3RANA

Canine gdp-ran q69l mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
201
Chain Sequence
b'GEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GTP-BINDING NUCLEAR PROTEIN RAN)
publication title The structure of the Q69L mutant of GDP-Ran shows a major conformational change in the switch II loop that accounts for its failure to bind nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Transport protein
total genus 59
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ranA00
2BVNA 3KTAB 1UKYA 1C1YA 4URWR 5KNCA 4UXJA 2REBA 5J40A 3UXMA 1DADA 4EJSC 2CCKA 2GVZC 1F6BA 1I2MA 5BXQC 4C2UA 2IEYA 1XPOA 1XTIA 1GNQA 4HLCA 4R7ZA 3R8CA 2Z43A 2RB4A 2D7DA 1M7HA 2PZEA 4G5QA 2VF7A 2P5SA 1NI3A 1JECA 4IVRA 5GADl 3T1TA 3PVSA 1NNEA 1W1WA 1E2GA 3EA5A 3UK6A 5EE9A 2BEJA 2ZI7A 1PUIA 1X1SA 4MQBA 3IIMA 4MKIA 5KOYA 1OFIA 4ERNA 1NBMA 4D80A 2XX3A 3EASA 4XIGS 4TLAA 2ZIAA 1EXMA 4CEJB 3DOEA 1SHKA 1IM2A 1E0SA 3I4LA 3CX7A 2ZSBA 4CEHB 3QEOA 2DY1A 4OQMA 1W49A 1S1MA 4XVUA 3BB3A 1I4LD 2GXQA 2GHIA 2VA8A 3DL0A 1XXHA 4Q00A 5SZKB 4V0MA 1SVOA 1IJEA 1D5CA 2BWJA 1GKYA 4QBIA 1Z47A 2OFXA 3KJHA 3GLIB 5H70A 1WQ1R 3LX5A 2ZJAA 1E98A 3QBTA 3V4RA 2F7SA 3H2YA 5FH9A 3F0TA 3QOFA 3BFVA 4TLDA 1X8LA 4Q9HA 4PAMA 1OIWA 2WV9A 4Q4AB 5LD2B 4OKSA 3GLFA 4QM6A 3VQTA 4M1OA 1KI1A 4TN1A 3A1UA 5GJVC 2AFHE 4AIIA 3SDZA 3T35A 4GPTA 3K0AA 2AWOA 2CJWA 2WJJA 3PV0A 1R0ZA 4FXPA 3BFKA 5CLQA 4IDPA 4U00A 4HUQB 5EE3A 2A5DA 3I3SR 3U3RA 3U4QA 2XNDD 3I8SA 2XJ4A 4W5HA 2JGNA 3HPRA 1E2DA 3AF1A 1AN0A 1VPLA 2B7BA 3HU2A 4PPQA 4A0FA 2FZLA 5FTKA 3B85A 1B23P 3CF0A 2ZSFA 3MWKA 4HB0A 4PSVA 5C18A 4WZAE 4M8NE 4BWYA 2JLWA 2XNSA 3ZS8A 1FNMA 4LJAA 4DLTA 2JASA 1ZNZA 2GJAA 2QROA 1UBGA 1ZUNB 2C96A 2QE7D 1CBUA 2FE4A 4JJZA 4KJZA 2KBFA 2XZLA 2F43A 1R6BX 4EQ6A 1N5IA 1TMKA 3B7GA 3DMDA 4DCTA 4RZXA 1ELOA 1T3LA 4V03A 5TY0A 3SR0A 4DDVA 1W36C 2FA9A 3GJ7A 3GD7A 1KNXA 3OEED 2IS2A 1FFHA 3MJHA 2HJGA 4JVNA 2G77B 2HXYA 4MKFA 1XNJA 1PLKA 1BYIA 2GJ9A 2WAXA 2ZRJA 4MYCA 4IOKA 1GM5A 1RKBA 5HKKA 1E2JA 1QBKC 4Q9KA 1G3IA 2NTYC 2W6IA 1R8SA 4RCZA 4DEXA 4E03A 5EUMA 1KI8A 1BOFA 4D0NA 1KO1A 3W8RA 1KZGB 1ZU5A 5EUQB 1NJFA 4IXMA 3E1SA 4B48A 2O0KA 3ZGXA 3OIYA 4LHXA 1J8MF 2JAQA 4EKDA 5K8LA 5K8TA 2QMUA 2DB3A 4W5WA 2Q3HA 2WJIA 5IT5A 1SVWA 2XTZA 2VQSA 3RS0A 3C4JA 4OK6A 4TYQA 5FOWA 2EFHB 3ZYCA 3SBDA 3DZDA 3AVOA 1P5ZB 2NMVA 2OCPA 4YMSA 3PEVA 5JI2E 2D2EA 2QPTA 1KO5A 1DAKA 4M0LA 5IHPA 1G7SA 1AGRA 1W2HA 2JJ2A 1QHNA 1TF5A 3W5JA 1G7TA 2H8KA 2RGAA 1KDRA 2CK3D 3P27A 1U9IA 1KK3A 2ZRPA 4HEJA 2O0JA 2V8OA 4PZZA 1Y3AA 3K9NA 4ESVA 2WWGA 4B3DA 3FVQA 4KVGA 4ACBA 4JT4A 4JLDA 1KOFA 3RS2A 3EIHA 3ADKA 4LGMA 3VKHA 2NPFA 3RC3A 2NO9A 4EPTA 1SXJA 5FFMA 4UNSA 1E9FA 2Q21A 2NQ2C 3MFYA 2HXSA 3TK1A 3CKLA 4NPHA 3Q85A 1U81A 4Q03A 4FWTA 4LK2A 4AC9A 2ZI6A 2BBWA 2ZJ5A 1QHHB 2QSYA 3KFXA 1SVKA 4D81A 2NPIA 3F8TA 3A1VA 3AH8A 3DZ8A 5SZHB 4GL2A 1QG2A 4OL0A 1Z2CA 2GESA 1IN8A 1ZD9A 2VBCA 3CRMA 1DELA 3FHOA 3Q7PA 4TLCA 1HYQA 2CE7A 1R8QA 4LBYA 1IY2A 1SULA 4ACAA 1KSHA 3X1ZA 2VTKA 4R9UC 3R7WA 3GFOA 4R2HA 4BEBA 4YC7A 2J7KA 4MRRA 4BLTA 2V4ZA 5LBIA 4PC2A 1YR8A 3KKOA 1DAFA 1YZGA 4DCSA 4TYYA 4YMVA 4HAZA 4QNMA 2EWVA 2GZHA 4LCBA 1NMXA 1Z0JA 1J8YF 1KNQA 1Q1ZA 1W0JD 4GP6A 3IPXA 4B6EA 1ZBDA 2VRWA 2EFCB 5F98A 2QP4A 1KSFX 1NF3A 2DFKB 2QBYA 1OHHD 2VP2A 4KI0A 1ZD8A 2F9LA 1MO3A 3PENA 4TYNA 3PUYA 1J7KA 4DB4A 1DAGA 1Z6TA 3D6TB 4C0QC 4QJ5A 5TMPA 4BEJA 4A15A 3AKCA 4BFZA 3CWQA 1Z0KA 2IS6A 2HT1A 2ZRBA 5AJZA 3ZD6A 4XWAA 2C2HA 1N6LA 1VCNA 1XXHB 2OEPA 4XVRA 4UNQA 4A0HA 2W0SA 5AJXA 5C1BA 1DAIA 5FI0B 2HUPA 3W6NA 2QAJA 1FX0A 2DWQA 4FCTA 1AQYA 2HCJB 3PUXA 1G7CA 1Z0IA 1ZD1A 2GA8A 4M2LA 4YLGA 5KTYA 3GLFB 5JJLA 3LA6A 1UDWA 1XEFA 2WJHA 2BHRA 2XTNA 4KO8A 3K0AB 5CIWA 2CJWB 2AWNA 1YHNA 3C7KA 5JS8A 2QGZA 3O8RA 2PJRA 4A8JB 1XB2A 3GEEA 3MCAA 2ODEA 2KE5A 3DHWC 3TIFA 1R10A 3U4QB 3CRVA 2RAPA 5L3VA 2FSFA 2FZ4A 4A92A 1ZM2A 2HEIA 2ZI5A 3MSXA 4ILEA 4M9ZA 1CP2A 1KI2A 3CRW1 2OFWA 2GXUA 1OE0A 2P6NA 4TL8A 4BLSA 1TUEA 3VNVA 3R8FA 1N6KA 5DLQC 1AKEA 2H16A 1OKKA 4TLEA 4OHWA 4BE7B 2VHUA 2IT1A 3ZH9B 2EQBA 2ZRNA 1TEXA 3BORA 3H0KA 1K5GA 4UJ3A 3SYNA 3UMSA 1E0AA 2N1BA 2FH5B 4XSGA 2WICA 3AP3A 1W48A 2CEAA 3NBFA 1W7AA 2F43B 1ZM4A 4EQ6B 2A7QA 3RLFA 3BH0A 4D6PA 2AK2A 2J46A 3EX7C 4JKYA 3DM5A 1W4AA 5CDFA 1RJ9A 1F2TB 3QPWA 5FTNA 1XMIA 4YXWA 3WHLA 1HE8B 3R9IA 3OEHA 1FP7A 1GWNA 2W2VA 3DEFA 5JCPA 3TGPA 2WMOB 1Z07A 3KX2A 3K70D 4LJYA 1NIPA 1P4SA 4NCIA 2GXSA 4X8OA 2HF9A 3N5CA 3IUYA 4GDFA 2OUKA 3KXKA 3NXSA 1X3SA 4HLUA 1OFTA 3HWSA 4BASA 3TNFA 3TW4A 1KK1A 1VYTA 2XEXA 3CR7A 4LSGA 1RRPA 3VR2A 5BYKA 4NCJA 1BS1A 3GLHB 1SKYE 3PJRA 5FUXA 2JJ1D 4LUCA 4B74A 1E96A 1EWRA 4GBMA 1BH2A 3ETLA 5H68A 3TW8B 1RPZA 4RCYA 1CJMA 5HR5A 1II8A 2R65A 5GJCA 5DHAA 1G8GA 1ONBA 2X8AA 2YWHA 1JPJA 5JZVA 3V9PA 1J99A 2BM1A 2CLCX 4DIEA 2R6CA 4IVPA 3TR0A 4LV5B 3G5UA 4B43A 5KSZA 3U44B 2BKUA 1ZMXA 2QI9C 2ATXA 3MD0A 5EP2A 2Q9AA 1T9HA 1MRNA 2JEOA 2QPOA 3ICEA 1R4AA 4LBWA 2QU8A 1QVAA 3IPYA 1IXSB 2D62A 1DAMA 1SXJB 1DBSA 3BAFA 3HR8A 2OAP1 1G41A 1LNZA 2BOVA 3OIUA 2ZUDA 2O8CA 2FEOA 1XBTA 1TQ6A 2QQEA 3ZJYA 1PLJA 2VHTA 1XDBA 2GCPA 4DDUA 5JJKA 4QXAA 1UADA 2DFNA 2WPDD 1CR0A 1OFUX 1PLLA 1FTNA 1S3GA 1YR7A 2OSBA 3C15C 3SJCA 4CT5A 4Q4JA 2LKCA 1XTQA 1UM8A 3R7WB 4QG7A 2ASEA 3A37A 3ASZA 2P0EA 4Z51A 4F91B 4XTRA 1SZPA 2N46A 3IILA 3GJXC 2ZJYA 2E87A 4NE2A 3VTKA 4WA7A 3WP0A 4A0RA 5JI3E 4AYTA 4Q5IA 1NJGA 1E9RA 4LHZA 4DT1A 2OT3B 2MSDB 3JZAA 2XZOA 3AF4A 2QBYB 4Q1CA 2IYYA 2ZI9A 4Z1MD 2N42A 3NHAA 3BK7A 1Z0FA 1QHYA 1A7JA 3I73A 3B1ZA 4UXHA 4DZZA 2P6RA 3N70A 4WAUA 1VCMA 3GLGA 3SFZA 2QP9X 4N1AA 4II7A 1GRNA 4Q4HA 4LJ8A 2QTVB 3BOSA 3ZZUA 1YU9A 3Q3JB 1OH5A 2G0TA 2UVQA 2ZS7A 1MV5A 3LO5A 3RYTC 3WY9A 4DLVA 5ANRB 1KJZA 1IQPA 1FX0B 4LJ4A 1LB1B 3A1TA 1NKSA 2Z4SA 4M1MA 1U98A 2ZROA 3PFIA 1YZQA 2XGJA 1CTQA 3GFPA 4TL6A 3CNNA 1JAHA 4NYJR 3Q9LA 5J47A 2WBLC 1VKJA 4PHTA 1KHTA 1Q1EA 4NYIR 1N5JA 4URVR 2QT1A 1P2VA 5L3QA 2ZSEA 1E94E 3QENA 5BQ5A 2IXEA 2I3BA 1W47A 3P20A 2CNWD 2XNDA 2GCNA 1VIAA 3O8CA 2QEQA 4CGZA 4NONA 4TZ0A 2B7CA 2FFAA 5KDLA 3RNLA 2B92A 4CDGA 1YZLA 5J4YA 4ABYA 4DSOA 4JT2A 1JR3E 2G0NA 5FR1A 2GBLC 1XTSA 3RVBA 4Z8YA 2WKPA 1O87A 3KXIA 3IQXA 1GZSA 4Z54A 1KO8A 1E2MA 1OPXA 3NHBA 2REOA 4I1UA 4MITA 2QE7A 1CJKC 1QG4A 3FHTA 2NG1A 1N0VC 1RJ9B 1K5DA 3SN6A 1TX4B 4Q01A 5F9HA 4QJ3A 1E2PA 2CL0X 5KHOC 2QRZA 3NTUA 3FKSA 1W44A 2FV8A 4PQFA 2C9YA 3L0PA 5FBQB 3RRYA 1NRJB 4I99A 1ZCAA 2X1VA 3QVVA 3ZIAD 1MABA 3OEEA 2WOJA 4NP6A 1E9BA 2QUZA 1JPNA 1CEEA 4EFNA 1KI9A 2VH5R 3R20A 1NMZA 1B0UA 4FMDB 1KIMA 4OI1A 3VR4A 1P9RA 1TQDA 2IYSA 3F3YA 1BIFA 1W0KD 2FF7A 4C0JA 2KBEA 2D3WA 2QAGA 2IYUA 1OYWA 3D3QA 5CYOA 2OM2A 1KAOA 2C9OA 3PUVA 1P72A 1Z2AA 2IYXA 3PQCA 1R0YA 2C8VA 3KQKA 4L5BA 2IWRA 5FTLA 1KO4A 4Q18A 4FIDA 4D0GA 2VP6A 1JEEA 3M0EA 5A5GA 5EXTA 4QFMA 1P3JA 3VX3A 4RFVA 1W36D 1JI0A 4ZDWA 4RKFA 1L4YA 3EIEA 1RIFA 1XZPA 1ODFA 4RZ2A 3E2IA 3K53A 3BD9A 4GP7A 4DLSA 2J3EA 1GKUB 4QHYA 5JWRA 1EFCA 1NVXQ 2CK3A 4PQYA 2ZRGA 3D31A 4W7SA 4MRPA 2J7PD 1N5LA 3HDTA 1UFQA 2ZAOA 4UJ5A 2ANCA 1S2MA 1SVSA 4Q9IA 3PIRA 2TMKA 3LDAA 4QGGA 2XJ9A 3B82A 1J90A 1N0UA 4WW0A 2O8CB 3B13B 4BQSA 3PXGA 2WSMA 2CDNA 4GMDA 1CF4A 1VG9B 2EU8A 3LQQA 2J9RA 2A30A 2OCAA 1TU3A 3LW8A 1U0LA 2R8RA 4JMPA 1S8FA 4LV6A 1NG1A 1X86B 2YOHA 2ZYUX 2PCLA 4WZBE 1ZNXA 4Q4JB 2FFBA 4RD1A 5HE8A 2PMKA 2FSIA 2QTHA 5AUNB 2WKQA 3K9LA 5KDOA 4PTLA 3NH6A 4QOSA 3VR5A 1Y63A 1UBCA 1KI6A 2PMDA 4ASUD 3BS4A 3EARA 4FWIB 2XSZD 1A4RA 1F5NA 4DDTA 1EGAA 4KFRA 4B33A 3CWZA 2FN4A 1PV4A 2DPXA 5FBWB 1HH4A 1NIJA 4Q48A 3EWAA 5JWHA 3LVQE 1E2NA 2YC2C 2FX3A 4DT1B 1AS2A 3LAWA 5JRZA 1XRJA 3RSLA 2MMGA 3FE2A 5L3SA 1E2EA 2GJ8A 3QKSA 2ECKA 1JQLB 1W0JA 1GL7A 2BJWA 2HT6A 2OAQ1 5TXGA 5HZHA 1EESA 3K0FA 4HZUA 1RE0A 1RYFA 5EJEA 2IEZA 2NOAA 1OHHA 1G6OA 4LBVA 3RSOA 5EE0A 4OQFA 3MWYW 5B64A 4ITRC 4Q4HB 1E2HA 4KODA 3VHLB 1T3SA 5EP3A 4PAQA 1XFAA 1Z06A 3HPQA 4QBGB 3ASYA 1GL6A 4MDFA 2V9PA 4R98A 4P4UA 4QGAA 2QP3A 3FMPB 3LD9A 4S2EA 5E95A 1H65A 2XB4A 3SS8A 1Z0DA 1CRPA 1OXTA 2BCGY 3NBZC 4BPBA 4ZPXA 3L2OB 1YJ5A 2GEUA 1I2DA 3DOFA 1ZYUA 1W4RA 5DYGA 1FMLA 3O8BA 3LLUA 3ZQ6A 1IY1A 2V3CC 1RRGA 1UPTA 2XOKD 5L3QB 4K81B 3U3JA 4OYHA 5B2ZA 5HE9A 4YDHB 3KB2A 1RVDA 1HV8A 1P62B 3CONA 3AP1A 3NIBA 1KDTA 5TB5A 1XJ0A 3KDSE 3KZ1E 1G3UA 3LNCA 1P60A 2QT0A 3SHFA 1CR2A 3CNOA 3W34A 1D2MA 1G5PA 2ZRFA 3TUZC 2BKEA 4NMMA 2ZU0C 1BMFD 5AJVB 5AUQA 2QM8A 3WMGA 1KO7A 3IBYA 1VCIA 3WYGA 3BB4A 3TR5A 2WM9B 2DWOA 1R0WA 1XP8A 3KKNA 4Q21A 3EC1A 3QF7A 2JJ8A 2V55B 1W2GA 2ZRAA 3FPAA 3CBQA 4OJKA 3WMFA 2ZR0A 2GXAA 1U8ZA 4WZ6A 4KU4A 3ZDQA 4F4JA 1K8RA 4AG6A 1IN5A 2VSXA 1MABB 4PANA 1TL7C 3AUXA 3UG6A 4A8JA 3EPKA 3TVTA 1P9NA 1HY3A 3C41J 3TAHA 2WMNB 1Z5ZA 4OK5A 2HYIC 1COWD 4NYJQ 3SNHA 2QAGB 3D7MA 1W4BA 3HU3A 2FFHA 2RHMA 1G64A 1S9HA 4DJTA 4PO9A 2LCFA 4NYIQ 3EZ7A 3TAUA 1T0HB 1OF1A 5HTKA 2DYKA 3C5CA 4E07A 2B8WA 4KITB 1Z0AA 2JJ1A 4OHXA 2QGNA 2XTMA 3A4LA 3I32A 1M74A 4RD3A 3QEJA 4DSUA 1OXSC 4JJKA 3VKWA 4CRWB 3ZD7A 1GRQA 1SKQA 1DVRA 1HUQA 3NVAA 1NN1A 4IJMA 3LXXA 2ONJA 4AKHA 2RHDA 4P4SA 5KSYA 4HB3A 4LJ5A 4EUNA 1YRAA 1F2TA 2JLYA 2ONKA 1LS6A 1WRBA 3NC1C 3SQXA 1NVWQ 4BRUA 3A4NA 4HAWA 4MRNA 3A8TA 3QPUA 5D3MA 3K0CC 4C9BA 3CIOA 3AP2A 2QQ0A 4A2WA 2O8BA 2FG5A 2IYVA 3SBEA 3T1OA 2MMCA 1G3RA 1G3MA 2DFTA 4CVNA 3IIKA 3U5ZB 4A6XA 2C98A 4NHOA 4LYHA 4MYUA 1AA9A 3TUIC 2WWIA 1L7VC 3CF6R 3EZFA 4KVAA 2IYLD 3GLHA 3CX6A 1WXQA 1JBKA 1M1YE 1MO4A 4A2PA 4DSNA 3EA0A 2CCJA 2A3RA 2YWEA 2ZR7A 3AVVA 1E2QA 4ZDJA 4PQRA 4HUTA 1ZNYA 3SFVA 5JSZA 5HCNA 4O2LA 1OLOA 1EX6A 2A5GA 2QL6A 2QSZA 4M22A 1XMJA 2WPDA 4KBFA 2IS1A 4BLOA 1V5WA 1E9AA 1KI6B 3AKEA 4GOJA 4K46A 3B8HA 4PC3A 4TMZA 1TUIA 4A2QA 4B44A 4TYWA 3L82B 3U44A 1OFHA 3WXMA 4PXAA 4UNNA 4BZQA 1AQUA 4LX0A 3OE7D 3PG5A 4DCNA 5L3SB 4IDOA 2IXGA 3QKSB 3VNUA 4LHVA 2QORA 2FEMA 3PEWA 2BBTA 1S96A 3K0FB 2KJQA 1KJWA 4HZUB 4PC7A 2MSEB 2WVJA 1F2UB 4BFWA 3B6EA 2F1JA 3WNCA 4DLZA 1GNPA 5TARA 3FOZA 4Z1MA 1FZQA 1D2EA 3VX4A 3CLVA 3GLIE 1RZ3A 3RANA 3DM9B 4HAUA 3SOPA 2H7VA 3KUCA 5DI3A 4IDNA 4P31A 4XWKA 1TNDA 4OHZA 3AM1A 3EAQA 2CHVA 3DDCA 2A78A 4URZR 3P26A 2WTUA 4KYIB 3RS3A 2R6FA 4RD4A 4TWZA 5CITA 4FD2A 4TQ9A 1T0JB 5C46F 4EJSA 2RGBA 1GIAA 4H1VA 2J0UA 1E1RD 1E79D 5EXPA 2P6UA 3DKVA 4ARZA 5AR1A 2F6RA 3I1FA 3MRSA 4GSYA 5EZ5A 5C4GB 4BZPA 4LWZA 4OQLA 1YE8A 5C2JB 3J81k 2OZEA 3V4FA 4F4IA 4UNRA 3GJ5A 2DBYA 3QXXA 1QHIA 5FOVA 2ZU6A 1AS3A 1M7GA 2NGRA 1LTQA 2ORVA 1OXUA 4BFYA 4I81A 5B57C 5DNYB 1MR3F 1ZIPA 3QG1A 4P32A 5J4KA 3U6KA 1U94A 1WCV1 2QZ4A 3BE4A 3RRMA 4HAVA 2CNWA 1IN4A 2QENA 4PR0A 3QE0A 3ZQJA 5BN5A 1PUJA 1FTSA 4PZLA 2C78A 1H8HD 4YMTA 2OILA 2PZFA 3KKQA 1G291 2DR3A 1IY0A 3T34A 3AVYA 3TBKA 4B34A 2ZE7A 1EX7A 2W6JD 2OO7A 4XJXA 2ZJ8A 2Q3FA 1Q0UA 1SVIA 3O8DA 3WMEA 5G3ZA 3EXAA 2YKGA 3BIFA 4TQAA 1CJTC 1T3HA 3L8ZA 5DH9A 1T6NA 1UDXA 2Z6VA 3BB1A 1T91A 5E7IA 4JLKA 4JLOA 1FUKA 2QTFA 3QJYA 4F4CA 4MGKR 1E9SA 5DSZA 3ZZ0A 3K70B 3OAAD 4DLUA 4TT3D 3WNBA 5FPKA 3L0OA 3ZIAA 3RRNA 1JAIA 1JQJC 4A0GA 2NO0A 1M7BA 5FL3A 3U7FB 1G9XA 3GEHA 2PH1A 1EK0A 1GOTA 1M34E 4EPVA 1W0KA 5BN3A 3AVUA 4Q1BA 3BFXA 4RFSA 3KQNA 3THOA 2PLRA 3MWLA 4H1UA 2BEKA 2WSSD 2FMXA 4MRVA 1GL9B 4TYPA 4XWOA 3QXSA 2WWWA 1F3OA 3CRQA 1S1CA 4TTQA 1AJEA 3C14C 2OCYC 4GNKA 4JL8A 2FPLA 3RABA 2VP9A 1LFDB 2G6BA 1MRSA 3BXZA 3D8BA 3IHLA 1Q20A 3QXJA 3KL4A 2PX0A 5D3QA 4HLDA 1E99A 4LDJA 1US8A 4P4SB 2R6AA 1G5RA 1Q1BA 3U2QA 3FFBA 3X2SA 3AV0B 4PHFA 1XU4A 2ZRDA 3REGA 2CVHA 2AHOA 1AGPA 5A4JA 4TZ6A 1TPZA 2KB0A 5D3MB 1Z3IX 4JVSB 1YRBA 1HQCA 1OXXK 3QKRA 4O0MA 1FL9A 3B1WA 4Q7JB 5UKDA 3RWOA 5EE1A 4C0LA 2YINC 2O8BB 3AQ4A 2J7PA 3MAAC 3RRZA 1ZCBA 3DVLA 1MOZA 2CBZA 4LPSA 4KLZA 4O3MA 4ZCMA 4JSTA 2G1JA 1L4UA 1MKYA 3EPLA 5FPYA 4TMWA 2YZ2A 2PT5A 3LBNA 2O8EA 1HURA 4BLPA 4G5GA 2ORWA 3FYHA 4G5SA 2XXAB 1HEIA 2ZSAA 1OV4A 2WWXA 5LD2C 521PA 3X1YA 2BIFA 5JSZB 2X19A 5F2EA 3NC0C 4KCGA 4EFMA 5KPJA 1Z29A 3PUWA 1YZKA 1S9DA 4K8OA 1Q3HA 4AURA 1CULC 1WE2A 4GZLA 5JS7A 2AD5A 2ZM5A 4WIAA 4O25A 2IUSA 3ND8A 1FUUA 1OYYA 4A36A 2PCJA 1P2TA 4KSBA 4D82A 2WIAA 3FWYA 4UXIA 4QGHA 5K8UA 3NBYC 2PJZA 4IHQA 2GF9A 4ASUA 3K9GA 1NBME 2IL1A 1WMSA 2P65A 1KY3A 2XSZA 2ZITA 1TQ2A 3QKUA 1P7CA 4XSHA 3UG7A 1G8HA 8OHMA 5KNDA 2HLDD 4L4UA 4DBLC 1P73A 5J5CA 3I62A 2FWRA 4RSGA 4HYYA 3LRPA 3NEJA 4TSFD 1G4AE 5GVRA 4W5JA 3JZMA 4F93B 5KU1A 3B1VA 4HZIA 1XXHE 1ZC3A 2VIIA 1NSTA 4V0ME 5DYIA 1DG1G 4DCUA 1Z6YA 5FPTA 1G19A 1G20E 2Z83A 5FOXA 3GJ0A 4QHSA 4B2LA 1W5SA 2WJYA 5DI3B 2PBRA 1T4GA 3GMTA 3AGPA 3QUSA 3GLFE 1DO2A 3T06B 4AKEA 1YZTA 2EW1A 4CYMA 3VR3A 1TF2A 4ZDIA 1A82A 2ZE6A 3I61A 1QRAA 5CK4A 2QY9A 1R5BA 3GJ3A 1PZNA 3H4MA 3VHXA 3WRXC 1ZP6A 421PA 3KQLA 4EJSB 1M2OB 2VHJA 5KSOA 2LKDA 1Q22A 1ZM7A 2RGNC 3KXLA 4F7WA 2J0UB 2IS4A 2J45A 3FGNA 4TTPA 4ARZB 4DSTA 1DPFA 2ORIA 2VPPA 3HR7A 4MYTA 4D0LB 1VDZA 4RKEA 1HE1C 2IC5A 1W5TA 4URXR 2GZDA 2QRNA 1NSFA 1RW4A 4IFBA 3OF5A 1XTKA 1G7RA 2GETA 2XOKA 1JR3D 4B32A 2CLSA 2OBLA 3K9HA 3TE6A 5AK0A 2ZJBA 1W46A 1G8FA 3LLMA 2VYFA 1D2NA 3QPVA 1T8UA 1DEKA 1XEWY 1X6VA 4GT1A 1K6MA 1S4QA 5HPYB 3B78A 5DE3A 1E6CA 1N3BA 2WJVA 2RGDA 5AUPB 4LJ6A 1YZUA 3L43A 4MKGA 4DDWA 4CT4B 3JVUA 2GWHA 2RGXA 3P4YA 1BMFA 3SYLA 3I5XA 2NZ8A 3MUFA 5FL7D 4AWXA 3I92A 2JATA 2CL7X 4NKRA 4B73A 2BMFA 2VSOA 4NZYA 1OH6A 3IKJA 3EZ6A 4Y0AA 4OQNA 1YR6A 4MGZR 3SC3A 1T5LA 1SGWA 3MMPA 3TKLA 1ZUIA 3NH9A 1E0JA 3QXCA 4LJ9A 4OI2A 3LH5A 2W2TA 4BLRA 1Z6AA 1ZW6A 2EFDB 3NG1A 2ZANA 3Q5DA 4DB2A 3BRWD 4YMWA 2AFIE 3Q72A 1LF0A 1Z08A 4HB4A 1CS4C 4MGYR 3NDBB 4FI3C 3CUEF 2PT7A 1LY1A 2VP5A 4A6PA 2FPKA 2A5YB 5EE5B 5TDHA 1OXVA 4IXNA 2W00A 1COWA 3QG5A 1CU1A 1KZ7B 3GQBA 3M1IA 4IDHA 4RFSB 3B1YA 5G3YA 2GEVA 4DC9A 3A6PC 3AF3A 4L8GA 4D4KA 2VSFA 1F48A 1Q44A 5AJWA 5JECA 3RAPR 1NVVR 2C5LA 5IK2D 2PLFA 2JLQA 2IYWA 1CRQA 1BYUA 2XAUA 4YMUA 2AKYA 4V0LA 2JLXA 1FOEB 3BH7A 2ZE8A 2I1VB 5TV2A 1W36B 1US8B 4M1TA 4O2RA 2P3SA 3GJ4A 2R2AA 1EG7A 1R2QA 1SXJE 3KUDA 2ZETA 2VHCA 1NMYA 3BGWA 2GAOA 4V0OA 5BW8A 1TAGA 3HU1A 4DVGA 4XOIA 4V0KA 2PX3A 4Z8XA 4C0BA 3C16C 4QM7A 1G8PA 5C4MA 1OT3A 1G6HA 5L8VA 2OV2A 2CLDX 3AKDA 3QKRB 3VAAA 2HYDA 4ESHA 5DI9A 2V1UA 3RS4A 2PEZA 2IYRA 1FNNA 5G40A 2XITA 3T1VA 1E2KA 5KUTA 1CIPA 4Q47A 2OFOA 2GTPA 4DKXA 2QNRA 221PA 3CR8A 1VYVA 4BZXA 2O8EB 1LV7A 5E3HA 1G16A 1QVRA 2EYUA 4BFVA 1FQKA 4QJ4A 5CIQA 2G9NA 4XD7D 5JEDA 2IA5A 1KKLA 2A2ZA 4M53A 3DPUA 3CW2A 3WHKA 2GVDC 2RGCA 5CJPA 1SHZA 3THXA 1XTRA 2WZQA 3OHMA 4L15A 3EIQA 4M1SA 5CB8A 1ZAKA 2GEDA 4CF7A 4D4LA 3QKTA 3SEAA 3DMNA 1KSGA 1OKKD 2V54A 3WBKA 821PA 4JL6A 4KV9A 1G1MA 4RZUA 4IEEA 1UEIA 2EFEB 4LYAA 4HSEA 4AYWA 3TMKA 1BKDR 2I4IA 4LOAA 2L0XA 1KMQA 2LWIA 1NP6A 3JVVA 3WYAA 1NY5A 2ATVA 1PJRA 5JBQA 1GUAA 1N6OA 3OE7A 1GVNB 4N0EA 4IW3B 2C77A 4OBEA 1U8YA 2AD1A 4UQOA 2QMEA 3ZZTA 2ZJZA 4G5OA 2GJSA 5KO2A 2GZAA 1E2LA 4LC0A 3TQFA 2ZREA 4RZ3A 4Q1EA 4E22A 1OJLA 1IN7A 4FCWA 3W6PA 2OBNA 2BC9A 4PC1A 2C04A 3IIJA 4FMBB 4PC6A 5DN6D 3FMFA 1C9KA 5EQTA 2JA1A 2QA5A 1R5NA 3FB4A 1XMSA 3O47A 2QN6A 5LB2A 1SQ5A 4IFEA 5JHHB 2VF8A 3SU8A 1N2CE 3QI2A 1Q3TA 3V00A 1UBFA 4EPRA 1EFUA 2D06A 3LFUA 4DHEA 4ZKDA 1OIXA 2UZ3A 2F3TA 3BBPA 2ODNA 2ZXUA 4I4LA 5EP4A 1E1RA 1E79A 2O0HA 1N5KA 3EWSA 2IYZA 1CKEA 1DTSA 1Z83A 3AF0A 1L8QA 1FQJA 1TU4A 1U99A 3SJAA 2WWHA 2QM7A 2DHRA 4QHTA 1NL3A 3QBVA 1JJ7A 1N25A 2C9CA 3QY0A 5AUOB 2FJUA 4KFSA 2ZSDA 4JZKA 3GJ8A 3QXHA 1F2UA 4V0NA 5A0FA 1WDTA 3ZVMA 1TTTA 5CM9C 4TTRA 4HAYA 4B3BA 721PA 2A9KA 1D9ZA 3L0SA 4J0QA 5IF9A 3FKQA 3IGFA 1WF3A 2IUTA 3UATA 1U9IC 1D6JA 5CDFE 4PPGA 2RGEA 5GVSA 3UPUA 1S3SA 1A1VA 1WP9A 1VIYA 1H8HA 1DS6A 1XZQA 2Q9CA 2I1QA 1QZXA 2E1RA 4GMXA 1JXMA 2ZUBA 5JLJA 2H5EA 5TVKA 4UNPA 4NBSA 2A5FA 1AS0A 4WXPA 5JCZA 1SXJC 2W6JA 4JS0A 4N0DA 4PFSA 5FBRB 1XWIA 3W8NA 3EG5A 3L0IB 3GP8A 2FDCA 4ZCLA 2ZVQX 1WA5A 3B5JA 5E4FA 4JVLA 2WWFA 1LW7A 4F38A 2F9MA 3K8YA 4X8LA 1IHUA 5FOSA 2NO1A 1RFLA 1BO6A 121PA 3OFND 1KK2A 5LPNA 2ODBA 3TLXA 4DXAA 1XD8A 3OESA 3OAAA 4TT3A 3VU9A 1KDOA 2RKOA 1NN5A 4PZYA 4URUR 4C0AC 3ONWA 5JMTA 1YQTA 3EPHA 2NO7A 1GITA 3DKPA 3T61A 4HDCA 2GBLA 2IK8A 4B47A 2V6IA 4EPWA 2ERYA 3HYTA 3PR1A 5G53C 2OBMA 2RMKA 1G21E 4Q1AA 2RH5A 2YHSA 2NZJA 4OI0A 3IDQA 3T5GA 2WSSA 1G18A 3G82C 1E9EA 1OB5A 3AEZA 3FMIA 5CYPA 4OK3A 3M6AA 4ON9A 2GNOA 2QPAA 4Q1DA 3B2EA 5FOUA 1DE0A 2ZQ5A 4JYCA 2O8DA 2IBMA 3EZ2A 4MA4A 5DIFA 4EPXA 1GDDA 2JDID 1DAHA 2B6HA 1U0JA 2RGGA 4S35A 2O5VA 4R71A 1Q12A 1XEXB 2IYTA 3BJIC 1NLYA 2NIPA 1XJQA 4AKGA 4KAXA 2W0MA 3TSZA 1AM4D 2BJVA 2H57A 4M9XA 5JWOA 3A4MA 2KSQA 1PVOA 2OLJA 2WWYA 2EFGA 2H17A 1XCGB 4Q9JA 2QMOA 5H8WA 3A58B 1DARA 3KJIA 3KKMA 5SZIA 4LHWA 3SYKA 2F1RA 1E0KA 1KAGA 4PO1A 1A2BA 2VL7A 2P5TB 4HDOB 4KFUA 1UEJA 4NYMR 1YR9A 4ZI2A 2OLKA 1P2UA 1VHTA 3KKPA 3UMRA 2CE2X 4JLJA 1GILA 2CL6X 2EWWA 3BERA 5KYKA 1H8ED 2H18A 5BN4A 4LYFA 4AK9A 3THXB 2H92A 2ZRHA 1WB9A 2OG2A 4DIDA 2R62A 4IDQA 1RRCA 1KMHA 3ZVLA 1M6NA 2NO6A 3ADBA 1GG2A 5DHFA 2JLVA 1NVVQ 1VECA 2YOGA 3AVWA 3CPHA 1S0UA 2G3YA 3MWJA 3I5YA 4MRSA 4BGDA 3VR6A 3RC8A 2ZPTX 2C03A 2W58A 3QIAA 4XVQA 3LW7A 1P75A 5EXXA 3GLGE 2HLDA 4HDQB 3LV8A 4MH0R 2BMEA 3KJGA 2IW3A 3P32A 4D26A 4C0SA 3SI7A 1E4YA 4M1YA 4TSFA 3FKSD 4WVFA 3THWA 3HP1A 3LQRA 2G1KA 4DLXA 5JFGA 3W9YA 2JIZD 4RD0A 4JBXA 4AI6A 3UANA 2VEDA 4M9QA 1KGDA 1XX6A 3AF2A 4BFXA 3WRYC 2XXAA 2YC4C 3L8YA 3U60B 2GKSA 4X8MA 4A82A 2J0VA 1GAJA 3VKGA 3M4YA 1EFHA 2F3RA 3IQWA 2J0SA 2WHXA 4G0NA 4DEYA 1ESNA 1UJ2A 2DWPA 4FMCB 2IYQA 1YKSA 3WP1B 4B75A 4HLUC 3K1JA 3WBJA 4GFDA 1Z6GA 2ZRLA 2YWGA 3PITA 3X1WA 4R2IA 4NL4H 1IXZA 4C7OA 2WOOA 4POAA 1KJYA 1T5IA 2WJGA 2OESA 4AD8A 4B3GA 2IXFA 4M4SA 3W5IA 1KI3A 4B3FX 1FMJA 1P2SA 2ZYWX 4JLMA 3P4XA 4CEIA 3REFA 3LBIA 1XD2A 4IOLA 2ZS9A 4PAOA 4ZV4A 3QSYA 1A5TA 1JR3A 2RCNA 2V7QD 2Z4RA 4TL7A 4IKEA 4JSYA 3VFDA 3K0SA 2F55A 4JBYA 4LZZA 2FU5C 2VP0A 5F9FA 1D8TA 3IBGA 4GOKA 5LB4A 4A4DA 4IOMA 3P1JA 4LHYA 4JVMA 1FP6A 5KSPA 1CXZA 1RYHA 1Z8FA 4W9MC 3K0EA 2AR7A 1OH7A 1ZUHA 3A1WA 5FL7A 5FTJA 5BYJA 4B2IA 2FSHA 3CPEA 2GCOA 5JHGB 3PUZA 3IO3A 4OHYA 2P67A 3SE0A 4DWJA 2FSGA 5E7JA 1ESMA 3TRFA 3KJEA 2DFLA 1E1QD 1NY6A 2KWIA 2YVUA 4GZMA 3U7HB 1ZM3A 2ZAMA 4NU0A 3LXRA 2UZIR 2ZR9A 1SVLA 2EYQA 4RD2A 4ZCIA 4G5RA 4URYR 3VU9B 2JLSA 4U02A 2YWFA 4JLAA 1SKYB 3AVPA 1QHSA 1J2JA 2SHKA 3QQ5A 5CM8B 4ZDKA 3W3AA 4DUGD 3ZLJA 3MLEA 2JLRA 1W4CA 2HCBA 2G88A 1WBDA 1QHGA 2J59A 3MJRA 3FFAA 3K09C 4IRUB 4LJ7A 3F5FA 2PEYA 4TQUS 3AGQA 5M04A 5DO9A 3QF4A 1ANKA 3AVQA 3B1XA 2R6GA 1EFRD 1OSNA 2DCUA 5IK2A 4TMTA 5JRJA 5IDVA 5GJBA 4BLQA 4G3XA 3AVXA 3CH4B 5FBVB 3SQWA 6Q21A 3EPJA 2O8DB 3I8XA 4P3YA 3DO6A 3IEVA 1OW3B 1QDEA 4BFSA 5K8IA 3VMFA 1X1RA 4UKDA 4US1R 5J4VA 1NN3A 4LC1A 3PEUA 3U7EB 2AK3A 2J5XA 4LRWA 2F1HA 2XB2A 3GJ6A 2ZYVX 2R9VA 5P21A 4B3XA 3UWKA 2FOLA 5KNBA 3THYA 4DLRA 2ZI4A 2Z0MA 4HB2A 2BCJQ 3T12A 1II9A 4OJQA 4MUBA 2ZI3A 3Q7QA 4XH9B 1YVDA 1L2TA 2IF0A 1LS1A 4XD7A 5G41A 2R44A 3LY5A 3UKDA 1JXOA 2B8TA 4LV8B 5FBLB 1GKIA 1VMAA 1DO0A 2VO1A 2OE2A 5HCIA 2G83A 1F60A 1NBMD 2K5UA 2Z5FA 4FMDF 4TLBA 1KMHB 4B35A 3Q5EA 3U6BA 3E5HA 4L9WA 3WYFA 1JJVA 1CJVC 2AKAB 2J87A 1U90A 1UF9A 3ZVRA 1HT2E 2YYZA 1R0XA 3K0CA 1VG1A 3ADCA 4KSCA 4PX9A 1Q57A 3FDIA 1M8PA 4Q4LA 4EAQA 2ZS8A 1EFTA 1G3QA 2FFQA 4HI0E 4YQFA 2ZVPX 4L9SA 5FR2A 3SJZA 2MSCB 2GJKA 2D2FA 3GCGA 4PHGA 2IX3A 3THWB 2ZJ2A 3A1SA 2ZJOA 5DGXA 1JALA 2H1LA 3RHFA 1KSJA 2VLIA 2ZRIA 3QVUA 3KFVA 2FPMA 1NN0A 2Q0HA 1VTKA 2GRJA 2J1LA 3CZPA 4X8HA 2FNAA 4FINA 4QC2A 1N6PA 5DN6A 3W90A 3R9WA 4MUAA 1ZINA 1O3YA 4P33A 2GF0A 1Z28A 3LX8A 2Q3MA 4NYMQ 2JLUA 3KQHA 3H84A 3B60A 3C8UA 1OH8A 1SVMA 4FCVA 2BMJA 1T8TA 4B6FA 2QAGC 2YOFA 2AXNA 2WAYA 5JJIA 4C7OB 1IJFA 4AG5A 4JKIA 4D4JA 4LY6A 1V43A 3X1DA 4B76A 1IBRA 2BMDA 4NCKA 5CJ2A 3SJBA 1A2KC 4US2R 3S1AA 4CEIB 4FW9A 4XTCS 4RJLA 1XD2B 1AK2A 4M1WA 2WKRA 4H9GA 1G17A 4WOPA 2GILA 1Q21A 5LDDC 4US0R 1KTVA 4I1SA 1VG8A 2GDJA 3ADDA 4RY2A 3ZS9A 3LWNA 2F1IA 5FUVA 1OIVA 3IEUA 5L3RA 5HKKD 3UIEA 2X2FA 1AKYA 2W6ID 3AUYA 4Q7MB 1VYUA 2AL7A 4WBSA 4I1VA 4JLNA 1CLUA 2HJVA 2PZGA 2V6JA 4A1FA 4D25A 4MYHA 1IONA 2V1XA 3ICQB 1E69A 1E3MA 1IAQA 2W2XA 1G4UR 3MGCA 3W6OA 4KFTA 2BBOA 2GCOB 1AIPA 2FGJA 4Q9LA 4OI4A 1CR4A 2XZPA 3NDPA 4P0TA 4OHVA 4QRHA 4U5XA 1X8KA 1QHXA 3TSWA 3CPJB 3Q8XB 2ZRMA 5SZJA 1UKEA 2HV8A 1YZNA 3CNLA 5F3WB 3OFNA 5JEEA 1II0A 2JJ2D 1P6XA 4C0KA 3EZ9A 3KB1A 3FMOB 4Q7KA 4BECA 1NLFA 3X1XA 4LBZA 4P4TA 2ERXA 3EW9A 3HJNA 3TSOA 1I4DD 3K09A 3AKYA 1MT0A 2ZTSA 1J70A 1XPUA 4A9AA 2CHGA 4IOJA 1ZRHA 1KY2A 3EC2A 4EFLA 4ZIRA 2J41A 3GFTA 4AYXA 4GI7A 1SXJD 2O52A 4DRZA 4EIWA 1DG3A 4M1KA 3QF4B 4MDEA 2VP4A 2ZE5A 4LI0A 3AB3A 1DOAA 2BV3A 4ZI3A 2Y8EA 1GRRA 1KK0A 3N2EA 3GEIA 3CF2A 2IF2A 3NWJA 5AWFC 2IHYA 4LPKA 4PSAA 4L16A 1KI7A 4NH0A 3IO5A 2O8FA 2GAAA 4HATA 4PSKA 4C3ZA 4M21A 3RWMB 2JDIA 2CHQA 3GLHE 2D74A 3ECCA 1LF5A 2OHFA 4ZO4A 1QF9A 2BM0A 2WIBA 3BWDD 3UMFA 1UBEA 1ZVQA 1XCMA 3THYB 4C0HA 2HDNB 4NDZA 5KDDA 3HYRA 3KTAA 1TF7A 4KHZA 2ANBA 1XEWX 1XD9A 4KBGA 4QL3A 2QMHA 4LYJA 5CLLA 4YDSA 4QBHA 1ETUA 1ZU4A 2IUUA 1VHLA 1IOZA 1P9WA 4WXRA 5J4LA 1GSIA 4I1OA 3T1QA 1HQYE 1X8JA 2GK6A 2C95A 4G1UC 1E9DA 1XCPA 1ZJ6A 5GJWC 1H8EA 3N2IA 4Q1FA 5IRCD 4M9SA 3TQCA 1ZM9A 3TUJC 1GFIA 5EXSA 3PCRB 4RVCA 2OXCA 3VR1A 1XPRA 1UAAA 4CEJA 1HT1E 4JLVA 2Q9BA 5AJYA 4YONB 1E2FA 1N6IA 1E2IA 5FPHA 2CVFA 2BDTA 1D9XA 4OQXA 4CEHA 1KKMA 3RS5A 4MGIR 3NBXX 3W3ZB 1XEXA 3TH5A 1CR1A 4CZ2A 4TMXA 1FW6A 1ZNWA 3CO5A 1XMVA 3CM0A 1JEDA 3OZXA 3U3MA 1VCOA 3WNDA 4NCHA 1NLZA 3GLIA 5HZKA 2A5JA 2E9SA 4PO8A 3RS7A 4NTZA 1UKZA 2REXB 3SHWA 2W83A 1P61B 5H1YA 3R9XA 1U0HC 4Q4AA 4GOXA 1ZC4A 2C99A 1HTWA 4CW7A 2JIZA 3B9QA 1MH1A 1ZIOA 4BFTA 4C4PA 2YNMA 3CX8A 1Q1QA 4B2PA 5BWMA 5FTMA 4CIDA 5B58C 4A8JC 4HUQA 4JLPA 5FOTA 2ZUCA 4EDHA 5KPDA 1C4OA 1N6RA 3K70C 1OB2A 1WBBA 3BC1A 1Z63A 4G01B 2IWHA 1CJUC 4HAXA 3UWOA 1R7RA 621PA 1RC8A 1U8AA 1RRFA 4C30A 4Q19A 3LVRE 2OCBA 2ODWA 4PPNA 4HLQB 2FGKA 3MG9A 4EPYA 1GNRA 2CMKA 3CZQA 4JL5A 5FPSA 3TVDA 3I72A 4PPFA 4QNRA 3T5DA 1G8YA 4BFUA 3LBHA 4V02A 4DLWA 1E32A 3S1AB 1II8B 2X77A 1AZSC 1E9CA 1EWQA 4YXWD 3U3OA 3FTQA 4FMCF 4F92B 3OEHD 4FN5A 1AZTA 2GK7A 1FPMA 5FUYA 5FUWA 2ZEJA 2BBSA 3NKVA 2V7QA 5DISB 5EZ6B 1U2RA 3U7GA 3ZVNA 5CB6A 3T15A 1XTJA 1TQ4A 2PL3A 4E09A 5B30A 3SZRA 5E7MA 1I4TD 4BRWA 4TMKA 2RGNA 2R6DA 1KYIA 2YV5A 1KI4A 1XJCA 1KDPA 3PEYA 4BUJA 2HF8A 4Q7LA 2JCSA 3ND9A 4KXFB 2ZRCA 3TJZA 4QGFA 4QBFA 4NCNA 3U61B 1LVGA 2ZYTX 3A36A 1IXRC 3QNUA 1NKTA 5J4HA 1UKVY 2AX4A 4IVQA 3BH6A 1E1QA 2CCGA 4KYUA 4N3NA 3G0HA 4RD6A 1JNYA 1GP2A 1N0WA 4B71A 2Q6TA 2ZRKA 2QG6A 2D4HA 4QKQA 2J0QA 1MO5A 1XF9A 5CK5A 4DCVA 3GPLA 3KQUA 4DLYA 1N6NA 3OIWA 2KI5A 3FHCB 3E70C 4AKIA 2B21A 4GRAA 2UKDA 4DUGA 2YJTD 1DAEA 4ZIRB 1NG9A 1JB1A 2JLZA 2AN9A 3C5HA 4JIMA 1TEVA 2AXPA 1JR6A 4D2IA 1HA3A 2P2LA 1E4VA 3CB4A 1N6HA 4PHHA 4C2TA 3B9PA 4AY2A 5EP1A 2EVWX 1EFRA 1Z22A 1GTVA 1VG0B 1R5OA 4U7DA 2CXXA 3RDPA 3CRRA 3AVTA 1G5TA 1MO6A 1TADA 2IHBA 3H1TA 4B3CA 1IN6A 3H86A 1NVUQ 2D7CA 3IHWA 1Z6XA 4E5UA 2VHQA 1QHHA 2O8FB 3GLGB 3OIVA 4ZKEA 3U3KA 4JLBA 2X2EA 4JBWA 3CH5A 4TMVA 5FI1B 4D4MA 2OXRA 3NEYA 4Q66C 4Y0VA 4TL9A 4KLNA 4MKHA 4IEIA 4Q02A 5ELXA 4JYBA
chains in the Genus database with same CATH superfamily
2BVNA 1M1YB 4K2AA 4C7VA 4COOA 4L3VA 3KTAB 3ABZA 4L8WB 5J2UF 5FA8A 4FVTA 5J40A 2CCKA 2GVZC 4JUFA 1SQ6A 1NHGA 1I2MA 3A0UA 3KEGA 4JGGA 4M55A 3KL2A 3HXQA 1Y3FE 2YDYA 1XTIA 3MJTA 4HLCA 5FPQA 1PJTA 3H9GA 1EH5A 2RB4A 3NPMA 2QDKA 3C4VA 2WSIA 4G5QA 2D7DA 2R47A 4XRRA 2V7WA 1JECA 1VGVA 5EPOA 5GADl 3T1TA 4R2WA 1NNEA 4Q37A 1KU6A 2QZ9A 2P11A 5AI0A 5IJ0B 2BEJA 1CQXA 1PUIA 3ROGA 8LDHA 1CV2A 1X1SA 4L76A 2CL5A 4MQBA 3ZW7A 4MP6A 5ECYA 5LA6A 1Q0SA 1KE1A 1OFIA 3ZHUA 5CT4A 3ESZA 4I4TB 4IICA 2CMFA 1A4IA 5JNTA 4KIFA 1BX0A 4D80A 3TJRA 3EASA 4XIGS 2ZIAA 3KHSA 1IZ7A 3IEPA 4DIKA 5EMNA 3FVTA 3NATA 1DSSG 1IM2A 4UDYX 5A7GA 2VPXA 4V1CB 1FYDA 1LJ8A 3CX7A 3I9KA 1JA9A 2VHXA 1C7IA 1JZTA 3LPCA 4YRKA 1Q83A 5BMOA 4YJDA 1W49A 2Z3VA 1DCMA 2QYTA 2GERA 3GD5A 1XXHA 3PT9A 4Q00A 2AQKA 1KC3A 1CUUA 2FSUA 2I2XB 4WT7A 1D5CA 5HUHA 5INTA 1HYBA 1X19A 4GO1A 3RSHA 1WQ1R 1ID8A 4FSDA 2F7SA 3IV7A 5BNZA 3QOFA 3BFVA 2VF5X 3R9XB 1RFGE 1R16A 3BSWA 3FMVA 1OIWA 4Q4AB 4MR9B 4QM6A 3UENA 3VQTA 1KI1A 2VDLB 1GKLA 1N92A 2LW7A 4OL9A 2WT9A 3H2HA 3EH1A 3JR7A 1VCHA 5E1OA 1KP9A 3AB8A 3PV0A 1R0ZA 4M8IA 3BFKA 2FEKA 2FDXA 4IDPA 2FW0A 4JYMA 3U4QA 3VH2A 4W5HA 2IHZA 2O4UX 1QV9A 4LRXA 3EF3A 3AF1A 1FP1D 1JKXA 4M8KA 4I1YA 4DKJA 3KLMX 2FZLA 3B48A 4EO7A 3B85A 3BIXA 3HN6A 4U7PB 4EYQA 3MWKA 5EKDA 4CDNA 2RCYA 3TLKA 2MR5A 1OC2A 1QYXA 5LZ2A 3KEFA 1XRQA 2NWQA 1D09A 3M82A 2Z04A 5IJ9A 2XUAA 4LJAA 4Q05A 1U4SA 1VL5A 1PWYE 4LRYA 4P84A 1DIBA 2X0EA 3FM9A 3FYUC 4C6HA 2OD2A 5C1DA 2YS6A 2NSYA 3WKBA 2C96A 1GPYA 1CBUA 2QE7D 4OSOA 4U2GA 2KBFA 2R6HA 2F43A 3WBBA 3WWPA 4EQ6A 4F5WA 1N5IA 2XZLA 3ACBA 1TMKA 1W8IA 4NARA 2PYDA 3DMDA 3H1AA 3IT0A 4DM3A 4P0QB 1T3LA 4DW8A 1NM5A 3EFEA 2WF5A 1JJFA 1QZ3A 4FFBA 3UJ8A 1A5ZA 1FXWA 2FP4A 4D6XA 3QTTA 4NEQA 3TQQA 4PG6A 3L7LA 1FFHA 1JQ3A 5C51B 2FUNB 4ISBA 4LQ4A 2ZPUA 1BYIA 4MYCA 3PFHA 4JJ6A 3VR4D 4G23A 4LXGA 2H4JA 2VRNA 4QTZA 1NZDA 5HKKA 5I7HA 4Q9KA 2HO4A 4GLBA 3AF6A 2Y1WA 3K0HA 3KZXA 3KUKA 1VB3A 3KB8A 4FYKA 5J1TB 4BFLA 1DIHA 4Y1GA 2MT9A 4CGYA 5EUMA 4DABA 4DEXA 1KI8A 5EVJA 2C0QA 1KO1A 4GXTA 1KZGB 3P2YA 2NX2A 1DDIA 3I5MA 3WWZA 3AV3A 1U6KA 3ZGXA 3OIYA 4CCYA 4IIFA 4EKDA 4HC4A 3ILYA 3OU2A 5ABPA 3T3PB 4QG3A 5I9SA 5K8TA 1L4NA 3OIDA 4ALIA 2YFQA 2CKMA 5IT5A 3F7MA 3N05A 4K03A 2C9MA 2Q62A 3QJ5A 5FOWA 5HGXA 3DZDA 3FDZA 3TW8A 3MWEB 4CDMA 1P5ZB 1I7LA 4F3YA 3WLMA 5JI2E 2C4HA 2D2EA 1KO5A 1I51A 3DYVA 5HKLA 3U7QA 2PSHA 2Y1XA 2OECA 2P2DA 2RIRA 2ZATA 1AGRA 3O74A 4EOGA 3W9BA 5BMVA 1BEZA 1QHNA 4WLFA 5FI5A 4BJHB 2GZRA 5E0OA 2FY8A 2XUQA 4HEJA 2FP3A 3OSZA 3SHOA 1MENA 4FZ5A 4HLNA 3RRJA 2V8OA 3D4NA 4BTVA 1WUYA 2W6CX 1J1UA 1KC1A 3NNDA 3FVQA 3JQ9C 2XT9A 1U5CA 4NU8X 2XGSA 3WGOA 3QE3A 4CI9A 3BFPA 4LGMA 3RVKA 1RD4A 4K6HA 5K8CA 1XRRA 4Y6RA 2NPFA 3RC3A 1DOHA 2ZB2A 3DOUA 2PBZA 4OJNA 3V8EA 2QW8A 3GUVA 4MI1A 4UNSA 1OZAA 2FJ0A 3EBOA 4O2AF 1F12A 1GTJ1 2FEXA 3G9QA 3BXOA 1X0VA 4UMEA 4Q03A 3LCMA 4PNZA 5DASA 5AO9A 1CVLA 1NX9A 2YWCA 2BBWA 1QHHB 4L02A 2OFFA 1BJKA 3COPA 2G06A 2WYIA 3HO8A 1NWHA 3A1VA 4IUCS 1R4NB 5SZHB 4GL2A 1KMMA 1E1KA 1Z2CA 1IN8A 2VBCA 3CRMA 3TLEA 1XGKA 2AG1A 3FHOA 3AHDA 1HYQA 3KQSA 1JQBA 4F2GA 2MSKA 5JE8A 4CIVA 4UEWA 3VR5D 4L75A 3X1ZA 2NAPA 1K63A 2VTKA 3H4TA 3IULA 3JARA 4R9UC 3R7WA 3IODA 4MQFA 4ZGWA 3BWXA 3PWTA 4X6UA 1YR8A 5E4JA 1DAFA 4LF4B 4OYYA 1M8FA 1YQQA 2JKZA 4EKYA 2NW6A 3D0KA 5T8KC 5AM5A 4F3KA 1DHTA 2H5IA 1ZISA 2HK8A 2NADA 2Q5FA 1Y48E 1Z75A 4FN4A 3VHQA 1D6MA 1KL7A 4MV4A 5AJUA 4JVOA 5LQNA 1Z0JA 1C1DA 2APJA 1DC8A 3OPVA 4AUMA 1BVRA 4LVOA 1G6Q1 2R7LA 1ZBDA 2CHEA 1JNXX 2QP4A 1NF3A 4KH0A 4MS4B 2BGKA 2PS1A 2X3UA 1FFBA 3OLXA 4WKBA 3ORSA 1ZD8A 1U7PA 4QREA 2VRBA 2A88A 1PGNA 3C6MA 1MO3A 3ZV5A 4TYNA 2XUHA 1KEZA 2L17A 5K0LA 3Q0TA 4HDRA 3WSVA 4A15A 3RVPA 2B4QA 4LTMA 1NU6A 5E6RB 4NF2A 4EUFA 1BCRA 1UIMA 2JIOA 2YJNA 1EFDN 2FQWA 2GNAA 2YIMA 2QR2A 1VJDA 3A9UA 5G0UA 4B3IA 1N6LA 4IG4A 3F98A 4UPEA 4A0HA 4IIUA 1Y9EA 1WG8A 2B2CA 1TMOA 2DM6A 3DV0B 1KH3A 1G20B 2W0SA 1X7GA 3INYA 5C1BA 1E7SA 5FI0B 4YASA 2QAJA 3W7VA 1WOYA 1RKUA 2V9ZA 4OBBA 1G7CA 1ZD1A 2GA8A 2LTAA 2HPHA 2P79A 3VZPA 2A94A 1IE3A 1D5WA 5JJLA 2CLEB 1X70A 3GPIA 1PJ3A 3LA6A 4FOSA 4M6WB 4OVKA 4R2JA 5HOEA 1XEFA 5ADUS 1CQIA 2G7ZA 4PGGA 3ZK7A 3K0AB 4Q4DA 3PJRA 1UXKA 1YHNA 4HH0A 2QGZA 2ZYGA 4A8JB 3ABRB 3SMVA 1N2CA 4OFXA 4WINA 3FNRA 3OHPA 2J08A 4QDOA 5JD4A 3VUEA 3DEHA 1EK6A 5DN9A 3ZI7A 4QT0A 2ZYRA 1FW8A 2QR5A 3KWJA 1V1JA 4WH0A 2K2QB 1XDZA 2L69A 2FZ4A 1HDRA 2ZI5A 3HVHA 3BL8A 2EKBA 1VI6A 3GH1A 3ZLUA 1AK9A 4CMGA 2OFWA 1NVKA 1OE0A 2GXUA 4J0DA 4YT2A 5L51A 2FOIA 1UQUA 4BLSA 1PFKA 1T25A 2HTFA 2FWPA 2IV2X 3TG8A 1QDUA 2QTCA 4BE7B 2JZOA 3QW4B 3OU6A 1T6BY 3ZCUA 1YR3A 3FOFC 2EQBA 3TCNA 3UMSA 1RAFA 2J3QA 2FH5B 3E3MA 4XSGA 3JSXA 4WNAA 2WICA 1PFYA 1QX4A 3AP3A 3K35A 3NBFA 3GFSA 3PQDA 1ZM4A 4E5KA 5KVVA 3KUXA 1Q2XA 1XLTC 3RLFA 2J46A 2IUEA 3E9CA 4PF1A 2W42A 2XUZA 1J39A 3T5PA 4R4JA 1ZOIA 1GGMA 4B5KA 1OU4A 3QPWA 3TIIA 3V4ZA 2ZZNA 1P4RA 3UGQA 3WRYA 3HRIA 3OEHA 3DV2A 5CB4F 3V3TA 2HNAA 4ALKA 1CUHA 3WGTA 1YQXA 2AMJA 2H4WA 2OHGA 2WHPA 1WB4A 1P4SA 1O0CA 3ZXUB 1HG1A 2O2HA 3AZPA 3H8JA 3N5CA 4ENWA 5BUZA 2V0GA 1M2FA 3KXKA 3NETA 3BA1A 4P3NA 2PGIA 1SUSA 3MCTA 2JFWA 4R05A 3EDQA 1J8VA 1YDHA 1B14A 2AC7A 5HS6A 4UTOA 4BASA 3TNFA 2VJOA 2PKQO 2WUWE 4W9NA 2ZWPA 4MI6A 4MJ3A 4EEXA 1YNOA 3D02A 4NCJA 4LNUB 1K8ZB 3L6OO 3PCXA 1C0LA 1X38A 3PC6A 1HKUA 1ONPA 4OIMA 2VYVA 1DQRA 2W5UA 4RMNA 2P1RA 3BZWA 4TXNA 3I2HA 1BH2A 4H2DA 1QC5B 5JNWA 1Z5WA 1CC1S 2XCIA 1T2VA 4YWJA 1KJIA 4DJ5X 4H7FA 5LXTB 1J2TA 2PZJA 3MK31 1JG3A 4BO0A 2KM1A 4M36A 4Q3LA 4EF5A 4LDPA 2JIQA 2NM0A 1R0BA 3EE6A 4JX8A 5ALKA 2JBHA 3A6HA 3ZHRA 1ACJA 4RLHA 3MM4A 4S24A 3IIEA 1MEEA 3IVMA 3JTEA 3C7TA 3OZDA 4FYVA 3TR0A 2H2GA 1Y5NA 2CDBA 2FUG6 3CYFA 3G5UA 3OEYA 2BKUA 3MCWA 4GF5A 2P9JA 2WQZA 4IO1A 4E2FA 1KTIA 2H1OA 3OPXA 1LVUA 2EBUA 2WIFA 4HL6A 3JQCA 4K88A 3TZLA 2C5BA 4ECAA 4IINA 3ZE7A 2PKRA 3WK9A 3KQVA 1IRXA 1NTOA 1LC3A 2WU1A 3HLYA 4MVWA 4PONA 2QU8A 1QVAA 1UCFA 3AHIA 3R5FA 5JLAA 2FW8A 1DAMA 1SXJB 3CLTD 3V32A 3AKZA 1ZGHA 2OHVA 2IELA 5C7IO 2FRDC 1ZIYA 3QYFA 5K0CA 1G41A 3ZLTA 1BXKA 2H2AA 2W8BA 2ZUDA 3B8EA 4DV0B 3L7JA 1W0CA 1XBTA 4YI5A 1UPFA 4NZMA 2QQEA 1L5SA 1ZK1A 1I9CA 2VHTA 3I9LA 4FBLA 3EQZA 1XDBA 2GCPA 2C1EA 3BJZA 3QMVA 2OORC 4OP3A 1L7MA 2X86A 3CBGA 5T64A 3R76A 5IASA 4CKXA 1Q0RA 1AKQA 2DFNA 1ULHA 1YK1A 2WPDD 3J7AC 3GJZA 5DWDA 3LQFA 4HYQA 1V7PC 1FTNA 2YRFA 3EZNA 3G17A 4IV8A 4UUBA 5EJMA 3V1MA 3VYUB 2A6PA 4Q4JA 3IP9A 2LKCA 1JG2A 1QE5A 3L18A 1T15A 3ML1A 1XTQA 1PBTA 3BTVA 3DO5A 3FI0A 4B4OA 1P39A 9LDBA 2AFVA 5MGNA 2PWPA 3A37A 1B1AA 1IUOA 3PNSA 3MRXA 4REQA 4EW1A 4ZJPA 4QPDA 4X62B 1E3IA 4LXHA 4IDDA 4A8HA 3IILA 1OWNA 3QEAZ 2Y1OA 3I1YA 2CLKB 5JI3E 3OQ1A 2RKWA 4KSYA 1MCZA 1B00A 2P91A 3FWNA 3L0ZA 1X77A 1UQRA 3CJQA 1SCJA 3QRWA 3MVEA 3SF0A 3P7MA 1LRLA 3H05A 1K89A 4Z1MD 1GHTA 3ND5A 3BK7A 2GYUA 4X00A 3B9BA 3R24A 2X1LA 3K6JA 1QHYA 1K98A 3AEUA 4ZEVA 3B1ZA 4R0NA 2CLIB 4JSRA 1AV7A 1NQWA 2VQDA 3GGSA 1YJ8A 4LVUA 1XU7A 4OU5A 5AM4A 5IUKC 1VCMA 4EHNA 3SFZA 5GMOA 3TOVA 1THZA 3EQ2A 4II7A 3RYIA 1RWPA 4ZCSA 2QTVB 3BOSA 2F67A 1YU9A 4KZKA 4UNIA 3ZZUA 1ZJJA 2G0TA 2ZS7A 4D4GA 3PL1A 3LO5A 2OXTA 4PLCA 3UOGA 1FDTA 4EHDA 5C9ZA 3WY9A 1H0SA 3Q9UA 4ZI7B 3ERCA 1B6TA 1FX0B 1KJZA 1VJTA 1DBIA 1YB1A 4E5VA 5EJ6A 5JY1A 5KJEA 1T0UA 1LB1B 3A1TA 1WUKS 5D1NA 1U2DA 3FCYA 4UMDA 2QRQA 3G3EA 2ZROA 4P3XA 2IHNA 3H8VA 1JVSA 3RADC 4IDAA 1QGED 1GD1O 2CFRA 4NYJR 4XARA 3DLPX 2GEBA 3HBFA 3S2YA 4N9QA 4C06A 4MUNA 2X7HA 2B1GA 2WBLC 1X7ZB 3IT2A 1LQTA 5AVZA 1Q7GA 1P2BA 1KHTA 2B0JA 4HEQA 1T8PA 4O4HB 1N5JA 1U3TA 1JIXA 2QT1A 1H69A 3GC6A 3RVSA 2FX2A 1AKTA 3QENA 3L40A 2I3BA 1JEQB 1I4WA 1W47A 5HF8A 3RHTA 4CQLB 1YL5A 4KXWA 1T1EA 3OC6A 1F7UA 1QIKA 1R00A 2QEQA 4GGOA 1M0EA 4CGZA 4NQRA 1PTJA 4ZVNA 2FFAA 3ZQUA 1DBPA 3RNLA 2VTBB 1N4DA 1YZLA 2C1ZA 2O07A 2OXFA 3BHMA 4FFDA 3GRFA 4IILA 3LYHA 5NULA 1L0BA 3MWFA 3W5HA 3O31A 1TFUA 1LPOA 3C3PA 2GBLC 3OCUA 5F76A 2OLEA 2XUFA 2YHIA 1Q91A 3QPCA 5FNVF 5I8WA 1O87A 2H1FA 2QIOA 3OCYA 1QPGA 4Z54A 1I5RA 1JKFA 3EMBA 4CIXA 2F8SA 1Z2NX 3C7CB 1TGYA 2WF8A 3OOJA 3DULA 3CC8A 3RC7A 3V6MA 2QNIA 1EUYA 3FHTA 1YJBA 1DP4A 4OOFA 1PG5A 4WOKA 4DJEC 5KNDH 1RJ9B 4Q01A 1YQWA 4QJ3A 2WYVA 1HF3A 1K8YB 2QX7A 4FZRA 5JPIA 3FKSA 4ZOCA 2FV8A 5KHOC 4PQFA 3C6KA 2IY7A 3R2JA 2C9YA 2I55A 4HQ0A 3T7EA 4HX9A 3ZLBA 1JIIA 1ZCAA 2X1VA 3QVVA 4NI5A 1EYZA 3ZIAD 4Y9DA 2RFLA 2I2CA 3UY4A 3F6SA 3VGJA 4Z4HA 1RHUA 4DCJA 3KXPA 2B25A 1CCWA 1YCFA 4HVAA 1TQDA 3F3YA 3TXYA 2D2IA 3AFHA 1W0KD 3E8XA 3MUEA 1ULZA 4N49A 2XUKA 2IYUA 5IDWA 4INPA 4U2DA 5CYOA 4BO4A 1Y4ZA 3D4IA 3EY9A 4LSMA 3PUVA 4UAJA 4CUJA 4X5OA 3PQCA 1XPJA 3AR4A 2Y76A 3UT5B 1VMEA 4RQBA 3S40A 1KORA 2YN0A 1HOTA 1V1RA 2NVOA 4FIDA 4Q18A 5K3AA 1DCKA 1FEZA 1G42A 5ICGA 1HZJA 1R4ZA 3T3HA 3AB7A 4QFMA 4KDRA 4RU1A 3RUAA 1XQYA 3EVGA 4RFVA 1Z7EA 1W36D 3F6EX 3T7SA 3EXIA 1JI0A 4FGUA 3UM9A 1RIFA 2NQTA 3GCXA 1EUQA 4KXYA 1COZA 5JNUA 3PQEA 4HNRA 4M0UA 3VU3A 4GP7A 4DXDA 3G2JA 1GKUB 1W5BA 1EFCA 1A8QA 2CK3A 3RTEA 2V6FA 4BXOA 4PQYA 2ZRGA 1JFLA 4CCAA 3RGGA 4GE0A 3OT1B 3LOQA 3L84A 1N5LA 3BCHA 1UIRA 3HDTA 4C76A 2ZAOA 1RYEA 2OV1A 1RIIA 2DR0A 2OQIA 4Q9IA 2IZ6A 3IUPA 1X80A 2OGZA 3A2MA 3P9ZA 2FUKA 4QGGA 4EBFA 4R8SA 3HKEB 3LJKA 4FX2A 3DXXA 4RK5A 3MTBA 2VQ6A 4D8VA 2A9OA 3PNBA 3PXGA 2X9VA 2CDNA 5IAAA 5DYTA 2WJ3A 3RQIA 1CT9A 3K31A 3BGOS 2ZQYA 3LW8A 4YQEA 3LT5A 1TLFA 4MEBA 4RYDA 4EYKA 1U0LA 3CEAA 3L6BA 4WBNF 4MUEA 3UGKA 4U3JA 1NG1A 1SIBE 1WPQA 4NU6A 5G4KB 2PWZA 1Z3CA 2A0XA 1I6LA 1GAXA 2ZYUX 1M2VA 2YWJA 5HE8A 5AUNB 4HNGA 2HNKA 2PMKA 2QTHA 1C2YA 2XVMA 1DRVA 2R2GA 3K9LA 4GEKA 3VHXB 1FNSA 2CBXA 5KB3A 1TEZA 3H5LA 1Y63A 3EAFA 4FYIA 4ASUD 2XZTA 3W1WA 1ZK3A 4A5SA 2OGSA 1EGAA 5BSMA 2QD3A 3CWZA 2FN4A 4RSRA 1NIJA 5FBWB 5FO1A 1QJCA 1M1XB 4ZC1A 1ZO8A 4H6PA 5HKBA 5CLIA 1N33B 4DT1B 1AS2A 4J8PA 4XQEA 3WFIA 1GG8A 2PKYX 3RSLA 5CA1B 3U19A 2MR6A 3WL7A 1FDUA 4IMPA 3LTEA 3LIIA 2ECKA 3UK0A 4B3JA 2BJWA 1L8AA 1IOWA 2OAQ1 3ORYA 2AJTA 3V48A 2HL6A 2IEZA 4R83A 4TVBA 2J6CA 1G6OA 1THGA 6NULA 4BBZA 4LBVA 1ZJYA 1KIAA 4NOJA 3R40A 5CTAA 3GB9A 2OK7A 4EI7A 3O0DA 1L3IA 3REOA 3F49S 4ITRC 2XMZA 4Q4HB 4DR4B 4F97A 4XJVA 4KODA 4KO1S 3GRCA 4QVGA 3TLBA 1P33A 1T4MA 1ZOLA 4PAQA 2R7AA 3BXPA 3HPQA 1H2AS 2A57A 2YZNA 4KQKA 2Z2IA 4KVZA 3HCNA 3PI6A 4P4UA 4NK4A 3LD9A 3QUTA 4S2EA 5IDQA 4RJTA 5CT6A 3OQJA 1JLLA 1Z0DA 4WBXC 1CRPA 2RONA 1V4VA 1ZQ1A 2JCYA 2X76A 2Z8XA 2ZWIA 3NBZC 4ZPXA 1YJ5A 1ZYUA 4Y0NA 1QF7A 3O8BA 1XA3A 1XLWA 2DUWA 4PGHA 4A2CA 2BEUB 2GMWA 2VHWA 1IY1A 3D2LA 5NLLA 4DMMA 1GEEA 5EHQA 5CA0A 4X95A 5EHNA 1ENZA 4OYHA 2FK8A 4JLSA 3HKCB 4YDHB 3EGDA 2PBFA 2BGWA 1GGEA 2ZZMA 1U0RA 2SKCA 2ZUSA 2FW9A 2WAMA 3NIBA 3ROFA 1SA0A 4AIRA 2X5OA 3P2IA 1T9DA 3KSZO 1AB6A 1KERA 1XJ0A 2F3QA 3KZ1E 4R2XA 5DU2A 1HNXB 3LNCA 1NW8A 2CNDA 5AHWA 1GDTA 4WOJA 1WD7A 3U4DA 1G5PA 2ZRFA 4BJ3A 2D4AA 1AKRA 2ZU0C 1JTEA 4F2DA 2HCTA 1PX0A 1QK5A 6CHYA 1OI2A 2J9YB 2HD4A 3IERA 5AOCA 2FR0A 5AUQA 2V59A 3IBYA 1VCIA 5E8JA 3WYGA 4YCBA 4HF7A 5IUNC 3AUJB 4QEZA 1ATIA 3TX2A 3GEGA 3NASA 2JFOA 4C5AA 3EC1A 3EWNA 4ARCA 4JN6B 1A9XA 2AV6A 5J2UA 1P2DA 4OJKA 3GGPA 5DT9A 3WMFA 1KPGA 4A91A 5ADWA 5ERXA 3A3PA 3TM4A 4CV3A 1GGKA 3I9OA 3BCRA 2V9CA 3AERB 3AEXA 1C3EA 5DJ5A 3MT0A 4IJ6A 1A97A 4AG6A 2VSXA 4A8TA 4U63A 1QTQA 2QTZA 1QE3A 4PANA 5EWMA 5GOZA 4MPDA 1JG6A 3IPAA 2IUFA 2ZYHA 4EQZA 2QTTA 3C41J 4DC0A 3N6XA 1Y81A 3TAHA 5K03A 2IHKA 3RUHA 3WLLA 4FDTA 2HYIC 3Q9SA 1E1DA 2YUTA 2XB9A 3H8SA 4UM5A 5H83A 3K6RA 2GSDA 3F4KA 3D7MA 1KMNA 2PVPA 2BI4A 3HO6A 2GN2A 3ZWWA 4JY7A 3H8WA 1JG4A 1OAKA 3PWKA 1GCGA 2AOVA 3LQYA 5AW4A 5KTNA 2JKVA 3LG2A 2A14A 2B8WA 1LDYA 4J16A 1WHTB 4INJA 4TN5A 2FPIB 4NRDA 2WUGA 4UAGA 5IUJC 2W2PA 2P9QA 4EW6A 2PM8A 2QGNA 3I32A 1NJSA 4TUYB 4RD3A 3STUA 4F5EA 3OF2A 2CD9A 3CINA 5SYMA 3SQDA 4FKBA 3WJAA 4DSUA 4RPJA 3ZD7A 1SKQA 1FYWA 1T3GA 3D59A 5H5JA 1Q77A 3O84A 2ZVJA 3LXXA 3IPRA 4WNIA 4AKHA 3E7DA 4QEKA 5G0WA 4HB3A 4EP1A 3NHYA 4EUNA 1F2TA 3KOUA 1MAAA 3VC7A 4DFDA 3OWOA 2ONKA 1WRBA 5ECWA 4GVLA 1UDRA 4GRDA 5EXDA 2HB6A 1UT6A 2E5WA 1YC2A 1L8OA 2R48A 3QPUA 5DBOA 4E94A 3HCWA 3CIOA 2LUOA 3AP2A 5KTPA 4KREA 2Y71A 1XELA 2I1WA 2FG5A 4HN9A 2IYVA 4GXRA 4OQEA 2MMCA 2OZPA 3PRHA 1G3RA 3L0CA 2I99A 2ZT7A 5DSTA 2C98A 4NHOA 1NW4A 5IM4A 2CC2A 3O4FA 5K99A 3CX6A 5CYGA 1WXQA 4MWEA 5HFAA 4RS4A 2R97A 2XQFA 2YWEA 5AICA 3MS2A 1XMQB 2PKXA 4GD3Q 4PQRA 4HUTA 5ED4A 4FS8A 1Z6PA 3ZD9A 2QU7A 5AQEA 1D7OA 1EX6A 4LE2A 1A5AB 3CMMA 4R1SA 2QSZA 1GFWA 4P4LA 4KGZA 5HK8A 3LBYA 2IS1A 3S2FA 4H6XA 3H0EA 5KWSA 1SUBA 4HDKB 1E9AA 5GM2A 4GOJA 4ARVA 1G60A 4E1BA 4UTNA 2WFZA 3NHKA 1N5OX 2HQOA 4JOBA 5JARA 1ZXLA 2PS3A 2NTJA 3O26A 4YPFA 5C52B 3QVGB 3DB1A 3WLFA 3NT5A 1JHYA 2IXGA 3VDQA 3VNUA 4LNHA 3KR0A 4NEHB 5E9AA 2QORA 4CE6A 3PEWA 2BBTA 2GUGA 3DMTA 3D64A 4ZYLA 2Q3JA 3KSUA 1DT5A 1PGJA 3CEHA 3P71T 3UQYS 2WVJA 2XGGA 1F2UB 2F1JA 3E1KA 4PLPA 3H3FA 1QAOA 3T3EA 1MZVA 1C4KA 1V35A 3WNCA 4F60A 4GBGA 2JF0A 3UB4A 2BAGA 4M87A 4UVIA 1FLVA 4RESA 3CB2A 1J21A 3DM9B 3RANA 3SY8A 2QN2A 4QM7A 1KRHA 3OJCA 3RFFA 3ANYB 3O1IC 2DQSA 4MRMA 4Q93A 5CCEA 1A9TA 1A7KA 3DDCA 3UJPA 5AOVA 1U9YA 2X0RA 3ZWDA 3P26A 4ZCPA 3RS3A 4Q3EA 4C08A 5TMDA 4Z86A 1K9SA 1XTUA 2EC5A 4FD2A 5C46F 4EJSA 3MS7A 2BFDA 2WPNA 4JU8A 1Y80A 2RGBA 3GAAA 1X2EA 3QBDA 3D8UA 4H1VA 4X65B 1RXCA 2CWWA 4LS3A 3Q7IA 1FJ2A 2VBFA 2WTBA 4BVGA 1C8LA 2I0FA 1DX6A 2M1XA 3DKVA 4L95C 2OCKA 5AR1A 4QUHA 5KYUA 4GSYA 4EMBA 2Q1SA 2JFFA 4G5FA 4OQLA 5JZMA 5C2JB 1BJRE 3PQ8A 4L27A 3D0OA 3WE7A 2NSHA 4ZCTA 4DBLE 4POOA 1YIAA 2DBYA 2FZCA 2ZU6A 3FGOA 5FOVA 1VE5A 3I04A 2ORVA 1LTQA 1K3UB 2AR0A 4ZRNA 4WJZA 3U5TA 1TJPB 4O2AA 1DQNA 1HE4A 4R1NA 1ZIPA 4CQMA 4HSGA 5J4KA 3LVBA 1IZ8A 1WCV1 1ZL2A 1G59A 2QZ4A 2PUJA 3BE4A 4HAVA 3RRMA 2CNWA 2FSSA 2QENA 3ZWXA 4ZZ1A 1V25A 1IC6A 3K4PA 1R4MB 5K3OA 2GPNA 4PSDA 5AFSA 3AXTA 3A9WA 4PZLA 5H7XA 1N5DA 3RFCA 3BRQA 2PZFA 1JE0A 1G291 3HE3A 2XMCA 3QVWA 2QRVB 4JHLA 5ALMA 3RF6A 4E3ZA 2GHTA 3FVWA 4DXHA 3TBKA 4M86A 5HIIA 1E59A 1EX7A 5AM2A 3C97A 3BG5A 1RLOA 2HH9A 4CF3A 1KEPA 1Q0UA 1SVIA 3I12A 2PFGA 4RV5A 3K6KA 4BVFA 2Z4TA 4R1LA 2VUSA 3G8AA 2I7DA 2ZSHA 4LX8A 4X93A 5B6JA 3EXAA 4IUYA 3E3AA 5F5LA 4O8ZA 2YKGA 5JZVA 1V11B 3DHVA 5DH9A 2IW1A 1T6NA 1UDXA 2Z6VA 2PLWA 1VBNA 1FUKA 1E77A 2QTFA 2P4EA 1IG3A 3OIGA 4G9EA 5K0EA 2QTRA 2X13A 3Q8WA 3ZZ0A 4TT3D 3DTVB 3NWOA 3KOWA 5DM60 2XE7A 2NO0A 3SEFA 3V8BA 5LQAA 1IATA 1M6HA 3MT9A 1K08A 3L7MA 3U7FB 3SDBA 1G9XA 2OHIA 2GTIA 5H16A 1I3NA 5JZOA 4F56A 2V7UA 4L0CA 1ZD3A 4Q1BA 5JC8A 1TE2A 4LZNA 5HIAA 1P9OA 1S8AA 1FP4A 4RFSA 1W35A 3GROA 3M6FA 4TS4A 3JWHA 1Q84A 1RWNA 1YULA 2O8NA 3TXXA 2WSSD 3DZBA 3O4GA 4D41A 1DQZA 3D3WA 2JFQA 1TRHA 5KQLA 3QXSA 3MHTA 1SUCA 1A98A 2IU4A 4A03A 3BKWA 3WYDA 4B7UA 2A0UA 2OCYC 1P4GA 2FPLA 3AEQB 2VP9A 1C50A 1LFDB 1O54A 1BROA 1OD6A 1JLMA 2XYRA 3D8BA 3IHLA 1KJ8A 4RM2A 3SJ7A 5CDUA 3FWHA 1ACMA 1US8A 2GPJA 4XVCA 4A3SA 4R5MA 1SBIA 3IMFA 3JXEA 2XQVA 4XGKA 2QTGA 1FU7A 5IXSA 1CR6A 4D42A 1BMQA 3FFBA 3ENVA 3IAUA 3KQWA 3X2SA 3BCUA 2VJNA 3GBPA 2WWVD 5A62A 3E4DA 4XR4A 3V1TC 4OGGA 2VWPA 1U7WA 4Y2TA 1Z3IX 5D3MB 5EGSA 2PWYA 5UKDA 4C0LA 3B1WA 4IIHA 1O9HA 1PK8A 2YRWA 1RZRD 2KPOA 3AQ4A 2J7PA 2E37A 2E6KA 1PD1A 2ZP1A 1ZCBA 3DVLA 3SP1A 3PYXA 1MOZA 2CBZA 1ID1A 4FNAA 4KLZA 5C7OO 4ZCMA 1DJQA 3RF7A 3V97A 3ELBA 1RTTA 1MKYA 1WCYA 3FBWA 3A28A 3E81A 1GLGA 4P58A 5FPYA 2PKWA 5CP8A 2O8EA 3OZAA 1EFPB 2GSWA 3G0CA 3KXDA 1R6AA 2E82A 2QYOA 3FYHA 4ZVUA 1SK8A 2ZSAA 3C3BA 5EA2A 5LD2C 1I5EA 3E2PA 4N7MA 5JSZB 5F2EA 5M3BA 3GZNA 4L78A 4EFMA 4G4SO 4NOLA 2QUBA 3ITNA 4OQZA 1N5MA 4I6GA 4K8OA 3TECE 4CM7A 4E12A 1CULC 1WE2A 3BIWA 3H42B 3NHLA 2JS7A 4CIYA 2ZM5A 4O25A 4P3PA 2Q6OA 1OYYA 4A36A 2XKAA 3R7LA 1P2TA 4IF4A 4KSBA 4AN0A 5F7JA 3DDWA 2I4RA 2WIAA 1B3BA 3QWFA 4HNVA 4UOEA 1XAIA 3NBYC 4K0RA 4KUHA 5CB4A 3NORA 1E1NA 3NGMA 5LC1A 1FRZA 1ADJA 1NBME 2IL1A 3K9GA 1JQEA 1YMUA 2FQXA 1P7CA 3CSSA 3GJYA 1QQAA 3L79A 2H4XA 2IDZA 5GINE 3I62A 5JYCA 4G09A 2YJ6A 4NZ9A 1P1IA 4PVCA 2Z9CA 5E1DA 3JAWB 2QLFA 1G4AE 4ZGBA 1G6KA 4W5JA 3JZMA 4ROSA 4ZAYA 4F93B 1V0JA 5HVNA 2XKKA 2GOYA 5KTMA 3ELUA 3VA7A 4AMGA 1DG1G 1Z6YA 3C24A 4FE3A 5FPTA 4YVFA 3H2SA 2OZKA 2FMKA 1PGOA 3RU9A 1SQSA 3A25A 2CFTA 2Q6VA 4NZNA 4UC0A 5CVCA 4AZTA 2FN7A 2YX1A 4MGEA 1T4GA 3ZWKA 4F8JA 2WWRA 4HNQA 3GLFE 1E20A 3N0WA 1DO2A 1GV0A 4QICA 5FB3A 2BR3A 1Z7WA 2EW1A 1A72A 1ORTA 4L5AA 2EP8A 4F5DA 1TF2A 2V8BA 3G9XA 1P74A 1E9VA 1HMYA 2OTCA 2Y0PA 3CEPB 4KIJA 2OSVA 2WNIA 4H0FA 3SXJA 3VPHA 2WZDA 5JNSA 1S02A 4PINA 2QN9A 1KP3A 1S89A 4XUDA 5JSQA 2C4NA 1K4YA 1O6BA 2AG0A 2DWUA 2J45A 3LWDA 2ZBFA 4TTPA 3GA7A 4C1NA 4DSTA 1DPFA 4M1EA 1NXVA 4M46A 4X66B 1GQYA 3R6TA 2PUAA 2IC5A 2QRHA 2CNKA 3JCZA 3PNYA 5FP0A 5KNBH 2F1OA 2QRNA 1NSFA 5BW5A 2G5GX 4RL6A 1LZLA 3RE1A 2FR1A 1G7RA 3SPXA 2ONYA 2UYOA 2OBLA 3K9HA 3SVZA 1QB7A 5A06A 3LLMA 1D2NA 3QPVA 3ZGNA 4BYGA 1NMEA 3DKRA 1NXSA 1XRPA 1MQSA 1XJWA 2UV8A 5BN5B 4HXEB 5HPYB 3B78A 2WU0A 2MHCA 1NQ5A 1HYHA 3AIKA 3L43A 1TZ2A 2HWXA 4MKGA 4DDWA 2O8FA 5TGDA 3FYDA 3C48A 4K6CA 4YQYA 3JVUA 1P8AA 3A2LA 4CT4B 5GZ1A 2XWBF 1RLUA 2JIRA 3P4YA 1BMFA 4GXNA 3I5XA 3ACDA 3MUFA 4EFKA 1Z2EA 5E38A 1O6CA 3IR5A 4GQIA 1CDEA 5ALXA 4NKRA 3HXTA 2K7FA 2VSOA 4I2NA 3T9BA 3RIGA 1NVBA 1JBEA 1HGXA 1TT5B 3R0XA 1ICIA 3ZY4A 4HDNB 2FLVA 2HHCA 1T5LA 4WFJA 2ERCA 3B20A 4HJXA 3QXCA 5I7UA 2QX4A 4BAUA 4OI2A 3LH5A 2W2TA 3PC8C 1QWOA 3STVA 2VPWA 3TOCA 2EFDB 3RO7A 2QTNA 3N3BC 4BLRA 2YTZA 1P0QA 3I09A 4HFNA 4QDKA 4YP1A 3KSMA 4FK8A 2AFIE 3FZNA 2FETA 1RT9A 3GVIA 4CMJA 3RK0A 4MV3A 4AS1A 4H7HA 3DXYA 1OAOC 4DGSA 3INRA 1E5LA 4LY9A 4P35A 2A5YB 3KKZA 4DIBA 1OFVA 3HB5X 2W00A 1COWA 3PGMA 1OBVA 3VI4B 5BN3B 2CSXA 1JN0A 1U7XA 3LZCA 3M1IA 2CLMB 1J5XA 3B1YA 1NRIA 5REQB 3PGXA 3WGYA 3AF3A 3FYUB 1T8WA 3GCWA 3GNLA 2IP4A 3RJ5A 3IUNA 1F48A 4KQ1A 4DLPA 5F1PA 3RAPR 4XUCA 2JLQA 2IYWA 4I8DA 1DBWA 1CRQA 1X7YA 1CS0B 2CXNA 1JRLA 3H3XA 5AIBA 2JLXA 4HDSB 4MW5A 5K1ZA 4FEGA 2XYGA 3AQIA 4CUZA 1V7QA 5JD5A 3LNTA 2AI3A 1ZH8A 2R2AA 3GJ4A 5BWBA 3JPYA 1TI7A 1JIUA 3UAWA