2FG6C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
321
structure length
321
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ornithine carbamoyltransferase
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 114
structure length 321
sequence length 321
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg6C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg6C01
1F1BA 2G7MC 3KZNA 9ATCA 2HSEA 1JS1X 3M4NA 4AM8A 4NF2A 1EZZA 1AT1A 4A8PA 1DXHA 4AMUA 3D6NB 4F2GA 2BE7A 1OTHA 7AT1A 2AIRA 5G1OA 1RAGA 1RAIA 3R7FA 3SDSA 4EKNB 3Q98A 3L04A 2QG9A 4KH1A 4KH0A 1XJWA 1D09A 4E2FA 4JFRA 3D7SA 1RAAA 3M5DA 2OTCA 2I6UA 2FZKA 5G1NA 3TXXA 2YFKA 4A8HA 6AT1A 3UPDA 4ANFA 8AT1A 4FYWA 3L05A 2AT1A 1DUVG 1AKMA 4WTOA 3GD5A 1SKUA 3AT1A 5ILQA 4KGXA 4EP1A 2RGWA 2ATCA 4KWTA 5G1PA 1RAFA 3E2PA 1TU0A 2P2GA 1TTHA 2BE9A 1RAHA 3L06A 1A1SA 2A0FA 3KZCA 3LXMA 4FYXA 4F04A 3KZMA 1C9YA 4JQOA 1Q95A 4OH7A 1RADA 1ZA1A 2FG6C 2FZGA 4JHXA 3M5CA 1ORTA 1EKXA 1PVVA 1RABA 1RAEA 1TUGA 1R0CA 2QGFA 3M4JA 4BJHB 4A8TA 2FG7C 3MPUA 1R0BA 1I5OA 3L02A 3KZKA 4KGZA 8ATCA 3R7LA 1RACA 4AT1A 3GRFA 1FVOA 3CSUA 1ZA2A 2IPOA 4H31A 4KGVA 1ML4A 3KZOA 2W37A 1FB5A 3TPFA 1ACMA 2H3EA 4FYVA 5AT1A 1NBEA 2EF0A 1EP9A 1PG5A 1VLVA 3NPMA 4FYYA 2FZCA 4IV5A 3R7DA
chains in the Genus database with same CATH superfamily
1Z3IX 3CV3A 4RPJA 3AY6A 5I7RA 2HJHA 4ASUD 4RE5A 1XTVA 3A10A 1WUYA 1GGEA 1JDPA 2WFLB 1FFAA 1JE0A 1NATA 4B35A 2QKYA 4XD7A 1NN5A 2QSUA 1VKHA 3COVA 4P58A 2OV2A 4I6JA 4QRDA 4CR7A 3R9XA 2IU6A 4P35A 4A8JB 5LLTA 1HPLA 1I30A 4GWKA 1WPGA 4ETMA 2GCGA 3JYPA 3AF2A 4RSMA 3OJEA 3FF1A 1KTVA 2X7HA 1CUJA 1XCPA 3UMRA 1FYDA 2C2YA 2GUWA 1UOEA 2M6RA 5CRIA 2QTWB 2JJYA 4P3OA 4W5NA 4BEBA 2P9FA 3IO3A 5A5EA 2CKMA 1B73A 1CF9A 4WNIA 3CVUA 3AWDA 2CMFA 1WSAA 1E96A 3QRWA 4QYSA 5KYTA 2IFTA 1JKIA 1U04A 2W6ID 3F4BA 1XJWA 2HCFA 2IHVA 3MFYA 4RY2A 4EGQA 3ST7A 4D8YA 1D6MA 4ND5A 4W1SA 3C3JA 5H80A 4EEKA 2XYPA 1T10A 1WHSA 1BIFA 4F4FA 1JHQA 5L3RA 2D2VA 5A1TA 4MJLA 4CIAA 2PZFA 3L18A 1C14A 2C00A 1E1DA 1T0HB 2GTHA 4Q4DA 1UPXA 1Z6PA 5F7JA 1JE1A 1JHUA 4MRAA 2JBAA 4QVGA 4QG3A 4AS3A 3Q3CA 3IAAA 2AT1A 1DOZA 1E7RA 3O8DA 4KXYA 3QPCA 4JROA 3HG7A 5E2IA 1NUUA 2AKYA 2C5GA 3H9EO 4LVCA 3TAHA 3UENA 4ZI3A 1X7DA 2V6GA 3E2PA 2FWRA 3KAKA 3FDJA 2CMKA 3SHQA 2ZT7A 2W71A 2DQKA 3M6IA 4R1TA 3WBJA 4OYYA 6REQB 3BWCA 4GZ6A 4O4LF 1STOA 5K0EA 5EXDA 1OLOA 4GLBA 2AFHA 4UBIA 3L06A 2P41A 2FRVA 1Q7EA 5HP4A 1DSSG 3INRA 1MJNA 1J4AA 3HADA 4RZHA 5DNAA 3THWB 4ARUA 1OH6A 4ZC1A 4CG0A 1R0XA 5KX5A 4K9MA 4Y6RA 4ZQBA 3HEBA 2HU2A 1Z4NA 3BWXA 3TL3A 1KDTA 3QHAA 3TPCA 1ES9A 1QXSA 4PC7A 4DY6A 2JGDA 2PK3A 2IH4A 1AHHA 1U02A 2FA9A 3H2IA 2PZJA 3D7NA 2P77A 3SBXA 2NU7B 2NP6A 1P1JA 4JJEA 5LDGA 1V9SA 2HSWA 1FTQA 3DD5A 2JK0A 4REQA 1J0AA 4B46A 2WP8J 5DI3B 1C5KA 4DJTA 3TJMA 5KYUB 4PLFA 3NXKA 4LOIA 2BFMA 4P5EA 4JL6A 5TGTA 1KTIA 4G0ZA 4HQ0A 4PLYA 3CH7A 2F8MA 1Y33E 4HY3A 2X22A 3H7IA 1NQUA 4O4LB 3DBRA 5DX8A 1YZYA 2XDYA 1MAHA 1M0EA 2VPWA 1P9RA 4H4DA 4KRFA 5LP6C 3GMIA 4RTSA 2Y67A 1WE2A 4BQOA 3OKFA 2D2IA 4RTJA 4BL5A 1ONPA 1M74A 2D1RA 2NO6A 3KAPA 5FQOA 2X0KA 1QLJA 2EZ4A 3GX1A 1R6TA 2E4WA 1IN4A 3PHHA 3QPDA 4B47A 3CUWA 1BTOA 1JPJA 2BRUC 3IILA 2EWMA 4TX1A 1GFIA 4LRUA 3I76A 3O9ZA 2WTUA 1UFVA 3DYBA 5FTMA 5KNDH 2C7PA 1KWKA 4Q4HA 3R3VA 4JC4A 1MABB 1XT6A 4BVEA 2J9GA 3BF7A 3HJUA 5NULA 4GQIA 4ND4A 1P75A 2C5FA 1QVAA 3RC7A 3SS7X 5L40A 1H85A 1U2PA 2B1QA 1OTYA 3SLKA 5A4FS 4CCWA 3UXEA 3TS1A 4AN0A 4R1NA 4M1OA 5ETJA 1SQ0A 5AKIA 2VP4A 1J8QA 3MT8A 1Q0ZA 3DV0B 4FE4A 2IJGX 4LJ9A 5DNYB 2VJKA 2OFOA 1EEXB 4BGUA 3H16A 2R0QC 1Q20A 3TINA 2FWNA 2PFKA 1YNOA 4KRGA 4F5YA 4CTOA 3IT0A 4G07A 2GHQA 5ALGA 4EBFA 2LNDA 4ED9A 1T8TA 1FX1A 4Y1FA 1CUDA 4JLDA 2UXCB 1E3TA 2HCJB 3GVIA 1EDOA 1IY2A 2AX3A 3PVCA 4LHVA 4FKBA 4QXQA 2NU6A 1FTYA 1YZLA 2WKPA 4XRRA 3UMYA 2BC9A 1KHHA 1LI4A 2HJVA 2JCXA 2PBRA 3LF2A 4WGGA 1GKIA 2QN8A 4M6WB 4HEQA 5IBRA 5EP4A 2D00A 3H8WA 3V7UA 3HA2A 2DFLA 3L40A 5CIQA 2DHDA 4W9MC 4HYQA 5COAA 4G9BA 1LPSA 2PZEA 4HLQB 4LBWA 2DECA 1OLUB 1TKRA 2Y93A 3H1FA 3OX2A 4QO8A 2P1RA 1B6SA 1GL7A 4P1ZA 1F14A 2IZ5A 1GPKA 1KFBB 3JYHA 3WGJA 4W5QA 2VYVA 2HXYA 5LOVB 1QK4A 4FOOA 1QG6A 3A3NA 4N49A 2QX4A 1Z7GA 3CLTC 1RLUA 4MQEA 1KO1A 3A9TA 3LUKA 3PX3A 4H15A 1JI0A 1U0SY 1JIQA 2B6HA 3AB7A 2ACKA 3CUEF 3RWBA 4O08A 1JLRA 1DAMA 5ECWA 3GOQA 3O7WA 4IIFA 2EZTA 2G08A 4F7WA 2P9JA 4FMDB 4LRSB 3PHLA 4R4JA 3PXUA 1KY5A 3GJ3A 1G5IA 1FFEA 4IFEA 4NR0A 1JIIA 4ER0A 1IXZA 2E7ZA 2OXEA 2R5FA 4LZOA 4LX8A 3U44B 3FBWA 4HVAA 3U61B 2WTXA 1QDLB 2QT9A 1C8LA 1ZN2A 2MINB 2HQRA 5FAKA 3ZJVA 3I3OA 1VJDA 4J3FA 4LSMA 3L4BA 4FXPA 4Q93A 3U5ZB 3MBOA 1YDHA 1UKCA 2H9IA 5A4AA 1FE8A 1GCIA 4CTMA 5AVVA 3SVZA 4ZXPA 4DW8A 1V47A 1SCJA 4P5DA 1K7YA 1QX4A 1VGVA 5BR4A 1UBGA 5CB6A 5K05A 3SS8A 1FVFA 1KK1A 3H9CA 3W04A 3JQDA 2G5GX 2ZQ5A 4KPYA 2FUCA 4CDMA 3HWSA 1UFRA 2O7NA 4DWVA 2D59A 2ACEA 2FW9A 1Y8ZA 2FK8A 2ZFUA 3DZHA 1SCQA 4G1VA 4ZT7A 3FYTA 1AM4D 3BN3A 4UUOA 5TRTA 5I4KA 1E2EA 1LFAA 4FFWA 4GXQA 4Z86A 4LJKA 4CKCA 3BJEA 4JA0A 4OHCA 5JRZA 2BGNA 5C52B 4MUBA 1ZFNA 3HJCA 4LWOA 3IMFA 4RORA 4BFSA 1RFGE 1N6NA 3BKWA 4KAAA 3KSAC 1RI1A 2WUFA 2XB4A 2XUJA 2YCBA 2R85A 2DVMA 2G09A 2G4CA 1U8FO 2Z43A 3IOEA 1AV7A 4M86A 3WL6A 4E3ZA 1TIBA 1P5JA 4HDCA 5U4XA 3DBIA 5H9VA 4IG4A 4X1YB 1YBAA 5DM4A 4PX2A 4MW5A 2VUIB 5LN1A 1B23P 2GT1A 2QW0X 3M70A 3ESRA 1D7OA 1MV8A 3Q5DA 4X1KA 5DH9A 4IZIA 4N0MA 3U16A 3CR7A 1V3VA 1HYHA 1ST2A 1KR2A 4G1EB 3LHDA 3QBDA 4M7OA 4AMUA 1DLIA 1E18A 4H7JA 1LSJA 3FTQA 3HC7A 4Q3CA 1H9AA 4MJ3A 4R9UC 3EVZA 2QPAA 4J0DA 1Z7WA 2BFEB 3FUCA 5E6RA 3WQSB 4PN3A 1NXWA 5CFPA 2UZ1A 1N3IA 4JSYA 2H2WA 1I36A 1VE9A 4KLRA 4KP7A 4C1NA 4FP9A 1HFJA 2PD3A 4AD8A 4ZOQI 4NXMB 3ZN2A 1K7FB 4L4UA 4HX2A 3QXGA 2N1BA 3EFHA 4IGFA 4YRIA 1NI3A 4ND1A 3ZXUB 4NPAA 1Y5RA 1FZTA 1AO3A 1EVIA 4HUQA 4QEKA 1OT5A 2AZDA 1J49A 4G1UC 3KS9A 2R8RA 1KPGA 1ENZA 1ZM3A 2WE8A 2HDHA 4I2NA 5JQGA 3DC7A 2CNOA 2G9VA 4NKRA 1NV9A 1IE3A 5JZBA 3Q3HA 2PH3A 3NATA 4LCBA 4B2LA 4LRWA 5DE3A 5IM4F 2I2CA 4GMHA 1EWKA 1K92A 3MT7A 2CUTA 2OAEA 4CTJA 2O7RA 1Z2NX 1QHEA 2V74B 5EI5A 3IODA 4KXUA 2R60A 3TQHA 4YRNA 5IVPA 5JFTA 1NUPA 4D25A 4YTEA 3T7AA 1E2FA 4RHFA 2JGEA 3QYPA 1RBMA 2DFVA 3A04A 4WSOA 3QTLA 3ZCSA 1TU0A 3STWA 4ZZ1A 2OKGA 4D8WA 1FXUA 3R6LA 3AM1A 5EIWA 3N05A 4DEXA 4D41A 1EUDB 4DNFA 2OWEA 2VSQA 3BD7A 4ZCSA 1VDZA 3D7MA 4MTLA 4XARA 4XUCA 721PA 1Z4PX 3ZWCA 4YASA 5DWDA 1EGQA 1M5UA 4DYVA 4PC1A 1PWHA 2ZJ8A 3B7WA 3R4VA 4LJ7A 1AKNA 1JQBA 3PNBA 1XZJA 4E5VA 5AXBA 1BXRB 1JLMA 5AVJA 4CM4A 5C18A 5PNTA 5K4GA 1F6WA 1B00A 3ERCA 2DFNA 3KV1A 2JFHA 1PZXA 4DE5A 4TROA 1C7RA 1JLHA 3C3CA 1A76A 4JBNA 3ZGNA 1PR2A 1TLLA 1YDGA 4O3MA 2RK4A 5CW1A 2IUYA 3PGJA 3H1AA 2NV6A 3TTXA 3B6ZA 5KKAA 1ZI8A 2GN4A 4HZIA 3QLUA 3GFFA 2AF3C 4V0SA 4GUDA 1YZGA 4TT8A 3EY9A 4IKPA 4BRSA 3U26A 3EGVA 4CLRA 2CNBA 1CJTC 4A8JC 1UPTA 3NCHA 1L5WA 1HE5A 1UOQA 3Q6IA 3VDMA 4AJ1A 2C82A 2WYOA 5KQGA 5I45A 5FBWB 1IBLB 3S4YA 4O0LA 1HBJA 2DBVO 2ID4A 4FYVA 4INPA 1I6MA 3TVTA 1N8KA 3BXEA 4MB6A 4LC1A 4C4PA 1QHYA 2ISQA 4YCLA 1HSZA 1ID8A 3E7PA 1DJQA 2R8ZA 1WX1A 1LWNA 4ARSA 5DGTA 1ZH2A 4MB2A 4KR6A 5A4KA 3EXIA 1L3IA 1M6HA 3OX3A 4ZCRA 2ZTUA 1QYRA 2ZU0C 2CFSA 3G2KA 4WBSA 1YGYA 1PQ4A 1OYWA 2ZBVA 4CLOB 4K86A 3T1TA 3OC0A 3ZZUA 1XVUA 1O0SA 1VCHA 4IJKA 1H6DA 2BFDB 1YS4A 4M1TA 4R2XA 4YA6A 1GZDA 4LJ6A 1W0JD 2EU8A 4BKUA 3VBCA 5H3CA 1E9SA 1W8IA 1KI9A 1ZCZA 2PR2A 3CX8A 3OZCA 3SQNA 4C0WA 5B4UA 5JNRA 1Y1TA 2J3IA 1K4KA 4EW2A 1PLJA 5EXEA 1OV4A 1SGWA 3LY9A 5AM5A 3JQFC 1KYVA 5I7HA 3LF1A 1HDIA 1TF2A 2AG6A 1HEYA 2W2NA 1UAGA 3L8EA 3QFSA 1EAYA 4XIGS 5CR9A 3RVPA 4DLTA 5L9AA 4EVIA 2PGDA 1USVA 1QPGA 2I8LA 1B15A 3IBYA 5K2MA 4EFKA 4FSDA 2Q45A 3O4HA 5J2UB 621PA 2R6GA 4G0QA 2M32A 4JI2B 1Z82A 1ZONA 5JC8A 4HGPA 1WKVA 3GLFA 1N6OA 3WLPA 2O19A 4A91A 3VOTA 4IJWA 4KWIA 2H2AA 1TUBA 2O50A 5KNCA 4XFDA 2OC9A 5TLSA 3UXYA 2IZ1A 4JUBA 2I6UA 2P6RA 4ITVA 2YMQA 4EWLA 3LTEA 3ACCA 4FQ8A 2BTOA 4K9KA 4Y2XA 2B36A 4HX9A 2GRJA 2V7XA 3ZQ6A 1Y3AA 2FZEA 3F9RA 2XEXA 3JZIA 4LMRA 4YT8A 1A9SA 3KP1A 4ICIA 1UBTS 3GEPA 3QVTA 5C3UA 4MPTA 4I81A 1KAMA 2BUBA 1NMZA 3HFRA 1APBA 3DKPA 2I66A 4GZ5A 4PGMA 4UPDA 1U8ZA 5EHNA 2EFYA 2X3YA 1W2HA 5A62A 3FYHA 4YRDA 4RMHA 1BDIA 4X1IA 1QRSA 1OZ0A 2BELA 2FN4A 3JQPA 4TMKA 4W99A 4NZNA 1HLDA 4QD3A 4CI9A 3IKMB 2K5UA 3NVAA 3WWYA 1ETHA 1NXSA 5AMXA 3ZC3A 4BLOA 1N6RA 4GI5A 1KP2A 4RIEA 3ZHQA 4ASUA 2ZRAA 4CLDA 6PFKA 1VZ2A 5CBKA 2V0NA 1XEWY 1KY2A 3EARA 3FMFA 2WZBA 4NS1A 5FPPA 4EKYA 3K71B 1RZRD 1FP2A 4HAYA 1T91A 2ZYSA 4CQLB 1EGAA 2ZT6A 4C21A 4BE7B 4NIMA 1OJ7A 3D3WA 2I7XA 4LKRA 3O84A 4NNPA 2HXSA 1LUAA 4LA4A 4V1CA 6ABPA 4X62B 1XFAA 4G0MA 1AQUA 2R6AA 1O7JA 2V1XA 3S2SA 1DC5A 4IIVA 2WJ4A 1T6YA 2W37A 2RB5A 1A7AA 4PZAA 2VCEA 5H1YA 2QJOA 3LBNA 5AT1A 3TFWA 3C4VA 3RAEC 2B4TO 2JIPA 5B3KA 1JTEA 4LXQA 2EBWA 1QDEA 1DU4A 1B1AA 3R76A 5BXQC 1GCUA 2DAPA 2P5SA 4XWAA 1IPFA 5BMVB 1ND6A 5CG2A 5F1PA 2UKDA 4C7OB 3KOMA 2FKAA 2GCOA 2BR4A 1YL6A 1Q1ZA 1CK4A 1A72A 2D13A 2NUBA 4QPPA 4DLBA 4ENWA 3E70C 4JB3A 5HZKA 1YI1A 5CDFE 2K2WA 4PNPA 1SEVA 4FYJA 1Z4IA 3LTNC 2NTEA 2CHGA 3DTVD 3P94A 3CF4G 2I3ZA 2QBYB 1FVHA 3AKDA 4KG7A 2FMIA 4V39A 4R16A 4YQFA 4FM9A 2XF8A 4WZBA 2WAMA 1PW7A 4PO3X 2GPJA 1QTIA 3BFVA 1W59A 1X38A 2NZ2A 3LY8A 3OLXA 3HSYA 4LYDA 2H1WA 2BFNA 2OHVA 2QR5A 2WD7A 3D3NA 4LTDA 3V5NA 3IVCA 1JFSA 2MSDB 2HD4A 2CMDA 3OPNA 1F0PA 1AK1A 4YRLA 2C7BA 3SF0A 3OJLA 1UF9A 1MB9A 2C7RA 3DMPA 5ELMA 4KO8A 4ZJYA 4QUGA 2X23A 3VR3D 3SNHA 3EF3A 4GI3A 3IEPA 4WAUA 4F96A 4X9XA 1THGA 5DO9A 4FFNA 3BWYA 2BBWA 3JVEA 2UDPA 1RWVA 5LXTB 5CA1B 1T5DX 3FVRA 4U9UA 5K4HA 4RTOA 1TCBA 2AGVA 1PLLA 2HA3A 4XW2A 1DC4A 1ZPDA 3GEIA 3AEQB 1QHNA 3QBJA 5LZ5A 1X14A 2LIPA 5GOZA 2BMVA 1TJPB 1E9FA 2IF2A 2HWUA 5TVGA 4YLYA 4OCZA 2QLJA 3VJKA 3HNRA 3VTAA 3HKDB 1JMYA 2ZAGA 3UJBA 1VBFA 4ZQHA 4J9VA 3T1OA 2GETA 1JNXX 1QG2A 3HDHA 4L9RA 3NDBB 1WP9A 3IRVA 3KQTA 4UTRA 1DWUA 1KMHA 3FRIA 1WAMA 4L15A 2MIIA 4E2ZA 5I7FA 5F2EA 2RSLA 2V65A 4WBXC 1ZVVA 1XTBA 3PIIA 3WYAA 3K9CA 1R00A 4ZT2A 3RRJA 3RB8A 5E6SB 3H65A 1P1KA 4Y2JA 4C4ZA 4CODB 4QPDA 3WRVA 1Q7BA 3WA7A 1L4BA 2FG7C 3HZHA 4I55F 1A1VA 3FE2A 2REBA 3ZLVA 5JYDA 4JGGA 2FLVA 3HRHA 4KXVA 3ZWXA 4N5NA 3ZE9A 2RGUA 3BM5A 4Q4JB 2G1KA 3KYCA 3NM4A 4ZYLA 4ZMSA 2WJGA 2DLCX 3R7LA 3LDUA 2EJWA 3QYAA 3WQHA 5ABPA 5BURA 1HETA 2AWNA 1PT5A 2PUWA 2PKQP 2GZRA 3ZYZA 4B3GA 4DMRA 3GRKA 4IH1A 1IIRA 1IWOA 3DDUA 4WESB 1N9GA 2FUKA 2A1UA 2XB6A 1OFUX 2Z1NA 5KU7A 2DXIA 4S1OA 5DHPA 3E5MA 2VS1A 1JEJA 3A4VA 4ND3A 4ZKEA 1XLTC 2AXNA 3ZE8A 2PU7A 1E3LA 2WSYB 3KKZA 5EQDA 1VLVA 3C6QA 3M4YA 4F85A 5L3VA 2PXAA 2EL7A 3PF9A 4CLXA 2NT4A 4UTOA 3CW9A 1XVLA 4KR9A 3G0GA 1CJUC 1Z13A 2BAGA 3OMXA 4NJEB 3FRHA 5EEGA 4MUNA 4IX9A 4ER6A 2I54A 16PKA 3DCYA 1XP5A 1PT6A 3C1AA 1YFJA 3CZQA 3L92A 1X9GA 4L8FA 3E8SA 3P96A 1C0IA 1DIAA 4Y2SA 5JTTA 4K81B 1ZK0A 1VQ1A 1FFWA 2C2HA 2HDWA 4QT0A 1L5RA 4ZOLF 3OKPA 1TW3A 3GELA 3ORRA 2OCKA 4M1EA 4U63A 4FZ3A 1HLPA 2ZSFA 4FZJA 2GBCA 1O1YA 1U4NA 2W8BA 1KRXA 1CBUA 1ENYA 3V4VB 1SCNE 1PLKA 4IRUB 1KQNA 3V1TC 3OM8A 1JA9A 2CLLB 3Q98A 2J4FA 5K01A 4HDKA 4EI8A 2NSHA 3L0YA 1YT5A 5AJXA 1A7KA 3RJTA 4QTYA 4L73A 1SXPA 5KSZA 4LZAA 4OBWA 1NDQA 4WZAA 4GR5A 2I03A 1KFJB 2NU8A 3NHBA 4WPGA 1EHYA 2EIHA 2YKGA 1VJTA 3GT0A 3EGWA 3PHBE 4HOYA 4HWKA 4ID9A 5FYDA 5A6VA 1OA0A 3ZW8A 4PZ0A 1IK4A 4OYHA 5FNVF 2D5LA 1M6EX 3HLTA 2WABA 1F51E 1K7SN 3FYUC 4EJ2A 3ND9A 4RABA 2LKDA 3HFJA 3HN7A 3O75A 4S0XA 2X15A 4DB4A 3FHTA 5KSPA 1PFVA 4YJHB 4TSFA 3SJ7A 4ZI7A 3L8ZA 1A3CA 3ZE2B 5GM1A 3AB3A 1UKBA 3KVRA 4JSRA 5HCUA 4A3SA 3TGPA 1BROA 2A8YA 2R48A 4QSMA 2XW6A 4C0XA 1HYBA 2P3SA 3Q3JB 1GHTA 2FLWA 4ZWNA 1O77A 5HJ2A 4MQMA 5FX2A 5LR6A 3OIGA 1R66A 3Q8LA 2YXEA 1SQ5A 2O20A 3H4VA 1E9AA 3EW9A 1Z7YA 3OLCX 3P9XA 5KCMA 2F1IA 5CT4A 5I4IA 1XXHB 1JU3A 1TVCA 2GXQA 2XMSA 3FPSA 4B83A 1DAHA 4HWOA 1X80B 5DLPA 2JRLA 4ZQFA 3TD9A 4C07A 4BFLA 5KAPA 5FNVB 3K0AA 3MBIA 1DGQA 4PGFA 2XZLA 4I2VA 1XNHA 2VHTA 4S1VA 1UC4B 4NICA 1BDMA 2LIVA 4XCVA 3TL6A 3LCMA 2PUAA 3ELYA 4M7PA 4LGMA 5JYBA 1JP7A 1V7QA 5J58A 2ZBQA 5FLXA 1W34A 4JNCA 1M2EA 1X7YB 3LCUA 1VSVA 4M7RA 4NX2A 4W1QA 3RTCA 1PNTA 2H5JA 1WU7A 1YSCA 3ND5A 3IQHX 5FLKA 1ZOPA 4HWSA 3IP1A 2HKIA 4MAFA 4C4RA 3NCTA 3GB9A 5ALFA 1NPDA 5T8KA 5I7OA 4M1QA 1EDDA 5ILOA 3DQPA 1T36A 4JLSA 1YE3A 3G9QA 3FM9A 1AGNA 4CKXA 2VQSA 5FAXA 4KMRA 2WHRA 2GEVA 4OYRA 1HYEA 1P44A 1VI5A 2RKOA 3BCRA 4WKCA 4PGGA 5DLQC 2IH5A 4EUFA 1FS4A 1OYOA 3FDIA 5COQA 2AFIE 5ALSA 4DY4A 3VZQA 2CC2A 3BIWA 1MPXA 3LXUX 4KODA 3O47A 2PGLA 1Q84A 1DQPA 4O4IB 5P8WA 3AYXB 3RUPA 4CIVA 1V45E 4XWWA 1XTJA 2ZUCA 1MC5A 1YR9A 2AJDA 1TJNA 4X71A 4N47A 1J0CA 1TVMA 3DZDA 5LL6P 1P8AA 2PRIA 4MK4A 1TYAE 1Y7TA 2RJNA 2D1SA 1V5IA 3MWKA 3IP9A 3IPXA 4RY9A 2KX7A 1IOZA 2AN4A 4DDKA 4WXYB 1SD5A 4ZOAA 4H4EA 4ZREA 2AIRA 1FMTA 1X39A 4L75A 3QKRA 2CXXA 5JE8A 5LCXA 5CT8A 1SB9A 3V4LA 1IOVA 2WJ6A 4GRIA 3LKVA 2R7NA 1VE5A 4N82A 4HATA 2AEJA 4IJVA 5EHQA 5JUWA 4J0IA 4YFYA 3PJDA 1ZR2A 3BD8A 3FUTA 2EEZA 2QTGA 1XHFA 4KH0A 5FXMA 1IG3A 2IHNA 4JC5A 5H02A 1WZNA 1LNSA 2FX3A 1TTPB 2ATVA 4FDTA 3AERB 4IJUA 4QFMA 4DR1B 3HGQA 1RYMA 2CHEA 1WRBA 4LEIA 3DZGA 2OTCA 4QOHA 1VB3A 1FLDA 2WBLC 3O8NA 4BMXA 1IQUA 1UBKS 2A78A 1A4UA 3L8CA 1KOLA 3WA6A 4CF4A 1AS0A 4KFRA 3UMVA 4B84A 1MHPA 4F46A 2HLHA 2EBHX 2RGNC 5BWOA 3THXB 4I7EA 4JVSB 1ZR4A 1FY2A 2NVUB 1JA1A 1KP3A 1AMNA 1JHAA 2WD9A 3A27A 1G5RA 4RMIA 1MRZA 1P5ZB 2SCUA 1XZFA 2ADFA 4YI5A 4TWAA 1G21E 4WDRA 2ZVJA 2SNIE 1X9IA 2H7YA 3CZ5A 3OQJA 3NS7A 5B3JC 4MZDA 1HK7A 1QYVA 1V2HE 1VSTA 2X19A 4C30A 3WS7A 1BHO1 2GGSA 3IE0A 1C9YA 1E98A 1XMPA 4E09A 4D80A 5IJAA 1SXJC 1OMOA 5LMZA 2Z98A 1IAVA 4H27A 4WADA 3VKVA 3WL3A 4D4JA 2ZRHA 1OZFA 3L1KA 4KPUB 3DYVA 2PFSA 1Q77A 3THOA 4HSEA 1E1RD 3G8CA 5IXSA 4YCDA 4JBLA 2G3YA 4EHKA 1TCVA 3Q7EA 4BWGA 2Y8EA 1L9XA 2ORED 3QX3A 5JPIA 1DZ3A 1BCRB 3KUCA 1W0JA 3D6JA 4FQ5A 1E3IA 2BMDA 1CTQA 3ONDA 1A8UA 1MC1A 1OBCA 3T06B 1A2KC 5HIAA 4DV7B 4EY4A 8MHTA 2P9GA 2C4HA 1XL1A 2EHJA 3DPUA 3KO8A 5BMOA 3SKXA 1Z07A 1QF7A 5IX8A 3JVDA 3CF2A 2BMAA 1U0TA 3K1JA 5ARDA 2H31A 4ABTA 4Q3DA 4FJ2A 5F2OA 1S96A 4EJ6A 2IZ7A 2Q0HA 2SHKA 4XB1A 2GKOA 3VAYA 4AZWA 5JXIA 2L19A 3T3PB 1LLDA 3OZXA 3EOAI 2PR7A 3NTQA 2WJYA 4RSHA 1HE4A 2BR3A 4UEKA 4Z9AA 3R5KA 1MOZA 4GOXA 4W1PA 1PQYA 1YDWA 2BH9A 3PQ3A 4ESEA 1LLFA 4N8EA 4ND7A 1PNRA 3KOOA 3QV1A 1PJ8A 4NV0A 2DWCA 1S8FA 3W77A 1QFSA 1ZD4A 2CCGA 2RH8A 3QLVC 4GM0A 2A33A 3F5FA 1QM5A 4KQKA 5DOZA 4Q4LA 4KFTA 3DWFA 5K0NA 4BC1A 4BLSA 3S8EA 4AIRA 4EPVA 3AFMA 4ITRC 5DBOA 4U6QA 3JX9A 4EECA 1KI6B 1F1JA 2BHNA 3ZTTA 5JYCA 1D1QA 4AQYB 4LDRA 1X1BA 3FROA 2HTEA 2Y1GA 4JC0A 5C31A 2Y0BA 1G4AE 1YOVB 3AW9A 1Z2PX 3G5LA 1Z0SA 4I99A 5IVKA 1DFGA 2ZWPA 4EDFA 5H9WA 3AFHA 4HWTA 2BP7B 4EPXA 2BEUB 1CY4A 1QU3A 3OT1A 4MR7A 5BRJA 3W34A 4LYAA 1DHRA 4BCBA 5AW7A 4M0KA 5HKKD 4I1VA 2ZTVA 4MIYA 3RGGA 1HL3A 1II0A 3EE6A 5LD2B 3ZGZA 5EHZA 2QM7A 5CPFA 1EDBA 5EMLA 4GF5A 2HCTA 4EG0A 4ZZ2A 3CC8A 1DVRA 3PCRB 2B2XA 2B82A 2P79A 1YKSA 2V4UA 2LDBA 3F8WA 1SVLA 3K9GA 4JFRA 4AJNA 2JJ1D 3GJ4A 5TT1A 1NJ1A 2W2OA 5D85A 5EZYF 3WSTA 4YUWA 2CJXA 2J30A 1RZRA 1ZH0A 3RRBA 3LLCA 2NAFA 2FUG6 3EMDA 3DE7X 2GEBA 1KEVA 2J9FB 3ASVA 3NWBA 3PVSA 5F4BA 4JI5B 1U0HC 4F9EA 1TM5E 2IELA 4BE9A 5LU8A 4N3NA 1K5GA 2GZ2A 5E9AA 2DWOA 2CNDA 4YRSA 2QVZX 1E6UA 4JVMA 2K6GA 4HB2A 4QBKA 4EW6A 4BAZA 5IJ9B 1XHEA 1CQIA 1MVNA 1C3LA 1ZSVA 3H3JA 3HBFA 3T5GA 1IJBA 1Z26A 4HNRA 3L2OB 4KBGA 3TVDA 4YRBA 3KETA 3M9WA 4YDHB 5LZ8A 3KJXA 1SG0A 2FSSA 4L95C 2VK4A 1WIWA 3SHTA 3BL6A 3A9UA 2O2DA 1N2IA 4YJFB 3S5JA 1W5TA 4XWYA 4YS6A 3DLIA 4JP5A 4PLHA 2PY6A 4XWKA 2DBQA 2A1TR 1GIAA 5HKBA 4GO1A 2D5CA 5D84A 1G3IA 4EX7A 2BFCA 2JFNA 4BKMA 1GU0A 3JALB 1OXTA 1UT5A 3CNEA 1EJ0A 4B79A 1EGMB 1R0CA 4Y8VA 2XCLA 3LA6A 3RG2A 4BNHA 2QG4A 4XQGA 1SHLA 4OKSA 3DDSA 1C2YA 4YR7A 5DDIP 1A9XA 3BSYA 1YRLA 2PKXA 3DTVA 1GKUB 2QTNA 2ENUA 5G53C 1JPVA 4Q0MA 5EIHA 2D7CA 4OFXA 3H19A 3Q15C 3U4IA 1TL7C 2LGJA 1LSUA 2JANA 4G5GA 1SO8A 2CXHA 3PEFA 4PPGA 4RTNA 4OJTA 5KVAA 4NE9A 2OXCA 4DDMA 1TUIA 2C4VA 2EC5A 3W5SA 3OLZA 2CFCA 2I22A 1CRWG 3AJEA 1SB8A 3UFBA 2JARA 3PWTA 1F1BA 1DKPA 4L4SA 5E9JA 1IXKA 5DPMA 3SC6A 3GLIA 2E9SA 1Q14A 2DKFA 1AX9A 1CUCA 3KYJB 3I6IA 4HR7A 1R2QA 4YT5A 5KVCA 3RIMA 1KJYA 1PJRA 3OCZA 4N48A 1E3DA 1MB0A 2FR8C 2CMGA 1E0AA 4KQXA 1FP4B 4FFLA 2DEUA 4GLJA 3MG9A 1NE7A 1TAQA 1W73A 1E6CA 3O73A 4WLNA 5AKYA 1QGUA 3N8GA 4I4IA 2W6CX 2R1VB 3M6MD 3PUHA 1A50B 4TKUA 5KMGA 4G4SP 1OC4A 1BMDA 2BE7A 2LCIA 2BCGY 1DRKA 2F3QA 3MQFA 5GTDA 1P91A 5EIBD 3M3PA 2C92A 2ZVPX 3VNUA 1TNDA 1TVKB 4AI6A 4WOKA 2OV3A 4YAUA 2AHRA 2Q3DA 9MHTA 1BO6A 1B0PA 3LK6A 4NDZA 4UBKA 1A9YA 1Z34A 1NLYA 3KHSA 3VM6A 2QSJA 3A6KA 4PZPA 3UA3A 1EVQA 3QPUA 4KIWA 1XCOA 5H81A 2JI4A 4UEJA 4A0SA 2VAWA 3ESDA 1V4VA 2QRPA 4WXEA 5GIPE 2DB3A 1HL7A 3P0EA 3VGJA 1KORA 3PLNA 1WXXA 2PSEA 4Q9IA 4EUSA 3L8GA 2V1UA 2J3JA 3PFCA 4ZN6A 3L7YA 2Z6UA 4D0GA 1OCEA 2Y4NA 3E4CA 4PAGA 1BN6A 2D1QA 3OF3A 4H77A 4YJDA 4HGQA 1OZGA 3QFTA 4YUAA 3LSYA 4C6HA 1M6NA 3DEJA 3W6ZA 1UOPA 3FRJA 4Q4AB 3SBEA 2ZYWX 3B2EA 1IPEA 2GBFA 1KARA 4XYBA 5TXGA 2AFIB 1NF8A 3G5TA 1E9VA 2GSWA 1V9CA 4GC9A 1I4TD 5IEBA 2ZIWB 1RXWA 2OCBA 4MO9A 2ATCA 1G7TA 4O4HA 4F2DA 5CX4A 1SK8A 4BUZA 2YVLA 4DT1A 4B7XA 1O08A 2NXNA 1TTHA 3PLAE 1MZPA 3CCBA 5IKOA 5LQAA 3FVVA 1HDEA 2C96A 1G6OA 5REQB 4RESA 3DD1A 4EB8A 4H1UA 5BOSA 4KZKA 2VJDA 4MUEA 1QNLA 1UMCA 3U3JA 3SMQA 4WJLA 3IAS6 3BREA 5I9NA 2O5VA 4L8LA 2WHPA 1JJBA 1S3SA 1RZUA 2NPIA 2M6KA 1JQJC 5H7XA 5I3ZA 4LOHA 4RSGA 5SZHB 1LU9A 3WWEA 3BXOA 2G8LA 3QUAA 4MJ7A 5SICE 3H97A 4FJ0A 2VP6A 1GM5A 1VBNA 3GEEA 2JD0A 1M1ZA 3M5PA 4FT4A 5LSAA 1IIBA 3DBOB 5AVZA 5HJ7A 4MS4B 5FRDA 4CPDA 2I4TA 2O4CA 4JI0B 1VKZA 3D5TA 1EINA 4M88A 1ECPA 3A2KA 1UK8A 5BN4B 3OZSA 2NW6A 4LVOA 2WJJA 2X8LA 2GNPA 3S0JA 1JWBB 1NX6A 2PU5A 1SBIA 1BJKA 4MQ5A 1ENPA 2H0QA 4O29A 2JKVA 2X0DA 1ABEA 5IU6A 1E3WA 3CQ9A 1BOFA 4DR7B 3F1KA 1LLQA 1N7JA 5DN9A 3RSZA 1XPRA 4XA8A 2HF8A 4RPHA 1MG0A 3G0CA 4MYRA 4WXRA 5EIOA 3EAGA 5EUBA 1SRRA 3C0KA 1KSJA 2C2MA 4WCVA 3AK4A 4B6FA 3P9CA 4NCJA 4AKHA 3VR2D 4IF4A 1K6JA 1D0IA 1HZZA 5HF9A 1EWYA 4FMPA 3WL5A 2QJTA 1FXWA 2YDYA 3Q3EA 5F7OA 1G20B 1VHJA 1ZM7A 1PW5A 2G67A 2ZE5A 4JMPA 5IAEA 1XVTA 5LWQA 3SIRA 4BNKA 2VQDA 2XCRB 1F48A 4GOJA 1T3GA 2ERCA 4IXWA 2JGIA 1AK9A 3OMLA 3FCAA 3VU9B 1J00A 3G9XA 4LYYA 2CDNA 2JFGA 2QD5A 3D6NB 3DH0A 4PBTA 5ALXA 3U3OA 3VU3A 3G8AA 4BX3A 3K0SA 4A15A 1PEKE 5HE9A 1U63A 1Z5ZA 3AF5A 4INAA 3LLMA 2FOXA 4PYOA 4R8SA 2VWHA 4UNNA 4B75A 1ZCFA 2FFQA 2YWJA 2IS1A 2XUDA 1NYQA 3GGOA 3GARA 3LUGA 1G9TA 1PS9A 3RROA 5K03A 1R9GA 2ZZKA 2BEKA 2Q5LA 2VHEA 5IRCD 3LY5A 3GIWA 5JCXA 2ERXA 3PUWA 2EJBA 4CMIA 4CMJA 1MOQA 3DJYA 2F3RA 3BB1A 4QDOA 4M1SA 3N6XA 1CUIA 1RIIA 4D57A 2PDAA 3F71A 4MVWA 2GUGA 2QUKA 5F3WB 2ZRNA 1L4NA 1RAAA 1O0BA 5HMLA 1GSAA 4Q05A 5JAOA 1SKYE 1KOFA 1GG9A 3BORA 2QLLA 5DLDA 5U9CA 1YZNA 8AT1A 4FZVA 4N5IX 1VIVA 1I7QB 1M6YA 3G5UA 2P1ZA 2EGGA 3ZHRA 3KPWA 4GL4A 3N3BC 5CCDA 3A9RA 1N7GA 4PQGA 3P9ZA 2VHZA 3WB0A 2P2GA 3TGWA 3E7WA 3P7MA 2V6IA 3DQQA 4Q6BA 3URKA 3UMMA 1YQXA 3JARA 2E4ZA 3P97A 2FSHA 3N0XA 5BPHA 4HVCA 1Q1GA 3WBFA 3FOCA 3WIEA 4AN4A 1WUKS 4RZSA 3EZ6A 3KFVA 5EGNA 3VZPA 1VJCA 3N59A 1B4DA 2ZG6A 4TM8A 2FG6C 2JA1A 3DE3X 3W2GA 4F8EA 4QHTA 4B45A 3ENWA 3WKEA 1Y37A 4JASB 1NBOA 2PIAA 2ZPUA 2ZBGA 1WXQA 3AF3A 1PVVA 2PG3A 1SC6A 2IKSA 3O8QB 1BJRE 1K8QA 2GZMA 3OO1A 3U17A 4ZK2A 1LGYA 1GL6A 1RAEA 3FFXA 3DHYA 3KR0A 2R5NA 5D87A 2FUG1 4XSHA 4YALA 3L84A 2GZDA 4JL5A 2NPFA 1C0KA 4HLUC 1FVXA 3H4TA 3VAAA 1JG2A 1EFUA 3S40A 3Q5GA 5AKGA 2VFAA 3AL2A 1ZUNB 2B99A 1TDJA 1WU8A 2PLFA 4PG6A 2Y1CA 3QKIA 2G04A 1PV2A 2ZI6A 3EF0A 3HFGA 5BN3A 1XNRB 1QS0A 3PQ4A 3FZYA 4E88A 1CUFA 1NLUA 3FWPA 3MQ4A 3RT7A 1DOAA 4CT5A 2IPMA 4OF4A 5CDGA 1S2LA 3M34A 1VYHA 4LOLA 3HR4A 3B6KA 1NVTA 1P81A 4CDNA 2C98A 4Q7JB 1OX4B 2COKA 2FF5A 1WCYA 3ROEA 2Z6QA 1V3UA 3PGVA 2G8NA 3B7PA 4LY0A 1SUAA 3DV9A 4FD2A 1DTSA 5LD2C 1L4YA 1ZU4A 2Q2QA 5DISB 5BORA 3X43A 3N2IA 5JVDA 3F3SA 1RPZA 2XT0A 3HXKA 5BWLA 1I0ZA 3NIWA 2HBRA 4RLHA 3DOJA 1GZHB 3FTCA 3JAWA 3A4NA 1P45A 3WO0A 4R5MA 4HDMA 1F8FA 3VSAA 3I05A 4II2A 3U4QA 1T1JA 4OLFA 3TRHA 3LXXA 4ZHQA 4BNYA 3PGA1 4GKBA 2NYUA 3FIJA 1E1LA 1NF9A 1QZUA 2MR5A 2VQ6A 2HA7A 4X97A 1CZOA 3NQ41 5J2TB 1NWCA 1FUUA 2VRBA 2D6FA 4G5OA 3JD2A 3VHRA 4KNWA 4P31A 4YVFA 4CG2A 2A0YA 4TTRA 4ZV7A 1DZIA 1DV1A 3NTLA 4DOMA 5E8JA 3GZ4A 2JCGA 3VYSB 2PL5A 2EGUA 3DAPA 4JUDX 4F2HA 1ONBA 4Y1GA 4BX0A 3KWFA 1J8MF 1VL8A 3PICA 4M22A 2XXJA 4NC9A 4EO4A 4DSAA 1RIFA 4FHZA 3BT7A 4D44A 1IOWA 3PXGA 4QVIA 3ADCA 4FYKA 3T7KA 3COYA 5DVZA 1ZMOA 3UGTA 5A9RA 4OI1A 3PCTA 1T9GR 3DTYA 3S2EA 3PEUA 1EFVB 1KDOA 4WOCA 3QFFA 3OX1A 4FUTA 5JCZA 2ZVQX 2OB1A 3A1WA 3FJYA 5KZMB 4RPLA 3M5DA 1OZHA 1T26A 3CZ4A 3MCZA 4RD3A 4A9AA 2P6NA 4PRYA 5LYJF 1UEJA 2FG5A 2X2FA 4YX9A 5ALDA 2AB0A 3PCXA 4BFTA 2JS7A 4D46A 1IJFA 2I9PA 2IX9A 1WMBA 4GC5A 2FEMA 5GWXA 1P0CA 5KYXB 1M2VB 3ME5A 4H59A 4TL7A 4JUAA 2YWFA 4NULA 3G2JA 3MTEA 4GZLA 5E2AA 4KOEC 3FKQA 4R40A 1JLSA 5BSMA 1F9EA 1OYYA 2H1HA 3GOHA 4R0MA 1CUEA 2ZRMA 5JARA 2OESA 2BMWA 2Z6AA 2R4UA 1DTEA 1DQZA 1XOIA 3H42B 4HRAA 3EXEA 3NW9A 3ZEIA 4BO6A 7GPBA 1GR0A 3G5MA 4YAFA 3WWZA 3PRKE 4ATNA 2YWEA 4CG3A 1WXHA 3THYB 3PYLA 2ZRJA 2HY7A 1YR3A 5ICSA 3IVXA 2ZZNA 3QY0A 4DG9A 2YC4C 2E2WA 1GTG1 1IZ0A 2AQHA 3I6MA 3QJGA 3AHJA 4OMCA 5IM5A 3H2SA 4K2HA 1OB5A 3CRW1 3QJ5A 4Q15A 1XRNA 3AVTA 2B1GA 3OEYA 4ND8A 4NYJQ 4AJ9A 4B09A 3IOYA 2NAPA 5EXTA 5F7ZA 2WJZB 3WTBA 5EMJA 3WXMA 1U7ZA 2O8VA 3AUFA 1PNQA 2IS6A 1G9XA 2NYRA 3GLVA 2E55A 2JW5A 3LYLA 3RTAA 3MTIA 5FLEX 1P19A 4OH1A 4YMUA 3F1LA 2GZ1A 3MD0A 3W90A 3DL4A 3DEKA 4OU5A 3MMNA 3A25A 2FJ0A 2GD2A 2XWJI 1BEUB 3O94A 4HPWA 4MRMB 2F4VB 2YHIA 2IYTA 4MQBA 1Q1EA 2PWPA 3HBAA 4MEBA 1T2DA 1CEQA 1DQSA 4YI3A 3TPFA 2IHBA 3ZDQA 2A1TS 4XASA 4AUKA 3D4IA 4U2FA 4XUGB 2X1MA 3IAS1 4N03A 2AKAB 1P73A 3S68A 3VR4H 3ASYA 1NQOA 3EF1A 5JXHA 2JJ1A 3GJYA 2FPIB 4S1TA 5BSRA 2IW3A 2R8PA 4WA8A 5C5EA 3GUUA 4ZAZA 1EYZA 2ZIFA 5EKTA 3L6CA 1RYBA 1G7CA 1YACA 3A37A 1KC3A 1JALA 4J0JA 2RDMA 1SUIA 4IHQA 1GCOA 3PTZA 5IANA 3CW2A 2QRVA 2O0HA 1O94A 2ZRGA 2J0QA 2RKWA 5KREA 4A8PA 1GNRA 2F3TA 3FX2A 4URHA 4EMSA 1FFYA 3K6JA 4KIGA 3CX6A 4RV9A 1PDVA 3ZXIA 4B9EA 1TLFA 1N1GA 2A9JA 4O4JA 4YMGA 4MP6A 4BV3A 1KO4A 4OAQA 1DWPA 3SVLA 2UUCB 2VYND 2Q5FA 3Q7QA 4UOQA 5A5GA 4WNYA 5CP8A 3WGZA 1SK9A 2OLKA 4DV3B 4P80A 3PKIA 3PDCA 2HFJA 1JKJB 1PRYA 4AC9A 1FEZA 2ZYGA 4PBRA 1A7UA 2YMLA 5EERA 4PWZA 2DETA 3U7HB 1W75A 3PRHA 5AXAA 1RC1A 4UTXA 1JSCA 3INNA 1KQPA 1OLXA 2WU4A 3Q2KA 4UJ3A 3RKUA 5EJ9A 1P2SA 3ZJYA 1QF6A 2BEVA 2D0OB 4PCAA 3LQ2A 1TM2A 1JDBB 3VDQA 1SXQA 3A6EA 5CURA 2G36A 2YXDA 4JLNA 3ZU6A 2ZSUA 2OSVA 4ISBA 4OBXA 1Q7RA 2C31A 4TVKA 1I3KA 5HOQA 3GLQA 4ZXFA 3L5OA 1T8PA 4O1MA 2M2IA 3Q12A 4RAQA 1VLLA 1KVSA 2G07A 2R96A 2X8WA 3E3LA 2QTAA 2XOEA 1Y8RB 3IMGA 3SHOA 3UV7A 4BV8A 1SKUA 6ADHA 2A9OA 1ZJYA 1HE8B 4QWMA 5CXXA 4CCAA 2EZ8A 3A06A 4YRPA 4GZMA 4JYCA 1OLSB 1NKSA 2XQKA 4I19A 1VJRA 5KNDA 5KNLA 1WV0A 3S2GA 2B7LA 1SURA 1K68A 2WW8A 4L02A 2AVNA 5TQVA 2QMHA 1HFWA 1G7RA 2FMFA 4Y9SA 2FR0A 4D9NA 1XSEA 1HOTA 1DARA 3SBOA 1YTUA 1B93A 4DRXB 3KWJA 1UCFA 4ZVSA 3JYNA 3KELA 3LJKA 4RY8A 3DLBA 4L7VA 2ZS8A 3O8CA 2ET6A 4DRZA 2JD2A 3UT5B 3LW7A 3OG9A 1EXVA 3Q8KA 4D43A 13PKA 1Z6YA 4PQEA 5EIFA 2A1IA 2ZJZA 3TQSA 3V8NA 5K8IA 2HEIA 1IYZA 1ADFA 1JNYA 1XTIA 4NQRA 4PCUA 1U0JA 1UBHS 3WYCA 1YA8A 4YPFA 5EJMA 1C2TA 1I3CA 4BJ5A 4TYQA 3N0VA 1KZ7B 1N0UA 2NT3A 1RR6A 2OHIA 3MBKA 3L02A 1H4TA 1GFZA 1JTVA 3UKDA 2UV8A 3WSWA 5L45A 1KJJA 2EDCA 2V55B 3TXAA 5K6AA 3HCRA 1R0ZA 3K0FA 3BG5A 3EXFB 1EFAA 2JIRA 3GJ0A 1QO0D 3I01A 2Z1DA 3GRPA 5TB5A 5JBQA 3E9NA 2NZ8A 1FYVA 4PY2A 5JYEA 4EB0A 1QGYA 2Y71A 4UUQA 5AVTA 4XDYA 3AHEA 1P3DA 3O5AA 3JR7A 5BY2A 1H2RS 3FFTA 1DIRA 1L5MA 2AE2A 2K4MA 5BN1A 2JK1A 3KKOA 1V8OA 3HWX1 1IB6A 2BF7A 4V3BA 5IKMA 4K6KA 4AW9A 2NO7A 3QKSB 4OM8A 4ZFNA 3AR7A 4OBEA 2YZ2A 4J3JA 1PKXA 4PQYA 4P33A 1Y4SA 4NYJR 1L6IA 1ZZEA 2QPLA 4MGEA 5D2CA 3X2SA 3DF9A 5K8UA 4JB2A 1JS1X 2COEA 4JODA 4MV3A 3SQOA 3NHAA 1RXIA 4DCCA 1T4CA 4Y0NA 5L7YA 3LUAA 2IXBA 3A6FA 3EA4A 4A5OA 4EENA 4L27A 3SZGA 3NOXA 5BW4A 1UDBA 3IEIA 2WOOA 4PG5A 3NFYA 3UMCA 2D0DA 1T6BY 1KA9H 2IK8A 3T5BA 2NG1A 1FTNA 3ZV6A 5BQOA 4BP3A 3X1XA 2NZXA 3HR8A 1LZLA 2NX2A 2PUEA 3CUKA 3KBBA 3OEED 5ALLA 4MQFA 3ZG6A 2XY4A 1CYEA 3KV3O 2O5EA 3D8HA 3SXUB 1HLFA 4MWBA 4EYSA 3INYA 5CEFA 2QTBA 3GJ6A 4HDNB 3OPYI 2YIJA 2J3HA 4EJMA 4Z4IA 4QM6A 5JMTA 4Y2RA 1OIVA 1MAVA 1TRKA 1LPPA 2D0PB 2JAQA 2WJAA 3CUVA 1NY5A 2BVNA 3D7SA 4NCXA 3RUEA 1ITZA 1IN7A 5KVSA 4LNUA 4M0UA 1E2LA 5CB4A 1E7MA 2TMGA 3G68A 3GLSA 3H6KA 1T9KA 3VOBA 3N2LA 4BIMA 1QU2A 3MEQA 3IHKA 4XM0A 3O1LA 3EXHB 1N2ZA 3QQPA 4TZKA 1N0HA 4NY1A 1S0UA 2WM8A 2HLDA 2KBEA 1RQ7A 3D31A 3EVDA 3NIBA 1E6EA 4RK5A 1SVKA 3WRXA 1H2YA 2FMHA 4JP1A 1CY7A 1PR0A 1VOTA 1Z2DA 2DG2A 3BHMA 2G77B 3BMNB 4G4JA 2GJKA 4NEQA 3V00A 1ISHA 3KNZA 2VHXA 2H07A 2PS9A 3FGOA 3VH1A 4BQRA 4B3JA 3PFIA 2FR1A 4DMFA 1ZGBA 4UHBA 4HEHA 2E18A 4ENRA 3O95A 3SXPA 3LIIA 4XX0A 4XZ3A 3I3SR 5I5EA 2WU3A 2YV4A 4FI3C 3G23A 2HPHA 5CVCA 3ND6A 2GHIA 1KE2A 3CJRA 3P0IA 3QOWA 4RL6A 2AE1A 3WYFA 3D2AA 1XEWX 5KPDA 3G13A 3VR2A 1OU4A 1P0QA 3JVVA 3N2NA 2HGZA 1CQJA 1MOPA 1BMFD 2NNLD 3KDPA 2XECA 2CNNA 3ZE6A 5LZ4A 1UZAA 4IJ6A 3AC0A 3L0PA 1VGRA 3R3UA 3ZWOA 4AURA 3PEWA 1VHLA 4WFIA 3MJVA 1SEPA 1E4EB 2L82A 1AUPA 4ZCTA 1PL7A 2PJRA 4S35A 2G88A 4U0JA 3WJAA 5B5SA 5KOHA 3M6AA 4GDFA 3JR3A 1K5HA 4BTEA 1SUBA 2RIPA 1Q19A 3BGSA 3REGA 1KEUA 2ZJFA 4I1SA 4L6IA 4UNQA 2P6PA 4DVGA 5LFAA 4GOLD 2RC6A 4O6VA 3FYSA 1TMKA 1JIVA 1OBHA 1XZLA 2O2CA 3R6WA 1LJUA 2PTHA 3V4ZA 1D5CA 4A6PA 6NULA 1HA3A 1SPBS 2B69A 3FWNA 5FWYB 3B6IA 3EZ2A 2NXCA 1HTBA 1TM1E 2WKWA 3FN4A 2AXQA 3LNTA 3QWBA 3L1IA 5J4HA 1O9HA 1OV6A 1E63A 1BW9A 4GHWA 5EESA 3VISA 3AMVA 2J48A 2YIVX 2NZWA 2W2PA 3E53A 4FLEA 4TV8F 1CRPA 2DT8A 5ES3A 2PNFA 4N6GA 4Z3OA 4PZDA 4H35A 2CJWA 2FQQA 4QOEA 4Y30A 1NJFA 3R8CA 5GJBA 1PF7E 1ZN7A 4TZ6A 3V33A 4AZSA 4P6VF 3KUXA 4BMZA 1QJCA 3PKJA 5IC6A 4F4DA 2YJ5A 3PC8A 1QPZA 2W6MA 3JD1A 3OLWA 3O21A 2PBLA 4Y6GB 1W36B 1L5FA 3QOFA 3E82A 4PCVA 5FJIA 1E7SA 2NUTA 1YB1A 2ZM6B 4M53A 2XGMA 1GUDA 1NBMD 1ZH8A 1JHOA 2QUZA 4WJKB 3QQ5A 3MELA 5IT4A 5KNBA 5TC4A 3PX2A 2VZ8A 4QO7A 3AP1A 4IWYA 3VU0A 3IDAA 1Z5VA 1J39A 3BAZA 3I73A 5HGJA 5AJTA 3VNBA 2Q4OA 4KVGA 2DQYA 3BC1A 1KE1A 5TVKA 1YL7A 3WMGA 4H7PA 3I8XA 4WW0A 1X86B 2D5BA 5IABA 5GGYA 3SR0A 4J29A 1EFPB 3TAXA 4F7DA 3UJHA 3UKJA 2HK9A 4NZ9A 1BMTA 1X1CA 2VQ3A 4NV3A 2YQ4A 4BHTA 1H1DA 4EF5A 4I66A 3K70B 1E5LA 1L5OA 3IDZA 3JRXA 1OBOA 2XTJA 3RUIA 1CVRA 2C4TA 1XAGA 1ZNYA 2XPCA 2VUHB 4ECAA 5IZ4A 2I4NA 1FP7A 1QVWA 2VXYA 2VT6A 1RYZA 3PC3A 2EBUA 1ADJA 5BSUA 1N5KA 4KN8A 1WUJS 2B4QA 2P8SA 5D1HA 4NNOA 4PXSA 4RJKA 1QIJA 2IEDA 3ASZA 3JVIA 4DIMA 4OG2A 1NJSA 2BJHA 2YHAA 4IXNA 1WJGA 4YO8A 4LMAA 5EYPB 5EIAA 2G1AA 4YV7A 2BEWA 1CY1A 1UDCA 2PTGA 1HQCA 1ZL2A 2R4QA 4KDFA 5HKLA 1U98A 2PM8A 3OQHA 1L3BA 4FD3A 4N01A 1F6BA 5J47A 1T9GS 1JHZA 1RBZA 3IOCA 4P3PA 5KDOA 1P39A 4G67A 1JEQA 3UA4A 3ZI7A 1QQ5A 1G4UR 3UJ3X 3LHIA 1QV9A 3K1TA 3CIOA 5G2OA 5DWQA 5FR2A 2J0VA 3G2IA 4DLAA 1QKJA 2ZSIA 3A0RB 3TDNA 4QLBA 1G5TA 1J42A 3HCFA 4P92A 2M1ZA 5JWRA 3M0EA 4U6NA 2CZQA 1RABA 2RG7A 3T5CA 3DP7A 3ESAA 1IDOA 3E22B 4GPZA 4M98A 3E15A 1PR6A 1VRCA 4HFJA 1WXFA 3MQ2A 4CKZA 4OQXA 1ZHOA 4WKGA 2IUFA 3UFXB 2WJWA 1IOLA 4CEHB 2F00A 3OTHA 1QH1A 2MSEB 2QI9F 1E69A 2PO5A 4Q1BA 4UVHA 1UKYA 1XKLA 3TKYA 2EWVA 1Y9EA 4K6OA 2RBKA 3UZUA 3VC3A 3FWZA 1U28A 2R84A 2IPOA 2DU8A 3GDOA 1RPAA 1VLJA 3AGQA 3OIYA 3OJOA 1DT3A 1B0AA 2B7BA 1ULHA 2IHYA 3NC0C 5FOSA 1RQGA 4RXMA 3CCCA 3A14A 4GPTA 4F6LA 2WD8A 2XXAB 1ZISA 2XADA 4QDXA 4E13A 5A9SA 3HVJA 2VBIA 2QVYX 3UUEA 3MYRA 1KO7A 3HKBA 1GNLA 2QF7A 4L3WA 4BBPA 2HMSA 1N3YA 1PVDA 3IALA 3FOAA 3KB2A 3DEYX 3KOYA 2NO1A 2G76A 3RBZA 1V7ZA 4WCFA 1L7PA 3EFEA 4PSVA 1W0CA 4OQYA 1Z22A 5AK6A 3EIEA 5FBKA 2N75A 4J94A 1HYQA 1N9KA 1SG6A 1R88A 1U1FA 1Z4OA 4PYJA 4ZMRA 2Z95A 3KD3A 2F62A 4RC9A 1PE0A 2O2ZA 5FL7A 3RYFB 1MIHA 2WYUA 3R77A 1GSIA 3CE6A 3W4IA 5AW1A 2TMKA 1JDBC 2YZGA 4QASA 2X8JB 4K2AA 3QLUC 3NDIA 2Q27A 2IWRA 4BVJA 1GZUA 1L5YA 1RKVA 2PXXA 2GK6A 1H8HA 4KO2S 3OCYA 1L2TA 3II6X 3ON5A 1OVMA 3KYBA 3PQ5A 1VCIA 4BOYA 4HUTA 5JS8A 2I7VA 3EDQA 1WBBA 5LKAA 5EQJB 1T2VA 2GYUA 1U3UA 1QX3A 2FP4A 1YS7A 1QVRA 5I7VA 2B0JA 4RVDA 4P38A 1RAIA 3H5VA 4W1RA 1RM4A 3ZD6A 2CWWA 1H2ZA 5SY6A 3S8YA 4AZ0A 3U4MA 1N9ZA 4RLSA 5KJEA 2PX2A 1YS1X 5DEIA 4CT0A 5IYZB 4EEZA 3I4CA 5C32A 1D4ZA 2VNSA 3KB8A 5INTA 3EODA 2V45A 3MF4A 3U3MA 1YRQA 1CUXA 3IJRA 4HHEA 5IF3A 3B5IA 2ZTLA 4C20A 4UATA 5LNK6 1N1MA 1DO2A 2NUPA 1SBCA 4BLVA 1RKQA 4PR0A 1K88A 1GAEO 1IAQA 1WCIB 2BCJQ 1RTKA 3TQRA 3NC1C 4YJ3A 3PT9A 3CNQS 4UOEA 4QUDA 3ND7A 1IVNA 1PZEA 1T5SA 3E9YA 3EVNA 4EFLA 1BE1A 1A8QA 2VJLA 2AFRA 1XX6A 1PJTA 1FCJA 2OB2A 2PEYA 3C6XA 3HY6A 3KTAB 2ID7A 3M1YA 3OT5A 4TTIA 3GFTA 2G06A 4Q7EA 5L7WA 1N3LA 3AR3A 3DO6A 1GN9A 2GZSA 3P9KA 3NMUF 3PUZA 1J9EA 1YR1A 3N8KA 1E5XA 3EC7A 3PUVA 2Z8XA 4KYVA 1YJCA 2WT4A 3DDOA 1JAXA 4D6XA 1E32A 2H2IA 1U3DA 3QPAA 3C1UA 4GLLA 2X0FA 3GP5A 1S3GA 1TU4A 2VNKA 1GADO 3B3QA 5DNEA 5GMOA 2NU9B 3TX6A 1JBEA 3PXEA 4PSUA 2Y1KA 4ACBA 1MDFA 4UXHA 5E1DA 5JCOA 3OQ6A 2VDVE 1WD5A 3ADBA 2HHAA 2WB4A 2H17A 1YR2A 2IXFA 1Z2OX 1RXVA 1VMDA 2GJ8A 3NIFB 4NK5A 4WASA 3G7SA 4P4SA 4B7ZA 1H4QA 4B48A 1Y8AA 4Q16A 2SBTA 3UJAA 4NTZA 4N5LA 4O2AA 4LVNA 1RTTA 5K0SA 1VLQA 3QG5A 1T3ZA 1DQRA 1KKUA 1QO7A 4MI6A 1XTSA 1T0BA 4PZ9A 3V48A 3V7WA 4CKYA 2VYNA 2DFDA 4XE5A 1XA4A 1XJ0A 3PE6A 3MXTA 2JF0A 3G8YA 4NYIR 3NM5A 5A7GA 1JXMA 4HNSA 4FBMA 1JVNA 4IH4A 5K0BA 1KYWA 4LCJA 1KEWA 4UM7A 3A3OA 1SR8A 7MHTA 1JHDA 5F5XA 5DYTA 3S2FA 1DBSA 4TKLA 3IBGA 3RUFA 2ZRFA 1W46A 2R3SA 4IOMA 5A04A 3JPWA 2JFZA 3HDJA 5C1PA 1WZ2A 3ICEA 4LXGA 3D2LA 4Z4EA 4PV7A 2I4RA 4JIGA 2JEZA 4RJ2A 4I4NA 1XKXA 4OXNA 1J1ZA 4Y0VA 1YMUA 4B3BA 2PD6A 4L76A 3IAUA 4IDOA 5F2NA 1BJTA 2H4JA 4YHHB 3I52A 1MH9A 2PH7A 4BNLA 4WE3A 3IP8A 3K3PA 1UM9B 2O2XA 5K1ZA 5LLDA 3HKCA 2X5XA 3PWSA 1EUCB 4IH9A 5FP0A 1E2PA 2WZDA 1DBWA 2PPVA 2XH8A 3SJCA 3RM3A 4F6RB 4DUYB 3BTSA 3OZAA 4UBMA 4P7BA 3SC2B 2OCXA 2IU4A 3ZXYA 3V4SA 5TT0A 4F0JA 2VYCA 3JQAD 1BGVA 3EXHC 5FBVB 1XXLA 4UQLA 4TL6A 5CDUA 1P31A 3GPIA 3ONNA 4FCTA 2CHVA 5PGMA 4KXXA 2KW5A 1UP7A 2UZAA 2NO9A 3NKLA 4QLAA 4ADSG 5E3JA 1SVIA 3JATA 4MVJM 5CB8A 3NBAA 3RRMA 4AJHA 2HDOA 1QH8A 1N78A 3A0UA 3LWBA 4QT4A 1TJ4A 3CB4A 3N6VA 2FZ4A 2V58A 2J08A 4C3UA 1IULA 3R7SA 3MWFA 3JWGA 4CEIA 3SQXA 1VL0A 4GT1A 2IY7A 1X1SA 2FY8A 3QYFA 5JIBA 3KVOA 3ZJ4A 1JAYA 1RHUA 2OGWA 1Y8CA 2XZTA 1IM8A 4B44A 4PONA 1ZXLA 4JOSA 1TT5B 4RF4A 3UMBA 1KOJA 3VZRA 1FMFA 1F9AA 2VNIA 2DTDA 3MM4A 2PX8A 2B78A 3FNIA 1PS0A 1R6VA 1VXRA 4ANFA 1XMQB 2GYVA 2ZIXB 4RD6A 4RVCA 3IKJA 3ABIA 4RXTA 1NV8A 2ZYRA 3IX7A 4PE5B 2NV0A 1HE2A 1NQ5A 1Z35A 2OYCA 3SN6A 2AC2A 3QE4A 4A27A 2J8ZA 2O2SA 1HDRA 2W6PA 4LJ4A 2UVPA 1F12A 2AI2A 1RXSA 3KVNA 2FPSA 3OOHA 2J6BA 3LNCA 3WNVA 3F97A 4KIFA 4XPIB 1DXOA 4BJ3A 2BV3A 2HLNA 3VC1A 3EIOA 1EK6A 1C29B 4ETNA 5I9LA 1B0UA 2JCBA 2BF4A 4HQOA 1YMQA 5DGCA 3PPXA 1Y6FA 4BKPA 1SZJG 4ZYYA 3SHWA 1BYIA 3WB9A 2I6GA 4V0ME 2Z9CA 1W6UA 2W5UA 2EX0A 2PA3A 3IUBA 2I29A 2W7TA 3IPYA 3QF4A 5LVAA 1RJFA 4JL8A 4K8OA 3AVPA 4QNMA 3EGCA 4JB0A 3G0OA 2CHFA 3SFVA 2QLBA 3N39C 1U9CA 2HO5A 4MVJE 1KMIY 3RAGA 5TMPA 4EFNA 4ID3A 2ZXEA 3GWGA 3DKKA 2VDRB 3PIDA 3SCZA 1W36C 4KDCA 3N76A 1X2BA 5AW8A 2FSPA 1RYYA 4KRXA 1VE6A 2BIFA 5CAEA 1DPFA 5C8YA 3DMRA 1PAUA 2CFRA 2GXUA 3A05A 3P71T 3KQNA 3SEFA 3DULA 4RDCA 3OEEA 2REQA 4KHZA 4BO2A 4M1WA 1T5TA 2X5KO 1QUEA 4M8LA 3HGMA 1W96A 4WN3A 5HWSA 1OH5A 1YIDA 2IKQA 1ZKMA 4MKIA 1CZLA 3IKTA 3S44A 5BR1A 4OY3A 3TTWA 4BO9A 2XA1A 3GFPA 3IT3A 2AOWA 4RF2A 3ROTA 4C22A 4A0GA 3BGVA 5JSKA 2G4LA 3IP6A 4BX9A 4ZGGA 4MMXB 1F8UA 3WMFA 4TRRA 3Q0EA 4CMEC 2W98A 1U9JA 3T52A 2EP7A 2QVGA 2XQFA 2ZYDA 3P9IA 4UUPA 4ESVA 1HNWB 1U2ZA 3IV6A 5CIWA 3VNQA 3K70C 1CY0A 4FLFA 5KWJA 1BCSB 1N2CE 1XAJA 3T0GA 1XDDA 1XMVA 4NVRA 3KQVA 4RKQA 2HT1A 2FLKA 4GKKB 5IKEA 1QAQA 4UFPA 2XUIA 4FX2A 4KQJA 4TM7A 4PWYA 4DNQA 4ZOCA 1QIEA 4UCWA 4IL5A 5EY5B 1G60A 1XRMA 4Z3DA 1SQGA 1KGDA 4PYRA 2KQUA 3JSAA 5J1TB 2AH5A 1JWAB 1NVMB 4MVXA 4DCUA 1WCXA 2R11A 4C4YA 1TYZA 3DP9A 4XLZA 4HNQA 2A5FA 3FAZA 4BRZA 3U9LA 1FDOA 3E35A 2I99A 3JD0A 1VRVA 1SHUX 1N77A 3DVAB 4L5CA 2WQ6A 2QXUA 4KH1A 3T1HB 2VF5X 1HT2E 2OHXA 4HXFB 5IK2A 1BMFA 4LY9A 3E3OA 1P77A 5LP6A 3JYOA 3KUDA 1R5OA 3RU3A 2C78A 1I3LA 1A8PA 3BDIA 1ZJ6A 3JASB 4XVRA 3REQB 1D6SA 4TN5A 2HBYA 5D6OA 4IO0A 1LC3A 1NP6A 1VG8A 2CCKA 2BRUA 3AJAA 4A03A 4BQQA 5D8DA 1AURA 3DEHA 4F3CA 3RC8A 3PC7A 3RK1A 3OEWA 4P4LA 2Q1SA 1AUQA 1N36B 2IEAA 3C5HA 4BCCA 1YQEA 1ZD1A 2SECE 5ILQA 2J07A 3C7KA 4B7UA 1GQYA 1L0BA 2OPHA 1RAFA 3MVEA 2C5AA 1CR1A 1Z6XA 2H65A 5B58C 4E1BA 3O3CA 2JLAA 5CTJA 3N86A 2QAGB 4MUMA 4UKDA 4XR4A 5JANA 3PRYA 4FCCA 3WIOA 4F3KA 3G2PA 2Z8YA 2RBGA 4HF7A 2JIZD 2NQ2C 2PXHA 3GVXA 2BT4A 1NGSA 1P7YA 3M6WA 4KV9A 4DA9A 1Z6TA 5DK6A 2VNAA 3ODGA 1CG6A 4BP9A 2WVHA 2EHDA 5MF6A 3AM5A 3FFAA 2OUKA 3JAKB 3TBFA 4BZWA 2Q8NA 4OHZA 4NL4H 4X6YA 4ALNA 1ORTA 1A8SA 3CLVA 3IVMA 1ZCJA 4QNNA 5T6BA 3T3IA 1SUFA 5LNK1 4UEWA 1EMDA 3C43A 2YWDA 2VKTA 3D6UA 4IHJF 1NQWA 4P98A 3IDQA 1WKCA 4J90A 3L0ZA 3LSTA 1OAOC 4N5HX 3AQ4A 4BDTA 4RKFA 5T3YA 5CCXA 1HMPA 2OZKA 1WZUA 2JGLA 1NBMA 3WHLA 4D45A 5DM2A 2C4UA 1A96A 3MA0A 1UFOA 2DZDA 1IB0A 2GDZA 3OU6A 3ET5A 3FPCA 4HTAA 4ZDWA 4WBNF 1CQPA 2JCSA 1QIIA 4TV9A 3VNSA 1AH2A 3FB4A 5AYVA 3BEDA 3RTDA 2ZIUB 5E3IA 5M3BA 5JJCA 4GIBA 3LHSA 4L9SA 4OEHA 5BQ5A 2P2CA 1QVVA 3QP9A 4CHTA 2UYCA 1XMIA 3R9KA 5DSTA 4QJ4A 3RAPR 4IDPA 4X8OA 1YR6A 5ESRA 1JEAA 1RPTA 1OBFO 3SWWA 3L9WA 2FW0A 1WXEA 3EIWA 1T25A 3F2IA 1L4KA 4IHJB 3BYZA 3UHOA 2FGJA 4KOAA 4XIJA 2JHCA 2HHLA 1XTQA 3IUNA 5FCDA 5A4JA 1J90A 3KAJA 5FO0A 5EUCA 5G4LA 1Y3CE 3QEOA 1R15A 2QTFA 4WLUA 4F1WA 1YZ3A 4AM8A 3CEMA 1WW3A 3AUKA 3HPQA 2QMUA 2W83A 2P2NA 4HRVA 3ADOA 1F2DA 4HDAA 4JVOA 1RWPA 2CGEA 2NNWB 1RJ9B 4NYMQ 3I39X 3MCVA 4OI4A 5KTMA 2JIQA 3GG9A 5AWFC 4DQXA 3N8NA 4YJKA 1FRQA 2C9ZA 3K8OE 3UWMA 3ZS9A 1O5TA 4E5NA 1SCUA 1PP4A 1HSOA 3KEOA 1USGA 4G5FA 4CUZA 2ATEA 1K5PA 1SIOA 1MPTA 3GLHA 4P54A 2AJLI 4OVKA 3TIGA 1E2UA 3ZCVA 3X3HA 4EB6B 3COZA 5BT8A 1C1XA 3AM3A 4QDKA 3LQRA 1PVOA 2AFHE 3I0NA 4JGIA 1NJGA 2AOTA 4H7DA 1L4HA 1WVGA 2PAFA 3ESYA 4LE2A 7REQB 5LUAA 1RPNA 3E5RA 1J5PA 4BP8A 2WG2A 4EF4A 3V8PA 2Q29A 4B0PA 3GL9A 1HT0A 2Z2IA 4XOIA 4HQLA 2XA2A 1T8RA 4YRRA 3HL4A 4F4IA 5IHPA 3T1NA 4FPXA 3KCQA 2FEPA 3VKGA 3IB3A 3VR5H 2ZE6A 3D6VA 3PQ2A 3V6MA 3A11A 1MIOB 1RE0A 4U6SA 3QVOA 5AI6A 1TYDE 4YUVA 1LPNA 3TRIA 4DIFA 1BS1A 5CBPA 3PPIA 3FW1A 2Y0PA 2P6OA 1QGAA 5CYGA 3FSRA 3EA0A 3P2YA 1BXKA 4MV5A 5I7AA 4EY3A 4TKZA 2GK4A 4KYIB 4I1PA 1EZ1A 1WCV1 3PPYA 5K3FB 4L8YA 4KR0A 4OGFA 3OEHD 1QCDA 5C8DA 4YJ2A 2J09A 2CLFB 3LOUA 5T64A 4DJAA 1KFKB 2INGX 3JAMA 2X9GA 1L7OA 2XMCA 5EHGA 2A7XA 2QW8A 3LT2A 3RYCB 2Q49A 2BGIA 4W6ZA 5A7HA 4MVJP 4AROA 1V8PA 2R86A 3S8MA 3PHCA 2CVOA 3DEFA 4CM7A 4JQOA 5BT9A 1D03A 2VAVA 2J9YB 3M8KA 3FGZA 3I4FA 2PMWB 3EG9A 4ZI5A 5LQKA 2XB2A 4B4KA 3DOEA 1ZA1A 5TIIA 1XEAA 2C88A 2YS6A 2A94A 3VUFA 4JEMA 1X74A 2E49A 2QV7A 4WY8A 1ODLA 2HRRA 2ECKA 2GZAA 1WXWA 4GGMX 1ZINA 3ZWDA 2QLMA 2Z5GA 1JSLA 2R9VA 1GT6A 3C5CA 3RU2A 4EKGA 4NEHB 1L5VA 1NG1A 1NW4A 4Y1EA 2Q2VA 3TW8B 4NENA 2XRMA 4NLLA 3RBAA 2W2MA 2HYIC 1ZNXA 4RFVA 3ZY2A 1Q12A 3A6PC 4QLOA 3MRSA 4DDWA 1Q1QA 2FE1A 2ZDHA 3OTGA 3BIOA 3UPUA 3IUMA 1Q74A 1CHNA 3COPA 1QOPB 2I91A 3TQFA 1KY4A 1KVUA 4O3FA 5FT9A 3S5UA 1NSYA 5KYGA 1MX9A 1CZRA 3QEMB 2YXBA 3O8OB 3G0IA 2Q4EA 4W7SA 4MVJF 2YL2A 1W1WA 3ZDCA 1PEAA 4BJ6A 3H7AA 1WF3A 5IVDA 4F56A 3DQZA 2Z5LA 1E2HA 3DFZA 2A5DA 4M8KA 1XL0A 2CVHA 3C3EA 4LVUA 4YP9A 2RC5A 4MQUA 2OY0A 4CL0A 3CTMA 3FBGA 3PEEA 2GN9A 4LFCB 3GLGA 4RNDB 3VDNB 1RC0A 1SQSA 4U2BA 5CU7A 4MDEA 4HGYA 3VR6D 3K2BA 1PGQA 1DC3A 4F60A 1PFQA 3BA6A 4IILA 4IDCA 3GVPA 4PC2A 3DMFA 3CFYA 1NR1A 2P4QA 5TR9A 1O8BA 4HS9A 1GPMA 3PUJA 4FE7A 2G7ZA 4QYMA 2VLIA 2VTKA 1CVIA 1GILA 1OTHA 2YWXA 4DF3A 3OE1A 4IJMA 2E0IA 1J1UA 2WFLA 2VPZA 4GPD1 4IIEA 4TUYF 1IM5A 4DJFC 4RTRA 3T38A 4FBGA 4L28A 5HILA 1C9NA 2C9OA 1LTKA 2E4UA 3FLEA 3I30X 4J7AA 5EE0A 4LF9B 4A8JA 2P9HA 3E6AA 4FZRA 3REOA 4QTXA 1LDBA 3ETDA 4H7HA 2Q7OE 3UG6A 4RK7A 4KE9A 1HO3A 4UARA 4Q5IA 4A1OA 4EHDA 3TKAA 5GGXA 3DMYA 3EYAA 4MP3A 3SKYA 3AFGA 4QQFA 1FLAA 3KFLA 3WYEA 5AHWA 1VYUA 5DBEX 4OXYA 1BEZA 1J70A 3U5TA 3KCNA 3PQFA 2BHRA 2I8AA 3TVYA 5AVRA 1KQFA 4O2BB 4OUDB 1BC5A 1SXJD 3NHWA 5AHXA 5KWVA 1D2NA 1NNLA 1OWNA 2BDUA 3OECA 2V6BA 3GDFA 3ZVNA 2VCHA 5D7BA 2HUNA 2RJOA 4MWEA 4NYMR 1XU7A 3Q87B 3IIEA 3I9NA 1YZTA 1ZZGA 3OA2A 5FEUA 2J33A 3R20A 4OJQA 1CUUA 2FN3A 4TT3D 4BNUA 3WMWA 3CIFA 1ZRMA 3RVKA 1LA2A 3A2MA 3TZBA 9ABPA 4PZUA 4G24A 1P1FA 3UV6A 4JMLA 3RG8A 2G6BA 1S01A 4JUCA 3VHQA 2HWWA 1U0RA 3P9QA 2XDAA 1YR7A 2W90A 3UJ7A 1T1SA 4WN9B 5IC5A 3JQFA 2PYZA 2HIMA 3CBQA 3CRMA 3R09A 4BQEA 3MZ0A 3AR2A 3CONA 4PPFA 2OR3A 2KHZA 6REQA 4WT7A 5G0WA 3T0IA 1L8XA 1D4AA 3H1GA 2ATXA 3HB7A 3IJPA 1U2GA 5L3SB 1HE1C 1UBJS 3THWA 3UBMA 1PGJA 4NBTA 4YRQA 4DKXA 4IUDS 3HEAA 3HP4A 1U6JA 2CD7A 2HCRA 4MV1A 3GUVA 3JQAA 1D6JA 4O2LA 5CHEA 4LI3X 3LKBA 4AB1A 4BGDA 4IJQA 1PKEA 2YYSA 3F6YA 4RIGA 1R6UA 4DC1A 2WQZA 3N8IA 4LHSA 5BVGB 2N3ZA 1Z0IA 4K5QA 5HPYB 2Y4OA 2WWRA 4CMHA 1NVEA 1A2BA 2QUIA 1U4SA 3BZUA 4US2R 5DCLA 2QD4A 2YIDA 2PUFA 2HM7A 4QYWA 4OHWA 2QXTA 2ZSHA 2AOUB 5ENZA 1JIXA 4GS5A 2AZ4A 3WWOA 5DI3A 3TK1A 4CF7A 3LV8A 1Z37A 1RRFA 5IAJA 5KYUA 4ZO9A 1Q3HA 3GRRA 4JI7B 1JXOA 1JTFA 1NOJA 5H83A 3U1VA 4CM1A 4B5KA 4ZCIA 2DHEA 3DVSX 4B3XA 2O48X 2E4YA 2P35A 3L07A 4ERNA 2J0UB 2QPTA 4BNVA 1MU0A 2H92A 4M8SA 3D59A 5HUJA 1RW4A 3G2QA 3H5RA 2WNSA 3NDRA 3LZDA 1ZJ5A 4F91B 3ZU5A 3LX5A 5CVTA 3G6KA 2R8YA 2FPOA 4CLEA 1VG0B 1JECA 3GGJA 3ABOB 1G6Q1 3DNFA 4IKEA 4JEUA 2G28A 3UGQA 3C87A 4W5HA 3ZWPA 1AN0A 1AVTA 1CP2A 1DKNA 1AGRA 1IEVA 2X2OA 1LBHA 1MNQA 4YWHA 3TX2A 4Z1OA 3NEYA 1T3TA 1G3MA 1QGZA 1DC7A 4TQGA 4Z53A 3MXOA 1Q17A 2XWPA 4RCZA 2WYIA 1PJ2A 3ZV4A 1KQ3A 3L4EA 1ZOIA 1BNCA 2XE8A 4UU0A 5EVCA 3DVQX 4DEYA 1WLSA 1NW5A 1XRRA 4K9LA 5AUOB 1W2WB 2QAGC 1LTQA 3DV0A 4K1XA 2WR8A 1GNSA 2WYHA 1MBZA 4YIKA 3CJQA 4RTQA 1Y34E 1RQNA 4J0GA 1PWEA 3HJRA 3H5NA 2EZUA 2QE6A 1NPTO 1SC1A 2Y0EA 5I9BA 1I01A 1CZNA 4OP3A 2FAXA 3TZ6A 2C9MA 1GL3A 4LUCA 1VL6A 1YAJA 1WMSA 1DLJA 2J9XB 3CKMA 4JZYA 4AWBA 3A3YA 1HKHA 2G1JA 2IBTA 4X93A 2IYFA 4XYLA 3Q1LA 2XWQA 1IN5A 3GBPA 3AF4A 2RHOA 3G85A 4M6WA 1A8IA 5AI5A 3EN0A 2FI1A 1N2XA 4AJJA 5KX5F 1N8NA 2I34A 2PKCA 4CQNA 3VRHA 2FZ5A 3D81A 4LJAA 4MSUA 1OC2A 4UXIA 4S2UA 3X1ZA 3FTDA 4I8IA 1OLUA 2F7SA 1O6ZA 3DW3X 3KE8A 2GPNA 1YZQA 2V7QD 1T2NA 1WLYA 2RCNA 3DUFB 3NHMA 3MINB 4QYIB 1JHVA 1VMEA 3W2TA 3ZCPA 4Z0NA 5LOVA 2AOXA 3NJ4A 2UYHA 3IEUA 1G98A 1W4ZA 3MMSA 1LVUA 3S7ZA 3KQSA 4RDHA 1LK7A 2GZ3A 5CEJA 1EK0A 1RJWA 3W5CA 3U9SA 2GAOA 2RARA 1M34E 5BV8A 4RD0A 3WLSA 2VOEA 4HQNA 3H8VA 4EVRA 1LQTA 1GDHA 5KOYA 2QL7A 3FTFA 1Z62A 4TKVB 3GRUA 7MDHA 1JHRA 4JLAA 3V6LA 2FXIA 3CLRC 5ESDA 3M3HA 4DLNA 4EO7A 4PSAA 4R41A 3G8DA 4D99A 2GN0A 1Q0TA 2O23A 3VHLB 5IT9A 2JGDB 2Z5VA 5JHGB 1DQNA 2ORWA 5J4YA 3LQKA 3ZZTA 1DXYA 3GQBB 2RHLA 3U44A 2Q1TA 3GY0A 4UDYX 1ARZA 5FFFA 2JL1A 3RQSA 4B6SA 1OYVA 3DXYA 3K0EA 1T13A 1KAGA 1MQ9A 4K6HA 2O52A 1T2UA 5WRFA 1OW3B 4E22A 4YP0A 4Z2YA 3FSEA 3D8RA 2BLLA 2HU7A 3M1LA 3VSEA 1COZA 1KP9A 1F7VA 1QLWA 3W8EA 3LHFA 4Q7KA 3J80A 3FPLA 4U4AA 4IV5A 5F2KA 2JG3A 3OKCA 3ZDDA 3DBRB 4WINA 2OEPA 1JMKC 4D97A 2WG1A 4HB4A 3KC2A 2JGJA 4M9UA 3LCRA 4HWGA 2R1UA 3IIMA 4MR9B 2FMUA 1R16A 3HCAA 4KTVE 5JJBA 1FUKA 4CM3A 1I32A 3DL2A 4HAZA 1CJMA 2QP4A 2EFDB 1QWOA 2FFBA 3EB9A 1R5NA 4ZAXA 1NXXA 1J2TA 2NYAA 3H99A 5D51S 2CFTA 2PLWA 3O92A 5C81A 5KYYB 4TXJA 1U2QA 2C2WA 1KKLA 5KCZA 2W2LA 3HR7A 4B3RB 3ONVA 4MLZA 5GZ3A 4Q4HB 4R0VA 3QPBA 2FHPA 2Q3LA 1M7GA 1E58A 1UJ4A 3FOWA 4N7BA 3U81A 4MV9A 4U1RA 2YV1A 3QIVA 4NE2A 1PYDA 4H6XA 1JAHA 4HQFA 2AMYA 1T9AA 2IDJA 5L7TA 2ANCA 4P4GA 2L17A 3NEJA 4XSVA 2CV2A 1D2AA 1KU6A 1THZA 2GCPA 3W3AH 3U3KA 1KVTA 3DE6X 3M6UA 4QGSA 1QP4A 5F64A 1WD7A 1QFZA 3V7NA 3NBQA 3O74A 2XMDA 1FLVA 1ICEA 1YIOA 2F90A 3C5WP 3L5KA 4X6UA 4IEIA 3KXLA 1HZZC 3CLSD 2BFEA 4FU0A 2P2DA 3Q7PA 4R84A 2GOYA 1OGIA 4ZEXA 1QH0A 2XMPA 3ROGA 1THTA 1XLTA 4D9MA 4AY4A 1KJZA 1JR4A 4JN6B 4FIDA 1TE2A 2YFKA 3E9DA 4GEKA 1GAWA 4WH0A 1SD2A 1EJ6A 1U3VA 1HURA 1UEXC 1TZCA 1W5FA 2P9CA 2OCDA 3ILHA 4HTFB 1LBEA 2ZSKA 1M2NA 4LZWA 3C3YA 4XJSA 3RKRA 4KREA 3FNHA 1AXEA 1XQ9A 3A6ZA 3RSSA 3A6JA 1SHKA 3KWMA 1V5FA 1Z39A 4FS8A 1GARA 3QUSA 2V7EA 2BGKA 4G89A 4POAA 2VG8A 2YOGA 3QMWA 4TQAA 5JS1A 2PX5A 4UUAA 3ZTYA 3WGNA 1E6MA 5C7YA 2G17A 3EZGA 1Q0LA 5JWOA 1MNAA 4MQEB 5KDLA 2EFGA 2H6EA 4HUJA 1M2GA 3V1KA 3ZBPA 4H3SA 2HREA 1Y4DE 5JSZB 3UF0A 1CY2A 1E1CB 3LRTA 1RMQA 1IHXA 3R24A 4PM4A 4W8OA 1ZG3A 3NT2A 1JG6A 1UWCA 2XQIA 2OG1A 1EUDA 4FJ1A 1WVMA 4XEHA 1KI3A 4ZEOA 2QM3A 2WSSA 4CM6A 5BV1A 3L0IB 4M21A 2RHTA 3I8OA 1EG7A 1XYGA 4HNHA 4I3FA 4J2TA 4JR1A 1QNFA 4NBSA