2FG6C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
321
structure length
321
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ornithine carbamoyltransferase
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 114
structure length 321
sequence length 321
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg6C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg6C01
3L02A 2EF0A 1RAHA 1TU0A 4NF2A 2G7MC 1C9YA 2FG6C 3M4JA 3SDSA 1FVOA 2BE9A 4KGXA 1EKXA 2A0FA 8ATCA 3KZKA 1FB5A 1RAEA 1AT1A 1XJWA 3GD5A 4KGZA 5ILQA 1RABA 2YFKA 4F04A 1EZZA 1ACMA 1ORTA 4IV5A 2FZGA 3Q98A 3E2PA 5AT1A 3KZMA 3GRFA 3KZNA 1TUGA 4EKNB 4ANFA 3CSUA 3M4NA 4H31A 4A8TA 1DXHA 3KZOA 1ZA1A 1NBEA 4FYWA 4AMUA 4JQOA 5G1PA 1R0BA 6AT1A 1I5OA 5G1NA 1ZA2A 1R0CA 4FYXA 3NPMA 1RAIA 1PG5A 4E2FA 4JHXA 2AIRA 3TXXA 3D7SA 4KH1A 2FZKA 1SKUA 2W37A 1EP9A 4F2GA 3R7DA 2QG9A 1RAAA 4FYVA 3R7FA 3D6NB 1RACA 3AT1A 1RAGA 2RGWA 2ATCA 4A8PA 4AM8A 3L06A 2H3EA 1Q95A 1RAFA 1DUVG 1A1SA 3L05A 7AT1A 1F1BA 1D09A 4OH7A 1AKMA 4WTOA 4KWTA 3L04A 3MPUA 5G1OA 3R7LA 4KGVA 2P2GA 2FG7C 4JFRA 1OTHA 2OTCA 4A8HA 1ML4A 3UPDA 1TTHA 3LXMA 4FYYA 3M5DA 1VLVA 2BE7A 4EP1A 8AT1A 3M5CA 4AT1A 2HSEA 3TPFA 1RADA 2AT1A 2IPOA 4KH0A 1JS1X 4BJHB 2I6UA 1PVVA 9ATCA 2QGFA 2FZCA 3KZCA
chains in the Genus database with same CATH superfamily
3LX6A 4Z49A 3PNVA 4B2IA 2X76A 4HEJA 4ZOBA 2CMFA 1JWLA 1INLA 1B8VA 2W4QA 5TF0A 1ZIOA 3LT1A 2Q6KA 1KMQA 5FO1A 3T7AA 1PJZA 1U31A 3AUXA 3ZKWB 5CLLA 3OM9A 4CU5A 2Z56A 4FNGA 4L3WA 1E79D 1GPBA 5AWFC 3PUYA 1YKGA 4BQIA 4QUDA 1UAYA 3C4QA 2AI2A 3QW4B 2OQVA 4QM6A 3W9BA 3VNQA 4D5GA 4D42A 3WADA 2WMDA 2HD4A 3KOXA 4E0BA 1Q1AA 1DVRA 4UEJA 3U0BA 5J2TB 1HG0A 1TM1E 1TYCA 1CQIA 3OKAA 3PQ6A 3EW9A 4A0QA 1Q5PA 4A0HA 2ZPAA 2G1KA 4GMKA 4JB2A 3KJIA 1U04A 4KLRA 3UUGA 4D3FA 4LHWA 4D9NA 2WR8A 3BK7A 1MVNA 3I72A 1GUDA 2A9PA 3N0WA 3PNLA 2IKQA 3E23A 3SSOA 3ZWDA 5BNZA 3M9WA 3FLMA 1H1DA 3AK4A 4WXMA 2YVLA 4TX1A 3R8XA 1HOTA 1P2DA 2G28A 2Q4BA 3PF8A 1ZR4A 2O8EA 4O59O 4MAFA 2QM0A 3O03A 3RWBA 2HMSA 1P3Y1 1N6LA 2XCRB 1RXSA 1AXEA 5FV4A 1GNSA 1Q92A 1LBHA 2YHIB 5G1PA 3PF9A 5E1MA 4IDEA 2C7PA 3B53X 2JI8A 3DE1X 3BIJA 4HSEA 5EIHA 4A73A 4YX9A 2IHJA 1JZTA 3UC9A 3H87A 1PG5A 3WGIA 4D3YA 1T2UA 2AW5A 4TLEA 5IF9A 1JJAA 5L9AA 3LX4A 2UZ0A 4TT8A 3K2QA 4HB3A 1CK4A 4OHXA 4U7WA 4D0NA 3FBTA 3WLSA 4KPYA 2CJXA 1AGRA 1JH9A 5JT1A 5FHQA 1XQXA 2ZZMA 4FYHA 1LJUA 4M4SA 4PCLA 4PE5B 4I5FA 1NJSA 2IYRA 1BFDA 4QX6A 4X85A 4KFTA 1XPUA 3T9AA 3C3JA 4OQ4A 2H9YA 3I6MA 3P0EA 1RYYA 4P93A 2P2DA 1DL5A 4LYAA 1NUSA 4WY8A 4G01B 3V8EA 3ZWAA 1I3LA 1VG1A 4NAHA 4NESA 4Z7NB 1N5DA 2DLDA 2QTRA 2ZRBA 4LPKA 4R1PA 5DNWA 4C78A 3ZVKA 1YC2A 2AR7A 3KB8A 3IRVA 4GE0A 3WL4A 1ZKMA 4OSPA 3UGTA 2R5FA 2GF2A 4X6UA 3V4LA 3AP3A 3NTOA 3QVOA 4JOBA 5F3RA 3TWOA 4P0QB 4GMHA 2JCSA 1PZHA 4TMXA 1L5KA 5BN3A 1Y8QB 1XA4A 5CM8B 3ER8A 2UYHA 1J25A 3HYNA 1O94D 3UMJA 1GPUA 2CJWB 2Q3LA 2P6OA 5K3OA 4EHDA 2NZYA 3DFFA 1IBMB 1E58A 1UM9B 4MCJA 5H0IA 3TW6A 1AKNA 2G08A 5DM2A 2VHXA 2QRPA 3H13A 3RWMB 3T9CA 3QUQA 2HQOA 3UHPA 2CYBA 2VKQA 3W3AA 5DISB 2XVAA 4BJHB 3CLUD 1JJ7A 4ENUA 1IAVA 3C87A 1JFRA 1RYBA 1U3GA 1O58A 3N28A 4RM2A 1KSHA 2VSOA 3DLIA 3CWCA 3TAXA 4F4UA 1VL2A 1MO3A 1W5AA 3HBNA 5FNZA 2AG0A 1E5LA 1JLLB 2HNBA 2ALJA 2D1TA 5DTJA 5TLSA 4MWDA 2MU1A 2NZJA 4Q6BA 5F1PA 3W9UA 1AZTA 1T9DA 3E9QA 1ADCA 5IKMA 2LDBA 3O8CA 2IF2A 4LGYA 2B25A 2JATA 4WXYB 1ACLA 3WL6A 4D8WA 3H1GA 1QP7A 1N33B 2HMYB 1A9PA 3V4RA 1USKA 1XU9A 4DLKA 1QHGA 1C30B 5B37A 4Z7JA 5JAPA 3OKCA 3L7CA 4CMEC 2VTDA 2AR9A 4M7RA 5C53B 3EQ9A 2D5AA 1OBOA 2RHCA 3NKLA 2O2DA 4KMMA 3PKIA 1RIIA 3OE7A 2RHTA 1GA4A 1KI8A 3N9IA 3PUVA 3H4VA 3I5MA 4Y67A 2Q5IA 3OCUA 3CLHA 1CYEA 3N1UA 2PLFA 2VDJA 1USWA 1BXRB 2GZAA 3CBQA 4KXFB 5CYPA 1KK0A 1D2GA 1HO3A 3MOGA 1YH3A 2JAHA 5IDQA 4EHBA 3BGOS 1LPOA 3HXKA 3B12A 5FWXA 2FDCA 4JP5A 4ZU3A 3MOSA 4UU1A 3P9IA 1AKTA 4TLAA 4BFWA 1I1QB 1ONPA 1HX7A 1KH2A 2UYYA 3VTZA 1BX3A 3W5VA 4ZZ2A 4CT5A 3ERCA 5TQ0B 1HYQA 1ORIA 1JILA 1LLQA 2GFQA 2M1ZA 3H05A 3CNQS 3OQNA 1Z6ZA 4BNDA 4YMUA 1Z62A 1X8XA 4GOND 3A31A 3F7OA 3QVLA 2NUAB 2I3DA 5D84A 1X9IA 1TX4B 2PGJA 3JX9A 4OB8A 2P69A 4IJWA 2GN8A 3AY0A 3DKVA 1W52X 4GPAA 3ZWPA 2XLCA 1W4AA 4ZZ1A 1JSCA 4HX9A 2O8NA 4WKPA 4B3CA 2FUG1 2ZBVA 3U2QA 1XZAA 1N2EA 4GPTA 1X7XB 1FZTA 1RAGA 1XZBA 4IRUB 4BO9A 2PUDA 3VR5D 3OZFA 1QYDA 2WIBA 4AUKA 5JJBA 1AIPA 3B9PA 5M29A 3FROA 2P1RA 2XCUA 4B47A 3LK7A 1NLZA 3PGMA 5JAOA 1C1XB 4YV7A 4EHNA 4Y9SA 5DO9A 4E4RA 1YJQA 2XDWA 3EIXA 1VSUA 4N8DA 4BMNA 3AHHA 2I1QA 3I4CA 2NO0A 1P4JA 3PRYA 3AUFA 1PBNA 2EKZA 3EIEA 4WN3A 3DLAA 1QIIA 3FHLA 4RZHA 2GT1A 2J3IA 1D2RA 3E70C 3WGUA 2F67A 4OMDA 1Y0BA 3GT7A 3VVLA 4JH0A 1ZVVA 2WJIA 1Y1KE 2Z9DA 2GXSA 3B51X 4HZUA 2H9IA 3ZGYA 1UBKS 4YRLA 4I55A 1K7CA 4P8RA 2LCQA 4EHJA 1F8GA 2R62A 1NQAO 4OXNA 4EVIA 3ANSA 1V4BA 4WBNF 3DB1A 2G36A 1P29A 4LYFA 1IE3A 1IOLA 2QT0A 3HLTA 3DMPA 4FNMA 3DOIA 1KO5A 4YA6A 2IXGA 5H16A 2XHZA 2AK2A 4BN4A 4IVNA 1SWWA 2HK7A 3LHKA 3ZXXA 1E77A 2YH2A 1YS7A 1V1MB 3FYUB 2HADA 5FTMA 3CPJB 3FUVA 4WZAA 5JLAA 1J5XA 3U9SA 5HE8A 4RKEA 2FFBA 1NL3A 3KQQA 4U5XA 1ZH0A 1XLTA 2G17A 2ZQZA 3E22A 2UZ4A 5JEDA 4M53A 3CPEA 4WZAE 5SZJA 3V8RA 2ZSKA 4RX1A 1II8B 3SJUA 3MYRA 5I4CA 3OTQA 1MO5A 3BX1A 3VDQA 3NDIA 2OHOA 1FTSA 1X7HA 2O8FB 4FFNA 4F4IA 3WLHA 5C9ZA 5AUQA 2R8RA 1II9A 2QUJA 2O3QA 4V02A 4FGUA 4F4JA 2K4MA 2JIBA 2GJ9A 3STYA 3EIHA 2FI1A 1JA0A 1XMOB 1I0ZA 4G63A 4FEAA 4ZP1A 3DO8A 3I1FA 5I5GA 1PSZA 3HP1A 5KYWB 2XUAA 3AR5A 4JU8A 4PNHA 3ZJ4A 3JS5A 2WWWA 5IT0A 1UKEA 1HT0A 1NMZA 2WUWE 1SCKA 4GH5A 2YOGA 3DYBA 3C4VA 2ZWOA 3IO5A 3QNMA 4KIWA 4RORA 4U0KA 3EYAA 3ZXUB 4B82A 3KT3A 4DDVA 4PG7A 4W5QA 4S3MA 1TYEB 3WK8A 4OLFA 5HF5A 1T4DA 2F1RA 5IAEA 4WXHA 5KZMB 1BZYA 3AR9A 4JOQA 3S7ZA 4DIOA 1MAUA 2JAOA 2NVOA 2R1TB 2NPIA 1DV1A 2W2PA 2XKAA 3CH4B 3FR8A 4L4SA 4TKZA 3RC9A 3TLXA 2J3MA 3K6SA 1KXZA 2VK8A 1C80A 4OD0A 1JEYA 1VI6A 2J85A 2BHRA 4OQFA 1L5HB 3IAM1 4MKXA 3ZCVA 2AFIA 1TVEA 2QQFA 3U6KA 3NEAA 2H7YA 2DJ5A 5ADWA 3S8YA 1XXLA 1FUEA 4NMXB 4YMTA 3GLRA 1G20A 1PG2A 1DG1G 2AFIE 2B5OA 2CLHB 2XQGA 3OEEA 5HE9A 1ADYA 4B80A 4C7OA 3T1OA 4UTVA 1RWVA 1G20E 3TQQA 4AJNA 3FIUA 1FRQA 1VE5A 1X70A 1PL0A 2I9PA 2XAAA 2C54A 3AHJA 1LH0A 3K94A 1C9EA 1IOZA 3TLAA 3AY7A 2C57A 2DQ4A 4CUZA 4H18A 1VOTA 3NC1C 3ET5A 3GP5A 3FNBA 2VL7A 3GVCA 1CY8A 2TMGA 4DMGA 2QYTA 3R4CA 2C59A 2NXEA 2FX2A 3BIWA 1C0LA 1YL5A 5CH8A 3VKGA 3QITA 4DHWA 3AR6A 2NXJA 1G5TA 3D6AA 1FU7A 4OFXA 1DO8A 2Q5EA 4ERXA 2ZS7A 3PJDA 4AZ0A 4I5EA 4KV9A 1Z47A 2PSSA 2Q28A 1JQKA 2HF9A 3IYLW 4DL9A 4DMFA 2J67A 1NM5C 1B23P 3DUFB 4RPLA 4I8IA 3FWKA 1W19A 2AGVA 2OV4A 3HBJA 4RLSA 4ESEA 4LHVA 4XRRA 2C7BA 2VATA 1BX0A 2NSYA 5JBIA 1L4FA 4LJYA 4Y6SA 5DSXA 4BY9E 1DKLA 2IHYA 1IWOA 1KNXA 4GLJA 3C3CA 1HL3A 3H6HA 5CB4B 5FWNA 3JYPA 3WHIA 4RGBA 4DUYB 4HFMA 3ZIDA 2RMKA 1KI9A 1EE9A 2AVNA 2MDTA 2QL9A 1Q0LA 1T9HA 3IIIA 3A3KA 4TTVA 4JJKA 4FVTA 1YVEI 4CZ2A 3TG2A 3WQSB 4Q3OA 2CMKA 2IZ6A 2JASA 3RIMA 4YUWA 4LF4B 1SY7A 5LBUA 4XLZA 2R8YA 3AZQA 4NNPA 4I14A 1FJHA 5JAZA 2R96A 1OXSC 5DLPA 1A8UA 7MHTA 1D9XA 4EG8A 4Q3KA 2OUKA 1SBQA 4MRAA 4MICA 2EW1A 2H63A 4HLQB 4N7JA 2ZKLA 1YZKA 2ZTSA 1CRZA 3ELBA 3I05A 4HADA 1ZM2A 1TFUA 2GJ4A 2Q9AA 4E5SA 4HXFB 3BK2A 4O3FA 4NABA 5JDCC 3TQIA 2IYXA 1RYEA 4N03A 1XD2B 2CLFB 4EVRA 4M54A 1WA5A 5CLIA 4MMXB 5KWJA 1E7MA 1WB4A 2NUTB 3Q0TA 4WY2A 1U9CA 1ZAKA 5HF9A 4J29A 4M1MA 4R1NA 1KC1A 1RJ9B 3M83A 3KT0A 4E31A 1R0BA 1EVZA 3GMTA 1PZMA 4J0DA 3PICA 2JBHA 4DREA 3DH0A 1WUJS 4J0IA 3KXDA 1RPJA 4E2FA 4YJ2F 1H6AA 4XGQA 1W581 3LM8A 3DOJA 4KZPA 5JIBA 2V7XA 4M9XA 1H4SA 2C5EA 4AJOA 2NZ8A 3EDQA 5C34B 3RS3A 1BE1A 1L4UA 2X0KA 1OI3A 2Y77A 5AFSA 1VKNA 4DPLA 5F12A 3PQEA 4CV1A 1LFAA 4OI0A 3UFXB 4GPEA 3EF3A 5KX5A 3RRXA 2DLCX 3AUAA 4I3GA 2YNMD 4YRPA 1H3EA 1T6ZA 1SVLA 1GPLA 1N0WA 5BQ5A 2I71A 1JKJA 2DKNA 4CTKA 2BFMA 1XB2A 2Z09A 2F59A 4HS4A 4MTLA 2FN3A 2XA2A 3RYFB 4D9CA 2CFCA 1SIWA 2Q9CA 2WJVA 1EJ0A 4B4KA 2NTJA 4W9MC 2GD0A 5IZCC 1ESEA 1GPH1 1W48A 1TZ2A 4GLLA 1AKMA 2YRXA 4R1QA 5C7OO 3W5DA 2QDXA 1NAIA 1QO9A 1PTJC 1WHSB 3HTXA 1VHTA 2QS9A 3OCCA 4B4DA 4AS1A 3AFHA 2F48A 3IXLA 3FZQA 4GF5A 2J87A 1JIIA 1UDWA 1P7PA 4P58A 3UPDA 5B5SA 2PUGA 3UT5B 4FNOA 2O2HA 4I4TA 4RLQA 2NW6A 2BR5A 3VR6D 1U2EA 4C7KA 4ZI7F 3OZUA 3ADOA 2I78A 2P79A 1TJ5A 2CCGA 1KI2A 1Q15A 2J1LA 3D4BA 3F0TA 3RGGA 4AB1A 3QVTA 5K3FB 4CEJB 3TTWA 1WDLA 2GD1O 1R6VA 4GMGA 3H8VA 1KE2A 1HMYA 2Q4EA 2QY9A 2ZTHA 3L6CA 1KY3A 2XADA 1OAAA 4R51A 2XB6A 1Y48E 1JB1A 3C41J 1KQPA 2XKBA 1KVRA 2ICAA 2VK2A 3U4AA 3EXIA 3VISA 4EPTA 3OQIB 2QQ0A 2OZLA 4C0QC 5A9RA 4X3CA 4ENTA 2YQ5A 4H7FA 5H5JA 1XAHA 1LSSA 2EZUA 2BHNA 4RKFA 4EGFA 4F96A 3OUTA 4EK9A 1YB6A 1E96A 1OI7A 1ULTA 3A26A 5HKAA 2C2WA 2VNKA 1E2GA 5JXHA 1GAJA 3D8HA 4V3BA 5JXJA 4QEKA 5IU6A 4S1VA 3PFHA 2IYLD 4L08A 4DJJA 1PUJA 1ZIXA 1GZ3A 1N4DA 3SYNA 5KO2A 5IXJA 4DJEC 3B1FA 1C9MA 4BV3A 1CQZA 5BMVA 4CIAA 1NN0A 1FEZA 2VHUA 1VGRA 3OWHA 1EFPB 2VQFB 4D7AA 6ADHA 2JC3A 3T0IA 2BL4A 5LXTA 4NPAA 1TQDA 2HBYA 5T6MA 3K70D 1BU8A 1EUYA 1T5BA 1XLWA 4HFJA 2XVXA 1FTNA 4LXUA 5CXXA 1W1WA 3EH2A 4JYPA 1D0VA 2PE5A 4ZI5A 3QEJA 1S5PA 3V6MA 3M1AA 3BIOA 1EAYA 1H2XA 3BTOA 2X7XA 1BOOA 2BM1A 3D5TA 1CDOA 3BK1A 3RODA 5J1SB 2V9ZA 1ELOA 3QYPA 4AIRA 5A0TA 3LKDA 4CDRA 4OM8A 4CQMB 4GVLA 3LSTA 3IFSA 3IAS6 3MLBA 5H1YA 3RUFA 3MMPA 2H2WA 2QN8A 1Z68A 2IHTA 3H16A 5AXBA 5LZ5A 4D41A 2AX3A 1WTCA 2H2GA 4ZK6A 1J0BA 1KZ9A 1OBVA 3O4GA 5FQOA 3H17A 3JAWA 2G1PA 4KHPB 2P5SA 5C1PA 4A82A 3ROGA 5IG2A 2ZUUA 3I2HA 4FYVA 1E6CA 2IH2A 1MT0A 5BN5B 5EP2A 3JTMA 4U7GA 2RC5A 1VL6A 4HLCA 2Y6VA 3M3DA 2QTNA 4EYEA 4XDGA 2O8DA 4JP8A 2G9VA 4C2UA 2YZMA 2YY6A 1QQAA 3DEYX 2H29A 4R41A 4EFMA 3WGJA 2Q2WA 1PQUA 1XN1A 1ZLYA 4LJSA 3I9V6 3FDZB 4UARA 4KRXA 4O4HA 5FYDA 2KX7A 1FNDA 5TGZA 1Z7GA 1Q20A 4MWBA 1N6NA 1KY4A 2WAAA 5JDIC 4MB6A 4JC0A 5SYNA 3B52X 3T94A 4J4BA 2JRLA 5JNLA 3RASA 4Z4GA 1D5WA 3ACDA 3RRMA 1VJCA 1GPWB 3NEJA 5TNXA 5J3JA 2BMAA 3K0CC 3LOPA 1U1CA 5AW9A 4CGYA 3ER9A 1T1IA 3GO4A 4IKPA 1XJ0A 4Z53A 1IOWA 3GLUA 5K3SA 1XRRA 4KB5A 1F20A 1YZLA 3NBMA 1O6ZA 2GBCA 1NWHA 2WWFA 2XCQA 3AX6A 3HC7A 3HB5X 5U4QA 4ALIA 4W5TA 4OLBA 5HHTA 1T1SA 2VPZA 2VPTA 3GXBA 3ZY4A 1YBVA 4F5DA 4S05A 1DC7A 3CEPB 3RYCA 4O3MA 4DC9A 3VPHA 3FY4A 3C1OA 3VPCA 3M4ZA 5DX0A 4TM8A 4XSVA 1KEWA 3E7PA 3SHTA 1BROA 1V5WA 3WLOA 1MN6A 4HQRA 1SCAA 3UMSA 2HRDA 3QA9A 1BWSA 1TF2A 4NENB 2XNKA 2IP4A 3QXCA 5IC5A 2ZE6A 1TU0A 3LPNA 1SRRA 4BIIA 3KB1A 5JBNA 2AJBA 4GI3A 3TB6A 4I50B 2WU1A 1SURA 2QE6A 3HN6A 1NOIA 3PYLA 2G9NA 2J9GA 1OBCA 1RI2A 4L02A 1QQ6A 3L7LA 3KR2A 1KBQA 3A4TA 4QRIA 1OD6A 2B1JA 1I1OA 4UHCA 3ABIA 5EQDA 4ZCSA 2ZFUA 1OVMA 2FSPA 1VECA 4KBGA 3A2NA 2NU7A 4LQLA 4GKVA 3FGZA 1NULA 1PK8A 3RM3A 1C1DA 4MYSA 5SY4A 4X93A 2DQYA 3CF6R 3BWYA 3EY9A 3W4IA 5F51A 4KW7A 1X0XA 3C5HA 5ICGA 1EWVA 2NADA 4YRJA 3NCHA 3FBGA 1C4OA 3W79A 4PG8A 4JROA 5CDUA 4BP8A 1HT2E 5KEIA 1JIKA 3CRQA 3E8SA 1Y34E 1F9EA 4DNPA 3SF8B 1QF6A 2NT3A 2GA9A 2Z08A 5CBPB 4L2IA 3LUAA 3NJ8A 5T3UA 1S3SA 4IV0A 3WL7A 3P27A 3ZD9A 3UMYA 4P34A 3BICA 4L6AA 4YJFA 2P35A 3E3AA 1QFZA 2AXQA 4LYYA 4Z86A 4R7TA 3L8DA 2EP5A 2HRCA 2VPYA 3AR7A 3FR7A 2CVHA 1EGVB 4F2HA 1QPBA 2GCNA 2DQKA 1L7VC 2AKEA 4MP6A 4XQCA 1E79A 1GTVA 2GJAA 3PQDA 5C81A 5CCBA 4MCIA 4C9BA 3ONNA 4LF9B 5L53A 1Z2AA 3VYSB 5F1YA 1LQTA 2P6MA 5A71A 1T8RA 4JUDX 3AP2A 3MB8A 2C83A 3M34A 1Z7WA 1YASA 3UB2A 5BWCA 4UE6A 2WLSA 3KQTA 5BSVA 1ZMRA 2HDOA 2O0KA 2YXEA 4DMCA 5BSRA 1E5TA 2BMEA 5A7GA 4PTYA 3IR7A 1UBOS 1HI9A 4IDGA 5G4LA 4EG3A 1CQIB 1TA0A 4FC6A 2XMCA 3CKMA 1H5NA 4IPTA 3AF5A 5EKSA 3DTTA 1A96A 3UJBA 3ANXA 3EUEA 1JLRA 1DWUA 1SU6A 1EZ1A 1LBQA 2C84A 1YI1A 2AQHA 2V45A 3MTJA 1HDOA 1W73A 3HR7A 2FSHA 4JKOA 4O0LA 5LD2B 1JR6A 3QOWA 3UHJA 4RKQA 1BC5A 2QTWB 6PFKA 3KDSE 2O8EB 1XTUA 1R00A 3DBOB 1L4HA 3C15C 2AHRA 1BD3A 4KKVA 5THXA 2ZWMA 2B94A 3TN7A 4QTYA 4LDPA 1P19A 4X6LA 2OHVA 3S1SA 4XJVA 1T6BY 3L04A 2YYZA 1ZG3A 1DMSA 1PGNA 2JGJA 3DMTC 3IBFA 3KTFA 4N82A 5CMLA 3FKSD 3U49A 3WZLA 3EG5A 1KDTA 2VDVE 1TQ8A 2JGLA 2Q9BA 2VI5A 2GPWA 4D99A 2VP2A 4P4LA 1N75A 2VHEA 3I04A 1VMEA 2FLKA 1CRLA 3IAS1 4KR0A 3LVQE 1EK0A 4MVJH 4RTKA 3BQMB 3SBXA 2TECE 3CKLA 1YBMA 1FTGA 1V95A 3QLEA 2WA2A 1GZ5A 5LU9A 3JYHA 1C8LA 1P2FA 1TDJA 3C1AA 3GMDA 3OM1A 4M38A 2IH4A 1ZXLA 1OPRA 3NW9A 4BLVA 2P7HA 2GESA 1SC9A 1R6BX 4F5EA 1FUKA 4R9SA 2QVGA 1ZIYA 4YK7A 5J5CA 3ROEA 3L5KA 1HFEL 4I19A 4GXTA 2X58A 3DAGA 3RQIA 3WRWA 2DETA 2AJTA 1H23A 3QU9A 4HXGA 1K7FB 4KDRA 2F1KA 3F7NA 2D4AA 2IDMA 2DPGA 3LDHA 3PNMA 2PMFA 1T0BA 4W6QA 2GYYA 3W2IA 4B75A 3I9V1 3NJRA 2PS9A 4JJIA 3IIMA 4R2MA 4J0KA 5BUZA 3A11A 5L7WA 1JYFA 3E9RA 3OIVA 2O3TA 1Z34A 5EESA 1CJKC 1TJYA 5J4VA 1IY0A 1ZGGA 1O94A 2GKGA 2V54A 3C8HA 2HTFA 3HVKA 3WISA 3ADCA 3CUTA 3NH6A 1E3LA 2OHXA 2W83A 4PRLA 5CK5A 3FHOA 4W5JA 3O82A 2FN4A 3QPBA 5EKUA 5HP4A 4WK4B 2AEJA 1RRKA 1SEPA 2Q8QA 1M7BA 4AXXA 2GBLA 2AZ4A 4LJ8A 4DMHA 1GZSA 3ZI4A 2WWYA 4OXRA 3CN9A 3EQ8A 4MK4A 1RJWA 4MVXA 1QAMA 5E3IA 5EXPA 1FDWA 5K4AA 2DBYA 5KSPA 8OHMA 3MBOA 4ZO8A 4B44A 5K8TA 3B70A 5CB0A 3THRA 1C8KA 4GP6A 4NG4A 5KJ1A 1ZZEA 4KAXA 4KVGA 2X5OA 521PA 2Y8EA 4ACBA 3UBMA 4K05A 4FDMA 1B0AA 1TL7C 4KWCA 2WHEA 2YX1A 4KVFA 3PVSA 2GAIA 2Q46A 3EGXA 6REQA 3S1AA 5JISA 3DO6A 1ZJWA 4HDCA 3PNOA 5LZ7A 2QZZA 4BO6A 1JFFA 2P1ZA 4J75A 1P81A 3WBFA 4B32A 5KINB 4B6GA 2P11A 4DT1A 1NNEA 3IDZA 5K6AA 1FVXA 3LFTA 3TOZA 3QPCA 4R0VA 5T4EA 3G9XA 1L8AA 1GR1A 3FTQA 1J7KA 1EP9A 4KLZA 3L9WA 3LWBA 4JJ8A 4RMGA 5IHXA 3ZHYA 2IRWA 4HN9A 4PFQA 1MDFA 2F17A 3L1KA 5CHYA 4H1VA 3R8CA 3ZHXA 3ABOB 3WLLA 1IY1A 4URYR 2J5QA 1E2BA 1UJMA 1ULBA 1ZN8A 1H1TA 3ZE8A 1KAQA 4L3OA 4I5IA 3PNSA 1B76A 1IB6A 1IDOA 1ATZA 1R9GA 2Q2NA 1EJ2A 4HDMA 4YREA 4ASUD 4EGJA 4UREA 3NBFA 2WIGA 2DAPA 3K0EA 1KDVA 2FVYA 4LBVA 4JVSB 3DE2X 3NI2A 1XZPA 1EGHA 3SBEA 1Z6XA 5BR4A 2X14A 4G0NA 1Y81A 2SECE 3I2YX 3LG2A 4WEQA 3HVHA 5I7AA 4B40A 1S8OA 3D2LA 3PDJA 4EY5A 1SZJG 4H7PA 1SVKA 2NYVA 1D09A 4RESA 2IFTA 4A6EA 2PLAA 4FIDA 2YC4C 2GBGA 1U02A 1SAYA 3Q9NA 5FPTA 1O9HA 2KS6A 4Z3DA 3U4GA 3T4XA 1KQOA 4QOFA 5C3UA 8ABPA 2CHUA 4A8HA 4Q3NA 1Y3CE 3OLYA 1DXOA 4DLLA 2XSZD 1PEAA 3EGDA 3T3IA 4EPXA 4BNDB 2HDHA 4NONA 1S2DA 3NGLA 2XKJE 1Q11A 4DLTA 1BMTA 4F9FA 4TL8A 4EMBA 1VBMA 2ZJ5A 2BAGA 1W9MA 2HREA 5K2OA 2B21A 1CR0A 1B8PA 5L7TA 4J1QA 2YS6A 3OQ6A 5K0FA 2ZRDA 3OAAD 5EKTA 3N8GA 3VR5A 1LBSA 3QPDA 4GGPA 4DHEA 3OX2A 1IZ8A 2A5YB 3ZTYA 2OMKA 3A6LA 3PEVA 1DAOA 5JVDF 3HCRA 1GDTA 2W6QA 2NYAA 1KU6A 5HA5A 2IWRA 2XR1A 3DCIA 4M0EA 1MJGA 4O4JF 1D2HA 3LNCA 1EVIA 2RHGB 1T3TA 1Z0DA 1CX9B 3A27A 5EOVA 1MUUA 4KGXA 2D5CA 1W0KD 4TWZA 3VZBA 4WZ6A 3SLRA 5MF6A 2Y0PA 2WNHA 2FP4A 1H69A 3UJ7A 4I1OA 4YAIA 1UIRA 1B6GA 4XUDA 4EB8A 1DE0A 3H1EA 2L42A 3M5WA 1K3UB 1IUPA 4AZ3B 1KRWA 5IT4A 5AQ1A 3IBYA 4NZPA 1T34A 3AFGA 1CUAA 2C58A 3V1UA 3S81A 2HWYA 1YDMA 2Q3CA 4HZUB 5JROA 3DDSA 2BLNA 3EC1A 4PYIA 4BVHA 4BLSA 3KWFA 5FBQB 1UT6A 1NJ2A 1T13A 4KO1S 4PGFA 3JQQA 3RTBA 5CDFE 3GLHE 4MW7A 5F98A 3WIDA 5C18A 2G88A 3ZTWA 2AG1A 3WGNA 4O1HA 2GVNA 3QBJA 2EFGA 3M8KA 1XXHA 4EG0A 2VF5X 2BFOA 2VP9A 3ER6A 3MRTA 3STUA 4GMFA 4B43A 3OU6A 4ON9A 1GQQA 2FW6A 3W06A 4BQQA 3FTDA 4MPPA 1VPEA 4LK2A 1GRCA 4WZAB 5E9AA 4ZJPA 4QO7A 2WZBA 4KEAA 4PZ9A 1V8PA 2MJLA 3E22B 5AM1A 2BRUA 2EW2A 3BB1A 3MT0A 4ZOEA 1XCLA 4K81B 5DGCA 2DPHA 4FE7A 5CA0F 4ACAA 4PZ0A 1AHPA 3JAKA 4PM4A 4RTSA 1GTRA 4JT4A 4N54A 2J9YB 5LZ9A 4CV0A 5DNEA 5FPKA 4KI0A 2ZUVA 3E1SA 5HF6A 3DM9B 1IN6A 4IKEA 5JFTA 4NBKA 1OXKB 4AKIA 1WBBA 4FM9A 1I4LD 4YWHA 1RWNA 3PDHA 3T7KA 2ZAIA 1K0FA 2FCRA 4OHPA 1S2GA 2C5HA 1RU3A 5IAKA 1Z5UA 4KQ9A 3QE4A 2P41A 1NW9B 4JWKA 3DFZA 3VDXA 4O2RA 2LRHA 4P33A 1SHLA 4UBNA 3LL7A 1G291 1VPLA 2DP4E 1CLEA 4LOJA 4MW2A 4UTOA 1ODSA 3QF7A 3QWIA 5H70A 5DTMA 3PEEA 1JQJC 1O97D 1D5CA 4XVRA 4FZJA 5FNVA 1A7KA 5G3YA 3P0RA 5K0NA 2YWJA 3U37A 4XVCA 3C16C 4R31A 4C29A 1W5BA 2M32A 2P6UA 2X5NA 1CP3A 2Y93A 3DZ8A 1L5LA 3UJ8A 1CE8A 1BN7A 4MUHA 1LJLA 2FEXA 3SOZA 1ZN9A 2HOQA 3PNBA 4RVGA 2HQRA 4BN0A 1HE3A 5PGMA 4MA4A 4Y6PA 2WKQA 1UK8A 1Z8FA 4BZXA 4TQGA 1DC4A 1WJGA 1WXFA 3DKPA 3NOQA 3X1MA 1JEYB 1CVIA 1N34B 3TBKA 4L85A 2ZPTX 4L28A 1P5JA 2E48A 5CYOA 2AFIB 1TIBA 4JR0A 1UC8A 2P4QA 3IUMA 3JRWA 3EWAA 1L0BA 1IXYA 4RH1A 4Y7DA 4KX3A 4ZVPA 1NE2A 3E2MA 3AVXA 1G20B 1KZYC 1R1DA 3EDMA 2EP8A 3KE9A 2ZU0C 5AXDA 2OYRA 3TLEA 4F6LA 4Z54A 4C4YA 4O5OA 4WFIA 1ICEA 2GX6A 2VWHA 4Q7EA 1NR1A 2E89A 3EBOA 2ODNA 1OF1A 2DCUA 1NJFA 4C0SA 2RAPA 3BCHA 4BZQA 1W59A 1KSGA 3K1AA 3FTNA 2P8SA 3RVJA 3S99A 4B17A 2YVAA 5IAOA 2DHDA 2PG3A 4XGRA 2RHOA 2JGRA 3EODA 1A8SA 1GTL1 4XTRA 4AKSA 2IU4A 2O5EA 3W6UA 3AYZB 3NFRA 4Z4IA 1QYRA 4P1ZA 1YJCA 5EP3A 1IRIA 3BTSA 3W78A 2EL7A 3JQCA 4QTTB 2YFKA 4FMBB 4WCFA 1ZN7A 3L8GA 4AZ0B 3ITKA 1DIGA 3D5QA 5D5PA 1IULA 3P0IA 1TTTA 3EIUA 4C0KA 1LLUA 5DCYA 4K9RA 4GOLD 2ZG6A 1XUOA 1BGVA 3IE0A 2ZJAA 4UBMA 3THOA 4B33A 4YMVA 5CCEA 4ZT7A 4RTJA 4IWYA 3TAUA 1NDUA 7ABPA 1JN0A 2CVOA 3OIYA 1GO2A 3CINA 4B6SA 2LIPA 5I7OA 4FJ2A 3IA7A 3E5NA 1GN9A 3H5LA 1BMFD 3CEAA 3HACA 4NK5A 4Z9YA 3DEKA 4X97A 5FPPA 4D0LB 1OGIA 3Q1LA 3ESDA 3WP0A 3S55A 1KVTA 4RUKA 2XJ4A 4JKYA 5CUQA 5I47A 3H1AA 1PNVA 1DBPA 2I03A 4H7DA 1ZHHA 3L77A 3K2IA 5DIZA 1CETA 1PZEA 2J08A 1TQ4A 1XTPA 3A1DA 3KYJB 4JS0A 4RD2A 3CLRD 5AOVA 5BQOA 3WXMA 1GSHA 1FY2A 3DBHA 3MILA 3N76A 4ZIRA 2MSCB 1PQWA 2FWNA 3AV3A 1T8TA 4R1TA 3T38A 5AW3A 3O21A 2B7CA 1NUUA 4YN3A 1YZTA 2RGUA 1RACA 3HJCA 4B3FX 1GSAA 1M8FA 1BDJA 4XUEA 1NUAA 5A5DA 4UOEA 4NWIA 1J56A 3T3DA 2YMMA 3TX2A 1ZNXA 3GEDA 1E2PA 1UXKA 4PZUA 5A4JA 1PVDA 5TS2A 2ZB8A 3AH8A 1VJDA 2X1VA 1IJEA 3DE4X 3FE2A 5BY2A 2HAEA 5A9SB 5I4BA 4G5SA 4DILA 4F91B 3EOAI 4RHTA 2R0QC 3UPTA 1Z6QA 4MHTA 5IEBA 3CJRA 2UZ3A 4IIYA 4OQLA 4WD3A 4KQFA 5EZYF 4AVYA 3LYAA 1JPJA 5EKXA 4ABYA 3WLQA 4XEUA 3RF7A 3PJGA 1FFAA 4Q16A 1DDGA 5BSMA 1Q77A 2OGZA 4Z1OA 1E3WA 3IP8A 2ZYWX 4M0LA 2BCEA 4G3XA 4ZVNA 1ZO8A 3I37X 3G68A 4Q1VA 1BS9A 2PVPA 3FZGA 4YPVA 1ODLA 2DOKA 4ZREA 4RJJA 1TTHA 3V42A 5C52B 1XA0A 2JAXA 4E07A 4OXIA 1NIJA 3ELWA 4LECA 5H80A 4RYDA 2ZJFA 5D3KA 3GP8A 2A67A 3E9NA 4UMFA 3OFKA 3UPUA 4MKFA 3PL1A 1YR1A 1J9ZA 2F4VB 2ZE7A 3OBIA 4PBRA 3HNOA 3OZBA 1A71A 3OIWA 1NRWA 1QE0A 4WFJA 1GKYA 3H1BA 4M1ZA 1XVTA 2C2GA 1QHXA 2YNMA 3OWXA 1RHKA 4GPZA 1YVRA 3FWZA 2R8XA 1JW9B 4Y7CA 4C2BA 3KPVA 3V4FA 3WICA 5KX5B 3I61A 3RSGA 3SDSA 3BT7A 1FNNA 2W6ZA 4IEEA 3I32A 1U0HC 4WADA 3L1VA 1JKJB 2ODTX 2WB4A 3TIVA 3PQ2A 1RW4A 1WCXA 4DCPA 4DV7B 2XUQA 4XYLA 3PC4A 3U48A 2Z6VA 1XCPA 4PO1A 2J5BA 4QOHA 2H4ZA 5BV8A 2G77B 2C88A 4J49A 3A9WA 1BA3A 1TA9A 4MQBA 5E7QA 1CB0A 1XWFA 4X71A 1L8LA 3W2HA 3WGQA 1Y7IA 2JFUA 2BIFA 3LPMA 4JQSA 2JW5A 3RRFA 3ICOA 5EY5B 1PR4A 1YS6A 1YS4A 4EVSA 2IBMA 4PPQA 3EZNA 1MFZA 3N7TA 3V7WA 3OQHA 3VR6A 4E3WA 3U16A 1NNI1 4CHTA 3TZCA 4I4TB 3BH7A 3JQAB 1QHIA 3A6DA 2HWUA 4ZJZA 2Y99A 4XASA 3T3NA 3VTAA 2HHJA 2NVUA 3KKOA 3GGGA 1QPGA 2EKLA 3WAGA 4I9FA 4DR5B 3I2FA 2ZT5A 3R41A 1YZGA 3WHKA 5LA6A 4TLCA 1KHHA 2ZYVX 2I0FA 4BGVA 4DBLE 1ZH8A 4IIEA 5COQA 4UM7A 1G3QA 1D1SA 4F6CA 1A76A 1ILEA 3D0KA 4LWPA 3MJEA 5TQVA 4IR7A 3DBLA 1BTOA 1CQJB 1DKNA 4LSGA 1NVBA 3EMDA 4UM9D 1MXFA 3MSCA 3RB8A 4KN5A 4B76A 2UKDA 3KAJA 3EXIB 3PPWA 4KAJA 5A03A 1ZJ6A 2I7CA 5BQPA 1QCCA 2OZLB 2OAGA 3DZCA 2QTMA 2ZBFA 2FPIA 2OD9A 4IZOA 1JAYA 2Q1TA 1JDTA 3Q8XB 1EPUA 4LZPA 4CDNA 2ZRMA 4JASB 4NDNE 4ESOA 1T26A 1M5UA 2XYQA 1OWOA 2X19A 3EVAA 3GCGA 2D5IA 1KR2A 5FL7D 4UVDA 3URMA 4JYBA 1U5AA 4R1SA 1XMVA 5EE5B 2AQKA 5H7XA 3QV1A 3SM3A 2H59A 3SSMA 4ZEMA 1PS8A 4I2VA 1EQAA 1G7CA 5BMVB 5TQJA 2JG3A 1VE1A 1YQXA 1YO6A 2BY4A 5M2QA 2CNLA 5ENVA 3WDLA 3CNHA 3D1LA 1YA4A 2CSXA 1E5DA 2MSLA 3Q15C 4V03A 4AZTA 5LXTB 1LZLA 1EDBA 3DWFA 3JR7A 1FDVA 3L05A 4D97A 4FKBA 1E9CA 1G3IA 3NIWA 4PNZA 3V1KA 1UJ4A 4D3ZA 3JTEA 4IHJF 3X2SA 1BJTA 1NX6A 4ZCQA 2IS4A 1RJGA 4URWR 5KTKA 4O29A 2A14A 2PVSA 4DSTA 4JHLA 1I5EA 2Z57A 4S35A 1NPTO 3V8NA 5F2OA 5JECA 3SVTA 3KKLA 3NRCA 2C03A 3JYNA 1R4NA 3QEOA 2DBZA 2HB6A 3MJDA 3ZJYA 2PRIA 2CNWD 1ZCJA 2HMAA 3QW2A 4D8UA 2ZJ0A 1N4AA 2HZ7A 5IW8A 1KP2A 1DKUA 3KZ1E 3M5DA 4GT1A 1EUCA 4YAGA 1COWD 3IIEA 3SKYA 1QDUA 4G1MB 4UZEA 1H4VB 3M70A 4ZOAA 3V7FA 3M1IA 1EK5A 3SQWA 4KH0A 1ZNYA 2PGOA 3JAWB 4DOMA 1WNTA 4IIDA 4BNUA 3R23A 4M8IA 1NNUA 2V7TA 1Q44A 3WYCA 1P73A 4MW6A 5C51B 5GM1A 5FH9A 4KQMA 1AQNA 2DUMA 5DGDA 2DZDA 1JHZA 3LO8A 3R7WA 4HNRA 3HRIA 2V6BA 1OILA 3IAXA 3UAZA 1XC7A 4BRWA 1WETA 2O8DB 2WINI 3O93A 4BEVA 2VH5R 4RMHA 5I7EA 1SD5A 3MTAA 3FUTA 2A33A 3NALA 3VI3B 3GRKA 4E5UA 1R3DA 4O4HB 4Q1EA 3REOA 3TE7A 4EJSC 1NC3A 1BQEA 4KJZA 1KWKA 5C0OE 1ZUWA 4PFSA 5LQNA 2I1WA 1KP3A 2ZRHA 3ZV3A 5EL0A 2FSVA 3GX1A 3EVCA 2AG6A 4U8GA 3INGA 1YHNA 2YVQA 4Q7MB 2PMDA 4WCDA 1DO2A 5L40A 2VEDA 3NHUA 3OE4A 3P32A 1YKFA 3DHVA 3D8RA 4ZHQA 5A5GA 1T9KA 5AUOB 2WZQA 1G3MA 3H2ZA 2HF2A 3ISTA 3K6RA 3DFIA 3PUKA 3CONA 1B2LA 3RYCB 2YV4A 2B4RO 4IH1A 4GXRA 3SLKA 2A4KA 2VT2A 3ESRA 5D1NA 4A5SA 4D44A 4C04A 1X3LA 3I3OA 1R2QA 2ZIFA 2NO9A 3RC7A 3JQFA 2VAWA 3CB2A 3F9CA 4J7CA 4RKRA 4BMPB 4Y2RA 3UWKA 4EI7A 5FUYA 1KEKA 1NATA 4KE7A 3OOYA 1LRJA 1EUZA 3R5TA 3U9LA 3W9SA 3RS5A 5T6BA 4D98A 4EYOA 3B5IA 4C0XA 3THWA 3F9RA 1Y5NA 2PBLA 1T3GA 4QBGB 4XX0A 3DL2A 1R0CA 1OCEA 1WV1A 2VDRB 3AW9A 3JWIA 5D3QA 5DWDA 5JZSA 3FUXA 3ITDA 4EHLA 1AS0A 3ZE7A 5EZ6B 1F0PA 1GA1A 3FYTA 4AY6A 4EO7A 2AH5A 2F1OA 4RNCA 3RT7A 5DSZA 1OX5A 4BB0A 1X7GA 3A1NA 3KNZA 3IEKA 1S1CA 3ONDA 1P1HA 3K9CA 2YQ4A 4MAMA 4NNOA 3V1MA 4CU2A 2FETA 2C4TA 4X61A 1QIHA 2VPPA 3EZLA 4DLXA 1C8VB 3PGJA 5KJ6A 4BQRA 3KQOA 2PXAA 1MXHA 4C6RA 2OCGA 4EZBA 4HNSA 6ABPA 1DEAA 3RAJA 4WDQA 1Z2OX 3PC3A 5AXCA 2HXSA 3L6BA 2VTKA 4QGAA 4C4XA 2UUCB 1XDWA 3DOHA 4L2IB 4NYJR 3VKVA 3KSUA 2H1OA 4OJKA 1QQ5A 4JBWA 3THYA 4DGQA 2NM0A 4U5QA 3TECE 4YJFB 5EC8A 3E1GA 1KGDA 3R74A 1EHIA 3SQOA 4EA6A 5K8LA 3GJ4A 5KYGA 3ASUA 1M0SA 4E14A 3H0EA 1GFSA 3W2TA 3BZWA 1K8RA 1YIAA 1ZRMA 3OOWA 1UBUS 2QDKA 2PEYA 4I1VA 3RJ9A 4LOKA 5CLJA 3Q7PA 4M37A 3PWZA 1NZJA 3QH4A 3RF6A 1BFUA 1NBHA 1DQRA 4KIFA 1ZMTA 1B73A 1Q7CA 2YWGA 3MUOA 3NZEA 1QOPB 4P86A 4EZEA 4YWJA 1QTNA 3KBOA 4UEOA 5EQTA 7GPBA 2KQUA 3RARA 1FYFA 2AMYA 2R6FA 3HPRA 4JP1A 4UEQA 2JDID 3ID6C 4B7UA 3K72B 1POXA 3EOBI 4E7PA 3K20A 1XMIA 2IYFA 1TI7A 2EF0A 2JHGA 4QATA 2Y67A 5I7RA 1R8JA 1P2UA 2BFEA 3WMEA 5KNCH 1C9YA 4NLLA 4NULA 2FPGA 3OEWA 4I8DA 4UU7A 5ADVA 4MEBA 2QK4A 2DT5A 3M6VA 3FCEA 5DM1A 1QJCA 3BD6A 3I42A 2QZSA 4UHHA 3GMIA 4ZAWA 5HBGA 1SULA 2YYSA 3C74A 4XIIA 3MCZA 4S2EA 5FR2A 2ZIAA 1E2QA 1FNBA 1N5OX 1QTRA 1G18A 2IYUA 3HGQA 1ZVQA 4WJZA 3CEHA 2I2XB 1H66A 1QNFA 3FKSA 2RDMA 2YXPX 2HPHA 5GONF 2ZB2A 3OF5A 3BOSA 1ZINA 3P4UA 2OXIA 4JEHA 4XQEA 4NBNA 2B78A 5E9WA 5AM5A 2KMLA 1K6XA 2PYDA 3O1HB 2H1IA 3BE4A 1PT5A 4UBOA 3INNA 1RHRA 5B3AA 1OQAA 4HNHA 4WAUA 2G06A 1VCOA 3UJHA 4DRXA 1PVOA 2Z2IA 3KCNA 1ADGA 1D1TA 4L50A 821PA 3IB6A 4CUKA 1P7ZA 2ZJYA 1U5CA 7MDHA 5DGIA 3FPLA 2OYCA 5B6PA 4ARCA 2I7DA 4QU9A 1KPGA 1GPMA 4FMDB 2CBGA 2TYSB 3G2LA 3PVCA 4DARA 3WV4A 1JU4A 1OVGA 1NVAA 2PDAA 1NA5A 1IATA 4BOYA 3RTAA 1N2XA 4JBLA 2VRCD 3W3ZB 1E4EA 2K7FA 4DM3A 3K31A 3A32A 1A0OA 3NNSA 3PTLA 5BOVA 3D81A 1DXQA 4NCAA 1XNQB 3BGSA 2VUIB 3RFTA 3K3PA 3GAMA 4GC9A 4IG9A 5ITZA 1THZA 1DBIA 1NW6A 2ZITA 3QP9A 2ARKA 2HM7A 2JH9A 1K0UA 1OWMA 2HSZA 3P4XA 4FBLA 1D7OA 5IVIA 1RM4A 2VSNA 3W5UA 2E18A 2GF0A 1IXRC 1ZESA 2RKOA 4JFAA 3N2IA 2F55A 1BHJA 4IOMA 3CSDA 5DPMA 4EUKA 1RWBA 1BO6A 2OCIA 1UDAA 4FX5A 4URUR 3X2FA 4K26A 3IDFA 4CN9A 1J8MF 1A27A 4MUAA 4P36A 2BUCA 4D9FA 4E11A 4G37A 1F5SA 5FWDA 5KTRA 1Q16A 1JJVA 2OOKA 3DUWA 3B60A 4R3NA 1IEXA 4R8RA 1QUEA 3T7TA 2JGMA 1L5MA 1D4ZA 1SQSA 4JXJA 4M55A 3BJRA 5JPIA 5F33A 4MLDA 5JSHA 1X1EA 4S1OA 4OXYA 3UTDA 1YSCA 5BV0A 1QP0A 5E4FA 3GVHA 3VM6A 2FK7A 3QPAA 2PKXA 3EGXB 4JJEA 4OF4A 1SIUA 6REQB 1RVV1 3H75A 1JFTA 2A5GA 4P5EA 3S1AB 1XTBA 4TTSA 4YRKA 3R0IA 5KJCA 1QRTA 2DEUA 2YUTA 4RZXA 2V65A 4WK2B 2V59A 1JFFB 2VWPA 3L4JA 2PJDA 4NATA 4IW3B 5CFZA 5IJ0A 4DT1B 2PSHA 2WYWA 2GEKA 3IIJA 1BVUA 1CT9A 3QTTA 4UFNA 5ES3A 5EZQA 4CE6A 3LUJA 2SKDA 3L1JA 4HZGA 3ZD8A 5CVDA 1LVUA 3NIFB 3ETHA 1PJLA 5B4VA 5KOHA 3NHBA 3AIIA 3VPFA 4ASUA 2G6TA 3HRKA 5CYGA 2OHHA 2AKAB 4WLOA 1KDPA 3FKJA 1WDMA 4WE3A 1LY1A 4H1HA 2J5RA 1S0UA 3IUBA 3R40A 4HDMB 4RMJA 4UHBA 1M2EA 4TMWA 3VUEA 4JBNA 3UMGA 2JIPA 2PSFA 4PR0A 3B48A 4R2XA 3BD7A 1RMQA 1DG3A 1SXJC 2C96A 1OYWA 4ND5A 4Q1AA 1V3VA 4DRYA 5FWYA 5JC8A 1P18A 2ZSUA 2A5LA 3BRWD 4OP1A 1PF7E 2CFIA 3ASZA 2DPMA 1GG2A 3IPLA 4EABA 5CJ2A 4F3KA 3WNQA 4WBXC 2IQIA 4NEQA 3DBVO 1XZKA 4OQZA 4QASA 4QLBA 3ZV7A 1J23A 2SHKA 4PLTA 4M1EA 1CHDA 1TO1E 2EERA 5ILQA 4ZCIA 3QLVC 3IOBA 3SWWA 4B74A 1J8DA 3NIGB 2QA5A 2HRRA 2XSZA 3EARA 3WLFA 3RUDA 3ENKA 3ZJTA 1E0SA 1UMDB 3GL9A 1WDTA 4I55F 3REQA 1SCUA 4L5YA 2CUZA 1U7HA 1C4KA 1X86B 3EGDB 1PGOA 1T1EA 3T1YB 2H9AA 3T5GA 3V1TC 1LZKA 4BUCA 2OORA 3PXUA 3ETEA 3IHWA 1G8AA 1SC3A 2FMHA 2PD3A 3OAAA 1KZ7B 3VHXA 4BZZA 4DEXA 1TUGA 1WL8A 3RNLA 2GK3A 3T8YA 3UJ3X 2WM3A 1QVRA 2DCMA 2C94A 4ZAZA 1DTWA 2JFZA 1P4RA 1APBA 3B6KA 4CQLA 5AOAA 3ADKA 1HDIA 4GOXA 5K0SA 3M9XA 4EA7A 5KU7A 2VYCA 1QCZA 1DOAA 3FPSA 4MV8A 1FMFA 2X77A 1A9ZA 1KEVA 3AJAA 1BEUB 3M2TA 4L8LA 5IP5A 2ON6A 4RPJA 2BGTA 4FBMA 3P5SA 3GCXA 1JJBA 4I4CA 2FP4B 1ZVKA 1Y42X 3D6FA 3R4VA 3QEAZ 3PDUA 3HJUA 4HJXA 2IYWA 2Y1DA 3VU0A 1X42A 3NS7A 3MM4A 4O4JB 2XRZA 1XPOA 3KYBA 2QJOA 4MRPA 5J2UA 1CY1A 4RY0A 5SZIA 3WHLA 2J6BA 1RWOA 3FRJA 1YXMA 3GLHB 1SVIA 4OHVA 4C6HA 2XB4A 2Y2UA 1E9AA 4DR7B 2Z5VA 1OTYA 3FYDA 4NRDA 4CFZA 4YRIA 4FOTA 3VSAA 3ZWVA 3T7IA 3QX3A 3OTHA 3T9FA 4YT4A 3HI6A 3UAXA 5BUSA 1NTRA 5LP6C 2FLVA 2C2ZA 5C37A 5SYAA 1C0EA 3AG6A 3AGPA 3LL4A 3UM9A 1HZJA 3KM0A 2QZ9A 3LGSA 3BFJA 3FNIA 3IP5A 3Q3CA 2FF5A 3FDXA 4QA9A 5ABPA 4C3VA 1T8PA 3GC6A 2HN9A 4YECA 3WGTA 2WHYA 1UADA 3KO8A 4JEMA 3WG9A 1SXGA 3AHIA 3K9QO 1N3IA 3KHSA 4LXGA 4P82A 3ZZTA 2BCJQ 1PRYA 3OZCA 3JAKB 1OX4A 3H7IA 3SZRA 4CF3A 1QONA 3M5CA 1U2PA 3CLTC 2NNWB 2X3YA 3T41A 3ROXA 4UAGA 1EFKA 4GNKA 4OJNA 1KA9H 4XOUA 4DCUA 4DUGD 4ARVA 4HPXB 2QRGA 3G8DA 1KQ3A 1KIAA 2OK8A 2O2IA 3CPSA 3LT2A 1FNSA 3H5TA 4QYMA 3ABRB 4MYCA 1CG6A 1EMDA 2PWZA 2TMKA 3OCJA 1P6UA 1WTAA 4N5IX 3MGKA 1K6JA 5TS3A 3ZY3A 4QUIA 3N6XA 3JYOA 1ONSA 4NF2A 4MKGA 3DA8A 1T24A 3B1KA 4K46A 2NMVA 1QHYA 4RPGA 2PU5A 3AHFA 3BL8A 3FD8A 3L0CA 1QANA 1MV8A 5FNVB 1K6MA 1DRUA 3TW8A 4CLDA 4P3OA 3FOBA 4LKRA 5AJVB 3BBLA 4JKIA 3JVEA 4F85A 1EDEA 1CE8B 2G4CA 4QAQA 3NNDA 2FWBA 4BNLA 3H18A 4F4CA 4PANA 1OGYA 3Q0EA 4F12A 5BURA 4Y6OA 1ISMA 4RC9A 5EJ5A 1U9YA 2TRSB 3LLCA 4OUDA 4WOPA 1AUXA 1KAGA 2E5LB 1MX3A 3EXHA 4K5QA 3E18A 1LK7A 1NQ5A 3EC7A 4HDQB 1EFHA 1Q3HA 2D0PB 3L5OA 2I2CA 2F1IA 5MN6A 1RM3A 1ICIA 1UFQA 4AYWA 5IDWA 3USCS 5JUWA 1VXOA 3UEOA 1EYZA 3IRUA 1IONA 1B74A 5AT1A 4PWZA 3UT6A 1KF0A 3C7CB 1CRWG 1XELA 3C5CA 4P92A 4AROA 3U7IA 2AOTB 1LK0A 1NQTA 1CZNA 4G25A 4RD4A 3F4LA 3DCJA 1P9RA 4OQEA 3WJAA 1SKAA 2FR8C 4HNGA 5ERXA 4BFSA 1TKBA 5JR3A 4DV3B 1ZCZA 4MVJD 2JHFA 2OPBA 4WGFA 5H3CA 1ZA2A 1FDOA 4R1MA 3U1BA 2AC4A 2XGOA 4Y2XA 2NAPA 3DFMA 3L0OA 4NS4A 3ZJVA 1ZVJA 5C1OA 1ZJZA 1TVKB 1UUFA 2WTXA 4ZQHA 3KC2A 4RVOA 3N2YA 1TVMA 3E82A 1SKUA 4L75A 4D74A 3SJBA 2QNBA 1XJQA 4RTQA 4Q4JA 1X77A 1R88A 1ZOPA 1ULHA 3NLLA 1XRLA 4TV9A 4TV8A 4UHEA 2COKA 4J16A 4AO7A 2JFPA 3V2UA 5KNDA 2ID7A 3OPXA 3QKSA 2M6KA 3H5VA 2XGMA 2C0QA 4L0CA 3IE2A 3P2JA 4WCFB 2IXDA 3LK6A 5GVSA 4P84A 4UQPA 3O8RA 2C9DA 3L06A 4J6FA 1MVLA 3DOUA 1K6EA 3VOTA 4PW0A 2DUNA 3ZU5A 3D3QA 2Y3IA 1SQGA 3HYSA 4RPIA 5LQDA 4LDRA 4E21A 4ZKDA 1NVVR 5LQKA 9ABPA 2G04A 5E2IA 1QZUA 1OXVA 1QS0A 1VL8A 1BWRA 3ICWA 4YUVA 3UUEA 4GAEA 1NW5A 1BMFA 4KWHA 1UC4B 3EFHA 4HFRA 3VI4B 3RVQA 1QV6A 2Y76A 3OUZA 2HKIA 1GZHB 3VU9B 3ZIAD 3GZJA 4QELA 1OOEA 5JNVA 1K4KA 2J41A 3FNRA 3P2YA 3L1IA 2P2GA 4G0ZA 4BN5A 2G0AA 4FYPA 4OQYA 4JI0B 4DV1B 1DJPA 3TSOA 4G0VA 5FQNA 4WWHA 2P6PA 1NY5A 4BU0A 2WU4A 5JD4A 5ED4A 5ALDA 1D4OA 1I7PA 2GK4A 4I9UA 4EIWA 2E0IA 4ZIRB 3DBHB 2WJPA 2GM9A 4KQ2A 1SKQA 2GTPA 3JQRA 1OFUA 2KM1A 2W2QA 4F6RA 1R74A 2Z8ZA 3DS8A 3IPYA 2QGFA 3N86A 4DQ0A 1Y1LA 4HN2A 4R5MA 5CDYA 3GYBA 3DULA 4HVLA 4ZDKA 2NV0A 2X0FA 2WU0A 3IILA 5A06A 4TL6A 2JJYA 2G4VA 2H4JA 1DJQA 2P2SA 3EGWA 1CR4A 1VXRA 2VP6A 1YB2A 4TWAA 3VOAA 3O38A 4BDTA 1R6UA 4C7BA 3PR1A 1HZZA 2AF4C 2FPSA 4D3DA 4EMTA 5CFRA 3S2EA 2ERCA 1N5LA 2WV7A 3KKMA 2ACVA 3EVNA 1BH2A 1P0CA 1SFRA 1XTRA 1YRQA 2DULA 3C70A 3ETJA 3O26A 4GOJA 2NXWA 3RKUA 4AG3A 4G0UA 1XQ6A 3OCWA 2YVUA 4B6PA 3NWPA 4JUCA 3RFVA 3CT6A 1J49A 3BXEA 3ILXA 1TU4A 4KGZA 3ZWYA 3HU3A 3PU6A 3WNZA 2C1XA 4FOOA 4WA8A 5CD9A 2PX8A 2WOOA 2QAGA 3AMVA 2Q7DA 4B3XA 2IHKA 2Z83A 2OAEA 2XT9A 3BXPA 4OSEA 4U63A 3CVWA 5FO0A 2WD7A 1SCDA 5CLGA 2YN4A 3RC3A 3DG9A 1NSYA 4GL2A 1LNSA 4YALA 1NRXA 1N6OA 2IVZA 4JGGA 5B1YA 2O1EA 4XARA 4RKYA 2NYRA 2YMLA 3RSZA 4ZEOA 4M22A 5D6NA 5AVYA 3BE6A 5F7XA 5KYTA 1GV0A 1HNXB 4FFPA 1HLFA 2G1UA 4PYQA 5JS6A 2DPYA 1VG9B 1ZEMA 4OU4A 1O7JA 1JSLA 4AS3A 2PNJA 1XBTA 3CE6A 4HMOA 4UBLA 1N92A 3FFAA 3WMGA 5DRTA 3GDHA 3KPWA 3NPMA 2IYPA 2C5SA 4J9VA 1S1MA 4JXZA 2C4KA 4LYJA 5ESDA 3RSQA 3TYXA 1RLIA 4XD7D 1E63A 1G7SA 4FD3A 4ODIA 2W11A 2VDPB 3A4VA 4DA4A 1O08A 1P75A 4N76A 3UOWA 4GI1A 1YI0A 3ROKA 3LGAA 5KQSA 3A1EA 3ILHA 3RAEC 3SJ7A 3QEMA 3SE0A 4DB4A 3KX2A 1WCYA 4FFSA 4UNNA 3LLUA 1MX5A 2SCUB 2EGHA 1T1RA 2Y1OA 2XMRA 4M0PA 3UGJA 4AJ9A 5B3LA 4F5WA 3EBLA 5E4TA 2CL0X 5DWQA 3QU7A 4UC0A 3A9SA 5AW6A 1YB7A 5HCIA 1FX0A 1H42A 1OKKD 2ABWA 4MWGA 1EI9A 4TUYA 1YQ9A 3I09A 4L27A 2NVUB 4OLJA 2OZKA 5AW4A 5HZMA 4G65A 2RH8A 3SC3A 4B6FA 4O2BA 5LA6B 1NVTA 1OT3A 2JFFA 2CMDA 4MB2A 4HQFA 4IWNA 1XROA 3DBLB 2WTMA 2D00A 5IS2A 2QN7A 1OU4A 1XYVA 3PD0A 1XF1A 3PSHA 4DQVA 4HV4A 4CKWA 2FX3A 2I67A 3IUNA 4JBHA 4L9SA 3AEZA 4RDCA 2P9BA 2KBEA 3K92A 3HA2A 4LYDA 4YRZA 4MV0A 2IDZA 1N3LA 3DEHA 4L07A 4CL0A 1DPFA 1PFQA 2R84A 3MAAC 5FL7A 1B1CA 3OCVA 4Q34A 1P2VA 1QIJA 3OA0A 3EC2A 2J7PD 3ACBA 2OXCA 3G2MA 3DZFA 5DK4A 1A69A 2P9JA 4AJKA 4IDQA 3RHFA 1FRVA 2JZCA 2YICA 3RFUA 3TLKA 4NFHA 4KPUA 2W5UA 3K70B 3TZLA 4NBTA 2NACA 4TQ9A 5T4BA 3OD1A 2IJGX 2AN3A 1XN4A 1Z4MA 5KHAA 5KC9A 4FPXA 3AM3A 2X15A 1SBCA 3R6GA 4WBSA 5DHPA 2J07A 3HCWA 4X44A 1XZMA 6YASA 2RGCA 2VUSA 1E3SA 3HFJA 3KJZA 4JELA 1KEPA 2FGKA 4X84A 5BOSA 5BPFA 2QSZA 5C5DA 3T1VA 4CR8A 4ESVA 2H5EA 2SBTA 1EEXB 2AMJA 2CNWA 1FLAA 2CLDX 3ANNA 3DCNA 2OCYC 3N2LA 3AJEA 5DWVA 1Y9DA 1R4NB 3IA2A 4QAJA 4XB6B 2XUGA 5DHRA 3GRCA 4DCCA 1GA6A 3S2ZA 5KQRA 1COWA 1X8JA 3ZK7A 4UVHA 3IDAA 2AFHA 1W87A 3AEKA 1FQOA 2QD3A 1RYFA 3AXTA 3FX2A 4ECEA 4W8GA 4JXXA 2IHZA 3F97A 4KK4A 3WKEA 1RQNA 1J9GA 4IICA 3SKVA 5JQGB 4KSYA 5DV9A 2COUA 2IKSA 3CRZA 3L8EA 3GJ5A 4F86A 1Q0SA 1UF9A 3FW1A 2FDXA 1SCBA 1M2JA 1G8HA 4U7TB 4ADSG 2YWEA 5LNK6 4N6OA 5CTAA 3IDQA 4YIKA 1QBGA 4L4XA 2E9SA 5BOSB 1TRKA 1MRZA 5E8RA 3R7WB 5I8ZA 2A7XA 2CFOA 3UK0A 4X1YA 1Z0AA 5L6MB 3SZGA 1RZVA 1G66A 2QW0X 1UC9A 1YE8A 1BD4A 2J3JA 1FJXA 2MMGA 1HDGO 2CXXA 2PM8A 3M6FA 5ILGA 4D4JA 4RQUA 4TLLB 4OQNA 4A5OA 1JQAA 5K99A 2GVDC 4X90A 4HN4B 3UAWA 3OC6A 4K9DA 5KPDA 1CUEA 1NF2A 4WNAA 2W2MA 4Z7QB 2Q50A 1C7ZA 2OG2A 3JQBA 2HI0A 2QG4A 3BJMA 1S3GA 1TA4A 4FQ8A 4MSUA 3WTBA 4AP6A 4E4TA 2E6UX 5K09A 4YMHA 1YDWA 2R48A 1Z4LA 2R86A 2X4LA 5CPFA 3QKRA 2QQGA 5FFNA 2B92A 5BNIA 4ZHQB 2EX4A 3CTPA 1IHOA 1A9TA 1RKBA 2YKGA 3TXYA 1ZM9A 2XEXA 3COVA 1N2GA 1Z36A 3N2GB 4ZYTA 3OJCA 5LWQA 4AQYB 5AKLA 1V5FA 4F9TA 1UKVY 2X9LA 2E37A 2IZ0A 1UPTA 1J20A 5MFZA 5AKJA 1UZLA 1CXZA 5GMOA 2ZIZA 3OY2A 7AT1A 2V7EA 5JE8A 1F6WA 4H3VA 2WHXA 1E3EA 2C2HA 4RADA 5GPBA 4N4AA 5B3JA 1M7GA 2JKVA 1JQBA 4QPNA 4RANA 1QVWA 2WTNA 3A1FA 1AVTA 1P4AA 4L7VA 4CG0A 3THWB 4PXAA 4XX0B 1P7WA 4Q6WA 4OY3A 2OBFA 4GPBA 4JP2A 1KZHA 3VPBA 1OU0A 3VZPA 5C4MA 5GV8A 1NMSA 1A2QA 5ICMA 2VF4X 3AV0B 1JTFA 2B2CA 4UUAA 4XCQA 3D3WA 5IJAA 3WP1B 4DDHA 4BNHA 1X1BA 5FPYA 4RPKA 4EPYA 3U5ZB 3KTOA 3AM1A 4L15A 1BE8A 3CGGA 4GO1A 4WLFA 3PCXA 1DAPA 3L02A 3DE0X 1JJIA 3HCDA 2DUJA 4N5NA 2OLKA 5JD5A 3DNMA 5A2QA 4M86A 2C5BA 2YHAA 2W4MA 4NZMA 5DMHA 1B6TA 5CA1F 4ECAA 3M4YA 1IBSA 2VA8A 2ZJOA 1BHO1 3N0XA 4YT8A 2BE9A 4W9NC 1XPRA 1E92A 3R7NA 2OGTA 1RC0A 1QUFA 4OFBA 4QO8A 3WQBA 4GX5A 1JEOA 3THYB 3MA0A 4DE5A 4JD5A 1N8NA 1R15A 2AHOA 5GM2A 2AXPA 3VSBA 4DG9A 2QPLA 3D6HA 3GUVA 3OI7A 4IGEA 1KHTA 1D0IA 2GSWA 3O90A 2RB4A 3DL7A 1I2CA 5E1BA 1J70A 5BRNA 3NP9A 4KBYA 5CIWA 1VSQA 1AQLA 2BN4A 2ZUCA 1OH7A 3UQYS 5CAEA 3EEBA 4MCHA 5K3AA 1Z28A 1PJ3A 3NBZC 4OBEA 2YZ2A 3ZEAA 1TLLA 2IEIA 3AUKA 2A5JA 2JDIA 3G5MA 3LY5A 3Q6IA 2X0IA 4YJ3A 5I4IA 2ZWVA 4OK5A 5KOYA 2WG2A 2CDBA 1Q19A 1UOOA 2OL4A 2QBYB 3KZMA 4U6QA 1Z35A 1KDRA 4RTRA 4MRSA 1BXGA 1XKTA 1G8GA 2DC1A 3QFRA 2BR3A 2FG5A 1GG9A 4AWXA 3DKKA 2VAPA 1V7ZA 2XA1A 2BFEB 1TAHA 2WG0A 4KE8A 3BILA 4Q7JB 1MB2A 2FPGB 1I6LA 3L7DA 3SC4A 5EUMA 4MKRA 4DKJA 3ST7A 3VHQA 4KLAA 3IELA 1G19A 2XA9A 1UWKA 2ETVA 1MR3F 2ZYTX 1XA3A 3NNNA 3OCYA 4R2WA 5AJTA 4IX1A 4B6JA 2YFHA 3RROA 2WM9B 1EEHA 3B3FA 4O2LA 3ZDRA 4DR1B 4DV0B 5E4JA 3E61A 3IJ5A 3PLRA 4X7PA 5JRDS 1JI3A 1W0JD 4ZU1X 3H1TA 3WRYA 4FGJA 5TMPA 3LQFA 4YRCA 2X1LA 5LYJA 4BBJA 5BXYA 1ZH2A 1UC5B 2JBAA 4PRKA 1IIRA 3PJFA 3BF7A 5L4NA 3SCZA 1DIHA 2COEA 3WKAA 3DP9A 3K9BA 2ATCA 5JH7A 4L57A 3SIPA 4KN9S 1N7JA 4CF4A 1P31A 1FP7A 2DMRA 2PQ0A 1L3BA 1Q22A 3CXUA 4XUGB 4A2QA 1BN6A 3IOMA 1FUYB 3KK0A 4Q7KA 4K3UA 1UK6A 3KJGA 3OJWA 1DJMA 2I3ZA 3A6ZA 1UQTA 1DWPA 1OZAA 2BBOA 2Z2KA 1JG3A 1S96A 1XP5A 2BVNA 3CKYA 4HTFA 4L0MA 4UFOA 3RV3A 3A9VA 2XUPA 1NAHA 3E5RA 4LS3A 1B8UA 4DSNA 1MORA 4FFWA 2QVBA 5CG2A 3GLQA 4OKSA 2C1EA 1N9KA 1IM2A 1P6QA 2VRCA 2WJGA 4MKIA 1GU0A 4XFDA 2ZTVA 3ZZ1A 5KVVA 5EQFA 2G5GX 1MAHA 2CL6X 4KFUA 1XYGA 4JV5B 2ESRA 4O0MA 2QD1A 1E4EB 5CP8A 4Q3CA 4D46A 5HBRA 3RUIA 1VYHA 1XTVA 2NXCA 4M0DA 2QN6A 1P9WA 2QMUA 4EW3A 3LTEA 4DBVO 2OECA 1M6NA 5KYNA 3DT8A 4G0OA 4ZOLF 3N87A 4JJGA 2PANA 5ITZB 3EGIA 3GUYA 1FC0A 1PVVA 2B30A 2OOSA 3AI1A 2CYAA 1T2DA 3FKQA 3GP3A 2WFAA 1EAMA 5KUTA 3A14A 4Y1GA 2FRDC 4C89A 3W5IA 2BI4A 4UD6A 5IBRA 4NZYA 1FYXA 2FG6C 2E4VA 5IASA 1I8TA 4Q3LA 1UJCA 2Q21A 5F78A 2O5CA 3E4CA 5DYYA 3TFQA 3IEMA 3ZGZA 3OSZA 3EK2A 1QIEA 3OH8A 1X80A 4LY0A 1O87A 5FULA 4F2PA 1G38A 4EYGA 1BE6A 3WBJA 3PFKA 2BKXA 1E1YA 2HV9A 5G0WA 1YNOA 2IL1A 2O07A 3CH7A 3KHUA 2FEOA 3L1HA 3MT9A 4ER5A 2FU5C 1M5TA 3TTSA 2EKPA 1GN8A 2PU7A 4BRUA 4CM1A 1PLKA 1MD9A 3DDOA 4MUIA 1Q0RA 2I2BA 4DMRA 5CDSA 4KCGA 4TWIA 1MENA 3SXJA 2ZYSA 5CCDA 4MO9A 3SLGA 2WUDA 1EZZA 3CUKA 1RIFA 1CY2A 3K9WA 5IJ0B 1EX9A 2NNLD 4ZA2A 4DA8A 2GOYA 4OG2A 4MEAA 4KWIA 4H7EA 4MVYA 4RFSA 5CDHA 1KTIA 1F51E 2PUFA 3E2PA 2J33A 1NYLA 4A2CA 2HIGA 4Y3UA 4CEIA 5ALRA 1JF8A 3EX7C 1KBOA 1QC5A 3UV7A 3PRKE 2OHGA 4YVFA 3IUSA 4WFQA 5KOHB 1KKMA 2VDQB 3QKTA 5ALFA 3SC2A 3TQOA 5DBEX 1T6NA 4URVR 1PYOA 4X3OA 1M73E 2D1RA 1PJQA 3BC1A 2HJWA 1XTIA 5JAUA 1OMOA 2NV2B 3K1JA 4P4UA 5HFNA 5A1JA 2OV8A 4JLSA 4NBSA 1VYUA 1YT5A 3V32A 3BRWA 1GQ2A 4I1RA 3QVXA 3RGWS 2B6HA 4QSMA 1QFSA 4G1VA 5FWYB 1G8FA 4N5LA 1N1EA 4E32A 2QN3A 4DIFA 4RTLA 3WI7A 4NXNB 5JZ9A 1XRSB 5MFPA 5KTMA 1JDNA 3OICA 1U0NA 4PHTA 5K5EA 4JT9A 1H2HA 4S12A 4YRBA 4DYVA 2UUAB 2GJSA 3REQB 1SCUB 1DAIA 4D80A 1T5SA 5AW7A 1UBSB 1ZPDA 2H85A 2IEGA 4LC1A 2XMSA 3VYVA 4BNGA 1XZQA 1K89A 3A05A 5JFGA 3UZUA 1KZ1A 1NPYA 1JNYA 4GGOA 1I51A 5HEKA 3F8WA 2HK8A 1PWHA 2P2LA 4LRQA 1U4NA 1AD2A 2G5CA 4K87A 1FE8A 1OXXK 4OBXA 5G40A 2ZAYA 4CQLB 3ROPA 2ZDQA 4IAOA 1C0IA 3RLFA 3K73O 1ZKDA 2CNDA 4OI1A 2BMWA 3CLSC 3UQZA 1WMFA 4XIFA 4X1OA 1QH1A 1SHUX 1T8SA 1EWYA 3A4LA 3W7VA 3BORA 4R68A 4UAJA 2CXRA 3S28A 3QWBA 2ACKA 2H51A 2JD2A 3NC4A 1XHEA 2B3DA 2OUIA 4N1AA 2O06A 4K9KA 3DO5A 2CD9A 1DEOA 1LDBA 3ODGA 3VAYA 1RKQA 3DKRA 2WJ4A 1OYOA 1SCIA 3JVVA 1PJ8A 3EGCA 2AWNA 1RAHA 3SBOA 3STWA 5L3SB 2QYOA 1YK1A 3CA8A 5GQSA 5J2UB 2BWJA 2O2EA 3LCRA 4WX2B 1T5HX 3C5EA 1E20A 4G5OA 1FVOA 3FYUC 1QAQA 3LP8A 3L46A 2PKCA 2XOKD 1XDGA 3T1QA 3PPYA 3TJZA 2PWYA 1S7CA 3TIXB 5L45A 1PGQA 3IOEA 2MSKA 3M4XA 3P7MA 1G8JA 5LFAA 1QWOA 3V8QA 4QE3A 1OJ7A 3NHYA 1HE2A 2LBPA 1B93A 1HDZA 1I6MA 1N9GA 1QVAA 3G9QA 3OOSA 4IIHA 5HIMA 1ENZA 3U44A 4GSKA 1NASA 4EEZA 3W5AA 5HXAA 3BFPA 1E3IA 3AM4A 2Q5JA 3OZAA 4KSCA 4Y2HA 1IBRA 3E81A 1WSAA 2AN4A 3FJYA 4E2YA 3AL2A 2QP4A 3F98A 1DRJA 1M34A 1XF9A 2C4MA 1XT6A 2V58A 3N05A 3PL5A 4UHKA 3TQHA 3AL0C 4HGOA 2IIPA 5E0KB 5EIWA 2IYYA 3RLIA 1R9NA 1M6WA 4P7KA 4R8MA 4EJ6A 1X38A 2FPUA 3WB9A 1OX4B 4QYIA 3U31A 3VFDA 5DM70 5KCMA 4DUGA 3I83A 2F8LA 3OZ7A 3AHEA 4EGAA 2GEUA 3OLZA 2HQBA 3ZD6A 2VDWA 2IF0A 1MG5A 3KFVA 1TQ6A 2EZ4A 3ICPA 4W7HA 2EYQA 2QTTA 5F1OA 1W46A 1N8KA 2PO7A 3KPUA 2BTQA 1NI5A 4HD8A 3A06A 3K0SA 4M9UA 1OXTA 3K8ZA 5JPCA 2GI4A 3HK2A 3LOUA 1HMPA 2UVDA 1GPJA 3WNVA 5TJHA 2NSLA 3QVUA 4XPIA 4NNJA 2ZXEA 3EAGA 4KMRA 1ODCA 2A6PA 2I29A 1U0LA 1FRNA 2HBQA 4RJ2A 1JGTA 4YR7A 1O2DA 4GX1A 1YD7A 1MP0A 4BE9A 5B6JA 1JHUA 1YS1X 3RUAA 2HWWA 5IAGA 4ZI3A 1K5DA 4LWZA 3S7TA 3UMFA 2AOWA 4XQ9A 4AZVA 2GBFA 1UBGA 5CFMA 4BKRA 3GVXA 3NVKI 3VDNB 1U4OA 2WUEA 4OUDB 1TO2E 2I6GA 3MELA 3EXHB 2FUKA 1W4RA 1DCTA 1C1HA 1RQ7A 1GUBA 2BKVA 2WUFA 2BGLA 4JZYA 2R8ZA 1ZU5A 2NQTA 4U9HS 2PIAA 5FT9A 1F17A 1RYHA 3AEUA 3ZD7A 5ALMA 5I7HA 1G4AE 4LJ7A 3VJLA 4DAEA 3DDWA 1VL1A 3L6UA 4TXHA 3IEIA 4U3JB 4MVJA 1R4AA 3C4JA 3HCCA 2XCOA 3MERA 2X0JA 4OH7A 5D7BA 3CH6A 3QFFA 4XWYA 4J3JA 2EJTA 3TNLA 3ZWBA 1SPXA 2B4TO 2OG1A 4IFTA 3TLGA 2BFWA 3G3EA 4C1BA 3HDJA 3ZNNA 4EGSA 1PGPA 3E48A 1N2JA 1SVNA 2HJHA 1H5QA 5FA8A 1SOUA 5GOZA 2WICA 1HRKA 1I0LA 2EQ5A 3TRIA 3IEXA 3PTAA 1I4OA 4N49A 3K1ZA 3O4RA 3GJ6A 3LHDA 2HSEA 4XDYA 3WQHA 2OGSA 3TLMA 3TH5A 2ZJ6A 2BOVA 1B42A 1TCVA 1CFJA 1GCGA 5ICFA 3IV9A 4QREA 5BP7A 4TV8B 3H2YA 4EJ0A 1P1IA 1UMCA 3WR5A 1J97A 4V0KA 5TB5A 2PJUA 1IDN1 4ZMRA 2Q07A 1AK1A 3RIYA 4RELA 3LOQA 1G98A 3AERA 2GJKA 3I28A 1OV6A 1AZLA 1LDYA 1U6KA 4FP9A 1MPTA 3MGGA 3L1UA 2JL1A 1D8TA 1EKXA 1U28C 4AN0A 5I9LA 4FR0A 1QS0B 4XWWA 1OBFO 2HU2A 3LUGA 3ZIAA 2F3RA 2OSVA 2FOIA 1VL0A 5FTWA 5DNAA 3FMVA 1FP2A 1PZNA 2LKDA 1Q7EA 4EA8A 4K9QA 4K6HA 1R8QA 4HHEA 1IYZA 1VDZA 3GD5A 5AVOA 3VZCA 5AJZA 1LS6A 3TQCA 4E5MA 4KK3A 4A0FA 5AVQA 2W0MA 2GN9A 2HNAA 3H5OA 4LVUA 4C2AA 4PZCA 2PGDA 1QGDA 3KUKA 2CXPA 3TMAA 3P9QA 1HQCA 2HA2A 3A9RA 4PPNA 4AS2A 5FLXA 4D9KA 4A3SA 1T36A 1E2JA 2I4OA 1JDUA 4HKTA 2RHHA 4FGSA 1P0IA 4HY3A 3GLIA 4J1TC 3ZE6A 4DZTA 2QW8A 2QT1A 2NUBA 4RHUA 5CFQA 1EB8A 5F2KA 1UFVA 3E9EA 2C4VA 2Q3MA 3TRDA 1NLUA 3TSAA 3GLIE 4F6RB 2RGGA 4AY5A 3KPYA 4IHKA 1TO6A 5GV7A 1H3FA 5C8YA 4BRZA 2QD4A 3PX2A 1WXHA 2YJ4A 1KI4A 1UWLA 1FS5A 1XRNA 3HA5A 1TRHA 4IUCS 4G81A 2FKNA 1V1RA 3FTEA 4YAWA 3I0ZA 1TKRA 2JK0A 1CTQA 4FGKA 2XE8A 2PMKA 3KBBA 2BMJA 3C3MA 4J0FA 4Z0HO 4UNSA 1JHRA 2I5PO 5C8XA 4G56A 1Z37A 2X7JA 3LDGA 4HAWA 2DFVA 1X7ZA 4PLVA 5CH3A 5FI0B 3H9EO 2WKWA 3RS2A 3TLYA 5B2ZA 3TR6A 4I6EA 3CG4A 3BTVA 3HUFA 4MVCA 4MV3A 3L6OO 5IC4A 2UZ1A 4W7IA 3Q4GA 2Q2QA 1ENYA 3COWA 4Z3KA 1JALA 1J1IA 3R7FA 4NR0A 5CDTA 4FT4A 2GJ8A 1VLQA 1WOMA 2LZ0A 3MGCA 4KN8A 5J5VA 5JCZA 1BDHA 4JB3A 4OFZA 1FIUA 2Q3JA 1CDEA 3JWHA 2QAGB 5AXAA 4A8PA 2RHJA 4Q4AA 2PH7A 4N3CA 3DEIA 3B6ZA 3ONEA 4LMAA 4MYUA 4R0MA 2ONYA 1CJTC 2WD7B 5ENDA 3CUWA 1NYQA 4J43A 4EPVA 2A3NA 1EWKA 1ANKA 4AJLA 4MTCA 1KGSA 1PZXA 2CVZA 2FSGA 1SQ0A 4C0AC 3M2PA 1MAAA 3EG9A 2FA9A 2D1FA 4MLPA 2V5AA 2N75A 4MQEA 2CLOB 1QG4A 2ZW9A 3CCBA 4LZAA 2FW7A 4Q3EA 3WFZA 1F4LA 5H83A 2FG7C 3LUCA 4CMHA 4AF6A 1NLMA 3ZR4B 1R0WA 4XD7A 3U81A 4MJ7A 1VLVA 5DLYA 1AGYA 3KTAA 2IUUA 1A2OA 3WDMA 4D6YA 4BE4A 4DIUA 1Z39A 4A2PA 4Y6RA 2V1XA 3TUZC 1OIXA 3DSRA 4UD2A 4YRGA 2Q5OA 2HDNB 1QCDA 4FBGA 4GU5A 5J59A 1NV9A 2C07A 4WQMA 1LRLA 2D8AA 3MHTA 4DMKA 1VLHA 4KACA 1U3WA 2E49A 4ZCTA 1SKYE 5FDFA 1KKLA 1NLYA 2ORIA 5EWMB 2ZJ7A 3HYTA 3V1YA 2VLBA 3OQ1A 2A1UA 1OKKA 5C4GB 4INPA 3WLIA 3T1NA 2R3SA 1E2MA 3I76A 1A9XA 3AVPA 1FX0B 2QU8A 1ECLA 2GRJA 2J0UA 2YXLA 4YLGA 2FFRA 5DMXA 4DN6A 2BGWA 4DUPA 3AETA 4ER7A 1DHTA 2V6IA 4LSWA 5GVRA 2A78A 4LQ4A 3COZA 3ZH2A 2DHRA 5JJCA 4C4OA 1T1JA 1E2NA 3N2KA 3QY9A 4O2BB 2IUTA 4GGMX 3DNFA 3DWGA 3A2KA 5JYCA 2M98A 4JDPA 4WA7A 1Y5MA 2GZRA 3HB0A 1EDDA 2CWWA 4GWLA 2OWEA 2OBYA 4PLFA 3T7RA 1NR5A 3JQPA 5FTLA 4FYIA 3ZJ5A 2EWMA 4ZVTA 4J4TA 1XVVA 2QN1A 4CKWB 4PEVA 3CX6A 4X6XA 4AJ2A 4HI0E 2MYUA 5GTDA 1S3FA 2NN3C 3HJNA 3IQXA 3LGXA 4IFIA 2P5UA 4XE5A 1SD1A 3HYCA 3OQMA 3ES9A 5E6RA 2DERA 5I8PA 3ICVA 1N0HA 5T64A 1GPNA 3A4MA 2C1ZA 2XGGA 3RVOA 4MV1A 2J7PA 2F6RA 3T7EA 4O5AA 4ZYWA 4G1BA 2FSSA 4B6QA 4XYEA 4GBGA 1ZI8A 4Y0AA 3TFWA 3D0QA 1W8DA 5CEJA 2GAFA 1U8FO 4AYXA 2OHJA 4JUIA 2EFYA 2ODQA 3OCZA 3I39X 4HAVA 2GHTA 5FTJA 4KPUB 1XEXA 2F9LA 2L82A 4BO3A 1TM3E 3MRXA 1VBKA 4URFA 2KB0A 5G0TA 1JR3D 7YASA 4XVHA 4LHSA 2LIVA 2CV0A 3VNUA 1DC8A 2BF7A 3NUGA 4BP3A 4Q03A 4Y1FA 3I2KA 1C29B 1D6MA 3OQBA 4AECA 5D87A 1G5HA 1JB9A 1EFDN 3D2CA 1N6HA 3HLYA 3LIPA 4H77A 4OL9A 3WYFA 4AG6A 1I7QB 4J0CA 5DW0A 4ZQFA 1IWBB 5DU2A 3GLFA 2IHBA 4HPJB 5C31A 3A6JA 2FEWB 3P5BA 5JYBA 1GTG1 1IG0A 2YIMA 4NS1A 5AKXA 4MS4A 2NP7A 3T99A 3L8HA 1MX9A 2M6SA 2ZANA 3DMDA 1A98A 4K88A 1BYIA 5ALVA 1QVVA 2J0QA 1AQJA 1RDFA 5IM5A 2AFHB 3AEKB 1II0A 2IZ5A 4DCJA 4EUFA 2J0EA 4NYJQ 2YYYA 4QXRA 4RA6A 2PO5A 3ESZA 1VG0B 4C0LA 3KQUA 1RZRA 2WSMA 1NNSA 2O5VA 5F1KA 3TLBA 3G17A 4BMXA 4Y6GB