2QU8A

Crystal structure of putative nucleolar gtp-binding protein 1 pff0625w from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
194
Chain Sequence
LPSINPHKKTIILSGAPNVGKSSFMNIVSRANVDVQSYNLYVGHFDHKLNKYQIIDTPGLLDRAFENRNTIEMTTITALAHINGVILFIIDISEQCGLTIKEQINLFYSIKSVFNKSIVIGFNKIDKCNSLSIDNKLLIKQILDNVKNPIKFSSFSTLTGVGVEQAKITACELLKNDQAESILLDQEQLLNTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative nucleolar GTP-binding protein 1
publication title Crystal structure of putative nucleolar GTP-binding protein 1 PFF0625w from Plasmodium falciparum.
rcsb
source organism Plasmodium falciparum
total genus 67
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qu8A00
1U98A 1SXJA 4IOLA 5FPKA 4JIMA 2QAJA 1IBRA 1QG4A 3OAAA 1NJFA 4AYTA 1P61B 4DDWA 1OB2A 4Z54A 4NYJR 3R9IA 1E98A 3C4JA 3KJGA 1FP7A 2ZITA 4B6EA 1TPZA 1X86B 1SVKA 3EZ2A 3GMTA 2FOLA 1RW4A 5EZ5A 1G5RA 1Z29A 3QF7A 1W4AA 4LC1A 1GUAA 4I4LA 2J3EA 4OQFA 3OFNA 1JR6A 4ESVA 5L3RA 2GNOA 3T61A 1TTTA 2NO7A 2C96A 4UKDA 2JLRA 2OCYC 5C46F 4HB3A 2WMOB 4UXJA 1CR1A 4YXWA 3U7HB 3SJCA 2ZI5A 1SVIA 2VRWA 4CF7A 1M7GA 1G8GA 1W5SA 2CJWA 3T5GA 1FNMA 4YMVA 1TL7C 4C2TA 2F55A 4QGGA 2AX4A 2ZAMA 3N5CA 4KLZA 3P4YA 1FUUA 2GBLC 1HE1C 1NMZA 4JBWA 1F2UB 3ZVLA 2QMOA 4AD8A 2GESA 1XJCA 1GRQA 2VP6A 1SZPA 4V02A 2VP2A 1N3BA 5EXXA 4URYR 2XOKA 5JCZA 1QDEA 2XAUA 4NMMA 5KSPA 3EA0A 4O2RA 5JI2E 3PCRB 3Q85A 4P3YA 3EAQA 2YC2C 4AI6A 1S1MA 1XMJA 3RC8A 1FNNA 3SR0A 2BDTA 3NC1C 3FGNA 1UKEA 3TUZC 2PZGA 2JIZA 1R5BA 1JECA 2O0KA 3GCGA 5BW8A 4MYUA 2ZSAA 4PQYA 5J47A 1WB9A 4QL3A 3AH8A 2YZ2A 4AURA 2FH5B 1I4LD 1ZBDA 2EFEB 4ZCLA 2ONKA 3RS0A 3VTKA 4U7DA 2ZRFA 2FFAA 2OAQ1 4EQ6B 1CR0A 3GLGB 4UNQA 4C0LA 4K81B 4LI0A 2ZAOA 1YJ5A 5JSZB 3U7EB 3R9XA 4TMTA 2JLYA 1X1RA 1W2HA 5TARA 2BHRA 3AVYA 1VG0B 3I92A 1KKLA 3EA5A 2VLIA 5AJWA 4OYHA 5E95A 4K8OA 4A2QA 2A30A 3JVVA 2ZU0C 4GP6A 4I99A 4E03A 1RRCA 2Z5FA 1Y63A 4CT4B 4XSHA 4NCJA 1ZNWA 3QPUA 4LOAA 3LFUA 3GJ0A 1XXHE 3LW7A 5JS7A 4BFVA 4BZPA 1J8MF 4JJZA 4CT5A 4MH0R 3CNLA 2GK7A 4BZQA 4CEJA 1R7RA 1F3OA 4PC6A 5CJPA 4XOIA 2F9MA 1OYWA 1CEEA 3OESA 1NVVR 3A1WA 1JAHA 3I8XA 1R10A 1Z47A 1N6LA 2GAAA 3W8NA 5CB8A 4UNRA 5AJVB 2ZSDA 2UZ3A 4NP6A 4ASUA 2PH1A 4DCSA 2BBSA 1E32A 1GG2A 2B8WA 2CMKA 4PR0A 2IXGA 4MKHA 2IK8A 5TV2A 3EZFA 3DPUA 4C2UA 1XEXB 1CP2A 4YDSA 2XB2A 4LC0A 3GLIE 1VYVA 3ADKA 4KCGA 4PANA 5B57C 2QPOA 1XDBA 4MRPA 1RRFA 4WVFA 1P7CA 4BRWA 3BERA 2XXAA 1Z5ZA 1OH6A 4JT2A 3L0OA 4CEHB 2GTPA 2HXSA 4D81A 4ZPXA 3CX7A 1XRJA 2ECKA 2VHCA 2W2XA 4FI3C 4I1SA 2CXXA 1K5GA 4FCVA 4EPWA 2EFHB 3H2YA 3CW2A 2YWEA 4UNSA 4GI7A 3OEHA 1KAGA 1SXJE 3ZQJA 2RGGA 1JB1A 5GVSA 5KU1A 5L8VA 3P4XA 4EJSB 3QXJA 1ZUNB 4J0QA 3PXGA 3K8YA 4JYCA 3AVTA 1COWA 3AUYA 5EP4A 2AXNA 1KDPA 2DWOA 3LQRA 3ZH9B 5EZ6B 3EPHA 2Q3HA 4HAXA 3FMPB 4JVSB 3CONA 2F3RA 2FPLA 3KB1A 1CULC 2H7VA 1OH7A 2AKYA 1Z3IX 3L2OB 1XPUA 2O8EB 1EG7A 5JZVA 4AKGA 2O0JA 2NG1A 3T1TA 1A4RA 1BMFD 2ZETA 4HUQB 1GZSA 3U6BA 5H1YA 1DG1G 1GSIA 2F43A 3RS4A 2ZJBA 2ZJAA 4Q9JA 4Q5IA 4I1UA 2J0VA 4ZI2A 1KI7A 4M1SA 2WIBA 3AKDA 4LBZA 2BC9A 2NOAA 1FZQA 5DE3A 4BQSA 5JWRA 1YZGA 2AFHE 2HYIC 3E70C 4HEJA 1U94A 3GEEA 5B64A 2N46A 3WP0A 4EFNA 4PSKA 3CWZA 2F6RA 3B8HA 5TY0A 2CK3A 4HDOB 2I3BA 1Q1QA 5IRCD 1TF5A 1IN6A 2CCKA 4Q1EA 1OIXA 5HE8A 2J0QA 3GQBA 4PO8A 2A5DA 3VR4A 5ANRB 2A5YB 5LD2C 3Q3JB 2IHBA 2JJ2D 1CU1A 3A4MA 3N70A 1R0YA 2ZRNA 3KUCA 1KDTA 1DPFA 3SYLA 4C9BA 4OJQA 1JPJA 4B33A 4IDHA 3QQ5A 1VCMA 2NO1A 3K70B 5DI9A 3A1SA 3CNOA 1KK1A 4UXHA 5TXGA 4D25A 1IOZA 3T34A 2O8CA 2IYTA 4RJLA 1KI6A 2WV9A 1QHHA 3BFXA 4M9ZA 4Q21A 1XB2A 1YRAA 4URVR 4KITB 4DLRA 2LKCA 3CNNA 1WBBA 3KKPA 2ZRCA 1G8FA 2QORA 1XMSA 1S4QA 1XP8A 3RLFA 3IUYA 3NBXX 1O87A 1E1QA 1Q20A 1Z6XA 5TDHA 3C5HA 4DCUA 1JXMA 2HT6A 2RGNC 3NDPA 4MGYR 2WSSD 3E1SA 1XNJA 3HWSA 1T6NA 1KY2A 1CJUC 3ZJYA 1TQDA 1G291 1KO8A 4MYTA 1DS6A 1D9ZA 1Q3HA 4FD2A 1EFHA 3B9QA 4KBGA 3R20A 3THXB 3VNUA 2YOFA 3ASZA 2O0HA 3KZ1E 2QGNA 2W83A 4A0RA 1OXTA 5CB6A 1VIYA 1NY5A 3DM9B 5JRJA 1GITA 3TW4A 3THYB 3DEFA 3BIFA 5ELXA 3B5JA 2HF9A 3L0PA 2A5FA 3LX8A 2BIFA 4LJ6A 2ANCA 4LPKA 1OKKA 2PEYA 4I81A 2OFOA 3QXXA 1SVOA 4MKIA 4QJ5A 3ZGXA 1HEIA 1MRNA 1NN1A 1QHNA 2DHRA 1O3YA 2REBA 3A1UA 4UXIA 4TYNA 4XWKA 4RD6A 1G17A 1NIJA 2HLDA 1PUJA 3LLMA 3PUVA 3CKLA 4BFYA 3A36A 1E2KA 1KDRA 4KVAA 121PA 4B43A 1MABB 1E4YA 2VHQA 2BBOA 3SN6A 2C9OA 3UK6A 2FU5C 1OFHA 1Z6GA 2RKOA 2V7QA 3B1XA 1EESA 4PX9A 4YMTA 4NBSA 4ZIRB 5K8UA 1E6CA 1NMXA 3PV0A 3OEEA 4W7SA 2ZE6A 2WJHA 1X8KA 4PO1A 4D4JA 4JSYA 2AD5A 2FX3A 3O8CA 3W3ZB 4B35A 3X1DA 2WICA 1R8QA 4FN5A 4PZYA 1JEDA 1SXJC 3EIHA 2W2VA 5TB5A 2V1XA 2GAOA 1IXSB 1ZUIA 2CCGA 4Q02A 1LTQA 4Q9LA 1LS1A 2HEIA 2PLFA 2OEPA 3FKQA 3TK1A 4DRZA 3B1VA 3B60A 3RS2A 2JLWA 2ZREA 1AS0A 2GEDA 1XTIA 3JVUA 3WMEA 2PMKA 2ONJA 4GMDA 1QF9A 3W8RA 5GJWC 2VSFA 2ZS7A 4G3XA 2G77B 1E0AA 3CX6A 3CRQA 3GLFA 1P60A 4MRVA 1UEIA 3IQWA 4ZKDA 1SGWA 3IIKA 4JLKA 2QPTA 4R9UC 1ZRHA 3WY9A 5FI1B 2ZS8A 4HLDA 3FE2A 4C0BA 4TL7A 4TQ9A 2CVHA 2GEVA 4TLCA 5EJEA 4M1WA 4OI0A 2JDID 3SDZA 5L3VA 4Q4HA 4B2LA 1JR3A 3AP1A 2VP4A 1II8B 3QSYA 1MO3A 3IEUA 1DE0A 4QXAA 1DAGA 1IJEA 2GRJA 5EE3A 3PG5A 3K70D 2A7QA 4IOJA 3RSOA 5HE9A 4FMBB 4RKEA 3WMGA 2CHVA 2H18A 1KAOA 3ZVNA 4IXNA 2JJ1D 4M53A 4E09A 4Q18A 3K09A 4HAUA 4FCTA 1FTNA 3I72A 4Z8YA 2IYQA 3B2EA 3HR7A 3FPAA 1E94E 3TQFA 2D3WA 4DIEA 2HT1A 1AQYA 3HDTA 2NO0A 4RZ2A 1RZ3A 3GLHA 3H4MA 2HCBA 3NBZC 2WBLC 2J0UA 2R6AA 3RDPA 4HDCA 5F9HA 1G21E 4A9AA 4YMSA 2ODWA 1T3LA 2IYYA 2X2EA 2J59A 3U3MA 4F4CA 4KFSA 1KK2A 3QPWA 2XJ9A 3UMFA 5JRZA 3CLVA 1S9HA 3KFVA 4KO8A 2J7KA 3OF5A 4AKHA 1P6XA 3VNVA 2R2AA 3P32A 2IX3A 3DMDA 1UAAA 1U8AA 2FSGA 1XF9A 4PPNA 2P6UA 3GJXC 2ZI6A 4AK9A 3LW8A 5P21A 1EFRD 1VG1A 4B48A 5H68A 1LS6A 2RGXA 1IN5A 3K9LA 3KJIA 3V4RA 2G1JA 5JCPA 1VHLA 3BORA 2FG5A 3AF1A 4Q1FA 1YZQA 5G41A 3SS8A 4TZ0A 3CPHA 1XMIA 1E4VA 1Z6AA 3VQTA 4DWJA 5FBQB 2FNAA 3EC1A 1RYFA 1W49A 5K8LA 3TBKA 4LBYA 1R5OA 4P4SB 2ZUCA 1ONBA 3VR3A 3SFVA 5C4MA 1YR8A 1C1YA 2ZI7A 5TVKA 1EWRA 4N3NA 1C4OA 1GNRA 3BRWD 2O8BA 1H8HA 3NG1A 4GZLA 1WXQA 4BWYA 4DCNA 1TF7A 3IGFA 4C0AC 4LV8B 4EFLA 4A8JA 5L3QB 1OE0A 3SI7A 2VP9A 2IYZA 2OCAA 1XPOA 1E1RA 1XD9A 3OE7A 2IYLD 2Q9BA 4R98A 4XVQA 2R6GA 3W90A 4DDUA 5KDLA 2HUPA 2X77A 1G18A 4XVRA 1V5WA 2JGNA 3SBDA 2P2LA 2ZJ2A 1ZM2A 1P3JA 1KO7A 4V0NA 1IM2A 1W0JD 2O8FA 4P33A 1YR6A 1SKYE 1U99A 4P0TA 3R7WA 1ZVQA 1CTQA 1VYTA 4MDEA 2QM8A 2E87A 2P0EA 2QTVB 4R7ZA 3I61A 3Q9LA 4A0FA 3UMRA 1QVRA 1UPTA 2VP5A 3QY0A 5B30A 3CWQA 4RD2A 4UNPA 3ZYCA 2AKAB 3TVTA 1LF0A 1E79A 2WOJA 2ZE5A 4M1TA 3U6KA 1G7SA 3TGPA 1R0XA 2B7CA 3E2IA 3AM1A 2RMKA 3UATA 2VEDA 4MUAA 2YWGA 4PC2A 1OV4A 5FH9A 3BK7A 1AS2A 4DKXA 4HZUA 3RC3A 3A37A 4A82A 5AUNB 3GLFE 1XEWX 4NCHA 2H8KA 3QKRA 3ETLA 2DFKB 2GA8A 2MSDB 1N5LA 1QRAA 3VR6A 2ZS9A 2VSOA 1NIPA 5KSYA 2QAGA 4LYHA 3I5YA 2B8TA 1P9NA 1W0KA 4HLUA 3ZD6A 3TH5A 1JR3E 1X8LA 1AGRA 1FFHA 2KI5A 4HAZA 1IONA 1KI9A 4HZIA 1ANKA 3KX2A 4AKEA 2W0SA 5LPNA 3TJZA 3SYKA 1G41A 4A15A 3W6PA 1F60A 4F38A 5C2JB 1YHNA 4R2IA 3CUEF 4TSFD 5DN6A 2PX3A 3KQNA 2CEAA 4JLAA 1P2TA 3T35A 3ZDQA 1FQJA 5FBWB 2GJ9A 4M1OA 2Q6TA 5JLJA 2GCNA 2OFXA 1UBEA 5LD2B 1ZMXA 2ZPTX 1PLKA 3IHWA 2VHJA 3GLHE 1E2GA 2VTKA 2GDJA 3AP2A 3ZZUA 4BLQA 1N0UA 3RS3A 3DO6A 4KSCA 2FSIA 3AVPA 3K0SA 1E2QA 4B76A 2P3SA 2W6IA 1OHHD 3D8BA 1U0LA 2PT5A 1ELOA 1SHKA 1P62B 5BYKA 3ZD7A 1D2NA 3ECCA 1LVGA 5SZKB 3NHAA 1Q22A 1RJ9A 1KI4A 1S1CA 4BRUA 2JLZA 2G0TA 3QKSA 4ACAA 2FFHA 1TNDA 2FV8A 4RVCA 2EWVA 4PSVA 1VTKA 1ZNYA 4WW0A 1LV7A 1TF2A 1Q0UA 3RNLA 4F7WA 3BH6A 5EE0A 4DB4A 2O52A 2DY1A 3LAWA 1DAMA 2BBWA 2QU8A 2Z0MA 2ATXA 2IHYA 1XXHB 3VHLB 8OHMA 5KPDA 2ZSBA 2ZYUX 1ZM7A 1ZIOA 1NBMD 2OT3B 2CL0X 4PHFA 2IUTA 3OZXA 1CS4C 1DBSA 4CEIA 3LBHA 3MLEA 1E0KA 5CLLA 2OV2A 1YRBA 2JA1A 2ZU6A 4HB0A 2NO9A 2NPIA 3QUSA 5LBIA 1DAKA 2XTMA 2QBYA 2J7PD 2X1VA 1H8EA 3MGCA 4TL8A 3U4QB 1AQUA 4HATA 1NVXQ 3GLIB 5JEEA 1A82A 1ZM4A 3E5HA 2W58A 2ZSEA 4RFSB 3J81k 2REOA 4WA7A 1D2MA 4C7OB 5FTNA 3A1TA 4XVUA 4IHQA 2WVJA 4HSEA 2WJIA 5JWHA 3ADBA 2EW1A 2ZR0A 4NZYA 3T12A 2GZAA 1GWNA 5EXTA 3W9YA 2EYQA 4OK5A 2Y8EA 2EU8A 4Q4AA 2XNDD 2EVWX 4XD7D 4E22A 4BFXA 5KUTA 3A8TA 2N42A 4ZDKA 1SXJB 2P65A 1EK0A 2ZRGA 3H0KA 5KDDA 5CITA 2ANBA 3PFIA 2A2ZA 4DZZA 5HKKA 4Q00A 1XBTA 1UBCA 2OBLA 3NKVA 4Q9HA 4F92B 2Q9CA 4ERNA 5JECA 1II9A 5F2EA 4QBHA 1FTSA 2GWHA 1ZUHA 3A1VA 3CRVA 1BKDR 4RSGA 3D6TB 1GP2A 1U90A 4KAXA 4C30A 4HUTA 2P5TB 5J4KA 4POAA 1DG3A 4LJ7A 2WSMA 3IQXA 2QA5A 2QRNA 1E9BA 3QE0A 4C0KA 1ZD8A 2XSZA 2QPAA 1YZTA 2NQ2C 4DUGD 2GF9A 1Z0JA 2CLDX 5JMTA 2H1LA 4BFUA 2CJWB 5E7IA 4ZCIA 1AM4D 3AVOA 1GFIA 2ORWA 4LHVA 5FPSA 1E9RA 4M9QA 2ZVQX 3EPJA 1R2QA 3K09C 4OQLA 3RHFA 1YZLA 3TIFA 2VQSA 1S0UA 1RPZA 3B82A 1L8QA 4EPXA 3QF4A 3CM0A 5FL7D 5IK2D 1QG2A 4EAQA 4JKIA 4TMXA 4W5JA 2RHDA 2QY9A 5BN4A 2VP0A 2KSQA 3Q7PA 5HR5A 3QKUA 4QC2A 4NH0A 1GRNA 1X1SA 4ABYA 3B1ZA 4NU0A 4C0JA 4JL6A 5JFGA 4PHGA 3DDCA 1HT1E 4AIIA 4DLSA 4NL4H 4D80A 3WHLA 1OFUX 2XB4A 3RS5A 5FFMA 2YJTD 1T8TA 3F5FA 3KFXA 4FMCB 3B9PA 4PAOA 4DIDA 1Z28A 3IBGA 3OIYA 1L7VC 2ZJ5A 1KI1A 3SJBA 4FXPA 2W6JD 3FKSA 4KI0A 4PC3A 3ZS8A 1XD2A 1ZP6A 5EP2A 4RZXA 1FQKA 3D7MA 5FBRB 2JAQA 2UKDA 5F3WB 2GCPA 1G7TA 2WJGA 4D4MA 1HA3A 4KYIB 1ZAKA 4AG5A 1ETUA 1P9RA 3CZPA 5J40A 2LWIA 1ZM3A 4PPGA 3QXSA 4CYMA 1QHGA 1KKMA 4QNMA 1XEFA 1AS3A 2ERXA 2BMJA 4LBWA 4XWAA 2YNMA 1IJFA 3QEJA 4M1YA 4DLVA 3TSOA 4CEJB 2VBCA 5E4FA 3ADCA 1E69A 4ACBA 4WAUA 3HYRA 4C4PA 4LWZA 3TKLA 4QGFA 1XZQA 4IFEA 4IRUB 5JHHB 1OFTA 1FP6A 4O2LA 1KGDA 2L0XA 2B21A 2WWHA 1R5NA 2J46A 1SXJD 3OAAD 4A6PA 2CE7A 3BAFA 3UPUA 2ZM5A 4AYWA 4ARZA 3NBYC 4JLMA 1GIAA 2QN6A 2QP4A 4GBMA 2XXAB 2OLJA 2YKGA 4N1AA 3C41J 3U7GA 3SU8A 2XZLA 5GJVC 1GAJA 1IHUA 3A4NA 1P73A 3U60B 2C9CA 3K0CA 1GM5A 2NZJA 1TAGA 1E3MA 4JLBA 1A7JA 3BB1A 3TNFA 3CPEA 3IDQA 4A6XA 1QZXA 3OFND 1Z0DA 3SEAA 4B3XA 1NVUQ 5FPHA 3I5XA 1T91A 2NIPA 2C9YA 2KBFA 1BH2A 2NGRA 2VHTA 2ZRIA 3O47A 1UBFA 1XEXA 3I62A 3NEJA 3IPXA 3TSWA 1QVAA 4FIDA 2H5EA 4OQXA 1FL9A 5FUVA 4YXWD 1T0HB 3KXKA 4US2R 4DT1A 3WNCA 4BGDA 4EUNA 2ZJ8A 4KFRA 3V4FA 1JALA 5JWOA 5KSOA 4W9MC 1DAHA 2LCFA 4JBXA 4JVMA 3WYGA 2IF0A 2CDNA 1R6BX 2JLUA 3SQXA 3C16C 1N6IA 5DIFA 1D2EA 4OHWA 4AC9A 1B0UA 1GL7A 2DFTA 3Q8XB 2EFCB 2F43B 2GEUA 1N0WA 4MRSA 1GRRA 3C5CA 4GZMA 4ESHA 5JJLA 1E9SA 2XOKD 2QZ4A 4CIDA 4O3MA 3G82C 2FDCA 1R8SA 2A5JA 4OL0A 2RCNA 4QGAA 4DCVA 1XWIA 1KNXA 2XTNA 5KDOA 2IS2A 5CYPA 4GSYA 2Q9AA 4NYJQ 1TQ2A 3NHBA 3GJ8A 2H57A 4OBEA 4M21A 1WF3A 2HCJB 3GP8A 2QMEA 4TL6A 1MR3F 4A0GA 2JIZD 2XZOA 4QJ4A 4Q7LA 5D3MA 3OIWA 2R6FA 1M74A 4TMKA 5J4VA 3K0FA 2IYSA 1S96A 4BLRA 4DDVA 1R0ZA 3VFDA 1KIMA 3AP3A 4PZZA 4H1VA 4NPHA 3FB4A 1VCOA 2WOOA 1LW7A 1WBDA 1KSFX 2PMDA 1CRPA 4BLPA 4R71A 3DZ8A 4Q4JA 3GPLA 5CDFA 1Q57A 2HYDA 2KB0A 3FDIA 4YLGA 2OESA 3AVVA 4B73A 1I4DD 1UJ2A 2OHFA 2V55B 5KTYA 4KSBA 1U2RA 2WPDA 2GJKA 1RFLA 5EXSA 3LVQE 1KI6B 1ZJ6A 4FMCF 4PSAA 1TX4B 4Q7MB 1ZD1A 3I8SA 3LVRE 3PVSA 2GXUA 5DH9A 1N25A 5K8TA 1T4GA 4DC9A 5DLQC 3AGQA 4D26A 2C2HA 1ZCAA 3SQWA 4LSGA 3OIUA 2ZXUA 2JASA 1QHIA 5FBLB 4NCKA 721PA 5KPJA 3QNUA 3B78A 4TLDA 1G19A 1N6OA 1V43A 3QEOA 2J45A 4DHEA 5JJKA 4B3DA 4JLPA 4O25A 4URXR 4JS0A 5JS8A 4ASUD 3I32A 3KTAA 4HI0E 3PUXA 4RKFA 3CF6R 3KQUA 5G53C 1L4YA 2P5SA 2WKPA 2FWRA 3X1WA 2AR7A 1M34E 5HTKA 3ZIAA 1M1YE 3GEIA 2CBZA 4LHYA 4BECA 3MJHA 2ZRKA 4QNRA 1F2TA 3CRRA 4DLWA 2FN4A 2VF7A 1AGPA 3WHKA 1I4TD 3QJYA 1UKVY 1YU9A 3CZQA 1IY1A 4UJ5A 1WRBA 2Z4RA 1G4UR 1MO4A 2ZYVX 1YR7A 3LX5A 1UEJA 1XCMA 2WKQA 3MAAC 3OEHD 4FCWA 2FFBA 4ZDIA 3ICQB 3GJ6A 1COWD 4RD0A 1Z0AA 2BVNA 1XZPA 1U9IA 1G3UA 4MGZR 2ZI9A 3B13B 4DB2A 1TUEA 2B92A 5CK5A 3QVUA 2NMVA 1SKYB 2K5UA 3QG1A 1GDDA 3RANA 3AB3A 4C0QC 1JJVA 5DYGA 3U2QA 4H9GA 2AL7A 2GZDA 1HURA 4XWOA 1K8RA 2OBMA 3OIVA 2D74A 2QRZA 3BD9A 4N0DA 4NCNA 1MOZA 2WWWA 4X8MA 3EZ7A 1W47A 1VG9B 2AK2A 4TZ6A 1HH4A 3FOZA 3VU9A 2P6RA 2J1LA 1E9DA 2CNWA 2G6BA 2GETA 3SJZA 1YKSA 3AV0B 3TE6A 3BB3A 5JJIA 4G01B 4IOMA 4JT4A 5DI3A 1Z63A 1NVWQ 3GLFB 2QSYA 2F1JA 4TQUS 1AKYA 4G1UC 1ZW6A 2JLSA 1YZUA 2KE5A 3BE4A 2FSHA 5IHPA 3T1OA 2QGZA 2V4ZA 4OK3A 2CK3D 4U02A 2B7BA 1Z6TA 5GVRA 3PEUA 2CHQA 4QBGB 3IBYA 2GJ8A 3IO3A 4Q4HB 2JATA 2BWJA 5CM8B 5CIWA 4TYQA 3IEVA 4JKYA 2ODNA 1KMHA 2CLSA 4TTRA 1W0JA 4EDHA 1NLZA 4B71A 4PPFA 2ZRBA 3VR2A 5L3SB 1T3SA 1L2TA 1UKZA 2OILA 1KZGB 4RD4A 3RRYA 2FZLA 2QM7A 2R65A 1LF5A 4BE7B 5FL3A 1KSGA 3DOFA 3KJHA 1M6NA 2Q0HA 4DJTA 2D4HA 4LJAA 1W7AA 1CIPA 1KJWA 2DR3A 2BOVA 4M1KA 5KYKA 4GOJA 2Q3FA 1GOTA 4LYAA 5KNBA 3ADDA 3F3YA 1Z0FA 1SULA 3UWOA 1VPLA 2Z43A 2H17A 3GLHB 5CDFE 3L82B 1SVSA 2J0UB 2RH5A 1YE8A 1GNPA 2DWPA 1U0HC 3HPRA 3KL4A 4QHSA 4LHXA 2F1HA 4IEIA 4B47A 3NDBB 4P31A 5EE1A 1N6NA 3O8BA 3HR8A 4Q1AA 2IUUA 4UJ3A 4A2WA 4KHZA 2GBLA 3LV8A 5A5GA 3FFAA 1X8JA 4YC7A 2WAXA 4ZKEA 1ZCBA 2NPFA 4EFMA 1RVDA 3AVQA 5LDDC 1NMYA 5JBQA 4PHHA 1CJVC 3FMFA 5J4YA 2C78A 2EFGA 1S2MA 1Z06A 2DPXA 1OKKD 2ZRJA 1J70A 3RWMB 4A36A 1EX6A 2BBTA 3LBNA 2CCJA 1NY6A 2HLDD 2R44A 1AJEA 3DM5A 2ZIAA 3CR8A 5LB2A 1M8PA 1HQYE 1K5DA 3IKJA 2V7QD 2WJYA 2XGJA 5FR2A 4Z1MA 4L16A 4DXAA 2G3YA 2QSZA 2G9NA 2QE7A 2BMEA 3KKMA 2GXAA 3OEED 4KJZA 1HE8B 4BFZA 3LD9A 2O8BB 4PXAA 3KXIA 4PAQA 1E2LA 4A8JB 1E2JA 1ESMA 4NYIQ 2IYXA 5D3QA 1N6PA 2YOGA 1P72A 3GJ7A 3IIMA 1KO4A 3KB2A 5EE5B 2QG6A 1OW3B 2YC4C 5AR1A 2V9PA 1AA9A 2ZR9A 4FWIB 4Q4LA 3ND8A 3S1AA 1EXMA 1J99A 1FMJA 3EXAA 5CM9C 2CVFA 1UBGA 3GEHA 5FTKA 1S8FA 2O8FB 3FVQA 5FOWA 3X2SA 3Q5EA 1QHYA 5FPTA 4M9SA 3UG6A 2O8DA 1Q1EA 2DCUA 2CLCX 1G64A 5KHOC 3KKNA 1E2HA 1NLYA 5L3QA 4WBSA 1XPRA 2KBEA 2A9KA 5JEDA 1EFUA 1G1MA 4BFTA 3MJRA 1WE2A 2H92A 5B58C 3LH5A 2QI9C 4X8HA 4TL9A 1KSHA 2C99A 3EG5A 3MCAA 4E5UA 3BGWA 2BCGY 1JR3D 4IDPA 1YZNA 4QKQA 3TUJC 5DO9A 2RHMA 3K9GA 5DHFA 2CL7X 1FW6A 4HZUB 4YONB 5EP3A 3EW9A 1N0VC 3FTQA 2XTZA 3NIBA 2HV8A 4O0MA 3JZMA 3P27A 2OZEA 4DEXA 4F93B 2BKEA 5AUOB 5HCNA 1TADA 3C14C 1TEXA 2FSFA 2PBRA 4IDNA 4IKEA 3T1VA 4BFWA 3ZLJA 1G3QA 3AVWA 3LA6A 1G16A 4D0NA 4TT3A 4KXFB 4KFTA 2FFQA 2FEOA 4LV5B 4BPBA 4TYYA 2QMUA 2DWQA 2XJ4A 2XEXA 1GL9B 3LBIA 4II7A 1N5JA 4C0HA 3P1JA 2REXB 3VHXA 1Z22A 2FEMA 3NBFA 1N6KA 2D2EA 1BYUA 3CB4A 3L8YA 3FHOA 1W36C 1Z6YA 2AHOA 4LDJA 4B6FA 1VCNA 4TWZA 1CF4A 1ODFA 3BB4A 2WJJA 3DOEA 3ZZ0A 1W5TA 2QNRA 5UKDA 1Z07A 4UQOA 2FE4A 4MGIR 2R9VA 1KOFA 5E7JA 4US1R 3RWOA 2WMNB 3L0SA 4YDHB 1CJKC 2CHGA 3CF0A 3VKGA 3A6PC 4GP7A 3O8DA 2PT7A 1YVDA 3CIOA 1IN8A 1TU4A 4ZO4A 4M22A 2C03A 1MKYA 4QFMA 3AF4A 4LCBA 1AK2A 3HU1A 1RJ9B 3VMFA 1W4RA 2O5VA 4TLAA 4BLSA 3I73A 2TMKA 1OT3A 2IYUA 3VR5A 4IDQA 4PFSA 3LY5A 1G5TA 2BM0A 1KJZA 3CF2A 2WJVA 2ZSFA 3QKSB 1VDZA 2ZE7A 3Q5DA 4X8LA 1H8HD 3LDAA 3T15A 4MYHA 4PO9A 4RD1A 3REFA 4URZR 3U44A 2OUKA 2JCSA 2YWFA 1GL6A 1DO2A 4AYXA 3UWKA 1F6BA 1TQ4A 1GKUB 5H8WA 4WXPA 1VECA 3AQ4A 2IC5A 2OE2A 4A0HA 3X1YA 1E1RD 1XTSA 3OE7D 4KVGA 1NG9A 2P6NA 3DZDA 3TSZA 4KYUA 1G9XA 4JL8A 1D8TA 2AWNA 2Q21A 2Z83A 2OAP1 3KKOA 5AJZA 5C4GB 3TUIC 3UXMA 5AUPB 3U61B 4NYMQ 5DGXA 4CEIB 1U8ZA 4HAWA 4D0GA 3SBEA 1RE0A 4BFSA 4G5SA 3THWA 4B75A 4DLUA 2RGNA 1FX0A 2PL3A 4FMDB 2QBYB 4BEJA 3ND9A 1IAQA 1Q3TA 3UMSA 3PITA 1AZTA 3OHMA 2W0MA 4OJKA 1E79D 5F9FA 1HTWA 1UDXA 4G5RA 1U9IC 4A2PA 1KNQA 5HPYB 3RS7A 1OXXK 3X1XA 3BWDD 2V8OA 3GFOA 1TUIA 1E9EA 1I2DA 4A4DA 3AVXA 4A1FA 2ZI4A 3LRPA 4LJ9A 3BOSA 1NN5A 2WKRA 4A92A 4XIGS 1HY3A 1DVRA 2OCBA 1KI2A 4LV6A 1Z2AA 4L5BA 4M1MA 5KOYA 3K0EA 5IDVA 3TRFA 5IT5A 2YV5A 3FWYA 3MRSA 1Q1ZA 3WYFA 3R8FA 5EE9A 4OI1A 1XEWY 2F3TA 3U3OA 3WNBA 2GCOA 1Z0IA 2QT0A 4OI2A 2FPMA 2ZVPX 5FR1A 3GLIA 4B2PA 3KUDA 4OQNA 1E2IA 1T5LA 1W0KD 5EQTA 1J2JA 1US8A 3BFKA 4Q03A 1OYYA 5AK0A 3IPYA 2RGEA 4QM7A 4MGKR 1J90A 3K0AA 5FI0B 3ZZTA 2ZQ5A 2ZRPA 2VA8A 3IILA 3EWAA 4P32A 4C3ZA 4RCYA 5FOXA 3BJIC 3U3JA 3CH4B 5DN6D 1WQ1R 1AIPA 4OI4A 3KKQA 821PA 3V9PA 4W5WA 1KHTA 4MYCA 2J41A 3BFVA 2C04A 1DTSA 4LJ8A 1MRSA 3RAPR 2AK3A 621PA 5CIQA 1XTKA 4Q19A 4B3FX 3NH9A 2QTHA 1OH5A 2IS4A 4XJXA 3AKEA 1JI0A 1MO6A 2W6ID 1S3SA 1XCGB 4AG6A 1N5IA 2J0SA 1HYQA 1E9CA 4GPTA 4Q48A 3M0EA 3QG5A 2JJ8A 2KJQA 3FMOB 3LXRA 3W5IA 2DB3A 2ORVA 3QF4B 5DHAA 3EASA 1VCIA 4URWR 5SZIA 4DEYA 1G20E 4QBFA 3HJNA 2QP9X 2YHSA 1RKBA 5BN3A 4NKRA 1U0JA 4DSUA 1G8PA 1JPNA 2ZJYA 3SE0A 2P67A 2ZTSA 3G5UA 3I3SR 3U3KA 4OQMA 4JSTA 2VO1A 2V54A 3VKHA 1NN0A 3IIJA 2IL1A 1C9KA 1A2KC 1NI3A 2VIIA 2ZRMA 1BMFA 3B6EA 2DFLA 2J9RA 2FA9A 2WWXA 2YINC 1F2UA 3FFBA 3GJ4A 3HPQA 1OXUA 3EIEA 1DEKA 4GMXA 4H1UA 4L4UA 5BQ5A 3P26A 4DLZA 1W1WA 4HB2A 1BOFA 1XTJA 2QEQA 1OJLA 1UFQA 2ZANA 3VX3A 4D0LB 3U5ZB 2ZRDA 1XD2B 3U7FB 3FHCB 2A5GA 1SVLA 3C7KA 1U8YA 3SFZA 2QQEA 3LXXA 4EIWA 4KODA 3WXMA 4NTZA 4Q9KA 1E0JA 3REGA 3EZ9A 4X8OA 1FPMA 2XX3A 3LLUA 1IXZA 4IJMA 1DO0A 1H8ED 5FUYA 4QOSA 2ZYTX 3RRNA 2EFDB 2FGKA 2QL6A 3W3AA 3VAAA 2AWOA 3H1TA 2PJRA 1P2VA 5HZHA 1NLFA 4LJ5A 4PHTA 3VX4A 2YOHA 4LBVA 3TAHA 5SZJA 2D06A 2IA5A 4EQ6A 2JJ2A 3GJ5A 3GLGA 3SHWA 2IYWA 3ICEA 3R8CA 4A8JC 4G5OA 5JSZA 2IXFA 4FMDF 2G88A 4M8NE 2AN9A 3X1ZA 1IY0A 3PQCA 2OSBA 2C77A 2HXYA 221PA 4RCZA 5G40A 2I4IA 2WHXA 4Q47A 3UG7A 5DSZA 4TLBA 3M6AA 4ARZB 5HKKD 1NG1A 4GOXA 3FMIA 3PENA 1CRQA 5E3HA 3M1IA 3MD0A 1EX7A 1G7CA 1TU3A 5FUXA 1W44A 3D3QA 4QM6A 4IEEA 2WZQA 2MSEB 1F5NA 2QT1A 4Z51A 2WWFA 4BASA 2YWHA 1E2MA 1LB1B 3MSXA 1G7RA 4MKFA 4B3CA 1UF9A 5J4HA 2X8AA 4IFBA 5BWMA 5F98A 2WSSA 2ZI3A 4JBYA 2RGCA 4V0KA 1ZU4A 4PC1A 1A2BA 1E2EA 2RAPA 4XH9B 1N6RA 1NP6A 3SNHA 1IN4A 4QBIA 2D7CA 3PEYA 1BO6A 1D5CA 4LX0A 1KO5A 5FOUA 3HU3A 4LUCA 2C98A 1IN7A 4TTPA 6Q21A 3G0HA 1ZNXA 4EPVA 2XSZD 4ZV4A 1VMAA 4XTRA 4DT1B 4IOKA 3QBVA 1A1VA 2ZR7A 3MUFA 3PIRA 1CKEA 5AWFC 3PEWA 4CEHA 2ZEJA 4JLJA 4ZI3A 4XSGA 2CE2X 2Q3MA 2SHKA 3I4LA 4FW9A 1VKJA 2X2FA 3QVVA 1ZD9A 3RABA 2QMHA 2ORIA 1ZNZA 3AGPA 1ZINA 1WA5A 1E99A 1EFTA 4L9SA 4MUBA 2QAGC 3K9HA 4K46A 4LGMA 2ZJOA 4EJSA 421PA 1D9XA 4KLNA 3DL0A 4HLUC 1KZ7B 1MT0A 1OXVA 1SVWA 5KO2A 2OM2A 4Q7KA 3F0TA 1LNZA 1KI8A 1NRJB 4JLVA 4L8GA 4MDFA 2WTUA 3SYNA 2JLVA 4WZBE 4PAMA 2IW3A 3KJEA 2V3CC 4CVNA 3TR5A 5FUWA 1EGAA 2IF2A 1G3RA 4TQAA 5D3MB 2QROA 5CYOA 2GZHA 3K0FB 2O8EA 1ESNA 4OHXA 3T06B 1W36B 1M2OB 1KI3A 2NO6A 2C5LA 2PZFA 1GNQA 3TMKA 4HUQA 2PCLA 3K53A 1VHTA 2I1QA 2I1VB 5FPYA 1CLUA 4LYJA 4Q4JB 4L15A 1Q21A 3B1WA 5SZHB 3NC0C 3FKSD 4D6PA 3H84A 1SVMA 4LHZA 4DDTA 2AXPA 2W00A 4FINA 1Z8FA 1GVNB 2OFWA 1E2DA 1G5PA 1NSFA 4HDQB 4PQRA 4F4JA 1HV8A 2ODBA 1E2PA 3PUWA 2O8CB 4KV9A 1QHHB 4CW7A 1D6JA 4JLDA 3GFPA 2IWHA 1Q1BA 1P4SA 2DBYA 3HP1A 1G6OA 3AF0A 3MWLA 2JDIA 2Z4SA 3N2IA 4LPSA 1XCPA 3NTUA 2EWWA 2B6HA 4JYBA 3VKWA 5JHGB 1VG8A 1FMLA 1Z08A 1M7HA 1T9HA 4TYPA 1VIAA 2QP3A 3WP1B 1CXZA 4F4IA 4Q1BA 1JNYA 1X3SA 2GVZC 1KMQA 3U3RA 1HUQA 3CRW1 1MH1A 3KTAB 4MITA 4OK6A 4UNNA 4DLYA 5BXQC 1IY2A 2A78A 5KNCA 1XJ0A 4L9WA 1W2GA 2QENA 3RVBA 2JJ1A 2PCJA 3WBKA 4OHZA 1OLOA 4DSTA 5M04A 1OSNA 1NKSA 4IW3B 1W48A 4NCIA 1Z83A 3AEZA 4Q7JB 4JLOA 3CH5A 3WNDA 2YYZA 1F2TB 3RSLA 4LJYA 4LY6A 1YR9A 5DYIA 1WDTA 4EKDA 2D7DA 1B23P 3GLGE 4NYIR 1DAEA 1CJMA 2Z6VA 3BH0A 2LKDA 3WRXC 4C0SA 3QIAA 4HLCA 3EPKA 3N2EA 3EX7C 2XNSA 1KTVA 2BJVA 4DLXA 2WAYA 4B2IA 4DBLC 2IYVA 3THXA 1XTQA 4IVRA 4PC7A 3MFYA 3IHLA 5J5CA 3KQHA 4BUJA 4PPQA 1XMVA 4P4UA 3THYA 3A58B 4OHVA 2MMGA 2UZIR 2NTYC 2OCPA 4NDZA 521PA 1NF3A 2GXQA 2JLXA 1EFRA 4AWXA 2XZPA 4BZXA 1QHSA 5EUMA 4WZAE 3QXHA 1NVVQ 4D4KA 2ZJZA 2IS6A 3FHTA 3TVDA 1MABA 3CRMA 4DLTA 3WRYC 5H70A 2WWGA 3D31A 3PJRA 1EFCA 2NZ8A 2PJZA 1PZNA 3NVAA 1GKYA 1KSJA 2PX0A 4MKGA 3VU9B 2DFNA 4Q9IA 2MSCB 2HJVA 3AVUA 4DCTA 4V0MA 4M2LA 4ZIRA 3TLXA 5DI3B 4TN1A 4B32A 5G3ZA 2BMDA 1E2FA 4TMZA 2EQBA 4QGHA 1IQPA 2RB4A 1P2SA 3CBQA 3CX8A 4I1OA 1OFIA 3TR0A 2ZYWX 3SJAA 3JZAA 1W36D 3DMNA 2GKSA 4JJKA 3EARA 1KY3A 1E96A 5FOVA 4ON9A 1NNEA 4CGZA 1JJ7A 1OPXA 5B2ZA 1KMHB 1CR2A 1W4BA 2RGDA 4G5QA 1PV4A 1KDOA 1MV5A 1JXOA 4ZDJA 1OB5A 4V0LA 4MRRA 3O8RA 1SKQA 4D4LA 4LYFA 2WPDD 2GXSA 4BLOA 2RGBA 2V6IA 2OG2A 3RYTC 3MWJA 3K1JA 3W6NA 4KFUA 4TLEA 1DOAA 1XD8A 1X6VA 1RIFA 1MO5A 4JZKA 1DAFA 4HB4A 3PUYA 1OIVA 1T3HA 3PUZA 4GOKA 3I1FA 1E1QD 4YQFA 1II8A 1H65A 2JLQA 4KU4A 1E0SA 1I2MA 5L3SA 4ITRC 3FYHA 4F91B 2OO7A 4LJ4A 3QKTA 4NE2A 4TMVA 3EWSA 3TAUA 2GJSA 1BS1A 2PLRA 4YMWA 3DVLA 5CK4A 1QBKC 4JVNA 3WYAA 4TYWA 3QENA 1JBKA 4GFDA 3ZIAD 1A5TA 4QHYA 5EXPA 2BEJA 1G8YA 3SOPA 5IF9A 1Y3AA 5HCIA 4BEBA 4S35A 2FZ4A 3GFTA 1S3GA 2OBNA 4JLNA 4HLQB 1XFAA 1UADA 3NH6A 4BLTA 4QRHA 4S2EA 3AKYA 4PZLA 3KQLA 4WXRA 4Q66C 5K8IA 4CRWB 4IVPA 1W46A 4DSNA 5FBVB 1LY1A 4LK2A 4Q1DA 1ZYUA 2VL7A 3LNCA 4TSFA 3LO5A 1PVOA 1ZIPA 5BYJA 2GILA 5FTMA 2VSXA 1G3MA 2WWYA 4B44A 3HYTA 1J8YF 1PLJA 4R2HA 1OF1A 4NYMR 3L0IB 3MG9A 3L43A 2G0NA 3SHFA 1JAIA 4B3BA 1OXSC 2KWIA 2BM1A 4TMWA 4B74A 4M9XA 5DNYB 5FOTA 3RRZA 2IS1A 2F1IA 3HU2A 4RFVA 3TW8B 4B3GA 1YQTA 4P4TA 4CZ2A 4LZZA 4XTCS 1OHHA 4AKIA 2EYUA 3L8ZA 2VPPA 2R6CA 1NL3A 3ASYA 1XX6A 3S1AB 3QPVA 2GJAA 3QOFA 1KO1A 4P4SA 2J87A 2C8VA 2CNWD 4D82A 4MA4A 2ZUBA 1JEEA 4HAYA 3R7WB 4ZCMA 1JQLB 3K0CC 2O8DB 4RY2A 3C15C 4OHYA 2FPKA 3SC3A 5CJ2A 1K6MA 2BJWA 3AKCA 3EPLA 1U81A 3NXSA 1G4AE 2IEZA 1T0JB 2BV3A 1DELA 1RYHA 1FUKA 2QTFA 1E9FA 3MWYW 4M0LA 2WIAA 1Q12A 4YMUA 1DARA 3ZVRA 1XJQA 3IO5A 1NBMA 3Q72A 2YVUA 4V0ME 3CO5A 1TQ6A 4IDOA 4G0NA 1E2NA 1HQCA 2D2FA 2HDNB 4W5HA 1NJGA 2CL6X 4RZUA 5KNDA 4RD3A 3KXLA 2ZROA 1G8HA 1BYIA 2FF7A 3QKRB 2JEOA 1BIFA 3UANA 2FJUA 1F48A 2J5XA 2J7PA 4FWTA 4EJSC 2W2TA 4V0OA 3NEYA 3MWKA 3B1YA 3AF2A 1R0WA 5E7MA 2QAGB 5FTLA 4OKSA 1WMSA 1Z2CA 2IT1A 3VR1A 1L4UA 1SQ5A 3W6OA 3BS4A 4E07A 5C1BA 2FMXA 1S9DA 4PQFA 2IBMA 2QUZA 2UVQA 3UIEA 1NSTA 2F1RA 5A4JA 4GT1A 2GF0A 3A4LA 1J7KA 1LFDB 1KK3A 1P5ZB 2XNDA 2IWRA 4XD7A 4Y0AA 4KBFA 4WOPA 5GJCA 4D2IA 3WBJA 2R62A 1ZM9A 1P75A 2WWIA 3K9NA 3LQQA 4G5GA 5J4LA 3CR7A 4IVQA 4N0EA 4GDFA 2DYKA 3AF3A 3PEVA 2C95A 2IYRA 4I1VA 1W4CA 3QBTA 2E9SA 5TMPA 2ZUDA 4MQBA 3NWJA 2MMCA 2ASEA 1AKEA 1KJYA 1T5IA 2ERYA 4JMPA 4Y0VA 3GD7A 2A3RA 5CLQA 3GJ3A 2N1BA 3BXZA 5EUQB 4GRAA 1QHXA 2BCJQ 3DKVA 4Q01A 4LHWA 2HJGA 2G1KA 3B7GA 5A0FA 1CBUA 2R8RA 3T5DA 2FGJA 2VH5R 4TTQA 4Q1CA 4U00A 1N2CE 4QHTA 2RGAA 4Z1MD 2AFIE 3C8UA 4CDGA 2QE7D 2PZEA 4HAVA 1KYIA 1ZU5A 4GL2A 1AZSC 4DUGA 3U44B 1NKTA 2D62A 2F7SA 1TEVA 2ZRLA 5LB4A 4Z8XA 4RZ3A 1II0A 3K70C 2IUSA 5HZKA 3H86A 3RRMA 2V1UA 3B85A 3KQKA 3DHWC 1P9WA 2ZE8A 2ZRAA 4M4SA 3BH7A 1PUIA 1VYUA 5KSZA 1IXRC 1RRGA 1WCV1 4EPYA 2GK6A 1DAIA 3THOA 3V00A 4WZ6A 1R4AA 2F9LA 3WMFA 1NN3A 2QQ0A 4URUR 3ZVMA 1N5KA 3ZQ6A 2GVDC 3MMPA 5FL7A 5IK2A 1CR4A 4U5XA 1AN0A 3EZ6A 3BC1A 2WM9B 1UM8A 5C18A 1OH8A 5G3YA 4B34A 1G6HA 4PTLA 5GADl 3THWB 2BKUA 2G83A 3AUXA 1EWQA 5GJBA 1CJTC 1FX0B 2ATVA 2V6JA 2VF8A 4ZDWA 4AY2A 1JQJC 1UDWA 4DSOA 3EIQA 1HT2E 1ZC4A 1G3IA 3P20A 3QI2A 1T8UA 4QG7A 1DADA 3EC2A 1RRPA 3KDSE 1RC8A 4JL5A 2OXRA 2OLKA 4US0R 3F8TA 4NHOA 1ZC3A 1GTVA 1XXHA 4IXMA 5DISB 1PLLA 3PR1A 1SHZA 3Q7QA 1FOEB 3ZS9A 2IXEA 2W6JA 3M4YA 5AJXA 1WP9A 4ILEA 4EPRA 3CPJB 3W34A 3ONWA 1TMKA 4Q4AB 2BMFA 2ZRHA 3QXCA 4GNKA 3BBPA 3LWNA 3UKDA 5BN5A 1GKIA 1UKYA 5AJYA 1YZKA 2AD1A 2GCOB 2XITA 4DVGA 3TQCA 1N6HA 3U4QA 2ODEA 2PEZA 2VHUA 5EP1A 2IEYA 3T1QA 1US8B 4HYYA 4TT3D 1Z0KA 3SZRA 1Q44A 4EPTA 2E1RA 4JVLA 4RFSA 4NONA 4WIAA 5AUQA 2HF8A 2OXCA 3W5JA 5JI3E 1M7BA 1NBME 4V03A 3R9WA 3K0AB 4C7OA 1GILA 1P2UA 5FOSA 2H16A 5FTJA 4MRNA 1E9AA 1KK0A 2VYFA 1XTRA 2R6DA 3DKPA 1XU4A 2BEKA 1PJRA 2GHIA 1OIWA 2X19A 4LRWA 4QJ3A
chains in the Genus database with same CATH superfamily
4GBJA 1W25A 1L4EA 2V3WA 3DF7A 3G02A 1Q7CA 5K3SA 4ESEA 1D4AA 1BMTA 1MQSA 3OAAA 3Q10A 3F98A 4G85A 1USIA 4JIMA 4V3BA 5HK8A 5JSKA 2EBWA 3OQHA 1H2XA 2QE6A 4FU0A 3Q8WA 5DXJA 3G2MA 3RS8A 3ZJTA 2YJGA 3L8FA 3L92A 3ZWOA 1VMDA 1AXGA 1R37A 3CT6A 2CKDA 4ZVUA 3SBXA 5BO5A 2ZITA 4B6EA 3V2IA 2C1ZA 2SKCA 3MTIA 1YI0A 1J9GA 4DCGA 1SN7A 2FOLA 3GMTA 3KVYA 4HEA6 3OQMA 4ZCSA 2X5OA 2Q4DA 1IZ7A 1GUAA 4I4LA 3GGSA 4G86A 3VTFA 1JR6A 3E4CA 3PQDA 3PX7A 4S1VA 4PBTA 4UHCA 3CRZA 1Y89A 2JEYA 3HK2A 2NU6B 1U1EA 3JSXA 3EXG1 2X40A 4UKDA 2PUDA 1L5SA 2CLIB 3O4HA 1R4ZA 2WTAA 3IUSA 1V2HE 1X8XA 2WMOB 4R2WA 3HNPA 3PYXA 4HPXB 1XRMA 4UXJA 5E3IA 4BMVA 4YXWA 3RTAA 1IOVA 4J16C 3P0FA 1TOAA 2OSVA 2P9YA 1SVIA 4P4GA 4WKNA 4AXXA 3E2MA 3DB2A 3ZZ1A 1AUQA 2GSWA 2HBZA 1U6KA 2OBFA 2Z1NA 3G2KA 2HIGA 3SP1A 2QN9A 3AJDA 2WUVA 2ZAMA 2XLCA 3KUKA 4OG2A 3S81A 3OCJA 2FCRA 2GBLC 1ACMA 2X5XA 1NMZA 4JBWA 4IGAA 4IXDA 5BUZA 3TNLA 1OX4B 2GESA 3EB9A 3RW9A 2VP6A 5JXJA 4OMFG 4QNNA 4B7AA 4URYR 2XOKA 4QQFA 3ODGA 2CFRA 5KSPA 1PS0A 3IAUA 2WG0A 3L07A 3PJGA 5B7NA 5JI2E 1F0NA 5JZSA 1MC5A 4AI6A 3TDNA 4PQEA 1WVGA 4Y7DA 3DC7A 2H2IA 1RWNA 3GCZA 4KI7A 2H5IA 2O1EA 1RKXA 2Q5QA 1X7ZB 2JBAA 3RVJA 5KWSA 1WETA 2CLFB 3R9KA 1XK7A 4DC0A 5M5BA 5JNLA 2PZGA 1BKSB 2JIZA 4MKZA 4E51A 2Q4BA 1J20A 5DNWA 2H1IA 2WDPA 2Z2JA 4JSRA 3J7AC 2GN9A 4PQYA 3DXZA 1R3UA 1WB9A 1FRNA 3L8EA 1NXXA 1EUDB 3GH1A 2YZ2A 4LXTA 4DLAA 1WHTA 1I4LD 4ZCLA 2OD7A 2ZYAA 3RGGA 1TCBA 1Z2PX 4F0JA 5KTSA 2ZRFA 2A4KA 5U1PA 2FFAA 4P34A 3X1JA 5AI0A 1UXOA 1IE3A 1JFSA 5HW0A 1K7CA 4WRRA 4BQIA 1CR0A 3GLGB 1BDIA 4TT8A 2IY7A 4K81B 1C3LA 4MHTA 4ZAXA 5D1HA 3VMMA 2ZAOA 3ZV3A 1E3SA 4E5DA 4IF4A 2CXTA 1HE4A 4TMTA 5SY9A 4IINA 4QFBA 4UD2A 1VG0B 3DEZA 1UIRA 5ECYA 2ZWVA 2P41A 1JHMA 2VWPA 4KOAA 5E95A 5LU9A 4OL9A 1SHLA 3M81A 3H13A 3IDSA 1AUOA 4YT2A 2RK3A 1YJCA 1JTVA 2NAFA 2ZU0C 4GP6A 1V9SA 3IP1A 4AULA 5IUKC 3TZHA 1YQXA 1T9GR 4KQ9A 4MMZB 3LFUA 5L45A 1XXHE 5JS7A 1H2FA 1DJPA 2PHZA 3ID6C 3TL3A 4BZPA 1XNGA 3OURA 4FKMA 4UTNA 2A59A 1R7RA 4PC6A 1NU8A 2G9VA 3N8HA 4N3GA 2F9MA 4N5HX 3GLRA 3OESA 3HS3A 1LFAA 1U2GA 1Z5UA 4MV0A 4P58A 4IIFA 2VJPA 4WZAB 1MEEA 1R10A 2GAAA 4V2UA 1DZIA 4JGGA 1VSUA 4X5OA 5DWVA 1K0UA 3OEWA 2HKIA 3BA1A 3PZRA 1T34A 2OOSA 2VP3A 3M2PA 5A7FA 4ASUA 1CFZA 5I7AA 4FTWA 2PH1A 4NECA 4DCSA 1F17A 3T54A 2R60A 4PR0A 2IXGA 5TV2A 4BRZA 2WHEA 4OAOA 3TD2A 3DPUA 4CLEA 1XEXB 4ECEA 4C2UA 4YRNA 1YFLA 3GLIE 1VYVA 1Z5NA 3LMKA 2DBVO 3FUCA 4KCGA 4EJFA 1SWWA 2I7TA 4WVFA 1P7CA 3I37X 3SHTA 1OH6A 3Q5GA 3W8DA 4EVSA 2R00C 3VZBA 1AK1A 1PD0A 2FR8A 2F3QA 5IU6A 5LA6B 1M2EA 2P9QA 3ZH2A 2CY0A 3VU0A 1QO0A 4DWWA 1LWNA 1XRJA 1P1BA 2ECKA 2VHCA 4FI3C 3TZLA 3TFQA 3SEZA 1T35A 4FCVA 4EPWA 1ZESA 3ZQJA 1PTJC 1ZSNA 5EYPA 3P4XA 2HA6A 1VIVA 1ZUNB 3IQHX 4J0QA 4KPGA 4RV5A 3PXGA 3ZBUA 2GCGA 1BC5A 2CFCA 1JEOA 2Q5JA 4HP8A 1AB5A 3Q9SA 3UQZA 2CDAA 2VZLA 1P4RA 4J43A 1S8AA 4RVNA 1ZISA 2CJPA 1UFVA 4HAXA 3WIOA 4GC5A 2AXEA 2X8BA 3CONA 1L7OA 1KPHA 4CFYA 2IHNA 3TX2A 3ORQA 4PCAA 1U8FO 3AW8A 4ML3A 2FPLA 3KB1A 1DCFA 2HSEA 2AC4A 2AKYA 2I6UA 3PR2B 1KS9A 5CX1B 1XPUA 5JZVA 1T1IA 2NG1A 5K0EA 3MERA 1A4RA 3NONA 4V1CA 4MA5A 4XASA 4O4JB 4ECAA 1MDFA 1B15A 3U6BA 4ENPA 2DUNA 1L1FA 1P19A 3PFWO 3RS4A 2JAHA 1P80A 2ZAGA 4D9MA 3NGXA 2LXNA 1PL0A 4QU5A 4J94A 4ER3A 4L5YA 2WIBA 1NPYA 1QFSA 2COKA 4LBZA 3G85A 2NOAA 1X1AA 2JKVA 5AVKA 5LMCA 7ABPA 5JWRA 3JD0A 3MT8A 1PR1A 2FETA 2BFFA 2GLUA 5DYNA 4LQDA 2HA5A 4XGIA 2IDKA 1FXUA 2N46A 2YX1A 3WP0A 4EYKA 4IHJA 4UFOA 5EPUA 1YCGA 2F6RA 5HEKA 4RZIA 5TY0A 1MEJA 4AMYA 3WL3A 1HLPA 4HDOB 2C8JA 1EJ6A 1LUAA 4AMBA 2I3BA 5AHOA 5JYEA 4KAFA 4YS6A 1FLDA 1Q1QA 1Y6ZA 3FGZA 3HCRA 1IN6A 5HE8A 2J0QA 1GDHA 1R16A 2FAXA 4Y9DA 2A5DA 4FC7A 5EEGA 5ANRB 5FB3A 4EA9A 2H1FA 3PTAA 5LD2C 2CMHA 2DPGA 3Q3JB 3UUFA 4R9SA 2Y92A 1KDTA 1J0EA 1DPFA 1BXRA 4RTLA 1G21A 1JPJA 1VCMA 1QQTA 5FXMA 3QU9A 3DV0A 3E9CA 5DI9A 2H1VA 1ZEJA 4UXHA 3WIEA 1UJCA 2V7TA 4I9UA 1USWA 1NXPA 4M1ZA 2I7VA 4LK3A 2Q5IA 3WGUA 2QN2A 1QHHA 2C54A 4N0MA 4Q21A 1XB2A 3AM5A 2QTTA 2I4RA 4TTIA 5FNZA 3RKUA 3CNNA 2WE8A 3C97A 4QWMA 3RIYA 3H0CA 4I1IA 2B34A 3BHNA 1O9GA 5TPZD 3BMNA 3MW8A 2QRVA 4NZMA 1BCSA 1I51A 2IVFA 4X3OA 4LZWA 4EA8A 1JU9A 2RBKA 3S7TA 1Z6XA 2OFPA 3AHGA 4KRXA 4O02B 4ZTBA 2RGNC 4V3CA 3PB3A 4CR7A 1O89A 4N76A 2EBFX 4N8DA 4RA9A 1UOOA 4XUCA 4ZAVA 1ENYA 2P0AA 1KBZA 3A6HA 2EX4A 1ISFA 1SUBA 4YCDA 1Z62A 5EY5B 1KY2A 1PS9A 2PPVA 1G291 1JHVA 2P4HX 2V7WA 1L7MA 1ZOLA 3I9OA 4MYTA 5HUQA 3CEAA 3THXB 1T4DA 4ZHQB 2C20A 3ASZA 1FVHA 2O0HA 4C3UA 4TVSA 5ALFA 1UWVA 2RH4A 3RQIA 5CB6A 4M0MA 2WFZA 3OJEA 3KTDA 2PMWB 2JBWA 1ILWA 4UCWA 4GVXA 3TW4A 1QIKA 3B5JA 1YR2A 2BI8A 2A5FA 3LX8A 2OG1A 1L5YA 1ORVA 1USGA 2PEYA 3H1GA 3H9BA 3QXXA 3T3MB 2JHGA 5D7BA 3FMGA 1O3YA 1U2EA 3IXLA 1RJWA 1EWTA 1F51E 4OMUA 1Y8AA 1G17A 2Y0DA 5ALLA 4JKOA 4AUKA 1U1IA 3CKLA 1GGKA 3AR6A 5IH3A 4F46A 4NZNA 1D03A 2VNKA 4B43A 1M2WA 2BBOA 5A1TA 4K0KB 1MFPA 5BNFA 3UK6A 2EJTA 3NYRA 2FU5C 3E9YA 1Z6GA 2B25A 3B1XA 3P96A 5FT9A 4DQVA 4EHHA 1EESA 3A05A 4FYMA 4PX9A 1V7CA 2YN0A 4GPZA 1E1MA 2E37A 3N7UA 4ZIRB 1NMXA 4EHAA 1COZA 1V9LA 2H11A 2WU4A 3FTCA 2ZE6A 2Z09A 4P7FA 4YACA 1G9TA 1H93A 1THMA 1UFOA 4UDYX 4YEDA 1DFGA 2AD5A 3LOQA 3IQIX 1V2GA 4B35A 1ZK3A 3TEJA 3QV2A 2RE8A 4PZYA 5HS4A 2WHRA 2DUWA 1SXJC 2MTBA 1NAIA 2EJCA 4GKJB 3CZMA 2CCGA 3NV7A 4Q9LA 3TQOA 3JQ8B 5AXBA 4BPRA 1K9SA 3AERB 1RWWA 5LXTF 3SBOA 3FKQA 3IURA 3TK1A 1GUFA 2CVPA 2FG6C 2RG7A 3RS2A 1WB6A 1YIOA 2ZREA 4RDCA 5ICMA 4LC9A 5EIXA 5GP1A 3VNBA 2VYQA 1P1CA 3PC7A 4PG6A 1JJFA 4EECA 2VSFA 2ZS7A 3T41A 2G77B 2YRXA 2P9EA 1W85A 2CD9A 1QKIA 4FN4A 1LBIA 4ZOCA 1I9CA 2QTWB 4ZEWA 5FD8A 3QKWA 4DBVO 3CGWA 3H5NA 3CZ9A 2VT7A 4MAMA 4O4JF 4ZKDA 1JX6A 4FJ2A 4JLKA 4OHFA 4R9UC 1ZRHA 5CLJA 1V8DA 4HLDA 3GFRA 1YB4A 4O3FA 4TQ9A 4XWGA 3IAFA 4MQUA 2CVHA 1I0IA 2GEVA 3RT9A 3LDHA 5K0BA 1QF6A 2Z3VA 2PZLA 5AVOA 4ZAFA 1SUAA 2ADMA 3N0RA 1IUOA 3AEXA 6REQB 5L3VA 3S8EA 4QU0A 5CW1A 4J03A 1X94A 4Z0NA 1MVNA 2R8BA 4YRMA 2O3JA 4X24A 2I6GA 3IEUA 5KYXA 4P3OA 1IJEA 3K9QO 1PSDA 1N2JA 2GZMA 5G1PA 5CDYA 1P5FA 4C3VA 3RVKA 3HJAA 2OM6A 5C8ZA 1P4JA 4IOJA 4MW9A 2P4UA 2CZQA 2OOKA 1P74A 2AFVA 4HNSA 4P3XA 4RKEA 1KAOA 5KNCD 3ZVNA 4IXNA 2H1OA 1Q2UA 2FX2A 3A28A 4FNGA 1N2CB 1TZMA 3EGXB 1UBUS 4P8RA 4TX1A 3V55A 2EW8A 3LY8A 5AI4A 4ZVRA 1P1JA 3FPAA 2Q29A 5AKLA 3MJVA 1AU9A 4N7BA 1WR8A 2AYZA 5ALVA 3HDTA 2HT1A 5KKCA 4RZ2A 3KT8A 1RZ3A 3NBZC 3PK0A 2HCBA 4XARA 1YGYA 4N5MA 3WGLA 2Z3WA 2VNIA 5F9HA 4K05A 3JQ7B 1NBHA 3HXTA 2J59A 2VWGA 2Y1DA 1KORA 2LDBA 2AQIA 3QPWA 4KFSA 4DCOA 1AB6A 4EEZA 1OU0A 3CB2A 1RPNA 2XJ9A 2DECA 2OGWA 3KFVA 2OAEA 4RX1A 2R8PA 1P6XA 3T7IA 3VNVA 1Z68A 1IRIA 4ZGBA 2B1JA 2UAGA 3NJRA 1JZTA 3KZMA 5A05A 4RA6B 5EIHA 3MIIA 3TYXA 1UAAA 4LJKA 4KXLA 1D1TA 2WEKA 3OI7A 2B4AA 4HX9A 4NJMA 2JVJA 2R4TA 2ZI6A 2GQ0A 3MILA 2WUGA 3LW8A 4AK9A 1Z4JA 2VS1A 3HUFA 1CQIB 1V71A 3QZUA 4NQRA 5TF0A 4B48A 2RGXA 4C4AA 5JDIC 3K9LA 1VHLA 1AQLA 4U2FA 4QG3A 2AJLI 2X1LA 3KQWA 4LGCA 3STHA 2FG5A 2Q3JA 1YZQA 1ZY2A 3IP5A 2QRMA 3AT1A 5D01A 3H5TA 3NS7A 3SIXA 4TZ0A 3K2QA 1C9JA 4H3KB 1XMIA 1AO3A 4DWJA 5KU7A 1M75A 1PFKA 3UMJA 1W49A 2FMUA 1CUYA 2CMGA 5DM60 5K8LA 3GPIA 1OXKB 1VL8A 2A3NA 3TDKA 5IJZA 1ONBA 4B83A 1EFPB 4D3SA 5K1ZA 1C1YA 1L3CA 5K0SA 1XJWA 4MUEA 4N3NA 4H7HA 2GBFA 5B36A 2AOTB 4BVGA 2FPIB 4KN9S 4GZLA 4K6CA 5DGCA 5TJHA 5A4DA 1TF7A 4BJ5A 1QNLA 4A8JA 1XIVA 2CSUA 2LD4A 2GA9A 4P53A 1H22A 3QPCA 3ZE9A 1OE0A 4EMTA 3SI7A 5L3QB 1W88B 2VH1A 3OO1A 5J3JA 3GVHA 1PTKA 2P6PA 3K5PA 3TTWA 1E1RA 1XD9A 2TYSB 3MRVA 5BW4A 2Q9BA 4R98A 3MAGA 3EUFA 4XVQA 3GFQA 1XN1A 3MA0A 3RYFB 1JG2A 1K06A 3NWPA 2GPAA 1V5WA 1NDUA 2LIPA 3B2NA 3L4KA 2P2LA 1Y1PA 4DPLA 3DUFB 3EE6A 2R7AA 5HKAA 1IM2A 1Y9AA 3AEUA 3PP8A 4PZAA 5IBRA 2CUNA 1U8TA 1U99A 2QJTA 2ID9A 3L7BA 1ZVQA 2FWBA 2QM8A 4R7ZA 2J5QA 2YICA 1L0BA 1SOMA 2JIBA 3Q9LA 1QVRA 2DX7A 2JFPA 3QY0A 4RL4A 3WG9A 5FLXA 3OICA 3LC7O 1NXVA 3LFHA 4G0YA 3O4VA 3K1YA 1IZZA 4DJFC 3IV9A 2V8BA 3TVTA 2QRKA 1E79A 1W59A 3F8SA 3VOBA 4F1WA 3TO5A 1V5EA 2O5CA 4BQPA 3E2IA 5AVYA 3HNRA 3U37A 3HO8A 4YXFA 4Q9AA 5CU7A 3DO8A 3I39X 2O3SA 2RMKA 5FH9A 1WD7A 3BK7A 1FU4A 2ZWAA 1B6GA 3BL8A 4DKXA 4DRYA 3RC3A 3RIXA 3L7DA 3WL8A 4RADA 3UM9A 4EKIA 4KQ2A 4NCHA 4PM4A 3ZWPA 2N0SA 2H8KA 4MR7A 1G59A 2QYHA 3A4VA 1RJGA 1JEQA 3UJ9A 4HV4A 2JB9A 3QKRA 3NHRA 1LV8A 1Q3KA 3DULA 4BATA 4FDLA 3D8NA 1N5LA 3QEKA 4QD3A 4RV4A 2ST1A 3VR6A 4X0EA 4CKEB 1B6RA 2B2CA 4YAKA 4ZT6A 3K9FC 4D9JA 3NRBA 1P9NA 1DEOA 1W0KA 3F7MA 3ZD6A 3TH5A 3WL5A 4MP6A 5K2MA 1U2TA 2P2CA 1CRWG 4HAZA 1IONA 3QKIA 4P98A 4GLFA 5K6TA 1Q17A 3RKSA 4AKEA 2YW9A 1UL1X 4C21A 2QD2A 4EL0A 1CYDA 2PXCA 3FAKA 4S0ZA 4J1TA 4KQHA 1F60A 2C4HA 4FT4A 4RZQA 1MRZA 4TSFD 5DYTA 3QITA 2XUQA 3R0QA 1XPJA 3VZSA 4BNUA 2R8YA 3IPRA 1Y4AE 1QB8A 5ERXA 1CUGA 5JLJA 2GCNA 1UBEA 2VCEA 1UDBA 2EZUA 2H2FA 2VHJA 2WU3A 4OCZA 3T3DA 4O2AB 1ID1A 3HB4X 5ALDA 5AQ1A 4GC9A 1N0UA 3R6GA 2E0IA 1YQUA 3SAJA 3K0SA 1E2QA 4EELA 4B76A 1FRVA 4ER6A 1ZXBA 5CCBA 5AHKA 1ITZA 3D8BA 1U0LA 4QQRA 1IJKA 2AN3A 1P62B 3CJTA 1D07A 3EEYA 5L4NA 5MFZA 3Q8KA 3GP3A 3N3AC 4ZVTA 1NTOA 3H1AA 4FOPA 1LVGA 2VOJA 4P80A 2CXRA 1RJ9A 2OHHA 2PFSA 2WIGA 1RNLA 4DA7A 1XOIA 2V3VA 4CQLA 2XCLA 1PT6A 4RHEA 4EO9A 4BRUA 3F1LA 1G8KA 5H7XA 1NC3A 3SPXA 1ECLA 3JQBC 1A9SA 3AC0A 3QKSA 4LEIA 4M9RA 5EWMA 3KXLA 5TPWB 2FV8A 3TLZA 1YJQA 3ZDZB 4ACAA 3K6SA 2A0YA 1GZ7A 1W19A 1RZVA 3BQNB 4MR9A 4K7JA 4M7PA 2Z6AA 2HQOA 1HZZC 1SQ0A 1YB5A 4IWNA 1TF2A 2VXCA 4COKA 8GPBA 5KMGB 3OE1A 4KDRA 2O52A 3TLMA 3M6VA 4PS0A 2BBWA 2B4YA 2CD7A 2V0CA 4QYMA 4TS4A 5KWIA 1RPTA 4KNWA 3JALA 4I5FA 2IHYA 3PRHA 8OHMA 1IRXA 3U0BA 3KS9A 3L9WA 1UIMA 2Z3ZA 2ZYUX 2DGDA 1NBMD 1QLHA 2R6R1 4Y18A 4PHFA 3ZHQA 1E5TA 1LA2A 3IOEA 2O3TA 2NYVA 3LBHA 3MLEA 3MS2A 5KHAA 4OB8A 3UHOA 4DRXB 2X9QA 3QVLA 3ZWYA 2ZU6A 3D9QX 4JQSA 1Z9BA 2HQ1A 2OK7A 1FXWF 1DAKA 1D4OA 1T9CA 5CM2Z 4EKYA 2L18A 3MGCA 3QLEA 1QKKA 4O2BB 5JNSA 3F2IA 3RWBA 4LZAA 5B53A 1PT9A 2IYFA 3QUAA 4JENA 1WCXA 3DW1X 1A82A 1RLMA 1ZM4A 2I1LA 3A9SA 2OO5C 3G2IA 2AE1A 4RFSB 1G5IA 4CG1A 2REOA 2CMDA 3KHSA 1D2MA 2C2WA 4P7GA 1PNVA 1SQ6A 3L41A 4WA7A 1N3YA 1L9XA 2CEKA 1EZZA 2CUKA 2ONCA 1KC1A 2WP8J 2Z2KA 1FNBA 2WVJA 2WJIA 4DV1B 3ADBA 2EW1A 2XMSA 1RFGE 4NZYA 4N8EA 1GWNA 4ZQGA 1QMGA 3MT7A 2IZOA 4KUHA 3PXDA 1EDDA 2Y8EA 2EU8A 3B9RA 1KZ9A 4Q4AA 3BBLA 3KC2A 4E22A 4BFXA 2R4QA 1R0SA 3IVMA 3OU2A 5KUTA 1E64A 2N42A 2ZRGA 1PEDA 4BBJA 3W2FA 2IYOA 3I5AA 5JD5A 2A2ZA 3ESCA 4NCXA 4UMEA 3QYPA 4N5LA 7MDHA 4QECA 2FPSA 3RADC 1UBCA 1KDYA 4UMFA 1N9GA 4ZI7A 3FR8A 4B40A 5LZ9A 3OZFA 4F92B 1UZAA 4D46A 2EGUA 5JG7A 1TE2A 2MT9A 4PEVA 4ERNA 3SYTA 1II9A 1U8XX 2ZIZA 3T4PA 5G0WA 4EW3A 2K7FA 3BWXA 3VU8A 3H9CA 1SBNE 1ZUHA 2Q6IA 5EUBA 1EWVA 2P2YA 3FWPA 2P78A 1M1XB 1GP2A 1W8DA 4WWHA 5F2KA 4F11A 5FEMA 3BWYA 2FMHA 4V2IA 3ZHRA 1B2RA 3WV5A 2B20A 5B6JA 3HYSA 1YBMA 3COPA 4V0QA 1DG3A 1AC5A 3C6XA 4LJ7A 4QPPA 2QA5A 2OCLA 5AFSA 1HOXA 3QE0A 2XNJA 1Z33A 4C0KA 2Z58A 1ZD8A 2GYYA 2QPAA 2ZGVA 5AHXA 1WCYA 3NHJA 5CVVA 3TB6A 1WZEA 4RH3A 2BJHA 2B83A 1H66A 3K96A 1H6DA 1Z26A 3RC1A 3VO8A 3GPDG 3AVOA 3IDFA 4KX3A 1E1YA 3R4CA 1QRSA 3UAXA 4G0UA 1DC8A 4Y2VA 1QYVA 4PXYA 4M9QA 3K16A 1R2QA 1K2VN 3RHFA 4XW2A 1YZLA 4DY4A 3LRXA 1S0UA 4H6PA 1MENA 1MVOA 4JUDX 1AKMA 4YAJA 1I01A 1IXYA 3HC7A 1L8QA 3IH5A 2V6FA 1AY0A 3QF4A 4KR3A 3CM0A 3OZEA 1SO8A 4NMXB 4D9FA 3TGLA 4EAQA 2BUBA 3BKXA 3GT4A 3CVWA 3IBCA 4KO1S 3N0WA 4O2AF 1CG6A 2B99A 1XU7A 4IDBA 2PMBA 1M1UA 2HCFA 2JBAB 5HR5A 3AL0C 1C30A 1J9ZA 1HG1A 2TRSB 3AIOA 1IBCA 2HW8A 1GRNA 3RG8A 2J48A 4G09A 3TL2A 4NNJA 1E6EA 3KYDA 4ZVSA 2XH8A 3KVRA 1CNEA 3DAYA 3IDAA 3QHQA 3LJKA 4HDKA 1L1RA 4PHGA 4PLVA 4C0JA 3IT2A 4C78A 3HYCA 5LKAA 4NL4H 4D80A 1CY1A 2BFCA 3R7BA 1AKRA 2XB4A 5C53B 3DCYA 1WHTB 2QVYX 4D8YA 3FUVA 1MXHA 2YJTD 2JW5A 3KFXA 4FMCB 1P77A 3UENA 5DTEA 4EMSA 2KYRA 4RYLA 3NNDA 4KLCA 3P2JA 5BPHA 1L7VC 2ZJ5A 3L5KA 4G8DA 2L82A 3P94A 4YPVA 1IUPA 5KVSA 1WMEA 4FXPA 3ZS8A 5T8KC 3PD0A 3FSGD 1R3DA 3UJHA 1MB0A 1XD2A 3MD9A 1ZP6A 5D84A 4FS3A 3U4AA 2PZMA 5EZQA 3W06A 2I6FA 4OLJA 1UBNA 2ARKA 2FEWB 2J30A 1WF6A 1UT5A 2UKDA 3FOEC 5F3WB 1V4VA 1I0LA 1VLVA 1JG1A 4YRKA 1FFYA 1IAVA 3IXMA 4L5JA 1HA3A 1WOYA 1IMOA 2I9PA 4R51A 2WP0A 2OHOA 1AVTA 1Z39A 1AD2A 1RMYA 1T5DX 2VJKA 5JCJD 3J80A 3N2ZB 4KSYA 5AVQA 1QHGA 3LT5A 2AQHA 3NM6B 1AS3A 1WEHA 3FTNA 2BMJA 4TM8A 1MF7A 2Q99A 4U2DA 4XWAA 1TQ8A 2W90A 2YNMA 3QEJA 3VOSA 3TSOA 5JT1A 4KYVA 1E69A 4ACBA 2N9UA 3EW7A 2F62A 4C4PA 1QDUA 3LDFA 1QTRA 4DM7A 3ESDA 1UK8A 1OFTA 1X0VA 5TT0A 2RGYA 2B21A 1NUSA 4B6SA 5COBA 5EMMA 2J46A 4CBVA 1FTYA 3FVWA 3L1HA 4BNYA 3SIWA 1CDEA 3IRVA 3OAAD 5DLEA 5CD9A 1MJFA 2DHEA 4CU2A 1UFRA 1IHPA 1Y3DE 1GIAA 1Z45A 4EOGA 4UDOA 2OLJA 2OQVA 4GSKA 3DBHA 3G5AA 5HQ3A 1XUOA 4N1AA 3C41J 4QO8A 1ZVKA 4U2CA 3N05A 4M0PA 4Y2HA 2XZLA 5GJVC 1SK8A 2B36A 4PCVA 4MWZA 4EUFA 3UMGA 1JSZA 3TN7A 2GEKA 1GM5A 2PGOA 1NF9A 1TAGA 2OFFA 4C5BA 1KQFA 4BNFA 1A7JA 4II2A 3GEMA 3JYPA 4A6XA 4B3XA 1Z0DA 2Q8QA 2YJ4A 5FIUA 1NYLA 5EYPB 3TPZA 1D6SA 3HACA 4MWEA 4FD3A 5J9FA 4BGIA 2NIPA 1YR3A 4LF9B 2WD8A 2ZRIA 4RHXA 3EYWA 2VQEB 5IXSA 3EDOA 1CHNA 4DJAA 2IH5A 3QX9A 2X5KO 1V8PA 2WUWE 1WMFA 2EQAA 1IUKA 1HEYA 3OZDA 4JC5A 4XKJA 3V6MA 4YXWD 1IIBA 3CEPB 1QV9A 3TBFA 3T5CA 2PLNA 2HIMA 3WNCA 1O0CA 2IV2X 3DE1X 2GZRA 1GN9A 2P7IA 2PGXA 4FB4A 4L4ZA 2FN9A 2LCFA 4JBXA 1QX3A 1XJ5A 4YCSA 3ESAA 4V1CB 1DJOA 4AC9A 1L5WA 3FD8A 4MROA 5BSUA 3O75A 3O7MA 5BVGA 3H97A 1DEXA 1I4EB 2DFTA 1BWPA 1V95A 1E59A 1Q0HA 2W6OA 4KLRA 2QJRA 5BSWA 1E58A 2FN7A 2FLWA 2XOKD 3FROA 4N01A 5CP8A 4CIDA 3KBBA 2XTNA 4IG9A 4L8VA 3C8ZA 2Q9AA 4RQUA 1TQ2A 2BFFB 3CTMA 3D3KA 3RBXA 1RMTA 4M21A 1WWKA 2XCQA 4UZFA 3GP8A 2H9YA 4TL6A 1NZDA 2JIZD 3OWHA 4OHOA 4IHJB 3E9QA 5ALJA 5LN1A 3OIWA 1QRUA 4A03A 1R8JA 1X7DA 3OQBA 5TMBA 4Y98A 1S96A 2HAEA 3W5HA 3VFDA 4B7XA 1KIMA 3MQ4A 3CG4A 3V33A 1ZI9A 1MX5A 3HADA 3B7WA 5EWLA 3R75A 4INOA 1KSFX 3H75A 4DF3A 2H4XA 3SC4A 4MW7A 4R71A 5KNLA 3IUJA 3H5IA 4W8OA 3VO1A 3TX6A 3D8HA 2JF0A 3T95A 4ENSA 2QM0A 1BXRB 2DT8A 2XDWA 3F49S 1G21B 2KB0A 3TI9A 3VSCA 3R7SA 3ZXSA 1EGVB 4AECA 4EY8A 2H3HA 1KBOA 2HM7A 2ZJ6A 3DV0B 3IKVA 3LT4A 3OSZA 5KTYA 4FPXA 4GOMD 2WPDA 4JP2A 2CV0A 3FETA 3CUVA 4F2WA 2QY6A 2EOAA 4FMCF 4MRMA 1RT9A 3BMCA 4G26A 3U4IA 3QFCA 2GFHA 4PSAA 4UHJA 2CDBA 4BX0A 3USZA 2MCFA 4NSNA 2ZK7A 2RDMA 2YTZA 3BMNB 2QRVB 2IZ5A 3OFVA 5F3DA 1BCSB 3PRYA 2I9KA 2C2HA 3JZFA 2NADA 3GX1A 3IL2A 2ZXUA 1QHIA 2A9QA 3JVEA 3LQYA 4MV3A 1STOA 4E21A 4WK6A 3I42A 2Q4OA 1RYDA 2PN1A 2RK4A 2WAMA 2NM0A 3ILYA 3NTRA 3PI7A 2RI6A 2O7NA 2JC3A 3QEOA 5PGMA 1HFJA 4EO4A 3B5EA 5JJKA 4GWKA 4JLPA 4HNUA 4O25A 3AUTA 5JS8A 3EAGA 1D5WA 4ASUD 2G6TA 3I32A 4B4KA 2IYNA 2CLOB 3VNQA 1I4OA 3CF6R 3UZUA 3NI2A 2ID4A 3NTXA 5LR6A 3HSSA 2WKPA 3EDYA 3RT1A 2QUHA 3BX1A 3INYA 3I64A 2AR7A 1NNSA 2OLEA 3I2JA 1U04A 2HOQA 1M1YE 4BQRA 3OVMA 4LHYA 2HN9A 3A6KA 1ZONA 3QOWA 4IY1A 4UUMA 4Q9NA 4R3WA 1QH8B 4YJKA 4BNMA 4YJ2A 3NYWA 1NQUA 1WTCA 1QO0D 3KYJB 4DSZA 3WLPA 2R8OA 1N1DA 5JO9A 3T3EA 3TNYA 4GKKB 3VPHA 3OHSX 1SCAA 5INTA 4DN6A 1YU9A 1CY6A 3QEMB 2VUIB 1TIPA 5A04A 3HKEB 4JOQA 2VHYA 1RI1A 1YR7A 3MAAC 2VAWA 1YVPA 2WSLA 3GJ6A 4GR9A 2F67A 3OZSA 2H2WA 2O59A 4KIFA 4UEOA 3OKAA 4XVHA 1D1PA 5DW3A 4YUVA 1XTPA 2BVNA 2EF0A 1U9YA 3CLHA 1M33A 3GMIA 3NTQA 2ZI9A 4MGZR 4U3JB 1TUEA 2B92A 4JROA 3I9V6 3JYHA 3NFYA 3UYKA 1GRVA 1GDDA 1KYXA 2XKAA 3CLUD 3SQOA 3SSMA 1A1SA 1HWYA 3KU4A 4CTJA 1XMQB 5LSAA 3C45A 3BG5A 4RS4A 4MW1A 4WCDA 5J1TB 5YASA 2PX6A 1M2GA 1HLDA 1OX6A 4H9GA 4JBHA 2GZDA 5BW5A 4XWOA 1K8RA 2K2WA 4QAQA 3M4JA 3JTMA 3OIVA 4Y2JA 1X1DA 4CMEC 2QRZA 5I4BA 2ATCA 1XAGA 4NCNA 4WBXC 4BWFB 1DX9A 3A4IA 2I6SA 3DNFA 1FS5A 4IHAA 2MYNA 3O74A 3LDUA 1XV5A 5ALUA 3FOZA 1RP7A 4OATA 2XGMA 4MPDA 4RVFA 2QAIA 3AV0B 2GD6A 2VJNA 3BB3A 5L95A 2M6KA 3RJMA 5JJIA 5TSDA 1W85B 4QUAA 2J9XB 2F1JA 4LXUA 4TQUS 1W9MA 1LVUA 2MYUA 3HFSA 1IBKB 1TC2A 2WJAA 1OLSA 3MB5A 4MCAA 3BE4A 1WPXA 2FSHA 2OMEA 4TXNA 3H4VA 1V9CA 2WQZA 4U02A 5TC4A 1JG7A 4YV7A 4QZVA 2EDCA 1CNFA 1E6UA 1PGQA 4EYQA 1LPSA 2IVZA 1B0PA 2EG9A 3PEUA 1Z7EA 3AZQA 3IBYA 4KTVE 5GVRA 3WYDA 2V7XA 2JATA 2PQ6A 5CM8B 4NABA 1U0FA 1MG0A 3HL4A 5CIWA 5EKDA 1Z8NA 2DR0A 1A5BB 4D0RA 1KMHA 5DMHA 5KYXB 3A2KA 3FPGA 5HQTA 1LLFA 2H1CA 4ALJA 1GRCA 3VA7A 1BE1A 4IHJF 1UKZA 1KZGB 1FP2A 4D8WA 16PKA 1LF5A 3U19A 4R1SA 5FL3A 3TOCA 1WMDA 3UQYS 1NM5C 1Y3CE 1ATZA 3NAMA 3OPYA 1M6NA 3FYSA 4BVEA 2D4HA 1W7AA 1D09A 2HDOA 2DR3A 5KYKA 4M1KA 1B8OA 5C8XA 4GOJA 1FNSA 3ADDA 1JMVA 1Z0FA 4M7RA 1J33A 2MDTA 2XVMA 1SULA 1G5HA 1D6MA 1ZSYA 5FQOA 1JUDA 3EWIA 5IKEA 3HCAA 1CS0A 2I2AA 2XMRA 3EEQA 4CKWA 1CLEA 1I1QB 1YBHA 2JGFA 5JISA 1TW3A 2IEBA 3IOCA 3LCJA 4QUEA 4LS3A 3HPRA 4FONA 5DM0A 1O54A 2X1MA 2F1HA 4GI1A 1BGVA 4IEIA 5ICCA 4ZN6A 2WT4A 3NDBB 1JG4A 2PTGA 1JDJA 4OQEA 3JASA 1QMPA 5C37A 1ACLA 5G1OA 4FR0A 3ELWA 2GBLA 3FFAA 2GWRA 2RJ3A 1LH0A 1ZCBA 4ZKEA 2NPFA 3AVQA 4EG3A 5LDDC 4H35A 4FJ0A 4CMKA 4W5NA 1NMYA 5JBQA 4IFIA 4PHHA 4NJMB 3ZTTA 1Y6GA 1SC3A 3ZHXA 1XCBA 2DPXA 2BSQA 1JIKA 3BSWA 2ZRJA 1J70A 5LYYA 4E4TA 3EQZA 4MPJA 4A36A 1EX6A 5AQEA 2PU7A 3LBNA 4BJ6A 1KAHA 4RMJA 1ULBA 3FNEA 4F21A 5HYVA 1EWKA 4HK4A 2VTDA 4BQOA 4J0DA 3PNVA 1AJEA 4W5RA 4JFAA 4EHNA 4NK5A 2DFDA 2EWMA 2PV7A 3LLVA 5KEIA 3IKJA 4G97A 8MHTA 2BGNA 1PU2A 1WZ2A 2J33A 3PXEA 3FR7A 5FR2A 4DVJA 2HLNA 3RU7A 4L16A 3SZOA 4F8JA 2P77A 3KKMA 3VKVA 3R5SA 1UT6A 4PXAA 4E3ZA 2B94A 3FI0A 4BKUA 1ZGBA 4BV8A 4IQFA 3VBCA 5B3LA 4A8JB 1E2JA 1OC4A 1GLVA 4GQIA 5K01A 3ED5A 4GP9A 1ISHA 1UINA 4LGVA 3ZK9A 1B76A 1B8VA 3F1KA 3KB2A 1W75A 4AKTA 2QG6A 1WXFA 2J6BA 3GPBA 4X62B 4RZHA 4Q93A 5AR1A 4Q4DA 4CR6A 5B6PA 4K6OA 1M5UA 3AUJB 4YASA 1VLJA 4W1PA 5CFLA 3UAZA 3COSA 1EXMA 1FLVA 2L19A 4PFQA 1K2WA 5E9QA 4FFOA 4Q7EA 1N1GA 1UBGA 1K7SN 3GEHA 2YDYA 1S8FA 3AEUB 3FBTA 3E03A 5FOWA 3U7RA 3BZUA 4GQBA 4J4BA 4ZVOA 3SIRA 3D6HA 3L6EA 3D2LA 5FPTA 1JDTA 1M2JA 3DDUA 5EI5A 4CDNA 3OM0A 3KKEA 2DCUA 5I47A 1FMTA 3WX0A 1G64A 2ZJ0A 1AXRA 4PWZA 3RSFA 1BWQA 3KKNA 4YDRA 4DG5A 1ZG3A 2QIOA 3DWIA 5JEDA 2O2CA 1EFUA 2FP4A 4BJHB 2AA3A 4B45A 1NVGA 1L1QA 2QI9C 4I9NA 2C99A 3UB4A 1V0JA 3BXXA 1RTKA 1W581 5KKAA