2QU8A

Crystal structure of putative nucleolar gtp-binding protein 1 pff0625w from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
194
Chain Sequence
LPSINPHKKTIILSGAPNVGKSSFMNIVSRANVDVQSYNLYVGHFDHKLNKYQIIDTPGLLDRAFENRNTIEMTTITALAHINGVILFIIDISEQCGLTIKEQINLFYSIKSVFNKSIVIGFNKIDKCNSLSIDNKLLIKQILDNVKNPIKFSSFSTLTGVGVEQAKITACELLKNDQAESILLDQEQLLNTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleolar GTP-binding protein 1
publication title Crystal structure of putative nucleolar GTP-binding protein 1 PFF0625w from Plasmodium falciparum.
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 67
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qu8A00
4F7WA 5HR5A 4WOPA 1VCOA 2WIBA 2CBZA 2VA8A 1S9DA 2P5TB 3FHOA 3QPUA 2A5GA 4XSGA 2IBMA 2IYRA 3NC0C 1AZSC 4L16A 3THYA 3TLXA 3S1AA 1I4LD 3RS0A 3GLGE 3BERA 2V1XA 2IF2A 4EJSB 3JVVA 3KUCA 4A6XA 2J5XA 3OE7D 1CR0A 4I1UA 1G8HA 1SVOA 4MYCA 2G3YA 4TMKA 5LBIA 1QZXA 5BW8A 4LUCA 2WAXA 2F43A 2F7SA 1HYQA 5E3HA 4QBGB 1MO5A 2C77A 3H0KA 4HYYA 1J7KA 3EG5A 2FMXA 3GD7A 5E4FA 2ECKA 4M2LA 2F3TA 1LTQA 3EXAA 3N70A 1XP8A 4URWR 1OT3A 2JIZA 4PO1A 3GEIA 1D5CA 4MGZR 4IDNA 2WWIA 2BM1A 3PVSA 1XJ0A 1CJVC 5KOYA 5IRCD 2P0EA 4LJ5A 4R7ZA 1Q1EA 4IOKA 4GPTA 1AIPA 3VKGA 4FWIB 4JZKA 4LJ7A 4Q02A 3X1DA 1G7TA 2AD5A 5EP1A 5K8LA 1IY1A 3FMOB 2K5UA 2IXFA 4RVCA 5DH9A 3J81k 4TL7A 3T35A 5L3SB 1U8YA 3AVPA 3B8HA 3SR0A 4C9BA 1G8YA 1SXJB 2IK8A 4Q00A 4BRUA 2DWQA 5EZ5A 1MR3F 2GJSA 3RVBA 1N0WA 4Z1MA 1OJLA 2IYTA 4B34A 2VHCA 4M9XA 4HB4A 1ZC3A 4K46A 1GKIA 2A2ZA 3GLFE 4TZ0A 3QG5A 1CJKC 4DT1B 1C4OA 3RS2A 5KNCA 3K0FB 4MYTA 1CBUA 2A9KA 1ZYUA 2GNOA 4A2QA 4EQ6A 3FTQA 3ZGXA 4MRPA 4B76A 3ZIAD 5JHHB 3W8NA 2HLDD 2KBFA 3PUZA 1SHKA 2GKSA 4Q7KA 4QJ4A 4F4CA 1JEDA 2QTHA 2R6GA 4H1VA 4DDWA 1CULC 2FEOA 3BE4A 4CW7A 1TEXA 1G4UR 4D6PA 3H1TA 1M1YE 2ZRCA 3EA5A 2QMHA 2ZRMA 1N25A 4FCVA 1SKYE 3HR8A 4Q7MB 1OXXK 4A2WA 4DLYA 5FPYA 2JJ8A 4B73A 3PITA 1YR9A 2ZI7A 1P5ZB 1Q3TA 3HYRA 1PUJA 2JEOA 3OIUA 4ZDIA 1WQ1R 2W83A 4G3XA 5AJYA 3Q5EA 4IXMA 4MRRA 1O87A 2WM9B 1GAJA 4M4SA 3C41J 4AY2A 1TQDA 2D3WA 3JZAA 4PZZA 5AUQA 4LV5B 3K0CA 5EP3A 3TAUA 4ARZB 3GFPA 2VP9A 1HEIA 2A5YB 4LYFA 4EJSA 3A8TA 4FI3C 2D06A 2H8KA 5CLQA 1AN0A 4KSCA 4PAMA 1XJQA 4PC2A 1ZAKA 5A5GA 2LKDA 2OM2A 2YOGA 5L3RA 2XX3A 3SC3A 3N2IA 1V5WA 3M0EA 4V0ME 4DLWA 5BN3A 3SDZA 2BMJA 2ZI5A 3KQNA 4RZXA 5J5CA 121PA 1SVSA 1QDEA 2BC9A 2QENA 3QBVA 4D81A 4URXR 2QP9X 3NH9A 3PEUA 4HSEA 4L5BA 4WW0A 3WYGA 5JI2E 1BKDR 2GJAA 4BFUA 5C1BA 3CPHA 5F3WB 4D0NA 1IN8A 2BEKA 3ZQ6A 3IEVA 5L3SA 3LV8A 2AKAB 2ZJOA 4MH0R 4YXWD 2ERXA 2WKRA 2AK3A 4DKXA 1SXJA 1VG9B 4AKGA 4KFTA 3BD9A 1HT2E 3I1FA 3MUFA 1ZU5A 5FOXA 4BRWA 4B2IA 1W4CA 2WWWA 1DG3A 1RVDA 4GFDA 1VIAA 1D2MA 3WXMA 3HU1A 1KDTA 4QFMA 1GVNB 3AV0B 2R8RA 4GZLA 4Q4HB 3L8YA 4DT1A 1L4UA 2QQEA 3U60B 2GAAA 4GBMA 4A8JB 4NYMR 2WSMA 1FFHA 2PMKA 5ELXA 4URUR 1JQLB 2OCBA 3C5CA 3ZS8A 1T91A 2GILA 4PPNA 3EIEA 4TQ9A 4ZIRA 3DHWC 3MJRA 2WTUA 3UANA 4DDUA 4RJLA 3KUDA 1ZVQA 2QGZA 3BAFA 3ZZUA 4LHXA 2GJKA 2H16A 2WPDD 1UBCA 2GZAA 1U2RA 4NKRA 1EWRA 1OFTA 2Z4SA 3CRVA 1FPMA 4QHTA 1FMJA 5C46F 5GVSA 2ZJYA 2H18A 3UG7A 1G8PA 4RZUA 3SBDA 3IO5A 4M1MA 1NMYA 2DPXA 3QF4B 2QPTA 1F2TA 3DPUA 1C1YA 3PQCA 3EC2A 4DLXA 4XVUA 2IS1A 2ZUDA 4IDHA 4B6EA 2O8DA 5BYKA 1W5TA 5HTKA 2JJ2A 4HAUA 4I99A 1UAAA 2QI9C 1E2QA 1E0AA 1KSFX 2DBYA 4TL6A 2P3SA 2ZM5A 1HT1E 1RIFA 4RKEA 2J7PA 1YZNA 3A1SA 1KO1A 4EIWA 4QKQA 3B1XA 4G5GA 3D3QA 1P75A 2IWRA 2HJVA 4IRUB 2NO7A 3SYKA 3CX8A 3BOSA 2G6BA 1RRCA 1ZMXA 3AH8A 3AP1A 2X8AA 3QJYA 3V9PA 5L3QA 4QBFA 2D2FA 1IY2A 1MABB 5AJXA 3LX8A 3QKUA 3ZDQA 5CIWA 4I81A 5JCPA 4TTPA 3GLHB 1GG2A 4TT3D 3WNCA 4Z51A 3K8YA 4B3FX 2JJ1D 4HZUB 4MQBA 2DFLA 1Y3AA 2DR3A 5BN5A 1CR1A 2D7CA 1Z29A 2YINC 3WMFA 2V6IA 3KKOA 4BFTA 5AUPB 1ELOA 4PAQA 3WYAA 3TH5A 4Q4LA 1W4AA 3FE2A 2XSZA 2XZLA 4HUQA 3FHCB 2R6AA 2RAPA 2NPFA 1KSJA 4DC9A 2H92A 4GMXA 1A2KC 3BGWA 3QG1A 3LBNA 2VBCA 5CDFA 1E9CA 1QG2A 1XD2A 2FNAA 3CH4B 4P4SB 2OT3B 1NVVR 4Q66C 1NIJA 4BFZA 3T5DA 1Z0IA 1IN5A 2WVJA 2V9PA 4IFBA 4MDEA 2FPMA 1ZUNB 1OIWA 1E9AA 1ZINA 1NL3A 3H86A 2QTFA 3PJRA 4RD2A 1KI6A 2VHJA 3L43A 3EPLA 3QOFA 2CVHA 1IQPA 1BO6A 1U81A 1OB5A 2ODNA 2ZJ8A 1OB2A 4XSHA 4UJ5A 1JBKA 5JHGB 4FD2A 1GSIA 1WP9A 3AF3A 3K70D 2DCUA 3A1UA 1SVMA 3CNOA 4OBEA 1AJEA 1G21E 3B1WA 3CF2A 1E79D 1KI9A 4LWZA 3NBXX 1E9DA 2B7BA 2ZE8A 5G41A 3QF4A 4DLZA 3Q7PA 4HDOB 2Q9AA 3AUYA 4NPHA 2FFQA 3RS4A 4YONB 1AGPA 3EIHA 3VHXA 3EPJA 4BLTA 1P2UA 1EK0A 1OH7A 5FBLB 5FOTA 1X8LA 2OESA 2EW1A 5JWOA 4YC7A 4M53A 1X6VA 4A1FA 3H2YA 4OYHA 3KQHA 1KK1A 1G4AE 3W6PA 1N6HA 2ATVA 3DM5A 4A0FA 2NO6A 2EFGA 3Q5DA 4LCBA 5IDVA 2W00A 2CMKA 3Q85A 2ZETA 4C4PA 3BH7A 3WRYC 2IS4A 2PT7A 1U98A 2ZAMA 2X19A 4L8GA 1JQJC 5DLQC 2F1RA 2AXPA 1FZQA 721PA 4LDJA 1U0JA 4MYUA 1QVRA 5JWRA 4R71A 5FL7A 1U8AA 2WHXA 5JRJA 4DCNA 1R0YA 2XAUA 3GLFB 4BPBA 1GWNA 2A3RA 4Z1MD 3GLHA 5BWMA 2KB0A 1G1MA 2PEYA 1W4BA 3G82C 2UVQA 2YC4C 4P4TA 2HUPA 1XXHA 3F5FA 4AI6A 1E0KA 1S3GA 4HZUA 3IPXA 4Y0VA 4Q9LA 2ZI3A 1AQYA 1DAIA 4PFSA 1IXRC 2W6JD 4YMSA 4FMDB 4DEXA 5FUWA 1E9RA 4RSGA 1YQTA 1T5IA 4HEJA 3X1YA 1J8YF 4Q9HA 4Q7JB 3I3SR 3ADCA 1FQJA 1NN5A 1FUKA 2MSDB 4GL2A 3REFA 4MRNA 1JR6A 1QBKC 4ERNA 1WB9A 1NVUQ 1M7GA 2ZYUX 4M9QA 1FMLA 2GETA 4JBWA 5DHFA 4O3MA 1YKSA 2FZLA 2QA5A 3BIFA 1UKYA 2MMGA 1B23P 1FL9A 1U94A 3LW8A 2F3RA 2WJJA 1FUUA 2NG1A 3EIQA 4JIMA 1ZJ6A 4QXAA 4F38A 1N6RA 3LH5A 4NCKA 5E7JA 3SYLA 1Q44A 3T12A 3BFXA 4LGMA 1DG1G 2IYYA 2WSSA 4JKYA 1LFDB 3NTUA 1J99A 2R44A 4LX0A 1JR3A 1ZRHA 2FG5A 2GXUA 2LWIA 2UZIR 4RD6A 1I2DA 521PA 2ZJZA 5TXGA 1BH2A 2FH5B 3CR8A 1P62B 5GADl 3R8CA 1K8RA 2YOFA 4C0AC 5GJBA 1XTKA 1NSTA 2YYZA 4KFUA 4U7DA 1T0HB 5KPDA 4FMDF 4R2HA 1T3LA 1NRJB 1T5LA 3HPRA 2D74A 2ZE5A 2IYLD 2IYWA 2QRNA 2J59A 1UEIA 1P2SA 2CLSA 4XVRA 5TVKA 1JXOA 1QHGA 1Q1QA 1JALA 1QVAA 2OO7A 4I1VA 1N5LA 1OFUX 4EFLA 5H70A 4ZCMA 3CNNA 1GIAA 3C8UA 3PCRB 3ZIAA 3C4JA 2HLDA 1D8TA 2BBWA 1F5NA 5B2ZA 4GOKA 1KTVA 1R7RA 3C15C 4LY6A 5FTMA 3LQQA 4KI0A 2RH5A 2ZIAA 2JDIA 2G1KA 3NBYC 1ZD9A 2OZEA 1JAIA 2BEJA 1SVKA 1SXJD 1W5SA 2PLFA 3A1TA 3EZ7A 4IDOA 3T5GA 4QJ3A 2FSHA 2V8OA 4TWZA 5EP4A 2J0QA 4Q9JA 1ZBDA 2BIFA 3LY5A 2EWWA 1GKYA 3IBGA 2CHVA 2ZITA 3AF0A 4EPWA 3GPLA 1XX6A 1NSFA 3DMDA 3F8TA 3PFIA 1AGRA 5F98A 4QGHA 5CK4A 1KI3A 5DE3A 1F48A 3KXIA 4PPFA 4F92B 4CEIB 4BLSA 4IEIA 3B6EA 2P2LA 1F60A 1W4RA 3LO5A 3MMPA 4TMWA 4TLDA 2AHOA 4YMTA 2FN4A 2P67A 1IN6A 1G3UA 3E70C 1CRPA 2FU5C 2FV8A 2WMNB 3ND9A 4Q4JA 3T1TA 3KB1A 1NIPA 3TKLA 3VTKA 1LY1A 3CH5A 4H1UA 1LF0A 4LC1A 5AJZA 4Z8XA 3PUWA 3FMFA 1E4VA 4TMXA 5DYGA 1XTSA 5KYKA 4DLTA 3BB4A 1Z0JA 4DEYA 1XCMA 3W3AA 1XEXB 4JLBA 4A0GA 2ATXA 3TUJC 1VIYA 2YWHA 1R10A 1QF9A 4WBSA 4GOJA 1KMQA 5G3YA 3U3MA 1NLZA 1CRQA 3U7EB 3THXA 4KHZA 2HCBA 5D3QA 3O47A 3X1XA 2CJWB 1N0VC 2ZQ5A 5J4HA 4KVGA 2DWPA 4QGGA 1TPZA 4URYR 2AWOA 4PZLA 4OI4A 1EG7A 4XJXA 4M21A 2CK3A 4JL6A 4NBSA 2PZEA 3LXRA 1Z08A 1E2LA 3TSWA 1CTQA 5H1YA 3WY9A 2BBTA 4KLNA 1MOZA 2Q21A 3FYHA 4KAXA 3VR3A 3GJ7A 4XWKA 4PHFA 1R8SA 1GNQA 1E9EA 5JS7A 2VF8A 4AD8A 2RHDA 3IPYA 4ZCIA 4DSNA 3KXLA 1RW4A 1E2FA 1NJFA 4B33A 5AUNB 2VIIA 2HXSA 2J0UA 4DZZA 5DNYB 1XMIA 4TTQA 3O8RA 1W1WA 4B48A 5LDDC 1TF5A 1MT0A 4YLGA 3RS7A 1GNRA 2FE4A 3EPHA 4IVQA 1A5TA 2OEPA 2Z5FA 1NBMD 3R9IA 4JLDA 2WPDA 3SU8A 2XSZD 4DCTA 4GZMA 1QHYA 2EWVA 2ZYTX 3WMEA 5CDFE 2GEVA 4LPSA 3PIRA 1XTIA 1OH6A 4IOMA 1N5IA 4HB3A 3EZ9A 5F2EA 5BN4A 2IHBA 1COWA 4CZ2A 3HDTA 2PL3A 2V4ZA 1Z2AA 2W58A 2J46A 5F9HA 3ICQB 4Q5IA 4TLCA 3IKJA 3NHAA 3I61A 4NCJA 1Q1BA 5SZKB 4YDHB 1HQCA 2BMEA 2WBLC 3H84A 3VR4A 4CEIA 5E7MA 5EE5B 2ZPTX 4D0LB 1A1VA 3QEOA 4XWAA 3MLEA 4POAA 3BJIC 3CUEF 4GT1A 3RRNA 2QT0A 2XNDD 3B85A 2JLYA 3HYTA 2OXRA 2O8FB 1G3QA 2PBRA 3E5HA 4LHYA 5UKDA 2F9MA 3TAHA 1ETUA 3RS5A 2QMUA 4LHWA 2ZU6A 3KJEA 4B3DA 5JEEA 3X1ZA 1W48A 5L3VA 4Q47A 3GLIB 3R9WA 5KDLA 1BS1A 5KHOC 2JJ1A 2ORWA 1T3SA 4CIDA 2O0HA 1N6OA 1ANKA 2PT5A 4LI0A 2HYIC 3R8FA 2ZR9A 2I3BA 2E9SA 1P2VA 1S2MA 1GILA 4X8HA 4E22A 4F91B 3MWJA 4DB4A 2CJWA 2XNSA 4AYTA 1NF3A 2Z0MA 1OXVA 2YC2C 2GHIA 2L0XA 4JYBA 1CIPA 3TUIC 1TU4A 3BH6A 5KPJA 4B44A 3P32A 1S4QA 3NVAA 1IJEA 5J4KA 2GJ8A 2YHSA 3KJHA 1MKYA 1YZQA 4S35A 1G3MA 3MCAA 3UK6A 2W0SA 1R8QA 1NLYA 2QPAA 1MO3A 5JCZA 2N46A 4A6PA 4EUNA 3LLMA 1XXHE 3THOA 3KQUA 4PC7A 1GKUB 3AF2A 1KDOA 4HDCA 1QHHB 1TAGA 2BJVA 2XZOA 1ZP6A 2QMOA 4RCZA 3IILA 2OXCA 5FTLA 4OK3A 1VECA 5FOVA 5GJCA 4BFSA 4O2RA 4CEHA 2EYQA 2JATA 2GF0A 3IIKA 3BK7A 4QG7A 2H1LA 5JSZB 3LFUA 1YHNA 2BVNA 3ZLJA 3GFTA 3CWQA 1HURA 2BKUA 3QENA 4RZ2A 4EPRA 1XWIA 1E79A 1G7SA 4LC0A 2XTZA 2ZJAA 4EPTA 3RC8A 1D9XA 1Z2CA 4A82A 4AG5A 1MO4A 1X86B 1M6NA 1T6NA 3QSYA 1T3HA 1YVDA 3CLVA 4GSYA 1W0KD 1N6LA 2QROA 3BFKA 3VR6A 5IT5A 5EE9A 3FKQA 3U7HB 1EGAA 1FX0A 1DOAA 1SXJC 4OKSA 3T61A 3SQWA 1F2UB 4WZAE 2EQBA 3IIJA 4JSTA 3AQ4A 1U0LA 3U44B 1I2MA 2QSZA 4EDHA 4HAYA 1XU4A 5DYIA 2CHQA 5DIFA 1Z8FA 1RRPA 3C16C 4DIEA 2O5VA 1G19A 5TY0A 2WSSD 4LRWA 5CM8B 2ZU0C 3U6BA 1P3JA 1Q3HA 4O0MA 4NH0A 4OQFA 3R7WB 1JR3D 2IW3A 3FB4A 4CGZA 3HU2A 3B1VA 3UG6A 4RFSB 3EZ6A 5KO2A 3VU9B 1DTSA 3NHBA 1KMHA 4MGKR 2PJRA 1A2BA 4IOLA 1Z0DA 4ESHA 4LJ6A 4MKIA 3QPVA 1OW3B 1VTKA 4LJYA 1RZ3A 5J4VA 1XBTA 4DXAA 3JVUA 1E2GA 1ODFA 1E2JA 4C0SA 4B3CA 1UDWA 2W2XA 2W6JA 1DPFA 1R4AA 4B35A 2PX0A 2VYFA 5J4YA 3EPKA 1VKJA 1S1CA 2BMFA 1VHTA 2Z83A 4G1UC 3TUZC 3PENA 1HE1C 1ESNA 3OHMA 2JDID 2QL6A 3NDPA 1IN4A 1M8PA 4IEEA 1LV7A 1LS1A 2UZ3A 4ZKEA 3JZMA 2IX3A 2OSBA 4BASA 1FP7A 4TQUS 1JNYA 1IXSB 4MDFA 2HV8A 5KUTA 4IDQA 3ZVRA 1XJCA 2C98A 2IF0A 3A1WA 3AVOA 2ZUCA 3V4FA 5TARA 4P3YA 3WNBA 4BLPA 5JI3E 5FOWA 2QNRA 3I5YA 5EE0A 5HCNA 5EUMA 2P5SA 3DM9B 2V7QD 1GRRA 3N2EA 5JSZA 4OHYA 1UJ2A 2PCJA 1WE2A 2ZI6A 4NYJQ 3MWLA 4Q18A 3BS4A 4MUBA 3B13B 1Z5ZA 1M7BA 1XPOA 1Z06A 2QQ0A 4TTRA 1E94E 1E32A 2GK7A 4MKHA 1DARA 4UNQA 3TK1A 2OAQ1 1EFUA 1KJZA 3K09C 3A37A 1ZM2A 1TUIA 3QY0A 1R0XA 4UXJA 1KGDA 4BZQA 3SYNA 3DO6A 1Z83A 1F2UA 3P4XA 3AVUA 3U44A 4PHTA 3P26A 1SQ5A 2G83A 3L82B 3SE0A 3EWSA 2BDTA 3AKCA 4YQFA 1KNQA 4UNSA 2IYUA 4KFRA 1XTRA 1PZNA 1E2EA 5CYOA 2VP0A 3R7WA 4A8JC 3FMPB 1IM2A 1E9FA 2WOJA 2QEQA 3L0OA 4P33A 5KNDA 3U5ZB 1UF9A 4IOJA 4FIDA 4M22A 2CK3D 4U02A 3ND8A 1KO4A 2G88A 1PLJA 2EU8A 4JVSB 4JS0A 3W6OA 1T9HA 2BBOA 4IFEA 3OAAD 2ZE7A 5FPSA 2BHRA 2OAP1 4TLBA 3LW7A 5TB5A 4DCSA 3K0FA 3I8SA 2FOLA 1XMVA 4DUGA 2YNMA 2V1UA 4PQRA 2GAOA 1DEKA 1IN7A 3SHWA 3BFVA 3T34A 4DDTA 1Z6AA 2ZRDA 5B30A 1R5NA 4I1SA 1CR4A 3WMGA 1Q1ZA 3G0HA 1E2PA 1MRSA 2ZSEA 4WZ6A 5GJVC 3T15A 5JECA 3ICEA 3R9XA 3ZH9B 2F6RA 4BFXA 1UPTA 3AEZA 1GNPA 1GP2A 2GXAA 1KY2A 1Z07A 2ZJ2A 4QBIA 4R2IA 5KDDA 1KI1A 5KSZA 5JJLA 2F1JA 4QJ5A 3TQCA 1GFIA 2GBLC 1COWD 3GEHA 2WWHA 4LJ8A 1AM4D 2ODEA 5DN6D 1DO0A 3RRYA 3MJHA 4XH9B 5CIQA 2PCLA 5SZIA 3QVUA 2ZREA 4XOIA 3VFDA 4AKIA 4NYIQ 3T1VA 1JJ7A 2YVUA 3WNDA 1SGWA 1TX4B 3HU3A 3W3ZB 3WHKA 3QKSB 1US8B 1Z6YA 1P2TA 4ARZA 1AKEA 2FX3A 3I62A 3W6NA 1P73A 2O8CB 1G7CA 4OL0A 1FTSA 3QIAA 4ILEA 4XWOA 4Q1BA 1VYVA 3ZVNA 2C9CA 2CE7A 3I73A 1UBFA 3SN6A 2VHUA 1J2JA 1ZIOA 1GL7A 1KKLA 2ODBA 3EW9A 2A5JA 4EPYA 4W5WA 2WJIA 3PUVA 4NCNA 2NO1A 4JLOA 3B78A 4CRWB 4P0TA 3E1SA 4D4LA 4DHEA 1EFHA 5M04A 1ZIPA 2WKQA 4KBGA 2RGAA 4AK9A 3KKPA 4WAUA 4NCIA 4G5OA 2BCGY 5FBVB 1KZGB 3CKLA 4LPKA 4DCVA 1ZUHA 2J41A 1NBMA 2YWFA 4PANA 1H8HA 4MRSA 2FSGA 2ZRNA 4V0NA 3K09A 1YR7A 5CM9C 1ZCBA 2ZRKA 3QNUA 4D4KA 2P6UA 3CW2A 3LLUA 1II8B 2WJVA 1AQUA 1PJRA 1FQKA 3ZYCA 4B75A 4DLRA 4A2PA 2NPIA 2F55A 1Z63A 2GVZC 3SFVA 3UATA 5H8WA 1OXUA 3Q7QA 1A82A 1TUEA 5CITA 1GM5A 4LBYA 4JT2A 5C2JB 1BYIA 1M34E 3VNUA 4A8JA 3GJ5A 1II0A 2WWFA 4TLAA 2IEZA 1R0WA 2V55B 1ZM3A 3IIMA 4KBFA 1XMJA 4NU0A 4JVLA 3CM0A 1GL9B 4CF7A 3GLGB 3EC1A 4D4MA 4BLOA 1OHHD 1UKZA 3RSLA 4LBWA 3VKWA 1WBBA 4Q4AB 4MGYR 4HI0E 2XNDA 4DVGA 2XEXA 2J0SA 4C7OB 1SULA 2IXEA 4UXHA 1E3MA 1JPJA 1XCGB 2OV2A 1ZW6A 3G5UA 3EARA 2Q9BA 3WBKA 1TQ6A 2QP3A 5EXXA 2GTPA 2IEYA 4LSGA 4ZI3A 2ZRPA 1U9IC 2X2FA 1NLFA 4QRHA 2B8TA 1RRGA 4MUAA 2AFIE 5EE1A 4OQLA 3MGCA 5FUVA 3TMKA 3QKSA 1US8A 2OFXA 3Q8XB 4V03A 1UEJA 5FUYA 2FGJA 4C0LA 3UIEA 1P9NA 1E2IA 1E2NA 1MO6A 4JLMA 5TMPA 1LF5A 1TADA 421PA 1S8FA 2GBLA 1Z28A 5DO9A 4QGAA 3AP3A 3PXGA 1HA3A 4HUTA 4MKGA 1MABA 2ZRJA 3MSXA 2BBSA 1M74A 3T1QA 2NO0A 5AK0A 1KSGA 2QAGC 1S9HA 4OHZA 1RC8A 3LQRA 2GEDA 4AC9A 2IYZA 1OPXA 1CXZA 2W2VA 4A0HA 5K8TA 1W49A 2FFBA 4C0BA 4B43A 3DZDA 2QBYB 5HZKA 5JS8A 2GEUA 2Z4RA 1A4RA 5IF9A 2O0KA 4KO8A 1P60A 3NXSA 1VHLA 4TQAA 5IK2D 1II8A 2ZR0A 3L2OB 4YMUA 3PR1A 3KQLA 2O8EB 1E99A 2QAGB 5FBQB 3TVTA 1I4TD 2RMKA 1RJ9B 1SKYB 2KJQA 4G5QA 3MAAC 5FI1B 4P4SA 2REOA 2ZSBA 3RAPR 3SJAA 4PC1A 3OFND 4QNMA 4AYWA 1W0KA 4DSTA 2A78A 2AFHE 5DGXA 2QM7A 4JSYA 3CONA 4JLKA 1XFAA 5DI3B 2DHRA 2RGEA 4DRZA 1DAEA 4PAOA 2CNWD 4FMCB 4CT4B 1L7VC 2CCKA 2VF7A 4JVMA 4O25A 1UBEA 4Z8YA 4BGDA 2XITA 4M9ZA 3FHTA 3BB1A 3T1OA 2IYSA 3GLGA 1EESA 3ZS9A 3PEYA 2ZRFA 1J70A 5HE8A 4C2TA 1IOZA 2G1JA 4DWJA 3KJGA 4Q4AA 4OI0A 2JLSA 4RFVA 1XNJA 1ZNWA 4GDFA 4C7OA 2HDNB 2YV5A 4N1AA 3A6PC 2CCJA 3RSOA 3FWYA 3HPQA 1W46A 3GJXC 3L0SA 4BLQA 2J1LA 5KSPA 1T8TA 2VO1A 4XTRA 5JMTA 1ZU4A 1KK0A 5EXPA 2RGGA 2A7QA 4HLUA 1YE8A 2EYUA 4QM7A 2A5DA 5BXQC 4M1OA 2GCOB 1G20E 3VAAA 4JVNA 1CR2A 4HLCA 3K9HA 4PPGA 4B74A 1CKEA 1M2OB 1OLOA 1TL7C 5GJWC 1NP6A 2LCFA 4ZO4A 3SS8A 4ZKDA 2WV9A 2XTNA 1HUQA 1YZGA 2CEAA 1KY3A 4PHGA 1ZM4A 4JKIA 1OXTA 1G8FA 2ZJBA 2CXXA 1SXJE 2I4IA 2V6JA 2FFAA 1DAKA 2MMCA 2ZROA 1Y63A 3QKTA 4DLVA 1U9IA 3OIWA 3W5JA 4KVAA 3LX5A 5KNBA 3FMIA 3GLFA 2QRZA 2QTVB 2ZYWX 1LVGA 5G40A 2REBA 3O8BA 3RYTC 4B32A 1VCIA 2CDNA 4FINA 1BIFA 1E9SA 4DUGD 1ZNYA 3ASYA 1KI4A 1G64A 2ZVQX 4HLDA 3VR2A 1DAGA 3DMNA 2HCJB 2QG6A 2DYKA 2FZ4A 4WXPA 4BEJA 2ZE6A 4OJQA 2FDCA 4KCGA 2V7QA 3AM1A 1JB1A 3D7MA 2EVWX 3IEUA 5J47A 1P61B 3U6KA 1ZM9A 3IHLA 4FXPA 3SJBA 1YZTA 1DBSA 3TJZA 2VPPA 4DDVA 3LAWA 1IJFA 1P4SA 2PZGA 1CS4C 3DDCA 4C0HA 4XTCS 2NOAA 1HV8A 2GF9A 3W90A 3AVWA 2LKCA 1N5JA 2QAGA 1II9A 4DB2A 4BZPA 1RJ9A 3CX6A 5A0FA 3LBIA 2JLXA 2VHQA 2OILA 3NH6A 3P27A 1ZM7A 1E2HA 5DI3A 1G5RA 4JLPA 2VHTA 3B9QA 3AP2A 2FWRA 1G6OA 1GL6A 1TF2A 3K53A 4HAWA 3UWOA 2AR7A 3QE0A 4N3NA 3ZZTA 4UNRA 5JLJA 2ZI9A 4LJ4A 1Z22A 1KKMA 2B7CA 1E4YA 3QXHA 3A36A 1G6HA 1DE0A 2WZQA 3CWZA 2B92A 5J40A 1TNDA 4PTLA 4WIAA 2TMKA 2V3CC 2IA5A 4JT4A 621PA 1WMSA 4DLUA 5HZHA 2VP2A 4ACBA 4LZZA 4V0MA 4MGIR 2JAQA 2HF8A 3OAAA 2OBLA 4OJKA 1SVLA 221PA 1H65A 2CL7X 1R5OA 3IUYA 2O8BB 2P65A 2R6FA 2GCOA 4X8OA 4AURA 5FH9A 3K9NA 3K0EA 1YRAA 2ZRIA 3V4RA 1E0JA 1KI7A 4Z54A 2BCJQ 2ONKA 2ZS9A 4IHQA 4Q01A 4EFMA 3K0SA 2FSIA 4ZDKA 1NBME 3KFXA 3OF5A 4X8MA 2Q9CA 2N42A 5B57C 3DZ8A 3NC1C 1VCNA 2FF7A 4QGFA 1W2GA 1KI8A 3NIBA 4OK5A 1H8HD 4KLZA 4QNRA 4F4IA 2KBEA 4ASUD 1XF9A 1A7JA 4Q9KA 1KAGA 1KO8A 1EX7A 3GP8A 3TW4A 4TN1A 1E1RA 3EWAA 2WJGA 1W47A 1RFLA 1E2KA 1LS6A 3E2IA 3CPJB 2VP4A 2HEIA 4Q1FA 2IT1A 1PUIA 1PLLA 5LB4A 3SZRA 4A0RA 4Q1AA 5DN6A 4NDZA 1CLUA 1FP6A 2GRJA 3EX7C 1GZSA 3CRQA 2YWEA 2WIAA 1EX6A 3OEED 1DAFA 5ANRB 4HB2A 1R2QA 4A4DA 3AGQA 2D2EA 3K9GA 2DY1A 5CLLA 2WWYA 2ZRLA 1DELA 1TEVA 3CZPA 3WP1B 2QE7D 4A9AA 2JA1A 3CO5A 4NHOA 2GJ9A 4KSBA 5IHPA 5C4GB 5P21A 1SVWA 1CF4A 3AKYA 1KYIA 2MSEB 5JJIA 5FUXA 4QHSA 1OIVA 3M1IA 4ZDJA 4KYUA 4I4LA 1XEXA 4OK6A 5EZ6B 4ITRC 1OXSC 3AVQA 5FTKA 4JYCA 1P9RA 3BB3A 3NG1A 1N6PA 1OH8A 3FDIA 1ZD1A 3B5JA 2HXYA 4BUJA 3B60A 2B6HA 3GJ0A 5DISB 1IY0A 3CR7A 5CK5A 2FGKA 4L4UA 1OSNA 3KX2A 1E98A 3KDSE 1DS6A 1E1QD 5EP2A 3RRZA 1Z0KA 2QUZA 1X8JA 3BC1A 4M1WA 2XB2A 2R9VA 2ZUBA 1UBGA 3HWSA 1IONA 5FI0B 4C2UA 3GLHE 4C0KA 2FSFA 2O8BA 4V0KA 2CE2X 3LBHA 3QI2A 5AJVB 4F93B 4US0R 3W5IA 4EQ6B 5EXSA 2ANCA 3Q3JB 2ZXUA 4II7A 3K0AB 4KXFB 1XB2A 5GVRA 1Q0UA 3M6AA 4LHVA 4LYJA 3QEJA 5LB2A 4QL3A 1BMFA 3QXSA 1NJGA 1S96A 1C9KA 5FOUA 2WOOA 2IC5A 1NN3A 1YJ5A 1R5BA 3P1JA 5HKKD 5KU1A 4PX9A 1HH4A 1OHHA 3U3KA 1RKBA 3BBPA 5B58C 2VEDA 3IQXA 4RD1A 5E95A 2J7KA 1OV4A 3GQBA 4U5XA 3MWYW 2G0NA 3KKNA 1ZUIA 4D82A 5FR1A 2DB3A 1XTQA 3QBTA 4I1OA 3HP1A 3RWOA 5JZVA 2NZJA 5FR2A 4G5SA 4ZDWA 3C7KA 3DKVA 2GXSA 4IVPA 3F0TA 2P6RA 2W6ID 4UXIA 4W7SA 2F9LA 2JLUA 4C0JA 1ZD8A 2I1VB 4D25A 4NTZA 4DJTA 4YMWA 2R62A 5H68A 4KV9A 1Z3IX 3R20A 4KODA 2FJUA 4JMPA 4RD3A 1JR3E 1XEFA 3RDPA 3AVTA 1D6JA 4URVR 2D7DA 3KQKA 4D80A 2OLKA 3DL0A 1N5KA 1QHSA 2HF9A 2NQ2C 5AR1A 4AYXA 2O8FA 2GA8A 2OG2A 2G77B 2ZJ5A 3CX7A 3K9LA 2GK6A 4JJZA 4G0NA 5EQTA 1KOFA 2XOKA 3MD0A 4YDSA 1UDXA 2C95A 4PC3A 3GLIA 1OFIA 4P32A 3BRWD 2VP5A 1CJUC 3IQWA 2A30A 3P4YA 2Z6VA 1U0HC 2NZ8A 4URZR 5KTYA 1GTVA 4L9SA 5DHAA 2H5EA 5DI9A 3T06B 2GESA 1AZTA 4RY2A 3D8BA 3X2SA 4WZBE 3LNCA 1K5DA 2O0JA 3MFYA 2X77A 4E07A 2ORIA 2HJGA 2QM8A 4HB0A 4Q1EA 1TQ4A 1OKKD 2J45A 2AWNA 1KDRA 2X2EA 4PPQA 4W9MC 1WBDA 1GITA 4GRAA 4IKEA 4LJ9A 5HE9A 5IK2A 5AUOB 2IXGA 2IYVA 2RGCA 4D26A 2JLWA 2E1RA 4UNPA 1YRBA 2GDJA 5BYJA 5CB6A 2IUTA 2OBNA 3OFNA 1I4DD 2BV3A 2XZPA 3LVRE 2FFHA 1W7AA 5JEDA 2G9NA 3U2QA 2Q6TA 4FCTA 821PA 4AIIA 3AVVA 4EKDA 1QHHA 4ZIRB 3K0AA 2CNWA 1NMZA 1XTJA 1N0UA 2C2HA 4GP6A 2OBMA 2YZ2A 4QM6A 2KE5A 3GJ3A 4D4JA 4LBVA 3QKRB 4Q7LA 2ODWA 2NMVA 2OCAA 3AKDA 4BZXA 4ZI2A 3B2EA 1NI3A 4B2LA 1DAHA 1VG8A 3TW8B 3ADBA 4CEJB 2AXNA 1W2HA 4EAQA 2SHKA 1TF7A 5SZJA 4IVRA 1G5TA 2E87A 1Q57A 1F2TB 2ZR7A 2VL7A 1TU3A 4NCHA 1QG4A 3MG9A 1T8UA 4AKHA 1N6KA 2CL6X 4A36A 1H8EA 1QRAA 1QHNA 2O8DB 2YWGA 3SJZA 1HTWA 1G3IA 4M0LA 4PR0A 4V0OA 4D2IA 3ZD7A 5FTNA 4QOSA 3I92A 1XDBA 2FA9A 4JL8A 4E5UA 3M4YA 3PEWA 3TSZA 1R6BX 2ZRAA 1OYYA 1Q21A 5EXTA 4OI2A 3FGNA 1CJMA 2Q0HA 3UMRA 2REXB 4LV6A 3N5CA 5L3QB 2VSXA 2B8WA 3QXCA 4NYJR 4RFSA 2ORVA 3LA6A 3LXXA 3VU9A 3EZFA 1KDPA 1W36D 3GCGA 1IAQA 5K8IA 3CRW1 5LPNA 4TLEA 2C5LA 3WHLA 4B47A 4K8OA 2AKYA 4QC2A 4TYNA 2VSOA 1X1RA 4LYHA 4NYMQ 4BFYA 1KHTA 2F1IA 3LWNA 2ZVPX 4JJKA 1KO7A 3DKPA 2RB4A 4B3XA 3QUSA 4PSVA 5FFMA 4TMZA 3SI7A 3UXMA 1NMXA 2X1VA 3F3YA 3W8RA 5FBWB 2GZDA 2QZ4A 4J0QA 5G53C 4CDGA 1KO5A 1WXQA 1RE0A 3VQTA 4H9GA 2DWOA 4HUQB 3I4LA 8OHMA 1HQYE 1GRNA 4KU4A 3TE6A 4OI1A 3OEHA 1NY6A 4CYMA 4GMDA 4BQSA 3MRSA 1XD2B 4W5JA 1S0UA 4RCYA 5D3MB 1W0JD 2R6CA 2YOHA 3CBQA 3CRMA 5FPTA 2CL0X 3SFZA 1E1RD 1P72A 2PH1A 2GWHA 4KJZA 3OESA 3TIFA 3FFAA 1G17A 2QT1A 3IBYA 1NG1A 4OQMA 4BEBA 1ESMA 4UJ3A 4US1R 1KI6B 2J9RA 3LDAA 4ZCLA 5KSOA 1KZ7B 3NEJA 2HT6A 2OCPA 2OE2A 4PSKA 3QKRA 2IUUA 1E0SA 4TMTA 3IDQA 4Q1CA 3ZD6A 4CVNA 2AD1A 3ADKA 4FN5A 4CEJA 2GZHA 3QXJA 1N6IA 3BORA 2BMDA 2JLQA 3RHFA 4ESVA 3U3RA 5A4JA 1DAMA 2EFEB 2CVFA 1G3RA 5JWHA 3FKSD 5HPYB 1NVXQ 4HAXA 2Q3FA 4LK2A 3TBKA 3SBEA 2WJHA 5JRZA 4X8LA 1RRFA 3IHWA 3SHFA 4FWTA 3KXKA 2AX4A 4C0QC 2CCGA 3CB4A 1U8ZA 3SNHA 5FPKA 5L8VA 1DO2A 3UWKA 4NYIR 1FNMA 2WKPA 4M9SA 3O8CA 1J90A 4TSFD 3NBZC 1E2DA 1AS2A 3RABA 4AKEA 3RRMA 1FOEB 2H17A 4KYIB 1JXMA 2OFWA 4K81B 4ASUA 1T0JB 1WF3A 1E9BA 3TR5A 1JPNA 2GCNA 2QORA 4BE7B 4B3GA 1NVVQ 3AKEA 4Q1DA 2BM0A 3UKDA 2IHYA 1XPUA 2WWXA 2ZI4A 3VR1A 5JFGA 3EZ2A 1N3BA 1XXHB 4JLAA 2J87A 4C3ZA 1CU1A 3FVQA 2J3EA 1RYHA 3KL4A 2IUSA 1LW7A 1WCV1 3ASZA 1ONBA 1XPRA 4B2PA 4LYAA 3I32A 3ZZ0A 1EFRA 1ZNXA 4M8NE 3GMTA 3ZVLA 1XMSA 1BMFD 4JLVA 1MV5A 4HLUC 4TYPA 5B64A 3OEEA 3L0IB 5DSZA 1G8GA 2BKEA 1AS0A 4TYQA 2RCNA 5K8UA 2QE7A 5D3MA 4FW9A 3CNLA 3KB2A 2JLRA 4IXNA 4B6FA 5E7IA 4MRVA 1G5PA 2MSCB 6Q21A 2F1HA 1GOTA 2KI5A 3B1YA 4ABYA 1NVWQ 4A15A 3THWB 4PQFA 2ZANA 2OFOA 4IJMA 2ANBA 2C9YA 2P6NA 3VMFA 4JL5A 4FMBB 1Z0FA 2C99A 3GJ6A 3BXZA 1O3YA 2R6DA 1B0UA 1IHUA 3FPAA 3LD9A 2WWGA 3VHLB 4GP7A 1JAHA 1U90A 3TVDA 3O8DA 3FFBA 4LV8B 4NZYA 5JJKA 2O8CA 2XTMA 4XD7A 4B3BA 2VLIA 1XZQA 3L8ZA 4OHVA 3CZQA 3VNVA 5FTJA 2C78A 5G3ZA 1E1QA 5KSYA 1XZPA 2O52A 3U4QB 1OIXA 1U99A 4MYHA 2PLRA 4B71A 3HR7A 2XXAB 1UKVY 2H57A 2N1BA 2PZFA 2XOKD 1NNEA 3GLIE 3U3OA 1Z47A 2JIZD 3SJCA 1N6NA 2C96A 1E6CA 2ASEA 2ZSDA 3CF6R 1Z6TA 3QQ5A 1HE8B 1KAOA 1P9WA 3U61B 2RGNC 1K6MA 2RGDA 3D6TB 5CYPA 2W0MA 5JBQA 3GJ4A 3L0PA 2C8VA 4WXRA 1T4GA 3NWJA 1KIMA 4ACAA 4US2R 2QGNA 3KJIA 3ZQJA 1QHIA 4G01B 1YZKA 3DOEA 5HKKA 4Q48A 1DVRA 3AF4A 3GFOA 2OUKA 3ECCA 4TYWA 4LHZA 2JCSA 3QXXA 1BYUA 5KDOA 2NO9A 3GJ8A 3H4MA 1VYUA 4RD4A 3RANA 2ZRBA 1EWQA 1TQ2A 3K1JA 1NG9A 2HT1A 3D31A 2YKGA 2ZSFA 2VH5R 4UQOA 1MH1A 4MKFA 1D2NA 2CHGA 3QVVA 3BWDD 2GCPA 3A4LA 2XJ4A 3CIOA 3B1ZA 3Q9LA 4N0EA 4ZPXA 2W6IA 4Q03A 3ETLA 1W36C 4P4UA 4HLQB 1Q22A 1ZC4A 2RHMA 3IGFA 2B21A 1PV4A 3B7GA 4EPXA 1ZCAA 4L15A 3V00A 2JLVA 1VG0B 4AG6A 5CJPA 1ZNZA 3C5HA 1XRJA 2D62A 5TDHA 2ZS7A 4Q4JB 2ONJA 1XEWX 1F3OA 4AWXA 2ERYA 2W2TA 3A1VA 3OE7A 4KFSA 1GDDA 3KKMA 1JJVA 3DOFA 1NN1A 2GXQA 3UPUA 4MITA 1IBRA 3AGPA 2D4HA 4XIGS 1G291 2PEZA 1W36B 2IYXA 1VCMA 4Q19A 5LD2C 1JECA 2EFDB 4W5HA 4Y0AA 3AVXA 1K5GA 4GOXA 3NKVA 1H8ED 3RLFA 4DCUA 3THWA 4E09A 4RKFA 2R65A 1LNZA 5FBRB 3X1WA 3Q72A 3RWMB 2NGRA 4L9WA 4FCWA 3WYFA 3TGPA 3THXB 1UKEA 3KKQA 2J0VA 4JBXA 4PXAA 4QHYA 2C04A 3RNLA 4ON9A 1VDZA 2CLDX 2IS2A 2WICA 3NEYA 4M1SA 4BECA 2RKOA 4EFNA 3AVYA 3AB3A 3AF1A 1YZLA 1CP2A 2QN6A 1EFCA 2JLZA 5LD2B 3EAQA 1OKKA 3I72A 4TL9A 1EXMA 4HZIA 3VX4A 2ZAOA 3I5XA 3U4QA 4WA7A 2WMOB 1S3SA 3ONWA 4M1KA 2XXAA 1TMKA 1KK2A 3VR5A 4FMCF 5SZHB 1E69A 1E96A 5J4LA 4PO8A 3OIVA 4RZ3A 3EA0A 2JGNA 2J0UB 2YJTD 2G0TA 3TNFA 2FEMA 1XD9A 1WDTA 1OF1A 2VQSA 4TYYA 3TQFA 2XGJA 2HYDA 1PLKA 4S2EA 1CJTC 1Q12A 2EFHB 2GVDC 4R9UC 5CJ2A 2Q3HA 3PV0A 1M7HA 1P7CA 1WRBA 4NONA 2QBYA 3FOZA 4DIDA 2PMDA 4NE2A 3OEHD 4D0GA 5FPHA 3SOPA 4E03A 1KSHA 3C14C 3MWKA 4F4JA 5HCIA 3NBFA 4LBZA 1G7RA 2RGNA 1CEEA 3QF7A 2O8EA 1RPZA 2OLJA 1D2EA 2H7VA 3UMSA 3PUYA 4GI7A 4NP6A 1Z6XA 1LB1B 2RGBA 1AA9A 1EFTA 1HY3A 4OQXA 2C03A 1L2TA 4XVQA 4QBHA 5BQ5A 3RS3A 5CB8A 2DFTA 4DBLC 1NY5A 2EFCB 3I8XA 2IWHA 1GUAA 1YZUA 1Q20A 3OIYA 1VMAA 3U7FB 1J8MF 4Q4HA 1AS3A 3A58B 3UMFA 5AWFC 1KJWA 5C4MA 4PSAA 1FNNA 2BJWA 3REGA 1UM8A 1G16A 4PO9A 3B82A 4IW3B 3P20A 2FPLA 2PX3A 2UKDA 4LOAA 2AK2A 4OQNA 4OHWA 3A4MA 1YR6A 1DADA 3VX3A 4CT5A 2XJ9A 4HAVA 3ZVMA 1V43A 1Z6GA 3W34A 2JJ2D 2QMEA 2NTYC 4TL8A 4KITB 1NKTA 3CF0A 1SVIA 3KTAB 1PVOA 2Z43A 2Y8EA 4NMMA 1KJYA 1GRQA 5FOSA 2J7PD 5AJWA 4YMVA 4DSUA 3ZJYA 1NN0A 3AUXA 4YXWA 3TRFA 3KFVA 4HAZA 3VKHA 2QU8A 2OCYC 3LRPA 3W9YA 4P31A 1OYWA 4M1TA 2KSQA 3LVQE 2IS6A 1AKYA 1UADA 2VRWA 4HDQB 3K70C 1W0JA 4JLNA 3WP0A 1FTNA 2OHFA 2R2AA 3WRXC 4DLSA 3SEAA 4Q9IA 1BOFA 4R98A 4NL4H 1L8QA 5EUQB 5C18A 2XB4A 2QAJA 2QPOA 1IXZA 2ZYVX 4LJAA 3RC3A 1Z0AA 3OZXA 1KI2A 1S1MA 2ZS8A 4MA4A 2IYQA 4V02A 1WA5A 3IO3A 4PQYA 1EFRD 3S1AB 3THYB 4CEHB 3ADDA 1MRNA 3PG5A 3SQXA 3K70B 2WJYA 2KWIA 4ZV4A 2QY9A 1R0ZA 4JLJA 1OE0A 4C30A 4O2LA 4JBYA 1VYTA 4N0DA 4UNNA 4M1YA 2NIPA 1P6XA 2F43B 1AK2A 4U00A 5FL3A 2ZRHA 4BFWA 2RGXA 2C9OA 4DSOA 2QSYA 3U7GA 1FX0B 2WAYA 3FKSA 1QHXA 5F9FA 2ZTSA 3GEEA 3DVLA 2DFNA 2JASA 2AL7A 4PZYA 4GNKA 1W44A 2ZSAA 3WBJA 1G41A 2A5FA 2BOVA 4OHXA 2V54A 1L4YA 1E2MA 1YU9A 2FPKA 1JI0A 1SHZA 4TSFA 2Q3MA 2DFKB 1SZPA 3KZ1E 1KNXA 2IL1A 4PHHA 1KMHB 2VTKA 3HJNA 4XD7D 3CPEA 3PUXA 4Q21A 1F6BA 4BWYA 1YR8A 1TTTA 4EPVA 4RD0A 4PC6A 1KK3A 3B9PA 1OFHA 3BH0A 5EJEA 4TT3A 4TZ6A 4BLRA 2AN9A 2PJZA 1X3SA 3DEFA 5EE3A 3EASA 1G9XA 3KTAA 3U3JA 1NKSA 2VSFA 1JEEA 2QP4A 3NDBB 4V0LA 4G5RA 3TSOA 4A92A 1D9ZA 4BFVA 1VPLA 3A4NA 4WVFA 1XD8A 3PEVA 5TV2A 1N2CE 2ZRGA 2ZEJA 4TMVA 1G18A 1RYFA 2I1QA 1VG1A 2VP6A 4IDPA 4UKDA 5FL7D 3TR0A 3K0CC 1FW6A 1SKQA 3CRRA 2BWJA 4HATA 4EJSC 1XCPA 3QPWA 1X1SA 1XEWY 1UFQA 2CLCX 1OH5A 1X8KA
chains in the Genus database with same CATH superfamily
3P52A 1M34A 1M2FA 1ZX1A 2P75A 4Y8VA 1ZHOA 2R1TB 4MQ5A 4DRYA 1UOQA 3HUDA 1IVYA 3NC0C 3NIWA 5CT6A 1Z5VA 4L16A 3DUFA 3TLXA 3QK7A 1A1SA 1UBLS 3GLGE 1WZEA 2H52A 3BERA 3WZLA 5EJ7A 4LQ4A 3I2KA 3KUCA 3SEQA 1DB3A 3JW8A 2P41A 2J5XA 3TNDA 2DBRA 5IDYA 1J0CA 1G8HA 4B6PA 3BXFA 4DXDA 4IMPA 2I3GA 1XV5A 4X1YA 1EJ2A 5CM2Z 2X42A 1PDOA 4QBGB 2AB0A 4ALJA 1LLQA 2ODPA 4B6JA 2PIDA 3TECE 4NQZA 5JFOA 4ZK2A 5B1SA 4TV8B 3EXAA 2IXBA 4U5QA 1OT3A 1PZGA 1SCUA 3N3BC 1RZRA 4ZP1A 4GPEA 8ATCA 2JZOA 4REOA 3H1BA 4I4CA 2Q0SA 2C4MA 2I55A 2AF3C 4FNAA 4JQZA 4LZPA 1Q7TA 4NJOA 4B4DA 5IDWA 4R7ZA 4GR4A 2ZBRA 3JYNA 2AFIA 1YB6A 1U2ZA 4FWIB 4GPTA 1TTHA 2QR5A 3D9QX 4Q02A 2YY7A 3V1MA 2WSYB 3AONB 3NV7A 2ZIZA 5DH9A 5DPMA 2Q8NA 3NQ41 4Q3NA 4RVCA 4MNTA 5UKDA 3KE9A 4LTMA 3AUUA 3SLKA 5L3SB 2QZ9A 1I4OA 2DUJA 3RC9A 2R68A 1CY4A 4C9BA 1B6RA 4EUEA 4CLRA 2JC3A 3LKZA 4PGAA 5EZSA 3EQZA 3MCZA 4CCWA 3UA3A 3O1JC 3DL2A 5IJ0B 5EZ5A 3UEOA 3OPYI 2GJSA 2PBLA 1L0BA 5HJ2A 4EF6A 4M9XA 1T3TA 2RC6A 2PH5A 3GEBA 2A2ZA 3L6EA 3TQOA 3GLFE 2ZUSA 4IG4A 3MBIA 3SYMA 3K0FB 1GAEO 3KJNA 1VE7A 2WHQA 4MCJA 5AQEA 1ZYUA 4YO8A 2P27A 2IY9A 2P40A 4PY2A 3UJ9A 2RDMA 4MB0A 5AKZA 2CGEA 5BQ3A 3OJCA 5BW6B 3ZGXA 4N5MA 4PXYA 3ZIAD 3I9LA 5LNK1 1I5EA 3W78A 2HLDD 2WR8A 3TFOA 3EAFA 2KBFA 4UHBA 4YECA 5ALTA 3QYPA 1JEDA 1DV1A 2R6GA 2FEOA 1OGYA 2P2GA 5ALMA 4OLBA 4EHBA 3AI7A 1NFFA 2HHLA 3TRJA 2HDHA 3A26A 4FQ5A 3QNWA 1G4UR 3GLUA 4D6PA 4TVKA 3ON5A 3H1TA 3HA5A 4F9TA 2V5VA 4XYMA 1M75A 3HSSA 1NOKA 4MV4A 3R7DA 1C3EA 1GZDA 3M8KA 4MZXA 1OXXK 1TM5E 3EBOA 4UAUA 4A2WA 2ICAA 2JJ8A 3IPAA 1GQ2A 1YR9A 5DLYA 4A8HA 3OIUA 4G3XA 5EWJB 3U40A 2HSWA 5L4LA 1MQ9A 1T36A 2EIXA 2R1TA 3GB9A 3JQBA 5F73A 4BNZA 2I1LA 3PRHA 1NUHA 4PNHA 2EP8A 4FFOA 2CWDA 3JWHA 3C41J 2PYIA 4DTCA 2BH2A 2GFHA 4PZZA 2XCIA 1MU0A 3K0CA 4LV5B 1W76A 3TAUA 4ARZB 3GFPA 3RIYA 2VP9A 1HEIA 2A5YB 4LYFA 5SYAA 5EJ8A 5E3IA 1F17A 4FI3C 3KEMA 3BD7A 1HYBA 5CLQA 5BNFA 4JUIA 3A6JA 2ZYIA 1O6BA 4ZVUA 2HSDA 1GU1A 2PR7A 3F7NA 2VT7A 2CVPA 2V0NA 5A5GA 3A3NA 2LKDA 4I6JA 1UJMA 5L3RA 4V2IA 3FCSB 3ZWOA 1FDUA 4PE5B 4D9MA 3FNRA 4GHWA 3SDZA 1AUVA 1QLJA 2XUHA 2ZI5A 4TV8A 3HY6A 2QN3A 1QDEA 2X2OA 5BUCA 1UT6A 2YW2A 3U37A 3VTAA 3WLOA 5C7YA 2NSHA 2QENA 1KYTA 4D81A 1Z13A 4W6ZA 5IEBA 3KPJA 4G5XA 2WTNA 2FCRA 2QRJA 5JRDS 3URKA 1BKDR 3PR3A 5KTPA 3I30X 2D0PB 5C1BA 2BONA 5EMJA 3CPHA 4K86A 2AJTA 1HDRA 3Q7RA 1E4OA 2ZYRA 3LCMA 4MMXB 1IPHA 5L3SA 3IEVA 3TPZA 2JGFA 1RT9A 3H13A 4GIBA 5EVJA 5SICE 2G7ZA 2PE5A 4MH0R 4F60A 3PX2A 4KBYA 5E4TA 4DKXA 3IPCA 5LP6C 1VG9B 5AVVA 4RO0A 1Z4LA 3BD9A 2YVKA 1D0IA 3DWIA 4OXXA 4RJIA 5FOXA 5H16A 3S40A 3TM5A 7YASA 3DFKA 5IJ0A 1P3DA 4EI2A 3LP6A 5DHQA 1UZLA 2J3QA 3FDZA 5KINB 3PF8A 3WJ2A 2EAUA 3AJEA 2YJ3A 1KDTA 3M33A 3OY2A 4GZLA 4JJFA 4QFMA 1QIKA 3RU7A 3U4DA 3AEKB 2H2FA 3IP1A 2JHGA 5LYYA 3U60B 3WGZA 2PQMA 2X3UA 1NVMB 4NYMR 1FFHA 3L9XA 4AW9A 4Y9UA 5CA0F 2RK3A 2QN8A 3CEMA 1YMVA 4UQPA 4E2ZA 1T2NA 3OT5A 5KC9A 2C7BA 1PTJA 4O8CA 3VSBA 4RJLA 3TXAA 1ZVQA 2X4GA 1J24A 3RO7A 4LHXA 1Z37A 2QRHA 2Y0DA 3AXTA 2ZUUA 5EHGA 3LUJA 4NKRA 1OFTA 2Z4SA 3GLVA 1SWVA 2VDNB 3I2GA 5GVSA 1KMIY 4P53A 3UG7A 3A6GA 2O8VA 3O0TA 4RZUA 4FT2A 2RIPA 2DPXA 1XYGA 4OJNA 3V5NA 1RYNA 2D8MA 1F2TA 2JJYA 2MOKA 2QPTA 3DPUA 3PQCA 2B25A 2VNHA 2ZUDA 4IDFA 4IICA 4I4IA 3H3JA 4YVFA 3T3IA 1O5TA 2IFTA 2YHIA 2XTAA 4MUEA 3VHXB 4E94A 3KV1A 2X76A 5F12A 5BYKA 5HTKA 3TKAA 4OJTA 5FF9A 4AWAA 4I99A 3FYUB 5EWJA 1AN9A 4NFYA 4NMXB 2PNJA 1E0AA 3PWTA 4BIMA 1VGVA 5DOZA 3TEJA 2DBYA 4FFDA 4KUEA 1HT1E 4A36A 1DIBA 1RIFA 1SBIA 3EXFB 5LMZA 3PNVA 4OLJA 2Q4RA 3UAYA 4G5GA 2P79A 4I3HA 2D5IA 3AHIA 5A1TA 5DSXA 3HDQA 1XVVA 2CLFB 5EMMA 3SP1A 2KMLA 1SPBS 4G09A 3U0VA 1F4VA 4JJ7A 3AH8A 1PJ2A 3T94A 1RKVA 3KKLA 4EHFA 3DBVO 2Y99A 4NV0A 3W8DA 1DKNA 3X0DA 3WMRA 3ZDQA 3IL2A 4GBJA 3QX8A 1RXCA 3VPHA 3IQHX 4TKMA 3B9BA 1GKLA 2GYYA 4BJHB 2VA9A 1QFMA 4TT3D 1ODCA 4B3FX 1J2UA 3K5IA 3PYLA 1QPGA 3R7BA 3C87A 2HADA 3QYFA 4HZUB 4Y2QA 5IHXA 5K05A 1JIUA 2GPBA 1QMGA 4FEAA 2WF6A 3WMFA 1I1OA 1XLVA 2R5WA 4CG1A 2V74B 4E33A 2YVLA 4BVJA 1X7YA 4UQLA 1ZCJA 2FPWA 4Q4LA 5A4MS 5DNCA 1GYRA 2XCTB 2R11A 4B3SB 3OU7A 2XZLA 1JDZA 2OR3A 2RAPA 3FHCB 4HUQA 1KSJA 3ZCPA 4AZVA 1A2KC 1MJFA 2A0WA 2A33A 4JU8A 1BH6A 1KYYA 1YS9A 5CDFA 4QEDA 1XRPA 3STWA 1G55A 3DOIA 3V7FA 4YUXA 1ML4A 4NEHB 5C4IA 3JZFA 4CTOA 3I6ZA 5JSZA 3W77A 3BTUA 4BFZA 5L53A 2Z6UA 4MULA 4RMNA 2EBHX 2A88A 2GASA 2WVJA 1CF9A 5BSHA 5FNZA 1DEXA 4MDEA 2C4VA 1XT6A 4YH1A 2QTFA 3PJRA 2YVAA 1S01A 2VHJA 2YWBA 1EB8A 3EPLA 2VDMB 3KQMA 1AKWA 4PCLA 3IT0A 5BUSA 5B1IA 4NJEB 1DI0A 3I6QA 4U2FA 5EJIA 2ODNA 2VPIA 2QI9F 2ZJ8A 3L7DA 4FYXA 4JK3A 4XSHA 5ERXA 2PMEA 5A5EA 5H82A 4HH1A 3AF3A 1XZIA 2DFPA 4YRGA 5ERGB 1NW5A 1CC1S 1PGNA 3CNOA 4W6QA 3V7NA 4UOEA 3CF2A 3B1WA 2E4VA 3TOCA 4FOSA 2O5EA 1Q74A 1AG9A 1JH8A 5IAJA 3ZI0A 4XUEA 3LK6A 5G1OA 3Q7PA 4NPHA 3AUYA 4RH0A 3T41A 2FFQA 1RPNA 2LTAA 5CGQB 4YONB 3PE6A 3EIHA 4MA0A 3R9KA 3VHXA 4CQLA 3EPJA 2PZAA 3L1VA 1EK0A 4MYDA 5LXTB 2A6PA 5C8VA 2OESA 2XRFA 4RF4A 3T5AA 1GARA 3FYUA 3GUVA 4M53A 3HP4A 3QY9A 4YP1A 1RZRD 1CE8B 1JIQA 1G4AE 1K0FA 1YK0A 4FOLA 1GYQA 2ATVA 2CYCA 2H7CA 2Y0CA 4OBXA 4X7PA 1XZEA 2FB9A 4LCBA 3ZWMA 3EXFA 2CMKA 2XF8A 2ZETA 3BH7A 1OWPA 3QOWA 4DG9A 1U98A 4A8TA 3UWMA 5K4HA 2R79A 4GOMD 2C82A 2AXPA 3CU5A 4K5QA 5ALNA 5GIPE 3QWAA 1EZ4A 4ROTA 4FE3A 4TOIA 3UK0A 4AJ4A 3H4IA 4MYUA 1QVRA 4IJVA 4D3YA 4PONA 1F1BA 2ENUA 2I4LA 3FHLA 4QYSA 4DCNA 3ZJVA 1R0YA 3AFNA 2XUZA 1A4XA 3GLFB 3D81A 4ND2A 1PQPA 2KB0A 1IEWA 1G1MA 3LFHA 1J6UA 2QSJA 2QUKA 1IHPA 3G82C 2HUPA 1XXHA 3GFVA 3E9NA 4HD8A 3H6HA 3V34A 1E0KA 4EY5A 3HNPA 4HZUA 3EE6A 1FJGB 4AI6A 2GD2A 3D0OA 4WJKB 3WNVA 2BHTA 2ZI3A 1DAIA 2BTOA 2I7CA 2R6ZA 4Z1OA 3KZOA 1IXRC 2W6JD 4PWZA 3MB8A 2VUHB 4DEXA 5DP1A 1Z17A 3GAMA 2GLTA 3UJDA 5JZSA 5KKCA 2C7RA 4TV9F 1E9RA 2P1RA 1YQTA 5A9TA 1BE8A 3X1YA 4OFXA 2C2YA 2XMQA 4BVEA 5KQMA 1NN5A 4FCCA 4FDAA 4XRRA 1NM5A 4ERNA 1WB9A 1C50A 2Z8YA 3K0BA 1MO2A 4NBTA 2VAXA 4AJIA 1E5TA 5JZ9A 1QU3A 2GETA 3A6HA 3PNBA 5DHFA 2HA3A 2FZLA 4HDMB 5BSUA 2B4QA 2DUWA 1ZD5A 2HAEA 1MNQA 1ULUA 2F3RA 4GRIA 5DGTA 1FUUA 3EIQA 5FAXA 3AO0B 3UV3A 2B4RO 3BBLA 4JBGA 1ISMA 2VKTA 3HYSA 4F38A 4GWKA 1L5MA 2XRYA 4R1SA 1BMQA 3LH5A 3SYLA 1JHZA 1KF0A 2CLHB 4NJEA 3TR6A 1XDGA 4ISCA 2IYYA 1LFDB 3KYIB 2CD9A 1XZMA 2AN4A 2LPMA 3RF6A 2WJPA 4EECA 2C84A 1WBJB 1ZICA 3GG2A 2XE7A 1Y98A 3KNZA 1I2DA 2OHGA 4FFBA 2ZJZA 4X5OA 1QIMA 4KWHA 3RJMA 1HTTA 1NI4B 2YJ4A 3DHYA 4QLAA 2H5JA 3LY7A 4LQCA 1DXHA 2CXRA 2YOFA 3GYBA 1SUAA 4KNWA 3EXHA 3SEZA 1XTKA 2MTBA 2ZJ0A 3Q5GA 2Y1XA 1NSTA 2YYZA 4KFUA 3SIRA 3SR3A 3U0BA 5L7TA 3O94A 4R2HA 5KPDA 1T3LA 3QRWA 5I7OA 2WQZA 1TQHA 2ZE5A 3E1GA 2IYLD 3D2LA 2QRNA 2J59A 1H2RS 2CLSA 4K6KA 1CE8A 1LQ2A 1XK6A 3ZYZA 4IWXA 4ZALA 2VTBB 1E4EB 3RU2A 1V3VA 4I4NA 4XFKA 4J2TA 1QVAA 3MHTA 1XR3A 1N5LA 5DJ5A 2FYTA 4OQDA 3C4JA 4ZD6A 2JBWA 1D8TA 1F5NA 3V8VA 3VU0A 1RPTA 1KTVA 3X2FA 2F4NA 1WUYA 4MSUA 4F9GA 3EOAI 2PUDA 1O77A 4JXZA 2QQGA 3BJEA 4Y7CA 1RR6A 3PXXA 3T5GA 4YJ3A 1SR8A 1D0VA 3NWBA 4GKVA 4E2WA 4KRGA 3CBGA 2HBQA 3WB2A 2J0QA 5T3UA 4LE1A 1TAHA 2Z6QA 2XB9A 1YZ3A 1O08A 2JAHA 3AJ9A 2A84A 2CHVA 2ZCUA 1ZMOA 3AF0A 3KZKA 3LYHA 4NU6A 5EC8A 3VNQA 1UAGA 3WRYA 5EPEA 3DYIA 2IEBA 2C7PA 3RSQA 1G0NA 4RTRA 1AGRA 3ECAA 2NLOA 3MUNA 4O08A 5A3SA 4QGHA 4CKWB 2QSUA 4PLCA 5CK4A 2X9QA 3VHRA 1KI3A 2H7YA 4XX1A 1PJTA 5D51S 2AKEA 3B6EA 1CQZA 1W4RA 3LO5A 3OC0A 4TMWA 3GDGA 5AKKA 2AHOA 4B46A 2FN4A 2PWAA 4F5DA 4AU1A 1IN6A 3P45A 1JLRA 4BWFB 2B3TA 2FV8A 1KH1A 5BR1A 2B4KA 1Z9BA 4KW7A 2WUGA 3C6QA 3UKOA 3FTDA 2BSXA 4BNVA 3H1AA 4K3VA 5FRDA 4II3A 3FMFA 3EVBA 3RSCA 2EIHA 3HUUA 1SCIA 4MVJH 2IXDA 3RROA 5KYKA 1ICEA 2FMKA 3NO4A 4FOOA 5F2OA 1PR4A 3ZWKA 4EELA 2EERA 4JLBA 1T1EA 1IM8A 3TUJC 1VIYA 2YWHA 4EYKA 2UUCB 3ONDA 1TEHA 3QPDA 4WBSA 4A27A 4KQ9A 5IAAA 5BRAA 3PHIA 4BVKA 2AEFA 4ENTA 3G5AA 2P3OA 1M6VA 3R6LA 4LYYA 3H2IA 3G2OA 4GM0A 3O47A 3GU3A 3OX3A 2G71A 2VF4X 5J4HA 2ZB7A 3W2GA 4PANA 3DZGA 1RCFA 2WIJA 2F59A 2QYSA 2FY8A 3NOQA 3PJEA 3VGJA 1JSCA 1EG7A 1R18A 3T4XA 4BNYA 1IY8A 2PZEA 1AZWA 4AKSA 3LXRA 2J4FA 1GG8A 1ZITA 1L5YA 5DP2A 4ZHSA 4G65A 5JJCA 3BHIA 3I2YX 1PJBA 1XDZA 4JEUA 5IKXA 1YL6A 4X63A 5EL0A 3GUUA 5ITWA 5JS7A 1Q77A 1V3UA 2APJA 5DBOA 1JLSA 4XQEA 3V2IA 2JB9A 3WAGA 2YHAA 1VSVA 3KXLA 2J5QA 4G89A 4GXRA 1NJFA 4B33A 3B3AA 5AUNB 1TE2A 2GM3A 3MGBA 4R0VA 5IP5A 4BB9A 2J0UA 1E4EA 1PQ4A 1XMIA 2W2QA 3DZJA 4DZZA 5DNYB 2VTBA 4I8XA 4MEBA 2QHXA 3KHUA 3PBKA 3GAZA 4EX6A 1E5QA 3ABQB 2GWRA 1A5TA 2Z5FA 4Q3OA 4LK3A 3DKRA 4PCVA 1PDWA 1XN1A 3DDHA 3HJUA 2JJMA 4X90A 1A5SB 5EKDA 3UKJA 4MR9B 4Y7DA 4LRTB 4EJ2A 4LWQA 3IEPA 3BCRA 3WMEA 2RHBA 1MLDA 3GX1A 4LPSA 4DMRA 1F3LA 5GM2A 3OURA 4HB3A 1I3OA 3G2MA 4GGMX 2E48A 1FYVA 4KN5A 3PNMA 2QV7A 1XO1A 4NATA 3ZPXA 2P8JA 4XR9A 1HG0A 4DV0B 2W58A 3UTCA 5AVYA 1C2TA 1R4MB 4GXTA 4CL3A 1E6MA 1N8TA 1PDVA 3FWKA 5AW0A 4I08A 1N5RA 3WLFA 1APBA 2P4SA 4TLCA 3DAGA 4CKWA 4IIJF 1UDCA 2YBEA 1AKUA 1Q1BA 1JHQA 5SZKB 3IEXA 2BMEA 3H84A 4ZVKA 3K6SB 1A9YA 1Y48E 1OVGA 3H8WA 4Z9BA 4ML3A 2ZPTX 2Z58A 1XDDA 4XWAA 3MLEA 4POAA 4YMGA 3CUEF 4LDQA 4ZMBA 2UUOA 5IAGA 2QT0A 1SIUA 3B85A 5AHWA 4MR8B 2OXRA 2H9IA 1USUA 3LCVB 2DQSA 1G3QA 1RWOA 2D54A 3C3PA 3E23A 4R7GA 2F9MA 3BA1A 4MWDA 4GE3A 1PZEA 1VE1A 2PT9A 2TMDA 4N12A 2QMUA 1NBIA 3KJEA 4ZYWA 3RBVA 3Q3EA 3HGTA 2FQYA 4UHCA 4BO3A 2ZT5A 3HEAA 1XCJA 4IFIA 5KDLA 3ER8A 4N0MA 5KHOC 2ORWA 3MSCA 4E13A 3CVVA 2C8JA 1N6OA 4CL0A 3OC6A 2D1TA 2HYIC 1A7UA 1TJ4A 2X8LA 3IE0A 4X8HA 1VBMA 2RHHA 2XNSA 3OWXA 4W7IA 1NF3A 3LZDA 3OETA 3D0QA 2VZLA 3GGOA 5IM5A 4JC5A 2AG5A 1SXPA 1KHHA 2GHIA 5BUZA 1P9LA 4KIUA 1TTQB 1TU4A 2EJUA 4JLWA 3VJLA 2PSSA 4P5PA 3AI1A 1KEWA 4M0KA 4BO1A 4P2BA 3PI6A 2R6HA 1G98A 2I22A 1TM7E 2LXNA 2YZ7A 3GH1A 2X22A 1I8TA 4RGYA 4FYMA 1O57A 3KG2A 2W0SA 1A5ZA 1WXIA 2H1IA 3NRBA 4W7HA 3LJKA 3UK6A 3LE8A 3A9WA 4LVNA 4G8JA 3IQDB 1B26A 4GOND 4O2AF 3THOA 4YJDA 3AZQA 3DMTC 4QQNA 3OOHA 5AXAA 1GKUB 4BTLA 4YGXB 5C31A 2XUDA 1TAGA 2BFFB 1HO3A 1JS1X 1Y4UA 4CU2A 3EULA 1STOA 1KZ9A 4DBZA 2EJCA 3LMKA 4RCZA 1A50B 2F90A 5CNMA 3IILA 3T9EA 2OXCA 2AFRA 5FTLA 1UPFA 5FOVA 4YLYA 4N5NA 5KQLA 1AURA 1KFCB 4O2RA 3WLNA 1UK7A 2GF0A 3R3JA 3OPMA 1N9KA 3BK7A 4QG7A 5KJCA 3LPCA 1JGTA 3M81A 4OGLA 4PNZA 1K5HA 2BGTA 2BVNA 4XVHA 4MR9A 3GFTA 3CWQA 3W1EA 2VHZA 1ISGA 2BZGA 5ENVA 3V7UA 2G67A 4EPRA 3D8HA 1UM9B 4LC0A 5KYTA 1JUDA 1Z45A 2YXPX 3VM6A 4A82A 2C97A 5SY4A 3TLAA 3KHKA 4RAOA 1L5HB 1M6NA 4ND8A 3A6EA 4MYRA 1LLCA 1U0NA 3CLVA 4EM6A 1OWLA 4WINA 4TS4A 2BDUA 2QROA 3BFKA 1JSZA 2UUAB 1EGAA 2WZDA 3E58A 3N2NA 4WXHA 1F2UB 2EXXA 2WD7B 4JI1B 3UPDA 4F4UA 3U44B 1U0LA 1CUXA 2G08A 2QSZA 3PCXA 5BMVF 1XAIA 3W2HA 3FOWA 1CDEA 4INPA 5AW2A 4Q4DA 3VYVA 5LIRA 3RYCB 2GCEA 4ID3A 1RIIA 1Z8FA 5IJ9B 3K6SA 4HRYA 2XHEA 3MWEA 4DL9A 5CXSA 3H3XA 1K5PA 3I1IA 4CMHA 4LRWA 3MA0A 4TT8A 2YNMC 1JHXA 1ST2A 4N3AA 4O0MA 1F0KA 4NH0A 7AT1A 5FWAA 1ZVKA 5JH7F 1YZHA 3HU2A 3B1VA 3O75A 5D1NA 3UG6A 4MR8A 3U56A 2E21A 3VU9B 3W9UA 3EG9A 3KQWA 1JI3A 1XA4A 2FWAA 2OYRA 3SG0A 4MGKR 2R66A 1GZ7A 3ACCA 1FLDA 1SXHA 3SD7A 2JFHA 1VKZA 3HB9A 4F72A 4OQEA 4M7RA 2RARA 3T7AA 4MI3A 3I2JA 3U13A 4MKIA 5ALXA 2QVCA 3SPXA 3FUXA 5EIAA 5J4VA 2Q4DA 4EHAA 4QD3A 3JVUA 1ODFA 1PI3A 4RA6B 1D1TA 1E2JA 4AS2A 3EUWA 2XYGA 1DPFA 2VJNA 1R4AA 1GFSA 5BXYA 1JDUA 4E15A 5K3OA 3OOYA 3IXLA 1VL1A 1Y7PA 2RJ3A 3D4NA 3EPPA 3OM9A 4YJ2F 3FOCA 4PRYA 1B6GA 3GXBA 3U16A 3MFQA 4YMUA 1VHTA 5BV0A 3TUZC 3OHMA 4OH1A 4WH0A 5JS1A 2GO7A 3VU3A 5IKPA 4NAHA 1IN4A 3C5EA 3DAFA 4O4LA 3PQ4A 4IINA 3AEYA 1LV7A 4B85A 5KWEA 4WLUA 5A2QA 5KNBD 4AF7A 3VR6H 2OSBA 2NNLD 1FP7A 4G0PA 1JNYA 1S2GA 4XCXA 2HV8A 4Z7JA 4RZQA 3GVHA 5HFJA 3ZVRA 3A1WA 3AVOA 2DKOA 2ID7A 3GFQA 3BVPA 4PEVA 5TARA 3ISVA 3KHSA 2X6QA 1TM3E 5EE0A 2JGDA 5HWSA 5HCNA 1KXJA 1TMYA 3A9TA 3BHMA 5JD6A 2V7QD 1CK4A 1UR5A 3EZXA 3LC0A 4TRRA 3EMVA 1A3CA 4F1KA 2X6TA 1WE2A 2G7MC 3C8DA 3I04M 2ZI6A 3OQHA 3Q0IA 4L02A 4ZOAA 3BS4A 4WY8A 2DT5A 2KM1A 5JLAA 4EGJA 1FDRA 1ATZA 1C7QA 3ASUA 2XIJA 4QE3A 1Z06A 4UVEA 4WOCA 3WA6A 5AIBA 1DC4A 4MKHA 1XPOA 1B3BA 1UFKA 2QIOA 3UUFA 3DL7A 8MHTA 4BC1A 1A9TA 2NZYA 3AK4A 4G4SO 2QLFA 2IHZA 3MILA 1SCKA 1EA5A 3K09C 3QY0A 1ZM2A 2VOEA 2HZ7A 2UUPA 1R0XA 1KGDA 2YRWA 2HDWA 4BZQA 1WLYA 3DO6A 1F2UA 1TUBA 3EJWA 3AVUA 3U44A 1BZYA 2FPOA 1ST3A 3L82B 3SE0A 1NDQA 3T9CA 1QIJA 2IU3A 4YQFA 2W7TA 1K6IA 1B6TA 1F1JA 1NX6A 2NO5A 2IYUA 3FXAA 3FPJA 1Q50A 1XTRA 4QXOA 4A10A 2JRCA 1LX7A 4IV0A 3FPCA 1UFRA 2VP0A 1MDBA 1P4AA 2H4JA 4JR2A 4EY8A 5KQSA 4FE4A 5DKFA 2WOJA 3L0OA 4HEHA 3U5ZB 4KRYA 5TQ0B 5I7AA 3FAKA 4IGFA 3ND8A 4QAJA 5ALQA 3ZU2A 1DLIA 4I0WB 4MV3A 1YR2A 4BN0A 1BW9A 1T9HA 2BBOA 4IFEA 3OAAD 3L4BA 4V1CI 1HDGO 1T1IA 2ZE7A 3P0IA 3ZDEA 3AW8A 1CQWA 2C29D 4HO1X 4P7KA 1I3CA 1YQQA 2V1UA 5EOVA 5IT0A 1E1NA 4PQRA 3UB3A 1NUPA 1DEKA 4RA6A 2M2IA 4YQEA 1BN6A 1EVYA 5KQPA 1K3UB 3N8IA 4RE6A 4DDTA 1Z6AA 2ZRDA 4RDXA 1XU9A 4OHCA 3SC2A 1CR4A 2D1YA 1A5AB 1Q1ZA 4H1WA 1MRSA 1S3FA 4RVUA 2Q49A 1LBIA 1UBUS 4WZ6A 5GJVC 4WADA 3PNPA 2BHSA 3T15A 5L7YA 3VPGA 3ICEA 4JBIA 3M4XA 4J1SA 5DLPA 1VLJA 2PL5A 5C5CA 1EMDA 3QELB 4MAAA 3BF7A 4HX9A 3ZH9B 4GKJB 1UPTA 3E3LA 1GNPA 1GP2A 2C3UA 4YV0A 1KY2A 1W6UA 2ZJ2A 4JYPA 4ANFA 2DH6A 2D5CA 4QBIA 1KI1A 4DV6B 1Z0UA 4QJ5A 3JSAA 4L08A 4UU1A 3PXAA 5TJ9A 4ENWA 2GBLC 1OC2A 5KEIA 3O93A 1FJXA 2J85A 2O3QA 1AM4D 1VMDA 4P83A 4TTVA 3K31A 3UCXA 3C7AA 3U9TA 1A71A 4XH9B 1RC1A 1SUCA 4KSYA 3R24A 5CIQA 2ZREA 2FZGA 4NYIQ 1INLA 1JIXA 1JJ7A 2PYDA 2YVUA 3HU3A 4UCXA 1F51E 3G3EA 3QKSB 1Z6YA 5JCOA 3I62A 1P73A 4XGQA 2ZWIA 5E8JA 2ODAA 1Q7BA 4OL0A 1FTSA 1DX4A 1NBHA 3MJDA 4ILEA 3P9YA 4D1YA 2OPHA 1B3RA 3G9QA 2FXVA 4YT8A 1TM1E 3O2NA 5BV1A 3D2AA 2CE7A 4CN9A 2C2WA 2YJ5A 3UQYS 4Y2HA 1G8KA 3ORSA 5AXDA 1VJ5A 3C6ZA 1L1QA 2J07A 1X94A 3EY4A 1QS0B 2EHDA 2FVYA 2J5BA 5A5DA 4W5WA 2WJIA 2XKKA 4HEA1 4NCNA 4EP1A 3DD5A 2NO1A 4P0TA 3JYPA 4YRFA 3LQYA 5EUBA 2I6QA 4D4LA 1EFHA 3PD7A 3FIJA 5M04A 3HN2A 2XUAA 2OHOA 3ZLTA 1Z16A 1AH2A 2VATA 4WNIA 4IM7A 4NCIA 3PHCA 1KXZA 4YCJA 5JVDB 4G5OA 4IDGA 2R3SA 1KZGB 2UZ1B 2DH5A 3CKLA 3S2FA 4RL6A 2FW6A 4C01A 4BCDA 1NBMA 5ICMA 1P18A 2AR9A 3MRVA 2EZTA 5TQ0A 1U9JA 2ZRNA 4JC4A 3CCCA 4HPWA 4CKBB 2O2CA 4HQFA 4D4KA 1T29A 2PRIA 3GBVA 3OHPA 1GUYA 3UJ8A 3EB9A 2P6UA 5J2UF 3R5KA 1FIUA 3FWNA 1II8B 3KOUA 3MTIA 1WS6A 1PYDA 3KOWA 4JP3A 4K26A 4V24A 4B5KA 3VVBA 3G7NA 1Y4ZA 2QR3A 1ZR2A 4ZCQA 3SFVA 3UATA 4Z3KA 3MJFA 1U9YA 1BX1A 3Q7QA 1TLTA 2R1VA 1TUEA 3C8ZA 3ETJA 3EZLA 4OMFG 4PSUA 2RHRA 4JT2A 3U48A 5C2JB 3UJNA 1GM5A 1GJRA 3G68A 1BYIA 3T99A 1K7CA 2XB6A 3VNUA 1KAEA 2CV2A 1P39A 5GZ6A 2Q3LA 1Z82A 1AX9A 1ZM3A 1KYXA 3A6ZA 3IIMA 1XMJA 3DQPA 5DT2A 4ZEMA 5AW1A 1TW3A 4FC6A 3R7FA 3L4EA 1J8DA 4D4GA 4M38A 5JJ5A 4OB7A 1HYEA 4I7EA 1V8BA 5LC1A 4L85A 4BLOA 2IKSA 4L2IB 3HNRA 4LBWA 4G8DA 4Q9AA 3RSLA 4XASA 4PCAA 1Z75A 3QELA 4FSXA 3ECSA 3UV7A 4DNXA 5K1ZA 1CUFA 3DOUA 3PQDA 4YIHA 5AKEA 1VRWA 3AFGA 1PX0A 4MJ7A 4UEQA 2OV2A 3BKWA 3G5UA 3LCCA 1T1GA 3OMXA 3JQEA 1Q16A 1Z26A 2QP3A 3EUEA 4HDAA 3DPIA 4MWEA 4E5PA 1PFWA 1U9IC 2XVYA 1YDWA 1RWVA 3GJSA 1EEHA 1RRGA 1NZFA 3ZD9A 2W93A 3TMKA 3F6EX 3RS9A 1WMFA 3QKSA 2X40A 2OFXA 1PVVA 2QZJA 4V03A 3HXQA 1UEJA 2FGJA 2D3TA 5BR7A 5T41A 3LY9A 1P9NA 4QQRA 3OD5A 5DNVA 5BSMA 1SBTA 4JLMA 1JYSA 4Y30A 421PA 3CZ5A 4B7UA 2UXDB 4ZZIA 5M5BA 1ORRA 2SKEA 3TI9A 3DT6A 3AHGA 3IT2A 3OLCX 4MKGA 3DYVA 1D7AA 1E3JA 2ZRJA 4EI9A 1PEKE 4ZIRA 4CHTA 1ZD2P 5CTAA 3CNQS 4KXYA 3RARA 3T1QA 4AF8A 5IH7A 1JDBB 2NO0A 1RMTA 3CC8A 1NU6A 3GT3A 5AK0A 2Y4NA 5ERYA 3T7EA 3EQ8A 1RWXA 5JV5A 2QJRA 8LDHA 1CERA 5LZ5A 1I1QB 2R6R1 3CJTA 1RC8A 2NXEA 2XT9A 2O3SA 3OLQA 4UARA 5JVDA 3GRYA 2QM0A 3O4VA 4A0HA 3ZOKA 1KOGA 2NUPB 2CJFA 4ZQEA 1QKKA 4EMBA 1GGVA 3V8MA 1AQLA 3DZDA 2W37A 4FFSA 3LGSA 4JLSA 5AVXA 2QBYB 4JYMA 2N1MA 2YMLA 1RXIA 2PIAA 1GLVA 3JQ8B 4LZLA 4MAFA 5IF9A 3K72B 4KO8A 1KAMA 3PFFA 4U6QA 4BKMA 3NXSA 4GP9A 2AJDA 3AU9A 4TQAA 4PN7A 3H9BA 1II8A 1PK8A 3CZRA 3UBMA 1E63A 3PYXA 1H6AA 3QJGA 3W04A 1GFZA 4Z3DA 3E18A 1C0IA 2VPWA 3LOUA 1I4TD 2KJQA 3BDVA 3CFYA 4G5QA 2ZSBA 4FBMA 4AYWA 1VGQA 4PC1A 1P4GA 1B23P 3CG4A 4DSTA 1NTOA 2A78A 1R3UA 4M1ZA 1Q1AA 4JLKA 3H7IA 1XFAA 3KWLA 2DHRA 2RGEA 4XQGA 1DAEA 4QU8A 4TXMA 5IPFA 5G0SA 5KI6A 4H6WA 4CT4B 2CCKA 2GDZA 4O25A 4U8GA 5EKSA 5JPDA 5J5VA 1B16A 1L5VA 2XITA 1EESA 2CNOA 3FPSA 4RH1A 1VPEA 3NEAA 2GHQA 5M2QA 1MEOA 3WRWA 2OV4A 1EXVA 1T1RA 4L8VA 3U9SA 4B6GA 5HE8A 4GE0A 4L2IA 4CKEB 3Q6MA 5B12A 4MPJA 3KJGA 3E53A 4L51A 1KE1A 2XKBA 3RASA 3E7XA 3L7IA 4N1AA 2VZEA 3A6PC 1P8JA 1NLUA 2CCJA 3BM5A 3RSOA 4QLBA 1I6WA 1W46A 2NV2B 2GM5A 1PSWA 4LRXA 4MRMB 5KSPA 1T8TA 1VBNA 4XTRA 1KK0A 2A0XA 5F1KA 2RGGA 4MVJA 1Z25A 2A7QA 3EUFA 4GYWA 1YE8A 4HLUA 5TEVA 2EYUA 3WA7A 4J4HA 4R31A 1E6WA 4QUGA 5BXQC 3B53X 4GVPA 5JDIA 1LVUA 1TCCA 2QMYA 1CR2A 4W9NA 3K9HA 3SBXA 2XXBA 5IJAA 3OZTA 4J0EA 4B74A 2Y9PB 1SIWA 4G41A 2Y0EA 3EGIA 2QVZX 3GXOA 4W1RA 5GJWC 3HYCA 5KVCA 2WV9A 5DLDA 3B7PA 3MMNA 1SHJA 4Y1RB 3HDGA 2SNIE 3R2JA 2CEAA 1TO1E 5F21A 1IYZA 5LWHA 1FS6A 1DKRA 3ZLUA 1ZM4A 3P4UA 1OXTA 1G8FA 3MW8A 2CXXA 3LGAA 4H3HB 2I4IA 2RHCA 2V6JA 3B6ZA 4KIJA 4EW2A 5JD5A 2GCIA 2ZROA 3CLTC 1FEZA 3QKTA 1IMOA 4JR1A 3LX5A 3GARA 5IXYA 3FMIA 1ODJA 3GA7A 5C1IA 5JDCA 1LVGA 3Q2IA 1PU2A 4GYKA 3U31A 1KS9A 1Z39A 3LQ2A 4DF3A 2OC9A 2OORA 2REBA 4I9HA 1TIBA 1J49A 3V8NA 1XOIA 4KH1A 3RYTC 2DJIA 3WNZA 2CDNA 1Y82A 1BC5A 4FINA 2OCLA 1R88A 3G8AA 3ASYA 5EZYB 1VIDA 3RSGA 3NM5A 3CH6A 4GR9A 4WFQA 1AO0A 1JVSA 3DMNA 2HCJB 1FBNA 2NUPA 2FZ4A 4WXPA 4BEJA 4OJQA 2JBAB 3E2MA 1YK1A 1A0OA 5H0IA 2EVWX 3U6KA 1P61B 3IHLA 3WWEA 4ZEVA 3BSWA 4UHFA 3TJZA 2F9FA 4OA5A 4PZAA 2VPPA 1U8XX 3PI7A 3LAWA 1P4SA 2PZGA 2PHZA 1YKGA 3P9NA 3AKZA 2FLKA 1HV8A 1ND6A 2GF9A 2I0FA 4XYLA 4KPYA 1RBZA 1U3TA 2FJPA 3QMVA 4Y18A 3GPCA 3IAM6 4GRDA 3TTTA 1SC6A 1VHWA 3C6XA 4FLMA 3VC1A 2BKLA 4DA6A 5BNZA 4J4TA 1GT6A 4U3JB 4C4YA 2GM9A 1DUVG 3LBIA 2VLBA 3EGVA 3NH6A 4M0FA 1MHTA 1ZM7A 2HDOA 4C88A 1MIOA 3M2TA 3OZWA 1EXDA 4X1IB 1Y1QA 2X1HA 3E9EA 1T13A 4O63O 3FCXA 5DHUA 1VE3A 5A3VA 3GV0A 3WGGA 5B55A 1VLMA 5P8WA 3SZUA 3A9VA 4Y0NA 5FCDA 1G6OA 2CKDA 2I4RA 3DTVA 5AJUA