3RANA

Canine gdp-ran q69l mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
201
Chain Sequence
GEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Q69L mutant of GDP-Ran shows a major conformational change in the switch II loop that accounts for its failure to bind nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Transport protein
molecule keywords PROTEIN (GTP-BINDING NUCLEAR PROTEIN RAN)
total genus 59
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ranA00
5D3QA 4KITB 4A2PA 2W0MA 1AS2A 3ZIAD 2AD5A 4YXWD 1CXZA 3G0HA 3Q3JB 2ASEA 2DFNA 5HZHA 3H84A 1OH7A 2ZPTX 1NY6A 1UKYA 3Q8XB 5DISB 3WHLA 2R6CA 3H2YA 1T5IA 3LLUA 1FTSA 1G3MA 1IONA 3N5CA 1H8HA 2RGNC 4HI0E 1G3RA 4PR0A 4O3MA 3PUYA 1M34E 2J9RA 1L2TA 1R5OA 2ZI5A 4LJ5A 1TL7C 3GJXC 5J40A 5C4MA 1EFCA 2ZE5A 3P32A 4TZ6A 1KDPA 1QG4A 1UDWA 1W46A 1FP7A 4JSYA 4PPNA 4C0QC 3EPHA 2RCNA 4I1UA 2REBA 4IDQA 2YVUA 4AG6A 1Z0JA 1OHHD 4EFNA 4IDPA 4PZYA 2BBTA 1KSJA 5CLLA 2ORVA 4CT5A 5FPSA 1JR3E 2IUUA 4EFMA 4TTRA 2R65A 1ZM7A 2I4IA 3U3JA 2ZS7A 4B34A 3OZXA 2I1VB 3HP1A 5H68A 4AYWA 1KO7A 3AP1A 5IT5A 1GL9B 4I1OA 4EKDA 1PJRA 2QE7A 3LX8A 4TLCA 1GSIA 5B57C 4M2LA 2FSGA 2WJGA 1OYYA 3W9YA 2AK3A 1KDTA 2QP4A 4KLZA 4B3FX 1J8MF 1NF3A 1DAHA 3CB4A 4D4KA 4EUNA 3AVTA 3KZ1E 3AKDA 2EYQA 3LNCA 2QAGC 3LAWA 4ARZB 2X1VA 1T3HA 3NG1A 1I2DA 2C95A 2E9SA 4QRHA 1GP2A 4P32A 3UKDA 3SZRA 5DNYB 2RGXA 4P4TA 1MO3A 3AVUA 1OIWA 2J5XA 4URXR 1EX7A 5EUQB 4IXMA 3EPLA 4C0KA 1RC8A 1ZUNB 1E3MA 2V4ZA 1G7SA 2DR3A 3T1OA 3UK6A 4E5UA 5C18A 1FTNA 2ZJBA 1YZNA 5JCPA 3OEHA 4OKSA 1GL7A 1Q1QA 4A8JC 1N0WA 2WWHA 4GZLA 2ZJYA 2PJZA 1YZKA 3QKRA 4PAOA 4ZKEA 1YZGA 4M8NE 4K46A 2L0XA 1S0UA 3TAUA 1SQ5A 1DPFA 2D06A 3QBTA 3KQLA 3DPUA 2ZYUX 3I8SA 3K70B 1H8ED 1MO5A 1TQ4A 2ORWA 2GJSA 2WJHA 2R9VA 4IEIA 4CW7A 2XB2A 5LD2C 3ONWA 4KV9A 4WOPA 3NIBA 2G77B 3MSXA 1XEWX 1TU3A 1U8YA 4B47A 2QTHA 3VKHA 1I4LD 4IVRA 1AS0A 1H65A 2IF0A 2VQSA 3P26A 3SJBA 3WNCA 4HLCA 4LC0A 1N6KA 1PLJA 4R9UC 1Z07A 3CWQA 1W4BA 2A2ZA 3AVQA 3OIVA 1R0YA 4B2LA 5FL7A 2YOHA 4Q7LA 1KY2A 2O8DA 3FDIA 5JFGA 5JMTA 4AURA 2ORIA 3EC1A 3SFVA 1U8ZA 4Q1EA 3DHWC 1R2QA 4KYIB 1KGDA 1G8PA 4L9SA 4LRWA 4TYWA 1JXOA 1TQDA 3EXAA 4GFDA 3RRNA 2FWRA 4FI3C 4LGMA 3SNHA 1XPRA 1X8JA 4B76A 4FMBB 1KKMA 1Q1ZA 1ETUA 4CGZA 3EX7C 2O0HA 4LJ7A 2GJAA 3EASA 4PANA 4O25A 1YRAA 3SHFA 3TK1A 1VCIA 4NE2A 1DG3A 1T6NA 1LFDB 2REXB 1OIXA 3NC0C 3CWZA 4FN5A 1JR3D 3BIFA 4JLVA 3CF2A 4HZUB 5DYIA 1J90A 4BQSA 3B1VA 3CX6A 3K70C 1M74A 3CF0A 3W3ZB 2HLDA 4B3CA 1JB1A 1NP6A 1E0JA 3AV0B 2ZU0C 1VKJA 1SKYB 1FX0B 3F8TA 2C5LA 5EP2A 1YR8A 4HZIA 1B0UA 2ZSBA 4E09A 3D7MA 1MO4A 2RGCA 3ZVLA 3GEEA 3A1WA 3M6AA 3K9HA 1KJYA 4TLBA 1C1YA 4Q01A 3U44A 2RGAA 1RPZA 3UPUA 3KQUA 1F2TA 1G7TA 1G5RA 4URUR 5KYKA 4ZV4A 1DE0A 5BXQC 5AWFC 3GJ0A 5J4LA 5C1BA 4QGFA 3T1TA 3K1JA 1ZMXA 4JLMA 3VX4A 3BB1A 4DSTA 1GKIA 3DM5A 1UKEA 4G5RA 3TW4A 3I8XA 2BEKA 5F2EA 3FYHA 3GD7A 4B3XA 3CX7A 2VPPA 2ZEJA 3QJYA 5DO9A 4MDEA 1L7VC 5HE8A 2WMOB 3EA5A 1E94E 2ZR7A 4FW9A 2JLYA 4NYMQ 4OL0A 4M1MA 4GOXA 3R7WB 4XSGA 3QPWA 4Q03A 4FWIB 5TARA 2CHVA 1Y63A 2ZROA 3KXKA 5TV2A 4N0EA 4LBZA 4G5QA 3SHWA 5L3SA 3EG5A 4AY2A 2V6IA 2CNWA 2WJVA 4N0DA 4LJ6A 2F1HA 3CH4B 3HJNA 1EXMA 1G16A 2W0SA 3HR7A 1IXZA 3HU3A 4NCHA 2FN4A 4D80A 2OBMA 1QHYA 3QE0A 2J0VA 4LZZA 4A15A 3R8CA 3K8YA 2RGBA 1Q22A 4PSAA 3WP0A 4U02A 1N2CE 3THWA 5DH9A 1VECA 5FTMA 521PA 5L3QA 4PSKA 2OXCA 4LYFA 4M9ZA 1R7RA 4RD3A 4IXNA 5JEEA 3B13B 4A2QA 4B71A 3RSLA 1OXUA 4LHXA 3RC3A 3IEUA 4BFUA 4Y0VA 4PQYA 3SJCA 1MV5A 3VKWA 4C0LA 1VYUA 3GJ7A 1OJLA 3WMFA 2GBLA 2YZ2A 5K8UA 1E6CA 2JEOA 2SHKA 4BZXA 4AKEA 2IS6A 2J7PA 2PMDA 4PHGA 721PA 4GRAA 2PT5A 2ZE7A 2ZRDA 4HAZA 3KKMA 4EPWA 4PC1A 3UWOA 2R62A 1T0HB 4PAQA 4Q21A 4DCSA 1GIAA 4MGIR 4LJ9A 3QVUA 3CNOA 4BZPA 3GLGE 4IDHA 5E95A 4C0SA 5FTNA 1P61B 2JJ2A 4ABYA 1OKKD 1Q1BA 2MMGA 1SKQA 3X1WA 4EDHA 3PUWA 4TMTA 2YYZA 2C78A 4G5GA 2OO7A 3R9XA 3CR7A 2FNAA 1XTSA 2WZQA 4M9XA 4ILEA 1XZPA 2Z5FA 2CLSA 4ITRC 2H16A 1D9XA 2AN9A 1XMSA 3DMDA 2C77A 3GEHA 2RHMA 5JWHA 3D8BA 5CIQA 1BOFA 2NIPA 4HUTA 4ZKDA 4OQXA 4LHVA 4DCNA 3MMPA 1NBME 2P6NA 1OH5A 3ND8A 2F6RA 1N6IA 2P0EA 3VHXA 2O8BB 2OCBA 3IHWA 2AD1A 2WOJA 4I1SA 1KO5A 2C8VA 4ZCLA 1DAGA 4ACAA 4A0GA 2Q3MA 2FEMA 1US8A 4XWKA 1JAHA 2WKQA 6Q21A 4MKHA 1QDEA 3FMFA 2WKRA 5UKDA 4Z51A 4KBFA 3A58B 2B6HA 5FTKA 1D2NA 1OXTA 2KB0A 1NBMD 3OE7D 2IXGA 3BH7A 2BDTA 4PSVA 4ZI3A 2XNSA 4YXWA 3LO5A 3RS2A 1JALA 2XJ9A 4Q47A 3ZIAA 5A5GA 2HUPA 4GP7A 4EQ6A 4QOSA 1E9DA 2OHFA 3L82B 4JMPA 4RFSA 1OH8A 4MYCA 2FGJA 1DVRA 3A4NA 1OT3A 2XGJA 5EQTA 2ZUBA 3FFAA 2QL6A 3RHFA 5DE3A 3EC2A 2UZIR 2BV3A 1Z6XA 1KO1A 2BMEA 4IOLA 4NCKA 3DL0A 1XEXB 3OF5A 4UNQA 4G01B 1KHTA 4DLTA 4US0R 1EFTA 4J0QA 5BN4A 1YZLA 1IY1A 2NPIA 4JLPA 2GZDA 5C2JB 2ZRKA 1W47A 3BS4A 1EFHA 4ZI2A 1X1SA 4UXJA 1SHZA 4DSOA 4LBVA 3BBPA 2XXAB 3H1TA 1NVWQ 4BRUA 4OYHA 3X1XA 4LBYA 3CNLA 3MGCA 1EGAA 3I61A 3NKVA 5B2ZA 4W9MC 4G3XA 4E22A 3N2IA 2FE4A 4CEJB 4C7OB 3LW7A 1ZNZA 3T5GA 1GFIA 1E9CA 2KSQA 3KKPA 1D6JA 2YWGA 3QBVA 4OHXA 3B8HA 4XD7D 4EJSB 4CEIB 1IOZA 4RJLA 3TQFA 4DC9A 5KNDA 3U4QA 4D82A 1XBTA 2XITA 3X1YA 2ZVPX 3K53A 3SU8A 4LV6A 1E9SA 1BKDR 2ANCA 2RB4A 4NL4H 2RMKA 1FOEB 2OZEA 1XDBA 2DFTA 2ZXUA 4RKFA 3HPQA 1CS4C 2QPAA 5KU1A 3HDTA 4M9SA 4Q7KA 1OW3B 2QI9C 1KZGB 4MYUA 3U3OA 5AUNB 1NLYA 2J7KA 1DARA 2W2TA 3SBDA 2QTVB 1I4TD 1XTKA 4MKFA 1N25A 1KSFX 1T9HA 2J7PD 5EE5B 2ODBA 1IXSB 3RRMA 4JL5A 2OFOA 2PX3A 1CJTC 3ZVRA 4BFSA 5KSPA 4URZR 1IN8A 1KOFA 3KTAA 1M7BA 4WXPA 1R10A 2ODEA 1MOZA 3WYFA 5FBLB 1GNPA 1MABA 5KUTA 1CR0A 2B21A 2RAPA 3W5JA 2ZAMA 1YU9A 2A5JA 3KJHA 5KPJA 4TZ0A 3PITA 1GRRA 1G4AE 3MWKA 4NYIR 3ZYCA 3DDCA 4M4SA 3GLIE 1QBKC 2A30A 2PZGA 5IRCD 1QF9A 1LTQA 2YWEA 3B6EA 4YC7A 1E2MA 5LB2A 2JLRA 2W6ID 4AYXA 3OFND 5FBRB 3PIRA 5FH9A 2OBNA 2VRWA 1ZM4A 1SVMA 1E9RA 1II8B 2BOVA 3HU2A 5JS7A 4FINA 2QBYB 3LRPA 1Z63A 1H8EA 5JBQA 2WWXA 3OIYA 3Q5EA 2FH5B 3MLEA 4DEYA 1TU4A 2KWIA 3NXSA 1OV4A 1U98A 1GKYA 1G5TA 4D2IA 3SOPA 1E2DA 4K8OA 3TUZC 3KQNA 4TL7A 3U3KA 4A6XA 2WWFA 4B6FA 1RVDA 1NSTA 3GLHA 4ERNA 1DTSA 4Q5IA 1TF7A 1LV7A 2X77A 1F2UA 1YKSA 1K6MA 3HR8A 1XTQA 3VHLB 1G5PA 3JVVA 2IHBA 2GVZC 4FMCB 3R20A 4I1VA 4NH0A 4DCTA 2DCUA 5AJYA 4POAA 4QXAA 1TPZA 1M7HA 1A2BA 2JLXA 4PAMA 5FOWA 3WNDA 1N5IA 2NG1A 4QM6A 3IBGA 1WDTA 1NLFA 4UXIA 5FL3A 2QENA 2J59A 1Q12A 3KB2A 4OK5A 4RZ2A 4GMDA 5L3QB 3LV8A 4OI2A 3GMTA 5HKKD 1ZC4A 3A36A 2LWIA 2KI5A 3KL4A 5EXPA 4DDVA 1KO4A 1P2UA 2Q6TA 3LDAA 5FBQB 1P9RA 4P4SB 2F3TA 1R5NA 2Q9CA 2XZPA 2ZAOA 4JBYA 4W5WA 2O8CB 3KUCA 3L0SA 3FHTA 4IFEA 3W8NA 4OQFA 4L15A 5KDOA 1OB2A 2DY1A 4NYJR 1CJKC 1S3GA 3BERA 2XB4A 1HURA 2CMKA 2D74A 3TLXA 5IK2D 1XEWY 5JZVA 1RE0A 1OHHA 1OFTA 4EFLA 3AEZA 3BB4A 2ZRLA 2ZRMA 4BFVA 2PX0A 4IOMA 5BYKA 2LKDA 3NDPA 3AF0A 4FCVA 5JHHB 3ECCA 1OH6A 3HU1A 4TT3A 5CJPA 2CCGA 1AK2A 4CEHA 3CLVA 3VR1A 2WWIA 5GJWC 4P3YA 4C3ZA 2FU5C 4KLNA 4DVGA 4CDGA 5KNBA 2IXFA 2XNDA 4ARZA 2XZLA 1VIYA 3B2EA 3Q5DA 4RD6A 4B3DA 4ESHA 4R71A 4URYR 2IW3A 4AI6A 1ZCBA 4NBSA 3E1SA 2CCJA 4NYIQ 5FOSA 4D0NA 2F55A 1AKYA 4Q19A 4Q4JA 4G1UC 3CBQA 1GILA 5AJWA 5CB8A 8OHMA 1MH1A 2HF9A 3OAAD 4LY6A 3KXLA 2H7VA 1ZM3A 2JATA 1TUEA 2O8BA 4KODA 2DHRA 4IDOA 4LDJA 3B9PA 4W7SA 4BUJA 3B82A 2JLZA 1G18A 1YZTA 1N5JA 1O3YA 3JZMA 3TR5A 1MR3F 3VMFA 3T35A 1KYIA 1KI6A 3FMIA 4B44A 1PV4A 2ODNA 4B48A 1EWRA 1NLZA 1Z0DA 4MUBA 4TQAA 1O87A 1ZNWA 3NBYC 1HH4A 5G41A 2ZSFA 4XD7A 3LBIA 1T4GA 2NQ2C 1LF5A 3D31A 5JSZA 1ZUHA 2C9YA 1W0JD 3EZ9A 1E0SA 1TADA 1G4UR 1AQYA 3QI2A 1Z29A 2ZE8A 4Z8XA 3TAHA 1IY0A 1W5TA 3NTUA 1TTTA 5KDLA 2F7SA 3FWYA 4L16A 3C5CA 3LXXA 4TWZA 5HPYB 3QXXA 1QVRA 4JLDA 1RRFA 3QXCA 2IUSA 2H1LA 1TF2A 2ATXA 2KBFA 2VSOA 3EAQA 1Z22A 3QY0A 4C0AC 5KPDA 1P2TA 4FCTA 3X2SA 4O2RA 5GJCA 4YMWA 2RGEA 3SJZA 1QRAA 1GNRA 3FKSD 4PHTA 3RC8A 2IS1A 4R2IA 2XXAA 2QMOA 2C04A 2F1IA 4YONB 3THYA 3GP8A 1HY3A 2FF7A 2RGNA 3U7GA 5C46F 3WBKA 5GVRA 1NSFA 3NVAA 3CRVA 3GFOA 4LOAA 1E9AA 3I72A 2JCSA 4O0MA 1TNDA 3SYNA 1JJVA 4IVPA 2EFGA 4QBGB 4D4LA 4QG7A 2N42A 3KFVA 5J4YA 1VDZA 4QBFA 2FOLA 2I3BA 2HLDD 2ZREA 2OLKA 4PZLA 1NVUQ 1KMHA 1UKVY 1WCV1 1Z47A 2QMUA 2IBMA 4URVR 2ONJA 2KBEA 2NO0A 5F9FA 2OXRA 1LNZA 2HXYA 3C16C 3RANA 1NN3A 2QP3A 2GEDA 3QXHA 2VHCA 2XJ4A 2ODWA 2AK2A 1Q1EA 1SVWA 4B2PA 3T06B 3EW9A 1WBBA 4V0OA 5DYGA 4KHZA 3P20A 4UXHA 4BZQA 5DN6D 4BPBA 3SR0A 4DJTA 2F9MA 2QY9A 1XWIA 4Q66C 1E2PA 4Q7MB 1KSGA 2J0UB 2YHSA 3CO5A 2ZJZA 3GFTA 3RS0A 2IEYA 2WPDA 4PO9A 4ZDWA 1W4AA 2V55B 2YWFA 3I5YA 4AD8A 4M1SA 2VO1A 5CK5A 3DOFA 1N0UA 4GSYA 1E2NA 5BN3A 4JL8A 1AJEA 1XCGB 1UF9A 1N6LA 4B73A 2QG6A 3R7WA 1E96A 4QC2A 3W34A 3RNLA 4X8OA 2GXAA 1GDDA 3KTAB 4M21A 1TMKA 3UMSA 3RVBA 2WJIA 1E4YA 1FMJA 3GCGA 2H17A 4G5OA 2ZS8A 4KFSA 4MYHA 5KTYA 3T34A 2E1RA 3CKLA 1A82A 3EPKA 1VYTA 3U6BA 3CH5A 2ZI3A 1FP6A 3DO6A 3AUXA 5CIWA 4QHYA 2UZ3A 3P4XA 1XZQA 1DAFA 4LCBA 4U00A 3NWJA 1JR3A 4GOKA 3G82C 1JNYA 1QG2A 2LCFA 2BWJA 1XF9A 4QNRA 3FHOA 4ZCMA 2CL7X 2GBLC 2B7CA 4LJYA 5EZ5A 2VIIA 1CIPA 3IKJA 3PQCA 5EXXA 3U4QB 3CONA 1C4OA 1D8TA 1F3OA 1E2GA 3IQXA 4HDQB 2BBOA 3EARA 3IDQA 2ZJ2A 3U3MA 2IF2A 1YVDA 3IEVA 4KAXA 4A92A 4KU4A 3SJAA 4OHYA 3TUJC 3EPJA 1R6BX 2EWVA 1GTVA 3RSOA 4PQRA 1SULA 4NCJA 1LY1A 4EPRA 1ZIOA 4OQNA 4RD0A 5JECA 4GPTA 2ECKA 1FFHA 421PA 2NMVA 1N6OA 1ZUIA 2ZRAA 2B8WA 2GRJA 3U7EB 3QF4A 2FPLA 2FPMA 3CPHA 3FE2A 4Q4AA 4DCVA 2EYUA 2W00A 1EFRD 3QXSA 3JVUA 3IIKA 4ZIRA 4HDCA 1M1YE 5CITA 1EG7A 1ODFA 1ZU5A 3QEOA 2YC4C 4NCIA 3UWKA 3VKGA 3GQBA 2O0KA 4XVQA 1N5KA 2ZJAA 3KJIA 2WJJA 3IIMA 3BFVA 3L8YA 1J8YF 1G3IA 1LF0A 5EE3A 2O8FA 2C03A 4RD2A 2EU8A 3P27A 1T8TA 3LLMA 3QF7A 2JJ2D 5TB5A 3PUXA 4M1WA 1SKYE 4B3BA 5AJVB 1T5LA 4TMWA 1P5ZB 1CKEA 5FI1B 4GDFA 4D4MA 2CXXA 5EZ6B 1CTQA 2J3EA 2X2EA 3VTKA 5G3YA 5J4VA 3RYTC 2DFKB 1P73A 1Z8FA 2PL3A 1RIFA 2AFIE 2IX3A 2FEOA 2GEUA 2XTNA 5DLQC 2GNOA 3AF2A 5LPNA 4A8JA 3GJ6A 2J0SA 3FMPB 3PEWA 2VP5A 1OXVA 2OCYC 1S8FA 4PC7A 4LJ8A 2C96A 3MG9A 3AKEA 1YR7A 3BAFA 2VYFA 3LY5A 4UNNA 3ADBA 3AM1A 2MSCB 2B92A 1R4AA 4PFSA 1UBEA 2PBRA 2QORA 2QRZA 5HZKA 5D3MA 4V0MA 1IN4A 2QPTA 2FX3A 3UMRA 2BKUA 2JJ1D 4RFSB 3V00A 1LS1A 5F9HA 1SVIA 3F0TA 1HQYE 5LB4A 4DIDA 4B32A 2QM7A 1Q21A 3CPJB 2H5EA 2W6IA 1KNQA 3B5JA 2R6FA 3QKUA 2PH1A 2X19A 2ZRGA 4JJZA 2YV5A 1I2MA 1W5SA 2GJ8A 1XEXA 2CLCX 3BB3A 5F3WB 1KI6B 5EP1A 1V43A 2P2LA 3SE0A 1W36D 2KE5A 3MFYA 1GRNA 2FA9A 1Z5ZA 4NYJQ 3WHKA 3KKNA 2WICA 2CE7A 2PEZA 1Q44A 3A4MA 3NEJA 1JPJA 3C4JA 5FPYA 4FXPA 5FR1A 4XWOA 5FFMA 3NEYA 3UANA 3VR6A 1WA5A 2C99A 3LA6A 1TEXA 1KDRA 5L8VA 1XCMA 1U0JA 1ZU4A 3K9GA 4QGHA 1NVVQ 1D5CA 1N6PA 1NN1A 1ZP6A 3EIHA 3MAAC 2HT6A 4DLXA 1ZNYA 5KNCA 5IDVA 2PZFA 2D7DA 1TQ2A 4AKIA 4JYCA 1Z2CA 221PA 1ZYUA 3T12A 4Q02A 1OIVA 3ZQJA 3IPYA 3WXMA 5AJZA 4FD2A 3KX2A 1RYFA 1T0JB 2G0TA 5LD2B 4NPHA 3ZQ6A 2OE2A 3KJEA 1DO0A 1XD9A 2GWHA 2YOFA 3ASZA 2VP0A 4TLDA 1BMFA 2H57A 5CM8B 1DG1G 4EPVA 3CUEF 2GF9A 4G5SA 1TAGA 4F4CA 4US2R 3GLFB 2P6UA 3OESA 1ZINA 3QG1A 1XD2A 1HE8B 1BYUA 3KUDA 4OHWA 4QJ5A 2BMJA 3FFBA 1N3BA 4LJ4A 4DLZA 2FSIA 4HAXA 3L8ZA 2HT1A 1E79D 5CJ2A 3DMNA 4UNRA 2BCGY 3RRZA 3AB3A 1R5BA 4HLQB 2QN6A 5AUPB 2ZUCA 1U8AA 3IPXA 4RZXA 1RRGA 2PMKA 1P72A 5H1YA 2DWPA 5AR1A 4TL9A 3IILA 1KJWA 1IN6A 5B58C 2A5DA 2OILA 4FWTA 1KK2A 2C98A 4XWAA 3VFDA 4DB2A 5AK0A 2ZSEA 3K09C 2WWYA 4JLBA 3ZVMA 2QP9X 2H18A 1TUIA 4FMCF 4JT2A 5E3HA 5FUWA 4BLSA 3J81k 2QMHA 3ICQB 1F5NA 1KK1A 1DO2A 4H1VA 3WMEA 3X1DA 2GF0A 3EZ6A 5LDDC 1P7CA 2WV9A 4DEXA 3W5IA 1GZSA 1ZCAA 3NHBA 2Q9BA 3PUVA 4KFRA 4A0FA 3FKQA 4Q7JB 1M8PA 4XSHA 3W8RA 4B75A 1FQKA 4XTRA 4B35A 2WIBA 3GFPA 1KI1A 1II9A 2ZSAA 3Q7PA 2EFDB 3SC3A 3ZD7A 1WQ1R 4RFVA 3IBYA 4OJQA 2WWGA 3FMOB 1Z3IX 4M0LA 1P62B 3QUSA 1E32A 3RS7A 4EPYA 2BBSA 1BS1A 4JKIA 1EFUA 3NBXX 1E69A 1BO6A 2V54A 3GJ4A 1XMJA 1T3SA 2CLDX 4US1R 2X2FA 2A5FA 5SZHB 3TJZA 5FR2A 2VBCA 2WMNB 2J1LA 1KJZA 4WZ6A 1GAJA 1R0WA 1OKKA 3GLHB 3VX3A 1KI7A 3WNBA 3K9NA 2FFHA 2O8DB 3TMKA 1VCOA 3QEJA 3KKQA 3THXB 4P31A 1BIFA 4OI1A 4PO8A 5FPKA 4W5JA 5G40A 3AF1A 4TTPA 3B1XA 1XB2A 4JLJA 3TVTA 2PEYA 2QM8A 3RWMB 1YHNA 3AKCA 4BLPA 4EJSC 1AQUA 3P4YA 4UKDA 3QG5A 2IK8A 4JYBA 4JBWA 4Q9LA 4OJKA 2IYZA 2G3YA 5L3RA 2QUZA 2OFXA 1SXJB 3CR8A 1KI2A 1T3LA 5C4GB 4DUGD 1CJVC 1CJUC 3DVLA 2R6DA 3K0CA 3L0OA 1VG0B 3PXGA 4DSUA 2W6JA 4X8LA 2BMFA 2AX4A 1U0LA 3ADKA 1COWA 3B1YA 4HZUA 4D6PA 3BRWD 5KDDA 2O8CA 3E2IA 4ON9A 4KSBA 1L4YA 2O52A 3KB1A 3CIOA 4RD1A 1NMYA 4MUAA 3CNNA 4C2UA 3AVVA 4Q9IA 2HF8A 2Q9AA 1E1QD 2OCAA 1CU1A 4YMTA 1XJCA 1COWD 1RJ9A 3F3YA 5DI3A 2ZUDA 2TMKA 2DWQA 4AYTA 4C9BA 1QVAA 3KKOA 4HSEA 5JRZA 2D3WA 3Q85A 1UAAA 4EAQA 3GJ5A 4BEBA 2NPFA 2IYUA 2HEIA 5FUVA 1AKEA 3A1SA 2DPXA 1ESNA 4IRUB 4M1TA 1UPTA 1L4UA 1YJ5A 1VG9B 4BLQA 3R8FA 1ZM9A 4R98A 1Z6YA 3SBEA 3VR5A 1Z0AA 3R9IA 3AF4A 5TVKA 2A78A 1G3UA 2GXUA 4M1YA 1IJEA 1X6VA 3RS5A 2PT7A 3VR4A 1IXRC 2AL7A 1QHIA 2B7BA 1DS6A 1B23P 2QTFA 2RHDA 2G6BA 1SXJC 1SVOA 4NMMA 4BFYA 3W6OA 4D81A 4GOJA 2VP9A 5E4FA 4A8JB 2E87A 1G20E 1JEDA 1E79A 4IKEA 3TE6A 4V0LA 1A1VA 4ZDKA 1WRBA 4UNSA 4KBGA 1N6RA 3BFKA 3U60B 2OEPA 4HAUA 3C5HA 4LC1A 3KQHA 2J41A 4KJZA 3NC1C 5JWRA 2F3RA 3K70D 2FZ4A 4JSTA 3B85A 3KDSE 4WXRA 3TNFA 1YE8A 2GK7A 2F43A 1GM5A 4LBWA 3RS4A 2RKOA 1JXMA 2V9PA 1CBUA 3K0AB 3T15A 3W6PA 4NCNA 4DDTA 4A2WA 5JRJA 2W2VA 2ZE6A 3I73A 3EWSA 1KSHA 2JJ8A 1ZD8A 4TMXA 1G21E 4H9GA 4X8HA 4Q1CA 4TMVA 2IYLD 5JI3E 3EIQA 2NOAA 1DAKA 2A9KA 2EWWA 1JR6A 1RW4A 4MQBA 1M7GA 1NN0A 2WBLC 1XJ0A 2J87A 2ZRCA 4NU0A 4CF7A 5GVSA 2OCPA 1OXSC 3A1VA 1W2HA 2WVJA 2ZRIA 1FW6A 3BGWA 2XNDD 2Z4RA 4L9WA 4AC9A 4Q00A 2QSYA 1IN7A 1LS6A 1Z6TA 2OSBA 4CYMA 4L4UA 2YWHA 1YR6A 1NIJA 5EXSA 1U94A 1HA3A 3ZS8A 5CDFA 3ZJYA 2XSZA 4MDFA 4Q9JA 4GP6A 3PFIA 2Z83A 3SDZA 3WRYC 4PPGA 2ZRJA 2GEVA 5DI9A 1P60A 2PZEA 3AGPA 4HATA 5IF9A 4LHWA 4LPKA 3AP2A 4PXAA 2EFCB 3TW8B 1GNQA 2D7CA 1FMLA 3AF3A 4AKHA 5HCNA 1X3SA 1VG8A 1OSNA 1XPOA 4PZZA 1GG2A 2ZYVX 1AM4D 2GCOA 4Q1DA 1ZVQA 1GKUB 2FSHA 4TYQA 1W0KA 2GXQA 3LQRA 621PA 3VNVA 1OE0A 4JLAA 5K8LA 1ELOA 4HYYA 1E1QA 4F91B 3SQWA 2WOOA 3QQ5A 4DHEA 1DEKA 2GA8A 4ASUD 1GOTA 2AWNA 2Y8EA 4UJ5A 2GKSA 1M6NA 2ERXA 4D0GA 2AKAB 3KQKA 2MSEB 3B1ZA 2F1RA 4RCYA 3UG7A 4FMDB 3AKYA 3WRXC 5SZIA 4N1AA 4LI0A 1KK3A 1LVGA 1VCMA 2IS2A 5DSZA 1RZ3A 1VYVA 4QHTA 4ZDIA 4C0JA 2VTKA 3OFNA 3I92A 2JIZA 3AGQA 5DHFA 2FMXA 2XTMA 3Q7QA 2NZ8A 3AVXA 1A5TA 4PPQA 3CZQA 3TUIC 3NH6A 2OFWA 3BWDD 4D0LB 3O8RA 1TEVA 1XXHA 5BYJA 3RABA 4BECA 1N5LA 3UG6A 1UEJA 1HUQA 5KSOA 2QU8A 5TMPA 1CR4A 2ZRNA 5LBIA 1XPUA 1P2VA 3I5XA 1W2GA 1C9KA 1VPLA 1Z0KA 3ADDA 4ZDJA 1ESMA 4A1FA 1DADA 1SZPA 1CR1A 2NO1A 1UDXA 2K5UA 1GUAA 1QHNA 4FCWA 4MGKR 4AK9A 1A4RA 2R44A 3DKPA 1PLLA 3B1WA 1S2MA 1Y3AA 4B2IA 3SN6A 1HV8A 2EFEB 3M0EA 1IAQA 1R0ZA 2QAJA 5CYOA 3EA0A 4W5HA 3REFA 4BFZA 4QGGA 5JWOA 3U6KA 1X8LA 1Z83A 1U81A 4RVCA 1JI0A 1TF5A 3K0EA 5AUQA 4MRNA 3CZPA 5EP4A 3GLFE 2QZ4A 1G17A 2H92A 5FOVA 3QPUA 1Z28A 3LW8A 4CEIA 2CHGA 4HLUA 1FX0A 3A1UA 3DEFA 2FDCA 4F38A 2CVHA 2FZLA 4D26A 3L2OB 3A8TA 5FBWB 1JJ7A 1WBDA 2ZRHA 2X8AA 3R9WA 1CEEA 5EUMA 1ZD1A 4G0NA 3EZFA 1F2TB 4HAWA 1KNXA 5P21A 2VLIA 4HDOB 3E5HA 2AXPA 4R2HA 2Z6VA 1KO8A 4V03A 3I1FA 4HAVA 1II0A 2IWRA 2EW1A 1KTVA 2VHTA 3QNUA 1ZW6A 1RKBA 2N46A 1GL6A 2ZJOA 3G5UA 1AN0A 1YRBA 2GK6A 1H8HD 3T61A 4LYAA 3TKLA 5B64A 4V0KA 1EESA 2ZU6A 5JS8A 3ZS9A 4Q4HB 3WP1B 1P9WA 4WA7A 2AR7A 3TIFA 2REOA 1RJ9B 5DI3B 1ONBA 1XMVA 3IHLA 2BEJA 4YDHB 2NZJA 4Q1FA 2ZQ5A 4KI0A 1FUKA 3CRW1 1CLUA 4IJMA 3VAAA 4BE7B 1UKZA 3I3SR 4R7ZA 4ACBA 4TL6A 4CIDA 3PR1A 1MABB 5SZJA 4OBEA 2ZI4A 3CF6R 1E2FA 1XTJA 1U0HC 3LQQA 4MRRA 4MYTA 4C0BA 2PCJA 4KVAA 5L3SB 2G9NA 3UIEA 1K8RA 2CHQA 3SS8A 5J4KA 4DLVA 1KI9A 2QQEA 2A3RA 2OBLA 2O0JA 2BM0A 1D2EA 2ZSDA 3EIEA 2AXNA 2HXSA 4TYPA 4YMSA 2IYYA 2Z4SA 4WVFA 3WBJA 2HYIC 4DB4A 5H8WA 2BIFA 3H0KA 5EE9A 1E4VA 5G53C 4Z8YA 1KIMA 3GJ3A 2GAAA 3VR2A 1HTWA 4GNKA 1II8A 1PUIA 1OYWA 3BOSA 4LYJA 1G8FA 1ANKA 3CW2A 1OFHA 2IL1A 1JPNA 3PUZA 5CB6A 4AKGA 1X8KA 2GILA 2YJTD 4JT4A 1XX6A 2OAP1 3K9LA 4Q1AA 2PCLA 4YMVA 5CK4A 4PTLA 4JKYA 4HB0A 4GMXA 2DBYA 2A5GA 3AVWA 5JEDA 2F9LA 1KKLA 1F2UB 1NVXQ 3OEHD 1XFAA 4X8MA 1Z06A 2UVQA 1OPXA 1A2KC 4JIMA 3S1AA 1G1MA 1IY2A 2G83A 4WZAE 1HT2E 2XX3A 1NMZA 4OQLA 2ONKA 4QJ4A 2ZJ5A 3K0AA 1EWQA 2QGNA 1VTKA 1FQJA 2IYXA 1OFIA 3RWOA 3B60A 1QHHA 3RS3A 1QHXA 3A37A 4O2LA 3IUYA 4IOKA 3A1TA 3L43A 3NDBB 2D2EA 1U9IC 1UM8A 3WYAA 2XOKD 3I4LA 4TSFA 1CRQA 5A4JA 1NNEA 2P3SA 2FGKA 3H4MA 4HUQA 5JI2E 2CBZA 5JJLA 2IA5A 2WSSD 4P4SA 4Z1MA 1V5WA 1ZC3A 3PEYA 2VA8A 2GAOA 2P65A 4DCUA 4S2EA 2QSZA 1S1CA 2QAGB 5KO2A 1XD2B 3ETLA 1EFRA 4LV5B 1E98A 4CVNA 4C0HA 2IXEA 2HDNB 1YR9A 2W6JD 4II7A 4QNMA 2FPKA 1Q57A 3KFXA 4MA4A 3C7KA 4BWYA 3ADCA 2JIZD 1QZXA 1US8B 2IYRA 2FV8A 3EZ2A 1NN5A 3ZVNA 3PVSA 2H8KA 3OEED 3TSWA 1S9DA 4CEHB 2UKDA 1XRJA 2IEZA 4M1KA 2O8EB 4IW3B 5FI0B 4OHZA 1VCNA 2EFHB 3BK7A 4RD4A 2NO9A 2ZTSA 4QKQA 2V1UA 3ICEA 4UNPA 5FUXA 2P5SA 4IFBA 4DZZA 4KSCA 1E9FA 4DT1A 4BEJA 5FPHA 3O47A 3T1QA 4M9QA 1XTIA 3DZ8A 3D3QA 1PZNA 4ESVA 2HYDA 5CDFE 3GLGB 3N70A 2BVNA 4CZ2A 4HLDA 1P6XA 5HCIA 3NHAA 3AVYA 1IN5A 4MGZR 2ZYWX 3EZ7A 2ATVA 3BH6A 3MWYW 4GI7A 2CVFA 4LWZA 4JLKA 1NL3A 3DOEA 4QL3A 4WAUA 3CRQA 5JLJA 2V3CC 3CX8A 2FFBA 4JBXA 2QEQA 4K81B 3Q9LA 1KZ7B 4Q1BA 4I81A 3V9PA 2C9CA 2NO6A 4A0RA 4LHYA 2JLVA 1TX4B 1WB9A 3K0FA 1M2OB 2JASA 1Q20A 3MJRA 2WKPA 1G8GA 2VHUA 1E1RD 1BH2A 3FTQA 2XSZD 3QKSB 1IQPA 3N2EA 3ZGXA 1ZNXA 4C7OA 3FGNA 1TQ6A 1U9IA 3DKVA 3B9QA 4BLRA 1KI8A 3LBNA 1E2KA 2W2XA 2CL0X 2XTZA 2ZANA 4M53A 1XCPA 4XIGS 3THXA 1XNJA 1SHKA 2JDID 3C14C 3AVOA 2ZVQX 1ZJ6A 5EJEA 4RKEA 1W0KD 2WWWA 1PLKA 2V1XA 2G0NA 2BM1A 4LK2A 4C4PA 2CJWA 2C2HA 3JZAA 3AP3A 2CK3A 3LVQE 3HYTA 1JBKA 4QBHA 2GZAA 3FOZA 2W83A 1FZQA 1UFQA 2R6AA 3CPEA 3VU9A 4I99A 2GCOB 1E9EA 4LJAA 5JHGB 1S9HA 1MT0A 3GLIA 4A0HA 1KAOA 2IYWA 2WSMA 2MMCA 1OB5A 3BE4A 3L0PA 1XXHE 4JZKA 4PHFA 5J5CA 4BRWA 1ZM2A 1PVOA 4S35A 4DUGA 2BHRA 4A4DA 2BMDA 1IJFA 2OM2A 4YMUA 2ZM5A 1NG1A 4LPSA 4LSGA 4MRVA 3I32A 4EIWA 1ZAKA 2G1JA 2NO7A 4HEJA 1KMHB 1KMQA 4UQOA 3BC1A 1LW7A 4GT1A 1J7KA 4MKIA 4RZ3A 3B78A 3V4RA 2IUTA 4P33A 3O8BA 3WYGA 2FG5A 4XH9B 1DOAA 1EK0A 2QROA 2MSDB 2VHJA 4TLEA 1E1RA 4D4JA 3GJ8A 4TT3D 2WJYA 2AHOA 4HB4A 2J0UA 1S96A 1LB1B 3MCAA 2IYQA 2GTPA 1IHUA 121PA 4Q4HA 3ZDQA 4BFTA 2J0QA 2V7QA 1U2RA 2VF8A 2G1KA 2A5YB 2QBYA 3L0IB 5G3ZA 1IM2A 3QIAA 3REGA 2BCJQ 1RRPA 2ZI9A 3TR0A 1N6HA 2AKYA 4DLUA 2P6RA 2Q21A 4DLRA 3CM0A 1S4QA 1FPMA 2VP4A 5KOYA 2DFLA 2OG2A 2RGGA 1XTRA 3PV0A 3QENA 5EE1A 1E99A 2JJ1A 1W44A 4JLOA 1Q3HA 2WM9B 4MRPA 3OIUA 4DXAA 5IK2A 5HR5A 2F43B 1XMIA 4NZYA 2JLUA 3LFUA 1D2MA 1HYQA 2OAQ1 3LVRE 4HB2A 5ANRB 1P4SA 2ZI7A 4MRSA 3RRYA 2ZR9A 3K0CC 4YLGA 4PQFA 4AIIA 5HE9A 4QM7A 2R8RA 3HWSA 4LV8B 1NBMA 1X86B 1MO6A 2ZRPA 1AGRA 4B6EA 4DBLC 1OF1A 4NONA 3TVDA 3MUFA 2XAUA 2NGRA 3H86A 1KDOA 2JLQA 1UJ2A 1NIPA 1P75A 1HT1E 1XP8A 4DRZA 2GDJA 3AH8A 3MWLA 3FB4A 2R2AA 5DGXA 1W48A 3ND9A 1GVNB 1HE1C 2OV2A 3IQWA 2IC5A 4OK6A 4XVUA 4TLAA 2Z0MA 2VSXA 2JLSA 2JGNA 1P9NA 3F5FA 3S1AB 3KJGA 4F4JA 4U7DA 1VMAA 1G19A 1J99A 1DELA 1G291 2DWOA 2QE7D 3PEVA 4B74A 1UEIA 2CNWD 2QNRA 3B7GA 4Q18A 4IDNA 4Q9HA 1EX6A 5SZKB 2VF7A 2EQBA 4QBIA 5AUOB 3QF4B 2J45A 1HQCA 3PG5A 4WIAA 1E2QA 1R8SA 1YZUA 4NTZA 4NYMR 5FL7D 5ELXA 4RCZA 5FOXA 1FNNA 1W4CA 1G7CA 5TXGA 1ZBDA 2FJUA 2IYTA 3M4YA 2XOKA 3TBKA 2D62A 4E03A 2F1JA 4ZIRB 2HCBA 2RH5A 4XOIA 2YINC 2C9OA 5BW8A 3IIJA 4B33A 2I1QA 1Z6GA 2CK3D 4NP6A 5DIFA 2IWHA 2QT0A 3TQCA 5E7JA 3IGFA 1BMFD 1W1WA 1XEFA 2OLJA 4JJKA 5TY0A 3CRRA 2WPDD 4TYNA 1G6HA 1Z08A 4KFUA 1SGWA 1VG1A 3X1ZA 4BFWA 3U7FB 4NKRA 2ZRBA 4Q48A 4XVRA 5K8IA 2VHQA 2GHIA 4Q4JB 4EPXA 1NJGA 2W58A 2QAGA 3OHMA 2WAYA 4PHHA 3U2QA 1U90A 2V8OA 2FFQA 5AJXA 4U5XA 2FFAA 1SVKA 2P67A 1G6OA 3BFXA 1WP9A 2R6GA 4I4LA 4EPTA 2Q3FA 1R8QA 2B8TA 5BQ5A 3NBZC 2CL6X 2CEAA 2QT1A 1NMXA 3MRSA 3SEAA 3SQXA 4M1OA 4ASUA 4MGYR 4NHOA 1W49A 4N3NA 2RGDA 2KJQA 2IYVA 1J2JA 5EE0A 3BORA 3W90A 3TH5A 3ZZ0A 1R0XA 3ZLJA 3QSYA 3LD9A 1PUJA 1E2JA 4HLUC 1QHSA 1AZSC 2HCJB 4KXFB 5H70A 5D3MB 1Q3TA 3RDPA 5JSZB 4JS0A 3TSOA 4PO1A 4P4UA 1JEEA 5FTJA 3GPLA 1CF4A 4WBSA 3WY9A 3UATA 4BASA 4ZCIA 1FL9A 4Q4LA 2HJVA 3QKRB 4FIDA 3AQ4A 1DAMA 1XXHB 2XEXA 3MWJA 4B43A 3PCRB 5CYPA 2GCPA 1WF3A 2HV8A 1KAGA 4KO8A 1ZD9A 4OHVA 1RRCA 4YQFA 4LX0A 4A36A 1GRQA 1SXJE 2AFHE 2BBWA 3E70C 4PX9A 1S1MA 3THYB 1KI3A 2G88A 2J46A 4ZO4A 1WXQA 3QXJA 2EVWX 1KY3A 1YQTA 4JVMA 4JL6A 2QA5A 1NG9A 4QHSA 1KI4A 4V0ME 3NH9A 4IEEA 5DN6A 4B3GA 2D4HA 1QHGA 4OK3A 2BKEA 5B30A 3TGPA 1G8HA 1S3SA 3O8CA 4TMZA 1AZTA 5J47A 1BYIA 3W3AA 2ZYTX 1MKYA 2CE2X 2Q3HA 2D2FA 1W7AA 2JA1A 1A7JA 3QOFA 3K0SA 1U99A 5CM9C 1J70A 4KCGA 2FSFA 3DZDA 3GLHE 3GEIA 2YNMA 1E9BA 2ANBA 2CJWB 2V7QD 1X1RA 5FTLA 1NY5A 5E7IA 4MITA 4Z1MD 2P5TB 5KSZA 3MD0A 1JQJC 4DT1B 1NVVR 2IT1A 3GLFA 1ZIPA 3VU9B 3D6TB 4AG5A 5JJIA 5A0FA 3K09A 4DDUA 3ZD6A 4YDSA 4F7WA 1E2HA 4FMDF 3GLIB 3GLGA 3QPVA 3C15C 3LH5A 4A9AA 3C41J 1G9XA 1RYHA 5E7MA 5JJKA 4KFTA 3OIWA 4P0TA 1OFUX 4DLWA 3MJHA 4LHZA 2Z43A 5IHPA 3IO5A 1NRJB 3A4LA 2WIAA 2GJKA 3SYLA 4GZMA 5FOUA 3M1IA 1E0AA 4RZUA 1ZRHA 1VHTA 4TL8A 4XTCS 1NJFA 3LXRA 3FPAA 3WMGA 4TQ9A 1Z2AA 5L3VA 3PENA 1UBFA 1F6BA 2GCNA 3SYKA 5FUYA 3OEEA 1UBCA 4EQ6B 2JAQA 1T8UA 4F93B 1AS3A 2GJ9A 1IBRA 1W0JA 2IHYA 4PC6A 1GWNA 4XJXA 3T1VA 1JAIA 3QKSA 3TSZA 5EXTA 5HTKA 1P2SA 4OI0A 3U7HB 1XU4A 4M22A 3FVQA 1T91A 3UXMA 2DYKA 1SVLA 2BJWA 4V0NA 4V02A 5GADl 4MH0R 4Y0AA 2ZIAA 3U3RA 4OI4A 3BJIC 1G64A 5FPTA 4MKGA 1OLOA 3U61B 2OUKA 2WSSA 3SFZA 4WW0A 4ZPXA 3T5DA 5M04A 5J4HA 3NBFA 3THOA 1CULC 2AWOA 3PEUA 4PC3A 2A7QA 4PPFA 4RSGA 2CDNA 4NDZA 4OQMA 4F4IA 4H1UA 3QVVA 3RLFA 1KK0A 3LBHA 1WMSA 1G41A 4JLNA 4A6PA 4TYYA 3ZZTA 1E0KA 3AUYA 4UJ3A 3LX5A 1Z0IA 2VEDA 1E2IA 2VP2A 3OAAA 2WAXA 4IVQA 4CEJA 2WTUA 1CP2A 2V6JA 1G8YA 1K5DA 4URWR 1CRPA 2GXSA 5K8TA 1N0VC 2QGZA 1MRSA 3HPRA 3V4FA 1JECA 1G7RA 4EJSA 3IO3A 2QQ0A 4E07A 4QJ3A 2NTYC 2YC2C 3QKTA 4L5BA 5GJVC 3C8UA 3BXZA 4C30A 1QHHB 2YKGA 3THWB 3PJRA 1UBGA 4GBMA 4Q4AB 3VQTA 2JDIA 4DLSA 5BWMA 1W36C 3ASYA 3DM9B 3U44B 1VHLA 2ZETA 2IYSA 1NKSA 2WHXA 1SXJA 5FOTA 5JCZA 3AVPA 1Z6AA 4BLOA 1SVSA 3W6NA 5KHOC 3CRMA 1N6NA 2GVDC 4IOJA 4HUQB 4BFXA 3SI7A 4QFMA 4BLTA 1FNMA 4DSNA 1DAEA 1AGPA 1Q0UA 2GESA 2O8FB 2JLWA 1UADA 1W4RA 1E2LA 3RAPR 2PLFA 2VL7A 4A82A 4IHQA 3TRFA 2VH5R 2BC9A 1D9ZA 2YOGA 4WZBE 1SXJD 2XZOA 1MRNA 4DIEA 4HB3A 1OXXK 1RFLA 2ZI6A 1E2EA 4F92B 1YZQA 2QRNA 3HYRA 3ZZUA 2QMEA 3VR3A 2GETA 5F98A 4DLYA 2VP6A 5HKKA 1DAIA 2GZHA 3UMFA 1NI3A 2ZITA 4BGDA 1XJQA 3I62A 1GITA 1JQLB 1VIAA 4GL2A 4D25A 5CLQA 4AWXA 3EWAA 5KSYA 2IS4A 3OE7A 2O8EA 1CR2A 1FUUA 4CRWB 2ZS9A 2QPOA 2OESA 1AA9A 1P3JA 1K5GA 4LUCA 1G3QA 1I4DD 3FHCB 3O8DA 3P1JA 4LYHA 4PC2A 4CT4B 4JVSB 2OT3B 1CJMA 4DWJA 2DB3A 4L8GA 4KVGA 5TDHA 2ZRFA 4QGAA 4TMKA 2CCKA 1W36B 3U5ZB 1Z0FA 1L8QA 4JVLA 4Z54A 4HAYA 821PA 4TQUS 2O5VA 1NKTA 4KYUA 1HEIA 2VSFA 3BH0A 1XD8A 2ZR0A 1F60A 5FBVB 2BJVA 4TTQA 3A6PC 5GJBA 2PJRA 1WE2A 4JVNA 1DBSA 5DHAA 4TSFD 2LKCA 3LWNA 2N1BA 3Q72A 4DDWA 3ZH9B 4C2TA 1F48A 3BD9A 3KXIA 2HJGA 2PLRA 4DKXA 5EP3A 5BN5A 2ZJ8A 3VNUA 1AIPA 2Q0HA 3K0FB 4RY2A 4Q9KA 2ERYA 3FKSA 4TN1A
chains in the Genus database with same CATH superfamily
5D3QA 3D6MA 1Q7CA 3DE1X 1AS2A 1W5BA 3JD0A 4IGFA 4LJLA 3G0HA 4WLFA 4G0WA 2V5UA 2IEBA 2G25A 1XZEA 3FW1A 5DBEX 5ALRA 3RBXA 2WLTA 4MIYA 4AQ7A 3H84A 2HQRA 1AOXA 5EGSA 5JCJD 5FBHA 3WHLA 2C2GA 2DUMA 4GHWA 1MX9A 1T5IA 1Y1TA 1ZVJA 4TV9F 3CKKA 1G3MA 3N5CA 2GAJA 3AJ9A 5CA0A 3T7AA 3VI4B 4C3OB 5AIBA 2AUMA 4KR6A 3KTFA 1M34E 2J9RA 1OI4A 4GZ6A 4D8TA 4LJ5A 3FVTA 4NZMA 5C9ZA 2HDWA 3F9CA 3P32A 1MAWA 1KDPA 1W46A 2C20A 5JYDA 3EPHA 4CQJA 3D3NA 2XE8A 2OKGA 2BGTA 4F4UA 4BEWA 1T1IA 2YVUA 2FCAA 4TGLA 3TLGB 5CVTA 4L85A 4AG6A 1Z0JA 4IDPA 2FK8A 2JGMA 4XR9A 5ADUS 2G08A 1WXDA 3ENNA 3OUZA 5FBZA 2PMFA 3ABOB 2YWJA 3QLTA 5CT5A 4RQUA 2I4IA 4RIHA 4B34A 1QVZA 1TDJA 5MF6A 4XVHA 3BMOB 4XD2A 1SO8A 4MW4A 3DMRA 3HP1A 1KO7A 1N5RA 2PO5A 4MVJA 5CHYA 3R7LA 3RSHA 4EG1A 5IT5A 3EGEA 4ZJPA 2PT9A 2QE7A 2W7TA 3IJ5A 4QBKA 3SQLA 4C88A 4ZZ0A 3QI7A 4FZRA 3GU3A 3BIWA 4LFBB 2AK3A 1FDTA 1KDTA 1UWKA 2I4TA 2NZ2A 4KLZA 5IW8A 1RM5A 1BXRA 1J8MF 3RSQA 3W77A 4EELA 1GZVA 4EUNA 2XZDA 3WB0A 2Q1WA 4GYKA 3TW8A 3ZWQA 2PQ2A 3LAWA 3LY9A 5CT8A 4EI9A 1T3HA 2X6RA 3EW7A 1T9KA 1H85A 2OBYA 5T8KA 5K2OA 3D8RA 4M76B 3V42A 4EW2A 5K6AA 3VH3A 4P32A 3TECE 4P3KA 5ES4B 2OXTA 1TYZA 4MO9A 5DNYB 1V8FA 2XD9A 3VR6H 1EX7A 3R5KA 2PYIA 2D54A 3ORFA 1RC8A 3UKJA 1ZUNB 1C7QA 4MEJA 2DR3A 1N5DA 1FSPA 3KT8A 5C18A 4E5YA 4G0PA 4CF4A 4H4DA 2YIDA 4NPCA 2H4WA 2XT6A 5D6NA 1J06A 1GL7A 4M54A 1UMDA 2C57A 2B34A 2PRKA 4K5QA 4ML3A 4WDRA 1JG2A 4GZLA 2ZJYA 4PAOA 4L4YA 4EHIA 5D6OA 5I8ZA 3SX4A 2L0XA 1EPUA 1S0UA 2BEUB 3QU7A 3TAUA 2J3LA 3ZHZA 2D06A 4UFPA 1JH9A 1XYVA 1KRWA 3PC6A 3KQLA 1T15A 2ZYUX 3KL2A 2CLHB 3VA7A 3K70B 4H16A 3K5IA 3WLIA 4IEIA 1IFXA 5GY7A 3ZU4A 4B7XA 2XCUA 3FOAA 3WIOA 3MK31 1THMA 1DQNA 4JDUA 4QXPA 1DQPA 4KV9A 4LE2A 2AI3A 2C7OA 3AFGA 5KS2A 1XEWX 1TU3A 3RK1A 1R9NA 1OZHA 2QTHA 4IVRA 3CF4G 3T9BA 2VQSA 2RE8A 1V1MA 2GHTA 4FQ8A 4LC0A 1N6KA 3HCDA 4D79A 4BN5A 1Z07A 3DL2A 1W4BA 1WXFA 4YPVA 1R0YA 2X3UA 5KKNB 1WM1A 2Q3EA 1LTHR 2YOHA 3K8QA 4XDYA 3ZGYA 1CHDA 1GGKA 3FDIA 1HQKA 5ALTA 4G8DA 3LPMA 3VYVA 4AURA 4CTMA 1Z4LA 4Q1EA 2NU8A 1WXWA 4K6KA 4BUCA 1KGDA 2POQX 3JD2A 2F59A 1TEZA 1LEHA 1YRLA 1E6LA 1AXEA 2H2HA 2R7LA 3KO8A 2X0RA 1AQJA 2BEVA 3O9ZA 1JXOA 1TQDA 3BIOA 3EXAA 3QITA 1IJBA 4GFDA 4XGIA 4WBXC 1JDVA 1K7EB 2CVQA 2NUBA 3MJVA 4UBKA 2J9XB 4C6HA 5JSFA 1NUPA 1O6BA 2FAXA 2GPJA 2VPZA 2H4JA 4FMBB 5LA6A 4TVKA 4CF6A 1ETUA 3L77A 4R6XA 4L6IA 5HSGA 5JD5A 2R68A 4K0KB 5DHPA 4IHAA 5IBPA 1VPTA 4F97A 2WJ6A 4UAUA 1R16A 3U26A 4JC0A 3GA5A 3CGGA 4JUDX 5DHSA 5JO0A 3E9ZA 2PS9A 1YZ3A 2P1RA 1T6NA 2WYUA 4M1QA 3VVLA 2REXB 3OQ1A 2GQ0A 6LDHA 1OIXA 2R7NA 1X39A 5K0FA 3CWZA 2P9CA 1JR3D 5CHEA 1EEHA 2D5IA 1TUGA 2NZXA 2Q0QA 2ZBUA 5ALEA 5DYIA 3VSAA 4BQSA 1MB0A 2E5FA 1M74A 4HGOA 1RMTA 5LIPA 1L5KA 5H0IA 3ZE0B 2Q2VA 3AV0B 1E0JA 3JYOA 1T1EA 1FU8A 1VKJA 3LP8A 1OLXA 3Q3GE 3LHKA 5C81A 2Z08A 1BOOA 3RHTA 4WSOA 4IFIA 4IJWA 2C5LA 4LXQA 4TRMA 3D6AA 2OVBA 3MXOA 1GPBA 1MO4A 3WIEA 4L72A 3I04A 4CJXA 3ZQ4A 4ITVA 3A1WA 3M6AA 4JB2A 2Q4BA 3MNFA 4GR5A 1ZJ5A 4MQ4A 3S99A 3U44A 1C1YA 5CYGA 4CCYA 5AK3A 2YW2A 4BO4A 1F2TA 4KQXA 4C89A 1G5RA 3DNFA 4BX3A 3KNZA 4RK5A 3U4CA 4ZV4A 1DE0A 5AWFC 4FK8A 3GJ0A 3QWIA 4U5QA 1QOQB 5CFOA 4QGFA 3SM9A 5JMWA 3T1TA 3JYLA 4RYDA 3U3DA 4BL5A 2C97A 4DG8A 1QMGA 2AJDA 1NI5A 2NSJA 2PQ0A 3AO0B 3NTQA 5F3DA 2BGJA 3TW4A 4G5RA 4GZ3A 1DP4A 1VL6A 4YRFA 1QX3A 2QVGA 3GD7A 3CX7A 2C8JA 2RH9B 2J8ZA 3C6XA 3I0NA 3QJYA 1ULHA 4I55B 5DO9A 4BJ5A 4MDEA 1L7VC 1JJAA 2XYVA 4JOCA 3HI6A 2H29A 3CC8A 3DE6X 3ZJ4A 4MEAA 5KYNA 4ZAVA 4DEVA 1E94E 1Y8CA 1T5BA 4NYMQ 5IULC 2QIOA 2VPTA 1C0IA 3FMGA 2XQKA 5AH0A 3E27A 5IH3A 2XRMA 5FJJA 3K71B 1UOQA 5AKHA 1DJQA 5T5QA 5U4XA 4B0PA 5AQEA 4CG3A 3P9SA 3NRBA 1U1FA 5CB4B 3AZPA 1MOQA 3PD7A 5A7GA 3O94A 5HZGA 3EDMA 4F12A 4ND3A 3KXKA 4G23A 3Q9SA 3EXHC 3EG5A 2WDZA 3NWEA 1N2CB 2CXTA 1GARA 2W43A 1CDZA 1JE1A 4MUKA 4N0DA 1N9GB 3A6DA 4LJ6A 1CUCA 2F1HA 3D6NB 2B82A 3KVOA 1U28A 3HJNA 4FJ0A 1IUNA 1NQVA 4MPPA 1IXZA 5J2UB 4NV1A 4ZFNA 4XYBA 2E4VA 3I23A 4LZZA 2XUFA 4YAEA 1GPNA 2OV1A 4IS2A 1Z2OX 2R66A 5B1DA 3K8YA 3R8CA 3TLKA 5EIHA 1NQ5A 5AW1A 3L7JA 1N2CE 3THWA 2G0AA 2WE7A 4L6AA 5FTMA 2RHHA 3K5HA 4IG4A 3AR5A 4QDJA 5L3QA 2B0CA 2IUYA 1MFZA 2OXCA 3HDYA 1R7RA 4M9ZA 4NBWA 4XOUA 5HFJA 2ZVJA 3H8SA 3ONVA 3SSNA 4B71A 1P5RA 1OXUA 4W5OA 4HDRB 3RU3A 1FXWA 4IJVA 5B7GA 1DBQA 2X23A 1XZIA 4PQYA 4AJHA 3EMDA 3N7UA 3TQSA 2Q1XA 1BE1A 1HO3A 5TGDA 4J0IA 3G9UA 4LTMA 1E1DA 1CS0A 1MGOA 1OJLA 1RWPA 1DJLA 2GBLA 3I9JA 4BZXA 5HMLA 4AKEA 1FRZA 1BQ3A 2PPVA 4OGWA 2J7PA 4OQ4A 1ZI6A 4FFNA 6NULA 1AU9A 1D8AA 2JZCA 5T7BA 2F8SA 3EQZA 1EM8A 3G2JA 3FWPA 4UUNA 5FUMA 1HDIA 4PAQA 1T0HB 4Q21A 4DCSA 2OB2A 4BC0A 4LJ9A 2P9GA 4ND2A 2Q2QA 3PE3A 4G4GA 2VLBA 3CNOA 4NHEA 1IC6A 3GLGE 4EMUA 4C0SA 5CFMA 1P61B 2JJ2A 2Y1DA 3B9BA 3F96A 3DPIA 1Q1BA 4FSDA 4ABYA 1TM1E 1SKQA 4BNDA 3I58A 2WZBA 3WOHA 2XCQA 5KI6A 4L7VA 1WOMA 1NT2A 1A96A 5CG2A 3R9XA 3OJCA 2OO7A 1PNQA 1TUBB 1QGYA 4RVOA 1XTSA 3DV2A 3RT1A 4ILEA 1WABA 3QFFA 2H5IA 3FPBA 1ZH0A 4FFBB 4F3YA 4YR7A 5IG2A 2ZZMA 1TC1A 1LK0A 1F38A 2J33A 2CW5A 4JU8A 2RHMA 1LZKA 4EGJA 4DV7B 3CLUD 3PIDA 5CIQA 2B4AA 2W98A 4LHVA 4MWOA 3B1KA 3IPLA 4FOTA 2P6NA 1SUAA 3K9QO 4XAQA 4PF1A 1NYQA 4PU0A 1ZSYA 3BUSA 4RSMA 3TB4A 5CVCA 5EWMA 1O2DA 3OMXA 1NXQA 3BRCA 2AE2A 3IHWA 3OP4A 2AD1A 2WOJA 3EH1A 2C8VA 3AG6A 3I9OA 4FGKA 4RFLA 2X22A 2Q3MA 1ZQ9A 2FEMA 5F4ZA 4ZCLA 3TTVA 3WYCA 1I10A 2GSDA 5FUQA 1AA6A 2OWEA 2C1EA 4Z51A 4FOLA 1DCFA 3A58B 5H7XA 5B5SA 5EWJB 2P9TA 1SEVA 1GTZA 2B6HA 3BE5A 2XT0A 4I3GA 1YJ8A 3FYCA 2VF2A 1PWXA 1NBMD 3EVZA 3JASA 3L01A 2IXGA 5J43A 1U2GC 4KQ9A 4U2DA 4BNTA 4O4IA 4AO6A 3UUEA 1A95A 2HA2A 4J7UA 2J3IA 3H75A 2XJ9A 3LO5A 3OQIA 4HMQA 1NXPA 4BU1A 4TTVA 5JROA 2Q0XA 3JSAA 5EEGA 3CT6A 4RFSA 3L82B 4KRYA 2F64A 2WZDA 4QDXA 3AFHA 3N53A 2IU3A 3T0IA 5C51B 1H4VB 4C7XA 1H2FA 1IPFA 4NWIA 1MB3A 1NF9A 1Z6XA 3DHVA 1GN9A 2R79A 3DL0A 3UB2A 1NUTA 3FI0A 3OF5A 1E3EA 4UNQA 1NU6A 4IHJB 3DGFC 5BV2P 1IY1A 1GV0A 1YS4A 3ON5A 2NPIA 3UWDA 4LZNA 2ZRKA 1HBJA 3NNNA 3ZGLA 2V7EA 3LGSA 4XFKA 2C8KA 1F7VA 3L8GA 4DSOA 3PX7A 2EIXA 3NRCA 4L5CA 3BZBA 3OEWA 3BBPA 3GT7A 4GM0A 3PDCA 4UAJA 1GU7A 3SXUA 5AVTA 1AGYA 3SZLA 1RI5A 4LSZA 4ZK6A 3MGCA 3QVTA 1J8FA 4ZOCA 1EGAA 3DMFA 3P7MA 4LDRA 3NKVA 1XVTA 1Q7GA 3DR3A 5EHZA 5IC4A 4K6FA 5AKYA 4QZVA 2PVSA 3T7CA 5ARCA 2MYPA 2KSQA 4OHXA 3BEOA 4EJSB 2JANA 5KNDA 1ZICA 3EVGA 2Y9PB 5F23A 4UPVA 4MVJF 4O5OA 2M6KA 1ZFNA 1V3UA 3TDMA 1U7PA 2QPLA 4MIKA 4WLEA 3KJXA 4DABA 5L4SA 3W8EA 2DBZA 2XUHA 2QU7A 3F5MA 2ZWVA 4LV6A 2RB4A 2DF8A 5LU9A 5DP1A 2FPPB 4UU1A 4P80A 1FOEB 2VXBA 2OZEA 1XDBA 1MUUA 3SLRA 4RKFA 2ZXUA 3H5OA 5F1PA 1AKVA 1CS4C 1XQVA 4DBVO 3DZFA 3QVSA 3HDTA 3AZOA 4N18A 1QIKA 3BFJA 4XIYA 4M9SA 1TIPA 4Q7KA 5JFOA 4LZPA 1D2GA 4V0RA 2P62A 4MYUA 3MGAA 5AXCA 1NLYA 3D0RA 1Y7LA 2MSKA 2P9HA 1E5DA 4FW8A 2QTVB 3INRA 1Z26A 3DYVA 3TL6A 1I4TD 3TLJA 1J9EA 1T5HX 3DBRB 1T9HA 2YASA 5KWIA 2QI9F 4MUGA 2ODBA 3RRMA 1Q5PA 4O1MA 1VJDA 4QAJA 3C6KA 2OUIA 3KPYA 5A7HA 2PX3A 4GC5A 4QWWA 2FZWA 4BFSA 4BMXA 1IN8A 1STOA 2W2KA 2PS0A 3BL6A 1W87A 1B73A 1Z0ZA 3GBPA 1NF8A 4IM7A 5IM4F 1V3TA 5EIOA 2EG9A 1XUOA 2GZMA 2H7CA 1M34B 2BGNA 3G85A 2IHTA 3IVCA 1UXGA 2AX3A 1P77A 2B21A 2HL6A 4KE9A 3T7RA 2ZAMA 3W5JA 2O1XA 5KPJA 1JFFA 4WZAA 1G4AE 3MWKA 4DV5B 3W7BA 1G8SA 3ZYCA 2XF8A 2EIHA 3CX3A 3F73A 4KUEA 1VLHA 2H2IA 3G9XA 1QBKC 1JILA 2C83A 3IHTA 5EJMA 2PZGA 4DNOA 2VQDA 1F7UA 1I3OA 4NULA 5IRCD 1BXZA 2GAIA 4KAJA 1DHTA 1JU4A 1UKAA 4IJUA 2JLRA 3PIRA 5JQGF 2OBNA 3IELA 3HU2A 4OX9B 4UUPA 1G8KA 1Z63A 2Z3WA 5JVDB 1H8EA 5JBQA 1R8YA 2FH5B 3JAWA 4AT1A 5CAEA 3S81A 4DEYA 1TU4A 3NXSA 1KJJA 1OV4A 3DDHA 1GKYA 3H83A 1NQOA 2CLEB 2BFMA 5H3LA 4BNKA 1POWA 4D2IA 3AERB 1IHXA 3GGOA 2VCEA 4B6FA 3AR2A 1FLAA 1NSTA 2Y1FA 3GLHA 4GRIA 4XWWA 3IQZA 2WJAA 1B1CA 2H1HA 4KDFA 1O77A 1Z35A 1Z25A 2VCYA 2I66A 1M2VA 2WY2D 2X41A 5JRDS 3UGTA 5K0CA 1FEZA 1K6MA 3HCEA 3RV4A 5DBIA 1SG0A 3VHLB 3CA8A 4Z2AA 1V7ZA 4FMCB 4ID3A 4DCTA 4ZGBA 2PH7A 3OKAA 3GLRA 4GDMA 5AJYA 4EBBA 4YMLA 4GVPA 2PNFA 1QORA 2PX8A 2ZBGA 4AJ1A 1M0EA 4B31A 4IHJF 2CSXA 5BPFA 1A2BA 3HMQA 1PK9A 1GAWA 3EWNA 3P2MA 2PSJA 5AVJA 3HCCA 4JHXA 2BGMA 5FULA 3UMGA 3WNDA 5IXSA 1N5IA 1C8BA 1R6AA 1RXIA 2Q2OA 5CDHA 1TLLA 1E64A 1WDTA 1ZVKA 2WFZA 4DDHA 1KP9A 4G09A 5FL3A 3RF7A 2VS1A 4YUVA 1E20A 1TA0A 1WSAA 2B5OA 2G04A 3K15A 3LV8A 4G07A 3W06A 4FYPA 5HKKD 2GFIA 5IYZB 3NP7A 1Y3FE 2J3MA 4ISCA 5I5EA 4DDVA 1JNXX 2RHWA 1GXSA 1KO4A 1XWFA 2Q6TA 4B83A 4DJFC 4DRXA 1HDCA 1ZNQO 5C1DA 2G1AA 1BHQ1 5C5DA 1HI9A 4OXRA 4P4SB 4MJ3A 1R5NA 5HYVA 2QQ5A 2XZPA 3UJHA 3UJ8A 3KUCA 2Q4OA 4MTCA 2AYYA 4IFEA 4KQ1A 4L15A 2AEEA 2Z1MA 4K9OA 4MO2A 4NYJR 4X1IB 1S3GA 2P4SA 1G6KA 1K6JA 3RODA 1HURA 4F5WA 3IODA 5JMPA 3VO1A 2D74A 2JFGA 4ZOBA 1RE0A 1OHHA 1OFTA 4EFLA 1MTZA 1Y1PA 3BB4A 4JEMA 4R54A 3ADOA 4C06A 4BFVA 4EBFA 5U9CA 2PX0A 4AICA 2FVXA 4DNXA 3V2HA 4H7IA 3NEPX 3COZA 4FBMA 4BP3A 1JIQA 3AF0A 1XIVA 1YRWA 2XEDA 5JHHB 4NZ9A 4A8PA 1FNSA 5E3JA 1OH6A 5IJAA 1BZYA 1QGUA 1I7DA 4FOSA 1A8SA 2FEAA 4TT3A 5C4IA 3CLVA 1F2DA 1KH3A 2FMUA 1GPMA 4FVTA 3ZI4A 4N8DA 1UL1X 2XZLA 2IXFA 1FYVA 3B2EA 2CLIB 2IHVA 1AKMA 2I7TA 3OEYA 3WWPA 2HGSA 2IW3A 3AI1A 1DC5A 3FZNA 3ETCA 4L78A 3S8EA 1KKUA 3NOVA 3L9WA 1A9OA 1PSDA 2WHPB 3GD5A 4NJMB 4NYIQ 5FOSA 4MQMA 3VC1A 3OUTA 1AGNA 1ULUA 3FNIA 1W1UA 1SMKA 3ESBA 4E0BA 1P5FA 5CDSA 1GILA 1PQPA 4LOIA 5EPEA 4R3WA 3IOCA 1Q17A 2HF9A 3OAAD 1EA5A 4LYDA 5AT1A 4ZYTA 2QM0A 3DVSX 2A33A 1ZM3A 5E4YA 3ZY2A 2O8BA 1GR1A 3HBAA 4HLNA 2GBFA 3KYDA 2H07A 2PD6A 4W7SA 4BUJA 4BZZA 3ZV3A 4B3IA 4UTNA 1A4UA 3SBXA 1N5JA 1O3YA 2J9ZB 3AR7A 1M9NA 1AGXA 3VMFA 1AURA 1KYIA 1KI6A 1PZHA 3JCZA 3PVCA 4ZWNA 1XEAA 2ODNA 1RXYA 3C7CB 3TCXB 1PV4A 4Z7OB 4MUBA 1T2NA 4PEVA 2RK3A 3FYUC 3O1LA 5SY6A 3RSFA 5CDYA 3RVJA 2IXTA 2V7UA 4MQFB 3CUWA 1LF5A 3HFRA 3D31A 3T3NA 2D5LA 5JSZA 2I6SA 2EZ4A 1R74A 4B85A 1T4CB 1G4UR 1AF7A 2FZVA 1Z29A 2ZE8A 1L8OA 4Z8XA 1BQ4A 3F6EX 1HT0A 3CHYA 5GONA 1G8AA 3WKEA 4HV4A 1IIBA 4PNHA 1GPLA 2F7SA 2HMUA 4Y2UA 4ZA2A 4L16A 4G37A 2E3JA 3ABZA 3I1JA 3OTIA 4OREX 3IXLA 1Z8DA 1RNLA 1KVRA 2X4LA 3PDUA 3QXCA 4KX3A 4EECA 2PGLA 3LUDA 2GBGA 1IY9A 1P31A 1W73A 3LUJA 2VSOA 2NXJA 2KBFA 3EAQA 3L7BA 4XE5A 5JXHA 1E5TA 1RIIA 1VJTA 2JGKA 4FCTA 1JHAA 2VAVA 3DYBA 3GDWA 4R3NA 3FKSD 3VR3D 1YF3A 2IS1A 1XHEA 4RL6A 4ZO8A 2C2ZA 1C30A 3O4FA 3THYA 5J58A 3GP8A 3GRCA 5FCDA 4KWEA 3WBKA 2JH3A 1QZ3A 4EW1A 1NQTA 3JYHA 1LX6A 1XG5A 4LOAA 4V38A 2A9PA 3HUUA 3I72A 2JCSA 3LC2O 2WYHA 1BH6A 3A9VA 1F12A 3H8WA 3O26A 2XNCA 1L0BA 5I9SA 1UC4B 2X7XA 2XWSA 1L3IA 3OE4A 4IVPA 1UK6A 4RF4A 3TSAA 3HA3A 1P3Y1 2EFGA 2J0EA 2N9UA 3CIFA 3HY4A 3KBBA 4QBGB 1A76A 1QUFA 2LUOA 3AR4A 3KFVA 3M6FA 1ECCA 3NX4A 4L5YA 2G5GX 3NV9A 5LZ5A 4DE5A 4MQEB 2VEOA 2P9FA 3PT9A 4GBED 4OMUA 2XUKA 5JC8A 5CNKA 3SC2A 3O3MB 1Z47A 1TVMA 4S3MA 3SMQA 2KBEA 2ZXFA 3L7AA 1LNZA 2Z57A 3NJ4A 2UUOA 2ZULA 4AS3A 4IP0A 2XWJI 4WCDA 2C0CA 2XJ4A 2P1ZA 1RZUA 1JPVA 5DGCA 3WO1A 1X1AA 3I5AA 1TKAA 4PZPA 4EWLA 5LZ9A 1Q1EA 1O4WA 3T06B 3CLTD 4V0OA 2F90A 4N3BA 1SN7A 4UXHA 5DYGA 1Z38A 2OENG 3C3WA 2GEKA 1UP7A 4JI2B 1VZ3A 1XWIA 3BZUA 4Q66C 5A4IS 4Q7MB 3D54D 4XJVA 4OAOA 1KSGA 3UBMA 2TECE 1PG0A 2ZJZA 3GFTA 3GP3A 2IEYA 4FUQA 4ZDWA 3LNTA 3T9EA 2V55B 1JE0A 2YWFA 4IDGA 3I5YA 3CRZA 3DFFA 2VHZA 1U7XA 1NI4B 4EO9A 4NMHA 2QDKA 4UBOA 1HZJA 1AJEA 1UF9A 4BKMA 1E96A 1QCYA 4ND1A 3T7KA 1TMKA 1XR3A 3AIMA 5J1SB 5A04A 4ZQFA 3RVBA 5K5EA 1JLLA 1PR9A 2FK7A 2GN4A 2H17A 4PFKA 4D97A 2Y9MB 4J16A 4MYHA 2ZBPA 5ERXA 4CL3A 3WSWA 4DOMA 4MW7A 4CNBA 3EIWA 3TZKA 1D2AA 1WEKA 4MJLA 3MQ4A 2PWPA 2UZ3A 3P4XA 3WGVA 1PS0A 3D3KA 1DAFA 3QFRA 3GJQA 4LCBA 4U00A 4CM8B 1MA0A 4KEAA 3LVFO 5IUKC 3QTBA 3O9VA 4HFRA 4YP1A 4D96A 3QP9A 2E4AA 1NPDA 2LCFA 3DUWA 3TKYA 3MMNA 1XF9A 2IV3A 3VDNB 3FHOA 2CL7X 2IOFK 4LJYA 5EZ5A 4ZC8A 2A9FA 3IKJA 4JJGA 4U3JA 4Q05A 4Q37A 2IHNA 1C4OA 1D8TA 4HFMA 1E2GA 1QE5A 3LLSA 2J3JA 4HDQB 5EZYF 5BT9A 3X1MA 2ZJ2A 1LZLA 4YLYA 4PG6A 4ZQIA 3UCFA 3IEVA 5TIIA 5C7YA 3ER9A 3KIPA 1JXQA 1Z7EA 5K0LA 2Y4OA 4KL8S 2D5CA 4D5GA 3TUJC 2BONA 1DQYA 4UPEA 5I51A 4L0CA 1LLFA 1VDMA 1GV1A 3GYBA 2DT5A 2QR2A 4V2UA 4XYEA 4DMCA 4Y2GA 2XKKA 1S8AA 3PNKA 1ZD2P 2I2FA 3ONFA 2PZLA 4NCJA 5DNEA 4D43A 4GF5A 4R69A 4RD0A 1ZH8A 3FKJA 2JGDB 2FYTA 2WIKA 4JLSA 4CTJA 2PA0A 421PA 1LC0A 3EXG2 3GUVA 5JQWA 1KYZA 1NYTA 2PL9A 3KR2A 2ZRAA 3P0EA 5KOJA 1PL0A 2X2PA 4NMWA 5JATA 1KFEB 2AH5A 2XUAA 2LTAA 3CPHA 5LDHA 3GT0A 1EFRD 3LUCA 2IPNA 5ALFA 3JVUA 3FOFC 4G36A 4GH5A 4HDCA 4ZMRA 1R0SA 1RYEA 1EG7A 1Q0SA 5BYAA 1YIDA 2PZJA 2YC4C 4ILKA 1EGVB 4N4AA 3NHUA 1V11B 3UWKA 2HAEA 4CR8A 4CTOA 2A14A 2XD4A 1SQ6A 5ILGA 1FY2A 1XP5A 3GRUA 3L8YA 1G3IA 4ZD6A 3W2HA 4KUGA 3WDKA 3KUXA 2C03A 4GPIB 3U1TA 4R81A 2EBFX 1JXAA 3V55A 3VAYA 4BVBA 1TW3A 3QF7A 2PXAA 3K6SB 2JJ2D 3NALA 4M1WA 4N03A 4O4LF 4B3BA 5I3ZA 2C2XA 1KOGA 3HL4A 4G8JA 5K0GA 1JX6A 2P2ZA 4GDFA 2HSDA 3L1IA 5EZ6B 2IV2X 1BMDA 2I67A 1P0PA 1R6UA 2X2EA 1JDTA 5G3YA 3VTKA 3ZBQA 3NDJA 1MMFB 2O06A 2QYSA 1Q50A 2GR9A 2YRFA 3QELA 3RQIA 4G5FA 1ND5A 1Z8FA 3EYAA 3PFWO 4D74A 4KQCA 4YI3A 1U0OC 1JBEA 2FEOA 4UAGA 4X3CA 3AF2A 5LPNA 4A8JA 1T6XA 4EP1A 3GJ6A 1BW9B 3DE2X 4MW9A 3ZBPA 3Q8KA 4F5YA 4RLHA 4ER0A 1YI8A 5L6MB 1QYXA 2C96A 3AKEA 1ESCA 4QUKA 2VYFA 3LY5A 2GNAA 4IXDA 1HSZA 1TM4E 1FP4B 2QK4A 1ZWKA 3O1HB 1FDVA 3OJ0A 1KJ9A 1AN9A 1ZMTA 4BU0A 2MSCB 2QV0A 4LF4B 2AOWA 2QORA 3I2GA 4L3OA 3W7VA 1IN4A 3C8MA 3EVAA 3UMRA 2BKUA 3T1NA 5F9HA 3V00A 3ZJUA 1N8NA 3K5WA 3TPCA 2JZOA 1AHHA 1TRHA 3RTBA 1TGVA 1G38A 1RDFA 3MPUA 4ZCPA 3GRAA 5LQMA 4K9QA 3L5KA 1BWRA 2OCLA 1QK5A 1WNFA 3RFXA 2I65A 3QKUA 3T0FA 4NAHA 4ARSA 2DHCA 4JJZA 1RBZA 2GJ8A 3ULKA 2CLCX 3K73O 4YHBA 1YCGA 3LL7A 2DX7A 1M1YA 1RYMA 3GX1A 4S1PA 3C3JA 2KE5A 2AEJA 1W35A 1DV2A 3FD8A 3NEJA 2PEZA 1JPJA 3E22A 4TV9A 5FPYA 4E5KA 4GYJA 3BDVA 5JIBA 3MN1A 1UJMA 2NYAA 3NEYA 1PZEA 2RHRA 5ALZA 1WA5A 2C99A 4IJKA 4XX0B 3S1SA 5CCBA 3P4UA 1KDRA 1Z82A 1CUBA 1XCMA 1U0JA 1CDEA 1Y5RA 5L8VA 1ZGHA 3X2EA 3T7IA 1KAHA 4BUZA 1UT8A 3IMGA 5LN1A 4K87A 1LV8A 1N6PA 2ADFA 3O92A 2VWGA 3HEMA 4MI9A 5KWSA 3QTTA 3PPWA 1WZIA 5JXIA 1U0BB 4CLHA 2ZWAA 4NAUA 1P7WA 1XQYA 1EFVA 2E18A 3HJUA 3KZKA 4R0NA 1YMUA 2HIGA 3UMBA 2DGDA 3QOWA 4JI3B 1FX1A 4F5ZA 1Z2CA 2C88A 4WZZA 2R11A 4Q02A 4H2DA 3BZWA 3TBFA 3WXMA 1JU9A 3KX2A 1RYFA 1T0JB 2G0TA 3T95A 2FMHA 3KJEA 2CSUA 3LYHA 3UH0A 1XD9A 2JFOA 1YS7A 1L3BA 2H2WA 4TLDA 2IH4A 1BMFA 5CGZA 5ISMA 4DUZB 4PGAA 5M7EA 2QJWA 1DG1G 4MKZA 2I2BA 1U0RA 2BKVA 2GF9A 2P30A 3DMHA 1P8AA 4F72A 2BFBB 5KX5A 4PLGA 4S1WA 2VPXA 2P6UA 2FR0A 3OESA 1N9ZA 2A9RA 1HE8B 4KE7A 3WRWA 3EY9A 3NBKA 4C14A 2WNIA 1BCSB 3DQZA 5IDYA 2CXOA 3VOBA 4L75A 4JR1A 3RTAA 3NM6B 4I8XA 1P0MA 2NWQA 4P0PB 3V4PB 2IY7A 3ZV4A 1ISPA 3ENWA 3SJ7A 2XBUA 3L8DA 4FHCA 2UVDA 4UVIA 3UW1A 3WNVA 1IDOA 4DPMA 4CMAA 4A0QA 1K6XA 3MBOA 4EFDA 3G17A 2BE9A 4ZVMA 1UZMA 5EMLA 3BF8A 4RYLA 3VOAA 3NGMA 2DWPA 3ISVA 2RONA 4FDMA 5BT8A 1VMDA 4TL9A 1IN6A 3VPCA 5B58C 3QHQA 3HYCA 3RIMA 3W5BA 1UIRA 1TOAA 4YT8A 4KWCA 1MB9A 3LBYA 4FMCF 4JT2A 2BRUA 2DJ5A 2GM9A 2YHIA 5FUWA 3HY6A 4L28A 4TKVB 2INGX 1KK1A 3HXQA 4H1VA 4F8YA 5T57A 4IHKA 1GFWA 3D9QX 2HK8A 1W8IA 1FB5A 2EV9A 1JQDA 3IJRA 1K3TA 3MJCA 1JGTA 3W5IA 3TG2A 3PUVA 4KFRA 4GLOA 3L3BA 4ZAYA 1RI3A 3JQBC 1SBTA 2FEWB 3W8RA 5KC9A 5GAJA 2NW6A 2VDMB 3R5TA 1TA9A 3VH4A 3QVXA 2QTBA 4HTAA 3LLCA 4J4HA 3X43A 4BYGA 3GFPA 5D1NA 4KR0A 2XUOA 4ME6A 1ABEA 3Q7PA 3HKBB 4QDTA 2WSLA 1R18A 2IQ5A 4U2FA 1GYPA 4ZIRB 2F8LA 1JFSA 3ZD7A 3IBYA 2EKZA 4HX9A 1I24A 3QVMA 4OJQA 1RCTE 3WDMA 2AFHA 2FX2A 3DZBA 3FMOB 2XMZA 1E32A 3FF4A 4REQB 4WNAB 4EY3A 1A9ZA 1ZGJA 2BBSA 1EFUA 3EUAA 2WTBA 3NBXX 1E69A 1C5KA 3GJ4A 3IP6A 3PX3A 4PIPA 1T3SA 1I5EA 3TJZA 4BKUA 2A5FA 1KMIY 2BELA 1ADGA 1M33A 3NHLA 4B3RB 4AIRA 4CMJA 4U7JA 1KI7A 1KE2A 2RGUA 2P91A 4ZRDA 3PZBA 5ICCA 2IUFA 2ONYA 4LRUA 1E3WA 1QK4A 2PN1A 1G8MA 2A7XA 4JZYA 1T8SA 3LXMA 4KPUB 4OXYA 5KX5F 5KPDA 4Y6RA 3THXB 1E58A 1I2BA 3MJFA 3KR1A 5K51A 1GQ2A 5EUBA 1WUYA 4XPIB 3AF1A 1VXOA 5IASA 4D9HA 4JLJA 1BEEA 2HRBA 4GPEA 4MWDA 3T7TA 1PJLA 4XWGA 3S2SA 2QUBA 4BVGA 5CT9A 3TIVA 4B8YA 2GFQA 5F7JA 1HG1A 4JYBA 4JBWA 5AVKA 4Q9LA 1JMYA 2IYZA 4PE5B 4ARBA 2B4KA 1XL0A 3NGXA 3RRXA 2OC9A 2OFXA 1MVOA 2UUPA 4UTOA 3CR8A 3UKOA 4CQNA 3FROA 2XA9A 3EEOA 2X0KA 2R6DA 5REQB 1ZR2A 3H04A 2BMFA 1IMOA 1QOPB 4GXRA 4OHRA 5DHUA 5I01A 1ID1A 1COWA 3HP7A 4HBZA 4K6CA 5KDDA 1KEKA 2IIPA 4ON9A 4YYEA 2GPSA 4X92A 1O9GA 1TJNA 4XSVA 2WUFA 3JTMA 4LWOA 4HVCA 4CQMB 2E21A 3A3OA 2YCLA 3CNNA 2FSSA 3TEFA 2ET6A 1EFAA 3WWOA 1JZTA 3NC4A 3ZHUA 3Q88A 2Q9AA 1LSJA 3ZGOA 1BKSB 3G0BA 3L6UA 1DBWA 1XJCA 3NUZA 1GSAA 3LZDA 1J0DA 1NV9A 5DI3A 1L4GA 2TMKA 4TWBA 3KKOA 4HSEA 4Y9TA 5DFAA 1ABFA 3DDUA 2D3WA 3QU9A 4EEZA 3G6WA 4LOKA 4KIWA 4EAQA 4ZRMA 1J20A 2XYHA 3LPAA 4ZVSA 2Z6UA 2HDHA 4C87A 3DTTA 3UQYS 1CZUA 3OX3A 4Q3DA 2DPXA 1X94A 4YRJA 2X2OA 4J49A 3TNLA 4D3YA 1VZ2A 1ZPDA 1C1XB 1Y8RB 1AMOA 1CRZA 1FU4A 4BN4A 2N3ZA 5C1OA 2WM8A 2C0QA 1YJ5A 3QK7A 3FDZB 3CNQS 1Y7IA 1UXKA 1Y3BE 1Z6YA 1ZM9A 4LF8B 3VR5A 1Z0AA 4O0LA 4RTLA 1XK7A 1W52X 4OAPA 5DTEA 4YAIA 4FILA 3HK2A 1MAHA 3KSDO 1G3UA 1UDRA 2GXUA 2PUVA 1TT5A 1ZH4A 1IXRC 3C5VA 5DHTA 3DJFA 4NVRA 4NAVA 4UEJA 2MTBA 1JSCA 2XNHA 5ALWA 4CNQA 4Y2TA 5DCYA 2XQGA 4YJ2B 2HIHA 3DOIA 1SVOA 1GTG1 1NRXA 5AXDA 4GOJA 1VGVA 4Y1RB 2W42A 2E87A 1G20E 1JEDA 1E8NA 1JU3A 3TI7A 5LQAA 3DYIA 5FWYB 2CLLB 5LLDA 2FPWA 3CTMA 4V0LA 5EHIA 3EFHA 1K88A 3K0KA 2ECQA 3GRKA 2OFPA 3H5NA 1AKTA 4O4HF 1N6RA 3HNRA 2JCXA 3U48A 1UPCA 3GVIA 4F9FA 3U60B 1X1TA 2FUNB 5JWRA 1JQ3A 3K70D 2ZQZA 2C82A 2OHXA 3WB9A 1YE8A 4ZVLA 5LYJF 4R16A 2Z8YM 2F43A 2PANA 3ZUGA 3RS4A 2EJUA 2J5RA 3K0AB 1ZGAA 5GOTA 4LVCA 5I9BA 4DDTA 4R8SA 1V4VA 1VBFA 3N0WA 4JQCA 3C3BA 5JRJA 2W2VA 3MOIA 2JHPA 1CIJA 5CA0B 3AY0A 1ZD8A 3K3PA 3VNQA 4TMXA 4EZIA 1QP8A 4HO1X 4LMPA 1QHEA 1BFDA 1LPNA 3GVPA 4JWKA 4YECA 3BHNA 4D8XA 1BJTA 2IYLD 5JI3E 2NOAA 3UPTA 2COKA 1KHHA 1E92A 5FNVA 3WLNA 1QH1A 4E5VA 3HB9A 2HH9A 3H4TA 2EJTA 4MMYB 1NW6A 3NTRA 5JPIA 4WOCA 2WVJA 1V8PA 1DT3A 2ODAA 5TXGA 1GZDA 1WIWA 3G7UA 3BGWA 2Z4RA