2IIBA

Crystal structure of pasteurella multocida sialyltransferase d141n mutant with cmp bound
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
377
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDNGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNNPYVKVMRRLGIIDESQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
publication title Structural analysis of multifunctional sialyltransferase from Pasteurella multocida.
rcsb
source organism Pasteurella multocida
total genus 133
structure length 377
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iibA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iibA01
4R84A 2II6A 3S44A 2IIQA 2IHKA 4V2UA 2C83A 4V38A 4V3BA 4R83A 2EX0A 4R9VA 2Z4TA 4V3CA 4V39A 2IIBA 2IHJA 2EX1A 2ZWIA 2IY8A 2IY7A 2C84A 2IHZA 2ILVA
chains in the Genus database with same CATH superfamily
1Z4MA 4EG1A 5JAUA 4BECA 1L4YA 2UZIR 2O2GA 1JG6A 3HC7A 1GKLA 1PSDA 1T4GA 4PYQA 5AKEA 3R5XA 4YCCA 2IVFA 1CK4A 2ZJBA 3LT5A 4RIHA 1XEWY 1M2HA 2ZYIA 5BSUA 3IXQA 3EQ6A 3A6JA 3KEQA 3DTVD 4ENUA 3FCSB 5IPFA 4RKFA 2PY6A 4I3FA 3CUYA 5L8VA 2JLXA 1CF4A 5DYIA 1PGQA 1PR1A 1JIQA 2OC9A 2P0YA 4HPJB 3NO4A 5EPUA 3T1NA 3L7JA 1DWPA 3LKVA 2F3RA 4DA9A 5AVYA 1G59A 4X1KB 4MK4A 4IFEA 1POWA 5ERYA 3COJA 4G4IA 5LM3A 3AT1A 1UPTA 2FEOA 1SKBA 1YQQA 3DEFA 3H5VA 4OK3A 4WQMA 1Z29A 2V9ZA 1TKAA 2GAIA 1Q22A 4Q3EA 2NUAB 3VR1A 1UBCA 4EPVA 3RTCA 3KYCB 3GRYA 3P97A 2C4WA 2CV1A 1LBHA 1CXZA 1A8SA 3TW4A 1JKIA 1R4ZA 1CCWA 2DRIA 5JFOA 4RY8A 1B14A 1XGKA 4Q1DA 2Z8ZA 3F74A 1OAAA 2I55A 3IR5A 4RF2A 3L7DA 4WHMA 1NW9B 3GGJA 3AF2A 4EG5A 1E58A 4B5KA 5F3WB 1U2ZA 1HORA 3H4VA 3MTJA 1ZHOA 5BURA 1F1BA 3HJCA 2G40A 1LQ2A 1AJEA 2DAPA 1DRVA 3N2YA 1LS6A 3KJXA 3GGSA 5J2TF 1JQ3A 1YUNA 4B43A 4PFJA 3VMFA 2H1CA 3VO2A 3F96A 1SFRA 1BXZA 1FF9A 3E27A 4E0BA 2OPHA 1CUZA 5H9WA 3OE4A 1LLFA 5A2GA 1IMJA 1L5RA 2PRSA 3DBHA 4XD7A 1LBIA 2NVOA 3KE9A 2FGJA 1JYEA 2IHYA 1AK9A 2QD2A 3DL4A 3C6YA 1X0VA 2KSQA 4GM0A 2P6RA 3H2KA 3ELUA 5L51A 1VGQA 4NJEA 3FOZA 2YHIB 1NF9A 1AN9A 3OZRA 4NZOA 4F06A 2D1RA 1HDYA 4F3NA 2K7FA 3B3GA 4HTFB 4Z9AA 2Q4EA 5F64A 1W36C 1VHDA 1DI0A 2KPOA 4CMAA 3LIIA 2JIDA 3B2NA 4KPYA 4NQRA 3GFOA 1WUJS 1L2TA 3RSOA 2QUKA 5BSRA 4Y7CA 2B7CA 5J47A 2YN0A 2C0QA 3JWIA 2K7ZA 5L7WA 3BH7A 4FQ5A 3GPDG 3TJRA 1IJKA 3Q8XB 2ZI4A 1H3EA 2E6UX 1E92A 3DM9B 2AW5A 2JI7A 4MEAA 5I8PA 1G2PA 2HUPA 5CA0A 4UBOA 1TT5B 3QK7A 4IZHA 3OPXA 4CDNA 2A59A 2XYHA 3OZCA 4C4AA 5I7OA 1JQBA 2MU1A 1QDUA 4H3HB 2HCBA 4S1VA 2AMJA 1PQWA 4BP1A 1NATA 1B6GA 3I72A 4UQLA 4U2CA 3F1KA 4H7FA 4YT8A 2C96A 4GR5A 4WV3A 3D2BA 4KIFA 4KN6A 1E1CA 1EE2A 3AKZA 1CUVA 2Q2QA 2QGFA 2FX2A 2XRYA 1R0RE 5FPQA 1NC3A 3OJXA 3F2VA 3RJMA 4BFUA 2XBLA 1YS7A 2OHVA 5AVJA 3IYLW 3CCCA 1OSNA 2BMWA 2ODWA 1STOA 2BZSA 3NHUA 1YL7A 4IUCS 2Z8YA 2I80A 4KLCA 4RGBA 4UKDA 3WDMA 3MB8A 4L8YA 4HVLA 2GCEA 3N9IA 1P1RA 3WLIA 4AWBA 3A8TA 1XG5A 5G53C 4EHHA 2IC5A 2FPPA 4IFIA 1F60A 1I2ZA 2O1SA 3CISA 3DOEA 2AZ4A 1NQAO 3EZGA 4K81B 4MUIA 5DW3A 2OG2A 2OFOA 1C2YA 4P22A 4PYLA 4WLNA 4D6PA 1AB5A 1YHZA 4L4UA 3VAAA 2Z98A 3CLTD 4X20B 1UUFA 1Q74A 1TO2E 4MB2A 1IBLB 5EIAA 2XF8A 1KNXA 1SBTA 1XZNA 2X0JA 1FDTA 1EUCA 1NG1A 1WV0A 1LPPA 1ODJA 1SU8A 2I1WA 2Y0DA 3ZW7A 5J1SB 2GZAA 1SGWA 1P1JA 2JGFA 1QHYA 3E3MA 3OM8A 5E9JA 3LPNA 5E0KB 5JH7F 1FFGA 2PNFA 3UJ3X 3KKNA 1ZR4A 4N7BA 3W5IA 5JHHB 4JJZA 4TXLA 1D3AA 1WA5A 3IAS6 3T5GA 1K7SN 2QZPA 4HEHA 2NYRA 4P2GA 2XYVA 4I1OA 1KOFA 4OFBA 1Z39A 1AM4D 2LE0A 2EVWX 1JYFA 1U2TA 2W6ZA 3AJ8A 3L1VA 3NAMA 2QX8A 5BWMA 5ICCA 3T5PA 3GJQA 2NTYC 4F3YA 3FETA 4BYMA 1LD3A 4J3FA 4EFLA 5CVCA 2KWIA 3DF9A 4L5BA 3EARA 1C81A 2ZBRA 4KQGA 1LSOA 1D9ZA 1J00A 2OCAA 4I5GA 5AHWA 1M8JA 2XMBA 4PGGA 1A72A 2QMUA 4EMSA 2FXVA 2WRZA 1DRWA 3LUGA 3QIAA 4C30A 2E3JA 1WBJB 2BV3A 4X1KA 3GFGA 5BV0A 4LQLA 3ET5A 3IPLA 3DH0A 3UUFA 4C0QC 4D43A 3P19A 5C53B 3SXUB 3KVRA 2YOFA 1ZGJA 2NV2B 4IUYA 4ALNA 2IEAA 3IILA 5HK9A 1I1HA 4AX4A 3GPIA 1RZ3A 1FEZA 4EEKA 1L8XA 1P7CA 1U2SA 2NUAA 3VTAA 4QBFA 4CMHA 1PX0A 2DFKB 3NTUA 3KYCA 1DC6A 3DKIA 5JSUA 5EZYF 3U4AA 3FOEC 4CEHA 3KLBA 3ZDZB 3LPDA 4ARAA 2QTMA 3OZTA 1E5DA 4TS3A 5JD3A 3WTBA 3HI6A 1J8MF 2IEZA 3AR4A 5JHGB 3VR3A 1KJZA 3W1VA 2PKEA 1TYDE 2WHXA 3A27A 3FCOA 4XB1A 5BW4A 3I5MA 2W2LA 5C1IA 5KTPA 5KWVA 3KEGA 3D4OA 4P5PA 1NQTA 2WEKA 5FIUA 3WKDA 4QQNA 2FKAA 4G36A 2PZ8A 3VPAA 1KDZA 2X9QA 2D4HA 1VMEA 4I1UA 4C07A 3IL2A 4UC0A 1VPLA 3DMTA 1E3EA 2H7XA 2V6BA 1GU0A 2GX6A 3ICOA 2QTAA 2XGGA 3QBVA 4W9NC 3T9BA 4CM1A 5CDGA 2PBZA 2NYAA 1QCYA 1UJNA 2I78A 3PXGA 4MHOA 4AQYB 4GPZA 3R6LA 4B3MB 1A9RA 5H8WA 3CE6A 4L78A 3KJEA 3UB4A 1YONA 2ATIA 5I48A 3BZUA 4F6RB 4G4JA 2FW9A 4RHEA 4LVCA 5CR9A 1M2WA 1ADYA 4UPVA 4JQZA 3WLQA 1L7AA 3OPMA 4PYJA 1ECFA 5IKXA 1NT2A 3CR8A 4FONA 5JSFA 1RBMA 2EOAA 3GZJA 3IUYA 5DGHA 2Z4RA 4U2DA 3PDJA 4FHCA 1TUGA 4YAIA 5A5DA 4HTFA 3PFGA 1E2BA 2Y1DA 4K9QA 4XX0B 2XZLA 2VHEA 3IP6A 2PMBA 4C76A 5BSMA 4RIIA 1H1TA 3EGCA 1HI9A 3UUWA 3W4JA 3MXTA 5COQA 4EJSB 5KUTA 1EB8A 4YEDA 3N75A 1OGIA 1D1TA 3L1UA 5D7BA 4PGHA 3FCEA 1W0KA 4F60A 2G9RA 1Y9JA 2XCIA 3H2JA 5LU9A 5ALMA 1RWQA 5EJIA 1XRSB 3MBIA 3OPNA 2DQSA 4HMOA 1TT5A 4LRWA 4YJHB 4DEYA 1FYWA 2ZBUA 5MN6A 3HUUA 3H13A 3RFFA 4MYSA 5DGDA 2ZAMA 1EH5A 2CNWD 3UAOA 3WGHA 2OBMA 4CF4A 4BDSA 1SOWA 3GFFA 1GNRA 1ULUA 1NV8A 2DF8A 4IKOA 5T57A 3R7AA 3KCNA 1HM5A 4EHBA 4EUHA 4QT0A 3BE6A 3E0XA 1U0HC 2IYUA 2R84A 1E7QA 4JJAA 1Q7TA 2GN6A 2C0CA 1NVTA 3D59A 2OWEA 2CVFA 3PT5A 5IKOA 3SS9X 2AN3A 3R9XB 3B6ZA 3PJRA 4W7IA 3L8ZA 4DL9A 4L5CA 3MS2A 1Z56C 2IOFK 3NVDA 3C3YA 2FN7A 3AMVA 4TMFA 1KOJA 3S81A 1RHRA 1RAGA 3V1TC 1B42A 2NZUG 2YFKA 1SVKA 1T36B 1X77A 1XTTA 2G82A 4MVJF 2CUZA 2X40A 3DOOA 2X42A 5H80A 4BU1A 1FTNA 3T4EA 2QRUA 1JA9A 4XYMA 3QQPA 3NHJA 3X1XA 1DAEA 1R6UA 2XGSA 4O5AA 4QELA 2G7MC 1ADBA 3M4JA 5IHXA 1P62B 4KE6A 4MX8A 2EKPA 3NWOA 1E2LA 3ROMA 2VNSA 1N2OA 3QV1A 1IM8A 2D5AA 4J0FA 2AOTB 2EKLA 1L6RA 4Y67A 2DJIA 5SZHB 2JLZA 1EQAA 1G3UA 3DLCA 3M49A 3TLMA 5IW8A 3FSJX 3WGLA 3B9PA 2B0CA 3LC0A 3IJPA 2ZR9A 5C7OO 3GF4A 1II9A 1OC4A 2C2WA 2FHSA 3AC0A 4ZTBA 1V3TA 4R1TA 2ZR0A 2CCJA 1ONNA 2HF8A 2W11A 1CP3A 1PW7A 1S2LA 1SBIA 4XLLA 3TTTA 1MXFA 4D4LA 3UAWA 3ELWA 4BLQA 1D6SA 4OBWA 4UE3S 2Q5LA 1MF7A 2OE2A 5EI5A 3RC3A 2RSLA 1JLLB 3AL0C 2WYVA 1NVKA 4C0AC 4CQMD 4C5AA 5A6SB 3RS0A 1DO0A 3RBAA 3UN1A 2OGZA 3A6EA 1BVUA 1BC5A 3KR9A 1H8ED 3NC4A 1JPNA 2WWFA 4IDHA 1LC3A 3S55A 3IUBA 3V5NA 4G5HA 1Q17A 4YUAA 1T9AA 2VPIA 3GJ8A 4RBNA 3N2KB 3OOHA 4FJ0A 3WSTA 3FRIA 4JZYA 4NH0A 2IH5A 2GPBA 1PL0A 1KDVA 4KQ9A 3SXUA 3WRYA 4RY2A 2GAOA 4RZSA 2W4QA 3A4MA 2QM7A 4GIBA 1U8TA 3V9AA 3W4IA 4YT5A 3M89A 4YRQA 5DEIA 3W5JA 1T3GA 2YVQA 3AY3A 3SYRA 1FTGA 2PT7A 3K4QA 3TFWA 3UAZA 2ZUUA 1E0AA 3TQOA 2JGKA 3U49A 3E9ZA 3WHLA 4YXWA 4AG3A 4PG8A 3UPUA 5B6JA 3T54A 4IZOA 2N1MA 2PL5A 4DNOA 4JHLA 3IAS1 4KMRA 5HIAA 1UDWA 2CLMB 4I2VA 1UMBB 2HK9A 3PE6A 5AMXA 4ETNA 3SWWA 4ZTUB 1R4MB 2P41A 4D9CA 2EEZA 3HVRA 2H1OA 1CVLA 1RQGA 2QRNA 5CVVA 5CA1B 2GETA 3FLMA 1KQPA 3TZ6A 2HYIC 2QRKA 1SBHA 5TQ0A 3HDVA 3NOXA 4BX9A 2CUNA 5PGMA 5IK2A 1R0SA 4XGRA 3WKBA 1PVDA 1RZUA 4ZHQB 5K7SA 1MDFA 4BNYA 3AGQA 4E2YA 3IUJA 1YE3A 3JYHA 2QLLA 5HP4A 4YS6A 1M33A 3OX1A 1W5SA 1E9BA 3ONEA 3V2HA 3KQLA 4B79A 4IIEA 1PR9A 4GKAA 1SCUB 4RE5A 5JASA 1M9NA 1RMYA 3OTOB 1MC4A 3HRIA 1OU0A 4BKMA 2WIBA 4F6RA 5ENDA 5JNWA 3H5OA 3KFVA 4B9AA 1JKJB 1M10A 3D6TB 3FFWA 4KSCA 4S1WA 2B4KA 2WF9A 5ER9A 1V71A 5K0NA 4V03A 3MBKA 4L28A 4KWCA 5E2IA 3F6PA 3QY0A 2BGLA 1NDUA 1SQ0A 2X14A 2ZSFA 3OSUA 4R7GA 3CRNA 5IF3A 5KYKA 2R8ZA 1ZK1A 4XX0A 4RH0A 4E3WA 1EUYA 1EX1A 4CTMA 2NSYA 5CJJA 2J3MA 1C1YA 5HTKA 2Q8PA 4EJSA 4QUBA 1G4UR 3G5TA 3DO6A 3C3DA 4TWBA 2RD2A 1PAUA 1Z15A 3AH8A 2YRFA 3HU5A 3HCDA 2ZBVA 1IZ8A 3RKRA 1VSQA 4RWZA 4B6QA 4K0KB 4HO1X 3KPUA 4PHTA 3PNYA 4UM8B 2H4HA 1TKBA 2OHGA 1J5PA 4YJHA 3RTEA 1UZAA 4TUYF 4BNZA 1IM2A 2AMFA 2RHWA 4D9NA 4I55F 4UCFA 3NIBA 2DFDA 1H2BA 5JZSA 3HYTA 3QVWA 1USIA 3RVNA 4X7MA 4D0GA 3OF5A 1ZSVA 1JEOA 3REFA 2FH5B 1RJEA 3GW8A 1JHAA 3D3NA 5ALGA 2WICA 3ZJ5A 2GTPA 3R9XA 4FN4A 4GPIB 4B9EA 2WJ4A 1V9LA 3G5MA 4UM9B 1F6DA 1ZCFA 2XB4A 4NIMA 4DIKA 1FK8A 2BISA 2GEUA 5JJCA 3WQBA 4YLEA 1YU9A 3HRKA 2XITA 3K35A 1CUWA 2IFTA 1QIFA 2PX6A 4N5IX 4ZZIA 4GX5A 1T36A 1E1MA 3MMPA 1TW2A 3IX7A 4PBTA 4MAFA 4X1IB 1UDXA 2PXAA 2FWAA 3VHXB 2C78A 1TZKA 2DY0A 3BXZA 3A3KA 8GPBA 5AOAA 5HRCA 2YZGA 4OMFG 3VNRA 3EIWA 3NM4A 4ZK2A 1HWYA 4NJOA 4M36A 2DKFA 3B82A 4HDKB 4GXTA 1MB0A 1H23A 4U00A 2FAXA 4DLRA 2CJWB 2IF0A 3MINB 1WUYA 1HTBA 3ROXA 1WBBA 3I45A 5I7SA 1X1TA 2AOTA 4MAAA 4CKCB 3ZPXA 5J5AA 1U8CB 3V3TA 1I3CA 5A0TA 1MX3A 4L07A 3PUYA 3F7MA 1NIPA 3OHMA 2JJ1A 1PUIA 2CN1A 1UP7A 2EAUA 2VDUE 3UV3A 3ROPA 5IX8A 3S2EA 2CLCX 5B1EA 3KVNA 1VL8A 4NBLA 4MW5A 5CIYA 2G28A 2CUKA 1KYZA 3NHAA 2YMPA 1GY8A 1QOPB 1GPMA 2FE4A 4ZIRB 5BPHA 2PKCA 2WLSA 3MRXA 5HIMA 1BE8A 2WWYA 1GPYA 4LZZA 4JOSA 1G6Q1 1JLLA 1WHTB 3EA4A 3I0MA 4ZT6A 1P0PA 5A6SA 5B1YA 4IILA 4ZYVA 3ETDA 5JO0A 4M98A 4OYYA 4UASA 1MB2A 5E95A 5K3EA 4OX9B 2QLMA 1Z5VA 4WRRA 2HM7A 4ZFNA 4BGIA 1QANA 2BMDA 2R2GA 5BSWA 3N2KA 3WFZA 3ZY2A 2Q3DA 1XT6A 4FN5A 3OQPA 3KG2A 1NNEA 1H5NA 2W2TA 3M1AA 3O82A 2BE9A 2RGGA 4U7PB 1E0JA 4EY8A 1P3DA 3K5IA 3S1SA 4FYYA 4OQ4A 3LUBA 4WK6A 1JFTA 1DX4A 2ECOA 4AJNA 2A30A 1FA9A 1C14A 3EQZA 1UWLA 2AJTA 2DY1A 3PTZA 4CNQA 2SECE 2QMOA 5KVSA 1Z7GA 2G4VA 3FUCA 5E4TA 2HW8A 2QRQA 4FB5A 1NVVQ 3UB3A 4BLRA 5K4GA 1ATZA 1G6OA 1UMBA 5IVHA 3L0IB 2W58A 3VR5D 1R4MA 3Q85A 3F6BX 3HGQA 3UW3A 4PYKA 5CA1A 1RLIA 2VNIA 2XR1A 2DLCX 2YQZA 4E03A 5MFZA 5K0CA 4XIIA 1YR7A 5LDGA 4EVQA 4M1MA 1A8IA 1UAAA 4FX2A 4IZIA 3J81k 1ZYUA 3V4VB 2JGDB 1GPBA 2PTHA 4GW3A 4ZHQA 1SXHA 2BT4A 2A9OA 1D1PA 1SD1A 1ZIYA 4GC9A 1GM5A 5IARA 3OH8A 1FXSA 4BNXA 1G8JA 2QY9A 2VYVA 2AZMA 4A0QA 1KVSA 2XDQB 1YWGO 3S28A 3LYAA 2B98A 4MRAA 4ZOCA 2FWJA 4X24A 4D6XA 4IEIA 4RQUA 2QLTA 2XOKA 3K4PA 3EZFA 3B12A 2DTEA 4WXHA 2BIFA 3M81A 1X8JA 2YHAA 2GN4A 4MRNA 2ET6A 1Z5WA 1ZK2A 5ALSA 5KQMA 2GARA 2WZQA 1L7XA 1RWOA 2G9NA 4DBLC 1MQSA 4OA5A 4TSKA 3SLGA 1L7EA 3DMPA 3OE7A 4WDQA 1JQLB 3E23A 3L8FA 2FX3A 4CM9D 1N0UA 4MEBA 5TGTA 5FR1A 1MRZA 4M0MA 4ZRNA 5KYYB 1M76A 3GX1A 2YHBA 3AJDA 4DQDA 2ZE5A 3IOBA 3HJAA 1FU8A 1KEEB 5JLJA 5KNDA 3DCYA 2R86A 1U4OA 4HN2A 1PE0A 3KKLA 4JP5A 5L3SB 5IBRA 1JBKA 2VK1A 4CN8A 1Q19A 1DT5A 2MWMA 4WXEA 2O3RA 4F7DA 3G0DA 1U28C 4XRRA 5JRZA 2F1JA 1NKVA 1X1DA 3NIDB 3RT7A 1TMYA 2XNKA 3ZK9A 4F84A 3QE3A 1T2UA 8MHTA 4RKEA 3GUHA 3QI2A 4BASA 1D7AA 1A8PA 4FZJA 4PNHA 1KU0A 4KLZA 4BNIA 3COVA 2XLCA 2HJHA 2CD9A 3WNCA 3OZBA 4A8PA 5LMNB 4IJQA 4JB3A 3OOWA 1M8KA 1THMA 4MW9A 3DGEC 3OJOA 3VUFA 3ZE0B 2HEIA 4J0KA 4IIHA 1O95C 3OBIA 4M1EA 1DEKA 3NUGA 3PJDA 5KJEA 5EE9A 4BO5A 4U3JB 2FUKA 4X1IA 1JDNA 3VHXA 2OG1A 3LF2A 4WJKB 4K87A 4CKWB 4GP7A 1U31A 1MFZA 1DIAA 2XVXA 4P5EA 1DTEA 3GLHE 4KR2A 3HXPA 1YR1A 4OYHA 2V6JA 3LT2A 4C03A 5I45A 4HDKA 3ND9A 2O50A 4PANA 4UW9A 4ZEWA 3UM9A 2CJWA 2Q6LA 1HXHA 4D96A 3MINA 4Y2XA 5BSFA 2NM0A 3JRXA 3PFFA 1CVRA 1BOOA 5DE3A 2Q0SA 2ZI9A 4CKCA 5BVGA 5JU6A 1YZUA 5GOTA 3O8NA 5U4XA 1K8ZB 2V4MA 3N8KA 1J8FA 2YWXA 3N86A 2IU6A 4G4GA 4KIGA 1US8A 4RV9A 4DMUB 4OGLA 3TX2A 1RNLA 3KXLA 2ZRAA 4YJ2B 1G9SA 3ANYB 3NIWA 4PY2A 1MH9A 3TLEA 1L8AA 3TSAA 3DTNA 3NALA 4KPEC 1OFUA 1R6DA 3Q9SA 2OXIA 1KFBB 1KS2A 3PPVA 2PSHA 2ZJOA 2NVUB 3ZOKA 4ZIRA 4LE2A 2P4UA 2F3SA 4Q1FA 1WHTA 4EVSA 1CV2A 4RK1A 5CEJA 2IEDA 1A9YA 1JEQB 1U1GA 1VG9B 2PH3A 1MABB 2V7QA 1Q20A 1L5YA 4C78A 4DADA 2DQYA 1U0GA 3THXB 3GEMA 4ASUD 2P3SA 1BAPA 1KJNA 6PFKA 1N2BA 5CDTA 5FTKA 1OGYA 2OVBA 1IYZA 5K3AA 1SHLA 2A14A 4KXQA 2OLJA 2QD1A 1Z0SA 5AR1A 2EZ4A 2QS9A 3A2MA 2JFBA 3FFAA 4Q7EA 5BORA 5JANA 1FJGB 4WXRA 1S8FA 2Y05A 3V9PA 3PUZA 1I0IA 1NVMB 2F90A 3F1LA 1EBUA 3ITKA 4NPCA 4WL0A 4CMCA 2UYHA 3OEED 2AN5A 3ORQA 3T7IA 4GOKA 1JMKC 2GKSA 2R0QC 3TQQA 1P4GA 1X7GA 1HT3A 5AKGA 1P4SA 1B26A 1TPYA 2NUTB 1WXGA 3NX4A 4R1OA 1SKMA 1UPCA 4JK3A 4W7HA 1W46A 2X5KO 4O5OA 1EDZA 2ODTX 1U2PA 4G3XA 3RRFA 2ORVA 2OUIA 4DAOA 5FUVA 3OIWA 4TM7A 2V3WA 3RU7A 1DOZA 5KPJA 1XLTA 2J9FB 5TQJA 3ETJA 3WK7A 3S2FA 1U3WA 4PRKA 4B40A 2RBEA 3CH7A 3ZVMA 3AXTA 1ONSA 2X4IA 5G1NA 1X8KA 2IIVA 3QZUA 9MHTA 3RI3A 3K0BA 1YKGA 5LP6C 3ZW9A 2AD1A 2J3IA 4GXRA 2JGDA 1POXA 1MOZA 2ZJ6A 2FZ5A 1VYVA 4J2OA 1KI8A 1SCNE 1A04A 3EASA 4OI4A 3RASA 4F12A 4X63A 4ALMA 4ZZ3A 3K09C 4MYTA 3LP5A 3REGA 5P8WA 3MRTA 5FV4A 2XDQA 2CEAA 4EPWA 2GKGA 3DTVB 1ZPDA 1JT2A 3KOWA 4QQRA 5TRTA 2JIQA 2XGJA 4PPNA 3U3OA 1TT7A 2XW6A 1E1LA 3O4IA 2QBYB 3EVFA 1Y4SA 3R1IA 1J20A 1U8XX 3FVRA 2XAAA 2XE7A 3GLVA 5BP7A 3RH0A 3S29A 4XWYA 5BUQA 5BXYA 2PT6A 5A4AA 4Y8VA 2DR0A 4H6PA 5E7JA 2CCGA 1HF3A 2FWPA 1JIKA 4FYKA 4RNCA 1WMFA 2HU8A 4BFCA 1ZGCA 1ZGBA 1D6MA 2IGTA 2LPMA 3SX4A 3Q2OA 3MQ2A 3WYNA 5I51A 4K1LA 5KYXB 5IWAB 1SIWA 3D8NA 2C58A 1RI3A 4YRMA 1N2SA 5KYYA 1CEXA 3FOWA 3GEPA 1CFZA 3EVGA 4H3KB 2BFPA 1ZD9A 1GG2A 2C8VA 1BROA 2JIMA 1M6VA 3A3OA 3KFXA 3NBQA 3NYWA 4UQPA 5ICFA 5JXJA 3RRBA 3NGLA 4B2LA 4BIMA 4CL0A 2X0KA 1RR6A 3HVHA 4Z8YA 5L3SA 1G8YA 2PRKA 2IXGA 5LWHA 4CKZA 4JX8A 3SR3A 2DETA 4B3TB 1DNPA 1U5CA 4RETA 3GBSA 1IN6A 1DJLA 1E2GA 1WR8A 3OHPA 3VR0A 5A4IS 5LJIA 4DSOA 2QLNA 3A36A 3X1JA 1OZHA 4EY7A 3H2ZA 3IR7A 5ITZB 1TM7E 3JRNA 5C8YF 1MG5A 1V8PA 1XCOA 5IBPA 3ZIUA 1ECGA 4RULA 5IMBA 2G9VA 2QVBA 1HL3A 2V58A 3C15C 3HYNA 3K9BA 4MS4B 4TMKA 2XTAA 4MR9B 1KL7A 1R0CA 2FZEA 3ITEA 1PSZA 5LR6A 2RH5A 1JHOA 1X8XA 3KWLA 1PGPA 2OHXA 3R0JA 1OVMA 3J7TA 4LQ4A 4RTKA 4DIFA 2NO0A 2JLVA 5JW6A 2FZVA 3DS8A 2VWPA 2WA2A 3LDUA 1QVVA 1EXVA 1RC8A 4HAUA 4U3JA 5FBKA 4EAAA 4RK6A 1W49A 3ESBA 1SEPA 2IBMA 3MWEA 3RTGA 3ZU6A 4D6YA 4BPRA 3VR6D 4A10A 2Z6QA 1TZJA 3AJAA 5CB0A 1PQUA 4KAJA 4Y1RB 1MV8A 3UWSA 4YX9A 3PRYA 4GLFA 3MWFA 4DJDC 5AHXA 2GUGA 5F4BA 3OJEA 4RF5A 1YTUA 2P7HA 1YK1A 2P69A 4FWIB 1R0YA 4UU0A 3JQGB 2OMEA 1FW8A 3M1IA 1QSGA 4GRDA 4WPGA 1QPGA 4YJDA 4X71A 1GTMA 2I2DA 5GQSA 2GCOB 2ZRNA 4ZREA 3WWZA 7AT1A 3OICA 1R8JA 4ID9A 3S1AA 4PLGA 1DXHA 4ZOEA 1XJ5A 1WV1A 2NPIA 1QHNA 3KQOA 4YJ2A 2C83A 2H54A 3ZQJA 1ODLA 1Z2DA 3AUTA 3ROQA 5CHYA 3A04A 2XQVA 4NBRA 3WDKA 2NVUA 1J06A 4UUNA 5FUYA 2WTEA 3L4BC 3LHFA 4CPDA 5DTJA 3L1HA 1Z25A 5JZ9A 2MDTA 3SEAA 3CKLA 4Z7NB 1PFYA 2WMYA 4BEJA 3ABZA 4M83A 1WLSA 1MABA 3T1VA 1G5HA 2LP4Y 1W6UA 4EHLA 3THXA 4HLUA 3DC7A 4O8ZA 5EKXA 4MP3A 5J5CA 2JEOA 2GBLC 1NX6A 2GK3A 4EW1A 5HCNA 4F4JA 1FVXA 3MYYA 4NI5A 1D9XA 2Z1MA 5HNKA 1BMTA 4ZVTA 2D0IA 2GEFA 3H2IA 3LYHA 3DCNA 4H31A 4HFMA 3VU0A 4ZK6A 1A5SB 1SHJA 2B5VA 4MWEA 1HSZA 3PD1A 1FW6A 1Q12A 5FTLA 3GH1A 5LOVF 1RJDA 3ELYA 5K0JA 2D2EA 5CLGA 4KWTA 5AUOB 3EWNA 1FDIA 2XD9A 3QEOA 4W6ZA 2GJSA 1NVAA 5AJZA 5DMHA 2QORA 5HKKA 4Z0PA 3DL7A 2IXTA 4TTIA 1I94B 1I4LD 5FAKA 1L4FA 1SUFA 2EARA 4PONA 3VPFA 2GZ2A 3HE3A 1SHZA 3TEFA 3GIDA 3O0DA 3PGVA 1SVMA 4F4UA 2CL7X 1H2YA 1PEKE 5JNRA 1ZCZA 2C59A 3MEQA 4JBYA 1CSEE 1HSOA 3FPGA 3GQVA 4MQFB 4P4SB 4F6CA 3JAKB 3PQEA 5J59A 2QPTA 3HKEB 5DU2A 5BT8A 1BX1A 1M5RA 3PKJA 2YW2A 1QO0D 4RTOA 1FFXB 3F49S 2OGUA 3LQQA 3FYTA 1CUUA 5G41A 4ZU1X 3VH3A 3G2KA 3DTVA 2QVXX 4L73A 5DI9A 3CZCA 3HXMA 1H0SA 1G5IA 2JASA 3QU7A 4RFLA 3TH5A 4D80A 3LJKA 4BNWA 2XZOA 1K7YA 3QE2A 1QRTA 3B7WA 4HAZA 3Q12A 1IZYA 1G291 2IITA 2Q46A 4HB3A 4IPTA 2JI4A 4JFAA 4DG5A 1PFGA 5HIJA 2B8JA 4X1OA 5CLHA 4LMRA 1JQDA 1P5JA 3DZIA 2BEJA 3BCSA 4IIDA 1NW7A 4LDAA 1CZRA 3LSTA 4ZA2A 1P7PA 5HE8A 5SY4A 1BFDA 1Y8AA 2RGEA 2C8LA 3AW9A 5CAEB 3MJHA 5KYXA 1Y1QA 1KYWA 1EUDA 5ED4A 1ESDA 4FLFA 4TKLA 5EKTA 3HCOA 2O8EB 2IE0A 4G1EB 4EDHA 5JCOC 2DWUA 1V16B 3K8OE 3ESAA 2P79A 2IPLA 1SU6A 2IYXA 1PJZA 1TM3E 2P65A 3BWCA 1NW5A 1KERA 2HFJA 3GV0A 1C50A 3EGWA 1O89A 1EK2A 1PJCA 1T9HA 2I34A 2QN9A 3HBAA 5F7ZA 3U62A 5KDLA 4GKVA 4OTZA 1ZO8A 2OAP1 2YRXA 3K6JA 3L1IA 1KGSA 4FR5A 3SMVA 4FEEA 1E1KA 4BTVA 4BGDA 4TYNA 1DQZA 1J8QA 2OCXA 1JB9A 3FNIA 4RTNA 1O7JA 3QLEA 1XZHA 3BSYA 2MSKA 1QTNA 1TJ5A 1T0JB 4YQZA 1NVXQ 1AURA 2H9AA 1RPZA 4TMVA 1KY2A 1VCHA 1MAHA 2HJVA 4M54A 5ETJA 2WVHA 4D8XA 1ZM2A 4OAPA 1E5XA 3OO1A 5BN4B 4MYHA 1JZQA 4ARVA 4FDAA 4ARIA 1S4MA 4N3BA 5C4GB 2HUNA 3IUPA 3AJRA 1SWWA 4UVDA 1NRWA 1DKNA 2VSQA 3O75A 2P62A 1PR3A 3LUPA 4EG0A 1XHEA 2I66A 1Q1EA 2HC9A 4ZOQI 2VF7A 2AJCA 1O5IA 3RUFA 5I4IA 1DRKA 16PKA 4CV3A 3NI2A 4ND2A 3HP4A 3RG8A 1C30B 3W2IA 1AKWA 2VSXA 1ZR2A 2PSDA 4AMGA 4LFBB 4Y1RA 5BYBA 1U2DA 3EGXB 5GV8A 5CYOA 4NBVA 1Q16A 3KLMX 2Q3CA 4LMBA 2SBTA 2NQTA 2V7EA 1SC4A 5EQJB 5EMMA 4OH1A 1X1SA 2PX4A 3JQGA 1TYBE 3RSSA 2ZG6A 3ZXUB 3B1WA 4FFWA 2GCOA 2VQ3A 4RW0A 2Q21A 4UFPA 2XPCA 3TVYA 2X15A 3JD3A 4JIMA 2PBRA 2OGWA 3FTCA 3KDAA 4MJ3A 2YFHA 5AKLA 3DZDA 4HEA1 5EPEA 5HMLA 4JP8A 1ISHA 4D98A 3LUCA 2CZQA 4FCWA 3VVCA 3QBTA 3GFSA 3STUA 1IXZA 5FWYB 4NJMB 1DBVO 1NVBA 5AIAA 2Q6IA 1G3MA 4DXDA 3TOSA 1SNYA 2RHJA 1CEEA 4BKRA 3P1JA 3OFKA 4IFBA 3VPCA 1BGXT 4Z5XA 4FB4A 3X44A 2J7PD 1GL9B 3QLVA 2NZYA 1YS6A 1PFQA 4IBOA 4LYHA 4E21A 1LUAA 3A6GA 4CUKA 3ZXYA 1I01A 4V39A 4E1BA 2EKBA 5DT2A 4C4PA 4E1VA 2JIRA 3FDXA 4LDJA 4Z9BA 3B1FA 1RS0A 3WLLA 1CUCA 4JITA 1G4HA 4MGYR 1VIVA 1XJQA 2HA0A 3TE7A 1YZVA 3MSCA 3V48A 1YO6A 1N1MA 2K2QB 2OCLA 3WICA 1V9CA 1U2RA 3AU8A 1LA2A 3PQ8A 3CZQA 2ZRDA 2QVLA 4NATA 1JP7A 2BKLA 2IOYA 3E1GA 1BH2A 1IDOA 4TZKA 3K1AB 1GPLA 1T35A 4J4HA 1QK5A 4M8IA 2QXUA 5AUQA 5AJUA 4XLTA 4G24A 4G85A 3DKRA 5L3ZA 3H9EO 3KPYA 4IJ5A 4OHCA 1CDEA 1LPBB 5B4TA 5CJ2A 3PRJA 4ZVOA 5CD1A 1JAYA 1VA5A 3QVOA 5CPFA 5JSHA 1GKUB 4Q1VA 4DG9A 2VTEA 2ONJA 4OLHA 2WHEA 3KT3A 5CJPA 3FVQA 4JLUA 4XYGA 1UXIA 1C29B 4Z86A 4XJXA 2H06A 1B73A 1YZHA 2VUIB 1FQKA 3AFOA 3FMOB 3JAKA 1M0WA 3NHYA 4Z9FA 3T5BA 3HKEA 1LRJA 3B52X 1EK5A 3KE8A 1NXSA 1RHJA 3EEOA 2FFBA 4BNNA 2CKDA 1UWVA 1FFXA 1KTIA 4RD3A 5ABPA 5A1TA 4BWFB 2WYOA 2X86A 1QB8A 3OTWA 5EP1A 3U7GA 2UXCB 1F2DA 1DTWB 4QDTA 1LF0A 4CG2A 2FLKA 1T10A 3ZNOA 4TGLA 1QCDA 4NLLA 4N0QA 1S02A 4OSPA 4NOLA 2Q9AA 4HOYA 3CT6A 1QUEA 3BK7A 3IVCA 4Q3LA 4LRTB 4A9AA 1KR2A 3DDHA 1L5NA 3TDMA 3SHOA 1PTJC 1N6OA 2A0WA 3AX6A 3GFQA 3F9IA 4DIMA 3CZAA 4Z6KA 3RSHA 1QYXA 1JSRA 1UBGA 1Z4OA 4KO3S 2FETA 2GBGA 5K6TA 1W35A 2JLQA 2YVLA 5TXGA 4V1CB 1RU3A 2CXOA 1OTXA 4IDFA 3RS3A 4F4DA 1DCKA 5CAEA 3SC4A 1HLDA 1NLUA 3FWNA 4KXNA 4L8VA 4C1BA 3KM0A 1HFEL 1QPZA 1VSVA 4NZNA 3DV9A 1CETA 3WX0A 1UKBA 2XH8A 3JPYA 3I34X 4IOJA 4MV0A 3ZHSA 4JI0B 2P75A 2QVYX 4JOCA 2OCYC 1S8OA 3A6FA 3GCWA 4JLVA 4DXAA 4M9XA 5ADVA 5CGZA 4OYRA 1NVWQ 1YDHA 4DABA 1N7HA 4I6EA 2KLHA 3U7HB 1S01A 2VIIA 4LFCB 3KSBC 1MR3F 2OFXA 2R25B 4R9SA 1FDWA 3X1WA 4K9SA 4CXMA 1FXWF 3I05A 2FJPA 5EP3A 4COOA 3MYRA 4HGQA 3RADC 1IN8A 3T9FA 4UFOA 5JXWA 5ALEA 3L40A 4Y2VA 4NWIA 1L5WA 2TECE 2ABWA 4EQZA 1BDBA 3LUJA 5BN4A 4DCJA 3IEPA 4OB7A 4HRVA 3M5PA 4F2DA 1SQ5A 3PNQA 4LZPA 2CYBA 5AD1A 2OM6A 4RZXA 2EYUA 4WSOA 1GPUA 1SBZA 2D6FA 2EW1A 4S35A 1LCIA 1PN3A 1GO2A 1V8BA 1JWBB 2YXBA 3KQQA 3BWEA 3T61A 3TW8B 1SUWA 4B73A 4C22A 5JAZA 4R0MA 4OF4A 4EL5A 5B58C 5DDIP 1C30A 2FPRA 3S3TA 1FQOA 3LYLA 4P83A 3T7EA 3QUTA 3PGLA 1V7PC 4F2HA 4YP0A 3RD5A 2BP7B 1MORA 1CR4A 3BMQB 3EGXA 4OHVA 3BKWA 3SX2A 1YZLA 3U9LA 4RCYA 2AVNA 1K7CA 1RWXA 5AVQA 2QQEA 2WJAA 2QVZX 2J85A 3RRJA 2IKQA 3SKYA 1VZ3A 4M53A 1TJ4A 5GIOE 1XU4A 1ZN7A 2YASA 1P9LA 3AM5A 4EJ6A 2OYSA 5BN3B 1JHDA 1C7EA 3IAEA 4O8CA 4QICA 4EJFA 1TA4A 2HJRA 3FUWA 4E5PA 5IMSA 2B99A 1ND5A 1WW3A 3HG7A 2FPIB 1A76A 1K86A 3G2QA 2ODAA 3JQFA 3SZ3A 2VZ0A 4EKYA 4KMSA 1RYBA 1BDJA 2NZJA 4HL6A 1S3FA 3EMVA 2WSLA 5GGXA 1NT4A 3LHDA 2CNWA 2DFNA 1CQIB 2YXLA 4KN8A 4NJMA 1XNQB 1ZONA 2IIBA 2JCVA 2O5RA 3W1WA 2I4LA 2JIBA 5KYWB 4GVXA 3GROA 3MVEA 2PVSA 3E70C 3SICE 1GYPA 1KMNA 2JGLA 3CM0A 3ESRA 5L3RA 1JV2B 2Z0MA 3RC7A 4LEIA 4I8IA 5C80A 2R4UA 4GX0A 4KITB 2HT6A 1XTQA 2FMIA 3ZZUA 1J23A 3SSNA 5EIBD 1OCEA 2XUZA 2DHEA 3IP3A 4KQFA 3ASUA 4HDNB 1BQEA 5DK6A 4BJ3A 5MN4A 3BK1A 4YC7A 5DX8A 5K01A 4Z7QB 1AOXA 3JW8A 4G86A 1JBQA 1Y1LA 3JPWA 5HJ2A 4B7AA 2NSJA 3LNTA 3BJMA 1Q1GA 1D7OA 2OESA 2GA8A 1CRPA 2OA0A 3DMFA 4NZZA 4CF6A 4F5EA 5HM6A 1RRGA 2VDWB 4RQBA 1XA4A 3U80A 4D9FA 1U9CA 3K1AA 4JQOA 2ZPTX 4N3CA 3V2IA 4HVCA 2CXUA 2EZ8A 1QORA 2EATA 5B37A 2GM4A 4BEVA 5SICE 3QFTA 2I9PA 2VDOB 4OJYA 2R8OA 1KEWA 2IY7A 1KQOA 4YT4A 3GG9A 4HDAA 3NKVA 1UEJA 2ZSUA 4J16A 1ZXXA 5HUJA 3GFBA 4LXQA 4TLBA 3HNPA 3L92A 2ZUTA 4AZ3B 2D0OB 3P2MA 3LLMA 1WZUA 3IESA 2RH8A 1JNYA 1NI4B 4FSDA 3ZIDA 5KEIA 3ANNA 3SJZA 2OHFA 5DN6D 1VSBA 4EFKA 3VX4A 5TLSA 5GJWC 2FUG6 3DT8A 3E9YA 5LYJF 1Z18A 4OXRA 2CNDA 3UT6A 4W7SA 4EKNB 2VWGA 3M7IA 4DDTA 2CMHA 3K9WA 3KQVA 3SXJA 3SJBA 1BQ3A 1BXRB 1PJRA 1DTWA 1UCFA 4G0YA 5FPHA 3EXHC 1C8VB 1H8EA 5KKNB 1CF9A 4C87A 3N8HA 1N6IA 4DWJA 4J9UE 3CH4B 5ALPA 4EECA 1PJTA 1KJ9A 1QYCA 3OP4A 4M1SA 5KQPA 3W6NA 4I2NA 3BFJA 3JRWA 3M83A 1Z0ZA 1BE1A 3LGAA 2NU7A 3EXIB 4IV0A 2XBUA 4A8TA 4CG3A 4TL8A 5FPYA 3LBIA 1H4QA 4D25A 1XCBA 5K3FA 4AUEA 3REQB 4BNGA 5FH9A 1FZTA 3AI7A 4G2TA 3JQ9C 4U9UA 3GMSA 1KEZA 1NI3A 5AQEA 1J1ZA 4CU5A 1T13A 3K0SA 1YR9A 2FRVA 2PZEA 2R7NA 4HWOA 3UMFA 1NUPA 3ZLUA 1YACA 2JLUA 3GZ4A 1KAMA 4GBMA 5AOCA 2WD7B 3Q6MA 1NXPA 3J80A 1UFOA 4CIWA 2YDYA 4L6CA 5FEMA 5LP1A 4TM8A 1IBSA 3OZIA 4H6WA 2NTJA 1JXAA 2QWXA 3JZIA 2P3QA 2R7MA 3RSLA 3OJCA 2PUAA 3CJRA 5C37A 3T7SA 5K05A 4QUAA 1KO7A 1EFKA 1MRSA 3WBBA 5H4GA 3L9WA 4PNZA 2B37A 3D0OA 3PCXA 5ES4B 3PK0A 4RVFA 2AXEA 2Y1WA 4LTMA 3K5HA 1G38A 3PWKA 4XA8A 5ALLA 5CD9A 3F8WA 3ILSA 3M3PA 3KZMA 2BDEA 4GX1A 1Y3HA 5D51S 4S3MA 2R8EA 3SCZA 3ABSB 4H7HA 3EVEA 3FFTA 4W5TA 4XIYA 4GG1A 2P40A 2NAFA 1FMCA 2UYYA 3R40A 1XZCA 3WGQA 4XXHA 1XTBA 2V55B 2P1DA 3PXUA 1E4VA 1JJBA 1H4VB 1ODFA 3ACCA 1OV6A 4J76A 3QMVA 4R1MA 4RK0A 4UHBA 4KWHA 4BOYA 1N1DA 1T2FA 2XI4A 3AF1A 1UDRA 5LA6F 4C5CA 2CY0A 5C32A 3M33A 1UC5B 3TW8A 2ZJ2A 4PTYA 1DG1G 5IAGA 1PLKA 1DRJA 3WGIA 2OUKA 4RZQA 4ZRMA 5KJFA 1Z2AA 1S2OA 2QLBA 3AONB 3M4YA 1BN6A 1Q0UA 3NTLA 3M6XA 3RFVA 1XL1A 4BJ5A 4MMZB 5IJXA 1IHUA 3BMQA 3LGSA 5BYJA 2R7KA 5B3LA 7GPBA 2O5EA 4H9GA 1K0UA 4Q39A 1GQSA 4I4TF 1XAGA 2NN3C 3ST7A 4HSGA 4MMYB 1EUZA 4V2IA 4L8WB 4XQ0A 1ZD8A 1VHTA 4V24A 2D1TA 1C0PA 1YQUA 3GLHB 1Z68A 3NC1C 1KI6A 2WV9A 2IHTA 3D2CA 2RFLA 5BN3A 4JT9A 3DOUA 1E7YA 1C2TA 3INGA 5FTMA 1KWKA 5ECDA 2FPIA 3C7TA 4HKTA 2B82A 3D4LA 2CVZA 2YYAA 3KHTA 4MCHA 1L4LA 3TZQA 1EVJA 2XYQA 2VUUA 2V7UA 5KQLA 1D8TA 3B6KA 1NUAA 1XK6A 3HPQA 3N0RA 1Z8DA 1IIRA 2BBWA 2P5UA 5J2UB 1UIMA 2OV4A 3ETGA 3G9UA 3GT3A 3P4UA 4AFNA 5HFJA 3PJEA 1ZNYA 4NNJA 2ATXA 2Z2JA 4EITA 5IU6A 2PGNA 1NP7A 2PH5A 1P9RA 4BS9A 1C3JA 2VHCA 2ZUVA 5ALUA 3G9TA 5T41A 5AW6A 2CXPA 5EXTA 4RKYA 3JVIA 4RJLA 3TUIC 2PIAA 2PYZA 3GARA 2NLOA 3KL4A 3OOSA 4HDNA 4MIOA 4NFYA 4RD4A 2JFWA 4U7WA 2W2MA 4FMDB 4HNQA 4BUCA 4R1SA 2IV7A 3U31A 2XUAA 2PM8A 1WB9A 1IEQA 3ZV7A 2GXSA 3MJFA 4GVPA 1D0VA 3UBTA 5JYEA 4HMQA 3ND7A 2QN1A 1G3IA 3D6HA 3I5XA 3ANSA 4LJRA 5HS4A 1UBTS 1Z38A 2GXQA 4YHBA 3THOA 3UIEA 3UJAA 1LV8A 4PFKA 3HBFA 3CW9A 5F35A 3CVWA 2VAPA 2ZIGA 3WK9A 2DUUA 1QAQA 3AB7A 3O84A 2B61A 3PG5A 5C2JB 4BVFA 3WGTA 4N76A 1DPFA 1VKOA 2H4YA 1YR3A 5DN9A 4CKEB 1AKUA 4WMLA 1EBFA 1YJXA 3MCAA 4QDOA 2VHTA 3CONA 4HVAA 4M0UA 1TK2A 3SFZA 3D4BA 3QKRB 1K1EA 3KPWA 1YCHA 2A67A 1P2UA 1ARZA 4G5RA 3IQIX 3LTEA 4LY3A 1SPBS 5B5SA 4AC9A 1NI4A 4UPDA 4Y6LA 3CRVA 2ZULA 1G2OA 1YV9A 2Q07A 4P0QB 1QRDA 1X8LA 3OHSX 2HD4A 4JR2A 2WINI 1PHRA 2X4LA 5H9VA 3UK0A 4CIXA 3QE9Y 1S2MA 1T1RA 3ADKA 4W99A 1UPAA 4QHYA 1ZSNA 3RSCA 4BNUA 1WCXA 4RMGA 2X9LA 2A78A 4UEJA 2H16A 3Q15C 2H5EA 2PA3A 4IIBA 3RWOA 2PBFA 1BXRA 4OFXA 4INPA 1ZAKA 2HRRA 1Z2PX 4AJIA 4F3CA 3JVUA 4NU5A 5KOJA 3PF8A 1FFBA 2ZATA 2EL9A 4ECAA 1NUUA 4MW0A 4HRAA 3EXIA 3L7IA 2HSJA 3QJGA 2WOOA 5T4BA 1DKQA 2QTWB 3NH9A 4GBJA 3REOA 2QQGA 4AF6A 5JISA 3OCVA 3U5TA 3FMFA 3E5RA 1KF0A 2ZWAA 1GUDA 3EZ9A 5I9SA 1DXQA 3R3JA 4KW7A 3RC1A 3CZ5A 2BHSA 3BDAA 3D7NA 3MT0A 3JV7A 2KE5A 3AB8A 4KFSA 4QVGA 2WSBA 4UNNA 2OLEA 1F4LA 3LUDA 3KVVA 4EX7A 3OP1A 3LY8A 4GP9A 3RT1A 2A1TS 1BGVA 4D99A 2WD7A 3USZA 5EGSA 4YYZA 1VMDA 2IHKA 2RAUA 3KOZA 1DCTA 3PYMA 1E4YA 3VR5A 3LBHA 2J31A 2PUBA 1ZMRA 2IPMA 4O33A 2BMVA 2F00A 5FAXA 3S0JA 3O6VA 1N9GB 3DB2A 3DFZA 1PWZA 5GMOA 1YCFA 2JI9A 1IUPA 3OX3A 3KQYA 4YUWA 1KJWA 1KP9A 4I81A 2W6MA 3H11B 2V1UA 1SIBE 1HG1A 3BIFA 4I5FA 1DWOA 3GDFA 1UIRA 2G5CA 1ORHA 3IBTA 4I9UA 5K3CA 3GJTA 1PFUA 2GD0A 3HY4A 1T1IA 4EPYA 4N0DA 5EE3A 2BSQA 4J07A 5CBPA 3BOSA 2P9QA 4CDGA 2F8MA 1YBAA 1OH7A 1LVHA 2Q41A 1VLQA 3OCCA 1FRFS 4LNHA 1WUHS 1ETUA 2COUA 3ICPA 4Y1GA 4BFWA 4M87A 4QGFA 4RANA 1OHHD 3GCDA 4DDKA 1EIZA 4UHCA 1SU4A 1ML3A 3PC2A 4ITUA 4YRBA 1CB0A 4DT1B 2O2ZA 2VBGA 1K9SA 4OJQA 5CT5A 4PEVA 4RA6B 5JBNA 4G0MA 4S1NA 2HMAA 4NFHA 3NXKA 4H0CA 4L50A 1O4VA 2Q6KA 3T3IA 4P36A 5ADWA 1X7WB 1FTQA 3KHUA 3JVDA 4ANFA 1KEUA 3P96A 1XDDA 3OIGA 4L9RA 2NU9B 3VZRA 1N36B 3WP0A 4LCEA 4CM9A 1TGVA 4XCXA 3N0TA 3DB1A 4MLPA 1QRSA 1CIVA 1X2BA 1YZFA 2F67A 2FE1A 4XH9B 4F5WA 1SVOA 3GLHA 4HH4A 4J0QA 2VT3A 2GLUA 4JBIA 1D5WA 1TAUA 4KYIB 1SXIA 3BA6A 4KXWA 2ANCA 5B1HA 2CW5A 2JJQA 1E98A 2GSWA 4MICA 5K1ZA 4RJIA 5FX2A 5LSAA 1HR0B 4AZSA 2GBPA 2P0EA 3GY0A 5JADA 5KYUA 2Y66A 4JUCA 1SBYA 3SDSA 5TPZD 1YQ9A 5JCJA 2C88A 5E6UB 2VQDA 1PLJA 5J2UA 4NMLA 3BTUA 4MR8B 4EBBA 1VL1A 1NUHA 4ARZB 4D9KA 2FW8A 2G6BA 3HB4X 3MJDA 5DCYA 1GRNA 2WQ7A 4JEHA 4W5WA 1V96A 1Y42X 5A05A 3RFTA 6YASA 1KXZA 2OP0A 1C9EA 1MHPA 1NMYA 2LCIA 3LUKA 2VJYA 2YV3A 1UBJS 3HWWA 4J49A 2WW8A 4ZVLA 1MPXA 2HHAA 4LQDA 4EJSC 2BI4A 4MO9A 1G8FA 1O77A 2AJLI 3FM9A 4K8OA 3QU5A 2R1TB 3PFNA 4KVGA 2NWQA 4A2QA 4LVUA 4D9MA 3DE4X 1CB7A 1N75A 2OCKA 3ETNA 3EBOA 3GVXA 4EARA 4BN5A 3NTOA 1L7QA 1TAHA 1BRTA 3S2UA 2EBFX 2NXJA 1FVHA 3HV2A 2UDPA 4MW1A 1FYFA 2RDMA 4OB6A 4CW7A 4UBMA 4F0JA 2XTJA 3ZIAD 3CZ9A 3L82B 5LQJA 2QDXA 4DYVA 4FJ1A 3LHSA 2H2AA 1G9XA 5IN4A 5KINB 5FQOA 3TB6A 1NXTA 3LOUA 4FNAA 1TX4B 2VBFA 5HGXA 4UEOA 1QG4A 1FU4A 1NOIA 4XCQA 1AUOA 2J6HA 1EKXA 1B8PA 1R27A 1VYTA 2VJQA 4QU8A 3RVKA 3WYAA 1KRHA 3ZWXA 3VC3A 4WFJA 4MVXA 3TRFA 2RGWA 1D5CA 1YD7A 3OJWA 3QKRA 3MHTA 1GZUA 4E3ZA 1LTKA 2DQKA 5AT1A 2B69A 1VJCA 1ZKMA 2DVMA 3QWIA 4HH3C 3TNDA 4A6XA 4AP6A 1IZZA 1HT1E 1Y9DA 2G25A 3FLBA 1F8YA 1LB1B 2XD4A 2GN1A 1Q84A 3PEFA 1M75A 3U4MA 3FYHA 1BCSB 3IUMA 1ZGAA 3DPUA 3JQPA 1T5IA 5TVKA 4FBLA 4LJ8A 3EA5A 4MKGA 4LF9B 1EK6A 2LNDA 3L4SO 4PHGA 2XUQA 5THKA 2J0SA 4DR3B 1FNSA 4YRFA 1Z7BA 5EZQA 4ASUA 3PEYA 1Z0JA 2WJHA 2AKAB 2C61A 1F9AA 4UNSA 2WTMA 1PD1A 1Y6RA 5EE5B 2O8VA 1KE1A 1WPXA 4YI5A 3T5TA 3E35A 4B8WA 2P68A 3OKFA 5G1OA 4CTNA 3MCTA 5BN1A 2B30A 2JPDA 3DFUA 1EM6A 1DJNA 4QD3A 4YMIA 4WNIA 3S2YA 3WYBA 2ZJ5A 3DQQA 3OEEA 3NAZA 3GUZA 1LRLA 4NL4H 4UJ3A 3GA5A 5E4YA 4YRGA 1U9IC 4DM3A 2WWWA 4B8YA 4ITVA 1U8YA 1IE3A 3CINA 4R54A 4UBKA 1HUQA 2W22A 3GT4A 3IPYA 1OLOA 1DHRA 4AY3A 2VYQA 1KVQA 1WCYA 3GFRA 5E38A 1HE1C 1WXXA 5K3BA 3RK0A 1ORIA 2ZYDA 3LFHA 1QP7A 3TZKA 4OVKA 3LX8A 3L46A 1YA4A 4N3GA 2JAOA 3NZEA 2ZUBA 3FVVA 1PNRA 1II0A 1FSFA 2GD6A 3ZXXA 4A27A 1Z07A 2ZU6A 4QBKA 4ALLA 2VN8A 5AUNB 1W1IA 2UZAA 5C5EA 3KC2A 2ENWA 4YRAA 4HAVA 4FYPA 1UDAA 4D9BA 2ODEA 4U7JA 4EHKA 1NPDA 3TTVA 1QHXA 2PEYA 4DLYA 4HWSA 3A37A 4IJUA 2G9ZA 1J39A 3HPRA 1AZSC 1OIXA 2QJRA 4Y6OA 4L4RA 1O6GA 1MVLA 2VP2A 4RESA 5TMPA 3QA3E 1H6DA 3HZOA 5AXAA 3EZ2A 2CNOA 2IOHA 3T95A 1M73E 4R5MA 3VSCA 5I9IA 5A9TA 4HLCA 3PCRB 3JVEA 3CCFA 3I37X 3DOIA 4MI6A 5H02A 3W5UA 1GQYA 1QQAA 5EQTA 2FWRA 1FSPA 4WCDA 3OZVA 5SYNA 2DGDA 4RA6A 1ILEA 5HM8A 2OV6A 3SG0A 2OV1A 4IS3A 2II6A 3IKVA 4BNVA 1X7WA 4PU0A 1JWAB 3CX4A 2OMKA 2Z9BA 2IUSA 1RWWA 2NU9A 1ULHA 5CTAA 4FMBB 2IGBA 4D57A 1DU4A 3DAFA 3ZWNA 3DPSA 1K3UB 3O5AA 2PN1A 2QD3A 4KE7A 1I4EB 5TT0A 1ZH6A 3C4JA 2FW1A 1Q6YA 4MGEA 5BT9A 5CBKA 3WBJA 4JXZA 2I2BA 5LL6P 1E9EA 1N5LA 2FFAA 3WYEA 3ZGZA 3K6KA 3NDIA 2H59A 4LJYA 1X94A 3BSFA 3C87A 3HVUA 3K0KA 4KFTA 4C4XA 4XWOA 1CRWG 3DZJA 3FTPA 5E2AA 5E6UA 1Y3CE 2FG6C 1KZYC 2P2SA 3QVJA 4Y98A 1GUBA 2YS7A 1L5QA 2XV1A 1PR4A 2RC6A 4MRSA 5ER6A 4MR8A 1Y4AE 3ROTA 3RSGA 4EO7A 1UKCA 2CSXA 3UHFA 3KUCA 4KN9S 1S8AA 4ARZA 4JU9A 2GJ9A 3RYIB 3CEHA 3NUZA 3AEYA 1KK1A 5JDIA 3W6UA 1XKXA 3IAM1 4HFNA 5J4LA 1D2HA 1G1MA 121PA 1T4CB 3NPMA 3NHMA 3SJAA 3ESCA 4P7BA 4KDFA 3F7TA 1D2CA 3L6DA 3D6UA 3O94A 1P77A 1Q83A 3LDHA 3B2EA 4LOJA 2Q5IA 4L9SA 2LKCA 1VZ2A 2R1TA 3DYBA 4F56A 4Y2HA 5EMKA 1U7UA 5HKOA 1XN1A 1A4XA 2JC3A 4JNCA 4TQUS 1BVRA 4U8HA 3QPBA 3F3MA 2Q27A 4ENWA 1PIWA 3L0YA 1WXIA 2O7VA 1KIAA 2ZIWB 4H60A 5FFNA 1Z5UA 5KHOC 1G6KA 4LC1A 1E6WA 4X8HA 4A91A 4KX5A 4NYJR 3VR6A 5JS7A 5FCDA 4YP7A 1N2XA 3QJ5A 3OA0A 2XMZA 1RHQA 3P4YA 4NDZA 4NK5A 2HCFA 2VT2A 3PXDA 3EF3A 3WLRA 2XRZA 1TMGE 2EJUA 2XMPA 3PFBA 3PP8A 4Y2SA 3EIQA 1YDMA 2ZJ0A 5EINA 3PR2B 3WOVA 4R0VA 3B7GA 1V7CA 2IYOA 4OOFA 5CW1A 5CA0F 3GLFA 2GXUA 2WP8J 2XA2A 4RVHA 1TC2A 4ZPXA 5AM1A 1NSFA 3VXKA 3WNVA 4QA9A 3RVQA 3ZK8A 1U0TA 3OD5A 5E7QA 4DWVA 4G0VA 1DAOA 3MSXA 1GJRA 2XCTB 1HMPA 2X4GA 4W6QA 2IW1A 4UM7A 4BEWA 4CIAA 3N8IA 4QUDA 3T4XA 3MK31 4YROA 5CHEA 4Q3AA 1R8YA 3TG2A 1XDUA 2C5HA 4IQFA 1BCSA 3DZHA 3W6ZA 2PUFA 2QAGC 1BRMA 3RYCB 1Y80A 1N9KA 1E9RA 1N8TA 3QXJA 4GOJA 4MYUA 5LIPA 1IRIA 4PM4A 3DVQX 1FFSA 5A0FA 1G41A 1YS1X 1ZVKA 3KUUA 2WAYA 4IS2A 1N57A 4II2A 5CVEA 2WAAA 5DWVA 3TE6A 3F5FA 3W5BA 1EESA 5DX1A 1ZM4A 2ZXEA 3G2HA 4PC1A 4FHGA 1CZNA 2GEKA 3QVVA 4C6SA 5C31A 3P8ZA 3WGGA 4WOKA 4XJVA 3DFIA 1DSSG 3OE5A 1DIBA 3LZDA 1EFVA 2WZCA 3AEZA 2QTRA 3BIWA 4MVYA 4G0PA 4R2KA 4AY4A 3CTMA 1ZCBA 1H3NA 3E9CA 3KJHA 1QFJA 3Q3IA 2AQHA 4BFTA 4LECA 5AYVA 3U1VA 5HILA 4E5KA 4QOEA 2FWMX 4ZQCB 1U3TA 2IU0A 3D3JA 1R10A 4ZPJA 2OYCA 1KR5A 3NLLA 1M2GA 4CHTA 2GM9A 3L8HA 4P54A 1MAVA 2VOJA 2XOEA 5KTNA 2C3MA 4Q1EA 3C8HA 4EW6A 2OL4A 1H2ZA 4JP1A 4YI3A 3WL7A 2ZRKA 3OTHA 2Q9CA 5LPNA 3B9RA 1O9HA 3RE1A 4EW3A 4DREA 4GI3A 2E4WA 3ANLA 1XTVA 2BPOA 3S7ZA 1QO0A 1JVSA 4UTZA 1DARA 3EE6A 2BFEA 5CXSA 1GA1A 3OD1A 2ZTHA 3OVMA 4NCNA 4EY3A 2QRLA 1AHIA 2XYRA 4ZYLA 1VI5A 2PMFA 3K0HA 4GX2A 3EGEA 4BNMA 1ACJA 2K87A 4N0MA 3VYWA 1LPNA 1CIPA 2FHPA 1FP2A 5CG1A 3T3OA 2ZU0C 4HQLA 3DOJA 3ETHA 3ZHQA 3QOWA 4UEKA 3KPJA 1NPTO 2CGEA 1ZD5A 3BD9A 4FW9A 4M8SA 3UH1A 4GGOA 1CUHA 2OAQ1 1CUJA 2Q50A 3OLWA 7REQB 2AZTA 4WI1A 4IUBS 2HRCA 3ROFA 2YWHA 1Y6JA 1J21A 4L27A 1RPAA 4QGAA 1NJ6A 4C0JA 4LFAB 2EDCA 1QK4A 4OMCA 3WLMA 1J70A 4ISCA 4QJ5A 2LDBA 4TQGA 5AKZA 4BNKA 3HH8A 4JI5B 3AEUB 1QRUA 3HVKA 1K97A 3SKXA 3N76A 5KIAA 4L8GA 3CG4A 2A94A 3CN9A 4PHHA 4JWTA 1W85A 5F21A 2O57A 2P78A 3CPEA 1BWPA 2BL4A 3Q87B 2JGAA 3VZCA 5IC6A 2K6GA 3CA8A 4GLLA 4UD6A 4G25A 4HDRB 1ESMA 2X8BA 4G0NA 5EMLA 4D82A 1W4AA 4GMFA 5K99A 3PIDA 3GAZA 2NNWB 1I2MA 2IUEA 3LWNA 3OA2A 4NDAA 2YWEA 3FOAA 3RRMA 4K46A 4KOAA 5GONB 5EIBC 3RYIA 4DC9A 4EP1A 2AX3A 1ZUHA 2FP3A 5JNTA 4F4CA 2E48A 3EPLA 1UBKS 1TVEA 2C97A 1LX6A 1PWYE 1T4CA 1JDVA 2HIMA 3ER8A 1M1NB 1C9MA 3K70D 4JJKA 2XT0A 4E12A 1OWLA 1PKXA 2X1LA 4NF2A 4JKIA 4ZI5A 1Z4LA 3ITDA 3UQYS 4AUNA 2C7QA 1I1QB 4QU9A 1OFVA 3RLIA 2VTVA 3WHKA 2A5FA 4MVJI 4G97A 5HZMA 1JDBB 2ODNA 4FDMA 4CTOA 1N4DA 4JWKA 1NBEA 1AF7A 1XRRA 5DHQA 1USWA 3JQ8B 1B8OA 1S7GA 3COWA 1IJEA 1R12A 3O4RA 5DHRA 4CJXA 1JEYB 1Y63A 2CZGA 1WNFA 3IUNA 5BSTA 3FFBA 4YAKA 3DULA 1VCIA 2IA5A 5J9FA 1ICEA 1RYFA 4QDJA 4F3RA 1GR0A 4FFDA 4HZUB 4LXTA 2IDKA 5SZKB 3W2EA 4F91B 4QQ8A 1XVVA 4TLLB 5BOVA 2BFMA 4N54A 3JD1A 5C5CA 4IJMA 1GQFA 2RE8A 3H1BA 3OQHA 3O9VA 4GOND 4BO6A 1CZOA 4J91A 3VJLA 2O07A 3N2IA 2R1ZA 3F4BA 4BQIA 2W6CX 3GMDA 3NCHA 1N5MA 1YXMA 5DKFA 1UMKA 1UPFA 3P0HA 2VC2B 5F2OA 1SXPA 3ASZA 1VJRA 1KRWA 3A4LA 4P8RA 1UT6A 4LOLA 1A4RA 3F5SA 3OM9A 5TY0A 4OJNA 4DBLE 3RYCA 2VA8A 2V4ZA 1QYDA 2RG7A 1G21E 3JY6A 1GV0A 3PC8A 3QPDA 4D5EA 2BDUA 2AKEA 1GRCA 3QSGA 4QOGA 4FKBA 3LQFA 4UDNA 4OMUA 2J7PA 1X42A 3IODA 3H5WA 3CH5A 2NPOA 1EK0A 2O2IA 2VWQA 2GVDC 1HO3A 4XD2A 4EK9A 1HYBA 3UK1A 1VPDA 3IAXA 5CX4A 1ND6A 2YNMC 3PFHA 3O7MA 1EVLA 1T2EA 1XO1A 3DEHA 1GNSA 2FWBA 3G59A 3K1JA 3JARB 3WRWA 4BLVA 5KNCH 4MGKR 2VF2A 5FUWA 1P5FA 1YI1A 1EFTA 1QKJA 3GDHA 3KELA 1JIIA 3I5UA 5HGJA 4LZJA 4AY2A 3LF1A 1YDWA 1NVEA 1ZQ9A 2C2OA 1ZUD1 2KM1A 2X76A 3BSWA 3B70A 5DXAA 3DXFA 1H3FA 2CDAA 1A7UA 1P80A 3EPKA 3VKGA 5B57C 2P9ZA 3ILVA 1DKUA 1M6NA 3T94A 1Y8QB 2NUPB 3OPYI 4HS9A 4MDYA 1B6TA 2PZBA 1U1IA 4AN4A 1G8KA 1T9KA 2BONA 621PA 1BEUB 5C7YA 3WYGA 3FBWA 1IH8A 3ONDA 3V1KA 2WDZA 1PI3A 1DELA 5EP4A 1D2GA 3A7DA 3DSRA 2C2HA 4DTCA 4RDIA 4DS3A 4JCCA 2IYZA 2ZDQA 4CL3A 4NU0A 2CFIA 1YRLA 3PQFA 3O8RA 2EF0A 4M1ZA 4FMCB 4XI9A 4WERA 5BVHA 1AF4A 5JMTA 1QTQA 1P9NA 1W76A 2CV2A 2WUFA 3V4SA 4C4SA 2QGNA 3F6EX 5ALTA 1GEGA 1AS3A 3ZEIA 3BB4A 3STYA 1QIIA 1W4ZA 2ZB3A 4HP8A 2ISQA 2YJTD 3B1VA 3PUIA 1ZK4A 3T3GA 1TEVA 4WVFA 4MYCA 2IXFA 2WC1A 4XWAA 3CGWA 1C8KA 4K2HA 3CNOA 4K9RA 4TYWA 1P6QA 3WBKA 1MJGM 2AXNA 4JLWA 3RABA 4IXWA 7REQA 1RXIA 2E18A 1VPTA 2Z30A 2Y1EA 1F4PA 2CYCA 1ZK3A 3GGCA 3IC5A 3KK0A 4I6JA 4QGSA 2GAAA 4QECA 1QLJA 1LEHA 1OBFO 1F5SA 2Z1NA 1DQRA 2HJ9A 1SUIA 1PK8A 2P9EA 3A4NA 3EZYA 4KH0A 5BQPA 2C5LA 3ZNQA 221PA 3AEUA 3IIJA 4OHRA 5LZ8A 1E2PA 4M7RA 2QN8A 3UJNA 1URPA 5KTOA 2WKPA 1SXGA 2HNKA 4WINA 1D2NA 1JR4A 3VVLA 4EI8A 1DBPA 1S2NA 3UENA 4EVIA 3DW3X 1FSGA 1IBCA 3KT8A 5FHQA 1ZUNB 3QXSA 4YP5A 1JJAA 1HZZA 1LH0A 1TVMA 2JBHA 2W0SA 3A6ZA 4X90A 4YMHA 1PL7A 2PLNA 2PSFA 1QJCA 1HMYA 3GCGA 3TUZC 3SDZA 1P7WA 4KREA 3RARA 4P7FA 1PDOA 4MI9A 4G0OA 4Y18A 2IZ0A 5JRDS 3K9GA 4GF5A 1BMFD 2AOXA 5GONA 3MS4A 1H2AS 3FHOA 2IQIA 1UP4A 1CHNA 1XTUA 4AJOA 1M1NA 4JUFA 4KDCA 1MOQA 1LSJA 3DVAA 4Q7JB 3TLXA 3GIWA 5J3JA 3UG7A 2XRFA 3H5NA 1HFWA 1EXNA 5EVJA 4QM7A 3GP8A 5EFOA 1H4SA 3I3OA 1IXSB 1DDIA 3FSGA 3H8WA 1DIGA 2PSJA 3A3PA 3L6OO 3C74A 4KGVA 5MN5A 4PF1A 1PG5A 2PL9A 2BGJA 3JQ8A 2GLXA 3S27A 4DLBA 2B4RO 1NY6A 1R66A 2I6XA 1HDIA 3EEFA 2HTEA 1E1NA 2X0NA 4FNOA 1JEYA 3BQ9A 2V8OA 3LW7A 4QTXA 2VYND 2IODA 4LYDA 1FRZA 1ELOA 2FV8A 4PZCA 2H1SA 1TFUA 4HZUA 1QZZA 5YASA 1E6CA 3P9XA 5CVJA 5C7IO 1E69A 4JJFA 3K1YA 3UYLA 1MOSA 4ZO4A 5DWQA 4Q18A 4FILA 2AG6A 2CLDX 2ATCA 3ODGA 3S4YA 3W5CA 2W8BB 1CJBA 3BVPA 4XYBA 4Q4CA 2N9UA 2Q3JA 1XEWX 2C8JA 2GPAA 2P5TB 3EZXA 1GKKA 4K28A 2X1MA 3WJ1A 4Q03A 4AB1A 1U0LA 1H2HA 2F1RA 3P9ZA 5EMNA 2K5UA 3I5AA 2A1TR 4LUCA 2LWIA 1FLNA 2ARKA 4MPPA 3ZC3A 1RFGE 3SLRA 1CNEA 4FIDA 1LDEA 2HADA 3B20A 1W1WA 3HHPA 1X19A 2V03A 1OVGA 4AKSA 2HSGA 1JSZA 3KKOA 3A7EA 3NGMA 3QLJA 1U2DC 5E7MA 1PD0A 3BQNB 2V45A 4JKOA 4C29A 3TFQA 4MITA 5GJBA 3WGNA 3AFHA 2IH2A 1ZZEA 3NOOA 4OP1A 4N82A 4DILA 5BUSA 1M2VB 4G4SO 1YC2A 3KJQA 3FVTA 1O5OA 3JARA 2XF2A 2CMKA 2EFJA 2FSVC 3QPVA 4Z2YA 1L7MA 1WXWA 3K2QA 3IV9A 3SQMA 4GI2A 4ZQBA 3T4PA 1AXEA 3BULA 2JFHA 3ZHTA 4WVLA 2IOQA 4RD6A 3JU3A 3ZE2B 1ZH8A 5JQWA 3RC2A 1ENZA 2HHCA 4OBBA 3QH4A 1UT8A 1EVKA 4FQ7A 1YJAA 1N5JA 1J0AA 1PJ2A 4CIBA 5L3VA 5FQNA 1PV4A 3OTGA 1T2CA 4JOBA 3II6X 8OHMA 1CEQA 1Z17A 1TLLA 3E84A 2IVZA 2QRMA 1WDMA 5A4FS 1P2FA 2J0VA 3FUTA 3AKEA 3H3JA 4YVFA 1W29A 3MJRA 4IFTA 2O3UA 4BUZA 1CR2A 3KUKA 4CRWB 3U7FB 2UUBB 4UMFA 5FYDA 3OFJA 2C98A 4AD8A 3T1YB 2AYXA 1L7NA 2H1FA 1TUEA 5CUQA 3SZRA 2F62A 3CRMA 5DN6A 4DJTA 1E0SA 5LNK6 3D6VA 5FO1A 4WH0A 4JJ6A 5DSTA 2QPOA 3CU5A 3G8AA 1GTJ1 3BB1A 4NABA 4AZWA 5L4SA 2VDLB 1W9HA 2VK2A 3M6VA 4HDQB 4EEZA 4FBGA 5BR7A 2WIAA 3HXQA 5MHTA 4AX8A 4P33A 3ZU3A 1U94A 3ECAA 1USUA 2VAMA 3C6ZA 4Y9UA 4EZIA 4DV3B 2O3SA 3LUAA 3DOFA 4PFQA 3IXLA 1QIDA 3BFVA 2VI5A 5AJTA 3NPAA 5I5EA 3GNTA 5FL7A 2F6RA 2GJKA 4KMMA 1JG1A 3IDZA 1J8DA 4G84A 4K9LA 1Z33A 2ZR7A 1VG1A 2QIPA 3I4CA 3OCZA 4YJFB 3SE0A 4ZYYA 5DTEA 4DRXB 4KACA 5HS6A 2OYRA 5EXSA 2OXRA 1XI2A 2OO5C 1OKKA 1IOZA 1M5UA 2Q4OA 4D9IA 2AG5A 3PPYA 2PUWA 4CLOB 1NZDA 4O6VA 3RPEA 5CA1F 2QAJA 5L9AA 5HIKA 1PTKA 3DAOA 1FVOA 4J0DA 4B6OA 4FFPA 1R9NA 4G41A 4LNUA 2BCJQ 3O3MB 2ZUWA 4O1HA 2BF7A 4U02A 1JWLA 4US1R 1NNI1 1R15A 3H1TA 1ZUNA 1SUBA 2LZ0A 1CJVC 2G70A 2X5XA 3W9UA 2X4DA 5LWQA 2VTBA 3BD6A 3ZTWA 2I91A 4TL7A 2FEWB 4JNKA 5EE0A 1NXXA 4IXNA 2P0AA 1UDCA 3TW6A 4B80A 4UTNA 3Q7EA 1J2YA 3U4HA 3TD9A 4WKOA 1K8YB 5AJYA 3PHJA 4PC2A 1H93A 2BUCA 2F1OA 1U0EA 3PGXA 1XVAA 3NT5A 4Q48A 4UATA 4S2UA 2FA9A 1VIMA 2WJJA 3SMQA 1ZZGA 2C82A 5DEOA 5DNCA 5JC8A 3EIUA 4WN9B 3RYFB 5BSHA 1M2EA 2XMCA 2ZT7A 1OPRA 3BE5A 5C52B 2F59A 5KJCA 4G81A 2WUGA 3NHSA 4QFMA 4X6XA 1NNLA 4WGFA 4RTQA 3WGMA 2O1WA 4LZNA 1WXFA 1SO8A 4WOBA 3OZEA 5AW5A 1XZAA 5C5IA 3P9QA 2WJPA 2Y1LA 3M9LA 1D4AA 4R2JA 3TAUA 1PJBA 1U3VA 2MYTA 3HA3A 4HJRA 4ND8A 4U0JA 1T0PA 3BFKA 5KHAA 1KEPA 3CNEA 1ID8A 1OT5A 1YI0A 3W78A 1K68A 3SGLA 2ID4A 3U3JA 1TTTA 2CJPA 3L8YA 4DLNA 3RJ5A 4AYWA 2H2FA 2E4UA 2D2VA 4GL4A 1B8UA 3NHLA 4A0SA 3AUYA 4G5OA 1CUDA 3ZBUA 3W8DA 3E7FA 3NRCA 4A1FA 2YIVX 1JIUA 1WTCA 2Z09A 4MLDA 2FDRA 1G9TA 2H9IA 3GG2A 3KV3O 4MUJA 2W8BA 4U2FA 1EE9A 5JZMA 4EA9A 1LPOA 2FPGB 5HKLA 3OZUA 3C8MA 3O8DA 1E3DA 1YFJA 1XLVA 5K2OA 3VPGA 1VPVA 2OHJA 3QU4A 4UHJA 3C4QA 3GO4A 2V9PA 2PVPA 1F0PA 3UCFA 5JFTA 1PDWA 1MO4A 1MT0A 3K0FB 3V97A 1MAUA 1T9GS 5A04A 1I3LA 2H08A 3PHHA 2IZZA 4LOIA 1HLPA 3O2SB 1OI2A 1C4KA 1KKLA 3CNHA 5C8DA 1QQ5A 2IXDA 4QC2A 3EVCA 1W6RA 4LYFA 3ACDA 5U1PA 5J43A 1YQDA 3VHRA 1PJAA 1FTSA 1Z4NA 4BVGA 4Z1MD 4LY6A 3C3EA 1ZGGA 3WB2A 1ZD4A 1ZI8A 4H3VA 4QJ4A 4ZGBA 4BCDA 1M2VA 2EP7A 4C7JA 4DPKA 4JLMA 3CVJA 1OA0A 4JJGA 1JDZA 3E9MA 1SG6A 2ID8A 5B64A 5LMZA 1TU3A 3DDUA 1IPHA 4EB6B 5DTRA 1IXKA 2PLAA 1VL2A 1WMAA 3MTGA 1OH8A 4GVLA 4JELA 3TKAA 4LI0A 4JKYA 1IHOA 2EC5A 3E7WA 5CT9A 5FUMA 4PCUA 3DE2X 1E6EA 1LPAB 1CZLA 4I1SA 1EFLA 4YQYA 5C8XA 5P21A 4LZWA 4UMDA 2GLTA 4TL9A 4WUVA 4Y9SA 2ORWA 4X7PA 3GLGE 1CPYA 4RLQA 1MEJA 4BVBA 1V1JA 5JC1A 2HWUA 1TCAA 2GA9A 4RORA 1EMDA 4S1PA 4ZO7A 4A8JB 3V8NA 4DY4A 4LVNA 4KL8S 4PLCA 1YRAA 4FI3C 4G09A 2NQ8A 2VJPA 4B45A 1FS4A 4E30A 1V7ZA 2WT4A 2EU8A 1V6SA 2W4MA 1IBKB 4TTAA 3LVBA 2VNHA 3MD9A 2I9KA 5DM4A 4IEFB 3V80A 4JU8A 2UZ0A 2Y76A 4R6XA 3WYCA 1KSHA 2WF8A 3LZCA 4GM1A 2I3ZA 1I7PA 3HJRA 521PA 1LKZA 4DSZA 3ZDBA 4MHTA 2Q5FA 4JSYA 4GSYA 2W2XA 4NICA 3RT9A 3T5DA 3TSWA 2VWHA 2Y8EA 2ZCUA 4KH1A 2VJKA 1X15A 3VPDA 3H9JA 1VKJA 3Q2IA 1RKUA 3ZX4A 1MZVA 1YI8A 1V8FA 2QKYA 4KC0A 1EWTA 2CV0A 1A2BA 1EFRA 2QX9A 1UKAA 3ZWKA 4JEIA 4V0NA 4IWYA 2XNCA 4OXIA 3ZW8A 3H99A 3ABQB 4HQ6A 1DADA 4PSDA 4B32A 1E66A 5ADHA 3DZ8A 3UMYA 3AETB 1KKMA 3PDWA 4TOIA 3A6LA 4DRXA 2QMHA 5DNVA 2IUTA 1ZOOA 1C7IA 1EP9A 2HMUA 1YRBA 2C20A 3I4FA 1HE3A 3NP9A 2H85A 4Q00A 2V7GA 1NLMA 1HH4A 2CF6A 2Q62A 3A1FA 3BAFA 5IVIA 4ENPA 1E4EB 1MEOA 2H8GA 4CLOA 3B3JA 2WKWA 3LCUA 3IUSA 3M6MD 1UK9A 4FE4A 3PGA1 4PQRA 4D81A 5EHGA 3ZHXA 1XPJA 3KQTA 3FPSA 5LNK1 3KXDA 3UCXA 1JHPA 4PZ0A 1U4SA 2QUAA 4RLHA 2QQFA 4LY0A 4ZVMA 5KJ6A 2UYCA 3U4QA 2P2CA 3GN2A 4OKSA 1SQSA 2EF1A 1GKIA 2OB1A 4CIVA 5F78A 4ZZ2A 1XRLA 4KZPA 5IDVA 2Q2WA 4Q16A 4DARA 3DG9A 3ED5A 3K53A 1AQ6A 3O92A 4K9MA 4PLWA 1JAIA 3OT1B 4GDMA 4RMHA 1E18A 1P0CA 3MUNA 4GAEA 3UICA 1IOWA 5F5NA 5CIQA 4B75A 4U2EA 5E3HA 1Q7EA 2ZRBA 3S8MA 4BHTA 5AVZA 5EGNA 4WN9A 3RYFA 4DG8A 2C2GA 5AVUA 1SVUA 2OBYA 4RJTA 5LIRA 2BLLA 4QZVA 3PQ6A 5LUAA 2W42A 1JHXA 3K0EA 4M1YA 2WAXA 4N4AA 5DM70 4MW7A 4RU1A 3ZVLA 4DMRA 2AA3A 3HJTA 1P18A 4L6IA 4J0IA 4R1PA 4A8HA 2OBBA 2R751 4BNFA 4O2AB 1A71A 3I9LA 4NE7A 1ORRA 3NW9A 3JQAB 1PVVA 4ZO6A 3H0CA 1W8IA 3LXMA 2EFHB 1RJ9B 3F7OA 5DX0A 1WE2A 2ATVA 3ICCA 2VRCA 3NJRA 4KI7A 1P9OA 3QVSA 5CVDA 3TRHA 5IEJA 3G9QA 1DC8A 3VU9B 2BHRA 2FK7A 4X8MA 1YUBA 1KIMA 1FLAA 3FWZA 3F78A 4JH0A 4OLJA 3LMKA 4N47A 5EJ9A 3L1KA 4F93B 4BNTA 5AUPB 3C16C 2DBQA 1D4ZA 5E9AA 4Q4HB 2RONA 1Y9ZA 3QVUA 4EYQA 3OI7A 3FPAA 2FPGA 2HGZA 4ZVNA 4LJAA 2EGHA 4LXIA 4AAYA 4ZTZB 1K0FA 1VI6A 4NK4A 4O3FA 2EIXA 5TPZA 1LSUA 3LFTA 4IDQA 5K4AA 1FTYA 3T99A 3VDXA 5KBYA 4JV5B 3K0FA 4UVIA 1U0NA 4DR5B 4EATA 2REQA 2IS1A 1DQPA 1IBRA 1ZU4A 1ES9A 3H9CA 2A9RA 3EHEA 3KOUA 4QGBA 3B1XA 4B2PA 3GLTA 4P7KA 4EMUA 3IQEA 1Y7LA 5KSOA 1K8RA 5GY7A 2G8LA 4MQ4A 3NBAA 4A1OA 4A3SA 4E7OA 1FP1D 3O26A 5K09A 3OMLA 1KH2A 1R3DA 3ZWWA 2EERA 4YAFA 4S1OA 1UPUA 1ZRHA 2ZOSA 4Y2TA 4A92A 4EB6A 5HW0A 2B78A 4LKRA 4WA7A 4WBSA 5JS1A 5JD4A 3BQMB 5F1PA 2VPZA 4F71A 1JXQA 4J2HA 1XZLA 1GU7A 1LX7A 3RJ9A 4A0FA 1XRPA 4NAUA 1PZFA 3DMGA 2R79A 4OQMA 1E2KA 2DCUA 3KALA 3VVMA 2QE6A 4HF7A 2C7VA 4HZGA 4DVGA 5C1DA 4R8KA 3KKZA 4PE5B 5COBA 2J87A 4RFVA 4YJ2F 3KJGA 3MGKA 4A8JA 1P33A 3C3AA 3DR5A 3ENKA 3OESA 1Z4IA 2XB8A 4FLEA 3MJEA 4QRIA 5IH3A 4JHXA 3CW2A 3T1QA 1I3NA 2AMYA 2Q3EA 4DFDA 5DGCA 3ZE7A 1ZD1A 3G6KA 1I7SB 4PLFA 3CY6A 2FPWA 2HK8A 4DWWA 4MZDA 4NTZA 5KVAA 2AWOA 4FKZA 1FUUA 1DOAA 2R6CA 5EN4A 1NNSA 4FHFA 2HIHA 3SLKA 4TLDA 4H15A 5EESA 1N33B 1H1LB 1NBIA 5KNBD 4RTPA 5SY6A 4WCVA 3W3ZB 1A77A 1KDRA 5FF9A 3OZGA 2JGEA 4BO7A 1XVUA 2HIAA 3AHCA 1UXGA 1QHSA 2IZ1A 2BUAA 4Y1FA 5BNZA 3D3KA 5I7FA 1PG0A 3V2GA 4DUZB 2A6PA 3TXXA 2BOVA 1GR1A 2I87A 2RHDA 4BRUA 1N3BA 2E4YA 3T0GA 1H6CA 1Q3TA 1UADA 3NBFA 4JYAB 5D5QA 3E5NA 1L1RA 1O97C 1ATIA 2W0MA 1J9EA 1NLYA 1Y1PA 3FNBA 4EH1A 4EPRA 2B8WA 3SYKA 3QRWA 2YV1A 1DUIA 4UBNA 1TM5E 3OSZA 3AETA 1PZGA 3LTNC 3DM5A 5FUXA 2GRUA 3IEXA 1SZJG 1UBSB 2QV0A 5FULA 1QNFA 3IS3A 3EDCA 3HN6A 4LJKA 4PWYA 3EUAA 1Z0DA 1C3OA 1HC7A 2IYTA 1OWOA 2QN6A 3MPOA 5B12A 3NCTA 3ND8A 2DTDA 3WLKX 3GYBA 5DO9A 1E4EA 5LZ7A 4KB5A 2P9BA 3SKVA 3TDNA 4YRCA 2Z2XA 3F4KA 4U6SA 4BE9A 5D5HA 2Q3LA 3BTSA 3EIEA 1HE5A 2ZWOA 3GWGA 3FXAA 1PJLA 3DCIA 4OA8A 4IGFA 1Z88A 1ZIDA 4GU5A 4JL5A 3VUEA 1ZEJA 1E79A 1VE9A 4GQBA 3T3EA 1RHKA 5CLQA 4KVZA 1FUKA 3QX8A 4D0LB 1E1QA 3K32A 3H1PA 2HCJB 2UXDB 2CXHA 3QV2A 1Z6XA 2MR5A 3OT1A 4PWZA 3R7DA 4E5YA 4YR7A 4OXYA 4F5YA 4C04A 2ERYA 2A1UA 3C1UA 5ESXA 2H6EA 2ISSD 5G02A 5THXA 2NV6A 3I2KA 3JQ7A 3VYUB 4KHPB 4UXHA 1DC5A 3RHZA 1CY6A 2G1JA 3QHAA 5C51B 1EJ0A 1CYDA 1V6CA 3NVKI 1M2JA 1DCFA 1RI2A 2Q1XA 1AKMA 4ND3A 2YDXA 4RPCA 4TTRA 2IEIA 2PGLA 3HFGA 4IEEA