2ADOA

Crystal structure of the brct repeat region from the mediator of dna damage checkpoint protein 1, mdc1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
194
structure length
194
Chain Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Mediator of DNA damage checkpoint protein 1
publication title Structure of the BRCT Repeat Domain of MDC1 and Its Specificity for the Free COOH-terminal End of the {gamma}-H2AX Histone Tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2adoA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2adoA02
2XNHA 3PA6A 3COJA 3SHVA 3PXEA 4Y18A 3PD7A 3FA2A 1OQAA 3HUEA 4JLUA 3EF0A 2WT8A 2EP8A 1Z56C 1T2UA 1T29A 2COEA 3T1NA 3PXCX 3K0KA 2COUA 3PC7A 4BMCA 1IMOA 2R1ZA 2VXCA 3PC8C 2EBWA 3UEOA 3HUFA 2NTEA 2COKA 4IFIA 3QVGB 3SZMA 3L46A 2INGX 4U4AA 2M2IA 1IN1A 2HTFA 3II6X 2JW5A 3U3ZA 3L40A 3PC8A 3SHTA 3OLCX 1Y98A 3QVGA 4Y2GA 1T15A 3I0MA 3K05A 3K16A 3T7JA 3JVEA 2K7FA 1N5OX 3PXDA 4XQ0A 1GZHB 2D8MA 2VXBA 4IGKA 5ECGC 3PXBA 3PC6A 3I0NA 1L0BA 1L7BA 3SQDA 3AL3A 4XPZA 4BMDA 2K6GA 2DUNA 3EF1A 2L42A 3UENA 3K15A 1WF6A 2LE0A 1JNXX 4N40A 4ID3A 2EBUA 3K0HA 1T2VA 3AL2A 2E2WA 4OFBA 2ADOA 3L41A 3PXAA 2AZMA 1CDZA 1KZYC 4BU1A 3T7IA 2ETXA 2XNKA 3T7KA 4BU0A 3KTFA
chains in the Genus database with same CATH superfamily
2L2QA 3B5EA 2PX4A 1N3LA 1XEXB 1X38A 2ETVA 3HBJA 3QEKA 2RHCA 3CE6A 1U9JA 2I3BA 1FQJA 2VTDA 1F2VA 3CJRA 4X3OA 3T7CA 4C0QC 5LQDA 7ABPA 1P4AA 2HV9A 2NU9A 4OEHA 5MHTA 3KYIB 3JWJA 4Q9IA 4N41A 3U0BA 1WX1A 1L9XA 2JDIA 4D26A 2A9RA 3M7IA 1WRBA 1UMBA 5J3JA 1BH6A 4PO9A 4RTMA 1DG1G 4Z9BA 3GJYA 3I39X 3PSAA 2X40A 4AZVA 3PX7A 1C9DB 5M2QA 4HXEB 1JR4A 3QEMA 1NXPA 2CDCA 5CLIA 1B76A 3TWOA 2OENG 4CLDA 1Z56C 4IILA 4DR2B 2E7ZA 2PO7A 4KLRA 4D4GA 1V7QA 4QEDA 2JGKA 3ZDRA 4OI0A 5HF8A 4YHBA 4ZYLA 3V4RA 5IVKA 3DZFA 2LWIA 3KBBA 4MQFB 4OI2A 3WJ2A 3GVXA 1IVSA 5BV8A 3QXSA 4BCDA 3ZUPA 4QULA 5B1SA 3IP6A 3WS7A 4IDAA 2L19A 1H3FA 3AHHA 5A9TA 2AQKA 3SPXA 1YZYA 1C41A 2EBWA 3ANTA 4Q3LA 4AQDA 1H9CA 3EGEA 1YB4A 1AGXA 3W2HA 5GONA 3PPYA 5TXGA 4B3MB 2GCOA 1MMFB 5ICMA 2VF2A 4FMCB 1OSNA 3VC3A 5H83A 3QEJA 5I7SA 3DLHA 5L4LA 4EB0A 3BERA 2JCXA 2JEZA 2W2QA 1L5NA 1Z4IA 3TNDA 3BXZA 3VDRA 2UUOA 3TGPA 3W7VA 1ZD4A 2OVFA 1GAXA 1KFBB 2QI9C 2BMWA 2Y76A 3WL8A 4XD2A 5TMDA 2QVYX 3MS2A 1WWKA 1YB2A 2QV7A 2ZR0A 4RGQA 2CKMA 4A0QA 1PFKA 2FN7A 4R2IA 3WKCA 4QE3A 3GROA 3MUEA 3O9VA 4JB8A 1IOVA 4IHAA 5T8KA 1GJRA 2AX4A 4JH0A 3ROTA 1F20A 2QV0A 4MMZB 3BGWA 4H4CA 5CDFE 2WZBA 4KLZA 3NHLA 2OYCA 1HF3A 4ALMA 5HQTA 2VA8A 3VOBA 1KJIA 4XQ0A 2HPZA 4BJ6A 2C4HA 3LQKA 1KOLA 5FCDA 3TSZA 3UWPA 3F5MA 1WPQA 4IHJA 2QIOA 4EMTA 4WE3A 1DGQA 3V46A 4P4LA 1ESZA 2QUHA 3FG9A 1MTOA 4E5YA 2QLBA 1V16A 3QW4B 2PPLA 2Y0DA 3IBSA 4FFRA 4UVDA 5HCNA 3SQDA 3OQMA 2CXRA 2PX0A 2OV8A 3HM9A 2WDPA 5BW8A 4CU2A 2BL4A 1R0KA 4XWWA 4FYHA 3K15A 2HWWA 1GNLA 2HWUA 3UT5B 3W79A 3AWIA 4IZHA 4LNUA 2WWGA 3PQ7A 2V6FA 2UVQA 4XQGA 2VDMB 3ZDQA 4BPRA 2CUNA 4HHEA 2IP2A 4BTEA 1DWUA 3TEJA 1QIFA 4POAA 2YVKA 1KI6A 1TD1A 4F3NA 3QWFA 3OTHA 3IFSA 3CYFA 2E1PA 2FLWA 1AQIA 5IABA 2CMKA 1QYVA 2JFQA 3N6RA 4MOWA 4WT7A 4JBXA 3WOHA 3P9XA 1ARZA 2W4IA 4I81A 4IMIB 2BGWA 1FTSA 1ZZEA 4RZIA 3UJNA 2VDKB 1J8MF 1YE3A 1YQGA 5C8YB 3INTA 2W0MA 2REQA 2Z95A 3KQWA 1SZJG 3K2QA 4PC2A 5KAPA 4C3VA 1K63A 3BRCA 4I7EA 4L85A 1PL6A 2VTBA 2WJZB 3ACDA 3AHIA 1S2OA 4OQEA 1TJYA 4U2KA 1KYZA 1F14A 2CYCA 3RSQA 1G66A 4BE9A 3DJFA 3VZRA 4AB1A 5AVSA 2VRCD 3LLUA 4YYEA 2ZWPA 3HO1A 1PHPA 3GYBA 3H83A 5C8ZA 4ZT4A 1ORWA 3DDCA 4Q3AA 4AZSA 3IV6A 3H4IA 5E4FA 1JFVA 2C9MA 3CRVA 3BDVA 3HR7A 3K09A 3MYRA 3OIFA 3E48A 2QT9A 2VDLB 1XZFA 1QB7A 1UK8A 1EVJA 1TU0A 2WR8A 5E6RB 5FWDA 3OJEA 4JBNA 3AUYA 1QOZA 4DUGA 4ER6A 5K8JB 4RW0A 4LDQA 3PRKE 5KHOC 4UBJA 4DZRA 2OGTA 4KQ1A 3VO2A 4ZN6A 4RD3A 3M34A 4PN7A 4QU5A 2MSDB 4UHKA 3UGTA 1B73A 5JFTA 4BO7A 2WIJA 1YONA 2ZTHA 4X90A 4K28A 1U9IC 5FPKA 5F3RA 4JJ8A 3ZVRA 2ZAMA 4FIZA 1KH2A 4U2BA 5EHNA 5L3ZA 1OH7A 3K5WA 1VE1A 5B30A 1FU7A 2GILA 3CWCA 2HV8A 4XX1A 4L8GA 2ECOA 4KIUA 2GCIA 2FZ4A 2ZE6A 2HGZA 2OBFA 2HJRA 3WLTA 2WYIA 3UMSA 1V0JA 2CXTA 4H6XA 2P2GA 1IAQA 1YQXA 3I0ZA 2NGRA 2YBEA 2UZIR 4ZVLA 2YJ3A 3LJKA 2GA8A 1ISGA 4AROA 1D8AA 2XD4A 2QMQA 3CB2A 3D7MA 4ALNA 2XCQA 4PHHA 5AW9A 2ERXA 3L1VA 3OFJA 3H11A 2I1QA 1Z5UA 2GEKA 4OP2A 3UV3A 3A3PA 3VPSA 3LNTA 5DW0A 3GN2A 3JAKA 3FRHA 4DNXA 4EI8A 5GJVC 3RG8A 3NVAA 1A5AB 4PPQA 3T5AA 3NALA 3I34X 1LUAA 3OFNA 5EIOA 5EWJA 1V3VA 3HKDA 3CVJA 1M6NA 1G5TA 2BCEA 4PNZA 4Q9NA 3EPJA 4YJFA 2A0KA 3N0TA 4Z2YA 1TRHA 5TQJA 3UN1A 4B5KA 1QHNA 1A04A 3DMYA 1GTJ1 1WQ4A 3EIFA 4A73A 4DM4A 3EXIB 3M70A 4M3NA 1YVPA 3ICCA 1IJEA 2CZCA 1AKTA 3JASA 3ZNPA 4NXMB 4GLOA 4DPLA 2W43A 2ZUTA 2EDAA 2PJUA 2E82A 4RF4A 2RGGA 4LRYA 5HEKA 1XO1A 5L95A 1FEZA 2GEFA 3GRZA 4GMHA 4M9XA 5C7OO 5FV4A 4Y6SA 1SVNA 4HI0E 4C9BA 4F1WA 1GQYA 1Z6XA 3G8DA 3HJUA 1E2IA 3OZBA 3JYPA 4I3GA 2ZB3A 3P0HA 1UDBA 3ORFA 2G4VA 2I29A 1XZQA 1TUBB 1W35A 4QGGA 2VBGA 3R5TA 4DCUA 4PTLA 1MT3A 3NXKA 4JI0B 1Y3FE 2O3QA 5A04A 2NM0A 8ABPA 4OA8A 1YR7A 2PUEA 3RSFA 4PGGA 1SVMA 5EESA 5H68A 2IQ5A 2WHEA 2O8BA 1L5MA 3M5WA 1P2SA 3PX2A 2FZLA 1S3IA 3CUSA 5AVKA 2P41A 3TEMA 4YUWA 4RA9B 1LSJA 1CB7A 1DBPA 1C50A 4M98A 1KGDA 3BXPA 1Y1RA 1GCUA 2BI7A 3ZE0B 1FP2A 4RABA 2EKQA 1NBIA 2R6AA 1THMA 1V1MA 3K96A 4LRUA 3RSOA 4CZ2A 3QKSA 1GM5A 3OM0A 5BVHB 4UPVA 2XNHA 4MV0A 4BFSA 1VSUA 3NC1C 3KOWA 2YUIA 2I4IA 3D6MA 4NMHA 4W9NC 5JVDF 4IJMA 5JSQA 3P45A 4O1HA 1Z25A 2ZIGA 1WOYA 2JFYA 3LBNA 4X1KB 4U6NA 2NYUA 4C05A 4MWCA 4E5MA 2EX4A 2FSVA 3U09A 4U00A 1ZN8A 4QBKA 4D3ZA 3FA2A 2O2YA 1HYEA 2BGJA 2ODEA 3AHDA 3HDHA 2WM8A 4MRRA 1IBRA 2HMUA 5LZ7A 4P36A 5JANA 1SUPA 2JDID 4ESEA 4FYXA 3NUQA 3RO7A 1P29A 2XRZA 1M2KA 4Y6PA 3SE7A 1IEWA 5A5FA 4YT5A 4UXJA 1IYZA 1JHPA 4KMSA 3HB7A 2CEKA 4PO1A 1G63A 2XCSB 3FRIA 4MUAA 3EXEB 3MT7A 4UM9D 4PZ0A 4RYLA 2V5UA 3ZBUA 4EQZA 1PVOA 2Z57A 2VRNA 1BDJA 3T5PA 1YVUA 1N8NA 1P2VA 3T5MA 1QOPB 1UXJA 2XDYA 2D3WA 4WFIA 4NJEB 3TQRA 1Q7CA 1GGHA 5E4YA 3BMNA 1LBHA 1QANA 3KDPA 4Q7JB 3AT1A 4EHLA 2HADA 4FXOA 2PZEA 4IEIA 1N0HA 1NXOA 1UKVY 2BGTA 2RAFA 3VR3D 3G8BA 3UWOA 2CNWA 2RHDA 4CM1A 1C3OA 5AJUA 1QQ6A 6Q21A 3ZV5A 1RQ2A 3AEYA 1KOGA 1OAOA 4HX2A 4HVTA 4K6HA 3RS3A 2H7YA 4OBBA 4D57A 3FHTA 3RYTC 4MXDA 4X00A 1WXFA 2BHNA 1QSGA 3MTAA 1Z6AA 2IELA 4PYRA 5NULA 2IU0A 4EHHA 5JMTA 1U0JA 5EUBA 2P2CA 4O0MA 5A06A 2HCTA 1FY2A 2GCGA 3KJQA 3NTVA 3M0EA 3M2TA 1NUSA 4YWHA 4DREA 4JXXA 2O8DA 4BTLA 4A0FA 1NVKA 2PD6A 1WHTB 3BWMA 1TFUA 5AVYA 5F23A 4ZT2A 1XB2A 3K1TA 2IOFK 3LECA 4AIIA 1E3IA 2QSJA 1UFKA 1SZPA 1NONA 4FSHA 4KEAA 3V8VA 1QH1A 3VKVA 4PZPA 5IEJA 2R1TA 5IKEA 1DTSA 3KD2A 3L7YA 4HAXA 1OYYA 2ONYA 1WQ1R 3PNPA 4L5IA 3PXGA 3I9JA 4RFLA 1H69A 4DV0B 5EE3A 5CB0A 3F6PA 3NBQA 4BMNA 3C7CB 1RWVA 4D9KA 2X9QA 1GYPA 1CUDA 3L8GA 3EZNA 3EDMA 4IV8A 4X45A 3CKYA 3KUDA 1RBMA 1O6GA 4UAJA 5E1BA 5G0TA 4B0OA 1P81A 2BF7A 2DUNA 5G4KA 3NG1A 4WTOA 5CK5A 1XN4A 2RHRA 3B2EA 2QXTA 1I4LD 3W2EA 3HMQA 1UC4B 1HDRA 1NBAA 2LIPA 3TZBA 3H4MA 3HJTA 4TQUS 3AK4A 1VCHA 3CKLA 4P32A 3GN1A 1N5KA 4NDZA 5KYUB 1ODIA 3MPUA 4Z9XA 5DGTA 4KPGA 4X85A 2NNWB 6PFKA 1MAUA 1RCFA 1AGRA 2X9VA 5KYKA 1Y34E 1VXRA 4LRSB 1ZSNA 2MSKA 4EKEA 4JFAA 2PMEA 4JFRA 1KGSA 4BQFA 1WOMA 2ZAYA 2D5IA 3C87A 1UPXA 2WAOA 4FYMA 1Z83A 1KO5A 3QW2A 2CXSA 4Q48A 3W9BA 4B3FX 4WXPA 3DCYA 1CRQA 1H8HA 3MQFA 5FA8A 4BMSA 2NXCA 4LF7B 1HY3A 4MLPA 2NSHA 2YWEA 2IXEA 3QY0A 1AC5A 3TSWA 3O90A 1JEJA 5D1NA 1ZM4A 2LP4Y 4KV9A 1QX3A 2IW1A 1MT0A 3H2BA 1AXEA 4HB2A 3SS8A 5FOWA 2WD9A 4PR3A 1PNOA 4E5NA 2BH9A 5F33A 3TKLA 3H9JA 5BN5A 2CDAA 5JW6A 2HIMA 4BO6A 3A0UA 2DBRA 3F4KA 2QGZA 2RH5A 2R8OA 5CTAA 4WASA 1PEDA 1OFGA 3Q7EA 3PJDA 4GGMX 3GLIA 1Y9EA 1N3YA 4CLRA 5GAJA 3GJXC 4IDOA 1YGPA 4GI3A 3X1DA 3T1NA 4RTOA 3KQNA 5FXMA 2GUGA 5CVJA 2FV8A 2GM3A 2ZSUA 3FPSA 3MBIA 5ESRA 3ZZUA 3WXMA 4IIFA 4DUGD 1M1YB 5F78A 1T25A 5JEEA 1BEZA 2QRPA 1T9GR 1QPBA 3BSFA 4FT2A 3D4NA 4R9VA 5CLLA 3PEVA 3WOVA 3WRXA 3LZCA 2C4NA 4HDMB 1TTHA 2D74A 3SC2B 4DV5B 3G17A 4FUTA 3AFMA 3FGPA 3WJ7A 5IYZF 2OGSA 3K0FA 1P6QA 4IUCS 5CNMA 4CCAA 3D4BA 3OU2A 1T9GS 3CF6R 1REQA 5PNTA 2CXPA 3FCOA 2I9PA 2VSNA 3GVIA 1QP0A 1KMNA 4HFMA 2QPLA 2EFYA 2GXSA 2R5NA 4ZP1A 4OUDA 3I5UA 2VR1A 4I1IA 4Q4AB 5IP5A 3GZ4A 3SQWA 13PKA 1GAQA 4KV7A 4LGYA 3ZZTA 4BVKA 5A4KA 3B7PA 1CY0A 4E33A 4GI5A 5DWVA 4FOOA 2VF8A 1IY1A 2ZRJA 1E9AA 1T2EA 3C1TA 3W77A 4CIWA 5JPDA 4R3NA 2D1FA 1QWSA 4N6NA 1NOIA 1RP7A 1KY5A 2BUBA 3T7AA 5C80A 3UAXA 2YOHA 4BFTA 3OFND 4E5UA 3BORA 3WGGA 1M8KA 2ZAGA 3KWLA 2D8MA 2JFBA 2VXBA 5BMVF 4DLWA 2I0FA 3UOWA 2JB9A 4C01A 1K5GA 5F5XA 5K8IA 3CLRC 1EUQA 1TM4E 2O8NA 1IMJA 3ZI0A 1QVRA 1A4IA 1RAAA 1MQSA 3KAJA 5LYYA 2YY7A 1J8YF 2ZT7A 3AM3A 1GADO 3TSCA 4BB9A 4NOLA 1G7TA 3E4CA 2IYOA 5DX0A 4Q4JB 1KC3A 4HGZA 1W85B 3S55A 1LBQA 1AZTA 3DAGA 4D9JA 5B1EA 1P9OA 2K7ZA 3EOAI 3AM5A 3U13A 4MR8B 3FLAA 5T3YA 3STHA 4CT0A 4DZTA 2AJ8A 3FGZA 4BXOA 4DEYA 3K0HA 2BFEB 1T2VA 1TUEA 4HAOA 2WJPA 1OREA 2AUNA 2P6OA 1SHTX 3OE1A 4V3CA 4BFUA 1XZ8A 1VDZA 1PQPA 5CFRA 2JIOA 3W78A 1P4JA 1KZGB 3HUUA 3AETA 1U3WA 5AVWA 3GJ0A 2R8BA 4Q0MA 1TT5A 3UIEA 1UBFA 4X3PA 4N39A 5FPYA 4TT8A 5BWLA 3HI4A 4HO1X 2Q9CA 3DVAA 4RV4A 3ENQA 2FEXA 5B1DA 3OM9A 2PUCA 1R10A 3K32A 1CV2A 3VTZA 1IXKA 1DRJA 1E3WA 1T5SA 3BGVA 5EEHA 4B3CA 1NN5A 5GZ3A 4PGHA 1NFFA 5IX8A 3QPDA 2OO5A 4G56A 2ZYGA 2C3YA 3F8WA 3KXDA 4KE8A 3THXA 4R1NA 2AUTA 4Q6WA 1ECFA 3ACCA 4D4MA 4ZTUB 2IOHA 1IEQA 3GPDG 4O2AA 5CA1A 4YRBA 1E1KA 1TGVA 5LQAA 2C2YA 1A7UA 2AE2A 2ZP1A 1ZW1A 3RS9A 5KTRA 1T8PA 3IVCA 4XSHA 4ND3A 2OBBA 3RVBA 5FIUA 2EFDB 2IVZA 2WM2A 2JFUA 1W44A 4PZCA 1U4NA 1W8IA 3LQRA 5TMPA 2X6QA 3LFTA 3WNCA 1PF7E 5LA6B 5LBIA 5ALEA 4F9TA 5KVQA 1IMOA 3OZCA 5I5EA 3M4JA 3U62A 1H9AA 4N7JA 2UZ1A 3OZFA 4CCSA 3OU7A 7AT1A 4DIEA 5FOXA 2PUGA 3C6MA 1RXYA 1A82A 1JZQA 2H54A 2QYSA 1KK3A 4MW9A 1K7YA 2AMVA 1GV0A 3E84A 4I1OA 5I7RA 3JXEA 1P2GA 4IPTA 5BY2A 1TAHA 2OAEA 1A4UA 2W90A 2JANA 2P27A 1T9CA 2R6JA 1E1DA 4HNGA 4CMGA 3OZWA 4GKVA 5BSHA 1WUJS 2GETA 4EBBA 4IJ6A 5IFLA 2H8GA 1GPDG 3VYUB 2CNWD 1RTTA 2EU8A 3PCXA 2K2QB 1DBVO 1SVUA 3L1JA 4I2VA 4EKIA 3Q8LA 2HY7A 4MGKR 4R5HA 3UB2A 2QAIA 4QJ4A 2GN6A 3NAZA 2ZREA 3CXRA 4OXRA 1OIXA 3WIDA 3F90A 1XMQB 2ECFA 3LX6A 2DGDA 1VLMA 3CJQA 4DIOA 3K9WA 2FSSA 1MRNA 4AZTA 4OMFG 4BNWA 3WKEA 2WUEA 1R00A 1JR3E 2DQYA 3NOXA 3OF5A 4P98A 4F9GA 1N7IA 1ZGJA 5DNCA 4HN2A 2AH5A 2B8JA 1Q5PA 3L8FA 2FEOA 3NV9A 2ZSDA 3O83A 4EUHA 1UANA 3W3ZB 2JARA 4C6RA 2XA2A 4P53A 4RHXA 5BW5A 2DHQA 1H65A 2O7SA 2P0EA 1NMEA 3LXXA 1XU7A 1V6CA 2OK8A 4ABYA 1IN4A 1UP4A 2GN4A 3EVNA 3W5SA 1ZKMA 4D46A 1NTOA 3IBYA 1C4OA 3VKHA 4L5YA 4QPZA 4KP7A 1UJ6A 2CL5A 2E18A 4J16C 5JS1A 4DB4A 2V7TA 4KACA 2BD0A 5IN4A 5JD4A 2O07A 1RWKA 2BDEA 2ILTA 4F56A 4YO7A 1TO6A 2C82A 3G9ZA 2J5BA 5FWNA 5H82A 1FFAA 3JTEA 1EFKA 1RCTE 2AC2A 2PIDA 2P3OA 1VPVA 5JXHA 1DIGA 3O75A 3ZU2A 4UBIA 2B9EA 1FYEA 4ZYXA 1BC5A 2X5XA 1EK1A 3ZCSA 4Z1OA 2AIRA 2ZT8A 1Q7GA 3CNLA 4W5HA 3G7UA 4U5XA 4TVSA 2CSUA 2GASA 1M1YE 2AL7A 3GRYA 4EZIA 1PSWA 3U6KA 4OQLA 2QQ5A 1E2PA 4BU0A 5LZ8A 4GPAA 3GLVA 3E22A 4URUR 5L4SA 1A95A 1YS2X 1BROA 1UDRA 3R4CA 1F48A 1YOVA 4DJJA 1X13A 1BWQA 2AMFA 2IDKA 4JR0A 4ADSG 1SOWA 3HSSA 2F9FA 5IDYA 3E03A 2Q3FA 3RYFA 4M9ZA 4ZOLA 2ID9A 3HE3A 3OQPA 3TLXA 1AQJA 1C7JA 2GJSA 1YJCA 1EXWA 2VK1A 1C3EA 3HCNA 2BCJQ 1Q7EA 1QV7A 3IRVA 3QXGA 4K6KA 4L4RA 4OK5A 2HDNB 1JSXA 3VOSA 4A6PA 3H2HA 5EYPA 1Q3TA 4PSDA 1KWKA 5DX8A 3CVYA 4MV7A 1ZVMA 4LE2A 4Z9AA 2Q8QA 1Y7TA 2OYSA 2VHCA 3H84A 2ZSEA 1CF9A 2QY6A 4DEXA 1G3UA 3C2QA 3VO9A 1RSZA 2W11A 4UUPA 4ZAWA 2QBYA 1WBJB 1ETHA 1Y8AA 2WMNB 4UATA 3BBLA 3GUYA 3U1BA 3P7MA 1NG1A 3WLPA 1E7WA 1H4VB 1IM2A 5IAOA 4C22A 4UE2A 3S40A 4C4TA 1GPBA 3BXEA 1U2DA 4BGIA 2H1FA 5JOQA 1K4MA 1VG0B 3EZFA 1KAQA 3QFRA 1BKSB 2J41A 5HGXA 1WY5A 2HF9A 5K0SA 1IN1A 5KYWA 5GONB 4LZJA 3MJTA 2VHWA 3F3MA 4PAWA 5JNWA 1ZUIA 2XB6A 4DMRA 4M53A 1FVXA 3K5IA 1EUZA 4MI1A 1U7XA 1ZG3A 3WAGA 3E0XA 3ZW8A 1RKUA 4LIPD 4TQAA 2G6TA 1MEOA 2W00A 4CPDA 4EO4A 4UQPA 5DBGA 4WKBA 4EZBA 1Y3CE 4DDKA 4ASUA 3WG9A 3COSA 3EZLA 3ME5A 2C07A 1M7BA 2HLDA 2Q5JA 4ECAA 2FF5A 3O8RA 2QIPA 6NULA 3ADPA 3B1VA 4B7UA 2XZLA 3FUXA 1C2TA 2BGMA 2H65A 3QK7A 4P54A 4WN3A 2O9JA 4RE6A 2DPYA 3O95A 3IYLW 2C2ZA 2Q27A 5FI1B 5AVZA 4JYPA 1ID8A 1IHDA 3D6JA 3ZW7A 4EX6A 3M4ZA 3UUFA 4U7TB 1W7AA 1PSZA 4XB2A 4WY2A 4EVRA 2X8JB 4ZIRA 4Z3OA 3OFVA 1HMYA 3RJZA 4E2XA 2GPNA 1GU7A 4BDTA 4DNOA 2Z2YA 1EJ2A 3FVVA 4UREA 3V8PA 5C3MA 5HKAA 2IEYA 2ZE5A 4XUEA 2YKGA 2I4OA 3H5VA 1V16B 4GEKA 4X20A 3K1ZA 2LE0A 4CM8A 5JALA 1D7OA 2YVUA 4NABA 1G8HA 4D0GA 4WBNF 1OZGA 1QHIA 3VU1A 1D03A 3WGVA 3G02A 1IG0A 5GM1A 1TGYA 1ADBA 1EDZA 1G60A 1RQGA 2FWPA 3E7DA 3TMYA 2PGXA 4HGOA 4EY8A 3EH2A 4R84A 2MIIA 3TS1A 4C7KA 4FYPA 4LHXA 5EC8A 4L07A 4LJSA 4BV8A 4D25A 4RGBA 1CD5A 5K05A 1G0NA 5K0ZA 1LLUA 1KNXA 2CLIB 4J2HA 3CPHA 4IVQA 4WX2B 2PQ6A 4AULA 5HX7A 5ALRA 3FLBA 2DB3A 3EMDA 1IFXA 1LV8A 2FVYA 5CJ2A 3UH1A 4YCSA 4INJA 3WLMA 5ALWA 4CKWB 3U61B 5I7WA 5KOJA 2REQB 5F4ZA 1RD4A 3BQ9A 3MA0A 1E66A 1VG1A 4LJRA 4M86A 1F17A 1LTQA 1ZW6A 3PFKA 4WK6A 2JLAA 4AVYA 3U60B 1LS6A 2NVWA 3FLMA 4TYYA 2C2OA 4L4XA 1FP4B 4C0WA 1YT5A 1S96A 3TL3A 3HFJA 5FUYA 4HQKA 2D1RA 2EQBA 4TYWA 4F06A 1JE1A 2B6NA 3OIGA 2Z5GA 2D59A 3DV0A 1T0PA 4FDUA 3QYAA 2H85A 3INYA 1CQZA 1T5HX 3NW9A 1YE8A 3QX9A 2FXVA 4DADA 3N0RA 1DBIA 2ZRCA 4J0CA 4X3CA 1YUBA 4LOHA 1KY3A 3ZZ0A 2GZ3A 2DBVO 1ACLA 3ETJA 4RMIA 3C8DA 2XYGA 5DHPA 5FHRA 4QHSA 5JAPA 3LUGA 4A26A 5JMWA 3U44B 3D4LA 3FTCA 3S28A 2GM4A 2NZUG 2JFZA 3LC0A 1JT2A 4QOGA 5AUPB 3M6UA 5I3ZA 1KBQA 1SEVA 1TM7E 2PZFA 3QOYA 2P67A 3GVCA 1G6HA 1HSOA 1UDCA 2Z56A 3K6KA 4K3VA 5DFAA 5HF5A 4HV4A 2RE8A 2PRJA 1FJGB 1ATIA 2VP2A 3COWA 1HPLA 3KHUA 3ZH2A 3WXBA 3LCCA 3EZXA 3GFTA 2IYFA 1KKLA 3EJ6A 1USUA 4OL0A 3S1SA 3MAGA 3UT6A 2WU0A 1NQAO 4L9AA 3M89A 3FNBA 5EZSA 2B1JA 3A4VA 4OYLA 3PR1A 1IEXA 2B92A 2BKAA 4PM4A 5FOQA 1X70A 2WSBA 4ITVA 4B2LA 1NR1A 2V6BA 2WC1A 3H11B 5EZYA 1IH8A 4HRVA 3P4UA 4DM3A 4QLAA 4RCVA 4JC8A 4ND1A 5BQ5A 3PQ4A 3ECSA 3C1UA 3I5MA 4LBZA 1K7SN 1HZZA 5LNK6 4I4TA 1JP7A 4JELA 4ZU1X 3VOAA 4K9LA 1IXRC 5EWJB 4CMHA 3IHKA 2W93A 3NRJA 4YFVA 4RVSA 2I1VB 1XCPA 1EKXA 2B2NA 3WGYA 1R5OA 3UBMA 1UF9A 4H7DA 4UMEA 5SYAA 3X1XA 2EWWA 2I6UA 2LUOA 4US1R 3N0XA 1G16A 3VSBA 4KO3S 2VYCA 1N2CB 3OCCA 5IPFA 4QICA 4YYZA 4O3MA 2GA9A 2B0CA 2H2DA 4WINA 2LR0A 3BWDD 5TEVA 5IJWA 3D6NB 1YQ9A 3DEKA 3EWSA 4LF8B 2KPOA 3ZWDA 1P8JA 2ZJ6A 4GDFA 3V3TA 4YRIA 5A62A 3RSGA 4BNVA 3PNSA 4G23A 3A3OA 3WLIA 4OBWA 2I3GA 4QTUB 1V3TA 2E87A 4LPKA 4KUHA 1DRKA 4NSNA 4M8KA 4JVSB 1MIOB 1F2DA 2HMYB 1YMQA 4M37A 1CR4A 2GN0A 3N8NA 1GHTA 3DKRA 3EDCA 3PU6A 3Q6MA 4R8LA 1ZH8A 4FWTA 3E8XA 2CC2A 4LDRA 4XRGA 1F5NA 1WVIA 3UCEA 1IWOA 1QVWA 3OE5A 3Q3JB 4QGHA 4A2QA 1M33A 3V4OA 3KVVA 5BORA 4TKZA 1Q0QA 3RC2A 1SCBA 1GRVA 4YGXB 1DTWA 1NL3A 2WY2D 1VGQA 1RLOA 1ODTC 2E4UA 3WNDA 2HB6A 1N8KA 3NTXA 1DC3A 1UEIA 3KKMA 3FFWA 3SEFA 5DTIA 1KI7A 1GGFA 2IXGA 3N2ZB 4QDUA 4QQKA 1P9WA 2EC5A 2H31A 1OC2A 2Q3BA 4OBEA 4OHOA 1H9BA 1N6OA 4Q12A 3PHHA 2GJ9A 2QLJA 4CTOA 3AB7A 2R7LA 1AK2A 3BSSA 2F55A 2ZUEA 1TK9A 4JUCA 5KC9A 2JJYA 2C4UA 3SEAA 3JWGA 4QVKA 1HDIA 5TT1A 4E4TA 1QHHA 1A8HA 3KR1A 2QN3A 4YUVA 1UBUS 1VJRA 4WJLA 2W6CX 5FLKA 1L5RA 2C7PA 3RNLA 1AM4D 2EP5A 3BJZA 5HMLA 4D4LA 3S5JA 4DXHA 3D7LA 3STYA 3H19A 5EN4A 2GCNA 1JI3A 2H5EA 2J9YB 3G6KA 3DEYX 1C81A 1GG2A 2XUIA 3OQBA 5EAIA 4B4UA 1ZVJA 2GXAA 1E2BA 2DUUA 2IUYA 1EWVA 5JSZA 1VPLA 3B9QA 3BMNB 3F9CA 3L1UA 1WXQA 1CUJA 4M0PA 3FPBA 2IOQA 1GXSA 1JFRA 3GMIA 1MABA 3UTDA 4DMLA 4YFYA 1KYWA 3MWJA 3M6AA 3AU9A 1NKTA 4RLHA 1C3OB 4NYIQ 1XRLA 4ZC8A 3RJ9A 3RVMA 1QBKC 3A1TA 3RC8A 3IRUA 3M1LA 2O0JA 4AW9A 3ZU6A 4RL6A 5D5QA 2OPBA 3UMGA 1KARA 4EGSA 1OTHA 5LYJF 3STTA 3IO5A 1PWXA 5FTMA 4PTZA 5KU7A 2I6SA 1D2AA 4BX3A 5BMOA 5DHSA 4ZJYA 1H2EA 1JLMA 3ER6A 4MVJF 3B3AA 1PT5A 2EW1A 4ASUD 2LD4A 1T6XA 2O2GA 1D9XA 1GILA 2APJA 1M7GA 1ZA2A 4WGFA 4AG5A 3TBHA 3NBMA 4P7JA 4NCAA 4DKJA 5A1JA 1XJ5A 3QOFA 3PNVA 5D3ZA 3EEQA 5BPHA 1E3EA 5A0FA 2HBYA 4LBYA 2DHDA 3SF8A 4LDZA 4TUYA 1A71A 4NOJA 1VSBA 3M9LA 1QH1B 4GMFA 1JQAA 1Q92A 2R1TB 3CZAA 2V7EA 5I7AA 4LHVA 3WRWA 1PFGA 5IXSA 5A5VA 3K9BA 1PFYA 1D0VA 4PC3A 5CJJA 3QE2A 1XQVA 2WM9B 5EE0A 5IBPA 2HLPA 3B6IA 2IBSA 5LP6F 4WQMA 4Y9SA 1VJCA 3KQKA 2OD9A 5I4IA 1HL7A 4D0RA 3K35A 4Q93A 1DJQA 5C4MA 4CDNA 3UHFA 2FEMA 4GQBA 2BFFA 4G84A 3IH5A 4I55A 4MKFA 4MIEA 4R81A 4YAFA 2B34A 2RKBA 3RS2A 1MR3F 1E2KA 4YMSA 3D6HA 2HSWA 3QXXA 2HD4A 3LP8A 5G4KB 2WB2A 3VJRA 4I1YA 3Q3CA 1XNHA 1HYHA 2DFNA 5AW5A 2CXUA 5CHYA 4BZWA 4MV3A 3ROPA 1WXEA 3IPXA 1Q2UA 1SBYA 2CHEA 2PFSA 2HWKA 2AXPA 2ZATA 3LBYA 4H7KA 4Q1CA 3S2EA 3U7EB 3VR0A 1ZVQA 4XGQA 2IS2A 3GOQA 5FNZA 3B9BA 1HL3A 1EFUA 5FTJA 2J9XB 4JAVC 1ONSA 1UR5A 2ZJAA 1NNUA 1NHWA 2XAAA 3FKQA 5FNVA 1MBZA 3EVTA 2O0KA 3ITKA 2NU8B 4CUJA 4KBYA 4WL0A 5AK4A 3B38A 1CZRA 3DULA 5LN1A 3OVMA 1BHSA 4YACA 4PZAA 2WQ6A 3NOVA 3IQEA 3UFXA 3OQ1A 1TIBA 4OPMA 3KQOA 5DI9A 4CIYA 5IDWA 1YZGA 5LP1A 4TYPA 4BBZA 4OHMA 3EIUA 3GA7A 5AK5A 6YASA 1RYHA 3DOEA 4WBNB 2OILA 4KRYA 2HAEA 1V8OA 2Y3IA 4FGSA 1CR6A 4HOYA 5IKPA 2XQJA 3T12A 2UUPA 3BIJA 4IIHA 3GLIB 5LNK1 4J91A 3WLFA 2SKEA 3QIVA 2NLOA 4FZ3A 4DG5A 2CN1A 4N6GA 4J94A 1GAWA 4O4IB 2VTKA 2OQVA 1PFVA 4JJAA 3G2LA 4P9NA 4PAOA 3TF5A 3IA2A 5F9HA 4QUHA 4PG4A 4DGQA 2G5PA 3SZMA 3D7SA 3SZGA 4XWOA 1AXGA 1QGYA 4P38A 3CF4A 3ZJUA 3PLRA 4AP6A 1IBKB 2UZAA 3C6YA 3CO5A 3V2GA 5DM2A 2IH5A 4RZHA 2D00A 1N2CE 3EPLA 4AI6A 1IIRA 3O38A 4RTLA 2FOXA 2H0RA 4EDHA 2I4RA 4XAQA 4HS9A 4G8JA 1TKCA 1ZOPA 4J7CA 2F67A 3A1SA 4HWOA 4TMXA 1REQB 3KQHA 1UWCA 3CX4A 3QUBA 1NFQA 2D1TA 3G2PA 1TK2A 1X9HA 3BK2A 3AYZB 2VPZA 4HDRA 2ECKA 2Q6VA 4BBPA 4FMPA 4P3OA 4BO0A 2HMWA 4BLQA 1ZWLA 1N25A 4HJXA 4OUDB 1DCTA 3QOXA 1XP5A 4HQLA 1OI4A 1XWFA 2P9HA 1P45A 2RGYA 3OCWA 3K8OE 3R3YA 4E2WA 4EG0A 3OCXA 3JYOA 4B80A 2YJTD 4B5LA 4ZO9A 4CTMA 1MV5A 1YB5A 2D5BA 4KXVA 2GO1A 3L6CA 3U1VA 4AT1A 3NNNA 3EGVA 3UBTA 3FHLA 4UZSA 1EDBA 2W58A 4CG0A 3OX2A 2IYUA 1PR5A 1T1EA 3DV2A 4QELA 4X92A 4QUBA 3FMIA 5HFAA 1M2JA 4RY2A 4OX9Y 1S8AA 3TZHA 4RO0A 2UUAB 3KDAA 4DLLA 2PL5A 4C4RA 1NW9B 4ETWA 2FGJA 1W75A 3VJMA 2P68A 3IUJA 1E6KA 1NVBA 3FTPA 3FYCA 1C9KA 4GQAA 2Z5FA 3B1KA 5DM70 3ESXA 3EF1A 4Q01A 4NU5A 2FH5B 2FPKA 2GSWA 2HUNA 3LYLA 2Z8ZA 3MGCA 1Z17A 2JLRA 4HFNA 4JOBA 2VQEB 3A1DA 1LLCA 1U0NA 2NYRA 2QYTA 3VRHA 3IAS6 3KD3A 1MPXA 3GZJA 3MHPA 4J1QA 4MVJA 1XLVA 4OK3A 1BD3A 4C04A 3I9NA 1GGJA 4BXOB 2WSSA 2P78A 2ZYSA 4L9RA 1E20A 4FMBB 4PCLA 4DY4A 3IILA 2DBYA 1CY4A 4C4ZA 3IP9A 3NYWA 1CR2A 4TYNA 1WHSB 4KPUB 4WA7A 2Q41A 4C3OB 3IQGX 1YDHA 2BZSA 2B4TO 1PU2A 3R5FA 3A37A 3JALB 1SUBA 1P0CA 1U3VA 4KO2S 2BFDA 2C20A 1P0MA 1Y4DE 2QKYA 4OLJA 1J0XO 1T36A 4HQRA 1QMGA 4ICIA 4BNGA 3GCDA 3N2LA 1VI6A 2BEUA 3QLJA 4BRWA 4HK4A 4CW7A 3DAFA 5DSTA 4DJEC 1JKMA 3VDMA 2QRGA 3ICPA 2F3TA 3ABIA 3EIWA 4MYSA 4AJLA 1OT3A 1KXZA 2H3EA 3HJAA 1NUQA 4AJOA 2PD4A 1VHDA 4AWAA 3PD0A 4NECA 4NHOA 5EQTA 3HUEA 4JLUA 1UC5B 5JWOA 1A96A 2NZXA 1S2LA 5CA1B 1L7EA 1TQ6A 1UKBA 4COOA 2HWXA 1WVMA 2A1TR 2BFWA 2YMLA 1JF8A 2QM7A 4L8FA 3U7QA 1DHRA 2Q62A 4EI2A 1HT2E 1PKEA 4IDBA 1QG2A 1PV1A 1N1MA 2F64A 4N5MA 1YE5A 2QTVA 5IWCA 3EZ9A 3T1HB 1JIQA 4ALIA 4B4OA 4ZFNA 2QLLA 2BI4A 1QPGA 1TU3A 1WDKA 3G9QA 2ZRAA 4UE3S 3U7IA 2A1TS 2PZAA 2R8PA 4OFXA 1SIUA 3CR3C 3O8QB 1ACJA 4GOXA 4J75A 2XIJA 4C7VA 5JJ5A 1U6JA 4KH1A 3EUAA 1P7WA 1U1FA 2UZ1B 3FDJA 4JU9A 4GLLA 4G26A 5JZSA 2KMLA 1SVSA 1FE8A 1OC4A 1NR7A 2NZYA 1CT9A 1TU4A 2OORC 2QAJA 3EDYA 3FB4A 4IS3A 3WGMA 3KO8A 2IZOA 3EA0A 4TTVA 3DOOA 1HFKA 1Z2AA 3QFCA 4EY4A 2PPVA 3FTQA 1BEUB 4BLRA 1E6CA 2DCUA 3R0JA 3WGHA 3EZGA 1ZQ9A 2Z30A 1SAYA 3M82A 3RFTA 2C2HA 3E58A 2MSWA 2IV2X 3OJ0A 4CIVA 4EYSA 4QM7A 4MAFA 3ILYA 3HCDA 1CUZA 1GT6A 2GT1A 2ZJ4A 3HYTA 3M1AA 4MQ5A 3F47A 4IV0A 2PAAA 3FIUA 3FXAA 3KOZA 5LXTB 1PIWA 3HBFA 2XCIA 5ALGA 1M8PA 3ZZ1A 3M81A 1RVV1 3IDZA 3C7AA 3KJGA 5ITZA 4F93B 3I0NA 4AF6A 4KNYA 4QFCA 3AOGA 1J25A 1E3LA 1MENA 2GJKA 4YALA 1J22A 1FLAA 3WDKA 3H1PA 3IVGA 4QDKA 3T3MB 3VVMA 4FLEA 1ULAA 2XDWA 1RMYA 2WA2A 3GDFA 2X15A 3AUUA 1EWQA 1AURA 2OTCA 3TNJA 3TR5A 1USVA 4QREA 4NU0A 4D6XA 5A6VA 1H3EA 1XTJA 1CPYA 1XPUA 3EHEA 4L4ZA 2NO5A 4URHA 4KJXA 4AK9A 4GXTA 1WXHA 3ESYA 3JQGA 3TRHA 4RIHA 3R5SA 3EOZA 5EGNA 3CE9A 5CD1A 4B44A 1WSAA 3KJNA 2C7QA 3DE4X 2FVXA 1LD3A 2ZQZA 3GLIE 5IW8A 3TZCA 4XWKA 4ABTA 3L1HA 4N65A 4X8MA 3DBHA 5CX1A 1P17A 1BGXT 3QXJA 4IFBA 4WKCA 2FPGA 2ZJ5A 1GNVA 3MTBA 2G4LA 2PLAA 1I0ZA 2FN9A 5JCOA 5KTTA 1M66A 3T4EA 1QYCA 1PJ3A 1FNCA 1QG0A 1U7PA 2YS6A 3RG2A 1GTSA 1S3FA 2WUDA 3Q9NA 4TWZA 1D6JA 3HCBA 4LV6A 2R68A 1GIAA 2FE4A 4MH0R 4GI1A 4RH3A 3DL4A 4D9FA 4OCZA 2NXJA 3QTTA 2XDQB 1UBCA 4MR9A 4TKUB 2X0EA 3ZHOA 4EUFA 3AVUA 4RHUA 1OFIA 2ADFA 1YOVB 3OHMA 4L8YA 4OHCA 3UCFA 2OHHA 4ZEOA 1YQQA 2V0GA 1FP6A 1IQUA 1VLJA 1U3TA 2M6RA 3DPUA 4MUYA 3R7SA 3EF0A 3KQUA 3CIOA 5HYVA 4YRNA 4ZOLB 3W5VA 4LF9B 1XTUA 3HB4X 2JH8A 3ZD6A 3RE1A 1TEHA 3AKEA 1NKSA 3DYVA 4LYJA 4O6VA 4Q4LA 3UUEA 4D4IA 2Y1DA 2J4FA 2H08A 4ZVOA 2BUCA 2J0QA 2X3FA 5EYPB 3KHTA 2XVZA 3IV7A 1PR2A 1KI9A 5IJAA 5KKAA 1FIUA 4KWIA 2F1HA 2A9JA 1AUPA 2JFWA 4JP2A 3WJ1A 4KITB 4A0GA 1K98A 3H8WA 1IC6A 1VSTA 3WRYC 1V26A 4MDHA 2OEPA 3V6MA 1DIHA 1CKEA 3ILSA 4EJSB 5KVAA 2QBYB 4KZKA 2F4VB 1E1RA 1ZK1A 2WJAA 3WV4A 4G1CA 3IJRA 3TIXB 3P96A 3BWEA 1D6SA 2OCKA 3VH4A 1TVMA 3A3YA 3CN9A 1FFDA 1FX0A 2YYYA 3TE7A 5SZJA 3O1HB 4YY3B 2IW3A 5LUAA 4GBGA 1M1NB 1IQPA 1LJLA 1Q2XA 3LPCA 4KIJA 3IAS1 5AKXA 4R16A 1JIKA 2JLYA 4KAAA 4WWHA 4IGAA 5L3RA 1HE3A 4AXXA 5KYWB 2NN3C 1SZDA 4LRWA 2VJCA 2FN4A 3Q1KA 3UJ3X 1OAAA 1MJHA 2VHTA 4D1YA 1FSFA 4O2BB 4KOEC 4C4PA 1A50B 1JYSA 1UIRA 4MGYR 3OA0A 1OLSA 1K8QA 4JBLA 3PHGA 4UU0A 2QJFA 3VHQA 1K4YA 1ZC3A 4BNLA 4YLGA 3SNKA 1OWNA 4ZHQF 1GSOA 3BWXA 3L4EA 4MQBA 1XZIA 2DCMA 4I5EA 4UVHA 2XKBA 1W4BA 2H63A 1NOJA 3AF4A 3KLBA 1IJFA 1NDUA 2D7CA 5AH0A 4ZDWA 1KDPA 2A9VA 1KH3A 2XX3A 2YNMC 2EL7A 4BNNA 1E99A 2UXCB 1O7JA 5F1PA 1SC1A 1FFBA 1QORA 3DFUA 3TJMA 1KR2A 4LYAA 1CNMA 2JHCA 3GXBA 4MV8A 4XPZA 1KMHA 3ULKA 5FDFA 2OAP1 3UENA 4RACA 1JB1A 2F4NA 4JUBA 4MPRA 3BXXA 4FW9A 4MKHA 2ZR9A 3KEQA 1V95A 4HH0A 1CRZA 4L57A 4V24A 1JPVA 4G9BA 2I3DA 1DXOA 3CNHA 2CLKB 1MVLA 2JGJA 1FB5A 3ESAA 3Q3HA 4ZIRB 2QTCA 1U8FO 2AEJA 1O0BA 3LCUA 4BQSA 4CV2A 1XCLA 1KJQA 1CX9B 1UCFA 1UJMA 4G8CA 1B0ZA 1P9RA 2WA1A 3IAUA 2VCHA 3D02A 1QCCA 1R16A 4CM8B 2IXFA 3FYUA 5D84A 4WSOA 1TYAE 2XNKA 3THYA 1NATA 5E2BA 2IBTA 4WDQA 3ZDAA 3O4HA 4KO4S 3WHKA 2WSSD 3L4BA 3TOXA 1C8BA 2F8SA 3OC6A 4PHCA 4O8ZA 3SBXA 5AW0A 4JB0A 2TMYA 5BSKA 1CQWA 4IKPA 1ZJJA 1L5OA 1UFOA 4UNRA 2B0JA 2KM1A 4XFJA 3ZS9A 2L69A 2O20A 1JAZA 1XNGA 2ZVDA 4L1KA 4F5EA 1VBKA 3DVQX 4G5YA 4RHTA 3NCHA 4WXMA 3O4GA 1YULA 4B3XA 1WZCA 2ZTLA 1OI3A 3A9TA 3AGQA 3RUCA 3U31A 3JAMA 3QF7A 4MVYA 3OKFA 3RT1A 2HSJA 3WYBA 5AVXA 4X95A 5I9MA 1W73A 3WMRA 1RRPA 5LB4A 5KOJB 3C3PA 1A9RA 5A4FS 5C1OA 3SX2A 4B71A 1FNNA 1P80A 2LDXA 1KI1A 2O5CA 2XUKA 3ELBA 4C07A 2XADA 1Z2OX 3F1KA 5IZ4A 2V97A 3VNAA 4Y9DA 5CXUA 5KTNA 1QLWA 3DSRA 5GGYA 1W4RA 1P44A 2BJWA 4M8IA 2PZMA 3M2PA 2QRUA 4KREA 2V9ZA 4FCCA 3E61A 3U40A 4MO2A 3FTFA 4I8IA 3DMNA 2H4XA 3U49A 4YP7A 2NOAA 4XJTA 1C7EA 3ABQB 4QUEA 1GUBA 5CNJA 3HL0A 1L5VA 2PKQO 3NYQA 1Y5LA 1L4HA 1DQNA 1U8TA 3EVDA 4IDEA 2Q3HA 3LXMA 2IC5A 4ARAA 2C00A 4DCVA 2Q4EA 2O59A 2FPLA 9MHTA 3JRNA 5IT9A 2J85A 4WNAA 1K08A 4BGUA 4JGGA 3ID6C 5CFNA 1HM5A 1TMYA 3DBIA 3GDWA 4B6EA 5G41A 3TVDA 3TQCA 4HAVA 1EG7A 1DIOB 3KK0A 4DV4B 3ZUGA 3F9IA 5HOQA 2QS9A 3R23A 3U3KA 1DL5A 3U9SA 1YWGO 4P3KA 1Z18A 5SY9A 4NS1A 1NSTA 2B8NA 4HN9A 4CEHB 2X2OA 3GY0A 4M7WA 3SEZA 1B15A 1S8FA 1Y33E 3COZA 4US2R 1DAPA 3DZGA 1AJEA 4TV8A 3HVHA 3PXDA 5EZYB 3C6QA 4YAUA 3OD1A 4EY5A 4QOFA 1K7XB 4F1KA 1L1FA 2W0SA 5FBLB 4Y6RA 4AY6A 1Q17A 1RKVA 2G4CA 1NJGA 1Z8DA 4P93A 4ZARA 2RBGA 4ZQFA 4I4TB 1VQ1A 2BW0A 2P2LA 3EZYA 3ADDA 3KCNA 4KGXA 1F7UA 1X86B 2Z83A 2I87A 3K92A 4IH1A 1ZU4A 2SICE 5G3ZA 3ZU3A 3R3VA 1KYXA 1OYOA 1USWA 2W2OA 4FFPA 2AEFA 4BQRA 3QPCA 5C8DA 1OX5A 4O4HA 4CCYA 2VHYA 4YRGA 3CVUA 4FI3F 5H0IA 2JD0A 5D85A 2YXBA 1G7SA 5ILQA 4ISCA 3VSEA 4ATNA 3RUDA 1FPQA 2JFHA 3MTIA 3Q2OA 4UULA 4A5OA 2A0XA 1Y4UA 3OLXA 2ODNA 1HOXA 3AVTA 5HIAA 5MN5A 1TM3E 5JBQA 5JYEA 1RJWA 2FWMX 4BPBA 3SQMA 2H6EA 2P1DA 3BIWA 1TZBA 3P9PA 4HGNA 1M6YA 1KEPA 2CVZA 2CVOA 4NX2A 4PAGA 1ZXBA 5EKSA 3SHOA 3WICA 3CVVA 3IP1A 1V43A 3DR3A 4V2IA 5DK4A 1CUWA 1Z2DA 1I1OA 5B6JA 3NVDA 2X1MA 3I4LA 4NL4H 2ZI9A 1T0UA 2QTLA 3C3EA 3D3QA 4QUAA 5IUKC 4EEZA 3ZHTA 4NFYA 1T43A 1XFDA 3PJEA 4JP3A 4OJKA 1I6KA 2PH1A 2EYQA 1W36B 2PLNA 2ZR8A 4RZSA 4UHBA 4ZK2A 4C0AC 1E94E 4YRTA 3WQQA 2WE8A 4E15A 2X23A 2EFJA 5FV7A 2Z4SA 3PWTA 2YWJA 1ZK4A 1ZMTA 4OMUA 5KTKA 1HSZA 1YMUA 2CWDA 4MW7A 5ENZA 4IDQA 2B1RA 3AYXB 5ERXA 3VGJA 1DTWB 3LLMA 1P0IA 4ZMRA 1IDOA 1S01A 2X2PA 1P9NA 1XXHA 1HYQA 2Q2WA 1FK8A 5K3EA 2FEWB 4QDZA 2QR2A 3O4IA 3JR3A 4HLQB 1XTBA 4WZZA 4MPJA 5FB3A 5LZ4A 1B3RA 1XZNA 3KR2A 3NOQA 2I8AA 2QLNA 2PKWA 1AA9A 1XCJA 3RWBA 4UPEA 4UCQA 2BTQB 2FDCA 1ZP6A 3NJRA 1CEXA 5JSYA 3DNPA 3L4SO 4M9UA 4L6CA 3JQBA 4TWBA 3VR4A 4C4XA 1CUVA 2CCJA 4MIKA 4BKUA 1H2YA 5CDGA 3AV0B 1H2RS 4P86A 3GLUA 1QHHB 3IT3A 4MTCA 2IKQA 2IODA 3T6KA 5KKCA 3HHPA 3IUMA 1V39A 1SZCA 1K4KA 4BX8A 4WKGA 3KXIA 4HMQA 2P4SA 5AVRA 3O2QB 4RVHA 4E1VA 1E1RD 2WJGA 1JZTA 2BR4A 1FRNA 4LRXA 1YNOA 3LP6A 2W83A 5I7UA 2W6MA 3D1JA 3ZKAA 1AQUA 1KMMA 3EUWA 3I6MA 3IOEA 4QJBA 4UXIA 5JSZB 1WIWA 5BN3A 5KOYA 4MP8A 3OBIA 1XEFA 2XYHA 1GXSB 1NC3A 3CRZA 3DFKA 1ZIYA 3VI4B 5ANRB 3WVNA 5JZMA 4PSKA 5D01A 2DH5A 4YRFA 2EF1A 4R2HA 4KTTE 4G5QA 5CNKA 2IXDA 4DDTA 2BBSA 4V02A 2I54A 3DW3X 1QH0A 2X9LA 1M8FA 3KEFA 2X0RA 3FHCB 4MUGA 4WDRA 2HJ9A 1EXNA 4UEJA 4OXYA 4TXMA 2X76A 1DIRA 2JFGA 3AEQA 2VWQA 3T9EA 1ADCA 1CJTC 1GY8A 1GGNA 2YIJA 4MJ3A 5BSGA 3U80A 3BFXA 4JIGA 4ARSA 2CDRA 4CMIA 4AS1A 3PZRA 2VUSA 1ZJZA 1QHSA 1RLTA 1VGRA 4WCFC 3VPBA 3SF8B 4KDRA 4TUYB 2O3JA 4M0CA 4JI3B 6REQB 3OTOB 1E5LA 1YRLA 3IOCA 3NHJA 4H3SA 1IVYA 1UK9A 5A5EA 1QIMA 3PFHA 2WT9A 2VH1A 3F6SA 2XAUA 3FKJA 5DW3A 1B74A 5C5CA 4I3FA 3T7IA 2V3CC 1KPIA 1M0WA 3T3GA 3U7GA 1R37A 4HMPA 1CZHA 1RQRA 3O1LA 1SVLA 4IIUA 1RI5A 3FD8A 1V9SA 2GBLA 3JSAA 4ID9A 2XYRA 5BSWA 2FCRA 1FNBA 2XWJI 4KX5A 5FPQA 4TQ9A 3AUXA 1WW8A 2D1YA 3KJFA 4GZ5A 2QMZA 3W1VA 4LJLA 2VDUE 3HWX1 5B12A 2O05A 4KQXA 1PTJA 2RAPA 4MWOA 4Y2JA 2ZJBA 3DDOA 3GX1A 3AV3A 1G42A 3ZHXA 5FNVB 5I9SA 4AFNA 5IARA 2FWIA 2LCIA 4P92A 2WFMA 1ODCA 1BRMA 2DAPA 1NRXA 2P9ZA 3UFXB 3PJGA 1KZ1A 2V6JA 2C57A 3SZRA 1EIWA 1WP4A 4GYJA 2J3MA 2G1PA 1RWOA 4IM7A 5SV2A 3RRFA 4JL5A 5KINB 4TMZA 5HJ7A 2ZIUB 2DC1A 2FN8A 2HMTA 4PANA 1HR0B 3E3LA 3AVOA 4PN3A 1XEAA 2GH1A 2H11A 1UBNA 3H9EO 1VA5A 4YN3A 4EJFA 1P1CA 3L7LA 3DL0A 4YRRA 4XIIA 3L46A 3RYCB 5KBYA 1PYGA 3H6KA 4CV0A 1OB5A 4NBVA 3STWA 2CNKA 3O03A 5HA5A 4MJLA 4BQOA 1OLOA 5JC1A 4F9EA 4HZIA 1P5HA 2ZWIA 3GGDA 3SVTA 4NE2A 1MO5A 1FFXA 2ON6A 1ST3A 4BFYA 2IPNA 3QLEA 2Q0QA 4GC5A 3SJUA 3QYJA 5FBVB 3SJ7A 1GL7A 4XGRA 3VJLA 4JMLA 3KOUA 4N5HX 1MAHA 1DIBA 1P74A 3ZHRA 2ZRIA 2ZAIA 1JHZA 1T15A 2OBNA 4IMPA 1EM8A 3VXKA 5KCMA 3X2FA 3TMAA 3LC2O 5EJEA 5IM4F 4CL0A 1B4DA 3JVEA 3OQOA 4JI8B 2VYFA 3ML1A 2X8WA 3JWPA 3L9XA 4NQZA 4DCTA 3RS0A 2J9GA 4E08A 1ZLXA 2PT6A 2O6LA 1L7NA 2D2VA 3U9LA 1UM9A 2BF4A 4J0HA 3A9UA 5DGCA 4V39A 1GL9B 4OG2A 2O5EA 3PXBA 5KPDA 4GFDA 3FW1A 3T0GA 1KL7A 1QIKA 3EXFB 4EENA 2RHWA 4V1CI 1Z26A 2HX1A 1V37A 1WU7A 3FWHA 4XQCA 3ZV4A 5FEMA 3HYLA 1V6AA 4REMA 3G8CA 4LC0A 5HIIA 1GDTA 3W5AA 3JARA 3G2HA 2I3AA 5REQA 3RTCA 2L42A 4F2WA 2GF9A 4GSLA 4PHTA 3LG2A 3FRJA 1C0EA 2CUKA 2OSVA 4OB8A 2Q7XA 3RBAA 4F72A 2QLFA 4N40A 3DMFA 4NAHA 3VR5D 1GWNA 4BIIA 1K0UA 1NRJB 2ADOA 1Q1EA 2BWJA 4BO3A 3KELA 4DCNA 4DT1B 3SKVA 4HATA 3DEHA 1AQLA 3PGJA 1T9HA 1GNRA 2KLBA 4HFJA 4B3DA 4BHTA 1TJ4A 2LKCA 2IU4A 1YGYA 2BMJA 2GZHA 1P31A 3R3JA 2QMHA 3RVJA 2ZGVA 3T7KA 1EDEA 1NVDA 1WMFA 3I37X 3UFBA 4YRAA 2MDTA 4UNNA 1BH2A 4WERA 2W8BA 3IOMA 3WWZA 5KYTA 4WK0B 1F8XA 1JSZA 1Q0HA 2XZTA 4MUHA 4NIMA 3TI9A 3VAAA 3FCEA 1NX6A 4Q9HA 1TCUA 5H9VA 4IWNA 4QTXA 4X0EA 1O4VA 2AD1A 2IX9A 2XE8A 4MGZR 4QBGB 3FH0A 3KUKA 1VLZA 2FFRA 2WLTA 2YHAA 2YMQA 4MROA 2SBTA 2ZIVB 1EFTA 1G19A 3D1VA 4DC1A 2IT1A 2QVBA 3RAJA 4MHOA 2BFDB 3PTLA 4GVXA 3GWGA 4IGEA 3NWOA 2HCJB 5K51A 2XXAA 1FF9A 1WLSA 2ERCA 2OFPA 4I66A 1KDRA 2EP8A 4PSUA 4XWYA 3G9TA 3ZYCA 3UMYA 1T2UA 4J1TA 1N6HA 2Q5LA 3O7WA 5FRDA 2TSYB 1QH9A 1CP3A 1J1ZA 5TR9A 3GFBA 1JMVA 4V0SA 1T4CB 3QZUA 2V7PA 4BMXA 1RW4A 1VL6A 1A77A 4V0NA 2ERYA 2LV8A 1VGVA 1JEEA 3G2MA 1V9CA 5HRCA 5HZHA 4G5SA 3TKAA 3VV3A 1W52X 1B0AA 3BMCA 3AHJA 1LJ8A 2AR9A 1JQBA 4IXWA 3UKJA 5TQ0A 3FGNA 4JOQA 3V4SA 1MA0A 2XECA 1ID1A 1M34B 2D54A 4J3FA 1WO8A 3K3PA 4WXHA 3GLGB 2PRYA 5DVZA 1RZ3A 3DWFA 3LK6A 4I99A 1CY2A 3VR4D 5BRAA 2J1LA 2R3SA 4J6EA 1BEEA 3Q7PA 4S1TA 2CBGA 1P62B 3G82C 2QJRA 3E53A 4FUQA 2AEMA 1DTEA 4HLUA 1T91A 1E0KA 4DLXA 4KQHA 8AT1A 3GAAA 3FYHA 1Y98A 1D1QA 4XYEA 1JU9A 3AHEA 4D4HA 1C0LA 4YP6A 1QS0B 5J4KA 5FUBA 1ZL2A 2C99A 1C7QA 1SKAA 2HF8A 3GFSA 4Q19A 3D7RA 1BWRA 5LR6A 4M0KA 4PGFA 2EG9A 3WLOA 1ENYA 2FG6C 5LD2B 1V5GA 5AHXA 4O4JB 3LHDA 2NXEA 4N0DA 1CUBA 2GJAA 2P3LA 3HH8A 2IZ6A 3JD0A 3OEWA 3R7WB 4O3FA 3EX7C 2HQRA 1CRLA 3L1IA 3OCJA 5SICE 1V5IA 3ROKA 1QNLA 4XJVA 5IHPA 1RM0A 2PGIA 2WBLC 1ZOLA 3IHWA 2QT1A 1XWWA 1U7DA 2VJDA 4XIFA 3IMGA 3VNQA 3BK7A 1AS0A 2BJVA 3OJLA 2WWRA 5HFJA 4PNHA 1R0ZA 2AWNA 3OCZA 1JR6A 3HVKA 3H65A 2XNDA 4ZYZA 3QU9A 4RENA 3B82A 5LWQA 4N7BA 1WMAA 1ECCA 3P5BA 3TTWA 1AMOA 4JUDX 3PLAE 3HJNA 4N4AA 1Z5NA 4REQB 5E38A 1BJRE 1OR8A 2YRFA 4W1RA 4U2FA 5IH3A 2W6JA 1SA0A 4NOKA 3U4MA 4GUAA 3QYFA 2HO5A 1JH9A 3NH6A 3AL2A 3RPEA 1X1EA 3KLPX 3AIOA 3TPFA 3PXAA 1TQDA 5DMXA 4CDGA 3QE3A 1EFVA 4UVGA 4IJVA 1GRRA 1E63A 1NAHA 2RHTA 2VWGA 3L05A 1ZOOA 4IX9A 1LZLA 4PFKA 5THQA 4EB6A 4HAYA 3IC5A 1JDSA 1PLLA 3C45A 3UXHA 2ID4A 2LXNA 5ADHA 2Z6UA 1IJBA 1N3IA 2PY6A 3EVFA 1R15A 3R5KA 4OSEA 4F7WA 5G0WA 1UODA 1RIFA 5CX1B 2I9KA 2R44A 4QTZA 1Q15A 3B60A 1M8GA 3WK4A 4EHNA 1MHPA 3CW9A 4FDMA 2UXDB 4ZEMA 5HGJA 5BNIA 4URYR 1NFRA 1ZISA 3OTIA 5JDCC 4EW6A 4ZAGA 5G2OA 4C29A 4K88A 3DOFA 2Y71A 4BECA 2GHQA 3H9BA 2D0OB 3M4XA 1KJWA 4WUVA 2QGNA 4DRXA 5EUCA 3AX6A 1K68A 4HTFA 4BQEA 5JATA 3E5HA 5IASA 1AT1A 2COEA 5FO1A 4U1RA 3X1YA 4HS4A 2YV5A 1D6MA 4J03A 4LYEA 2XB9A 5CDHA 1WV1A 1GQOA 1L7QA 2GAFA 2Q5QA 3P97A 3SSAA 5KNBA 4XJXA 5GMOA 3UG7A 3C85A 3FROA 4JLWA 1A9ZA 4AY2A 4FFMA 3HY4A 4OM7A 4GM0A 4UUOA 3TOZA 1W6UA 1JXAA 1T0HB 2C5GA 2ZDHA 3QUSA 5JE8A 4YMTA 3F4BA 3OT5A 3TOVA 4L4YA 3IUNA 3SFZA 3LLSA 1W8DA 2V7WA 3UQZA 4Q9AA 2H06A 3LO8A 2CVHA 2XF8A 4HQ0A 1YZHA 2AFIB 1GYQA 1POWA 5JQGA 3DMTC 4RS4A 1I4WA 5LBUA 2XSZA 4IIYA 4Q5IA 3D8UA 3JX9A 4G4SO 3L6DA 4Q9LA 1KZHA 1PWEA 1XZMA 2E85A 2OV6A 3ZU5A 3Q7TA 2OZPA 2GEVA 4AURA 4UOZA 4ZCPA 3PWZA 5G0VA 5AI9A 5E0KB 1JHAA 4BAZA 1E9RA 4HNSA 3WP1B 3OC0A 8ADHA 5TLSA 3LGXA 1IEVA 3K70D 3KVOA 2WKSA 1YK0A 3CH7A 5HF9A 1D2NA 3AERB 3IJ5A 1NP7A 1IY8A 3GVPA 1U63A 3SS9X 4HXGA 3PCRB 2FR8A 3GGPA 4GP7A 4O1IA 4X7BA 1OLSB 3PT9A 4L02A 4RHYA 4EG5A 2RGDA 3QKRA 4DLUA 5TVKA 2DUWA 3EODA 3MC1A 4NV3A 5FTWA 5HILA 1DO0A 1AKWA 2P9EA 1M6HA 2VBFA 2XUPA 5BUCA 4C3ZA 1FYFA 1YCDA 2GZDA 1Y6ZA 1PZEA 1CUXA 1Z9BA 3ND9A 3O73A 4LWPA 3DBLB 1APBA 2XBMA 3U19A 4Z3KA 3SZLA 5JTTA 1DMRA 3C70A 2RI6A 3L6OO 2VSQA 4YP5A 3KVYA 2G82A 3DT6A 1VI2A 5K0LA 2IPXA 3JQ7A 1U5AA 3MFYA 4ZQBA 3KJZA 1V4BA 4LKOA 3O47A 4KSCA 1D2RA 3U3RA 1KMHB 4M7OA 4D3XA 3USZA 4L22A 1QH8B 5A4AA 1L4LA 2G88A 4UBLA 3L41A 1G17A 2QZ4A 4QLBA 3RWOA 1BXRA 4EECA 5IYZB 3BREA 2ATEA 4R8KA 1P1FA 4C6SA 1E0AA 1AK9A 3D6AA 2JAQA 1LU9A 2VAMA 3FNFA 4XQ9A 4MCIA 5AUNB 1JAHA 2QY9A 3BXFA 4FYIA 2I6QA 3B3GA 3CUTA 4OQZA 5AOAA 3K0CA 5CFPA 2A30A 2FR0A 2YIMA 4BOYA 2NPIA 1R8YA 1YTLA 4HDSB 1JU4A 4ZRNA 4IWYA 1QNFA 5JMPA 1E6LA 3TCNA 3ZXSA 4C6HA 3QVVA 5IJ0A 3DCNA 1M34E 1NRWA 2HPAA 4OF4A 4ZCSA 4B3BA 3GLGE 4UAUA 3THYB 5JBIA 2E5LB 4WECA 3ELYA 4PRLA 1ECBA 1VL5A 1FNSA 4H60A 4UZEA 3TTUA 2MINA 3QG1A 2YC4C 3AWDA 3W5JA 2ZJ0A 2HYDA 3WYNA 1N7GA 3ZHYA 4ESHA 3JD3A 3OM1A 2R66A 4U7JA 4DLKA 2A92A 2GPBA 3P9IA 1XTPA 4PSCA 1ZJYA 4IUBS 1S9HA 1X1TA 3SI7A 5BMVB 4B31A 2N0SA 1MNQA 1AF7A 3P52A 2AW3A 4AMZA 4ND7A 4HNAA 2CCKA 5FI3A 2ZIZA 4CM5A 1T5BA 3TM5A 3BSYA 4FPXA 2JKZA 3H9CA 2NXNA 1ITZA 4PPGA 4W63A 4Y3UA 1J5EB 2IP4A 2EIHA 3FCXA 1U0BB 3I62A 2VQSA 5F1KA 3QVGB 1PNTA 2RAUA 2P9BA 2Q8PA 3PWKA 1ZDMA 3QFTA 2NT4A 4LPSA 2YIVX 2WJ3A 4OHZA 3ZNNA 1W36D 1EE9A 3PUJA 1T4BA 3Q85A 1RYFA 3DYIA 3T34A 1S8OA 3MBOA 4J0IA 4RF3A 5EEGA 4DCMA 5KJCA 3HXOA 1E96A 1SXJC 2HNBA 4F97A 1O8CA 2QROA 2IHZA 2AE1A 2W2KA 1ZS9A 3PFCA 5AXBA 3TIGA 5BYKA 3SYRA 3H4TA 2P2YA 1GGMA 4O08A 1R0RE 4R0VA 1LQUA 2IHUA 3FSEA 2HU7A 2A9QA 1W93A 2AJLI 2IIBA 4EW3A 2C2KA 3BILA 3L7NA 3VH3A 4HGPA 3RC3A 3AI2A 1SXHA 4RJTA 5FUMA 1MTZA 3M6XA 1C0IA 1Q14A 2HIAA 2OXRA 1P1HA 4FC7A 1THGA 4UNSA 1J2UA 4G63A 4RVUA 4AWXA 4B7CA 2IYRA 1SQFA 1MX1A 3NTRA 5AW1A 5LMUB 5B4UA 1MZVA 2RHOA 3A6FA 1Z39A 1C5KA 1J0DA 3AIIA 3HP1A 4WNAB 1SOAA 3WGLA 1KBOA 3HUDA 4CFYA 4LJ9A 4F9FA 1ZGBA 3FMOB 3JQFC 5B3JC 1W5SA 1QAQA 1RT9A 4FZJA 1EFRA 1VXOA 2TYSB 4ZCLA 1CDDA 2FW9A 4ZU6X 4LV5B 5ECGC 3WLNA 5JCXA 4CF5A 4IKOA 3AVVA 2QM0A 4TVBA 3GQBB 5GVSA 1L1QA 2YN0A 3EQ7A 1PUIA 4X6UA 3N2EA 4J49A 1K2VN 2JJQA 1X19A 5F9MA 3VO1A 1ZH0A 1A8IA 4PZEA 3D4OA 3MWEA 1ISRA 5B37A 2E1RA 3L49A 3PEUA 4JROA 3AMVA 4Q4DA 1AGPA 3CWZA 2XNDD 3ROFA 5AM0A 1WSBA 1F7VA 5GV8A 7GPBA 2AOTA 1KEVA 1KEKA 2XUFA 1N8TA 3NASA 3EXHA 3BIOA 2XZDA 4IP0A 5CM2Z 3RIGA 2HA3A 2PX5A 3TOSA 4DR3B 1N78A 2D2EA 4XWGA 2IKSA 1EQAA 3L43A 3R3ZA 5KB3A 4JLVA 4OXXA 2W6JD 3RFXA 5UKDA 4NBUA 1UDAA 1KE2A 2C5SA 1YZVA 3IELA 3IDOA 4ITUA 4BNHA 5ABPA 2C5LA 2EAUA 1CUIA 5LWHA 3AO0B 1G41A 4R6XA 2FP3A 3L8EA 2CNDA 3VGPA 4CMJA 3NIWA 1DUVG 1AXRA 1MJNA 1U8EA 2RJ3A 4IRXA 2IJGX 3UGJA 2PKRA 2QZSA 3I2FA 5AI4A 3RT7A 1VSQA 2PYIA 2G5GX 2V7GA 2CHQA 3ZXXA 5A2QA 1EDDA 3VSDA 3IEIA 4O4LB 4A2PA 4GE3A 3T3OA 4AZ0B 2I03A 3IT0A 1RKXA 1VLHA 3B6MA 3BE5A 3KQTA 1X7ZB 2AFIE 1BXGA 2ZZKA 2PSJA 3O74A 1Z4KA 4TM7A 1SBQA 3HDYA 1US8B 1XQXA 2HRDA 4ZOCA 1NYRA 2AOXA 1OKKA 3R0VA 3KTAA 1NU8A 4S2UA 1H94A 3P0EA 2WZDA 1A4XA 2IXTA 2BMFA 4D0SA 3MCWA 3UPTA 2Z3WA 2ZRLA 3RUIA 3SYNA 3DL7A 2PT5A 3HY6A 4Y6OA 1QFMA 3NO4A 4FEYA 4EI9A 4QHTA 4W9MC 2VKTA 5EXTA 1P5FA 4RJ2A 1D2HA 2CNBA 4F8JA 4G9EA 5AM4A 3F74A 5ALLA 2NTEA 1YQEA 3TG2A 2FWAA 1YA8A 5KNBD 4RJIA 3BTUA 4EJMA 5GJBA 5AXAA 1RI3A 1GPKA 1IY9A 2E6KA 3ECCA 5CXQA 1X80A 4UEKA 2I7CA 3A9VA 4BFXA 1CHDA 3F71A 1XK7A 5FPSA 2PLWA 5TX7A 4CV3A 1BVHA 3LRPA 2XEXA 1OYWA 5DYYA 4RC9A 1IHUA 3UWDA 3AIKA 5DH9A 1D1TA 1UMCA 5CVUA 3COPA 1DG9A 4AJEA 4ENPA 3FMPB 2G9QA 3LVQE 1CQJB 3R0ZA 4XDGA 1Z5OA 4DLBA 2XSZD 4EA7A 5EJMA 3TPZA 3KX2A 1OFUA 4GPZA 5KI6A 4BKOA 5ALDA 4JI2B 4L3OA 4I8XA 8OHMA 3ROZA 5FBQB 1E4EB 5CCBA 3ZGXA 1OI7A 2FHSA 5BUSA 4Y2PA 2W6NA 2ZQYA 5M7EA 1JMYA 3HZRA 1UBLS 2VH5R 4RANA 3SVLA 4NCJA 2YRXA 4Z86A 2WFAA 3PF8A 2C04A 3KLNA 4GOMD 3BULA 4QXOA 4RHEA 1H93A 1GPNA 1XZDA 4BNJA 4B3TB 2QTNA 4EHIA 2X7HA 3G2JA 1X7GA 3LGSA 5EMNA 1JILA 2HQOA 1E1QD 3C39A 4Q3CA 5AICA 4EA6A 5IT5A 4YASA 1A9QA 2JLSA 5KX5B 4RMNA 3N0VA 2IH4A 3GJRA 4N0EA 3VR5H 1QYIA 2ZB2A 5GTDA 2ZW9A 3AEQB 2C8JA 4MZDA 1R0XA 2YQZA 3LOUA 3F0TA 2J9FA 3B85A 4FHCA 1QGUA 2R48A 3DZCA 1XZGA 1CUUA 1ZEMA 4ID3A 3SU8A 3UJPA 4TTRA 4C89A 2QT0A 4CMIB 4CGYA 1K6IA 3R3SA 2JNWA 4XQEA 4RORA 4E7OA 1DCKA 3KZMA 3M4NA 1E79A 3N8DA 4DV1B 4V0RA 1IOZA 2BKEA 2IEGA 4LX0A 4OB6A 2NVOA 2YZMA 1E89A 3HV2A 3PL5A 3UJCA 1CW2B 4WJZA 4MYRA 3KIPA 1ZR2A 5K6AA 2WKPA 3MIZA 1E3TA 3TLCA 3LQQA 5EFOA 4FB4A 2OG2A 4AX8A 1F1JA 2GKGA 3NANA 1RFGE 4CR6A 3ZI4A 3RADC 1C14A 1UBRS 3JQ9A 3ODPA 5C5EA 3GCZA 5CFLA 3TUJC 1QDLB 2HCRA 1BIFA 4I5DA 3SEQA 2FK7A 1N2SA 5LDGA 1RBQA 1MAVA 1ZR4A 2B8TA 2IPMA 5CA0A 1SBTA 2BGIA 3IAEA 1KKMA 2Z8XA 4BNKA 4C6TB 1DAOA 4KMOA 5J2UB 2GGSA 1NW4A 1L6RA 3OQIB 3D59A 2VJPA 3ZZNA 2BDTA 3NONA 3O8OB 2H2WA 4CTNA 1E1NA 4B09A 4ZZ3A 4BUZA 2CHUA 5IF3A 1Q22A 1SB8A 4PLZA 2V5AA 2ADMA 3RSCA 5ALHA 5A4MS 4R9RA 2QU8A 2ZWOA 4RKWA 1G8FA 2CV0A 4XW2A 1W0KD 4RY0A 2O2CA 2VP9A 1QGDA 3BTVA 4I08A 1GUYA 3LUBA 3VR4H 3GP5A 3WK9A 4D2IA 4D92A 4DG8A 1T26A 1T9BA 5JZVA 2G36A 1VCOA 1UOQA 5TIIA 4CN8A 5FQOA 3NBFA 4I0WB 3RR2A 3T5CA 4EGCB 5HKKA 3GH1A 1HKHA 1C9MA 2XIQA 2BTOA 4PQYA 2J9ZB 3CGWA 2X5KO 3TW8B 3G59A 1U7UA 4WLOA 3TGLA 1YDFA 4DCCA 4NZNA 1NQUA 3PUYA 1YCFA 4PTYA 4JENA 5LA6F 1FNMA 2OG1A 3PEEA 2JJMA 4RXUA 3F6BX 3LCRA 5F7ZA 2P0YA 2Z6QA 3SQXA 1CQPA 4HDNA 1DV1A 3OMLA 1W0JA 2RH9B 3R3UA 1CJMA 1TB4A 1PN3A 1FFXB 3RKRA 1RRFA 1KO4A 1IZZA 1VL0A 3EY9A 1KA9H 3HO6A 2WWTA 3K05A 1L5HA 3NS7A 4NNOA 4QFMA 3SJCA 4ZZIA 3K16A 1QV6A 2B99A 1CBUA 1N2ZA 5EHQA 1LRLA 4H35A 1IN5A 5SZIA 4FQ8A 1WKBA 5ICGA 1SK9A 1V1RA 1KJNA 1UOEA 1YQDA 3MWGA 4KL8S 2KX7A 1A8SA 5ETJA 4M89A 4N48A 1W5TA 4K26A 3D8TA 2H1RA 1P2TA 3IR5A 4XARA 2E37A 3F6EX 2K4MA 1CZKA 1OXKB 3BVPA 3GEEA 1QRUA 1G2PA 1EFRD 4WVFA 4IGFA 4OGLA 3AHFA 3D8RA 1SMKA 5DM0A 3IE1A 3HB1A 1ATZA 3QTBA 4ZVMA 4A8TA 4MVJI 1ORTA 1KEWA 2JHAA 2KW5A 2WIKA 2YWBA 3H0EA 2I7DA 3I04A 5AJVB 4M1YA 1DRUA 1PT9A 4X41A 3NP9A 3RAPR 2O0MA 3L7MA 1FTGA 1HK7A 1KI8A 4JL6A 4LHWA 5G3YA 1XVAA 2DFKB 3DC7A 4R41A 5KS2A 2HSEA 2GB4A 3D0QA 3KQLA 1GCIA 1T4MA 1E0SA 2BFCA 4BVGA 4MP3A 3JARB 5REQB 1RM3A 4KHZA 4GVPA 1O08A 4RUKA 3DH0A 4JWKA 2ATIA 1ZL0A 5ALIA 3BMOA 1M2VB 4ARVA 4CWAA 1GU0A 2NZJA 1PWYE 3SR0A 4CG2A 4KQWA 1QBGA 2NWQA 3BMQA 1M0EA 4K9OA 3AY3A 3GPCA 3RLIA 4CKEA 1W30A 5KHAA 2BHSA 4C0XA 2VTVA 1VA4A 1RQXA 4EATA 4Z0TA 1H5NA 4RM3A 1HNNA 4MWTA 4ZXFA 5EIEA 2QWXA 4HNTA 5LVAA 4NENA 5ARBA 2JGFA 1E2HA 4MAMA 2XMZA 1J0BA 1GSHA 4IXNA 5J5AA 2YINC 3A2NA 3HR4A 4DWWA 4N47A 3H86A 1RJDA 1PS0A 3B20A 4TGLA 2PRZA 1NW6A 3KZKA 4PZZA 2W8BB 3CLUC 1U8ZA 3IP8A 3TR0A 2PS9A 1LA2A 1O95C 4FHZA 4LYYA 3UWMA 3H0KA 1Z0AA 2AZ4A 3PE3A 3RS5A 3W5CA 4R68A 5K7SA 5AK3A 5J23A 3OMXA 1G5FA 3BZWA 1GZ5A 3ZCRA 1H2AS 4UOEA 3QENA 2CYAA 2JHGA 3O0TA 4OXKA 2GI4A 4OB7A 3T9CA 3R6LA 3WK5A 5GGXA 2HEGA 1H66A 2XUZA 3EC1A 4JQYA 2RGCA 1OKKD 1FSSA 3EB9A 3VBEA 3GRUA 1XD2A 3G5MA 3GRRA 4Q1AA 2O7VA 4OA5A 3K6SB 3LAWA 2XXAB 1N6PA 3Q2KA 3C7KA 3BCHA 3DEIA 3CLKA 3HRKA 4BVLA 5LQMA 3NU1A 1NVFA 1PL8A 2FZVA 4NG5A 1XRJA 5AW4A 1Z45A 5ICEA 5JJCA 4JLSA 1FUYB 1U11A 3NHUA 1GG8A 1Z68A 3P9NA 1F2TA 2E5FA 3EH1A 5I7FA 4M9CA 3C3JA 3QVJA 5JAOA 2GAJA 1NSFA 1HFJA 3BMCB 2FPPA 4QWMA 5I9BA 3MOGA 2HUPA 2PVPA 2IBMA 3D43A 3TEFA 2C3MA 4PRKA 5KYNA 2SHKA 4TWIA 4S12A 4E3WA 1JFTA 3NPAA 3WWCA 1BDHA 1NF2A 3L40A 3GRPA 5DT9A 2G5TA 521PA 3LO5A 4C7OA 2IZ1A 3LHKA 1CJVC 2C0QA 3K1YA 4NCNA 3ZCXA 4YRMA 2WHPB 3ABOB 4J9UE 3D8BA 4IZ6A 1JPJA 3PFFA 3LGAA 3QE4A 4YJGA 2GCEA 3F6RA 3I0MA 1XTQA 2J8ZA 3ICVA 3DOHA 1M1XB 4PIMA 1Q1GA 3RS4A 1FFSA 4E2YA 3L79A 2PKYX 3MF4A 4W82A 4B4VA 1ZUNA 5GONF 4EVSA 1D4AA 1ZMBA 4G1EB 1Z5GA 3QA3E 3UK0A 1BDMA 2XZPA 5K8CA 3IUEA 2YZGA 3A4YA 1F9AA 4MARA 5IVDA 1GDHA 1O9HA 4BO4A 3PQ5A 1TAGA 1KSHA 1H05A 2W9XA 1OBOA 4JP8A 2YXLA 1G8SA 1K27A 4DGSA 5JNVA 3D3WA 3SXPA 5CLQA 2JKVA 5L3QA 3D81A 1X1BA 1KS2A 2BFMA 4TMYA 2IIPA 3AL3A 1L1EA 3VZCA 1OLUA 3FYSA 5JFGA 1Z6QA 2YWGA 4G3XA 5CEJA 4MQUA 4HVLA 3G1WA 4UTVA 4Q7EA 5ALVA 4DUYB 2BP7B 3CSSA 1CUGA 3GZNB 4UARA 3TLJA 1HDXA 1SEPA 3ROEA 2WTXA 4R1MA 1EQ2A 1S8NA 2J5KA 3ONFA 1JDBC 1PT8A 4PLCA 4RBNA 3DO6A 4Q3NA 2VT7A 1PS9A 5TVGA 3VZPA 5H5JA 1BE1A 1MOQA 4BCBA 3TSAA 3QI2A 4G9GA 4MAAA 3WGQA 3PHBE 1E79D 2I7XA 4IHJF 2X19A 1L4YA 3HEMA 5DN6A 1UBKS 1HDGO 3X1ZA 5I3CA 3UHJA 3TRFA 5EY5B 1YZKA 3UW3A 2RGRA 5GIOE 1Q19A 3LKZA 4LJ8A 1XHEA 3PA6A 4DBLE 1XDSA 1U99A 2WV7A 3PE6A 3PKJA 1R0BA 2W4MA 4RLQA 3K1JA 4G0MA 3S99A 4ENVA 4R9UC 2PUHA 1T6NA 3BF7A 1R1DA 5BQFA 2C5AA 1ZJWA 1MKYA 3I2IA 1KDYA 4F6RA 1Z7YA 1XI2A 2VCEA 2O2EA 3C8MA 4XPIA 1BE0A 3K5HA 1BX3A 4PZUA 4BVBA 1QZTA 1HG0A 4Q1EA 3EEOA 4JVOA 1YOBA 3I2GA 2HBRA 5HP4A 3A27A 3LA8A 2ATCA 5K6RA 4G09A 2ZIWB 2ORWA 1NXWA 1EPUA 1PTKA 1L8LA 1QZXA 1MQ8B 3KR9A 3BEDA 3OIWA 3LOPA 3OU6A 4F4DA 4A92A 4AJHA 1U2TA 1N0IA 2WT4A 1G6Q1 1SVIA 3BJRA 4OMDA 3PGXA 3TLMA 1E4OA 3VPDA 1E9VA 1YCGA 1XE3A 3CNNA 4K6MA 1XCBA 4ZGGA 1LSUA 4G5XA 4KX3A 4QOJA 3G49A 2CLSA 4QPCA 5T5QA 9GPBA 1PZGA 2NTNA 3J81k 1BS9A 5K4GA 1Y1SA 1E98A 1W4AA 1JLRA 3W5HA 1KIFA 1LH0A 2WSLA 4PW0A 4PPYA 3V00A 1OH5A 2G71A 4AX4A 3PVZA 1AGNA 3GLRA 5HKKD 2YWFA 1W4LA 4F12A 4FFOA 4PE5B 1U9IA 4J4HA 4KWHA 4YI3A 1X8XA 1A7AA 5K9ZA 1RHJA 3S1LA 2PT7A 2H59A 5DK6A 4H15A 4MW5A 5H3HA 3W04A 2ZS7A 2EJBA 3DQQA 1A2OA 2IYVA 1U04A 1UT8A 5JQGB 3WR5A 1ZN7A 2HHJA 3QLUC 4WN9A 3CW2A 2F43A 1QFZA 3NBZC 5D51S 3WMXA 2RHHA 5BSTA 1DB3A 1U7WA 1W0JD 2GBGA 2DPMA 1E9SA 5KNLA 2GD0A 2I1WA 2WD7A 1L5KA 1P4RA 3SQOA 1YR9A 3ZHCA 1T9KA 1Z62A 1WEHA 3OOYA 4PS1A 1CS4C 2DJ5A 3RTDA 1Y63A 4R71A 3LT1A 2BMAA 1DBWA 4JI1B 2JD2A 4Y1RB 5BRNA 5K01A 1QRTA 1EB8A 4ZEVA 5FF9A 2XUAA 2O14A 5EHIA 4H7JA 4KK3A 4QXPA 5DI3B 1XMPA 4GE0A 1U6KA 2WJVA 3AVYA 1G7RA 4L0DA 2PSFA 3RRYA 1EX9A 4K05A 2O48X 1ZX1A 1Y0BA 1K8RA 3HSKA 4R3WA 4ZQGA 3DCJA 5BT9A 1G5QA 1PQUA 2C3PA 1XNRB 2FSGA 4PGAA 1AKRA 1Y89A 4HZUA 2ROQA 3GDOA 3QKWA 3WGTA 2LBPA 1Z2CA 1N7HA 1U1IA 5FWYA 1I13A 3LK7A 4ZT3A 3R2JA 4LJ7A 1PJQA 1E7SA 1EA7A 3O3MB 4NAUA 4XKJA 5COQA 5HQ3B 5LKAA 4GS5A 2A5YB 3AQIA 3EIOA 3KWMA 1GFZA 2JVIA 1QYRA 4YCBA 1H4SA 3JQ7B 1JQKA 3CF0A 2JFVA 1QO9A 5EXDA 4ND8A 3U9TA 3WL4A 4EYKA 1FFWA 4OM8A 1Z4MA 5K2MA 5AJHA 5KOHB 1UIMA 4RVDA 5IG2A 3CN7A 1ZCBA 3MOIA 2WIDA 5CB6A 1V8PA 3QEAZ 1QKJA 4XLTA 5DKFA 1GKLA 3C5HA 3GJTA 3GRAA 3E7PA 3IAM6