3RANA

Canine gdp-ran q69l mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
201
Chain Sequence
GEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Q69L mutant of GDP-Ran shows a major conformational change in the switch II loop that accounts for its failure to bind nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Transport protein
molecule keywords PROTEIN (GTP-BINDING NUCLEAR PROTEIN RAN)
total genus 59
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ranA00
2GAOA 4RD4A 1COWA 4A9AA 4RD3A 2W0SA 4FCWA 4IDNA 3LQQA 2WJGA 1G7RA 3WNCA 1XMSA 2G0NA 3IBYA 3K0CC 5ANRB 2GXAA 2IYLD 3SE0A 1U2RA 5HZKA 4H1UA 4KFTA 4UNSA 2YNMA 1I4LD 4DSOA 2UVQA 1W46A 4PO9A 4FINA 4PHTA 3A4LA 4TYQA 2FH5B 4DT1A 3DVLA 2O8BA 2IYZA 3BGWA 3HYTA 2ZI4A 3AUXA 2R6AA 3I72A 2VHJA 3UXMA 2ZVPX 2WIAA 2NGRA 5EZ5A 1WRBA 2QAJA 2ODWA 3LBHA 4JBWA 4MKGA 2IF2A 4PQRA 3EXAA 2W6JD 1DOAA 5DLQC 2O8CA 4Q9IA 4AY2A 4LYHA 2UZIR 1II9A 1N5KA 1GVNB 3L8YA 2DWPA 2WWXA 3IDQA 3TUIC 2JATA 2N1BA 1Q1QA 1GFIA 3SS8A 4EQ6B 3WNBA 4OQNA 4I81A 4OI1A 3K0CA 4F38A 4LJ9A 2GAAA 3KTAB 5EE0A 4URWR 3W34A 2ZE7A 2Q3MA 1TMKA 1I2MA 3NKVA 5FBVB 4AG5A 1H65A 3KFVA 4ZPXA 4CEJA 5DSZA 2JJ8A 1K5GA 3K9LA 5EP2A 4O0MA 1E0KA 3KJIA 3SOPA 1DPFA 4TLCA 3K09C 1EFTA 4GRAA 4E07A 1N6KA 1G20E 2BCJQ 4FMBB 3R9WA 1QG4A 3GEIA 5FPYA 2XAUA 1ZJ6A 4GOJA 3R9IA 2V9PA 4KFRA 5EE5B 2FSIA 2I1VB 4DLZA 4M22A 4C0KA 3CO5A 1KDOA 1MOZA 5CK5A 3FYHA 3ZVLA 5LBIA 2XNDD 2ZRPA 3S1AA 3AVOA 3DOFA 4PPNA 2XZLA 3KFXA 3TRFA 1ODFA 4RJLA 2YKGA 3AP1A 4Q7KA 4KCGA 2GWHA 1S0UA 3U3KA 5L3QB 1W4CA 1Y63A 2G83A 2B21A 2Z0MA 1SKYB 2NQ2C 3KJHA 5FBRB 1Z0IA 3QF7A 1ELOA 3U6KA 4CEIB 3FVQA 3CUEF 2J0UA 3W3ZB 1W7AA 5FPKA 1R5OA 2ERXA 1FP7A 2BJVA 3NHAA 2FU5C 3QKSB 1WF3A 2GZHA 1BIFA 1GL9B 3MUFA 4R2HA 4MYCA 2EU8A 3PXGA 2ZRGA 1F5NA 3CW2A 2BM0A 1MKYA 4M0LA 4YMVA 2EFHB 5DYIA 4BGDA 1S4QA 1Q3TA 2REBA 1ANKA 1UPTA 3THXA 1XCGB 2JLSA 4DCTA 2EFDB 4N0DA 3DZDA 4EIWA 4NCIA 2ZSBA 3CX8A 2XITA 3SYLA 4H1VA 5B30A 1T0HB 3B60A 3ZVNA 3WP1B 5KNDA 4WW0A 4V0LA 3JVUA 1OB5A 2WWYA 3IGFA 3H84A 1PLKA 3H86A 1SQ5A 2QP3A 1R0WA 3X2SA 4A8JA 2F1HA 4H9GA 2GCOA 1LFDB 2QTFA 4K46A 1QHSA 2A5JA 4EQ6A 3QXJA 1G7TA 4A1FA 4G5RA 4A8JB 1N6RA 4YDHB 2A30A 1HQYE 1JPNA 1OKKA 1U8AA 1VHTA 4B48A 1T9HA 1ZC3A 3TBKA 2GK6A 2BMJA 4EPXA 4LJAA 3ICQB 1DE0A 3GJ5A 4IXMA 4ZKEA 4JVSB 2HXSA 3QBVA 3HU3A 1RRPA 4HATA 4V0NA 1C9KA 3BFVA 3LFUA 3Q5DA 4QBFA 1KKLA 1G6OA 2X77A 3JZMA 2P5SA 2XZPA 4HLCA 3UMRA 4OI0A 3HPQA 3KB2A 4RCYA 2A3RA 3T1TA 4M1TA 2D74A 1TAGA 1OT3A 1Q12A 1PLJA 1KOFA 4MKIA 5HCNA 4ZV4A 4C7OB 3CZPA 3L8ZA 1ZUIA 3BFKA 1VG8A 4KHZA 1E2MA 2J41A 1VG1A 2FFQA 3ZD7A 3THYA 4KVGA 2GBLA 2OBLA 4FXPA 4KU4A 1TU4A 4G5OA 1JXMA 3SQXA 1Z0FA 4Q9HA 1C4OA 5GADl 1Q57A 3U7FB 2O0HA 4PANA 2LKCA 2ONKA 3GJ6A 3KXKA 5CLQA 2V6IA 1W5TA 2DCUA 3W5IA 2J0SA 3PUYA 1W49A 3MWYW 2REOA 3NH6A 3ZIAA 2GEDA 4L4UA 1NBME 3SDZA 4WZBE 3OIYA 1Q44A 5FBQB 4BLOA 1OH6A 1N6NA 5KDDA 4MYUA 4KAXA 1ZM2A 5FL7D 3LA6A 2IA5A 5KPDA 3HR8A 5IF9A 2HDNB 4JLKA 2EWWA 5J40A 1AKEA 4DZZA 1KI3A 1PLLA 1HY3A 3CR7A 1E9CA 5TMPA 1IXSB 1TUIA 4E03A 4JSTA 1CR2A 1F6BA 2G9NA 1SVIA 4GSYA 3THYB 4R7ZA 4JT4A 1R6BX 2EW1A 4NPHA 4OL0A 4CT5A 2HT1A 4DIDA 1NJFA 1OJLA 2R6CA 4EFMA 2RGXA 4GBMA 1M7HA 5B2ZA 1GRRA 2QMHA 5F98A 2IS6A 4XH9B 4A4DA 2YWFA 4AYTA 2PZGA 3T35A 5E3HA 2VP0A 1XPRA 4YXWD 1DAGA 1NSTA 1YJ5A 1X86B 1Z6TA 2Q3HA 4IOLA 1JB1A 3TUJC 3BIFA 2AKYA 3OEEA 1A4RA 3QEJA 4X8HA 2ZSDA 3D6TB 1IBRA 1OXVA 2FSGA 4OHVA 5FBLB 3C16C 3QKRA 3FE2A 4PHFA 1Z28A 4NP6A 5J4HA 3LH5A 4P0TA 4WVFA 2DFKB 2CL0X 4XSHA 2FN4A 4Q1CA 4YMSA 5SZIA 1NY6A 5TV2A 5AR1A 4DB2A 4KSCA 4L16A 3LNCA 3MWKA 2IWRA 6Q21A 1CJKC 2RKOA 3SFVA 2FNAA 1CP2A 1XCMA 4ZI2A 2R6GA 1XU4A 4G5SA 4A6PA 4ZIRA 4NTZA 1GTVA 1C1YA 1E9AA 1CXZA 3TR0A 4G1UC 3AGQA 3FHTA 4GP7A 2P67A 3MJHA 2XZOA 4FIDA 4BWYA 1P6XA 1ZM4A 3QJYA 3PUZA 3EARA 3SJCA 3VR1A 2CCKA 1ETUA 2VA8A 2CHVA 1Z6AA 2GXQA 1WQ1R 3VR5A 4EFLA 1V43A 5L3SA 3VX4A 2HYIC 5JSZB 4ZDJA 1NIJA 5JI2E 1V5WA 3QKRB 4IOKA 5K8LA 4C2UA 1KO1A 3GLGB 4LZZA 1W0JD 3DM9B 1T0JB 1P9RA 1Z08A 2ZR9A 3GLFB 1DAKA 3Q9LA 5CM9C 4QRHA 3EPHA 3U3JA 1XZQA 5KO2A 1Z2CA 2ZU6A 1KJYA 1TNDA 2JLXA 2N42A 2ZJBA 2PCJA 4TYWA 1LV7A 1NN5A 5L3QA 5FOTA 3WYFA 2JJ2A 3VQTA 4D25A 2CLSA 5CLLA 2J45A 2W00A 2O8EA 1SVSA 2VHQA 2ZUCA 1FQKA 2WPDA 1IY1A 2PT5A 1O3YA 1X3SA 4QXAA 4B47A 2OBMA 3DMNA 5L3RA 1W0KA 5HZHA 2VIIA 4PZZA 1T91A 3CRQA 3QXCA 4AIIA 2YHSA 5CYOA 1G8GA 4O2RA 2F6RA 4YLGA 2R44A 3MSXA 5FTNA 1D2MA 1M34E 4LGMA 2PH1A 4A2PA 2O8DB 2XX3A 3PUXA 2FPMA 3VHLB 4M1WA 2O0KA 1MT0A 5FPSA 2H1LA 4JL8A 1VPLA 3AM1A 1VTKA 4JIMA 3FOZA 1GIAA 2YC2C 3KXIA 1KY2A 4TL7A 4TSFD 4V03A 3IQXA 1XFAA 2RCNA 1NMZA 2QT0A 3LW8A 1ESMA 5KNCA 4R98A 4AKEA 2J0QA 1ZC4A 4YQFA 4DB4A 1NLZA 4QHSA 1KK1A 4M1SA 2FJUA 2FOLA 3QUSA 1FNMA 1CJMA 2RH5A 3DM5A 1F2TB 1KK0A 5GJVC 2A5GA 5HKKD 3VHXA 2ZYVX 4HSEA 4Q1FA 1VG9B 3C41J 1DG3A 3REGA 2GXSA 3SHFA 4LHYA 1WA5A 3AF1A 3T12A 2A7QA 3OIUA 3QNUA 4RD0A 4KYIB 4F4IA 4Q01A 1VCNA 4V0MA 3EC1A 1IN6A 3PENA 2XTMA 3QIAA 1E9DA 1JNYA 4IFEA 5FTMA 2R6DA 2ZRAA 3TH5A 3ECCA 3H2YA 1DAFA 2XNDA 4WIAA 3Q5EA 2GJAA 1W48A 5JI3E 3RWOA 5FFMA 1E2LA 4LBWA 2C96A 3EC2A 4D0NA 1D6JA 1FUUA 5KSYA 2P6NA 4TZ6A 2ODBA 4Q9LA 1N6HA 2EYQA 3NC0C 2ZRKA 3RRMA 3KL4A 1AM4D 1F48A 1SULA 3NHBA 1E0JA 4EFNA 3KUDA 4TLBA 4WAUA 4XTCS 5JWOA 4HB2A 3I3SR 3U44A 2BBOA 3BXZA 4EAQA 1YZQA 4LBVA 4XVRA 4US0R 1E79A 3LBNA 4JL6A 4LPSA 5EP1A 2C95A 3PG5A 4LBYA 2IYXA 1M7GA 5FTKA 2IL1A 2F9LA 3KKMA 3MWJA 1OH7A 1MO4A 1P75A 1VCOA 3EIQA 4IEIA 1GOTA 1KO5A 2NO6A 4HAUA 2WWGA 2BBSA 2G1JA 4LJ7A 5JCZA 2IXEA 1E2JA 4EPYA 1MO6A 5HTKA 4K81B 1II0A 1OHHD 2B92A 3D31A 2TMKA 3OZXA 1AIPA 2YOFA 3C14C 3O47A 3V4RA 1R10A 2AKAB 3THOA 1ZIPA 3CLVA 5FL3A 4JLVA 4LHVA 4YC7A 2JLZA 2ODEA 4OI2A 3P4YA 1Z07A 4URYR 3L0SA 3CX7A 3EAQA 4PR0A 4Q19A 4TT3A 1J2JA 4C0AC 1OW3B 2KBEA 2WAYA 4D4KA 4XD7A 1FQJA 2HYDA 1IJFA 2C9CA 3VX3A 3ICEA 4KO8A 4KITB 1ZM3A 4C0QC 1SZPA 1P62B 2CVHA 3QXXA 3L0IB 2FEOA 2ZROA 4LHXA 3GLIB 3K0AB 1TF5A 1P3JA 4MRVA 4FMDB 4HB3A 2CL7X 5C2JB 4IKEA 1NG1A 2ANBA 2CEAA 3CONA 5JSZA 1F60A 2GVZC 2XB4A 4US1R 2ODNA 3K0EA 4BEJA 4TYYA 1NBMD 3VTKA 2H7VA 1YZUA 1IOZA 1Z3IX 3M0EA 1FOEB 5IDVA 3OE7D 4DUGD 1GWNA 1ZAKA 2BVNA 3PR1A 4A2WA 2JDID 2CL6X 3BE4A 5DNYB 4LV5B 1XTSA 3IILA 3JZAA 2DWQA 4ZIRB 3TAUA 1TF7A 4MKFA 1G17A 2F3TA 1RPZA 2ZS8A 3SU8A 3AB3A 2QPOA 5KDOA 2P2LA 2LCFA 3HU1A 1OH5A 3EWSA 4DLRA 1GL7A 1S2MA 3IIJA 2OLKA 1YHNA 1NIPA 1KI9A 1RC8A 4KVAA 2FDCA 2YC4C 1KK2A 2QAGC 1NLFA 2BM1A 4B3CA 3PUWA 4FMCF 4XWAA 3A4MA 3AH8A 3LBIA 4Q1AA 4JLOA 3CX6A 5BN3A 4MYHA 5KSOA 3IHWA 4M53A 2EFEB 2QT1A 3DKVA 2PL3A 2GF0A 1SHKA 2IHBA 3B1VA 1NG9A 4TLDA 1JI0A 5CIQA 5JMTA 4QNRA 1P9NA 2O52A 4OQFA 5JEDA 3EPJA 1WXQA 4Q4AA 5JRZA 3U7EB 3T61A 1DS6A 3N5CA 4B3BA 4ARZB 1G8YA 4BE7B 3WHLA 5KDLA 4FWTA 4QOSA 1NKSA 2OFOA 2BMDA 3TR5A 1GRQA 1ZVQA 1W36D 4AI6A 1A7JA 1P2TA 4MGYR 4LJ8A 4M1YA 3N2IA 1HT1E 3DPUA 4BLTA 2JAQA 4U00A 3A1UA 1RRCA 3CZQA 3T5GA 4PHHA 4MH0R 1OLOA 1AS2A 1JQJC 1P9WA 1JQLB 3HPRA 3SYKA 1L7VC 1A82A 4KODA 2NG1A 3KKQA 3HDTA 1D9ZA 3LXXA 3SYNA 4CF7A 2VHUA 1Z6XA 2EFCB 3SJBA 3AV0B 1P2UA 2ZI3A 2ZUBA 4Q1EA 4C30A 4W5WA 1OYYA 4U7DA 3C4JA 2CHGA 4TTPA 4BLPA 2WPDD 2XNSA 3LVQE 1IN4A 3MGCA 4Z1MD 3R9XA 2EFGA 1WBBA 1Z29A 3U60B 4N3NA 2W58A 521PA 2D4HA 3OAAA 3Q8XB 3E2IA 4ZKDA 1BO6A 2ZRIA 2F43B 3QBTA 4LHZA 4A15A 2FFBA 5FOVA 4JLDA 4TT3D 3GFPA 1OFTA 3GLHE 1CS4C 2ZRBA 3GFOA 2C04A 5HPYB 3L0PA 1AA9A 1N5LA 3KQKA 1JBKA 1UKVY 3T34A 1M6NA 5HE9A 3ZZ0A 4MDFA 5F3WB 2WJYA 1AQYA 3FKSA 4P31A 4BECA 4UNRA 2A5YB 1JEEA 3LLMA 3KKOA 2QMOA 2XXAB 4I1UA 4JLAA 1CU1A 4DLUA 3QE0A 5DI3B 2QQEA 4BQSA 1BYUA 3K0FB 5TB5A 1X1SA 5TDHA 1NVUQ 2C03A 1OIWA 5K8IA 1Z6GA 5KSZA 1FMJA 1D8TA 4POAA 1NNEA 1U0LA 3IPYA 1SKQA 2ZE6A 2WJVA 2PZFA 1T4GA 4PSAA 3X1DA 1E99A 1NRJB 4JVNA 1IN8A 2ZS7A 4JZKA 1WE2A 1IY2A 1QF9A 1YE8A 3U3OA 1Z22A 4C0HA 2QBYA 1J8YF 2VPPA 2ZJZA 1S8FA 3BOSA 4P33A 3O8CA 1BH2A 2G3YA 3LV8A 3ZH9B 2FSHA 4NE2A 1JR3A 4HDOB 1LNZA 2Q0HA 1R2QA 1X8KA 2ZRDA 3HYRA 1QHYA 1MO3A 3U44B 4KV9A 4QC2A 3SQWA 4LK2A 1E9RA 3U7GA 2BEJA 3GP8A 1MR3F 3QF4A 1HH4A 2VP2A 1S3SA 4Z8XA 5KYKA 2FA9A 3BB1A 5P21A 1IXRC 2W0MA 2IYQA 2XJ9A 2XJ4A 1VCMA 3RS4A 2RGBA 2Q6TA 4V0KA 3V4FA 3EWAA 4A6XA 3T1OA 1N0VC 3VKWA 3KKPA 2NZJA 4R71A 5D3MA 2CMKA 3FKSD 4B2LA 4DJTA 1IN7A 1OIXA 2IYRA 1RJ9A 2HT6A 3ZVRA 3NBYC 4PPGA 4W7SA 2WKPA 4PTLA 3KQHA 4MITA 2VSOA 5CJPA 2HJVA 1WBDA 1LS1A 3GJ4A 1XX6A 1MRSA 5JCPA 3UKDA 3P26A 1E2EA 1L4UA 3QG5A 3LWNA 4Q4LA 3B8HA 1ZRHA 3NXSA 1F2TA 2K5UA 3E1SA 4HUQA 1YZKA 2QP4A 2XTZA 4JLBA 1HQCA 3TVDA 3LX5A 2XTNA 2YVUA 4DT1B 2ZVQX 3E5HA 1GILA 1US8A 4PHGA 3K1JA 1ZYUA 3EG5A 1T3HA 3QG1A 2X1VA 4PSVA 4AWXA 1UADA 3VNVA 1US8B 2JGNA 2F7SA 1MRNA 4GZMA 2E87A 3RNLA 3GMTA 4GOXA 3UPUA 3G5UA 4L15A 1XP8A 5A0FA 1XCPA 2ATVA 2HXYA 3VFDA 4Z8YA 1H8EA 1KAOA 2RB4A 4HUQB 5E4FA 1II8A 4IFBA 4P4UA 2Z6VA 3LD9A 5TVKA 2P5TB 2XEXA 3BH0A 3FMFA 4NYIR 1K8RA 5EJEA 3PEYA 4Q03A 5DE3A 5EZ6B 5AUPB 3TW8B 2OV2A 4GZLA 2OSBA 2CCGA 1HTWA 1ZM9A 4TN1A 4LJYA 2H5EA 2JASA 1KO4A 1NVWQ 2AR7A 3NDPA 4RD1A 3WHKA 4NCHA 2VHCA 1JALA 2OAP1 5IK2A 3W6PA 3K0AA 3NBFA 4AD8A 2A9KA 1E4VA 1XEWY 4OHXA 4JLJA 1E1QA 1G19A 2A5DA 4NCKA 4URXR 1XNJA 4FMCB 2ZRJA 2QG6A 4CEHB 2H92A 1G41A 3PEVA 3Q3JB 2NO1A 4HAZA 4Q5IA 2AWNA 3RS2A 1E3MA 4LSGA 2QRZA 4ZCIA 3PEWA 2Q9CA 1NJGA 4I1VA 3ZIAD 4J0QA 2FFAA 1VMAA 2ZIAA 2HLDD 4LC0A 2ZEJA 1NVVQ 1XF9A 2GVDC 2HLDA 2ERYA 2PEZA 4LCBA 2F1RA 3FFBA 4OHWA 5C4MA 3B78A 4UXIA 4Q18A 5JWRA 2YV5A 4M1KA 4NYIQ 2D06A 1KI1A 1Z47A 1NVXQ 2QZ4A 3SFZA 3LW7A 1TADA 5FR2A 3M1IA 5TY0A 2WWHA 3ZZTA 3TSZA 3RDPA 3FMIA 1D2NA 4EKDA 1KDTA 1KI6A 1T5IA 4L5BA 2V8OA 3AVVA 4D4JA 2QP9X 1O87A 5AJZA 4JKIA 2FF7A 4URZR 1QHHA 2GJKA 1RYFA 2A2ZA 4O25A 2GCPA 5L8VA 2BDTA 3X1WA 5KU1A 2E1RA 1Z63A 2QY9A 5EUMA 4F7WA 1EX6A 3Q85A 5H8WA 2P6RA 3L43A 3DL0A 3W6NA 621PA 3PV0A 4KLNA 1XEXB 5G3ZA 4YXWA 2X19A 4XVUA 1ESNA 1FPMA 2ZJ8A 2ZRHA 4QG7A 5BN5A 4TL9A 1ZNWA 3WXMA 1QDEA 3ETLA 2QORA 4ZCLA 1FX0A 4IVRA 3TUZC 2NO7A 2Z4RA 3GLHB 1E2PA 4IOMA 2GCNA 2RGAA 3VU9A 5UKDA 1PV4A 1E2DA 1DAMA 5LB2A 1W44A 5G40A 3TAHA 3SEAA 5FTJA 2ZJYA 1LF5A 4CDGA 4XIGS 1QHXA 1HURA 3VR4A 3B85A 4OJKA 4BUJA 2O8BB 1KHTA 4EPRA 2VHTA 1ZNZA 4EPTA 4FMDF 5EE9A 4PO8A 1TL7C 4ZCMA 5BW8A 1JECA 1FTSA 4HDCA 3B1YA 4CVNA 2HJGA 3HU2A 5E7MA 4AYXA 4EPWA 2IYSA 1G8HA 2H57A 2GESA 2ZRNA 1CTQA 4NONA 5FL7A 4ABYA 5JJLA 2W6IA 4EDHA 4RVCA 1Z2AA 4RSGA 4NYMQ 2GHIA 1RIFA 1E2KA 1MABB 2PX0A 4D6PA 2O8FB 1M2OB 3MRSA 4G5QA 1WMSA 2FPLA 2GZAA 4GPTA 4TMXA 1UKEA 1ZNXA 3BH7A 4XTRA 3ZDQA 4XJXA 4US2R 4L9WA 3GJ0A 1M7BA 1AS0A 2ASEA 3EW9A 4B3FX 4DCVA 2B7CA 2VH5R 3KQUA 1E2QA 2DBYA 2IHYA 3GLGE 3HR7A 3PUVA 1U99A 1IQPA 2DR3A 2IF0A 3SN6A 1EG7A 3BD9A 5D3QA 1ZCBA 2JIZD 3KZ1E 3A6PC 1NMYA 3F8TA 2Z4SA 1M8PA 2V7QA 5IK2D 4A82A 1QRAA 2B7BA 3W90A 4II7A 4JSYA 5EXXA 1XEWX 2NMVA 1N3BA 3MAAC 1T8UA 1GP2A 2V6JA 1EFRA 2CBZA 2WAXA 5FPTA 1LF0A 821PA 2NOAA 1E98A 5ELXA 1X6VA 4KBFA 4Q4HB 3K70C 2PJRA 5G53C 2J5XA 1AJEA 2GILA 3H1TA 1TQ6A 3EZFA 3LDAA 3AVYA 1OIVA 4YMWA 1R8SA 5LD2C 3RRYA 4HZIA 1P73A 4RY2A 3UMSA 1IY0A 5GVSA 4O2LA 1G3MA 3O8RA 1RW4A 2V54A 3LVRE 2HV8A 721PA 2OCPA 3IBGA 2GK7A 3NG1A 1LW7A 2BIFA 3TK1A 3TLXA 5GJBA 1AK2A 3X1XA 2L0XA 3B82A 1KDRA 1UDWA 3U6BA 1JJ7A 2RGGA 4NMMA 4OK3A 4IJMA 4F93B 3AF0A 5L3SB 2KB0A 5AJWA 3GEHA 3AVXA 5HKKA 1N6IA 4FD2A 2REXB 5HCIA 2QENA 1DAHA 3NH9A 4IXNA 5EP3A 1S1CA 4AKIA 1G7CA 3V00A 1OPXA 1E1QD 2C2HA 2ZRLA 2QI9C 3CRVA 2QTHA 2A78A 1IN5A 1CIPA 2SHKA 4JL5A 1W1WA 3K0SA 3ADDA 4TSFA 3U4QA 1KZGB 2G0TA 2W2VA 4LYAA 2ZI5A 1E32A 3P20A 3GJ7A 3WYGA 3QPVA 5J4LA 1NN0A 4HAVA 4PZLA 2WSSA 3L0OA 1FP6A 1XMJA 3C7KA 4JMPA 3RABA 3RHFA 4QGGA 2CXXA 2ANCA 4A0HA 1GDDA 4LJ4A 4JYCA 2WWFA 2X2FA 3I8XA 4DDVA 2ZRCA 4Y0VA 3TQCA 1IM2A 2ATXA 4D4MA 4DDWA 5FOSA 1G3RA 3AF3A 1EWRA 2C9YA 2CJWB 1G8PA 3K09A 3PIRA 2V1UA 2DB3A 1G3QA 4BFXA 1E9FA 2WBLC 4Q4AB 1E94E 4CW7A 5EP4A 4WZAE 5FUYA 4TMWA 5CITA 2I3BA 1P5ZB 3CBQA 1ZMXA 2JJ2D 2GEVA 3F3YA 1SVOA 2WMNB 3BH6A 4S35A 4Q21A 4G3XA 1U0JA 4JKYA 1QHGA 2WKRA 3MMPA 3LLUA 2IXFA 1ZIOA 4KLZA 5JS8A 2GA8A 2ZQ5A 4WZ6A 1ZW6A 1QBKC 1CLUA 4NKRA 3EZ7A 4WXRA 3BRWD 1FMLA 3UWKA 1G8FA 2KWIA 2QL6A 4P3YA 5SZKB 1XMIA 4QKQA 1SXJC 2WIBA 1ZUHA 1VYVA 4RZ2A 1B23P 5FI1B 4ARZA 1CJVC 3AF2A 2BJWA 1CR0A 2QUZA 1II8B 1TQ4A 3GJXC 2F1JA 4NYJR 2BKEA 1WP9A 4LRWA 1DELA 3QVUA 1M74A 4PXAA 3R8FA 1J7KA 3ZJYA 121PA 4KBGA 3I5YA 3SJAA 3WMGA 3H0KA 3FMPB 2Z43A 3WBKA 4Q1BA 3AKYA 2ORWA 3D3QA 1DADA 4QJ5A 4DDTA 1SXJE 5FOWA 2VL7A 1RVDA 2IC5A 1ONBA 2QM7A 4QL3A 1B0UA 1U9IC 4D0LB 3OAAD 3RYTC 1U98A 4DEYA 1IHUA 1ZD8A 3VAAA 1EFCA 2QN6A 1JEDA 4Z1MA 2P0EA 2NO0A 3OEED 3CF6R 2IUUA 3KJEA 3RS5A 4M21A 4DLXA 3VR3A 4QFMA 3MG9A 2ONJA 1E2GA 4BZXA 3EASA 2IWHA 3ZYCA 2FEMA 1OFHA 2DYKA 2ZJAA 4WBSA 4BFUA 4IRUB 4LDJA 1P4SA 5JLJA 4URUR 1D9XA 1KDPA 2QPAA 4XVQA 3OEHA 2XSZD 4EPVA 5JFGA 3KQLA 2QSZA 2R9VA 3B1ZA 4WA7A 1UM8A 1YR6A 4DEXA 4C9BA 1FFHA 2WWWA 3B1WA 3DOEA 3S1AB 3B6EA 1N0WA 3CB4A 4ESHA 4QM7A 2GCOB 3I1FA 5AUNB 3GLGA 1TEVA 3P4XA 1G3UA 3MLEA 3K0FA 2QRNA 3C8UA 1BMFD 1TU3A 5FPHA 1A1VA 1G16A 2FE4A 4ZDWA 4PPFA 2ZXUA 2OFXA 1AGPA 8OHMA 2ZR0A 3MJRA 1E9BA 4KFUA 2IBMA 4L8GA 2NIPA 2DPXA 4KI0A 1UBFA 3A58B 1XJ0A 1R0ZA 2H16A 4CEJB 4FCTA 4HB4A 3GLHA 1NKTA 2BOVA 4IEEA 4PZYA 1FL9A 1DAIA 1FX0B 1Z8FA 1OHHA 4LBZA 4KXFB 1XXHA 1L8QA 5C1BA 2WWIA 3OESA 4PAQA 4BFYA 4JVMA 4N0EA 4E09A 4AKHA 1KJWA 2O5VA 1A2KC 1KYIA 4B71A 3RWMB 1OXUA 1W4RA 2QAGA 1TQ2A 4DLVA 3AQ4A 1W36B 1R0YA 1XPUA 1XRJA 3HP1A 2F55A 1NY5A 1SVKA 2QA5A 4TWZA 3RS0A 4D81A 4UJ3A 4LYFA 1D5CA 2BBTA 1W4AA 3HWSA 5AJYA 1R5BA 1UDXA 1KK3A 3AKDA 5JJKA 4HAXA 1NSFA 1Z0AA 2IS4A 1Y3AA 2JJ1A 2ECKA 4Q1DA 1P60A 2ZI6A 2QM8A 1BYIA 2BV3A 3AVPA 1ZCAA 2V7QD 3UWOA 3OIWA 2W83A 4HI0E 1CR1A 1EK0A 2JIZA 3ADBA 1Z06A 1XD2A 2J7PD 2QU8A 3GJ3A 1AQUA 5AJXA 4X8LA 2IYUA 4ASUA 4Q4JA 1QHNA 1T6NA 2R65A 1OKKD 1LB1B 4FN5A 4BEBA 1R8QA 4DIEA 1X8LA 2P6UA 5EE1A 5GJCA 1OYWA 2VO1A 4GT1A 2IEZA 3B5JA 1EFUA 4CZ2A 4JLNA 2BC9A 4M9ZA 4QBHA 5IT5A 5BYKA 1NN3A 1QVAA 5CK4A 2JA1A 3EA5A 4DCSA 4OHYA 4A0GA 2DFTA 5EXSA 1XTJA 2J1LA 3FGNA 2VSFA 4KSBA 3RSOA 1KIMA 3IHLA 3U61B 2AD1A 4D82A 4NCNA 4MRSA 1KTVA 4GNKA 4HLQB 4PPQA 3KB1A 2W2XA 5JS7A 1HV8A 4Q9JA 4TMTA 5TXGA 4BZPA 2AFIE 2RAPA 2ZSAA 4GMXA 4B33A 1R0XA 1ZNYA 1PUIA 2BBWA 5H1YA 3A8TA 1P61B 2NTYC 4JLMA 4LX0A 4IDPA 5M04A 3RC3A 2H8KA 4C4PA 3B7GA 1N6OA 3JVVA 2VF8A 2ZRMA 1OB2A 4ACBA 3E70C 3DDCA 3TW4A 3FPAA 4I99A 3K70B 4AURA 1EFHA 4C0JA 4M9SA 4TTQA 2F3RA 1KO8A 1GNPA 1G4AE 3KXLA 4PFSA 4JVLA 4TYPA 5CDFA 1N0UA 4CGZA 3WP0A 3UK6A 3AKCA 4PC6A 4OQLA 2VP4A 4Q47A 1ZM7A 2OE2A 2OLJA 3AP3A 4QHTA 2GNOA 1EFRD 3GPLA 2VP9A 3WRYC 4XOIA 1CBUA 1EXMA 3CIOA 2Q3FA 4HUTA 4UXJA 4B2PA 3DEFA 2ZJOA 1DBSA 2ZSEA 4UNQA 3ZZUA 4LJ5A 2C98A 1R4AA 3PQCA 4TTRA 4IHQA 2OEPA 3P32A 2HUPA 2J0UB 3NEYA 3MFYA 1VYUA 1W0JA 2ZYUX 2PMDA 1T5LA 3TJZA 3SHWA 1G9XA 3ADCA 3C5HA 3LAWA 5KPJA 1QHHB 4M1MA 3WYAA 3H4MA 2J3EA 1KSHA 3IQWA 3W8RA 1W2HA 4EJSA 4Z51A 3GLIE 2KI5A 2AFHE 2WKQA 5E95A 5AK0A 1S9DA 1QVRA 1YR7A 5DH9A 1IAQA 2W2TA 2WOOA 4MQBA 2OUKA 1PJRA 1J99A 1MO5A 2OBNA 2ZUDA 5A5GA 2ZANA 4C0LA 5C4GB 4DLWA 3CPJB 3BBPA 1AZTA 4E22A 1AS3A 2V3CC 2RHMA 1CR4A 4C2TA 1E2NA 3BS4A 1SVMA 3QKSA 3UANA 3I32A 3PCRB 4ASUD 5AUQA 1Z0JA 1Z5ZA 2RGNC 1YVDA 2WZQA 2QPTA 4TQUS 3DZ8A 4DXAA 4D26A 3A4NA 4Y0AA 4A36A 4MUBA 4MRNA 4ESVA 2I1QA 2BHRA 2V1XA 2QMUA 3RRNA 3G82C 4NH0A 2AX4A 2H17A 2J59A 1AN0A 4BFSA 2PMKA 3CPHA 2OXCA 1H8HA 1HYQA 2GZDA 3ADKA 4JJZA 4QBIA 3OEHD 2J46A 4HLUA 4U5XA 1PZNA 4ZI3A 1E2IA 3ZGXA 4NU0A 1FTNA 1G291 3J81k 1JR6A 1OFUX 3NVAA 2HCJB 1I4DD 4OYHA 1QZXA 2YJTD 4TQ9A 1AGRA 2KJQA 2XOKD 3PJRA 4Q7LA 3ZVMA 3EIEA 3SR0A 1LY1A 2ZITA 2VF7A 1XZPA 3AEZA 3B1XA 5IHPA 2V55B 1XJQA 3NC1C 4ITRC 4RZUA 3OFNA 2QE7A 4OQXA 3X1ZA 1OFIA 1X8JA 1XEXA 2QQ0A 3U5ZB 3WMEA 1GKUB 2KBFA 2RHDA 4IVPA 2JLUA 2FX3A 1Z0KA 4XD7D 2ZRFA 3TMKA 5F9HA 1E4YA 4IDQA 2R62A 2FGJA 2VTKA 2CE2X 5H70A 1OE0A 3T1VA 4AC9A 5B64A 4AYWA 2KSQA 1SHZA 1BMFA 1Q21A 1S1MA 4TQAA 1U90A 1XD8A 1E6CA 3AVQA 5EXPA 4DLTA 4MGKR 2RGCA 4TMVA 4ZDKA 2CLDX 2ZR7A 1S96A 1KNXA 2OO7A 3RVBA 5BXQC 1XBTA 1E2FA 1S9HA 3K9GA 1DTSA 3LQRA 3QENA 5GJWC 1LS6A 1KMHA 3I73A 4S2EA 4BPBA 3EPLA 2FZ4A 4NHOA 4V02A 3ASZA 2IYYA 2MMGA 4G5GA 5JHHB 4NL4H 3AF4A 3VU9B 1RYHA 4YDSA 1T8TA 1G4UR 1LTQA 1VCIA 2JCSA 3PITA 3RAPR 4GDFA 3CH5A 1DARA 1SXJD 2GBLC 4A0FA 2I4IA 3LY5A 1F2UA 1RFLA 2YWHA 4GL2A 2A5FA 1QHIA 2QTVB 3U2QA 1E1RD 2ZSFA 1P2VA 5DIFA 1GSIA 1KAGA 4ACAA 2VP5A 1IONA 1TF2A 2OCAA 4HAYA 1KNQA 4HZUB 2LWIA 2C5LA 2B6HA 4YONB 2MSCB 2QMEA 2QGNA 2WJIA 4LOAA 4Q66C 421PA 2XXAA 1KI6B 1U8ZA 3M4YA 1ZINA 1N5JA 3ZS8A 1W4BA 3QY0A 2RGEA 4QJ4A 3TNFA 1YR8A 3GLFA 3CWQA 1YZGA 4M2LA 4QGFA 5DO9A 4HLDA 3IO5A 5FI0B 3SZRA 4B2IA 1FW6A 3LXRA 2AD5A 2ZE5A 4HZUA 4B3XA 3EZ2A 4OK6A 2G88A 4FCVA 1A5TA 1YKSA 2PLRA 4UKDA 2QNRA 1HE8B 2HEIA 1EWQA 1Q0UA 4OQMA 2Z5FA 4QM6A 3CNLA 1XB2A 3RS3A 4ON9A 3A37A 2OZEA 3GLFE 2YINC 2D62A 2BWJA 5F2EA 3SNHA 5H68A 1FUKA 2FZLA 4FW9A 1E96A 3K53A 3LO5A 4PAOA 1SVWA 2C8VA 4MGIR 5DI9A 2AXNA 3I8SA 1E0SA 3W9YA 3BFXA 1ZD1A 4E5UA 2J7KA 1UEIA 2CHQA 2PX3A 2OCBA 5BN4A 2JLVA 4V0OA 2FV8A 2BCGY 1NL3A 3CRRA 5JBQA 2MSEB 1E9EA 1GRNA 2BMEA 1QG2A 4UJ5A 3FHCB 1H8ED 2PCLA 3F5FA 3QPUA 4GMDA 1WCV1 1Q22A 3Q72A 5C18A 1TQDA 5DN6A 3GLIA 1P2SA 5DN6D 1OSNA 4LC1A 2EYUA 1G5RA 4MRPA 1N6LA 1K6MA 2F9MA 5KOYA 4PC7A 2WJJA 4PC3A 3IPXA 4MRRA 4PX9A 4DCNA 3BWDD 4OJQA 2X2EA 4TL6A 2V4ZA 1RZ3A 4XWKA 1E0AA 1UBGA 2BEKA 1YZLA 5FTLA 1G1MA 2OM2A 5CB6A 3OF5A 4ZO4A 1MH1A 1G21E 1WDTA 4LWZA 3T5DA 4D4LA 1A2BA 1TEXA 2UKDA 4IVQA 3REFA 4W9MC 1W36C 4DRZA 1G18A 1YQTA 3CKLA 3KQNA 4TZ0A 4IW3B 2OG2A 1I4TD 4NYMR 1N6PA 5LB4A 2PBRA 3B2EA 3LRPA 4XWOA 2NZ8A 4Q02A 4IDOA 4OBEA 2CE7A 1TTTA 3L82B 5EQTA 4PC2A 4BRWA 1IXZA 3BC1A 3EZ6A 4Q7MB 4KFSA 1Z0DA 2VYFA 3ND9A 3UG6A 2D7DA 5JECA 3BORA 2YYZA 2IUTA 1U9IA 3KUCA 3BB3A 4PAMA 2WOJA 3BERA 3O8DA 4TLEA 4HDQB 4DC9A 4DBLC 1ZU5A 3GCGA 5E7IA 3WRXC 1SGWA 1UFQA 3K8YA 5DHAA 4NCJA 1D2EA 2R2AA 5AWFC 4BRUA 3ZLJA 5CJ2A 3OIVA 1U94A 4C0BA 4UXHA 2IEYA 5CM8B 2OT3B 2ZU0C 1DEKA 2EVWX 3A1SA 1DG1G 3K70D 1E1RA 3QSYA 1CJUC 3A1VA 4LJ6A 4GI7A 1YR9A 4Q4JB 4DSTA 5BWMA 1F3OA 1Q20A 4B32A 4BASA 4GFDA 3EZ9A 4D0GA 5J4VA 3FDIA 1GL6A 2IT1A 3OFND 1SXJA 2GJ9A 3ONWA 3CH4B 5BYJA 4BLSA 5K8TA 1COWD 1UBCA 3UG7A 5JEEA 4RFSB 3OE7A 4C3ZA 1VECA 2LKDA 3BAFA 3DKPA 4R2IA 2HF9A 4M9QA 3I4LA 5K8UA 4TYNA 3TVTA 4F4CA 3A1WA 4TMZA 1UKZA 4GOKA 4DKXA 3U4QB 4I1OA 1HE1C 1AKYA 2G1KA 3MD0A 1EGAA 4B43A 1H8HD 5JJIA 2UZ3A 3NDBB 4X8OA 4OKSA 1Q1EA 1ZU4A 2C77A 1DO2A 3M6AA 4Z54A 2DWOA 4KJZA 3K9NA 4AG6A 5G41A 1MV5A 1PUJA 4V0ME 3TSOA 2PLFA 1J90A 2AK3A 2H18A 2YOHA 4W5HA 4LV8B 5EXTA 4C0SA 3DO6A 2P65A 1XTKA 2PZEA 4IDHA 4JLPA 3VKHA 1KZ7B 1UEJA 1NVVR 2G6BA 2W6ID 4MGZR 1KGDA 4OI4A 1OV4A 3PVSA 4DHEA 1K5DA 5FUWA 1CEEA 1J70A 3WY9A 1ZUNB 4D80A 4B6FA 5J47A 1VIAA 3QKUA 4P4SB 2NPFA 3FKQA 2IS2A 2YWGA 4CYMA 3N70A 4I1SA 4RD6A 2N46A 4URVR 2B8TA 3BB4A 4AKGA 4TMKA 2ZS9A 1L4YA 3C15C 4A92A 3K9HA 3V9PA 3O8BA 5KTYA 1W5SA 3WNDA 3VKGA 1IJEA 4CEHA 2QROA 4QNMA 3RLFA 3THWB 1S3GA 1F2UB 2GJSA 5FH9A 5JHGB 2W6JA 3VR2A 5JWHA 1XTIA 3D8BA 3R7WB 1AZSC 2GTPA 3IUYA 4WOPA 1X1RA 1JR3E 4QBGB 5E7JA 3GJ8A 1NP6A 1KMQA 4R9UC 3GD7A 2YZ2A 4B76A 1XPOA 2RGDA 5CYPA 2ZJ5A 4ILEA 4JT2A 1HUQA 2DY1A 4RZXA 1VHLA 2WJHA 3UATA 4TLAA 2JJ1D 4HB0A 1SKYE 2NO9A 2GEUA 3D7MA 4LI0A 4B35A 4B44A 5SZJA 2XB2A 3QPWA 3I92A 5AJVB 2ZJ2A 5CIWA 4DUGA 2OAQ1 2WICA 1NN1A 1OXSC 4HEJA 4GP6A 1GAJA 1KI7A 3IIKA 1GUAA 3ZQJA 2O8FA 4QHYA 2AK2A 4OK5A 3R8CA 2FSFA 2CJWA 4DWJA 4B3GA 1NMXA 4PC1A 3NTUA 1W2GA 1GZSA 2ZM5A 1J8MF 3ZQ6A 1GKYA 2ZE8A 3EIHA 2VQSA 1U8YA 1NLYA 2FWRA 4W5JA 2Q9BA 1RRFA 5A4JA 3RC8A 3IIMA 2ZYWX 2ZI7A 1R7RA 3FWYA 4NBSA 4A0RA 4BLQA 4M1OA 3AVUA 4B75A 1KMHB 1Q1BA 1UKYA 3WMFA 3QXSA 1NF3A 1RKBA 1U0HC 2J9RA 3X1YA 1GKIA 2KE5A 2GDJA 4DCUA 1RE0A 1KY3A 4RFVA 2JLWA 3P1JA 2ZTSA 2QGZA 5EE3A 4RCZA 1XMVA 2CK3A 4RZ3A 5LPNA 2EWVA 1N2CE 1XWIA 2Z83A 2PEYA 4D2IA 3W8NA 2Q21A 4PO1A 1GM5A 2XGJA 4F92B 1G5TA 3VMFA 2QE7D 5KSPA 1OF1A 3ZS9A 1XTRA 4LV6A 4DVGA 2IUSA 2JLQA 4C7OA 2WHXA 3CNNA 5FBWB 2OCYC 2XSZA 3A1TA 2WTUA 1TPZA 2FG5A 2AL7A 3IO3A 5SZHB 4HYYA 4NZYA 4UNPA 1YZNA 4YMUA 2FMXA 2J0VA 4CIDA 1W0KD 3NBXX 2DHRA 3ZD6A 1VIYA 3TSWA 4DSNA 5IRCD 2O8CB 4RD2A 2IYTA 2ZETA 4F91B 4M8NE 3AP2A 3KDSE 3KJGA 1ZP6A 2D2FA 2D2EA 1G5PA 1CJTC 1JPJA 1KSGA 4AK9A 5CDFE 2VP6A 3Q7PA 3T06B 4QJ3A 1JJVA 1EX7A 3R7WA 1XEFA 2QAGB 1DAEA 3UMFA 1I2DA 3MWLA 4MUAA 1UJ2A 4BFWA 2JLRA 3RSLA 3B9PA 3GFTA 5LD2B 2WVJA 2IK8A 2ZPTX 5DI3A 3VR6A 1T3LA 5GVRA 1LVGA 3QI2A 2PT7A 1W47A 3RS7A 4PQYA 4CT4B 3FMOB 2IW3A 4MA4A 3HJNA 5DYGA 1HEIA 2AXPA 2R6FA 3QKTA 2D3WA 4P4TA 2DFNA 4F4JA 2JEOA 3CPEA 3CRMA 4A2QA 2R8RA 1L2TA 4PSKA 1JAIA 5BQ5A 2YOGA 4N1AA 1P7CA 4BFVA 3I5XA 2C9OA 3CF0A 4LUCA 4P32A 2F1IA 3THXB 1XD2B 2J87A 2VRWA 4X8MA 2GF9A 3W5JA 1VYTA 4RKEA 2J7PA 2WMOB 3DHWC 3T1QA 3TIFA 2ZYTX 5C46F 2MSDB 2OILA 4BZQA 5LDDC 1KSJA 4EJSB 3QXHA 4NYJQ 3TKLA 3EA0A 2CLCX 5G3YA 4Q7JB 3LX8A 3PFIA 3NBZC 3AKEA 2IYVA 3PEUA 3W6OA 3W3AA 4I4LA 1N25A 3A36A 2VEDA 2GKSA 3WBJA 4DSUA 1UF9A 1E9SA 5DGXA 3L2OB 4LY6A 4PQFA 2O0JA 221PA 3Q7QA 2ZAOA 1Q1ZA 4BFTA 1SXJB 4K8OA 3VNUA 1Z6YA 1Z83A 3F0TA 4M9XA 4BFZA 1XXHB 3U3MA 4BLRA 3G0HA 2ZREA 1RRGA 2HCBA 3CNOA 3CRW1 2IX3A 4LHWA 1OXXK 1XDBA 4P4SA 5B57C 4O3MA 2C78A 2VLIA 1VDZA 1BKDR 1YZTA 3FHOA 2OXRA 1E69A 3IEUA 1CRQA 2CNWD 5J4KA 1CULC 2BKUA 5KUTA 1GNQA 3SJZA 4DLYA 2D7CA 1PVOA 3CM0A 1GITA 4QGHA 3TGPA 5HR5A 3DMDA 1G64A 2C99A 5J5CA 4CRWB 3IEVA 4EUNA 3QQ5A 4JS0A 4TL8A 3SC3A 4CEIA 4DDUA 2ORIA 1YU9A 2CVFA 1BOFA 1GNRA 2WSMA 4OHZA 4FWIB 2NPIA 2GXUA 2VBCA 2Y8EA 2HF8A 4B3DA 1CF4A 1R5NA 4ERNA 2G77B 1KJZA 4DLSA 4HLUC 4L9SA 1ZD9A 3QOFA 1Q3HA 1OXTA 3MCAA 3CR8A 4KYUA 3U3RA 5DHFA 3AVWA 1KO7A 3CWZA 4RKFA 1XTQA 1M1YE 5FUVA 4FI3C 1HT2E 4JBXA 4G01B 2WV9A 3T15A 1JXOA 2AWOA 2PJZA 5D3MB 3FTQA 4G0NA 4IOJA 2O8DA 1KI8A 5TARA 3OHMA 1BS1A 2FGKA 3SI7A 5AUOB 1HA3A 3ASYA 2BMFA 2CDNA 3QEOA 4A8JC 3U7HB 2VSXA 1MABA 2IYWA 3B13B 1OH8A 1JR3D 2RGNA 2YWEA 5JRJA 1JAHA 3I62A 3UIEA 1NI3A 1VG0B 4JBYA 3QF4B 4B34A 4LPKA 4Q9KA 4MDEA 3NWJA 1GG2A 5J4YA 5DISB 2Q9AA 2GRJA 2GETA 1KKMA 4NDZA 2JDIA 1XXHE 2X8AA 3TE6A 2O8EB 1CKEA 1EESA 1U81A 3KTAA 1FNNA 2ZAMA 4Q00A 2P3SA 4YMTA 1E2HA 1KI4A 3BK7A 4LYJA 4U02A 3NIBA 3I61A 1N5IA 2JLYA 4JYBA 3QVVA 2DFLA 4M4SA 4MYTA 3BJIC 3C5CA 3RANA 4EJSC 3CF2A 2EQBA 2QBYB 4UNNA 5FOXA 2OESA 1G7SA 1YRAA 4WXPA 4QGAA 3AGPA 5HE8A 3GEEA 2FFHA 2WSSD 2GJ8A 3KX2A 2FPKA 3AVTA 1CRPA 4XSGA 1DO0A 3EPKA 2CK3D 3RRZA 1G6HA 2IXGA 1SVLA 2AHOA 3THWA 2MMCA 1KI2A 5FR1A 5F9FA 2ORVA 1P72A 2B8WA 3R20A 5KNBA 3FFAA 2ZI9A 1UBEA 2CCJA 4ZDIA 5CB8A 3N2EA 3ND8A 4B73A 1XJCA 5KHOC 1KSFX 2OHFA 3SBEA 3FB4A 4UQOA 3B9QA 2CNWA 1UAAA 1YRBA 1T3SA 3AUYA 3NEJA 4B74A 2IS1A 1TUEA 2E9SA 5FUXA 1FZQA 1XD9A 1RJ9B 4Q48A 2OFWA 2QSYA 4B6EA 4JJKA 2AN9A 5JZVA 4RFSA 1TX4B 2RMKA 4HAWA 3GQBA 5FOUA 3SBDA 1ZBDA 3P27A 3TQFA 2QEQA 1WB9A 1VKJA 2F43A 2XOKA 5EUQB 2WM9B 3IKJA 4Q4HA 1G3IA 1NBMA 3EX7C 5B58C 1DVRA 3KKNA 1E79D 4MKHA 5L3VA
chains in the Genus database with same CATH superfamily
4DR6B 4UDNA 3AEXA 1EDOA 5CMLA 2O7NA 1WSDA 4K9OA 5I7VA 3VR3D 2V98A 1D2HA 3BCUA 5C32A 1B8VA 3QLTA 1XNRB 3BFPA 1BCSB 3K0CC 1THTA 4H0NA 4TPKA 2IYLD 3BEOA 2OOKA 4KFTA 1N2EA 1N9KA 3MMXA 4BP3A 1P7VA 2BKAA 1TZKA 1E3EA 2YJ6A 3WWZA 1V8PA 4P5PA 2CF5A 3EDCA 4FINA 1U3GA 1N2CA 4P7FA 4Q16A 5AOVA 3RV3A 4FB4A 2Q1TA 4RXMA 1WDWB 4AECA 5LMCA 4PWYA 4TZKA 3AXTA 1UT5A 3AUXA 2R6AA 4K9LA 1XIVA 2VHJA 1J5PA 2ZVPX 1KBZA 3ENZA 5EZ5A 3LKZA 2OORC 3DZGA 4IINA 4JBWA 3W6ZA 4MPTA 2W6JD 4RJTA 3AW9A 4KPEC 4MLZA 4ZPJA 4LYHA 1N5KA 1EWVA 1Y4UA 5KWVA 4P0PB 1WCWA 3H11A 3NUGA 2JATA 5CT9A 1A9RA 5DF1A 4HQ6A 1GSHA 2ADMA 3SS8A 2GN0A 2OB2A 1HE5A 1PNTA 5C3UA 4F38A 3HY3A 5J5AA 1I1NA 4URWR 2Q3MA 3NKVA 1OTXA 5HNKA 2FR1A 2QN9A 1OCEA 4AG5A 6REQB 4Z86A 5AVTA 1BWRA 3LWDA 4BVAA 3H83A 1NNSA 3CUTA 4ISBA 1GA4A 3TGLA 4S1TA 4DQKA 1SIOA 1YVUA 4WCDA 1K5GA 3G5MA 4D02A 1E0KA 3KJIA 2O0LA 3SJUA 1M54A 4LDQA 4LZNA 4DLLA 4R3WA 1JW9B 4TLCA 5AOCA 3RGWS 1ZGJA 1PVVA 3SKVA 3H3JA 3JD2A 1YGYA 4MS4A 3V33A 3NAQA 4P92A 1V6SA 3R9IA 1A5AB 1N5DA 3KT8A 2AOUA 2FZ5A 5K2MA 3U49A 3C3KA 3NALA 2JH3A 3V1YA 3BDIA 2NSHA 4C0KA 1SBHA 3CO5A 5AXBA 2AMYA 4YUYA 3ILVA 2PUAA 5T7BA 3PGLA 3RC7A 4CLRB 3FYHA 4JP8A 5GIOE 3PDIB 2FUG1 1H0HA 5LBIA 1IRIA 2XNDD 3DOFA 1UFRA 2X4DA 4INAA 4J29A 3JAWA 1ODFA 1T36B 3FMGA 2VDWA 3LE8A 1TQ8A 4KCGA 3A6DA 3FR7A 5FFFA 3WS7A 1S0UA 5HKLA 5L3QB 1PO7A 2IKQA 2XQGA 1Z2DA 4J2HA 2J4FA 4Q37A 1SU6A 3CX3A 4UULA 2G83A 3WO1A 1MVLA 2G36A 4U2CA 4GS5A 5FBRB 1ISGA 5P8WA 3ZV5A 1JQDA 4CBVA 4DIOA 3AL0C 4CEIB 3FVQA 2JB9A 1F8FA 2GARA 3A4VA 3C85A 5DWDA 3PDIA 4MV7A 2RHRA 5B3JA 3WR5A 4RDXA 2Y1OA 2X5KO 3KQOA 3GJSA 2ZBGA 5E9QA 4QRDA 4F4FA 5JY6A 2BJVA 2GH1A 3WK4A 3CF4G 2GZHA 4XW2A 4R2HA 1Y34E 1UIRA 4KO3S 1F5NA 1L7PA 2NPOA 1QBGA 2EJVA 2WE7A 3NWOA 3Q0TA 3CW2A 2FJPA 1S4MA 1C8VB 1G2PA 4LZOA 1UZNA 2EFHB 4M0LA 4YMVA 1PFVA 1M1XB 1Q3TA 2REBA 1W25A 3OZDA 4IV0A 3THXA 1XCGB 3WKBA 2JLSA 3KPUA 4DCTA 2N47A 3DUWA 2D0IA 1B93A 4ZRNA 1JLKA 5IC5A 3DZDA 4PLCA 4R2WA 1NDQA 4NCIA 5ERGB 4B4VA 3KOYA 3UGQA 3WRXA 2CMGA 1SBQA 2XITA 2XA2A 4HAOA 1QG0A 3V8PA 2A14A 4H1VA 2FLVA 4KNYA 2JLVA 3ZVNA 5KNDA 1YJAA 4WW0A 4AMBA 3GJRA 5ENDA 1IOVA 1Y42X 1CVIA 2ZYAA 2V6FA 3QFHA 4IIVA 2P7IA 2DU8A 2YVQA 3OZIA 3H86A 1TGVA 4QUIA 4A8JA 2HSWA 3ETNA 4K46A 1LFDB 1OTYA 2E4XA 1WCYA 4D3ZA 1QHSA 5DULA 1Q0QA 1SIUA 1ZH6A 5G1NA 1G7TA 4A1FA 3RFTA 4A8JB 3NGMA 1P1HA 4WJLA 3TI7A 1VHTA 3QVWA 1ZC3A 2XB9A 4NAVA 4RDHA 5F51A 4OP3A 4CWAA 2YWRA 4F3NA 5FQOA 4LJAA 3COJA 3ICQB 1DE0A 4NE7A 4IJQA 2YCLA 1QLWA 3T7SA 5K5EA 2XVAA 4EG8A 1IHOA 4K9SA 3OZBA 3KL2A 4CF4A 2Q6VA 4L2IA 5JASA 4PZUA 4NCBA 2ECFA 3PE6A 3VBCA 4OI0A 4KPUA 2O3QA 5JAZA 5DLEA 3WZMA 5BMOA 1BX0A 2AXEA 2O23A 1N8NA 2RI0A 3QYPA 4JLWA 2HA5A 2BFWA 3A7EA 3HKEA 1PLJA 3ABQB 1NVTA 3EVDA 3P45A 1U0OC 4EJ0A 5HJEA 4ZV4A 1XKTA 2C07A 4DAOA 1BCRB 4GM4A 3I9JA 3L8ZA 4KHZA 2ONCA 2XMRA 3P96A 3ZD7A 2XB6A 5HBGA 3DWIA 4KVGA 2OBLA 4O5OA 1FSSA 1XUOA 5KQRA 4AMZA 1V95A 1JXMA 1YQUA 1ZSYA 2R97A 1PS0A 2BHLA 4OGKA 5FADA 3ESBA 4Z7NB 2E7ZA 5HILA 4BPRA 3WJAA 2LKCA 2ONKA 2QUHA 3DMGA 3KXKA 5CLQA 4DREA 1W5TA 1R64A 2PSHA 1A7AA 1WWKA 3QNMA 3AZQA 3HRKA 1KU0A 1Q19A 3JYQA 1XA3A 3B9RA 3MWYW 3GLKA 4M76B 4R2XA 3EDRA 2GEDA 4ZVQA 5DBOA 2ETVA 3SDZA 4WZBE 1Q0ZA 1NXSA 3HA5A 4BLOA 5KTOA 2B4YA 3RF6A 5KDDA 3UC5A 1ZOOA 5FL7D 5LC1A 4MVJD 4RL4A 4O08A 1KS2A 1MTOA 2YWDA 3CMCO 5KPDA 3HR8A 5IF9A 2QRQA 2EWWA 3CIFA 4X6YA 3HU5A 5C5DA 1RCFA 1KI3A 1ZKDA 3FI9A 3OTQA 1TCVA 1KE1A 1Z0UA 5I8PA 1K4YA 5A0VA 2XMDA 3TZCA 3QVSA 3JTEA 2AZMA 1BHJA 2F59A 2OWEA 3IP9A 3L4SO 1ZD3A 2W2QA 4RA6B 5ESXA 2Y1KA 1CR2A 4AMUA 4AAYA 2G9NA 1XLUA 4BCBA 4GSYA 4R7ZA 3EWNA 4ALNA 1ZXLA 1KZYC 1R6BX 4OXKA 2V74B 1JG1A 1AV7A 3R0JA 4FOTA 4CCYA 1I9CA 1YBMA 2G8LA 3SE7A 2WQ6A 3ZEIA 3EZNA 3UUWA 1Y0BA 2BGKA 5JCOC 1JJFA 1X42A 2HLHA 4JODA 5JT1A 2NXJA 1I5RA 5ESRA 2NZWA 4GBMA 4GI1A 4N6OA 5ALUA 5B2ZA 3QVMA 1NYTA 4KIJA 1YFZA 1EJ0A 1EJ2A 3LPNA 1SUDA 3KCQA 4A4DA 1NW4A 2PFKA 1CY2A 3HXKA 2GUGA 7MDHA 1C0EA 2Z2XA 5B2EA 2YZNA 1Q11A 2IH4A 4BNXA 1DAGA 2G1AA 5L6MB 1GRCA 5ECWA 1X86B 2Q3HA 2QZPA 4IOLA 2C7QA 3EXHB 4WLVA 3TUJC 2GEBA 1OLUA 3EMDA 3A6FA 3GMSA 2ZSDA 2FSGA 3OZCA 4RADA 4KMMA 3KLNA 3ZHCA 2GBCA 4CMJA 4J9UE 4ANFA 5DBGA 4PHFA 1Z28A 1QYVA 2ERCA 2OHVA 1DBVO 4RJ2A 3TTWA 1U1CA 2FHSA 2BFCA 2DFKB 1BXGB 4IZOA 3CUUA 3QUQA 4KQ2A 4YMSA 4D41A 1NY6A 5GV8A 2AB0A 2M2IA 1DLIA 1R0CA 2BFBB 3GZNA 3QW4B 4JJGA 4KSCA 3M3PA 6Q21A 3BHMA 4KXQA 4OA8A 1LK5A 1CJKC 1CY7A 1E3WA 1NBWB 3OE5A 3BRCA 1XCMA 2CLHB 3G9XA 3B8EA 1A95A 3GY0A 1JH9A 2FEAA 1GARA 1U8XX 4TTJA 2GX6A 1XU4A 3K15A 3MERA 1PL6A 4JC8A 3TQOA 2QV0A 3EWIA 3ZJ5A 4ZIRA 5BXYA 1G59A 3DPSA 1M1NA 1VE6A 3FHTA 2EC5A 4K1XA 1PDVA 4C4TA 1QVVA 4MDEA 1QFYA 2Z8XA 3SPXA 4ZK2A 4KXVA 2BFBA 3GZNB 4FIDA 2QQFA 3QJYA 1YZ3A 4NDAA 1CPYA 3WLOA 5LM3A 3T5PA 3PUZA 3RJMA 3RKSA 3VR1A 3ZWAA 2WT9A 1UJNA 1WQ1R 4OP1A 1W2WB 5FQNA 3VX4A 4CFSA 3M34A 1Z7EA 1H1LB 3HB4X 5JI2E 1V5WA 4QAQA 4XGNA 1KMIY 2GEJA 2AFHA 2VHXA 1UBJS 3AG6A 3GFSA 3HNOA 1KO1A 3GLGB 1ACJA 1L4BA 1W0CA 4MPDA 1BDBA 4XEHA 4OL9A 2CN1A 3FSGA 1DAKA 3TB4A 4RMJA 1V1MB 2DGDA 2DPMA 4QRHA 5DK6A 2HF2A 3EPHA 3GVPA 2O05A 1XZQA 4HGZA 1Z2CA 5CR9A 5DOVA 4BEWA 1E7QA 5KYVA 4NV3A 4TYWA 5KSWB 1QB7A 4RBNA 1XA0A 1IB6A 3JD3A 2J45A 2O8EA 1SVSA 2VHQA 3NO4A 1ZH8A 2WPDA 3DAOA 3EN0A 1AQ6A 2C4WA 1XTVA 1O4WA 4YAGA 1O3YA 4QXAA 4M60A 2GBFA 2OBMA 2JGJA 3FRJA 3BXHA 4FILA 4P82A 3S6JA 3PKZA 5CLGA 3ZBTA 1T91A 3ELDA 2ZSHA 3D2AA 3ITDA 2YHSA 2I2WA 4NNOA 5CH5A 3AEUA 1G8GA 3T3PB 1I7LA 3W2GA 2I6TA 4REOA 3WRYA 2UUAB 1OPRA 4M9UA 3MSXA 4BVGA 3PQ7A 4ZK6A 2IYFA 5LP6F 2ZJFA 1EQUA 3BE5A 4QX6A 5HFJA 2XX3A 4ICIA 1R0LA 4RIIA 9GPBA 3PUXA 5DHRA 4M1WA 2O0KA 1MT0A 3GVIA 1NXPA 2J4CA 2HLPA 4WGGA 4JL8A 1VPLA 3V8QA 3VSDA 1EZ1A 4FDAA 5DNEA 4MI9A 4CDRA 3FOZA 1J0BA 2YC2C 4Q7QA 1KY2A 2P6OA 4KQGA 2D1YA 2HC9A 5ALIA 4ETMA 2GVNA 2RCNA 2C8LA 1P5HA 4PGFA 1YZYA 1DRVA 2A0YA 3IQGX 3I6QA 2PQMA 4MEAA 1KFKB 1V1RA 3SXJA 3EYWA 1KK1A 3AUAA 4M1SA 2ZR8A 2I6QA 3HKCA 3TLAA 1KJ8A 1RXIA 1FNMA 2W6NA 2ZDGA 3HNPA 3PDJA 4NAUA 1DWOA 3GAFA 2RH5A 4PPYA 3TBFA 5DWQA 1F2TB 5A9RA 2B3TA 2AMJA 3PA8A 2A5GA 1PEAA 4JKOA 3VHXA 1QB8A 3VYRB 1VG9B 3KEOA 4AN4A 2G63A 3CR3C 4K28A 2R7AA 1WPRA 2LVBA 3SHFA 1YTLA 4MYDA 1ZHFA 3T12A 3URKA 4JR1A 2NUPB 2I7TA 4Q01A 4V0MA 1AMOA 3IAUA 4M86A 2ZUEA 5JBNA 1PR9A 1IN6A 3ACCA 3PENA 3PQEA 3QIAA 4KPUB 1J22A 5THKA 1NTRA 5KQPA 5IS2A 2H06A 4ZRDA 2HXGA 4LSWA 5EEHA 3WLQA 2JK1A 3O2QB 1LJLA 1RBQA 2P3QA 2XNDA 3UNXA 1ZIXA 1FVXA 1H0SA 1CUGA 2DWCA 3MJSA 4AZ0B 1G8MA 1E2LA 5T4FA 1WPXA 1R4ZA 4LMBA 2QJFA 2ZATA 3EC2A 3P5SA 3B6KA 4GMHA 4TZ6A 2P6NA 4QUEA 1QAOA 2J0EA 1NX9A 5HIKA 4LXQA 2EYQA 4CG2A 5KKNB 4YP0A 1QIIA 3L6CA 1A9OA 2MR5A 3NC0C 2ZRKA 5BSUA 3HFRA 1AM4D 2B9EA 2P9GA 3EGDA 3G0OA 1CD5A 1E5DA 3NHBA 3KUDA 4K6CA 4LWOA 4TLBA 4EFNA 1TYZA 5JWOA 5JSUA 3GRVA 4M0UA 4HB2A 4G8DA 1ISHA 1YS6A 2OCDA 2Z2JA 4MUGA 1I0ZA 3L7NA 4BWVA 2CJYA 2QX9A 2QYSA 3H7IA 4XIIA 2J5BA 5IPFA 3GT0A 4XVRA 5LQMA 3K9BA 3GQBB 4U8GA 4US0R 3EUFA 4JL6A 2EL7A 4LPSA 4QZVA 5A6SA 3HKBA 2PKCA 1T4CB 2AE2A 3G2MA 3L4BA 1X2EA 2CBXA 1P75A 3QPDA 4JAVC 1RPNA 2QTZA 4JJIA 4KLRA 3HKBB 2G1JA 2JGDA 4R40A 5J1TB 2IXEA 3U3DA 1GNSA 2NAPA 4XQGA 1E2JA 1XZ8A 5HTKA 3KJQA 3E9MA 2IP1A 1Z0SA 3BKWA 4DWWA 2PRSA 3CMMA 5DP1A 1YWGO 5LKRA 1QTIA 1Q7CA 3JV7A 1WY5A 4OOEA 2YOFA 3C14C 4NJMB 3V1TC 4EVRA 2AKAB 4R9RA 1SZDA 2Y2UA 3MLBA 4LS3A 1JEYB 1XZDA 5FL3A 1SUIA 1BNCA 3QE4A 4LHVA 4YC7A 2CMHA 3MTIA 1FK8A 3W77A 2ODEA 4OI2A 2JLZA 5HRUA 5KJ1A 4URYR 3GELA 4X20B 4Q19A 1VL5A 4AY4A 1VKZA 2V9CA 1ILEA 5JAPA 2G8NA 5KMGB 3AM3A 5EFOA 2B5OA 4C0AC 3TECE 5HOQA 2WAYA 2V6MA 1FQJA 4KQ1A 2XH8A 4O6VA 1YUNA 1CIVA 4XD7A 4KO8A 4KITB 5FWNA 3B9BA 4E12A 1SZPA 1T9CA 4FS8A 4DA8A 2FEOA 4RTNA 3RVNA 4KE9A 2FOXA 2Q1YA 4ENUA 1TF5A 1P3JA 5I9SA 3ZKAA 3O4GA 2QD3A 1NOIA 1T2DA 2UYGA 4G07A 1NG1A 4HB3A 1T1JA 4CKEB 5ABPA 1RHMA 2PWZA 3CNEA 3JQAB 3M49A 3TQTA 1SQGA 4ESOA 3GC6A 5KWJA 4TYYA 2ID8A 3I6ZA 3OY2A 1AY0A 2C1EA 3WZLA 4BNDB 3WHIA 5F2NA 1F4PA 1K3FA 1YZUA 2XT6A 5EVCA 3CW8X 1NP7A 4R05A 4ZOCA 4H2DA 4TSKA 2E89A 4DUGD 5LBTA 5EA2A 3PR1A 3WGGA 3HVHA 1U5AA 4KQMA 3UN1A 2CL6X 1DJNA 3DO8A 1R0SA 4LFAB 1YMQA 3ENVA 2DE0X 3R3JA 4Q3BA 4GNRA 1NQWA 1W4ZA 2DWQA 1JFFB 2HSZA 1TF7A 4DIMA 1G17A 2F3TA 1UQRA 1OREA 1YE3A 3IIEA 5FULA 3H99A 1WSBA 5IZCA 3NRBA 3BMOB 4LC9A 3D3WB 1MIHA 2RJ3A 4Y67A 4IGKA 3LRXA 4XASA 2YXNA 5DMHA 5CFNA 1UQTA 2P62A 4E4RA 2I4OA 2QR2A 2RB5A 2ZT5A 4G6ZA 1UPAA 2A94A 4M54A 1W35A 4KRXA 2ACVA 4BV8A 1YHNA 1NIPA 4H60A 4HWTA 3T0GA 1G98A 4C05A 4Y0NA 1EVLA 1KK2A 2QAGC 3OD5A 3NQ41 5AH0A 5CX1B 5LZ4A 2FDCA 1NLFA 4JUAA 3M5DA 5FNZA 1IEXA 1BDMA 4P3NA 2NU9B 1DX9A 4N41A 3A4MA 3N6VA 1PL7A 1QCDA 1SCAA 1TW2A 2NT3A 3I2FA 4GEKA 2TRSB 5I7EA 4FDUA 4OFBA 5BN3A 1N2GA 3CJRA 5KTMA 5I4CA 3V97A 2AUMA 4IZ6A 2PL3A 2QMQA 4MA5A 4E3WA 1CE8A 4NZ9A 3H1FA 2XHZA 3HJHA 1I13A 1C7EA 1DTWA 1XK6A 2FR8A 2X1LA 3GZJA 3BJEA 3QEBZ 4BVKA 1GLGA 2WTAA 5E1BA 1JI0A 3OM8A 1A4UA 5DNAA 3WGNA 3EPJA 3KEQA 3O21A 1WXQA 3BSFA 4ZANA 1AXEA 1R88A 3PNQA 3KPVA 3T61A 4TTIA 3H2JA 1L4EA 3GFGA 1ESEA 4J6EA 5YASA 4E46A 1NXQA 1G8YA 4BE7B 5HOEA 3FX2A 3E7WA 4Q05A 1TO6A 1HDYA 2X86A 1QO0A 5KDLA 3HMKA 3I04M 5KS2A 4FWTA 4INZA 3WLEA 1UFVA 3CVOA 4WZAB 1E7YA 4CQLA 2XNHA 4MGYR 1HNXB 2YL2A 4F21A 4MUXA 2PIAA 3DPUA 1LLUA 2B1JA 4BLTA 2JAQA 5CDTA 1RRCA 1YIDA 3OLXA 3IXMA 2NAFA 3LGXA 4CMCA 5BNTA 5LQAA 3D8UA 4IUDS 4WVLA 4ZFNA 1BHO1 1BN6A 3SMQA 4C6SA 2HY7A 2VUSA 4KODA 4NEGA 4Z3KA 3HDTA 1D9ZA 3N39C 1U0EA 3COSA 3L1KA 3TNJA 5ALFA 4CF7A 1A71A 2Q2VA 2H5IA 3A9VA 2EFCB 4MRAA 4GLFA 2CKMA 3A6JA 4X5OA 1NBEA 1BD3A 1P2UA 1ZJ4A 2FZVA 2IIQA 2OL4A 2ZWOA 3PRHA 1OYYA 2Y71A 3C4JA 4KQCA 4QNNA 4W5WA 4ZVNA 5HGJA 4BLPA 4ITUA 4F6CA 2R47A 3WGVA 3KWMA 4CI9A 3IKLA 3MGCA 5K01A 5B3AA 4DBLE 1JHPA 4QDXA 1NP3A 1ODIA 2O8VA 3UA3A 1Z29A 1PV1A 1H1TA 2Q5OA 5D5QA 1XNGA 4N3NA 2W58A 3OAAA 1U9JA 1HZZC 3Q8XB 4ZKDA 2ZRIA 3MHTA 1CUZA 2NQTA 3PNPA 2FFBA 4JLDA 4TT3D 4U6QA 5LQRA 1EQ2A 3CE9A 4HJRA 1ADBA 3L9XA 2X4IA 3OLYA 1I3OA 3GFOA 2FP4B 2V03A 2XMBA 3IUMA 2V5AA 2YTZA 4DQ0A 1G4HA 1EVEA 1KXJA 1AA9A 2EW8A 2W6QA 3F1KA 2VQ6A 3KQKA 1D4AA 3EFHA 3TOCA 4F9EA 3ZZ0A 1X77A 4WERA 2WJYA 3UVEA 5F3WB 4UNRA 1ECCA 1NUPA 5JNLA 2XXAB 3KKOA 2QMOA 3GDHA 4NPCA 3MOIA 1CU1A 4DLUA 2H00A 2GN1A 2QQEA 2H2HA 3QU4A 3P9CA 1KPHA 5FUQA 5DEOA 4Y9RA 1USGA 4OXNA 3WLRA 1UXGA 2Q27A 3IDOA 3HLKA 1IUOA 4ZVTA 1HBJA 4NBUA 4POAA 1NNEA 1U0LA 4PLTA 1Y8RA 1SKQA 4IPTA 2WJVA 1T4GA 2PZFA 1FNBA 4HXGA 4TX1A 1E99A 5WRFA 5K6TA 5JXWA 4N5NA 3E82A 4JVNA 3SWWA 2ZS7A 2CD9A 4JZKA 5I7OA 2VZEA 1YVEI 1N2SA 4G2TA 5EESA 2DERA 4Y2YA 1GAQA 3L04A 1F0PA 1Z22A 3WGQA 2VPPA 1RMTA 4G0ZA 1B3RA 4NZMA 3OURA 1A8SA 2QTWB 4C4OA 2YFKA 4IDBA 1Y1QA 4HH4A 4R1TA 3G6KA 3DVAB 3LV8A 3ZH9B 3CF4A 3TZKA 4MAAA 2PGJA 1DI0A 5ARCA 1PEDA 4MW5A 5AIBA 1T1RA 3OZSA 2C1XA 1X8KA 2YVAA 3CSUA 4HQ0A 1ZCZA 3HYRA 5A06A 4YUVA 3FSGD 4C4ZA 2JHAA 3MT7A 1E9RA 5E4JA 1HYHA 2BEJA 5AP9A 3U7GA 3FVRA 5KYKA 4EZIA 3DCYA 4MKZA 4J3JA 1ZW1A 3BB1A 4AJNA 2W0MA 1M8JA 4G36A 1BFUA 1T1EA 2XJ4A 4MEBA 2P79A 3RS4A 4RJKA 4V0KA 3TBHA 3V4FA 4D9EA 2A6PA 2JFHA 5LXTA 3T1OA 1N0VC 1QG6A 4MA0A 1KJNA 5H81A 2ZIZA 1Y7TA 4R71A 1EVQA 5D3MA 4ZU3A 1WSWA 2VJPA 3F46A 2NZYA 1NVDA 4I1PA 4H7HA 4O02B 1QO9A 2XT0A 1FEZA 3NP9A 1Q95A 3K1AB 2BTQA 1WVGA 2VCEA 2D0PB 4FFLA 4C43A 3A7DA 4B45A 4GDMA 2PSSA 4G0YA 1KYWA 1HMPA 1MPXA 4MVJA 3KQHA 1XAJA 1NW9B 3KKZA 1T9AA 1XX6A 4LGVA 1MRSA 5JCPA 2WF9A 2ZWPA 5CTAA 3UKDA 4EYKA 1E2EA 2DSNA 3D3JA 4IJ5A 1ABEA 1AKVA 4Q4LA 2QVGA 2QXTA 3WKEA 1ETHA 2HPZA 1ZSVA 2DHDA 4KQ6A 4JOCA 2L17A 1C30B 1YZKA 3OFKA 4JUBA 3MPUA 3NDIA 2JFWA 1NONA 2GNAA 3HB7A 2D2IA 5JNSA 4ND2A 4DT1B 2ZVQX 3CLSC 4RK6A 4ZVVA 2O06A 3EG5A 5EFZA 5CUQA 4EW1A 2WTEA 3QG1A 3IKTA 4MOWA 1U0TA 3D5EA 4RTSA 4PSVA 2XCQA 4QQRA 4AWXA 1CF2O 1QFZA 2CHUA 2E87A 3GMTA 3ULKA 1L7RA 1NU6A 2HXYA 3UJ7A 4JDPA 4Z8YA 3VFDA 2NSJA 2PSJA 2RB4A 1JJBA 3DE1X 2XOEA 4IFBA 5AOBA 2YFHA 5EZSA 2XEXA 3WTBA 5M5BA 3FROA 1K8RA 5EJEA 3GVHA 4AWBA 2PA3A 3FUTA 2CFOA 3DLPX 5CFZA 2AH5A 3TW8B 4EW6A 2OV2A 1HTWA 2IPXA 4OSEA 1XDGA 4GOMD 4MR9B 4Y1GA 1XRRA 2P1ZA 5ALYA 5AXAA 1XZMA 1DQNA 1NVWQ 2H5EA 2IV2X 5KOJA 5AICA 4YYZA 1QH9A 4QYIB 1WV0A 3G8YA 2F00A 4N5HX 2ZULA 1O5IA 2GEFA 4XM1A 1E1QA 4IWNA 4QQ8A 1XNJA 1YL6A 3Q3JB 4Q5IA 4G4JA 4HLNA 1A88A 3PR3A 2AG6A 2E21A 4FFNA 1E3MA 2QRZA 3AI2A 3FWKA 4XIYA 4RENA 1NJGA 4H1HA 1T36A 4I1VA 4J0QA 3PDUA 2VBGA 2I78A 4ND1A 5ALPA 4WN9B 2OGTA 2ZIAA 1T24A 5KINB 1COZA 3UK2A 1JDBB 4R1UA 1NVVQ 5AHKA 4ZVMA 4YUXA 1YK0A 2GVDC 3ZDBA 2IXTA 1TYAE 1Y1PA 4FC6A 2HLDA 2ERYA 2RH8A 4JASB 4EKYA 1VA5A 1WXXA 1OLSB 2F1RA 4S05A 4C20A 2Q1UA 5LU9A 4DSZA 2B1IA 3FFBA 4P3KA 5JZBA 2DT8A 5C4MA 1KC3A 5K0GA 4Q18A 1IC6A 1BU8A 3L06A 1HOTA 4EG3A 2XYQA 2YV5A 3AONB 4M1KA 5E1MA 4AUNA 4WCFC 2CSXA 2QLBA 4EBFA 1Z47A 4OP2A 3RODA 3WDKA 4YXFA 4ZEMA 4KQIA 5TMDA 2MIIA 4GYWA 1FDOA 3L6RA 3ELWA 3FLBA 3RDPA 3TSZA 1GQYA 2Q5HA 2NM0A 2BMAA 1RC1A 3G8BA 4FSHA 1KI6A 1T5IA 3PYXA 4MZDA 4QD3A 4RH1A 3ZIUA 3AVVA 2OZKA 2J31A 2O4CA 2YNMD 3OEYA 5AJZA 1X7YA 2X0KA 4ZAVA 4BO5A 5L8VA 1QHHA 5H0IA 1RYFA 4O25A 4ZQFA 1FDRA 3VR4D 3CNQS 5KU1A 1FFAA 3F4KA 2QY9A 2EF0A 2BL4A 2QPLA 5EUMA 4BS9A 4DYHA 1A8QA 4MX8A 3I6YA 4BO6A 1V96A 2QQGA 3L43A 4IDCA 4EHKA 3S2SA 621PA 1SK9A 3LT2A 2MT9A 1XEXB 3ASUA 5CNJA 2FMIA 3K4PA 4XVUA 4FM9A 3VSBA 3SF8B 1HDOA 2PRJA 4JR2A 4L51A 1BXGA 2AJLI 2ZJ8A 4B4WA 2HWXA 2FZWA 5BN5A 1A9ZA 2XE6A 5AKKA 1SKBA 5ELLA 1RYZA 1ZNWA 3WXMA 4F3CA 3M2PA 2QORA 1Z4OA 5EIOA 3DDUA 1GTZA 4HDMB 1E2DA 5LB2A 5G40A 3H4TA 4HX5A 2AC4A 2ILTA 1JFLA 4G0PA 4PSUA 1SC4A 2JNWA 2OR3A 4H3KB 4UHFA 4XIGS 1HURA 3DDNA 1F17A 2FW8A 1X8XA 4PNPA 4RHTA 3VR4A 1KHHA 2NUAB 4BUJA 5A4DA 4F0JA 3UV7A 5D3KA 4EPRA 4EPTA 4FMDF 3RFFA 3DMPA 5EE9A 5TSDA 3QJ5A 2WT4A 5LP1A 3OOEA 2HJGA 3KYCA 4AYXA 1PT6A 3IRUA 4CCYB 4NU8X 1XE3A 4AN0A 4PSCA 3ZLTA 4YJ3A 3W5HA 3GJTA 2GESA 4JUCA 1PJBA 2IPNA 1V9LA 1J4AA 3K16A 4G5YA 2WHRA 4OSOA 4UMDA 3U7RA 4FKZA 4EDHA 4H6VA 3NVMB 4RVCA 5F5XA 3RVOA 3F5MA 4YCAA 2DF8A 1DDOA 3VH3A 5IABA 4UPVA 3EB9A 1W19A 4UFNA 1XMQB 3FTFA 4LE2A 1IG0A 4JB2A 4FYJA 4CM8B 1M2OB 2DG2A 3MRSA 4G5QA 1U0FA 4M8IA 4AZSA 1IZ9A 2GZAA 3TF5A 2F8SA 2G5CA 4XTRA 1UKEA 4W8OA 5K0FA 4X3PA 1X1DA 4IAOA 5IEJA 1M7BA 3S1SA 3N8GA 3W4IA 1AS0A 5SY9A 2DETA 1GU7A 1TCUA 4WDQA 2Y92A 2F3QA 4B3FX 4DCVA 4LJLA 1JAXA 3W3AH 2VH5R 2J9ZB 2JKYA 3QGMA 1ML4A 2VNAA 3AM5A 2XI4A 1NZFA 2CXOA 2IHYA 3N0TA 4PLVA 1H2BA 1W29A 2DFVA 5K3AA 2GASA 5AKGA 4YI3A 1KIFA 3UHPA 4ZI7A 1ZCBA 5E6SA 4WBNF 3A6PC 1NMYA 3NHJA 1FYFA 1D7OA 2Z4SA 1OYVA 3W5SA 2CNBA 1M8PA 3L0ZA 4M89A 5BYBA 4ZYTA 1IHPA 1ECBA 1XHEA 2UVDA 2VHWA 4O2AA 2KPOA 1L5OA 2SKCA 4YT2A 1IEWA 2NMVA 4MV8A 3UAYA 4DKJA 3VYWA 5HZMA 3EZLA 3A28A 3E3LA 3ZXSA 1OAKA 4RTKA 1GPYA 3HZOA 1X6VA 4MS1B 4RWEA 1Z75A 5AI8A 5KHLB 2Z9DA 4PLGA 3WJ2A 1B6SA 1IOWA 3NIFB 4I66A 1NVFA 1P0CA 3AESB 4GF5A 2X9NA 1V48A 3BN3A 1OIVA 3LDAA 3ZYZA 4LKOA 5FWYB 2W7TA 1BRTA 1Q74A 2HADA 4NQZA 1P73A 1ZGHA 2J6CA 4RY2A 1HLGA 1QP8A 9ATCA 1NPTO 4X90A 4YRBA 2V54A 2HV8A 2JKZA 1DKQA 1EYZA 1V6CA 2OCPA 4LDZA 4DVJA 4CM7A 4H3VA 4G86A 4XFKA 3FNGA 3B3JA 2R6JA 1YFKA 2MYUA 1PBNA 2OD7A 3ZWCA 1AUQA 1V3UA 4WKPA 1AK2A 1A9QA 4ZT4A 1Z7WA 3B82A 4IGFA 3SZOA 4JI4B 1GUFA 2WYHA 3U6BA 1U28C 1JJ7A 3DQPA 3IV7A 3EGVA 1CZNA 3N76A 4F93B 2C2YA 4X41A 2YN2A 3MWFA 5EKSA 1YULA 3TDKA 3LGSA 3B6IA 2REXB 3A6ZA 1YU6A 3KE8A 3P8ZA 4IQ8A 2A0WA 3RT9A 2ORED 1WZIA 4JJAA 3QLEA 2C2HA 4YMGA 3LCUA 4UEQA 3VPHA 2F4VB 5CYGA 1CIPA 3AF5A 1UWKA 3U81A 5I4KA 2XIJA 3VBEA 1C1DB 5DBFA 3U4QA 2C3UA 1KZGB 1QCZA 3IMEA 4WK4B 3ROFA 4R0MA 1XZCA 2Z2KA 1E32A 3QPVA 1N0IA 4IILA 1BW9A 1AHNA 1UANA 4AJKA 4B87A 1QH0A 4KWIA 3RABA 4QGGA 4HQFA 3RHFA 2TYSB 2A84A 4LGCA 3HSSA 3U7JA 1VP9A 5EJ2A 1A9SA 5A2GA 2X2FA 3PF8A 4DLPA 5KNDH 2FZGA 5KX5F 2Q5CA 2FPOA 4K6KA 1YRWA 3NHRA 3FGZA 3TQCA 3ZE7A 1XKQA 1IM2A 5AVOA 2Q4BA 1UJBA 2IOYA 2PUVA 3DVQX 1ZGBA 2XUIA 2C9YA 2CJWB 3IAHA 3T99A 2FKNA 3IOYA 4AG6A 1UXHA 2R8PA 3UGKA 4HBZA 2IEBA 3L6UA 1D03A 1X9HA 1G3QA 2XGMA 4G63A 5EIAA 2WBLC 2HA2A 5JNUA 1CDEA 1QM5A 1TYDE 2I4RA 2PRZA 4LNUB 1KQNA 2B25A 5SICE 4EYGA 2QZJA 3H8VA 2JJ2D 2GEVA 5IXJA 1SB9A 3F98A 5L4NA 4H17A 4ZQBA 1UJ6A 1QZUA 3H8SA 4O2BF 4ZMBA 1U0JA 3R6DA 4MRMB 2OK7A 1YOVB 1QHGA 3H0EA 4GO1A 3QSGA 1ZIOA 4F3RA 3CJTA 2GA8A 3PKJA 4WZ6A 1SBNE 2PMEA 1HT3A 5ULLA 4Y6QA 3GU3A 3DOOA 3EZ7A 4Q4CA 2A59A 1FMLA 3DJFA 4HPJB 4N49A 1G8FA 4YJGA 1F20A 3UMJA 4BNFA 3UOWA 3EBPA 1XMIA 3RASA 4XYLA 4YP9A 2V0GA 1CJVC 3AF2A 4M6WB 4X9XA 2P91A 2WUDA 5HIIA 1TQ4A 2FMKA 3HHEA 3QWIA 3SDBA 3KJXA 4G67A 4BB0A 3CSDA 4ZHQA 1RJGA 1WP9A 2WU0A 2IPAB 3QVUA 1M74A 1PJQA 1I0IA 2WWVD 3RRFA 3U26A 4FGUA 3RFVA 4AUEA 4EYQA 3C7DB 3FBGA 5D00A 1D6MA 4IQGA 4UCWA 1SBIA 4DA7A 1WW3A 1UJMA 2JVJA 2YNMC 1K86A 2NN3C 1DADA 1TCBA 4L95C 3RFXA 2ETXA 3RSSA 3U1TA 3REQA 3NVDA 2NU7B 1PV2A 1NBAA 3DDZX 2W71A 4ZI7B 1FJGB 2BKXA 4I2NA 1UWCA 3G3EA 5ICFA 1RVDA 1DC5A 2IC5A 2R8YA 2QM7A 4REQA 4L5AA 1H3NA 3TLGA 2PH3A 1S8AA 3O5AA 4H7DA 4RPIA 4Y8VA 1PIWA 1U98A 2Q4TA 4LXHA 3W9SA 2AA3A 2FPWA 5ILOA 1IHUA 1FFEA 3B6MA 1EFCA 2Y0EA 5K7SA 3OEED 4NK4A 3KJEA 2Z4TA 3TGWA 3TDNA 1J97A 1UDBA 2XMSA 3PVZA 5BVHA 3FUWA 4FONA 4ZOLA 2INGX 2CT8A 2ONJA 1E2GA 4BZXA 1A04A 1GKLA 3QRWA 1D4FA 4JOQA 5T64A 2FEMA 1RYMA 3F73A 1M67A 3JQ8A 4G1BA 4F5YA 4NNPA 2DFDA 3KZNA 4LXUA 5JLJA 4P93A 5BO5A 1ADJA 1NMEA 2QUIA 3FRHA 3IIIA 5CDSA 1KDPA 2COKA 4UPDA 3DFKA 1CFZA 1J1UA 4HO1X 4HOYA 3B1ZA 3U16A 3NW9A 5CGQB 4TTVA 4DC1A 2CLMB 1UM8A 1PWEA 1WMAA 1YR6A 1ZQ1A 4C9BA 1FFHA 4OA5A 3B1WA 4CDMA 1FUYB 3OU6A 3WGYA 3N2ZB 1DRUA 1MC1A 1SRQA 5TMEA 2HAEA 3CB4A 1UPXA 1QS0A 1NU8A 4R8LA 5BV1A 5JZMA 2GCOB 1VPDA 1RRMA 3I1FA 3O0DA 2ACEA 1M2JA 4NECA 3RFCA 5L4SA 4QYXA 1G3UA 1L7NA 2IPMA 3K0FA 4LQ4A 5C8VA 3C8UA 3W7AA 2QTBA 4YAIA 1A1VA 1D1PA 3W2FA 1G16A 4OKIA 5E2IA 4N5MA 4PPFA 3UJAA 1RQ7A 3DQQA 3MT0A 2ZR0A 1YIOA 5LSAA 1SUWA 3UMBA 4KFUA 3GRFA 4JBGA 4W1SA 2O5RA 3AWIA 4KI0A 4D5GA 4X84A 1K0UA 3A58B 3AHJA 4R6XA 1PHRA 3IERA 4UVGA 4L9AA 7REQA 4HGRA 1MN6A