2QU8A

Crystal structure of putative nucleolar gtp-binding protein 1 pff0625w from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
194
Chain Sequence
LPSINPHKKTIILSGAPNVGKSSFMNIVSRANVDVQSYNLYVGHFDHKLNKYQIIDTPGLLDRAFENRNTIEMTTITALAHINGVILFIIDISEQCGLTIKEQINLFYSIKSVFNKSIVIGFNKIDKCNSLSIDNKLLIKQILDNVKNPIKFSSFSTLTGVGVEQAKITACELLKNDQAESILLDQEQLLNTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleolar GTP-binding protein 1
publication title Crystal structure of putative nucleolar GTP-binding protein 1 PFF0625w from Plasmodium falciparum.
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 67
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qu8A00
2BVNA 1RJ9B 1QF9A 5KTYA 2LKDA 4C30A 4R7ZA 2WJHA 4TQ9A 3AQ4A 2BM0A 2FNAA 3G82C 4MKFA 2NOAA 4C2UA 2A78A 4DZZA 1E2LA 1Q44A 5CIQA 4KODA 3ZIAA 4QNMA 5TXGA 3SC3A 1PLJA 2ZROA 1IM2A 4A82A 1S9DA 2GESA 4Z1MA 1R0XA 5TB5A 4MGKR 3PEWA 3PG5A 2BMDA 3QPWA 3I72A 4DLUA 5HE8A 2FPLA 2YZ2A 2IC5A 2GA8A 4PXAA 2EVWX 5L3QB 2WZQA 3B85A 4DT1B 1HQCA 1OFUX 2WIBA 1TF2A 2QNRA 2OBMA 2REOA 1KI3A 4BEJA 4FMDF 1OLOA 1Z0FA 2ZI5A 2HCBA 1NP6A 1DAKA 2F1JA 1U2RA 3LW8A 4QOSA 2IHBA 2OEPA 3EIHA 1F2TA 3P20A 1AKEA 4LY6A 4Z51A 3D3QA 2GK6A 2WBLC 2JJ2D 3HPQA 2MSCB 3PITA 4TMTA 3N5CA 3RANA 4LZZA 4TYPA 2JATA 3MG9A 5DE3A 5KDOA 3QSYA 4MUAA 2PX3A 2ZEJA 1G8GA 4LCBA 1ZIOA 4Q4LA 1FMJA 3X1YA 1E2GA 2W6ID 4V0MA 4ZCMA 4HAUA 1IN4A 5DNYB 1II8B 4IXMA 3TVTA 4NYMR 3CNNA 4POAA 3R7WB 3AB3A 1IXRC 3QJYA 3K09A 2CL7X 4C0HA 2W0SA 2GAOA 5FTLA 4F91B 2ZUDA 3I73A 2YYZA 4ACBA 4ZPXA 4B2IA 2OSBA 4PO9A 2CCGA 2P5SA 4KLNA 5AJVB 4IFEA 3W5JA 3THWB 2O8CB 3BIFA 2YWFA 4MKIA 2WSMA 1R5NA 3TQCA 3IO5A 2FPKA 1DAHA 5L3VA 3BWDD 2GVZC 1Z6AA 4I81A 3AF1A 1R7RA 4G3XA 4B6EA 1DARA 5B2ZA 3GJ4A 2ODNA 1JALA 1W4BA 4HB0A 5DYGA 5JI3E 3B60A 5JBQA 3UMSA 3GCGA 3FKQA 3M4YA 2IYZA 2VPPA 4LYFA 2PJRA 1DG3A 1SXJC 1PUJA 2QT1A 3W34A 3KXIA 4S35A 2ZM5A 1ANKA 2RGGA 1C1YA 2QZ4A 4NE2A 3QEOA 2JLXA 3SEAA 1JR3D 1T91A 2A30A 3RDPA 1IXZA 1E4VA 3LXXA 3QKSB 3BE4A 2GBLA 2PEYA 2JJ2A 4I1VA 3H86A 3AP1A 4RZ3A 4YMSA 3EXAA 2PL3A 4RFVA 5EXPA 2CNWD 2PJZA 3AH8A 3SHFA 6Q21A 1OT3A 3LBIA 4PAQA 3U60B 1IOZA 1S3GA 1KY2A 2R6CA 1HA3A 2ZJ5A 4A9AA 4B44A 1VMAA 3AUXA 2W6IA 2P3SA 1TL7C 3AVQA 3SN6A 3KKOA 3U4QB 1RC8A 1JBKA 1NLFA 4GI7A 4OHWA 1KKMA 1AZTA 3EASA 3QOFA 2AL7A 2FFAA 2IYXA 2VP6A 4IOKA 5KSPA 3GLGE 121PA 3U7FB 3D7MA 2G0NA 3BD9A 3RRMA 1G5TA 4RD1A 4DDTA 3VX3A 1IN7A 1KK1A 2RHDA 3AEZA 2CLSA 3DOEA 1E2JA 3AVYA 4LDJA 2O8BA 2AXPA 3TE6A 5C4MA 4DLWA 3MAAC 1YR6A 4DIEA 4O3MA 1U99A 4JMPA 5FR1A 3Q5EA 4Q9HA 2IL1A 5EQTA 3H84A 4KXFB 5AR1A 1WE2A 1YRAA 3GEEA 3LWNA 4PAMA 1J90A 4LPKA 2HLDD 1MH1A 2PZEA 3NBZC 5H1YA 4C0LA 1NIPA 1Q1BA 4PHGA 3J81k 2TMKA 3CPJB 4GL2A 2WMOB 2DWQA 2ZJAA 3PENA 4RVCA 1JR3A 1T4GA 5FTKA 3O47A 4G1UC 3K0SA 5TDHA 2DHRA 3H2YA 1Q1QA 3QPVA 3GPLA 2RGBA 4IDOA 2QEQA 4YXWD 4RY2A 1HTWA 3KJHA 2A9KA 3RRNA 4OQMA 1U8AA 1RE0A 2CNWA 4DSUA 3FDIA 1TU4A 1DBSA 1O3YA 5CM9C 4IFBA 1FW6A 2D7DA 3KQNA 5FOSA 2ASEA 5G40A 4B3FX 5BYJA 4OKSA 3RABA 4KJZA 4A2QA 2OO7A 1DPFA 2XNDD 1M6NA 4P4UA 4HAVA 2WIAA 3FVQA 1SKYE 2WWIA 3H1TA 4NYJR 1XU4A 2H7VA 5GJWC 1XRJA 1YZNA 1E3MA 1NBMD 2QT0A 4EPYA 3PR1A 2GRJA 5FPYA 2RGDA 4DCTA 4DWJA 2DFTA 4M21A 2NO0A 4QFMA 4BFXA 3X1XA 3OAAD 3BAFA 4MA4A 4G5OA 5JI2E 3ASZA 3CWZA 4IOMA 2CHQA 5KPJA 4RZXA 3CF0A 4Q18A 1E0JA 1VCMA 2HLDA 2DPXA 1TUEA 1YR8A 4HLQB 2UZIR 3NBFA 4OYHA 1S8FA 2O52A 3A36A 4NCNA 2OFXA 4PZLA 2GCOA 2QG6A 5AUQA 2ZJZA 3UMRA 1QHYA 2JLUA 3R9XA 4YXWA 4CW7A 4C7OA 4HLCA 1GRQA 3EC1A 2IA5A 2Q9BA 4QHTA 2EYUA 2AFIE 3CNLA 5KHOC 4RZUA 3LLUA 2P6NA 3P32A 3WYAA 3MJHA 4PAOA 2XNDA 4OHVA 3KX2A 1OXXK 2D4HA 2XSZD 1T3SA 1ZAKA 5SZHB 3KFXA 4PFSA 5A5GA 4UNPA 4Q1DA 4TL7A 4OQNA 5CJ2A 4JLKA 4RD2A 1UDWA 2DWPA 4IVQA 4AKIA 4UNRA 1KI6B 1K8RA 1VYUA 1WXQA 4DVGA 4D26A 2IYYA 4M2LA 4US2R 2WWGA 3OAAA 1R10A 1YZQA 1ZP6A 3AF2A 4MGZR 4ZDWA 3VR3A 3VR1A 5LDDC 3GLFE 2BV3A 2CEAA 4ABYA 5FTMA 4PPGA 3GEIA 4BASA 4ZV4A 1Q1EA 4DLVA 2MMCA 3B1WA 3SE0A 3KXLA 4JLBA 4Z8YA 1ZNYA 1GNRA 1U8YA 1XX6A 2WHXA 2CLCX 4TMWA 4XOIA 5TV2A 2IXEA 3KTAB 1AGRA 4O25A 2G1JA 3AVUA 3QPUA 3U3MA 1KJZA 4ASUD 4V02A 1HY3A 2WJJA 4JSYA 2C04A 3LNCA 4IJMA 1RIFA 1E99A 3QXJA 4DKXA 5J4YA 4U00A 1MR3F 1Z28A 2F1RA 2ZRNA 2EW1A 4LHWA 2BBOA 4XTCS 4V0KA 1JNYA 1N0WA 2QTHA 1ZD1A 1S1MA 3TH5A 2ZJ2A 3K0CC 1E9SA 1HEIA 2HT1A 1NLZA 1ESNA 1KK0A 1UKYA 2IYQA 2JIZD 4QBHA 1RRPA 2YC2C 4Q19A 5CM8B 3T5GA 2ZREA 4MYCA 2XSZA 3CUEF 2F43B 2V8OA 3MD0A 1XMSA 1U0LA 3GJ5A 3UG7A 1E6CA 2EFDB 4QM7A 2FN4A 2AR7A 1EWQA 1ZM4A 3TR5A 5FL3A 3T1VA 1PJRA 4Q4AA 1XFAA 3IBYA 1P2SA 3BB4A 5GVRA 1E9DA 2N46A 3GQBA 3QF4B 4QRHA 2RKOA 1Z08A 1WA5A 1LF0A 3LLMA 3O8BA 4YQFA 1DG1G 1FX0A 1Q3HA 1U94A 2YOFA 1N6RA 2ZE6A 1Q12A 2ZI7A 3K1JA 4C0JA 4II7A 1CJMA 4ZIRA 2D2FA 2OESA 3ZJYA 5BW8A 5F98A 3EZ2A 1NJFA 2E1RA 4ASUA 2FG5A 1WF3A 2BC9A 2OCAA 1ETUA 1ODFA 1NSFA 1XWIA 3FKSD 1RKBA 1OXTA 2AWOA 4RKFA 5AUNB 2PX0A 1P2VA 2QENA 1ZUNB 1W46A 1GVNB 4PC6A 1FOEB 3SYNA 2J0UA 4YMVA 1HT2E 3GFPA 2G9NA 5FUXA 1E2IA 3PIRA 4YC7A 4XJXA 2YKGA 1VYVA 1SVSA 2JIZA 4LC0A 4A1FA 2PMKA 1KMQA 2GF9A 5DISB 4B35A 4PPQA 1SQ5A 4UKDA 4URWR 2DFLA 2ZRAA 5UKDA 4HZIA 1CBUA 2Z5FA 3QG5A 3BFKA 2NO9A 1BKDR 2LCFA 3RNLA 1HYQA 1UDXA 2V1XA 5JS7A 1US8B 1II9A 4EJSA 3ZGXA 3T06B 1EFRD 3RS2A 1E0AA 3QUSA 3HR8A 2HEIA 3CRRA 3V00A 4QC2A 2P6UA 1M7BA 3X1ZA 2NPFA 1BH2A 1P62B 4WVFA 3L43A 4MDEA 3QIAA 5IRCD 1CR1A 1E79A 1SKQA 1ZMXA 5FI1B 2Z83A 1WQ1R 2RGXA 4FINA 1CEEA 2FGJA 2ZI6A 3BOSA 2QBYB 1AS3A 4BLQA 1FTSA 3CONA 5KUTA 4CEHB 1PVOA 2P65A 5SZIA 2EFCB 4HEJA 5C18A 1ZBDA 4P4TA 2ZYUX 2OHFA 3LO5A 3GFOA 5LPNA 3K0AA 2RB4A 3BH7A 4LBZA 3RAPR 3CH4B 3WNCA 3VNVA 2IYWA 3C5HA 2DFKB 2OCBA 1WBDA 1P7CA 2R6AA 3C8UA 3ZVLA 2F1HA 5JJIA 1Z2CA 4A92A 2GDJA 1EX7A 4RD4A 1O87A 1RYHA 1UEIA 3TUIC 5JWRA 3QI2A 1MKYA 4BFWA 4MKHA 1NRJB 2XXAA 1W1WA 5CIWA 2JEOA 3RWMB 1AZSC 4ACAA 1YZLA 1GKIA 1KI2A 1GDDA 1U9IC 3K70C 4X8MA 3BK7A 1W36C 4V0ME 1S1CA 4IOJA 1EFRA 1RRCA 3SQXA 3KKMA 1Z22A 4PC1A 4D4MA 4K81B 2ZRBA 2ZXUA 4N1AA 3O8DA 1NNEA 3I62A 2V7QD 4TTQA 1XTKA 1NMZA 1Y63A 2IBMA 3RSLA 4JVMA 1GRNA 1TQDA 1N0VC 3F3YA 1OYWA 1UBCA 1NKSA 3THXB 5DI9A 4Q7MB 3UPUA 3A37A 3IIMA 4YONB 1G18A 3UANA 2XNSA 1XPRA 3KKPA 2C9YA 4KITB 3T1OA 2QAJA 1UBEA 2C5LA 5CYOA 5HPYB 2YC4C 2BHRA 1TEXA 5K8UA 3PJRA 4IDNA 1G3QA 2GILA 4YMUA 4FIDA 4HDCA 4PO8A 1LVGA 1OH5A 5HCIA 2QQEA 1I4DD 3OHMA 3ZZTA 1DE0A 2C78A 3JVUA 1H65A 4DHEA 5HZHA 4IDHA 4Q4HA 4HZUA 3KJEA 4FCTA 3G0HA 3RRZA 3AP3A 4I99A 4KCGA 2W0MA 2PH1A 2REBA 3UK6A 3FHOA 4D4KA 1P61B 3ZVNA 4RFSB 2Q3FA 2RGNA 4KVAA 1W4AA 1ZC3A 4HYYA 5A4JA 3DKVA 4MRVA 3IEUA 3OF5A 4OL0A 3SU8A 2QU8A 2CCKA 3SFVA 4GMDA 2V7QA 4B47A 3K0FB 5G3YA 4FXPA 5E3HA 1LFDB 4H1VA 3VKHA 4KFUA 4HAYA 4DLYA 4NTZA 2D06A 2H5EA 5KU1A 2JDID 3Q85A 1ZUIA 1VECA 2GWHA 4W5JA 2DCUA 1XXHB 2FEOA 2J3EA 1V43A 2YWEA 3IGFA 3K9GA 5A0FA 4M9QA 2QORA 1E0SA 1AJEA 2EU8A 3TSZA 3TAHA 1EFCA 1KSHA 2AK2A 2BJWA 2G77B 1KO5A 2ZRGA 3KZ1E 3C16C 4GPTA 4PO1A 4JVSB 3B1YA 3EIQA 4D81A 3KL4A 3ZDQA 1KOFA 2GNOA 3Q9LA 1M8PA 3K09C 4XD7D 3RS3A 3U44B 3KQHA 1FTNA 3OIUA 4JVLA 1Y3AA 4JZKA 1JR3E 1MRSA 3P26A 2QM7A 1W2HA 3B8HA 1Q1ZA 2CL6X 5J4HA 3M0EA 1ZINA 4ZO4A 5FL7D 2V3CC 1P3JA 4C2TA 2IEZA 4Q66C 1G64A 3HYRA 1R5BA 1I4TD 2FSFA 4KI0A 3V4FA 4Q9IA 1Q3TA 1SKYB 4DCUA 4YDHB 3HWSA 2I3BA 2ZRKA 1NG1A 4IXNA 1S96A 4MQBA 3M1IA 5AJYA 5DI3B 3UG6A 1KDTA 1U0JA 3EARA 1GRRA 3OIYA 3U3RA 2R2AA 3OFND 4ARZA 4HUQA 4AKGA 1XD2B 5KSYA 5HE9A 3UIEA 5J40A 2B7BA 2GBLC 3ZVRA 2ZJOA 3GFTA 3QXSA 4JL6A 5FPTA 2JLQA 4Z8XA 3PUYA 4JLNA 3ZQ6A 1XPOA 1RPZA 1CKEA 1SHZA 3THYA 2ECKA 2O8EA 1EG7A 2XTNA 3HR7A 2QL6A 3NHAA 4O2RA 1NVWQ 4M0LA 4UXJA 1IJFA 4E07A 1RVDA 1N6IA 2OFOA 4OK5A 2ZYWX 2JLVA 1NVVQ 3FMFA 3EPKA 5D3MA 2C03A 4P31A 2NO1A 1VG1A 1YJ5A 4D4JA 2WAYA 2VSFA 3PCRB 4Y0AA 2ZRHA 5FL7A 4NYIR 4QGAA 5AUOB 5JWOA 3UWOA 3GJXC 3UMFA 2BEJA 4PSAA 2A5GA 4C0KA 1YKSA 1ZM3A 3BGWA 1COWA 4MGIR 1OB2A 1C4OA 5TARA 4FWTA 3O8RA 2LKCA 1JEEA 1M7HA 1SHKA 2GETA 3C5CA 3THOA 3EZ7A 4AG6A 4DCVA 4QJ5A 1I2DA 3W8NA 4D2IA 4EKDA 1G8FA 1KGDA 4CF7A 2VHCA 2GEVA 4OHYA 4UXIA 1YR9A 3OFNA 1Z6TA 1GNPA 1OW3B 2GTPA 1DELA 1XEXA 2VQSA 4Q03A 2ODWA 2OM2A 4LJ9A 4P0TA 3GLFB 3A4MA 1ZM9A 4D0LB 5CLLA 1E9BA 3R8CA 2NPIA 4M1OA 3VR5A 4R98A 1KY3A 2A5DA 3IIJA 3IDQA 4ZCLA 4KO8A 1KJYA 1XNJA 2NO7A 1WRBA 2MMGA 3IHWA 3TNFA 4TMVA 5KDLA 2QAGA 5EUMA 2FPMA 1IY1A 4AD8A 4B75A 4HLUC 4I1SA 3LFUA 3OE7D 4WW0A 3TIFA 2DR3A 1G6HA 1OIVA 1P5ZB 4PHTA 2CVHA 1R6BX 3FB4A 3AKDA 1BS1A 2JLWA 2O8FB 2O8DB 1R5OA 4LHYA 3EA5A 2ZRPA 3HYTA 1XZPA 2IK8A 5FUYA 2WAXA 5FBRB 4EAQA 4JT2A 3W9YA 4NDZA 1J70A 2GJAA 2PZGA 4HDOB 1TAGA 1AQYA 1QHSA 2OILA 3CWQA 1PLKA 1J8MF 3E1SA 4BFSA 5HTKA 1GSIA 5EUQB 1UJ2A 1G8HA 4BQSA 2HJGA 2LWIA 2OLJA 1A2BA 2QRNA 4ILEA 4URVR 3B9PA 1L2TA 4I1UA 3VKGA 1DADA 1KK2A 3IHLA 4QHSA 1E2FA 2QRZA 5AWFC 3W8RA 3FMPB 1UKEA 1BYIA 2CJWB 1VG0B 4CEJB 4M1MA 4C0BA 4MITA 3D8BA 2XOKD 2J41A 4FI3C 5C4GB 3RRYA 4QJ3A 2DY1A 4EQ6B 821PA 221PA 2VF7A 4M22A 3CO5A 4BUJA 4EUNA 1YVDA 3FFAA 1OXSC 3RS0A 3CRQA 3A4NA 1UPTA 5DIFA 4IOLA 4LUCA 4JSTA 3QENA 3I61A 1F2UA 2YWHA 2YWGA 3OE7A 3PEUA 3X1WA 1XMIA 2V4ZA 2HF9A 4AIIA 4TQAA 4WA7A 1WP9A 1JXMA 3SR0A 3LXRA 3K70B 5DLQC 1W36B 3RC8A 1XTSA 2I1VB 2R6DA 1MRNA 2XX3A 3KXKA 4KLZA 4QXAA 5G53C 5EP4A 2ZR0A 4YLGA 5E4FA 2KBEA 3GLIA 4BPBA 1YRBA 3DPUA 3NG1A 3WRYC 4AG5A 1YZKA 1YZGA 3DM5A 3LAWA 4MGYR 1J7KA 1Z3IX 5FOXA 4CZ2A 2RMKA 4LJYA 2C9OA 1LW7A 2WJVA 2ZITA 3RLFA 1GAJA 1JJ7A 1KI1A 3MWLA 3B82A 2AX4A 4LV8B 4Q1EA 3SOPA 1VTKA 2QUZA 3GJ3A 4JBYA 1GL6A 2GZHA 2G1KA 1QHHB 1E9AA 2REXB 1ESMA 1KO8A 2GAAA 2VSXA 4OQFA 1IQPA 2IW3A 4CDGA 5KOYA 2D74A 4EFMA 3DL0A 2WPDA 4D80A 3ZLJA 2XOKA 3FMIA 1EK0A 1P9RA 1LV7A 2CVFA 3CR7A 2ZI4A 3IEVA 4HDQB 1YR7A 5DSZA 3A6PC 2Z4SA 3RYTC 4XIGS 4GP6A 4DCNA 3WBKA 1N6PA 4NP6A 4GFDA 3OESA 4PTLA 3U3KA 2MSDB 4RKEA 4UXHA 1L7VC 1VPLA 2JGNA 1TMKA 1VCIA 1Z6GA 1Z06A 2X19A 3SFZA 2J0SA 1TX4B 1SVIA 1P72A 2J1LA 3HJNA 5IK2D 4GP7A 3P4XA 4GOJA 2XGJA 2D7CA 3L0IB 1R8SA 2IUSA 3D31A 4LJAA 3VR4A 5L3SA 2PZFA 4TMKA 4HLDA 3ZYCA 1PLLA 1F2TB 1IY2A 3GJ8A 5KNBA 2HV8A 3E2IA 4M1KA 2ZJYA 4YDSA 3B1ZA 3LDAA 4IKEA 5GJBA 4CEIA 2ZI9A 1NF3A 1OH7A 1E2MA 3CLVA 3QVVA 2G6BA 2QM8A 3B5JA 3PUZA 4OJKA 2VP2A 1NN0A 1DOAA 3SS8A 3A58B 1CS4C 2W2TA 2C9CA 3LBHA 3U6KA 2Z43A 5FBWB 2BDTA 4M1TA 3KJGA 2AFHE 2JLYA 3CF2A 1MV5A 3W3ZB 1GWNA 4AYTA 2F9MA 2QTFA 4OI2A 1HURA 2EFHB 4JKYA 2ZSEA 1XPUA 1NN1A 2ZSDA 3EW9A 1H8ED 1SGWA 1OSNA 2FH5B 4BFYA 4EIWA 4PC7A 3QBTA 2YINC 3TVDA 1FMLA 5FBLB 4HAZA 4WXRA 2WWFA 5IK2A 4EJSC 3FHTA 3FE2A 1M34E 5KNCA 2V55B 4B48A 2R9VA 4XH9B 4AKEA 3PV0A 1B23P 4URYR 5FR2A 3LX5A 5JCZA 4GZLA 1NLYA 2VSOA 1SXJD 1JPNA 4B6FA 3OZXA 3PUVA 4B33A 1CRQA 4P4SB 2GXAA 2J7KA 4L4UA 2JAQA 3FYHA 3U7GA 3CRMA 3KKNA 4LHVA 4BFVA 1OXVA 4C0QC 1SVMA 1X3SA 1HUQA 2BOVA 2VO1A 4TLAA 2ZJBA 2K5UA 4WZ6A 1MT0A 8OHMA 4WAUA 1TNDA 2GXUA 4DLRA 3T1TA 1TQ6A 4QJ4A 2QPOA 3OEED 3R9WA 4DLSA 4KYIB 1E69A 4EPRA 5HKKA 2AWNA 3SJAA 1EESA 4D25A 1KSJA 1UFQA 4DLXA 2H57A 2PT5A 3H4MA 1A2KC 1Z5ZA 4M4SA 1ELOA 2HDNB 2FEMA 2O8BB 2BMJA 2VP9A 3HU1A 3UXMA 4O0MA 1FQKA 4MDFA 1SVWA 1E2QA 1H8EA 1Z0KA 1T8TA 1X8JA 4GZMA 5FI0B 2JJ8A 5KO2A 4IEIA 4B74A 1BOFA 4JJZA 1NSTA 5CB6A 2J0VA 5BN4A 3GMTA 1Q21A 2XZPA 3PQCA 4URUR 5CITA 3KQLA 1KMHA 1US8A 3EIEA 4Q00A 1OE0A 2BWJA 4B73A 1EFUA 2F6RA 4WXPA 1S9HA 1WCV1 5IF9A 1SXJA 4CVNA 2HXSA 2NQ2C 5E7IA 1G6OA 4URXR 4Y0VA 3U61B 4A8JC 3W6OA 1XDBA 2YOHA 4M1WA 3LH5A 3AVWA 2Y8EA 1YHNA 2GJSA 3DZDA 3PVSA 2QPTA 3EA0A 1QHXA 4R2HA 2Q9CA 3Q5DA 4E03A 1D8TA 4B2LA 3RS7A 3TRFA 3WXMA 1XD8A 4DJTA 3KUCA 3SBDA 4IVPA 5AJZA 1SVLA 3Q3JB 1N5LA 2WWWA 3GLHB 3S1AA 1E96A 4NH0A 3SJBA 3OEEA 2IT1A 3GP8A 1LY1A 1GKUB 2ZANA 1X86B 2F1IA 2PEZA 2X2FA 1RW4A 1T5LA 3I1FA 3GEHA 5EXSA 4TQUS 2W6JD 3L0SA 3ADKA 1AA9A 1IN6A 2V6JA 1RZ3A 2WM9B 4ZDIA 3IILA 4LJ4A 4F7WA 1Q0UA 3ZD6A 4DCSA 3LVQE 2A3RA 4ITRC 4LPSA 4DSOA 1I2MA 3C7KA 2IS4A 1XJCA 2H92A 3JZAA 5TVKA 1E79D 1W47A 1SVOA 3AV0B 4B34A 4IVRA 2XZLA 2OLKA 3AVVA 2KI5A 1ZD8A 4ZKEA 3NDPA 3U2QA 2GXQA 2HXYA 2GCOB 2ZETA 2C2HA 1E2DA 2DYKA 1AQUA 1J99A 2ZYVX 1G7SA 2A2ZA 4MRRA 1W48A 3WP1B 2UZ3A 5BWMA 4C7OB 1G4AE 3L8ZA 1N6LA 1S3SA 5CLQA 4PR0A 1G3RA 1WMSA 1N2CE 4JLPA 3RVBA 3P1JA 2IYTA 2ZS8A 2ZU0C 2WKRA 4HB2A 2A7QA 4JLMA 4MKGA 5JHHB 2P6RA 4JJKA 2R44A 3ADDA 2H1LA 2VBCA 1RFLA 1G20E 1OFHA 2QPAA 4Q7JB 5LB4A 1G291 1YQTA 4RCYA 5EZ5A 4OHZA 1VHTA 2OAP1 721PA 4TMZA 3WBJA 4A6PA 3SDZA 3NTUA 4QBIA 1YU9A 1CF4A 3B78A 3C41J 1VDZA 3U7HB 1AKYA 4PHHA 2W6JA 3OIVA 2ORWA 2CMKA 4A2PA 2V1UA 1P60A 3AVOA 2CDNA 2VHJA 1DTSA 1CJUC 1EFHA 4HUTA 4M53A 1VIAA 4QG7A 3QKTA 3KDSE 4JIMA 1ZNWA 1FNNA 3LQQA 4DLZA 4L5BA 1CRPA 4NCKA 1EXMA 3IUYA 2P2LA 2ZS7A 2IEYA 1IN8A 4RFSA 4FD2A 1P6XA 2GK7A 1JXOA 2O0HA 4EPXA 2ZRLA 4MRPA 3B7GA 3K9NA 5G41A 2GKSA 3X2SA 3MWJA 4D0NA 4TYNA 5FPSA 4BFTA 4CIDA 2OXRA 1NMXA 4V0OA 3KUDA 1JAHA 4BEBA 1W44A 2Q3HA 3TSOA 4C4PA 3LD9A 1CLUA 1G9XA 3CX6A 1OIWA 1CR2A 3I3SR 4KFSA 1UBFA 1XXHA 5JSZA 3L82B 1KI7A 3WNDA 1N6NA 4IRUB 2Z4RA 3VU9A 4DB2A 2HF8A 2GJKA 2IX3A 2X2EA 2HUPA 2ZUBA 2ZRJA 3ZZ0A 2J46A 1HQYE 1P9WA 2FSIA 5IT5A 4Q4AB 2WTUA 5IDVA 3U44A 1J2JA 4E22A 5K8TA 1X8LA 2VHQA 1E2HA 4BZXA 2EWWA 5JLJA 2GCNA 4LOAA 3TAUA 1XJQA 4DUGA 1GL9B 4OI0A 1FX0B 1R0ZA 1W0JD 2ORIA 1GNQA 4G5RA 3X1DA 4AY2A 1CP2A 4NCJA 2ONKA 4PC3A 2FA9A 1CTQA 2XTMA 4V03A 3WRXC 2CE7A 3VKWA 3NBYC 4GDFA 2NO6A 2GXSA 3ZH9B 2Q9AA 5E7MA 1FP6A 4JYBA 2NTYC 1E9EA 2PMDA 3PXGA 4CRWB 1KO1A 3KFVA 3ASYA 4BWYA 3CPEA 2QMUA 5C46F 4J0QA 3CW2A 4TLEA 2VP5A 5AJXA 2EFGA 2J0UB 4AI6A 4LV5B 4M9ZA 2F9LA 1IHUA 3NEJA 4NZYA 1YZTA 3GLIE 2IWRA 2VL7A 5P21A 1GG2A 2WOJA 2NZJA 1E32A 2D62A 2QAGC 3Q72A 1QG4A 1KI9A 1TF7A 5EP3A 5G3ZA 1KDRA 3PUXA 3C15C 4PQFA 1G8PA 1FNMA 1DEKA 2O0KA 3BERA 4EFNA 4B71A 1TU3A 1OH8A 1MO4A 3SBEA 4JS0A 4US0R 2C95A 4AYXA 1TEVA 2QN6A 3A1WA 3RHFA 4JBXA 3TR0A 4EJSB 2BIFA 2C8VA 1IONA 3W6NA 3GLGB 2B8WA 4Q4JA 2H18A 3AKYA 2ZSFA 5DGXA 1KZGB 1E98A 1JJVA 1W0JA 2Q3MA 4Q5IA 1MABA 5HZKA 2ZSBA 2RH5A 2OCYC 3DOFA 4TYQA 1PZNA 2X1VA 1HV8A 2FX3A 5KSOA 2WKQA 1ZM2A 1Q20A 2WICA 1ONBA 3T5DA 1BIFA 4UNSA 2OZEA 4DLTA 1E94E 3SNHA 5KNDA 1G4UR 1ZU4A 1PUIA 3ZVMA 1X8KA 3LBNA 2ZRCA 2ONJA 3I8XA 3NIBA 1BMFD 4US1R 2KWIA 4FWIB 1TPZA 1W49A 2I1QA 1RJ9A 2CCJA 4PZYA 1G8YA 2FWRA 3AF4A 3EC2A 4JLDA 3GLFA 3U5ZB 4NL4H 5GADl 1R0YA 4JL8A 4Q02A 2QA5A 2WV9A 2FZ4A 2YVUA 1TQ4A 3REGA 1Q22A 1ZNZA 2B7CA 3B9QA 1VIYA 2KE5A 1G3IA 2XXAB 4RSGA 1M1YE 2FOLA 5M04A 2RGEA 4AKHA 2ZPTX 2OV2A 3FGNA 1FQJA 1NI3A 3BS4A 3K9LA 1MOZA 3Q7PA 5BYKA 3U7EB 1COWD 3EAQA 3QQ5A 2BCJQ 5E95A 4QBGB 5L3QA 3VR6A 4TLDA 2R6FA 4DT1A 4GNKA 2GZAA 421PA 3K9HA 4LV6A 4Q7KA 3FWYA 2N42A 2O8DA 2J87A 2ZJ8A 3B2EA 1AIPA 2ATVA 3A8TA 5LBIA 2XEXA 2AKYA 1G7CA 3LV8A 3B13B 4TT3D 5CK5A 4Q9JA 2QP3A 4W5HA 4A0FA 4AK9A 4B32A 3I8SA 4FMBB 4L9WA 3BB3A 1N6OA 4AURA 4A8JB 4E09A 2FE4A 2ZI3A 1YZUA 4ERNA 3QKUA 3WHKA 1XTJA 2QY9A 2N1BA 2WKPA 2A5FA 3N70A 4K46A 1LS6A 4LJ8A 4RZ2A 1G17A 4MUBA 2IXGA 3VR2A 2BBSA 4D4LA 1NVVR 2WOOA 2O5VA 1ZM7A 2BBTA 3T35A 4ESHA 3FFBA 4F93B 1KK3A 2UKDA 5JFGA 4TYWA 1BMFA 4P3YA 2BM1A 4A0HA 2W00A 2RGAA 1GILA 2D3WA 4MYUA 1N5JA 1OJLA 4LRWA 4TTPA 5FTJA 3HP1A 2WMNB 2J5XA 3AGPA 1F48A 1II8A 2CHVA 3DO6A 4CEJA 3R7WA 4Z54A 3WNBA 1ZVQA 4URZR 2PLFA 3VAAA 4TN1A 1T0JB 2IF2A 4ON9A 1XBTA 4LYHA 2AKAB 3CZQA 2DB3A 3U3OA 3THWA 4LJ6A 3N2EA 2O8CA 2CLDX 2NZ8A 3U3JA 5JECA 2PCJA 2P67A 1F3OA 4QBFA 2IYVA 5JJKA 4GBMA 3I5YA 1KO4A 1W5SA 5AJWA 2IS6A 4ZI2A 3AGQA 1OYYA 4C0SA 4CT4B 2EQBA 3NH9A 4X8HA 3TQFA 2IYUA 4G5QA 4ESVA 3ZD7A 3TGPA 4IW3B 1NVUQ 4TT3A 4F92B 2F3RA 2XITA 3QNUA 4NMMA 5LD2C 4LHZA 2QE7D 4AWXA 3QKSA 2VTKA 1NJGA 4TL9A 1IBRA 1CR0A 2RAPA 1U90A 2YJTD 2ZUCA 5EZ6B 2Q6TA 3AKEA 3CIOA 4DB4A 3NHBA 4RD6A 3TBKA 5DHAA 5B64A 2VRWA 1S2MA 1GIAA 4PPFA 3U4QA 3F8TA 3BXZA 2DBYA 3OIWA 3QKRB 2XJ4A 3P4YA 3RWOA 2ERYA 4G0NA 4JLVA 1AS0A 1SXJE 2ZVQX 4UNQA 3BC1A 4BGDA 4M1SA 2J0QA 3QY0A 2FU5C 1NY5A 1KI4A 1HE1C 2CE2X 3IPYA 4H1UA 4P32A 4IHQA 1U98A 4KVGA 4Q1BA 4TLBA 3UWKA 2PCLA 2AK3A 1BO6A 2FSGA 2XB4A 4TZ0A 2WWYA 2IWHA 5JRZA 4PSVA 5DYIA 3BJIC 3TK1A 3CRVA 2FSHA 1G7RA 2Q0HA 2ZRFA 1XTIA 3PFIA 4KU4A 3DEFA 4N3NA 4EPWA 4OQXA 3QF7A 4HAXA 1G7TA 4I4LA 2AXNA 4ARZB 4PANA 4CYMA 4FW9A 4HUQB 1OF1A 1II0A 3HU2A 4YMWA 5FOWA 2ANCA 1DAMA 1HT1E 4RJLA 2FDCA 2QE7A 1G16A 1F5NA 5EJEA 2KSQA 3D6TB 3SQWA 1OHHD 3CB4A 1G21E 2WPDD 1RRFA 5FH9A 2ERXA 1CIPA 4LWZA 1UF9A 4QGGA 4DDVA 4E5UA 1YE8A 5FTNA 2W83A 1KI8A 3THYB 3WY9A 2O8EB 2ZVPX 4QL3A 1GL7A 1ZJ6A 2GJ8A 4BRUA 1JQJC 5EE9A 5DH9A 4JT4A 1KSFX 3SYLA 5JEEA 3KQUA 2Z0MA 3IKJA 5D3MB 5GVSA 2WSSD 4XWOA 3I92A 1ZUHA 1JQLB 1GITA 1QHIA 5CK4A 2IS1A 3BH6A 2GF0A 1L4UA 2BEKA 2FZLA 4X8LA 1P75A 1GFIA 4LSGA 5JWHA 3MJRA 4NYMQ 2F7SA 4DBLC 2VF8A 2B21A 1W5TA 4PZZA 1HE8B 4Q48A 4L15A 1E1RD 5FBQB 1E9CA 2R6GA 5KDDA 4TWZA 3CNOA 3IPXA 1W7AA 3SJCA 2R62A 1D5CA 3KB2A 2GVDC 3N2IA 1ZIPA 2VLIA 4CT5A 1VCNA 2IYLD 4OI1A 1S0UA 5ELXA 1F60A 1XEXB 3BRWD 2D2EA 2H16A 2JASA 2JJ1D 1OHHA 3FPAA 4KV9A 3TMKA 3QBVA 4I1OA 1T3HA 4F4JA 2QMEA 4OHXA 2DFNA 1G5PA 2C99A 3WP0A 1LNZA 1NMYA 1H8HD 1Z83A 5JMTA 5JS8A 2ZR9A 1V5WA 2JLSA 2ATXA 4P4SA 3VHLB 3VMFA 2XB2A 1W2GA 2QAGB 4W7SA 5FOVA 1GOTA 1N6HA 1GKYA 3A1SA 5FFMA 5CDFA 5FBVB 3BFVA 3QXHA 2A5YB 2WSSA 5JEDA 4NCIA 4KBGA 4B3BA 1Z0JA 4KBFA 3R9IA 1DAGA 1ZD9A 1E4YA 1AN0A 2JCSA 1XB2A 2OG2A 1TUIA 1Z07A 2CHGA 2H17A 4V0NA 3RS5A 3RSOA 1XEWX 3REFA 3AF3A 1KI6A 1JR6A 3MLEA 5EP1A 3B6EA 1KDPA 3A4LA 5DO9A 1X1RA 3AM1A 1KHTA 3KB1A 4M1YA 1E1RA 3C14C 3WMFA 1OB5A 1Z0AA 1LF5A 1XCGB 2RGCA 1XXHE 3MRSA 4FMCB 2EWVA 4DXAA 2E9SA 4DDUA 2IUTA 2QQ0A 3U6BA 3PEYA 4TZ6A 2GZDA 2FJUA 2QSYA 2OT3B 4A0RA 3EWAA 2PT7A 3KTAA 3UATA 2NG1A 2G83A 3NBXX 1KAOA 2JJ1A 1KYIA 3JVVA 4WBSA 3EX7C 4LJ5A 1NY6A 4XVQA 5CYPA 1ZRHA 2HYDA 4TMXA 4X8OA 3OEHD 5C2JB 2AN9A 2BBWA 1DAIA 1T3LA 1P73A 2VP0A 4FCWA 1H8HA 1CJKC 4QNRA 5HKKD 2IHYA 5LB2A 1G1MA 3LQRA 2IXFA 3T61A 4WOPA 5CB8A 4LBVA 1C9KA 5BQ5A 4IEEA 3V9PA 1N5KA 3BH0A 1DVRA 3KQKA 1F2UB 2ZE5A 4BZPA 2P5TB 4S2EA 4NCHA 1I4LD 2PLRA 3VFDA 2ZQ5A 2F43A 3GLHA 4HI0E 2IYRA 1R0WA 1A7JA 3GJ7A 4XTRA 4HLUA 3CH5A 4GSYA 4DIDA 3ONWA 2BJVA 2J59A 5K8IA 1CR4A 4QM6A 3SI7A 1UM8A 5FPKA 1K5GA 3CBQA 4A4DA 1QRAA 2BMFA 4KSBA 1NG9A 1CXZA 3TSWA 1T9HA 3DZ8A 3VHXA 4KYUA 4PX9A 4IDPA 1JB1A 4NYJQ 1ZCBA 3GLIB 3AVTA 3QF4A 4TYYA 2XJ9A 2W2XA 4HSEA 521PA 621PA 2B92A 4M8NE 2IYSA 2OUKA 4JVNA 2F3TA 2W2VA 4AYWA 1U8ZA 2ZAMA 4LC1A 2ANBA 4QGFA 4JLAA 3ZS9A 4BLSA 1T5IA 1JI0A 3QXCA 3TUZC 3HDTA 1D6JA 1QHNA 4DEYA 4M9XA 3CX8A 4EDHA 1NVXQ 3WYGA 3NVAA 2SHKA 3NC1C 2HJVA 1ZW6A 3VTKA 4TLCA 4LGMA 2V9PA 1SVKA 3OEHA 2XTZA 2J45A 4BLRA 4OK6A 3I32A 2ZR7A 3QE0A 4XSGA 2QGNA 5GJVC 3TW8B 4BFUA 1OV4A 1CULC 1FP7A 4B2PA 4QHYA 1L8QA 2QMOA 3DM9B 4A36A 4KHZA 3CF6R 2FFQA 3T34A 2QMHA 1E2KA 5EXTA 3SHWA 1OKKD 2OE2A 4A2WA 2FFHA 2G88A 1EFTA 2MSEB 2BMEA 5BN5A 2JLZA 3A1UA 5BN3A 1A5TA 5F9FA 3KJIA 3MSXA 2C96A 4GRAA 1RRGA 4R71A 1NBMA 1A1VA 1E2EA 5L3RA 1MO3A 3AUYA 1NN5A 4OBEA 5JCPA 2AD5A 3I4LA 4Q01A 1Z8FA 4BECA 5H68A 4D82A 5L3SB 1P4SA 2ZSAA 4JLJA 2A5JA 3AVPA 5J5CA 4YMTA 5LD2B 1B0UA 1FL9A 1IAQA 4FN5A 1RYFA 2G0TA 3ADCA 3VNUA 4HB4A 2QSZA 1ZC4A 4LBWA 4TL8A 4CEIB 5GJCA 5JHGB 1Z29A 4WZAE 3ADBA 3MMPA 2CK3D 4JBWA 2V54A 2QBYA 4XSHA 3CPHA 4ZI3A 1GP2A 4RD3A 4CEHA 2DWOA 2WWHA 1FPMA 5C1BA 1QBKC 2GEUA 2WVJA 2RHMA 1QG2A 1UADA 2ZE8A 2VIIA 5DHFA 5TY0A 3DVLA 1VYTA 1X1SA 1N0UA 1W0KD 1LS1A 2ORVA 2RCNA 2C98A 3CX7A 3IQXA 5FUVA 4XVRA 3ETLA 1OKKA 4G5GA 4B3XA 1KDOA 1XEFA 3W6PA 1EX6A 3DMDA 1XD9A 2VYFA 1FFHA 4L16A 4RD0A 4UJ3A 2RGNC 3MGCA 3QEJA 3QG1A 4EFLA 4CGZA 4W5WA 1Z0IA 1CJTC 1DS6A 3QVUA 3T1QA 1IJEA 1KNXA 2QI9C 2XAUA 4C0AC 1CU1A 3CR8A 3A1VA 5EE5B 1A4RA 1R2QA 5H70A 3DMNA 1DAFA 3ECCA 1GM5A 1KAGA 3L8YA 1E9RA 3IQWA 2ZE7A 4ZKDA 2GJ9A 1XCMA 2CK3A 1XZQA 3THXA 1G5RA 4GOKA 2ODEA 3RS4A 4KFTA 3BFXA 3QXXA 3EG5A 3BORA 4MYTA 1TTTA 4HATA 1KZ7B 3BBPA 4WIAA 2ZRDA 3ICQB 5F3WB 1W0KA 1T8UA 3IIKA 2FMXA 4LK2A 5HR5A 5EE1A 1M7GA 2OAQ1 4GMXA 5J4KA 3Q8XB 2VHUA 4Q1CA 5F2EA 4AC9A 2HT6A 4JKIA 3TW4A 4DUGD 3GD7A 3K0EA 4JL5A 3K53A 2Z6VA 1JAIA 2CL0X 2OBLA 5JJLA 4FMDB 5L8VA 5B57C 2KBFA 2W58A 1XTQA 4ZCIA 1QVAA 2YOGA 1AK2A 1KMHB 3G5UA 1N3BA 5SZJA 4W9MC 1BYUA 3MCAA 5TMPA 3GLGA 3IBGA 2BCGY 1Z63A 2BKEA 4Q9KA 3WMEA 2X8AA 5EXXA 1SXJB 1Z6XA 4BFZA 1VG8A 3L0PA 3K0FA 3NKVA 4NONA 1E0KA 5J47A 3FOZA 1Z2AA 4DSTA 3DKPA 1N25A 4L9SA 1KTVA 4TTRA 1Z47A 2R65A 1A82A 1XJ0A 4U02A 3ND8A 2WJIA 3EZFA 4F38A 1U81A 3AKCA 1SZPA 1XF9A 1MO6A 3CKLA 3PUWA 3M6AA 4Q7LA 3EWSA 1OFIA 3FKSA 3FMOB 3S1AB 4A6XA 5BXQC 5H8WA 3ICEA 1D2NA 2ZIAA 4B3GA 1XMVA 5AUPB 1XTRA 3JZMA 1J8YF 2NGRA 1XEWY 2QTVB 1G3UA 3PEVA 4O2LA 3WYFA 4PSKA 5FPHA 3NDBB 1UEJA 3NXSA 2JA1A 1W4RA 3F5FA 4R9UC 4UJ5A 4Q9LA 3SZRA 4EPTA 4LX0A 4DDWA 5ANRB 2X77A 3CRW1 3I5XA 1PV4A 4A0GA 4TL6A 5HCNA 3MFYA 4HB3A 1QHGA 1IY0A 1F6BA 4ZIRB 1P9NA 3SYKA 3MUFA 1TF5A 3FHCB 4OQLA 3P27A 4KAXA 4F4IA 3K8YA 5KPDA 5JZVA 2NIPA 3W5IA 3EZ6A 1M74A 1E1QD 1Z0DA 2HYIC 4FMCF 1M2OB 4B3CA 4LHXA 4MYHA 3E5HA 2FGKA 1D2MA 4V0LA 4OK3A 1E9FA 5DI3A 4PQRA 2OBNA 2OFWA 5EE3A 3EPLA 2QROA 1XD2A 1ZU5A 3CZPA 3EPJA 3KKQA 5FOUA 4PQYA 1K5DA 5CJPA 4Q21A 4F4CA 1FUUA 4A8JA 1FUKA 2UVQA 2AHOA 4LBYA 1OIXA 2QGZA 3K0CA 5E7JA 4C3ZA 4DRZA 4ZDJA 4GT1A 1EWRA 2H8KA 2OXCA 5B58C 5KSZA 4N0EA 1G3MA 1E2NA 2E87A 3V4RA 3EPHA 1N5IA 2FFBA 5IHPA 4OI4A 3L0OA 2VH5R 3LX8A 1VCOA 4IDQA 1LTQA 1TQ2A 3E70C 3R20A 3AF0A 1XMJA 4QKQA 4B76A 1IN5A 1UKVY 3FTQA 4OJQA 3TJZA 1AGPA 4G5SA 4Q1FA 3HU3A 3LVRE 4UNNA 3WHLA 3AP2A 3NEYA 4A15A 1WDTA 4HAWA 5DN6D 4Q47A 3SJZA 1OH6A 4C9BA 4WZBE 3LW7A 4G01B 4NPHA 1DO2A 3GJ6A 3TLXA 1N6KA 2ZTSA 1E1QA 3BB1A 3DDCA 1WB9A 2OCPA 2EFEB 5CDFE 3B1XA 2WWXA 2I4IA 1MO5A 3Q7QA 5K8LA 4BLOA 2BKUA 2VHTA 4MH0R 1D9XA 3K0AB 3LRPA 1NKTA 3RC3A 5AK0A 2NMVA 3VQTA 1GZSA 2R8RA 1T0HB 4TSFD 2VP4A 4NU0A 4NKRA 2YHSA 1KSGA 1WBBA 4L8GA 3DHWC 2G3YA 4D0GA 4DC9A 2VA8A 4B3DA 1JPJA 2IF0A 4DEXA 2L0XA 5JSZB 4QGHA 4D6PA 1QZXA 4JLOA 4PC2A 4R2IA 5SZKB 4P33A 3B1VA 1OXUA 1OPXA 1EGAA 3VU9B 3ZQJA 4BLPA 1JECA 2QP4A 2V6IA 1VG9B 2F55A 2QP9X 1S4QA 3UKDA 2J7PD 3ND9A 1T6NA 4H9GA 3QKRA 3VX4A 1ZNXA 1E2PA 1G19A 4M9SA 2O8FA 3ZS8A 2IUUA 1P2TA 4BE7B 3LA6A 3K70D 1UKZA 1W36D 1R8QA 2YNMA 5EE0A 2GCPA 1OFTA 2KB0A 3W3AA 1GTVA 4U7DA 5DN6A 3EZ9A 1NL3A 4ZDKA 3L2OB 4GOXA 4KFRA 1K6MA 5FOTA 3F0TA 1U0HC 1QVRA 2ZYTX 3AVXA 1FZQA 3HPRA 4PHFA 1SULA 1NIJA 2C77A 1NN3A 2PBRA 2Q21A 2XZOA 5FUWA 3GLHE 3H0KA 3T15A 4Q1AA 3NWJA 4MRSA 4XWAA 1TADA 2WJGA 4PPNA 1D2EA 4NBSA 1Q57A 4TSFA 1UBGA 4DSNA 1KNQA 2P0EA 2JDIA 2J9RA 3TKLA 1KKLA 1KIMA 1IXSB 1VHLA 2CJWA 5EP2A 1CJVC 3MWKA 4XVUA 4UQOA 3R8FA 1AS2A 2JLRA 4LJ7A 4NHOA 2IS2A 3O8CA 4KSCA 2GEDA 3NC0C 5J4VA 4XWKA 4EQ6A 4Q4HB 1JEDA 1Z6YA 4HZUB 5F9HA 2AD1A 3A1TA 3ZIAD 2B8TA 2FV8A 4BRWA 1X6VA 4MRNA 2ZRMA 3IO3A 1HH4A 1UAAA 1XCPA 3TUJC 4JYCA 2CXXA 1DO0A 1ZYUA 4Z1MD 2ZS9A 3T12A 2J7PA 5JRJA 4BLTA 3CM0A 3LY5A 4XD7A 4BZQA 1VKJA 3C4JA 2EYQA 4Q4JB 1U9IA 1R4AA 1QDEA 2ZAOA 1P2UA 2ODBA 2WJYA 5B30A 5D3QA 1G41A 1AM4D 1LB1B 2VEDA 3GJ0A 4RCZA 2GHIA 1MABB 1DAEA 3NH6A 5J4LA 3MWYW 1GUAA 4N0DA 2CBZA 4EPVA 1ZCAA 1KJWA 2B6HA 2O0JA 2ZRIA 2YV5A 4NYIQ 4B43A 5KYKA 4LYJA 1D9ZA 4K8OA 1XP8A 2ZU6A 2FF7A 2KJQA 1W4CA 3ZZUA 4LI0A 2HCJB 4U5XA 4FCVA 3W90A 3WMGA 1QHHA 4LYAA 1KO7A 1NBME 1L4YA
chains in the Genus database with same CATH superfamily
4FLFA 4O4LB 1ZJ5A 2PA0A 2LKDA 4C30A 3MCWA 5COQA 2W11A 2ZTMA 3NBAA 2XCOA 3TN7A 1FLVA 3JY6A 3WHPA 5ITZA 4DZZA 3DAOA 1H2EA 3OZ7A 4JP3A 3K1AB 2QN9A 1E4EA 1WB6A 3RSHA 5DNWA 4QNMA 1W5FA 1PLJA 1PUXA 2F67A 2HLNA 3Q7IA 3W5DA 4Z1MA 5F2OA 2ST1A 1R0XA 2G82A 4NS1A 5IJZA 4YT5A 3PEWA 4RTQA 3PTAA 3DYIA 3WNZA 4RXUA 5FV4A 4U7GA 2IC5A 2HSGA 3QVXA 1M9NA 5CEJA 2C4MA 1JB9A 1MP0A 1NR1A 2A6PA 4HN9A 4ALIA 2H59A 4DLPA 1HQCA 1OFUX 3NHFA 2IV2X 4NJMA 2C2KA 1ISMA 2OBMA 4FGJA 2CUKA 2REOA 1E5QA 1ECCA 4L73A 5LBUA 5A9TA 3STVA 4FFOA 4D8WA 4DV0B 3E5RA 1TZBA 2MTBA 3L7IA 2VUUA 2NT4A 4YRPA 1ULZA 3VYUB 4QOSA 3SF8B 2HK7A 4M3NA 2IHBA 1JSLA 4BVJA 5K0JA 2VI5A 2ZJFA 1WP4A 3GZJA 4MW7A 1QIKA 2GK6A 2REQA 2WBLC 4F60A 1WD7A 3LG2A 3HPQA 3A3YA 3D0QA 2IV7A 4TMTA 4YPFA 2PAAA 1C0PA 4LS3A 4OLJA 1EUZA 2P9EA 4TYPA 5DE3A 4EA7A 4YPVA 5KDOA 4MUAA 1N9GB 5H59A 4N01A 3EFHA 4LCBA 5TNXA 4Q4LA 3HMKA 4KAAA 4KPYA 3H2ZA 3S4YA 3NV9A 4I1PA 3L4SO 1WMFA 2RGRA 4FOTA 2ENUA 1WIWA 1RM0A 5DNYB 2JKVA 4KVFA 1BXRB 1II8B 2HI0A 3IA7A 1GYPA 2PT9A 3HVHA 5LMZA 1AKNA 4UU7A 3PQ7A 1H1DA 1IXRC 3QJYA 4PRLA 4D3FA 3K09A 5FNVF 5KKNB 1RAGA 1W88A 2NXWA 5EHNA 2GAOA 2PBLA 3OBIA 1KVRA 4HP8A 4LNUB 4TLLB 4F91B 2ZUDA 3QU7A 3RFTA 2PL9A 4ACBA 5K4AA 2OP0A 1RRMA 1RWKA 2CCGA 2YY7A 3HYCA 4J0FA 4RDHA 3KB6A 3THWB 1YDGA 3NTOA 3BIFA 4CUZA 2F48A 1LU9A 2OVFA 5JD5A 4PNHA 1ECBA 5JSKA 3G0BA 1P1FA 3BWDD 3ZDFA 5HSGA 4G24A 1RYDA 2ZIVB 4EW1A 4F4FA 1AO0A 4DIUA 4FFLA 4KR2A 5B2ZA 4AUKA 4NZMA 4F85A 4KQXA 3KNZA 1R18A 3GJ4A 1QO0D 2ODNA 4IGKA 4HB0A 3LK6A 2XYRA 3B60A 2B61A 4JOSA 3M4YA 4OAPA 2A1UB 1LJUA 1X7HA 2IYZA 1DG3A 4PHCA 4CG3A 3W34A 4DA8A 2O3TA 4S35A 2ZM5A 1C1YA 2PSEA 2WD8A 2A30A 4QWMA 3RDPA 3W7VA 3VZRA 4BTVA 3EOZA 2RAFA 4MV8A 1SC9A 3OTQA 3BE4A 1ZGGA 3LA8A 3T52A 2JJ2A 4EO9A 3H86A 1X0XA 3AP1A 4RZ3A 1NJ2A 4G8JA 2QTZA 3EXAA 2EEZA 3A2KA 4MPJA 1PWEA 4RFVA 3RASA 1KE1A 4CM9D 3AH8A 4JK3A 4D9BA 1KMCA 1OT3A 1Q2UA 3LBIA 3RBVA 2JAWA 1WQ4A 1KY2A 2BGUA 1HA3A 2R6CA 2WU8A 3EH2A 3OOJA 4LY9A 4A9AA 2VAWA 2PMFA 2W6IA 4B3TB 2CF6A 1TL7C 3HDVA 4AX4A 1RC8A 4KQ1A 4OHWA 4HRAA 5B58T 1AZTA 1QWOA 2KQUA 2IYXA 4GO1A 2VP6A 4IOKA 1P1BA 5EJMA 3GLGE 3WGMA 5BMVB 2XCQA 2E4YA 2RIPA 1URPA 5IMBA 1FFYA 1JV2B 3IDFA 2NO4A 1DJMA 4UZEA 3S2FA 4NG4A 4R8KA 2RHDA 3AETB 2EAUA 2Z9CA 3T7RA 4Z5XA 1RI2A 4WJKB 3JZIA 3JASB 3FLBA 1H66A 3KOUA 1FDRA 4D9HA 4LDJA 2O8BA 3CHYA 4KDFA 4KO2S 2GBIA 1DXYA 4DXDA 1YR6A 4DIEA 2JS7A 4O3MA 3D8HA 2C1ZA 4LMPA 2ZOSA 2COKA 4BB0A 4PM4A 5E4YA 4F97A 4J0IA 4PGMA 2KLHA 1P74A 1N3YA 2UVDA 2JKYA 4FUTA 3ZR4B 1JVNA 3GWZA 3A9SA 3I9V6 1YRAA 4GGPA 4M99A 1CUZA 1TUGA 1T36B 2YWDA 1D09A 1CUGA 1K6JA 1NKVA 2HLDD 1MH1A 2PZEA 3QLTA 4F6RA 1N92A 3AO0B 3L7BA 1KR5A 5BRAA 3QSGA 3F1LA 3VYTB 1NIPA 4PHGA 2WYOA 3FNIA 4LN1A 4IQFA 3PRYA 5EPOA 5LNK1 3MINB 3K5IA 5EZYA 3USCS 4FOOA 2BFCA 3I8OA 2XWQA 5HILA 3K05A 5TDHA 3LGSA 2DHRA 3QPVA 3HSSA 4EITA 1ZOSA 2FPGB 4K9NA 1BNCA 2HZBA 4GYKA 2YR0A 4ZMSA 2CNWA 2HWUA 3ZJ5A 2Y6VA 1DBSA 1O3YA 5CM9C 2O3RA 3TZQA 4C6RA 2WQ6A 2FPRA 4BNDB 2DBQA 3KQNA 5FOSA 5TQJA 5G40A 3F6CA 1WMEA 4LF8B 3RABA 4A16A 3B36A 1K7CA 1M2EA 1RQGA 2FQWA 2R8YA 3CEAA 2OO7A 2V0NA 4EO4A 1QUFA 1NWHA 5A0VA 2AVDA 2P2NA 1J0AA 1RMQA 4EHJA 1X1EA 4HAVA 1UZUA 2WWIA 2X0FA 3GK3A 4RORA 2PKQO 4LA4A 1EFDN 4KIUA 1LI7A 2PKQP 3MNFA 4QXRA 4RHEA 1TJNA 4RIGA 4CMBA 1TLFA 1CEXA 3HEAA 3UICA 3IX7A 5BVGB 3DEAA 5ECGC 1QU2A 2R751 3K4PA 2G36A 2DFTA 1L7XA 4EUSA 2JIOA 3AC0A 4MAFA 5K0SA 3GRAA 4OM7A 3HM9A 2HBZA 4ZO9A 3FSEA 1LBEA 5DBHX 2BKXA 1WULS 3CLRC 3PIDA 1RP7A 1UJ5A 2J48A 3PC6A 4XGRA 5JI2E 1ISIA 5JH7B 1GY8A 1JHYA 5KPJA 3KQPA 1X39A 2GNPA 1MFPA 1V7PC 2R5NA 4AMUA 1E0JA 1NI5A 4LDQA 3ZQ4A 1TUEA 5HZGA 1JH9A 2OBBA 3NBFA 2B37A 3WKDA 4GBED 3U4GA 1CR6A 1KAQA 3H65A 1OWLA 2OFXA 1TCCA 1OGYA 5I9TA 3JTMA 1FP4B 2R0QC 1ZG3A 1VKZA 3F2IA 3F98A 1TFRA 5LUBA 2IA5A 1SVNA 5FO1A 2ESRA 1BDBA 3IDOA 3GNSA 2X14A 2O3UA 2CFSA 1HI9A 1O4WA 1HLPA 4MIEA 4KQWA 4FX2A 3K20A 3WYAA 3R7BA 3MJHA 4P83A 4PAOA 4U9UA 1OZFA 1N9ZA 1T1SA 1H0SA 2YDXA 2QM0A 4G9EA 4OHVA 4RA6B 2D4HA 1Q83A 3SZOA 2OOSA 4J07A 4N5DA 3V7WA 5JAOA 5JMOA 1VE1A 1TIPA 1GN9A 1T6BY 1XZGA 4EUHA 1AHPA 3L1KA 3OZIA 3LQ1A 3KJZA 3C3MA 4OQNA 5JZOA 3GDGA 3AI1A 1SWVA 4RD2A 1PEKE 1DTWB 3A32A 3ZWOA 4UNRA 1XMOB 3CQ9A 4U7JA 3QVTA 4RK4A 3Q4GA 1DSSG 4DVGA 4U6NA 3Q7EA 2WWGA 4US2R 1R10A 3O75A 3VR3A 4I14A 3Q15C 4MGZR 4Q3LA 4U6QA 3DUFB 3NIDB 3WI7A 1QP0A 2JGJA 2BV3A 1MJNA 1QGZA 1Q7TA 2H0AA 3HRKA 4XUDA 5DT2A 4XUEA 2QD3A 5FTMA 4F86A 5CDYA 3DTVD 5C9ZA 2MMCA 5JZSA 1JR2A 1RQ2A 1YHYA 3R0ZA 3KXLA 4JLBA 4E5MA 1TCUA 1R8XA 3E3MA 1QYWA 2FN9A 3K2BA 3W8FA 1PGPA 2D7JA 3UQZA 2X5KO 4OOEA 1ATZA 2FHPA 2GN6A 4MVJM 1KJZA 1QYRA 4ASUD 4E2WA 3U4IA 4V02A 4JSYA 5A9RA 4MWGA 5T64A 1P91A 3PE4A 1E99A 3OD5A 1P7YA 2XUKA 3QXJA 3VTFA 1RBQA 1MR3F 1Z28A 2F1RA 3O1LA 5A4KA 2PGIA 4X00A 4YJ3A 1QQ5A 1H2WA 1SCUB 4LHWA 3CUSA 3WSTA 5BUZA 3O4JA 1NBIA 4DYVA 2VXOA 1OZHA 2O2IA 3MPUA 1ZD1A 1HYHA 5DYWA 4F2DA 1VBKA 1L5RA 3K0CC 3UWSA 4CG1A 1EGQA 4OX9B 1KK0A 3WTBA 2HK8A 3SLRA 5CFNA 3R5TA 1GPNA 3T5GA 4Q19A 5D3KA 4N3BA 1RPAA 2BFBB 2ZREA 4AZ0B 4XJSA 1ZH6A 4MYCA 1J1ZA 4IIFA 3GJRA 3T54A 2FR8C 1CP3A 5CT6A 2V8OA 1KEEA 1W0CA 1ECFA 1FJGB 2BZSA 3USZA 3ISJA 4QM7A 3MMXA 2AR7A 2ZBEA 1EWQA 4ND4A 3OQMA 3TAXA 1TZCA 1JSCA 3JSAA 3JWPA 1XNQB 1K08A 1P2SA 3PUIA 5E2IA 1E9DA 5GVRA 4AZVA 3SIXA 5BT8A 5KWVA 1R12A 3A11A 5E6UB 1RZRD 1X74A 2RKOA 4U7HA 4I3FA 1Z08A 3EAGA 2GFIA 4J75A 1M75A 2EDAA 1EA7A 1R4ZA 3EPRA 3WGIA 3X0DA 1I10A 1TK2A 3MCUA 1TM3E 2CWWA 5D00A 4ZIRA 2IEDA 4GYWA 5JOQA 1TK3A 5BW8A 3U3ZA 5F98A 1T6XA 4PINA 1QONA 4QVGA 2HCTA 5C32A 2E1RA 1XIVA 3OTGA 3VC2A 3UH0A 5JNTA 1HDOA 1BFUA 1EX9A 5E6SB 5KJ6A 2BC9A 1CUFA 4CIAA 3I1IA 2C31A 3IURA 4H4DA 1EEXB 1RKBA 1Q91A 1OXTA 3JQ8B 5AUNB 2HUNA 2O06A 4PAWA 2QENA 3STHA 1AOXA 3RAFC 3J7AC 3MJVA 4JUFA 1FOEB 3HFRA 4RGQA 2VOEA 3V34A 1EUCB 1Z36A 3P0EA 1E2IA 3PIRA 1YBAA 2RE8A 3AT1A 4YAKA 1JG3A 3R6GA 2JIZA 1SVSA 1Y81A 3GPCA 5FWXA 3IBSA 1Z56C 3FOAA 1K2VN 2PMKA 4UEQA 1KS2A 2GI4A 2GS9A 1E1NA 2O2CA 4RYDA 1CZKA 1TD9A 3EY9A 3ABIA 2GN1A 4L6IA 1GZDA 4H3HB 3KKZA 2Q4RA 2F3QA 1CRLA 1USKA 2NXNA 4UKDA 4ZEXA 4C07A 5BN3B 3E2PA 3IA2A 3MPOA 3FYUB 2Z5FA 5AW4A 1MAWA 2K4MA 4X93A 2FR0A 2NO9A 3BFKA 3TI7A 2R60A 5CU7A 5CB0A 9LDTA 1US8B 3EUAA 4IP0A 4FOPA 3C1OA 3DNMA 1GR1A 1PVDA 1E62A 2G40A 3QXGA 5EJFA 2YNMC 1O95C 2YXEA 4DG8A 1EFRD 3G68A 4FDAA 3RBZA 4IIGA 3RS2A 1E0AA 2DT8A 5DGIA 4CI0B 1BW9A 2Z56A 4L5CA 3C98A 5HJEA 2XUPA 3WJAA 3MWGA 4C7XA 1M66A 1QC5B 1DHRA 3QIAA 1PT7A 2BPOA 2WD7B 4R69A 3IH5A 1SKQA 3KWMA 1C41A 3H5OA 1WQ1R 3JYOA 3S55A 4BO1A 2B4RO 4E1VA 2Z09A 2FWNA 3ITKA 4WEQA 1JBQA 2FGJA 4KQFA 1HK7A 3BOSA 3ZCTA 1MDBA 4Z4IA 3NVDA 1AS3A 1J8DA 3P9YA 2BEWA 4UMVA 4BLQA 3ST7A 2WP8J 1FTSA 3CONA 4QO7A 1LTKA 3SEFA 1BCRB 2COEA 3ZYZA 1E8DA 2P65A 3K7EA 4F3KA 1LQTA 4P7FA 5A4AA 5BR7A 3G7NA 3OT4A 5AVSA 1C7RA 4P4TA 3TNDA 1FFSA 1X7ZB 2DUJA 2AOXA 1MJ5A 3BKWA 4EA6A 2C92A 2PO7A 3CH4B 9ABPA 3VNVA 4EG1A 1DUIA 2IYWA 5B3AA 2OCBA 1PZEA 1P7CA 3FX2A 3ZVLA 4DTIA 3ZJUA 2C9MA 4OGWA 2QDXA 1MDFA 2DOKA 4A6DA 1JS1X 4YJGA 4RTLA 1IZ0A 3BSWA 4PG7A 3L3BA 2JFPA 4WUVA 4WTOA 5ADUS 1YSCA 4JC5A 4MKHA 2XXAA 2ZB3A 5K3CA 1QZZA 1GZ4A 1YTUA 3BN3A 1ZN9A 3KWLA 1N2ZA 1AZSC 1CNMA 2ET6A 2VYVD 3GRYA 1IVNA 1V9SA 4NAHA 1ETHA 3AR3A 4NE7A 1RXWA 4O4IA 4MJ3A 2HW8A 2CUZA 2V7PA 3WV4A 4EJMA 4DV3B 3FZEA 4MARA 3OF3A 3KKMA 1Z22A 3GELA 2AFHA 3M81A 3MERA 2ZRBA 4LOHA 4XARA 3HM2A 3KAJA 1CG6A 3O8DA 5T8KA 3U16A 2ZCJA 1OXKB 5AK3A 4DA6A 2V7QD 3QV1A 3HCBA 2IYNA 4LRQA 2XKJE 1Y63A 3PWKA 5LVAA 1DWUA 5AXDA 3HP4A 1NSYA 5IMSA 4GSKA 2UUBB 1L5ZA 3BCHA 3DPSA 3DD5A 4PICA 1N0VC 1OYWA 4UHCA 2VTBA 3JATA 2VXYA 4RA9B 1PQUA 2IYEA 1NRXA 4Q7MB 4DAEA 3UPUA 4GGMX 2QY6A 4GOND 3IIMA 3UANA 3BMNA 3VBCA 2WQ7A 1A7AA 3EVCA 4NMWA 3TLGA 4DREA 1F0PA 1UBEA 2A9RA 3I83A 1YMVA 5CYOA 3IE2A 4DKJA 1VSTA 2BHRA 4MCIA 5A9SA 2A9QA 2Z8YA 1EINA 2PTHA 5FV7A 3UMVA 3V55A 2C2OA 1G3QA 2GILA 4YMUA 4ZI7A 4QPZA 5B7PA 1JEJA 5SV2A 3E58A 4N6GA 2PUFA 2XUOA 3R7AA 3AMVA 3DFUA 1M3SA 2WYWA 1DE0A 1GA6A 2AXEA 4F9TA 1NLMA 3OLQA 4QE3A 3UXEA 4CIYA 2BF4A 3OOEA 3WL5A 1KEZA 3HA5A 2MINA 4RV9A 3OMLA 3KJEA 4FCTA 3ROMA 3G0HA 3RRZA 1KAEA 3F9IA 5TR9A 4Q4CA 2VTEA 2FUG1 2I7DA 3M6WA 5I47A 2C4UA 2I2BA 2GGSA 1M8GA 3DFZA 3EXEB 4L72A 4KVAA 4RFSB 4D4KA 1VHJA 4IV5A 4BMNA 4FYIA 4HYYA 5B12A 3QPCA 4KN8A 1UXHA 3JWHA 1MN6A 3KZOA 3IEUA 5E9QA 2B3DA 4WCFB 3H2SA 1NJ6A 1SUAA 2CCKA 2FRXA 1LK0A 4NBVA 4R1QA 2WAMA 4UDOA 4YRFA 5HOQA 2FN7A 1IPFA 4FHDA 3GBSA 2UAGA 3OUUA 4RPIA 4Z0PA 2VLBA 2WJWA 5G3YA 5E3HA 5KAMA 4KFUA 2AFVA 1C0LA 2OBFA 3ASUA 5KU1A 5TT0A 1NQAO 3QFTA 2GWHA 5IM4A 2OHVA 2WR8A 3AZOA 4X7RA 3ZXUB 1GAWA 1XXHB 3K9GA 4M9QA 2QPLA 4JNCA 5LQCA 2EU8A 3IYLW 3C6BA 4HDRA 3AI3A 1KQ3A 1YB7A 2HPZA 4OV6B 2Y4NA 2GAFA 3CFYA 4CMCA 3DT8A 4GPTA 1QB7A 1RHKA 2ALJA 3S44A 2O19A 1KJ8A 1KOFA 3EQ6A 1VMDA 3ELYA 3L04A 4FK8A 4TVBA 3Q9LA 2NYAA 4Q34A 4OHUA 3RS3A 1Z0UA 2IXDA 1FTNA 2OQIA 3OIUA 1P9OA 1Y3AA 2B5OA 3QWFA 3BE5A 1YCHA 3FDXA 3P26A 2QM7A 1LQUA 1U2DA 1W2HA 4ZVLA 4AULA 4DR2B 2CL6X 3FCSB 3TLAA 3OQOA 1VRCA 1H22A 4ZO4A 3TOVA 4DPLA 3DOCA 3T9BA 1VZ3A 4HH1A 3BL8A 1NC1A 4BY9E 3DE6X 3LDUA 2IEZA 5ADVA 1AY0A 4CQLB 2P69A 2BKVA 3R77A 4KI0A 4Q9IA 1NW3A 1Y1LA 2AW3A 3RM3A 1Q3TA 3UHOA 4NATA 1SKYB 3AEXA 3E15A 4RHYA 5ALPA 4DCUA 1RHQA 3HVIA 4RTNA 1QF7A 1DOZA 2DJIA 2ZRKA 3PZRA 3RHZA 5DNCA 4ZHQF 3JQ9C 1S96A 5SY4A 3UG6A 4IMJB 2WUVA 1GZHB 1CY6A 3T3EA 2R2AA 3AHDA 4ARZA 4EKIA 1RR6A 4F5YA 4FYVA 5KSYA 3TECE 3UIEA 4V2UA 3DCNA 3IV6A 3OKAA 4R8LA 1D2AA 2CXRA 2HPAA 2YXLA 4HX9A 1DI0A 2DJ5A 1FB5A 1KFKB 2E4VA 3G0OA 1E89A 3L46A 4D46A 5LOVF 4Z8XA 4JLNA 4RE5A 5GM2A 3ZQ6A 1XPOA 2AN1A 4K0KB 4LF9B 1EXNA 4MCJA 5FFFA 1Y0BA 1CKEA 1DIRA 1EMDA 1SHZA 1ABEA 2ECKA 2P6OA 2ZIUB 2QZJA 1EG7A 3D7LA 2XGSA 3C8ZA 1B1AA 2CMFA 4ISBA 2HF2A 5AKLA 4BV8A 4C03A 4UE2A 3DOUA 3W0LB 4LAFA 5ALSA 4BZZA 5LP6A 1IJFA 2PMWB 4R2XA 3VR0A 1N6IA 3IKLA 4UHDA 1O9BA 4WBNF 4TTSA 3FMFA 3GEMA 1Z38A 5D3MA 4BRZA 1GFZA 4CU5A 1B41A 1FRQA 1VG1A 2FPXA 1YJ5A 3CF4A 4F4DA 5KOHA 2WAYA 4RS4A 2VSFA 5KKCA 2H52A 2ZRHA 1XDUA 1VP9A 1U7TA 3MTDA 2AFIB 3UWOA 4HWRA 1K06A 3F4LA 3QELB 2BEJA 4PSAA 2G76A 1ZM3A 4WRRA 5CTJA 1IUNA 3UWMA 3BGWA 2F8MA 1JQ5A 4MGIR 1QFSA 3RSSA 2ZJ4A 4LXYA 4BU0A 1FNCA 2LKCA 4OXQA 1J24A 3NYQA 2GETA 2NXEA 2QJOA 4AG6A 1KIFA 1F1JA 2YHUA 1K7EB 4ZGBA 1FFGA 4EKDA 5HM8A 4CF7A 3DP7A 1SO8A 3KALA 2VHCA 4YIKA 5LDHA 4MUEA 4S05A 4OHYA 2PKYX 3NYWA 1U1CA 2GTPA 3KVNA 2VQSA 1PTKA 1SBZA 2XA9A 2ODWA 5CHEA 5BURA 3LDGA 3C85A 4P0TA 1IEWA 2IELA 4CUKA 1ZM9A 3M6MD 1E9BA 1QRRA 3V5NA 3VR5A 4R98A 4GGOA 4FBGA 4ZOCA 3IDQA 1GV0A 4KO8A 2AB0A 4ZRNA 3KUXA 4AL4A 4DBLE 4Y6LA 3KTFA 5KJ1A 3JCZA 1WRBA 4LF5B 1PR5A 2I9PA 4KN5A 1AU9A 3TTXA 1GSHA 5ESXA 2FPMA 3R24A 4AD8A 4CIVA 4YO8A 4XDHA 3BD8A 2R1UA 3LFUA 4LZPA 2H2GA 4AMBA 4DM3A 3TIFA 5JAUA 2O3SA 4MWEA 3K96A 4JITA 3B7WA 1E0DA 1SC1A 4PHTA 3AEUB 5F9MA 5IAAA 3JQQA 4G0PA 5U9CA 1A97A 4DQKA 4LHYA 2QYTA 3NTVA 3HYTA 3I9V1 1XZPA 1LTHR 1W85A 5FUYA 1NHWA 4HQNA 5ICMA 1V8OA 4XIIA 4HF7A 4EAQA 1AQIA 5JROA 3W5AA 3W9YA 4NDZA 3AINA 4CM4B 2PZGA 1CW2B 1TAGA 1A2QA 1L7PA 1QHSA 1QQ7A 4N5LA 4BXOA 3F97A 3N8IA 4G2NA 4K9SA 4N5HX 4FMPA 4EHHA 3NNSA 5A7FA 5CYGA 1W4LA 1DQNA 1JDNA 3EVGA 5CT5A 3CSSA 4AJPA 2F8LA 1E5VA 4XUGB 3B9PA 1RYZA 3BGIA 2I78A 4BNUA 3A14A 2EC5A 1J8VA 2KX7A 3VKGA 2C7QA 5KQGA 4DMCA 1U0BB 3H9GA 4C29A 3OJ0A 2Q6KA 5T4HA 3HZOA 4Y3UA 1KK2A 3ZEIA 4ZYXA 4QHSA 2HNBA 2BFOA 2CNNA 2AZDA 5GONB 1SIWA 3KYBA 3PE6A 5NULA 1WCXA 3RVQA 1L4KA 1QAQA 4QOEA 3EXG2 1UKEA 1BYIA 1VG0B 3NFYA 4M1MA 1BQEA 1OX6A 2WAAA 2L17A 2HEGA 1ZLYA 3D8BA 2J41A 3LS2A 2HMYB 2UV8A 2QKYA 3L7KA 1EM8A 221PA 3IVAA 4XWTA 3WGJA 3FFAA 2MDTA 3QYAA 3HBLA 3IRVA 1Z5PA 2DT5A 3OQIB 4RF2A 3DEKA 1F2UA 2YWHA 3PEUA 4FFBA 1XAGA 1N7JA 3X44A 1L8LA 2HF9A 2V4ZA 5G4KB 4AIIA 4TQAA 2R5FA 1JQKA 4A5SA 3I05A 4NBUA 5DLQC 1QTIA 3EUEA 4H7PA 1XTSA 3HS3A 5HKOA 3RC8A 1O6ZA 2I1VB 3RT9A 2D4AA 2R6DA 3KXKA 5CNKA 4CF5A 5BUSA 5BVGA 5FWDA 4LCJA 3DE3X 2WWRA 3REOA 2KBEA 3GLIA 1YRBA 2JBWA 2XWBF 3FPCA 4C7BA 1T9BA 2D54A 3DM5A 4FQ5A 4GKVA 1J7KA 1Z3IX 3L6CA 4HAOA 1P4HA 4Y2YA 1HDEA 3V8PA 2J6IA 3S27A 5JH7A 1LW7A 3V4OA 3KPUA 5HOEA 3R6TA 3U81A 1V11B 3S29A 1XRRA 2LW7A 3V1TC 2XD4A 1GL6A 4L2IB 5M7EA 2GZHA 2OHXA 3PNOA 4ECEA 1M2GA 2REXB 1KO8A 2GAAA 2N0SA 3N2GA 3VPBA 2AQKA 3DL2A 3ZNNA 5IX8A 5CB4F 2D74A 1B6GA 1XHLA 4WK2B 3RC2A 4M37A 4YALA 2XOKA 1RQLA 2ONCA 5DN9A 5TPZD 1M8FA 2CLKB 1DX6A 1GTZA 4JX8A 2ZUEA 3IEVA 1WOMA 5CFPA 1HNZB 3NB0A 1CZOA 5DSXA 4U9IS 4U9HS 3RRJA 1RWXA 4BNYA 4DG9A 2M6SA 2FP4A 1L4EA 2ZUWA 3NTQA 4XIGS 1VMEA 4C20A 3R0XA 3S2SA 4H0NA 2GX6A 2O1WA 2RK4A 4UXHA 4MO2A 1QQBA 4HGZA 5AKIA 4RC9A 2QJTA 3BWXA 1I3OA 3B6JA 4DMFA 5T3UA 3VSDA 1TX4B 1HKUA 5FB3A 3JQCA 5IH7A 2BH2A 2ZCUA 4JI1B 1Q0HA 1P72A 1XCOA 3W2TA 4BVFA 3IAEA 5TT1A 3WNQA 3P4XA 4PVCA 4E6PA 3ZIUA 2XR1A 4UVEA 4JFRA 1R8SA 2IUSA 2O8VA 3D31A 3DE1X 3DMPA 2Z5GA 1I51A 4LDNA 3IAS1 4D9FA 1Y3CE 1F9EA 2TMDA 1UCFA 4O4HF 4F1KA 1FXWF 4GEKA 1EWVA 2XA2A 3H9QA 1FYVA 5DLDA 4MW0A 1EX1A 1R74A 1P0QA 1UUFA 3JXEA 2G07A 1TVMA 2OZKA 2H9AA 5K0NA 4IKEA 4CHGA 4UUNA 3LECA 4I4TF 4DMLA 3EGWA 1E2MA 3WXBA 1YONA 4YRJA 1D2CA 3EFEA 1GCGA 1U2GC 3W1VA 3PUZA 3CNQS 3M89A 4CM5A 1Y7HA 5J2TB 4XX0B 3A58B 2RI1A 1HL7A 4G6ZA 3C1TA 2ZSHA 3HLKA 2C9CA 4XQCA 2QRVA 5FBWB 1XKQA 1VI6A 2VJOA 2WJAA 3ILXA 5KVVA 3JYNA 2AFHE 3PX2A 1XHEA 4YP7A 1GWNA 2QVGA 5DEOA 1SUDA 2F9MA 1ZWKA 3ORYA 4GQAA 4BYMA 1QIJA 1YZ3A 3O1JC 2VOJA 1GZ6A 4WLEA 5PGMA 5CMLA 4K0RA 4KFCA 1M6HA 1N32B 1QYIA 3EB9A 4GXQA 4YRRA 4U2DA 4NU8X 5B4TA 2BKLA 2XVZA 4R8VA 3UJ6A 6CHYA 1XLVA 1GPH1 1I8TA 1H8ED 1SAYA 3FAZA 2W5UA 3D54D 5F1KA 4CLOA 1APBA 4DM7A 4PC7A 4IXWA 4BN5A 2RHOA 1VPTA 3NRBA 2P4EA 3D3WB 4YACA 1FMLA 5HW0A 3FHTA 4NBRA 2WWFA 3LX4A 4EJSC 3IVCA 2VTDA 3ZHRA 1WPGA 2WUGA 4R1LA 2QTMA 1MIHA 4WCFC 1GGHA 4I50B 4B48A 3S7ZA 2WWTA 2XUAA 3A2LA 3EXFA 4ZTZB 7MDHA 4XH9B 4AKEA 3PV0A 5KTKA 4W5OA 4LVNA 5TPWA 1QYCA 4ZQEA 4WJZA 4JP1A 3LP6A 3Q9SA 4G56A 1BQ3A 1KY4A 1ST2A 1SXJD 3RR2A 4DL9A 5FJIA 1HEUA 3PXDA 4JIGA 1YB6A 5GPBA 5REQB 2UUAB 5GQSA 3K9WA 1Y7LA 5K51A 4WZBB 1B0AA 1CFZA 3FYHA 3U7GA 3KKNA 1G8JA 3W4JA 1OV6A 4LHVA 4UBKA 3CUTA 1BEEA 1MO2A 5E6SA 1YI0A 3RYFB 1G2PA 3N28A 3UB4A 5K0FA 3KSRA 3STXA 2H7CA 4C0WA 5BV1A 2B4AA 2GXUA 3L1JA 4HN4B 1TQ6A 4R1OA 4KYIB 1SZJG 3KD2A 3BM5A 5KYYA 3PQ2A 1T8WA 4MVJI 5D87A 1KSJA 4KE8A 4D25A 4C5CA 4M4SA 3H4MA 5DGDA 1JLLB 1ELOA 2HDNB 2FEMA 3EF3A 4IS3A 2VP9A 5I51A 1UZNA 5EYPA 4O0MA 2EW8A 2XVXA 2H2DA 1A8PA 1SVWA 2J6CA 4E5VA 5EJ5A 5FWNA 4MDFA 4LDPA 4GZMA 4ZOLA 2JJ8A 4UHBA 2CMHA 4B74A 2YJ3A 4JJZA 1NSTA 2FJ0A 1S8OA 4EHFA 2J0VA 5D1NA 1D5WA 1RCTE 1X9GA 1JLMA 2XZPA 5AKYA 2QD4A 1T10A 1FCJA 1QJ4A 1U1EA 3OFSA 1G5IA 1US8A 4I8XA 1D8AA 5KYXB 3KQLA 4WXPA 4N7RA 5L7YA 4I2VA 4Y9UA 2IU0A 1KU6A 3WWZA 1N2JA 1GV1A 1L5GB 3OCJA 1WXXA 1Y80A 3FYCA 1Q1NA 4S24A 4ENUA 4ZWNA 2NQ2C 2WHYA 2C2BA 2GEFA 3I01A 3OOHA 5DTQA 4C08A 1QDLB 1R3DA 1TECE 2YOHA 4GQBA 4MVJH 3PVSA 3I9MA 2ISQA 1JU3A 3QJGA 1XTUA 1SD1A 1QHXA 1CY8A 3VDNB 2BSQA 3RS7A 4RF4A 3ET4A 4B9EA 4BNGA 4MVJP 3I30X 5I8ZA 3C3XA 3MMNA 5AJZA 4YWHA 4NG5A 3JR3A 3CX4A 3Q3HA 1LZLA 3IP1A 1E96A 4FDVA 3SS7X 4E88A 1UIRA 3TB4A 5INTA 3GP8A 2SECE 5HS4A 2B5WA 4BMZA 1M8KA 2HU5A 3EG9B 3ZOZA 2SKCA 3A3KA 5GINE 1WY5A 4IIHA 5EXSA 3EY4A 5DXFA 5HRCA 2HCRA 2W6JD 4OJYA 3FOCA 1G8MA 3L0ZA 1QOZA 1EWKA 3JAWB 2ONZA 2NADA 3IEMA 4LJ4A 1WNFA 3GT4A 1T4BA 4TXNA 1MHTA 2ERCA 3TD2A 4I5FA 3BMOA 1USUA 2P9BA 3QMMA 3AXSA 2DCMA 1D4AA 1W47A 2DQYA 1ISGA 3RB8A 5K6TA 1JYSA 5HQ3B 3FDFA 3I6MA 4YECA 2EX4A 2OLKA 3PFNA 5FIUA 4RTSA 1S02A 1AE1A 1X9IA 3FPBA 5EIXA 1F8YA 3SC2B 1ZJYA 3V3KA 1V3VA 1N2IA 4BNXA 1UBUS 5AHRA 2ZETA 1E2DA 2Q6IA 4B6PA 2A2ZA 4MRRA 2W93A 3NHZA 3WIBA 2PLNA 2UZ3A 3N58A 1T1GA 2X9QA 2ZB2A 5LJLA 4OJMX 3ZWBA 1S3SA 1NQXA 1ZZGA 2WEKA 3FGPA 3OT1B 4PR0A 1G3RA 1FRVA 1WMSA 4UQPA 4JLPA 3WLEA 1U0GA 4PU0A 4XXHA 4ZVNA 5IWAB 3CKYA 3PC8A 2ZS8A 5K6AA 1J6UA 4UBOA 5JHHB 2P6RA 2HH9A 4JJKA 3ADDA 4J2TA 3GRKA 1RFLA 4Z1OA 4MW2A 4GP9A 2K2WA 4AJ9A 5EZ5A 5AKGA 1SBCA 1XJWA 1P80A 4GM4A 1KQFA 721PA 3WBJA 3VYVA 5J2UA 4QBIA 4P6VF 2ZT7A 3NWPA 4C5AA 3C41J 4QEZA 4W7IA 1P2BA 5A6SB 4PHHA 3U7HB 3OIVA 1VJ0A 2QRJA 4JI7B 5E6RB 4LYDA 2CGEA 4OX9Y 3AVOA 3OZCA 4H7JA 3QGMA 4R8SA 4TV9B 5EKXA 4HUTA 4MW4A 4UU8A 1Y33E 4M53A 2GB4A 2D5AA 4M8LA 2WY2D 4HOYA 1TAUA 1CRPA 4TS9A 3OQ6A 3PRJA 1E66A 2AMJA 2P2LA 3N5KA 1ENOA 1M6YA 4INPA 4RFSA 3ICOA 1HTTA 3PFWO 1EVEA 3OCYA 2O0HA 3BDIA 1WLSA 3GD5A 1B76A 2ZRLA 3DE5X 4EHIA 1EAYA 1F7VA 3JQEA 1QM5A 2C7OA 5DEIA 4MWCA 4IUBS 4OFZA 3P9SA 3E5NA 1PD0A 2CDRA 2OXRA 4RKRA 5TGZA 5IFKA 1NMXA 1XK6A 3CVXA 4YJHA 1W44A 4HEHA 4UUAA 4OFWA 4N8DA 1O0BA 3PNYA 3NEPX 2JVKA 1G9XA 1OIWA 4W9RA 5DWQA 2BLNA 4KE6A 3ZWDA 3J80A 4IIYA 4E33A 2PK3A 4W9NC 2VH1A 1XXHA 3P2JA 2FMUA 2I99A 1GARA 4MQEA 2QUKA 3CV3A 3T7TA 1J06A 5JS6A 1PZHA 1ADFA 1DO8A 1V39A 3AR7A 3DJYA 5IUKC 4UM9B 4DB2A 2GJKA 2Y93A 5AOVA 1X7WA 2B36A 3WDKA 2FRVA 1SCKA 3PT9A 2J46A 4PQGA 5IT5A 4Q4AB 4UNQA 5IDVA 1C9EA 1J2JA 4E22A 3KV1A 4DV6B 4ZOBA 2IQIA 5IWCA 1P4AA 3GDOA 2B4KA 4G4JA 4F12A 1T3ZA 1CDEA 5JLJA 1Z5VA 3KOZA 3P0JA 2VQFB 5J5VA 4ZZ0A 3BWYA 1W0JD 5JS2A 1VKHA 2DHQA 2NACA 5E38A 1CP2A 3T5MA 5C7LO 4C4ZA 5AM0A 2OHOA 1CTQA 3OZFA 4V03A 4X84A 1YDMA 2WF9A 3K16A 1VJGA 3VPAA 1T0UA 4CQLA 2NO6A 2AOVA 1T15A 2GXSA 2R86A 1Y8RA 3GC6A 1I0IA 1TAQA 2XKBA 1FP6A 5F3DA 4CNQA 4JYBA 2XT9A 5MF6A 2NTYC 4XGIA 3PXGA 2D59A 3D4LA 3F78A 3WB2A 1KO1A 3HUUA 3OOWA 3ASYA 3CLUD 5C46F 4JBNA 4IILA 3W3AH 4N0PA 4I9UA 4FHZA 5AT1A 3VPFA 2VP5A 5MN5A 2ATCA 3BF8A 2VVTA 2V3VA 4TRNA 4LV5B 2F9LA 1U8CB 3KYIB 3OX2A 4JD5A 5LM3A 4N41A 1YZTA 4NR0A 3KB8A 1VL1A 4XFJA 3G0CA 3GLIE 1BWSA 2IWRA 2VL7A 2VPXA 4NV3A 4YY3B 1FTQA 2WOJA 3AHHA 2G6TA 3Q72A 5G3ZA 4IKOA 4G5FA 1DRKA 1KDRA 3UB3A 2XADA 4RTPA 4X60A 4H60A 1P29A 1QCYA 3L02A 3S99A 1DEKA 3TQHA 3MBOA 2A0UA 3PDCA 2OORA 1ADYA 1TU3A 3NYIA 4XGQA 4EI7A 2YICA 3RROA 3VNAA 1TEVA 3A1WA 3RHFA 4JBXA 3TPZA 2BIFA 1IONA 2NU8B 3TZLA 1Y1QA 3O3CA 5ENZA 5KVSA 4WKCA 3PNLA 5ICFA 3AKYA 1OLUB 1R9NA 4MULA 1G1AA