4RZ3A 2ZI4A 1XGKA 2ERYA 1Z34A 3A9SA 3NM5A 1HXHA 2W37A 4XR9A 5BN5B 3V4PB 2V6JA 3BJMA 3ZK9A 3AETB 5LD2C 3RIXA 4IYJA 4IDHA 5I5EA 1SAYA 1JBKA 4FQ5A 1YDMA 2YIMA 3KB2A 1JFSA 5BP7A 4UMEA 3OQPA 2WUDA 2DP4E 1G55A 2Q5HA 5AXCA 3AILA 1MJFA 1NRIA 4M0CA 4X44A 3S8EA 4O4LA 2ZBVA 2BTEA 2W2XA 1C3JA 1YL6A 1L4NA 2AE1A 1U3TA 2UZIR 1RTKA 2CXXA 5BYJA 4AKIA 3V4OA 3PRYA 2PGDA 1ZZGA 1MXHA 3MWFA 2IYWA 2QORA 2D2VA 3NH6A 1UAYA 1E9FA 5DU2A 5KYVA 5JNLA 2PJRA 2JHFA 1GGNA 4IO0A 5IT0A 3GLGB 3SMQA 1OROA 1CNEA 3BEOA 2GJKA 2J48A 2XHZA 1IN6A 4D46A 4HQOA 4AMVA 5CFPA 1CDZA 1OLOA 2EX1A 1R6AA 2UYGA 3LHKA 4PXSA 4IIXA 1L1FA 4HRXA 1L7MA 1SVUA 2WU1A 4R81A 1JG4A 1QHSA 4JGIA 3LPLA 4F9FA 3Q9UA 4A0QA 1MZVA 1GUBA 3GLUA 4X66B 2HD4A 5FH9A 4CLXA 1KDPA 1SKBA 5INTA 2Z95A 2FPXA 5JS6A 3LQKA 4K2AA 3RVOA 4FQ8A 1UC8A 3N8HA 3NOQA 1CRWG 2CKDA 1PZGA 2GAJA 1RRGA 1Z4OA 3R3JA 3OESA 4MLZA 4NEGA 5DEIA 2GFIA 4QGSA 2GEKA 2Z09A 4IIFA 1NW7A 4ZP1A 1ECPA 1DQRA 1XO1A 3KM0A 3A10A 4Z86A 3DE6X 4PPQA 4TS9A 3RC2A 1E89A 3ZN2A 1V7ZA 4UDNA 1XWIA 4BFWA 5K3BA 3VRHA 4MITA 1NQ5A 1N2IA 3BWVA 3HKCB 1C3VA 1Z2AA 2CZGA 3GU3A 3B5JA 4DM4A 1TM7E 4CT0A 3I2GA 1ORWA 2ZROA 2GESA 1ENOA 3LY7A 4TXJA 2VXOA 2AXPA 4LEIA 4OI0A 4AQYB 4PTYA 1DT3A 5JI3E 4WKOA 1F8FA 2O2GA 3KYCA 4G9EA 4GP9A 4URYR 1X9HA 3L8YA 4WK4B 4XD7D 5ECGC 1G16A 2AI3A 2GSDA 4TQGA 1EKXA 2MYPA 4BIMA 1BXGB 4EY4A 4LRTB 2DYKA 4BQQA 4ARVA 2JL1A 1L7XA 3RFCA 1PJ4A 1GSIA 3C3DA 2PY6A 4B4OA 1OV4A 1WF3A 1IULA 1NQWA 1CB0A 1LLQA 3C24A 3FBTA 4Q1DA 1Q3TA 1SBQA 1IQUA 4O5AA 1EHYA 3NHSA 3MJHA 1KQ3A 3HBNA 4P8RA 1KYTA 2NYUA 3I0NA 4CKBB 5CFLA 3ECAA 3F47A 4DSTA 1OPRA 2B5OA 1SZPA 1JBQA 1ZK3A 1YB1A 1EFVA 4N5HX 4NXNB 1R6XA 4RLSA 2O9JA 2QX8A 1CZRA 3N0XA 4G8CA 5C31A 2OZLA 3GLTA 2FLWA 2W2MA 4XD7A 3WXMA 1VYHA 2ZBRA 1JVBA 3FDFA 4U0JA 4ZFNA 2CFCA 4KJZA 4Y8VA 3JAWA 3R40A 5IBRA 1A76A 2D4HA 3W8DA 1ID1A 1HMYA 3F4KA 2G3YA 4MIYA 1FS6A 1YO6A 1F0YA 3FPSA 4EAAA 1QTIA 3ZZTA 2GS9A 3DZGA 3FCAA 2CB9A 2NUTA 3V6MA 4C0JA 1MB3A 5CA1F 1UPFA 3A4MA 5DZSA 5C53B 4YJ3B 1O4WA 2CL5A 1ETHA 1PS9A 2WAOA 3DBLA 1GYPA 3ER6A 4BXOA 1QF9A 1D2NA 1T43A 5EAIA 1K3UB 1KBQA 4LSGA 4AKEA 1E4VA 1HNWB 2BFWA 5H81A 1Z4PX 5A5DA 4JJ8A 3CUSA 1LSUA 2YJGA 1I6MA 1NUSA 2G36A 1DCMA 3KB6A 4BRSA 3SBOA 2QN9A 2FETA 3OCZA 4TL9A 3ZI7A 3EWAA 4F0JA 3CR7A 3AERB 1IJKA 1UMCA 2ONZA 2QTZA 4P53A 3B3QA 2GBLC 1WEHA 3HEBA 4HPWA 4E31A 4CKEB 3VJRA 1CY6A 2A94A 1EINA 4JD5A 3EUWA 4N7JA 4FYIA 3VX4A 1CUVA 2XVAA 3QKRB 3O2JA 3B53X 4Z5XA 5AM0A 1UK6A 4FYJA 5CB8A 1PJBA 4XX0B 2QTVA 1NR7A 4OY3A 3MPUA 1Y63A 3IBYA 3HCNA 2R2AA 4DB4A 3ZY4A 4WKBA 1XMJA 1XZQA 2NTEA 4MR8A 5LIPA 1VLMA 5EMKA 1RABA 3I4FA 1XN1A 3MWYW 1NYTA 3D59A 3C6KA 4V24A 5HBRA 1K75A 1JV2B 2P41A 3DV0B 3HCAA 5CX1A 3V2GA 1PI3A 3D2CA 4I55F 2QRPA 4GNKA 4RADA 4B3IA 3T9BA 1M5UA 2E3JA 2REXB 1TI7A 4ZEWA 2ZUTA 1E2PA 3TNDA 1QLHA 1Q95A 4TTAA 3UKOA 1AK9A 2Q27A 2XOEA 3CCCA 4O4IA 2IDJA 1NDUA 4NL4H 3T34A 3NAMA 5GGYA 1OAAA 4OL0A 3KQVA 5DKFA 1G3QA 1SPXA 4DYHA 2ZM6B 3NFRA 2P67A 221PA 2ONJA 1XLWA 2R1VB 4WNCA 2AMVA 1EMDA 3ASVA 3BTSA 1NPTO 1PT9A 3AGPA 3QITA 4OF4A 3FOZA 4RESA 1EWVA 4RH1A 5K7SA 2GHQA 4H0FA 2FPOA 3ROZA 3NRBA 3MLEA 4CRWB 4TKUA 4L73A 4CIDA 2AD1A 3JRNA 4R9UC 1XL1A 5ICEA 3ER9A 5JAIA 2VHQA 3WC4A 4B9AA 4J3FA 3DXZA 1RIIA 1NYRA 3CNQS 4C0XA 2FSVA 1ZN7A 1E4EA 2Q5QA 1IPEA 1TVEA 4I81A 3WL4A 1DJMA 3ZKWA 4ZU1X 2JFXA 1ONPA 3MZ0A 4YH1A 4YECA 4TYYA 1FP4B 2ZB8A 2Q5IA 4CDNA 5HQ3A 1FVOA 2OE2A 4Q03A 3ONVA 3IBGA 4HJXA 4NQZA 4TMTA 4C88A 1HE8B 4TLBA 3UH1A 2SKCA 2WB2A 4Z7QB 1OWOA 4ZT5A 3EE6A 1D9XA 3TTVA 2E85A 2ZIEA 1KDRA 2PT6A 1K2VN 4FBMA 4BZZA 4DUGD 5MN4A 3LIPA 4RGVA 4QT0A 3LRPA 3MMSA 3LDAA 3T7DA 3IQDB 5A3VA 2C2BA 4I50F 4DIEA 2AG5A 3L07A 3OCJA 5KCZA 3ISVA 4EHJA 1L4BA 1NR1A 4DCSA 3F71A 4MZDA 1OREA 1NN5A 1ULSA 3HGMA 3L0SA 5CPBA 2NZWA 3TE6A 1T2UA 4A1OA 2AJ8A 2QJFA 5BVHB 1D8TA 2XDQA 3BGIA 4Q00A 2Y27A 1ESMA 1T9GS 3SF8A 3T1VA 3UWMA 1N2OA 1NQXA 4JQCA 5JLJA 3BK1A 3K9BA 4US0R 4YRJA 1G2PA 1ADFA 4FGKA 1I2BA 2ZBQA 4X84A 2NYAA 4FYVA 3HLYA 2FPUA 4DUGA 1KVSA 4O4HA 3OFSA 3VI3B 1VP3A 1YTUA 1ORIA 4OHPA 3BHMA 4KO3S 1FTYA 2Q3LA 3MTJA 3JARB 1XEFA 4JQYA 5LA6F 1S0UA 2B82A 2RHDA 3D6TB 3RYIA 1TT5B 2XVYA 1VHDA 1XCMA 2EQBA 3CKMA 3EMKA 5D85A 5ELMA 5FIUA 1EE2A 3TX2A 3B8EA 5C0OE 4Z7OB 2NXCA 3EHEA 1TECE 2AQHA 7REQB 3QLJA 4MMXB 2HDOA 2IYFA 3OU6A 1TVKB 4XIGS 3ZIUA 3VYWA 5BWBA 3MQ4A 3FOWA 5F12A 5BORA 2PV0A 5GJWC 4Z4QA 3ZU5A 2IT1A 3UCFA 2BSXA 2XUOA 3KKKA 4LJ4A 3C8DA 1BE1A 2CNWD 2VP2A 4KL8S 1N1GA 1D04A 3D6AA 3QJ5A 1QZUA 2PR7A 3FPHA 3UIEA 3ZY5A 1SBZA 5GY7A 1WOMA 1L9KA 3EEIA 3VNAA 3FFTA 2ZSIA 2J9YB 2F55A 2DLNA 3W5CA 3P9XA 1SUSA 3ZCXA 4BEBA 5IBQA 4Y9DA 2AZMA 4AZ0A 4ZTUB 4DC9A 4Q9AA 2NAFA 1YI0A 2L82A 2VDJA 3E2MA 1NJ6A 5ESRA 3HSKA 1XXHA 2FFHA 3UMGA 3R8XA 5C35A 2P68A 1FYFA 3K8YA 2H18A 4LBWA 2Y76A 4MJXA 4ZPXA 1RMTA 2AEJA 4RSRA 1Z0DA 2BGLA 2GZMA 2HZ7A 3GRPA 2XTZA 3JQQA 1O97D 1VCOA 1DE0A 2CNWA 4JJGA 5CX4A 1PD1A 3FI9A 3O3NB 3OO1A 4UCQA 4FJ2A 5KTPA 1VKRA 2QDKA 4NS4A 1G6OA 1KARA 1WPGA 3ORHA 2OXCA 2AHRA 3GUVA 3NKVA 4DARA 3PFGA 4Q4AA 3HJRA 3TDMA 2XV1A 2YXBA 4FS3A 1Z35A 1TD9A 3KEFA 2BBWA 2K87A 3Q11A 1QYCA 3D31A 1R88A 2VP9A 4FONA 1L7RA 4Y1FA 3ZBPA 4EO4A 3RVRA 1ONOA 3EEQA 2B7LA 1T9AA 3R24A 2XR1A 5FX2A 4EDHA 5CFOA 3HA3A 1GUDA 4TUYF 4ZQFA 4BVGA 2JLVA 3N2KB 2PX0A 2NU9A 4QJ5A 4DDKA 4S1VA 1AO0A 1OA1A 1SXJD 1HE5A 4C9BA 4Q1BA 1NL3A 1YBAA 3AEKB 4B4VA 3ENWA 1UJNA 1V9SA 4DRXB 3GGCA 1OFHA 4YONB 3R7SA 1H3NA 1PFWA 1PKXA 3WSVA 2NQ8A 3EODA 1SCKA 3ETEA 1JQAA 3G2NA 2IYUA 1SXHA 1SHKA 2GCNA 1CEXA 4DIKA 3V7YA 4YP5A 2NN3C 3QJGA 5K45A 3RSFA 4DBLC 1PNOA 4RXTA 1G18A 2QYOA 4KG7A 3AVYA 2XWBF 1P0QA 4GOMD 3EH1A 1Y3HA 2MYUA 4R1TA 3VKVA 1U0FA 4RL6A 1CF4A 2FSIA 2IP1A 4DGSA 3L40A 5IMBA 2PX5A 4N1AA 4RPKA 3KQYA 3ROKA 3EGDB 3OA0A 4P3YA 1SXJA 1XCJA 2BKEA 1BE0A 5IAKA 3OUTA 2PM8A 4QJ4A 2QSUA 1UJCA 3OC6A 4DY6A 3BJZA 3WLNA 1KXZA 2Z2ZA 2R5WA 4RTLA 4WV3A 5HS6A 1C9DB 1Z4NA 2NV6A 3TRJA 4YCCA 4C4SA 5CDTA 2GRAA 3EC7A 4QLAA 4A8PA 2JVJA 3HGTA 3H86A 3M4YA 4H27A 3W4JA 3KSBC 4LDRA 3BXOA 4RCYA 2FPKA 1A9PA 1IVNA 2PL9A 1OT3A 3H75A 4U63A 3VSAA 2Q07A 5AFSA 1E1MA 1ADYA 5BW4A 2PGNA 3CSDA 1WLSA 1E3MA 1SB9A 1HORA 3KB1A 1J06A 3A14A 2FWNA 3BGVA 4D41A 4ZOQI 3AVPA 2QRNA 3OU7A 1WY5A 3OIYA 4R01A 4S1NA 3ILYA 4F56A 3CG4A 3DVAA 2AVNA 3KYBA 1GEEA 1B8UA 2QUKA 2ZSAA 2E18A 3EXG2 4PIMA 4XWAA 3S70A 4ETIA 1DFIA 4HGYA 1FP1D 2EYUA 4QTXA 5T67A 4TMXA 4RBNA 3T7JA 1Q7GA 1TKCA 2RGUA 1KU6A 3KLBA 3ZDYB 1J33A 2KHZA 4R4JA 2H29A 2PZKA 4JUAA 2A0WA 2G82A 5DLQC 5FBZA 3TQHA 3SJBA 1BX0A 3TH5A 4ECAA 1ACJA 2IWRA 3ENQA 4IVPA 2CUZA 3T12A 2ZP1A 1JJ7A 4DNOA 5K99A 4WVFA 4C5BA 2AKEA 1RXWA 4I4NA 5H80A 3AR3A 1Y8AA 2C9BA 1GPJA 3G68A 4Y67A 2CD7A 4IWXA 1KAOA 4L4RA 3CRW1 4F7WA 4KR2A 3I58A 2IXTA 4UBJA 4RE6A 4TMFA 3O0DA 1SK8A 1Z26A 1AMUA 2CSUA 3Q8MA 3GJ0A 1JXAA 1HE4A 4LF6B 4Z7JA 1SC4A 1A7AA 4GR5A 1KO1A 1Z28A 2R96A 2NO9A 2XB6A 4M8LA 4E5SA 2Q4TA 3PR1A 2Y9MB 4A23A 1LCIA 3ZE1B 4F96A 5GADl 2OGTA 1RHKA 1EJ0A 3AB7A 1P39A 1L5LA 2XE6A 3TEJA 3M1AA 2ZRJA 3DWGA 4KTTE 4OUDB 2NVOA 3AP1A 3NOXA 3H2ZA 1IG0A 3ADKA 2FP4B 2FSUA 2W6NA 1KJWA 4K6FA 1YBVA 2J9XB 4CCWA 3H2SA 3NTUA 4CN8A 4I66A 1T34A 2UZAA 4B4DA 2XNHA 3KR0A 2XUPA 1SXPA 1D2GA 4YDRA 3REQB 3TZBA 3OSUA 1QRSA 4HO1X 3HFSA 1UOQA 2YYAA 2J31A 2C3MA 3JVUA 1LBQA 3VC3A 3QBDA 2BIFA 1DBVO 1KPGA 1VKZA 2V98A 4KQ1A 1XV5A 4HDRA 1J8FA 1PT7A 3QLVC 3TINA 3L6CA 2WQZA 1NAHA 1D0SA 1Q0ZA 3H9EO 3R0QA 2V3WA 1YD7A 2Y05A 1VJ5A 4HAYA 1E1LA 3D6JA 4K9SA 2WLSA 3OZBA 4ZYVA 1KEEB 3ZHTA 1XTPA 4RO0A 3C0KA 3FG9A 4JC8A 3SEZA 3WMFA 4LMPA 5CT8A 3LYLA 5I7UA 1SOMA 4YJ3F 3RC9A 5B58T 2JF0A 3O91A 2XKJE 4QYTA 3RRJA 4FC7A 1JHZA 3C8HA 3ECCA 3ZE0B 1N2CA 4D9GA 3ZLVA 5DMHA 4GDMA 1KJYA 4DLRA 3NTQA 5BMVA 4PAWA 1LX6A 1XCGB 5JY6A 5AYVA 4OYYA 4CQMB 1ZH4A 1E3SA 1LBIA 4EYQA 3FRIA 1TU3A 4D9EA 1TOAA 1JQ5A 4LK2A 1PNTA 3MGBA 3SYTA 4D56A 4JP1A 3ZGZA 2ZIZA 4NE2A 2X4GA 3LQYA 1GJRA 1HA3A 3KSMA 4GMHA 2PA0A 4MOWA 4Y6RA 1JECA 1PJ8A 4I55A 1FFXA 1JLHA 2IEGA 3HJUA 4CU5A 1Y5LA 1J0DA 1UIRA 1HSZA 1Z5GA 5KSPA 3ZDEA 1M34B 4G4IA 2FB9A 2L18A 1HDRA 4TLEA 1Y82A 3QE4A 4HWPA 2B9EA 2I71A 2K7FA 2J0QA 3GQVA 3D8RA 1QGOA 1UANA 4G0QA 1RMYA 1WQ4A 1DAIA 1ZMOA 1IN8A 2EZ4A 1U0RA 3PXBA 5BWLA 2DWQA 1F3LA 2NXEA 2GM3A 4LTDA 4NMLA 3LQ4A 1Z8FA 2KI5A 4IUCS 3F6RA 3ABIA 5HR5A 4YEDA 4KIWA 2TMGA 2REQB 5BN4B 1IUPA 3DR5A 4P82A 3IEXA 2O2DA 2VDKB 1DBQA 2CYCA 2C04A 2P2GA 1RJDA 3L79A 3FYDA 3OA2A 5FTMA 1KH1A 3EF1A 1D2EA 3TCKA 3A05A 3TUJC 1IK4A 5BT8A 1MPXA 3ZLBA 4CU2A 1BO6A 1RM4A 1TUGA 1DADA 2EFGA 4XE5A 2A67A 5AQ1A 1YB6A 2J4DA 5BW5A 3A2MA 4OG2A 1LQUA 5A5FA 4E1AA 1WW3A 2ZW9A 4R1LA 4Z4HA 2ADOA 3AI3A 5DNWA 4DQKA 3FN4A 2BM0A 3OJXA 4UM9D 5EUMA 4EPVA 1PV1A 4UNRA 1ICIA 2C9YA 2EX4A 5JWHA 4FX2A 3CPEA 4ZI7A 5F23A 2VT2A 3VR4D 4CW7A 4F21A 1GTRA 2VRWA 1NG9A 3SWWA 1D0VA 2TECE 4KH1A 5E4YA 4BX2A 2F1IA 3K09A 1JB1A 1MB9A 1UKEA 2C4UA 2BEWB 4JT4A 4YC7A 4ARBA 3SC3A 1QFXA 2O8CA 4U0KA 5JISA 2HCJB 3Q41A 1OFGA 2BR3A 1C1HA 4Q9HA 1V0JA 4OK3A 4UEKA 5FPYA 3HK2A 3WK6A 3MAGA 3P7MA 3PENA 3K0BA 1X70A 1XZFA 2UZ0A 1EDBA 4OSOA 1I5OA 2W0MA 3K9FC 2IE8A 3SHFA 3E22B 3Q7TA 4JKOA 4DHEA 1IDN1 2VWPA 1RHUA 2FCAA 3A3PA 4BV8A 1AGYA 4EL0A 5EJ2A 3PTAA 1RKVA 3KPUA 2F1JA 1WWKA 3VR4A 4HX9A 3TW8A 1YB4A 2IOFA 2VSQA 3U7JA 2QHXA 2AZXA 3DNPA 3KXDA 4IVRA 4MVYA 4CV2A 2XQVA 1T91A 4GX2A 1BOOA 1V1MA 3RBXA 4MVJF 3ZE9A 2EIXA 1KGSA 2KJQA 4XH9B 4UM8B 4MS1B 3EEFA 3FUCA 3GJ6A 5CCDA 3IV9A 1UBUS 4WY5A 3RVLA 1GNSA 1WNFA 1C9NA 3KQTA 3MMXA 4ITRC 2X4IA 4IHQA 1T5HX 2GPBA 3P9SA 1PGOA 1V11B 3OQBA 4Z0HO 3THWB 4PXYA 3OZ7A 1G21B 1QSGA 3NATA 2QY9A 4PCAA 1KQGA 3FOCA 4RDIA 1E2KA 1IRXA 1B0AA 4MV4A 3VBEA 2BR4A 4TROA 1E20A 4RSMA 2P9HA 1FFBA 1P0IA 4C7OB 2CNDA 3RIYA 4OSPA 2K4MA 1U8AA 3O8QA 5AIBA 2JI6A 2JCSA 3G89A 4C4RA 1MO5A 4PRLA 4BLUA 5J1TB 2VF2A 2YMQA 4DY4A 3JQ8B 5FJIA 2DX7A 1CVRA 1SKYB 1KK0A 2C5FA 1RYFA 2Y1CA 3DT8A 3MIZA 3IKLA 3S1SA 1GL9B 1LFAA 2DSTA 3IDSA 1K1EA 5LXTB 4YJDA 1ZGGA 3S2IA 2VDLB 4RPCA 4Z4EA 4WBXC 2DFNA 3NHPA 2NAPA 4AVYA 3PVSA 1RSZA 2M6SA 4EB3A 3NYWA 2AN3A 1M2WA 2Q0HA 1AKNA 2W22A 3GEIA 4U7WA 4N47A 2V7BA 5EMJA 3ONDA 2O2HA 4DPKA 3EIQA 3OICA 3V3KA 3KZKA 1IY1A 2QW8A 4RY2A 3VZRA 3HWRA 4QVIA 4Y6QA 3X1XA 3UWPA 1BN6A 2IV7A 3T7KA 1QIFA 4PCVA 3EQZA 3NDPA 4TUYA 1Z74A 5ALUA 2E37A 2QJRA 3BQNB 5JATA 2RJNA 4AY5A 3E7XA 1K7SN 2XMRA 3UKJA 4J0DA 4CL8A 3C3AA 3ICEA 3E3OA 1VE1A 3E15A 1CUSA 3CONA 3WGLA 5JAUA 3HXTA 4J1QA 3JQ6A 3V1MA 1AO3A 2E5FA 3QOFA 3NHFA 2G0NA 5DASA 1Y3AA 4OXQA 4LMAA 4Q4HA 4PHHA 2C3YA 4UZEA 3RSSA 1GT91 3JWIA 2GO7A 1XD9A 1GGVA 3PEUA 3WDKA 3BRCA 1VLHA 2OA0A 2EW2A 3ZI4A 1F9EA 1U31A 2QLBA 4ICIA 2ZBUA 4IIDA 4PFSA 4XCVA 3QFTA 3OJEA 5BSRA 3WBJA 1YUBA 3QG1A 2EBHX 3GLIE 4HXYA 3AIKA 4D1YA 1GZSA 4IEEA 1EX1A 1UZAA 3A11A 5TEVA 4DTCA 3CLUD 3IT2A 3JQ7B 5A3SA 3W5VA 3O8DA 4AP6A 1VLLA 4DIFA 2P77A 5DK4A 2JARA 4DR4B 1TO1E 2WW8A 4UTNA 1NBMD 3GLGA 4XUEA 4B3RB 1V35A 5G4KB 1W94A 3IIEA 1BGVA 3DP7A 3IQXA 2VA8A 3P94A 1E9RA 2NPOA 5HVNA 3ASZA 1TA9A 4OBWA 4JI6B 3V55A 1BC5A 1UC5B 3CW9A 4HLNA 4ZGWA 3BB4A 3H17A 4N7RA 4GYJA 5IBCA 1RAEA 3TQRA 1M6HA 5DHAA 1SVOA 4MKHA 5HWSA 1VFNA 2H1CA 2ZE8A 4MINA 3TM5A 1GPDG 3I2KA 1D2AA 4BRUA 5A0TA 3IAAA 1G4UR 1RVV1 2Y0EA 3KQNA 2IUTA 2UZ1A 4HJRA 4ESVA 3NBAA 2J87A 1G5HA 5ILQA 1FLVA 1NBMA 1B73A 5IAOA 3T1QA 3F6SA 4ESOA 4ZZ0A 3ZV5A 1U80A 2FH5B 4B1FA 4CM6A 1HSOA 1KMNA 4BNWA 1SBIA 4R8VA 3AJRA 4J0HA 2AKAB 3DE7X 4Z9BA 4F8JA 2VT7A 1FNSA 4TWIA 4AJLA 3PGJA 2XCOA 2YFYA 1II8A 4JB8A 4XJXA 5REQB 1V5GA 1CVIA 1FDOA 1P4RA 4H6VA 3OZWA 4I1YA 5AICA 1GEGA 4DC0A 4ARIA 2D2EA 2IODA 3DKRA 3GF4A 3HKCA 1DV1A 3NHZA 4M8KA 3P8ZA 1Q3HA 1EIZA 1TFUA 9LDTA 2HADA 4AJEA 2FP3A 3DYVA 3NUGA 2OCLA 4LPSA 1NQTA 2D00A 3G1UA 4LXYA 4UXHA 5LQNA 2NVWA 3BRQA 1Z3IX 1OGIA 2E6UX 4EY7A 2VHVA 1U04A 3B85A 4IZIA 4ZEXA 3D3WB 3FWKA 4UREA 2J3EA 4OAOA 3PIDA 1VOTA 2OOKA 2XCLA 3I5MA 3KLPX 1Q0TA 1TK3A 2I4IA 3QLEA 1XU4A 3BXXA 1SR8A 1M2NA 1ZONA 3OBIA 4TPKA 4HWGA 2YBDA 2XUFA 3KEOA 3PUIA 4L15A 4Z0NA 3HZZA 3QPUA 2QMZA 2AT1A 2OZPA 1GCIA 4RGYA 1U7WA 3W9SA 1VL6A 3DBRB 3V8VA 2GEDA 2XGMA 2BM9A 3HV2A 2FR0A 4FFWA 4GQAA 4V1CI 1H2WA 3ERCA 5BURA 4N7MA 4YV2A 4UHHA 3PFCA 5J4YA 2HX1A 2C5GA 4GPZA 4WECA 3U16A 4JB3A 2QD3A 4K87A 4R8LA 4W5WA 3WQHA 1BKSB 3TLMA 2YHIA 3OLWA 4OJNA 3DMDA 3BPSA 1VHWA 2HHJA 5CYPA 1JHVA 1UP4A 2W58A 3FYUC 4I3FA 4BU1A 1GTL1 1HPLA 1KEUA 2FF7A 3KV3O 3QVVA 4LBYA 4FBLA 2C92A 3NTXA 3OLCX 2HSDA 3TBHA 4J91A 1LPBB 4GBED 5CM9C 3I92A 2GFHA 3WFZA 5JLAA 4DIBA 3HB4X 2AXEA 2W6MA 4MA5A 5A04A 3KD2A 4MV1A 2FN9A 1O0CA 2VSFA 2OCBA 4ZODA 3LZDA 821PA 2Y3IA 4OLBA 4EJ6A 3FMFA 4Q39A 4XQ0A 1EGHA 4KXYA 1FX1A 2I9PA 3AJ9A 4L4SA 2RARA 1PFUA 3BTUA 5K0TA 1HQDA 1UJ4A 3GGDA 3R9KA 4BP1A 1XTQA 3AERA 4UCFA 3QTLA 4WDRA 3P32A 1NDHA 3Q7QA 4OJMX 5L3ZA 1RLTA 5JZVA 4CKEA 5IH3A 2ASVA 3E2PA 2VJMB 3IMGA 1KR5A 5DBGA 4Q24A 1O9BA 4EHFA 3FNRA 2QY6A 3PTLA 4EM6A 1R1DA 1UXIA 4RMNA 3T9AA 1AA9A 1M2KA 4MKXA 1MIOB 2GARA 4GQBA 1T2EA 2ODAA 3SDZA 3L1IA 4IL5A 1DDGA 2I1QA 3O73A 4AJJA 3NORA 2JAUA 2IHJA 4DV6B 1VG9B 2XA9A 2OPBA 4YUYA 2NZ8A 1DS6A 2AMFA 2D8MA 2H0QA 3CRNA 4MVCA 3TUZC 4HEHA 3ZX4A 1HTTA 2NSJA 3K35A 4U5XA 3TW4A 2ODTX 2QX4A 3H2IA 3DLPX 3AB3A 2R11A 1XCOA 3IEVA 3JQRA 5CT4A 3RUPA 3EPKA 1Q91A 4BO8A 3T4PA 2VNHA 1P0PA 4XLTA 1EEXB 2EF0A 4KN8A 1TUEA 1ZVKA 4I5FA 3EPJA 3A8TA 5FADA 5IHXA 5P8WA 3G49A 4B33A 5CXUA 1HYQA 4EHKA 1MORA 2WMOB 3DMFA 5LBTA 3QKSB 1NTOA 1CZOA 3NRJA 3F3SA 5HJ5A 2GK7A 3AI7A 3E3AA 5AW5A 1G1MA 1LQTA 1KMCA 1L5SA 3LQQA 1BHQ1 1RM0A 3KQSA 4XYLA 4DDTA 4KR3A 1DV2A 1ZA2A 4G09A 1GIAA 1SBTA 1U65A 2XB2A 3WGZA 4R3UC 3A4NA 4QPPA 1O5IA 1U81A 2X15A 4H08A 2PUTA 4RGQA 2ZJFA 4LQ4A 3NHBA 5FR1A 3EW7A 3T38A 3ZHOA 2A2ZA 1IQ0A 5C51B 3B6KA 3JYOA 4JT9A 4BB9A 5JQGA 1XHLA 3TLGA 1YDWA 2PL5A 4JK3A 3BRSA 4IEFB 2NU8B 2WWFA 1GD1O 1V3TA 4MQ4A 3JU3A 3C2QA 4CFYA 5HM6A 2EWWA 5MHTA 3BGOS 5FUVA 4MZXA 4UASA 1L5GB 4NG4A 1QH8A 1T5TA 3GJ5A 4RHEA 5K09A 2QRGA 3G2KA 5IM4F 3T3NA 3OEHD 2AZDA 3PUWA 1NJFA 4G86A 1CLUA 1DHRA 1PSDA 4G1FA 3GUZA 1QIMA 3SYKA 3VJKA 1H4TA 2O0KA 2JKVA 5AIAA 3UA4A 3H1BA 4F2WA 1CKEA 2W6ZA 1T5SA 3U31A 3I5XA 1KRHA 1J97A 2A58A 1RQXA 2FNAA 2H9IA 2HA3A 5ETJA 3P5BA 7AT1A 5BYKA 3DLBA 2MYNA 2CMGA 2CLHB 1TKAA 2Z58A 3H9QA 3GCDA 3I2FA 4HXGA 2DKNA 1ZOPA 3IPYA 1K9SA 1NMXA 3QENA 3ZCPA 5JAZA 2JIMA 1P62B 1O77A 1T9DA 3CJRA 2GF0A 3OEHA 5K1ZA 3SBDA 4CKWB 2YKGA 3ILHA 1Z2NX 3Q0EA 4IV5A 5B37A 3W2HA 3PNYA 4BRZA 4YCNA 2RB5A 1ZCJA 3V7WA 2EZTA 2LNDA 2D5AA 3IE0A 4AUEA 5KS2A 1V1RA 1MAVA 3BXPA 4EJSA 2QL6A 4PZPA 1TVKA 3INRA 4S1TA 2X6TA 3EIHA 3OTHA 4G5GA 3TQFA 4JENA 2AFIE 1F8XA 1OFUA 4TXNA 4GBMA 3HP4A 2BELA 4MAFA 4BLQA 1LBEA 4U1RA 2AQKA 3HYTA 3E61A 3T9DA 3W6OA 1I24A 1K7YA 2X5KO 1AQIA 4PQRA 4WBSA 5F98A 1QX4A 2RJ3A 1V8ZA 4KR7A 2QVCA 3IAM6 2OGZA 4H60A 3AR5A 5ANRB 1JT2A 2TMKA 4JLDA 1UBFA 4R9RA 5ALGA 2XGGA 1EVYA 4GVPA 1MTZA 3FCEA 3E53A 3OTQA 3WHLA 1E8DA 1Z7WA 3U9TA 4BLSA 1AKEA 4KAJA 3KT3A 1TGYA 3F8WA 3GLKA 4K9KA 4NCXA 5DTRA 3WRWA 4DMRA 3QLUC 2N0SA 4L4YA 4UBLA 3OJFA 1F6BA 1W5SA 3IELA 2H59A 4HDSB 1TYAE 1TQ6A 1Z07A 1TJYA 3B3GA 1L1RA 4OU5A 3JQDA 3TOXA 1Z08A 4GPD1 5LXTF 1HURA 2JFZA 3D54D 4HLUC 5ALNA 5G0VA 1K9VF 2YVKA 1H8ED 2VAXA 3GB9A 1COZA 1FYXA 3GUCA 5E6SA 2FPIB 2DB3A 3T5CA 1DDOA 3H84A 4FCTA 5ECDA 3H1AA 4NV1A 4RIGA 4XYGA 1ESNA 3B70A 4ME6A 2PSEA 2JCGA 1L5MA 5LUAA 2YNMC 2VJCA 3RVBA 3EXFB 2ZJBA 3JQBA 4ZAZA 1Y9DA 4AU1A 2BFEB 3EZXA 5FWAA 5E6UA 3QEBZ 4ERNA 4ZYUA 1E1YA 1Q92A 2G5GX 3N2KA 3RFFA 2PGXA 5AI5A 2ECQA 4XDYA 2CLIB 3O92A 4Q1EA 2HNKA 1GQQA 2VLBA 2VJLA 3LCCA 3WFJA 4DNXA 1JQDA 5B3JA 5KTRA 3FGOA 1H8EA 3KFLA 2O3UA 4W9RA 1D5WA 3QEOA 4FSXA 1D6NA 1YE3A 2OHIA 3KT6A 2HWKA 2C7RA 5IVKA 4D43A 4IDEA 3FPCA 1D0IA 2DSNA 3RSZA 2NYRA 1YRLA 2LGJA 3DZ8A 3G5LA 1M75A 3NUZA 3OQ6A 1E5DA 4MRRA 4BB0A 2UU9B 4CUZA 1SUBA 4L85A 4RD4A 5K03A 5HXAA 1WVIA 1TF7A 1OZ0A 5BSKA 1QR6A 2QW0X 3AXSA 4GOLD 4MGKR 1VMKA 4KYVA 4AN4A 2QUJA 4ZT4A 1NX9A 1X1RA 5EVCA 2AMLA 3IUYA 5CHEA 5KTYA 4FZ3A 2AMJA 3OX1A 1IATA 3LXMA 1Q11A 2IYNA 2PFSA 2CFSA 2WC1A 3F90A 3LQRA 3KHSA 4WFQA 1NJ1A 3CSUA 3KP1A 4U2GA 4V0MA 1QVRA 1SQSA 1WMAA 3AONB 2FCRA 3BAZA 3DOHA 4AD8A 2RCNA 3H8VA 3OAAD 5M34A 1CEYA 4EPYA 1R15A 2AEEA 3N75A 4XOUA 3K6SB 5A0VA 1H1LB 3EGWA 4S0ZA 4HV4A 1KI3A 3DO6A 4DW8A 4OMCA 3WRXA 2Y1OA 3GAAA 4RWZA 1OYVA 5DGCA 2CXNA 4H7JA 2H1RA 2H0RA 3VVCA 3QXCA 3CMCO 1NPYA 5THXA 3AC0A 3H2YA 4ZEMA 1KRXA 3RWOA 3CBGA 4M54A 5GVRA 3SQNA 5B6IA 2BOVA 3HPRA 4KWEA 2MSCB 1LPPA 4P7GA 3IV6A 2VCEA 1KH3A 3PEYA 1WZIA 1ECFA 1XIVA 2VCHA 3IOEA 2FFBA 4GPAA 2OBBA 4C6TB 2Z1MA 2P8SA 1E1CB 4YUAA 4EYKA 2O1SA 1PR5A 1XQVA 3W4KA 2COEA 3OAAA 4CNQA 4B31A 4CM8B 3B82A 2C3UA 3S2SA 3GRVA 2EQAA 3K9HA 1V3VA 2QKYA 4X95A 1X1DA 4PHGA 4W9NC 4NMWA 4P32A 3L0PA 1BOFA 4YCLA 1V48A 4R9NA 1DG1G 4YUVA 4ENSA 2HQBA 1AS0A 1C80A 3KJZA 4G5HA 3DJYA 3E5NA 3A6DA 3ELYA 3IVAA 2BDEA 1A82A 4G85A 4UTXA 4PX5A 1ZJ6A 2ZRPA 4ED9A 5EYPB 1P2DA 1NYQA 3EAFA 5KJCA 1J8DA 4RF2A 4XTCS 4QQ8A 1HEYA 1A04A 4D4GA 4YI5A 3IJRA 2LRHA 3NWBA 2GI4A 2VKQA 3BSWA 4NPHA 4QYXA 2CVOA 1A9QA 4LZWA 4M76B 1XMSA 1JG6A 7GPBA 1YIAA 3C16C 3UBMA 3MWKA 1NBHA 4FEEA 2JIPA 3KUCA 4ND4A 1RAFA 5F51A 1J9EA 1BJTA 4QOEA 4KLRA 1P6QA 2HDWA 3JWPA 1FK8A 1T3GA 3GEDA 4GOND 3UH0A 1IEXA 1IJFA 3G9XA 4L9RA 4DR6B 3RS3A 4LFCB 2HJRA 3UAYA 3IR6A 1OXBB 3AGQA 3DFIA 4AUNA 4EB6B 5EHZA 2R8YA 4DV1B 4PY2A 4QVGA 1GT6A 1CCWA 1JZTA 4F4HA 4J29A 3ICCA 4KQGA 5CNJA 4ASUA 2V3VA 3IJPA 3REQA 1K06A 3TD9A 1EWQA 1BG6A 1TQ4A 2XF8A 3C6BA 3HEAA 3HNOA 1Y6RA 1RYBA 2MR6A 2VQFB 1QFSA 2OCKA 4XI9A 4DZZA 4R1NA 2TMDA 4LOHA 1HQYE 3VBCA 5CM8B 1AN0A 3DEHA 2WTEA 2IHKA 3GARA 4HAVA 2V7XA 2ID9A 3R3ZA 1T3TA 1ZC3A 1U3GA 2JH9A 3R7WB 4GQIA 1JN0A 1XKQA 2JI9A 4HEJA 2OZVA 1EU1A 1L3BA 5L6LB 4KHPB 2V7WA 2QV0A 2H06A 4BBPA 4TV9A 4O3FA 1SUFA 2Q4DA 5TPWA 5MGBA 1N5LA 2WM8A 3L0IB 3LPAA 1Y7TA 1TTPB 3JTMA 3T9CA 5TIIA 3AOGA 1YQDA 1P9NA 3PP8A 4KFUA 3F3KA 4EG4A 2HJGA 4D9FA 4JLSA 4KO8A 2WUFA 3C5HA 4KRGA 3KLOA 2HIGA 2VPWA 2BFFA 4LV8B 4UMVA 1DB3A 2C00A 2P2LA 4RMIA 4FD2A 4EH1A 3GLVA 1X3LA 4HZIA 3HRIA 5K4GA 3KZOA 3NKFA 3ZKAA 1Q7BA 5F78A 2A1TS 1MW8X 3G0GA 1I6WA 1YKSA 4F3YA 2QMUA 1CNFA 2R60A 4M1OA 1STOA 1XVIA 1ZUWA 3HI6A 4FLEA 1H6CA 3A1DA 3U4CA 2WUVA 3Q5DA 2C8LA 5EKSA 1QVVA 5JH7A 5JSHA 3A9CA 1H93A 4H7EA 1GADO 5DYYA 2J4CA 5JFOA 3HB0A 1VJDA 3DMNA 3CZ9A 3DZHA 3K1JA 2RAVA 5JNRA 4Q3DA 3AEZA 4TWBA 4R6XA 5T8KC 2ZJ0A 4ZDJA 3L1UA 2FJUA 2PD3A 1ZIYA 1ISIA 4TKLA 1DARA 5EPUA 3N3BC 3FMPB 3COSA 1MHPA 4EVQA 2I2XB 2OBLA 1JJBA 2CDAA 3U44B 1IAVA 4IIEA 1E3WA 2VJBA 1UBJS 4RYDA 4ARSA 5CB0A 2ZPAA 1CEEA 1W9MA 3EBOA 1DIBA 5BN4A 3DC7A 3VDQA 2OV2A 4TYPA 4BE7B 2B3DA 4GP6A 3ICWA 3TZLA 5CDHA 4DLLA 3IC5A 3W9BA 3VSBA 3AM1A 3UAWA 4GIBA 3O3MB 1CDDA 3L46A 4I3HA 4BCCA 3OIGA 1NXPA 3WB2A 3AV3A 4GR4A 5JJCA 3D0OA 4QXMA 3HDTA 4Y2UA 4AF7A 5COAA 2ZU6A 5H8WA 2DPGA 5EMMA 1WB9A 4DV4B 2ZIGA 3F2IA 1GAWA 3LO5A 5EP4A 1C4XA 3PC8A 4ZOBA 5E95A 3C6QA 2XXAA 1WZEA 1AV6A 2WHQA 5E1DA 4F9TA 4TZ0A 3EH2A 3RU9A 2YFKA 4LK3A 5IAGA 1NF8A 2FVXA 3MB8A 1X86B 2NVUA 3OFJA 4KN6A 3ETCA 3GFOA 2WJHA 3R1IA 2CD9A 4MUMA 3DAHA 4BC1A 4ZCIA 3GCWA 3N74A 4XUGB 2P4EA 4FE4A 4J9UE 2QG6A 5ITZB 4DYVA 5K8CA 4YT2A 1AQJA 4ERXA 2IOQA 1EFHA 2BEWA 2VNJA 3PA6A 3PEEA 5HRAA 4OLFA 1GRVA 4DR2B 3ZYCA 4N41A 1IIRA 1YGPA 3CB4A 3EXEB 3SCZA 2XKKA 3IAHA 2IPNA 5JDCC 3O8CA 2OENG 5BR7A 3E22A 1FPQA 3I6ZA 3TOCA 1IJEA 1CUAA 3WIOA 4FOSA 2ZWOA 2WKPA 3MOIA 1URPA 1SCUA 3BDAA 2PBZA 4J3JA 1QMPA 3KE8A 3SSMA 2PX6A 1XZAA 4EHDA 4YX9A 5CFMA 1JQ3A 3RW9A 3DW3X 1DIRA 3MJEA 4HGZA 2O5EA 4BV3A 4PLCA 5JQGB 1QLWA 4L4ZA 4P5DA 1R6VA 4XIJA 3R0VA 1ZWKA 1OXUA 3WLFA 4HR7A 2QX6A 4JIGA 4D8YA 3RWMB 2X9NA 1K68A 4MP8A 3VR6D 1N6IA 4FWTA 2FUKA 3DT9A 1ZHFA 1NMYA 1U9IA 2E5WA 4P9NA 2O8NA 3BYZA 1OBOA 3PXCX 5CXSA 2WAYA 1PJCA 3NEYA 2WFMA 2PMFA 4JQSA 5IFKA 4J75A 4OAPA 5JNWA 2QDXA 1L5OA 1EFKA 4EPRA 4NV0A 5T41A 1ZU4A 5FUMA 3IJ5A 1PYOA 3QVTA 4UKDA 2PRZA 1YDEA 2C1EA 2YQZA 1H4VB 4Q1AA 3G5MA 3EXIB 3GAMA 2J9FA 4WCFB 3IKJA 1YCDA 3LQ2A 3Q6MA 3G23A 1G3IA 3TYXA 5CCXA 1JR6A 1E0SA 1E9EA 1QYVA 2HCFA 2P1RA 2PH7A 3DVRX 3C39A 4N3NA 4O29A 1PQUA 4P4UA 3VR6A 1A7JA 3B51X 1JA9A 3QA9A 3VGJA 3JQ8A 4ZO7A 3URMA 1XXHE 2NSYA 4PBSA 5K8LA 3B7PA 1UMDA 4OHWA 2WWYA 3AW9A 1ZUD1 3CZ4A 1MV8A 3QU9A 4QYIB 3LHDA 2O8VA 2N1BA 1PIWA 1NE2A 1TAHA 3C7TA 2FN8A 3N6XA 1SB8A 2BEUB 1Q74A 3FH0A 1A98A 1LVHA 2CLLB 4F3RA 4KI0A 4BRWA 4IVQA 4HDNB 5DK6A 3W6PA 1JH9A 2VQDA 3GJ7A 1QHEA 1P2UA 3FZYA 1O95C 2QTWB 1THMA 2OORC 4ZZ2A 5JD6A 1MRNA 2RGNA 1NY6A 3ND9A 4HUJA 4NU5A 3OHSX 1FS5A 1Z15A 2FG7C 4QPDA 3RRMA 2BUCA 5JMTA 2Z4TA 4MPDA 1QKIA 2IHUA 2NX2A 3DS8A 4UM5A 4BFXA 4IAOA 5A0FA 3U3MA 5IT5A 2PNJA 3UMJA 1YOVB 1NBOA 1B0UA 1VE9A 2WI8A 1CUUA 2Y1DA 2RGWA 4W1SA 3PK0A 1L6RA 2QNIA 3PJEA 3KJXA 2PKRA 5JNSA 3PKZA 4NBSA 3KEQA 2B4RO 1JPJA 1FBTA 4FCCA 1FDWA 2ZSBA 4ECEA 2BFCB 3EZ2A 2NUAB 1E9CA 1OXTA 1ZSNA 3R0JA 4ZAXA 2IH5A 1IQRA 3GEHA 1WABA 1RXYA 1F9AA 4MI3A 4BVHA 1Z18A 1YOBA 4RHXA 2BGNA 3DR3A 4EG1A 1R8SA 4KPEC 1DOAA 1XA0A 2D4AA 5KC9A 3U48A 5CVUA 1MQSA 2D13A 2O3JA 3O83A 4QC2A 2ZRLA 1OFTA 3FHTA 3D7KA 1L3IA 1RBMA 2EV9A 4EUFA 2PFGA 5D3QA 3KJHA 3DHNA 4NBUA 2O7RA 4JELA 5G4KA 2YZNA 4B3BA 1WXGA 3ZGOA 4OH7A 1XNRB 4DREA 1X1TA 2ORWA 2IGTA 2I2FA 4LX0A 2CNOA 3FWYA 1Z73A 2CHQA 3EMDA 1POXA 4BJ5A 1IYZA 3FROA 5FA5A 4TRRA 3A6HA 2D1FA 3AUXA 1LWNA 2YN0A 3ZZ0A 4YQFA 1ZHHA 4JX9A 1HE1C 5T3UA 5JSFA 3LY5A 3V42A 5B1DA 1I4WA 3NC4A 1EFTA 4PW0A 5EJ9A 4LF7B 2CN1A 4HGOA 4E51A 5KOJB 1G41A 1U8EA 4Q4DA 5TNXA 4P3PA 4RZHA 3TLKA 1BXKA 3H9UA 2CHVA 2J9ZB 5IVDA 5BQPA 4CKYA 2E7ZA 3VV3A 2V54A 4E3WA 5AW7A 1XMQB 2ETXA 3IHTA 1ML4A 3L04A 4PF1A 4GNRA 4ZI2A 3COWA 4GI1A 4PYIA 2V4UA 2HHCA 1MR3F 3PDUA 1PWXA 1N57A 3FTQA 3H4TA 3RC3A 3ZS8A 4Z49A 1NXTA 2ZTHA 3W4IA 2AK2A 5REQA 4R1SA 3N2ZB 4OFWA 1G66A 4Y1RA 1XRPA 3PQ7A 5B55A 3IR5A 4CVNA 4AECA 3U6BA 2FPGA 2EC5A 2JHPA 2Q29A 4DDVA 4OKSA 3LCMA 2W4IA 4IIJA 3AR6A 4A26A 5CVEA 5BNIA 3WJ7A 3HQ4O 1PJRA 3FYCA 4Z4IA 2AC2A 1Z4KA 2OAEA 3ZXXA 3VFDA 4D8XA 2XNKA 3L92A 5TC4A 1Z39A 4I5DA 5KJFA 4GUAA 1B15A 3M7IA 4FI3F 4XKJA 1QPGA 3KDPA 1AD2A 2LD4A 3HCPA 3CN7A 3E48A 2JZCA 5ESWA 1LC0A 2YH2A 1W36C 4LVNA 1Y4AE 4R1UA 1H0KA 1D07A 4Q7JB 3W7BA 1XC7A 4M9QA 5EGNA 1AMOA 4EB0A 4Q9KA 3TOSA 3RS5A 1VC2A 2HGSA 5I47A 3E9CA 4CQNA 2VDWB 5EXSA 4FNMA 1KWKA 4W6ZA 3V32A 1JU4A 5B7GA 4IOKA 4FW9A 3ICVA 4CEHB 1NVTA 3L8CA 3CURA 3E5MA 1CWUA 4N9WA 4NFHA 3KR9A 4YREA 2DKFA 4KODA 4A0FA 3HUUA 3MELA 1GKKA 1TJ3A 4AY6A 3EVGA 3LCJA 1Z8HA 3PKIA 4EY8A 1Z6QA 4ZVKA 3M6MD 4GOXA 3V00A 3H5VA 2HLNA 1C1YA 3DDSA 2NZXA 5CVDA 3IODA 3PX2A 4FFDA 3KETA 3NU1A 2RBKA 5JE8A 4M38A 2WP0A 3UXMA 4TRJA 4H4CA 2H4WA 5FRDA 1CUDA 3Q88A 3V1UA 2GAOA 3OLXA 1MMFB 1W581 3AO0B 3OZDA 2V7UA 2PKCA 4WZAB 1RQ7A 1VKOA 2ZTLA 4M60A 1XA4A 4O59O 3OFND 5LWHA 2HSEA 4H0NA 1ECLA 3K0KA 2CWDA 4IV0A 4P4TA 2Z43A 4X7MA 3LT0A 4ARCA 2A59A 5L40A 4WKNA 1GPLA 5AJZA 3W3ZB 4D0GA 4HS4A 1DC7A 3USCS 4DILA 3X1YA 2JH3A 1RR6A 2ADMA 4FOPA 4DA8A 4PE5B 3IDQA 2I4RA 1N2CE 1JHPA 2VJMA 5TARA 1U8TA 3ESQA 4YS6A 1P81A 1W34A 2R7MA 3R5TA 4K40A 4NH0A 2OQVA 2J32A 3HZHA 3GJ4A 1KAGA 3RJ9A 4L72A 4TZTA 1TK2A 2GEUA 4RL4A 4X0EA 4YDHB 5J9FA 3SOZA 1PW7A 3HADA 3RU2A 4F9GA 1JEQB 2D1SA 3K1TA 2SICE 1ZSYA 1YACA 4PSUA 3OFNA 4WMLA 5KNBD 3DFFA 1IDOA 3I6BA 3REGA 3VR2D 4TTQA 2ZYUX 5B4TA 3PXEA 3KTAB 3OOYA 1TYEB 3A1SA 2EEPA 2HPVA 2P9TA 3G9TA 2H1IA 1M74A 5EWJB 1U1DA 2FW0A 3ZR4B 1E2UA 3EVBA 3UNXA 3VR3D 3MWDB 2RMKA 3QVUA 1I3CA 3UMYA 1X14A 1W48A 4U3JB 3LW8A 3LBAA 1GFZA 3L18A 2JI4A 1NN0A 1X7ZA 3M49A 3U49A 4O63O 1W5TA 3KJFA 4QFBA 4QGGA 3OT4A 4LHSA 6LDHA 1H6AA 1QP0A 1AKRA 1CZHA 1YT5A 2YC4C 3OZAA 3JWGA 1HLFA 4OK5A 2E5LB 5DM4A 1UPXA 4PG4A 5EP2A 2VJAA 3CNLA 5FLEX 3R7FA 4JP2A 4KQCA 3P97A 2PXHA 4MWTA 2QP9X 3SYMA 5E3HA 5KNBA 1WMEA 3QKSA 2Z9CA 2Y1FA 1QONA 3VR2A 4INJA 2PUDA 4WDQA 1QH1B 5DHFA 5AVYA 5K0EA 4I5IA 2VH1A 3T4UA 2D1YA 2L17A 3ANSA 4QU8A 1TUIA 3WIBA 1PE0A 1Y6QA 2ZI6A 4M3NA 1GPH1 4IJVA 3VR3A 2I2CA 2P1ZA 4WXPA 4CTMA 1VHLA 1VG1A 3BA6A 3IHLA 3ESRA 5KQSA 1M6VA 2W2OA 3X2SA 1L5FA 1YMUA 3LWZA 2OO5A 4Y6GB 4NJOA 3S1LA 2WEKA 4WTOA 2RBEA 3MXOA 2AGVA 2FZVA 1AKWA 3B20A 1P9WA 5C8VA 4P31A 3EVCA 3R6DA 4E5DA 4DT1A 2F9FA 5E2IA 5JEEA 4RLFA 1BQEA 1NVFA 4HVTA 1DQPA 5J5VA 2L0XA 4DM7A 1LSJA 1WM1A 3CT4A 4JSTA 5AESA 5F7OA 2OECA 4YJ2F 5B1YA 1EK6A 1WDKA 4ESHA 3EVZA 3N2GB 4JMPA 1U9JA 2EZ9A 3LLVA 3OLVA 1RRKA 1X42A 3DFZA 3TECE 1GZUA 3UYLA 5IKPA 2QXUA 3W06A 4E21A 1QG6A 4NHOA 5AKIA 1OAKA 2F1OA 3ESDA 1N2EA 2ODPA 1ABEA 4K28A 3DF7A 2JGRA 1L8AA 2QIPA 3UAVA 3IXQA 1IC6A 1JAIA 4RE5A 1YZKA 4KWCA 3PUJA 4ONEA 4OREX 4PG5A 3S44A 2ISSD 2QZZA 3TNJA 3LY8A 4IEIA 2AEMA 1K7CA 3E7WA 3ONWA 1QIDA 3CVJA 4FN4A 1Q57A 4BGVA 2R48A 4IINA 1SCAA 3CUKA 1GQRA 1OGYA 1TYCA 2Q5LA 3FTNA 4J1NA 2ZJ5A 2XB9A 1VXRA 4E11A 1K8RA 3VJMA 1KFBB 1TQ2A 4UVGA 3LUKA 4ILKA 4YCAA 3WYCA 3NHAA 2QUAA 4ND2A 4NNOA 4B2LA 4BO4A 4KVZA 4EEXA 4OBBA 3RHTA 3AF0A 5DIFA 2D74A 5KQMA 3D6NB 3HE3A 2F3SA 3PUKA 2BTQA 4I14A 2AR0A 3K9WA 3EDOA 2L42A 3IPRA 4P98A 2RGXA 2W6QA 3C85A 4BQOA 4DV2B 1GAQA 4K6MA 5K05A 4P3KA 5DPMA 1T0HB 2PZLA 4B8YA 4K46A 2EU8A 4IDBA 1KQOA 4P7BA 3CZAA 3U7QA 3GO4A 2Z5LA 2CE2X 2JD1A 1BA2A 1VYUA 2VI5A 2BE7A 2CXTA 3HMKA 4GI3A 2PRJA 1CNMA 1WCIB 1XKTA 2JNWA 5I51A 5L45A 1XZDA 1HNNA 1B00A 1JZQA 3GYGA 1SOVA 4X3PA 2EZUA 1C7ZA 2NTNA 5EUBA 3RNLA 3GLQA 3IAEA 4YTEA 3SPXA 5TVKA 4QTTB 4K86A 1ZJZA 5LMZA 3CB2A 5DISB 5K0JA 1YFLA 1QBGA 2H1OA 5ICGA 2WABA 4ZQGA 2X3UA 1FDTA 1YCFA 2DUJA 3CKYA 1FNBA 1MOPA 1UQRA 2QVLA 1WCXA 4FNAA 4YALA 1A4UA 1CLEA 4MQ5A 3DBOB 4RVNA 4GGPA 5KTNA 4X65B 2QT0A 3PSHA 4YYEA 4JLJA 1ZFNA 3A6ZA 2R7LA 4WIAA 5CJ2A 3SG0A 1SCQA 1T6XA 2H2FA 3IS3A 1NNI1 2CNKA 2Q2NA 4KQIA 4KPUA 4QGHA 5CIQA 5DFAA 4BX9A 4U2FA 4L0QA 1N2BA 4GSKA 2D3TA 1ZZEA 2QUBA 5CURA 4P2GA 4E03A 3KT8A 3IURA 3O95A 2BKLA 1W85A 2X1VA 3EXFA 1H3EA 5CFQA 2BFEA 3D3QA 1IHOA 4HRVA 1CTQA 4AJ2A 1G20A 1XNGA 1EFPB 2OLKA 1VP9A 3M5PA 2O1XA 4HSEA 2HLPA 2PNFA 1NATA 3OT1B 2WIFA 1L7OA 4U2CA 2WMNB 2GZRA 4WZ6A 5HPYB 3WS7A 5C2JB 3AI1A 2R25B 4KZPA 4CMEA 4IHJA 4WVLA 2QPLA 3ZCUA 2YZ2A 5JZ9A 1VSQA 5C8YB 4F5EA 1KORA 5KTTA 3EY4A 1ML3A 2C2MA 3TCXB 3UENA 4MJ7A 4F72A 2VJNA 3HRKA 5K6AA 1IXSB 1BD3A 4PIPA 3VMMA 4IZHA 1U2EA 5H9WA 3KZCA 4R2WA 1VECA 4MKGA 4HYQA 1MRSA 1YZ3A 1JI3A 3P4UA 3CINA 3I4CA 4CIAA 1DEAA 2HL6A 3FSJX 1NVBA 5LZ4A 2I6UA 4IIUA 1EQ2A 3L8EA 1JF8A 1I7DA 3R77A 2A5FA 4EKDA 4F4FA 1KC1A 2XH8A 1DKUA 4QQFA 3ELWA 1E3JA 5HFJA 1KYYA 4UD6A 1XQ6A 2XB4A 5IG2A 3NGXA 2X0EA 1T0PA 2H4ZA 2MR5A 2ZIXB 4PS1A 1AUPA 3ESYA 3X1JA 1LK7A 4PZLA 4HNUA 1BCSB 1Z9BA 2VAMA 3GLGE 3F97A 5B4UA 1P4GA 2FEAA 4BVJA 4XWOA 1DGQA 3HY3A 4HZGA 4LXXA 5LFAA 3E9NA 3L7OA 4FILA 5JBQA 3QVSA 4J0GA 4C6RA 5JPDA 1UOEA 1A8SA 1YJBA 3IULA 1XKLA 1NIJA 4I08A 5K01A 1QOPB 1TU0A 3L1KA 5AT1A 1MGPA 1NVVR 1Y81A 3DXXA 5LLSA 4RV4A 4MPRA 2BSAA 2HK8A 2WD9A 3L82B 4AM8A 3THSA 4UMFA 1T8YA 4YRDA 3W34A 1XJCA 3HU5A 2PZEA 2P90A 1VZ2A 2NZUG 2AUNA 3MMPA 4QBFA 4I1RA 2BCEA 5ES3A 1TZJA 2A5GA 2D0DA 1KEZA 2I8CA 4GMKA 5HK9A 1P29A 2Q1XA 2OCAA 1NBME 4YP9A 2CL0X 2F43B 4MNTA 1GSHA 3I45A 3TAUA 1YFKA 2QTMA 1GKIA 1J22A 2Q9CA 4OQEA 2COUA 3T6KA 4DG8A 1KIFA 3L4SO 2H07A 3N0VA 4FSHA 5KWEA 3G85A 3HCOA 4X00A 4Y0NA 1EWRA 3LT5A 4G4SO 4JLVA 1L5RA 2Z2XA 1BN7A 2XMDA 4RAOA 4TKMA 5LU9A 4ZGBA 5LQUA 3AKYA 3FA2A 2WOJA 2XUIA 1SVKA 5FFMA 2P0AA 2RHWA 4ZC8A 1N0HA 2C88A 4L27A 4FM9A 2XWPA 3QMPA 5G0UA 4DHWA 5BUZA 2FWBA 2WD7A 1BEEA 4JOQA 1E79D 4ENUA 4JA2A 1QQBA 2DHRA 1PYDA 1CJVC 2G1UA 1KNXA 3KTDA 4QGFA 3ZHBA 5B2ZA 4CKZA 3D6UA 1BFDA 2FWAA 1T0JB 4IRMA 4JJZA 2NPFA 3S81A 2XHEA 4QJIA 2DERA 3NDBB 3G6KA 3MT7A 4GM4A 1GKLA 3LP8A 2CBXA 3NGMA 5EMNA 2R7NA 4GE0A 1XVUA 3WNBA 2GNOA 4OB6A 3CVUA 4DQXA 4RD2A 4YP1A 5CA0B 3QX8A 4XGRA 3RS7A 1HDCA 4BLWA 4DCUA 5C1DA 2YWHA 1WULS 4IRUB 3H99A 4QFCA 4OGKA 5BWCA 4JYAB 1LDMA 2MSLA 4KBYA 3TK1A 5L3QB 5DYWA 5CJPA 4GE3A 5H5JA 1H9CA 3A7EA 3DOJA 5HE8A 1JPNA 3WGMA 2AYZA 2RONA 4GS5A 1N6LA 5BSFA 4LE0A 1J2YA 4R1OA 4EB6A 3CNHA 1E79A 2AL7A 1KC3A 2IYZA 3AL2A 5I4KA 2ZUFA 3C3KA 3D8BA 1BVRA 4II3A 4KXUA 1P2SA 4E4TA 3MHPA 1BDHA 4K3VA 3RKRA 1SUCA 1R6UA 1QOQB 1E5XA 3K5WA 1W6RA 3GFRA 2G17A 2H11A 3NTLA 3HUEA 3UAOA 5JZBA 1QCYA 4JR1A 4M88A 3COZA 3AFIA 2D5BA 1WY7A 4D8VA 1Y7PA 3OQNA 2I7VA 4FFNA 4RZUA 2QWXA 4RK1A 2VPXA 3NHRA 4GMXA 5FA6A 4D9MA 4AJIA 3H87A 2AD5A 5EHNA 2CJWB 1KMQA 3LX8A 3CKLA 3HP1A 3EAQA 1K66A 2FUCA 3P9KA 4U6QA 1US8B 2XUDA 1K8XB 3OF3A 4C05A 1H05A 3WK9A 2M2IA 1WHSB 5E6SB 5E2AA 5FD8A 1NW4A 2O5RA 1ZK0A 1LBSA 3HC7A 3K5HA 4TTIA 2WBLC 3BGSA 3U61B 4L6CA 1E5LA 2PRKA 5GONB 5LZ7A 4CM4A 4DIMA 1MCZA 3QKWA 4JYZA 3INGA 5AJYA 2IYAA 4ZTZB 3MCZA 1PT6A 4UARA 3RAGA 2P2NA 3CA8A 4WLFA 1NG1A 3TZCA 3VC2A 3WGOA 3VR4H 5JYEA 5B12A 3EJ6A 2Q7DA 2RHOA 2XYQA 3GLHA 3NHLA 2B7CA 4LFAB 2CNNA 1C5KA 1UXKA 5L3VA 1EZZA 4FNGA 1B41A 4R3NA 2I5PO 4B7XA 5IF9A 5CEJA 3R4CA 5HSGA 1XSEA 3BKXA 2ZJOA 2Q5JA 3ZIDA 1QCCA 4NRDA 1XRQA