2IIBA

Crystal structure of pasteurella multocida sialyltransferase d141n mutant with cmp bound
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
377
Chain Sequence
b'MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDNGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNNPYVKVMRRLGIIDESQVIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
publication title Structural analysis of multifunctional sialyltransferase from Pasteurella multocida.
rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 133
structure length 377
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iibA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iibA01
2II6A 2ZWIA 2C84A 2IY7A 4R9VA 2Z4TA 2IHZA 2C83A 4V38A 2IHKA 2IIQA 4R84A 2ILVA 2IIBA 2IHJA 4V2UA 2EX0A 2EX1A 4V39A 2IY8A 4V3CA 3S44A 4R83A 4V3BA
chains in the Genus database with same CATH superfamily
2AUMA 3U1BA 4IO1A 3AR5A 3HDHA 1U1CA 3P32A 5IBQA 2F1RA 4CI0B 5K3OA 3EC2A 5TIIA 1P0PA 1GLNA 4FHZA 1JN0A 1ZJYA 2BAGA 1QKJA 1WUYA 3AHJA 3H2BA 4JR0A 3FN4A 2DPMA 4MS3A 4TTSA 5ALTA 5G02A 1NWCA 1GD1O 2CLIB 5A1TA 4GECA 2BW0A 4MKIA 4JAVC 1E1RD 1HZZC 3B1ZA 3H5NA 3P2IA 4LHYA 5U4XA 3DHYA 5EE0A 4FYIA 5JSUA 3QELB 4TWZA 4U02A 2YR0A 5KTNA 3H1TA 3P9XA 5E6RB 4D9JA 1E4VA 3LY5A 3W6PA 2I91A 1J8DA 1IZZA 4GSKA 2ZIGA 3EHEA 4HADA 1XF1A 3FYSA 2OCKA 3R5FA 4B7XA 2OOSA 4DA8A 1PEKE 5KQLA 4X90A 3WNCA 3DAYA 2I65A 4CKWB 4YJ3A 5KX5F 3HFJA 2P3SA 2HBQA 3FLEA 4HDQB 1FX1A 5AESA 3VSEA 4OK5A 3GB9A 1Z4KA 2B35A 3E23A 1JL3A 2F62A 2TRSB 3D8RA 5CDGA 4GVXA 4RANA 3AZOA 3W77A 2Z5LA 3LDUA 1HV8A 3JYQA 2VPWA 4L7QA 3SXUA 5GJCA 4MR7A 4NKRA 3OECA 4TGLA 4YYZA 3WWYA 4MA4A 4ECAA 1HNXB 4JBLA 4K9NA 3VU3A 1F1BA 5DHUA 5AI5A 9LDBA 1I4LD 1T2AA 2D06A 4XGKA 3EDRA 1QGDA 3U3KA 3Q3CA 3IEIA 4CNQA 4G81A 4JR2A 4LZZA 4ZI7B 1ARZA 3TUJC 4FIZA 1NIPA 1SXJB 1Q7CA 3HCEA 1FFBA 3NT5A 4XB6B 1NVXQ 2VHCA 4HCJA 3JVUA 5EJ6A 4GPEA 2DTEA 3FMFA 3I9OA 4XASA 5LYYA 4E5KA 3JVEA 5C7YA 3KHUA 4DV0B 1JWBB 3QNWA 3G5UA 5GV8A 3IDZA 4Y2UA 4BQNA 3CVWA 1ULSA 1CDDA 1U2GC 2RIPA 2VDNB 3D3KA 4OP2A 2QJTA 5FPKA 1MIOA 1XQ1A 1BRMA 1JDBC 4B3RB 3CNBA 2VDLB 4F2PA 2X8LA 3RC3A 1YSCA 5REQB 1U8FO 3V4OA 5JAPA 2K4MA 5C32A 3K53A 4BLRA 3W6NA 4YDQA 4G86A 5L4NA 5I9NA 3A36A 1QE5A 4F11A 4OBWA 3E61A 1I1OA 3H9EO 3FCXA 4A0FA 3AEXA 1YC2A 3LT5A 3EVTA 1KVRA 4O2BF 1PT7A 1HPLA 4JYCA 2J0VA 4EPYA 2R87A 3K1AA 1C1DA 1EXDA 1T9DA 3HDYA 3JAKB 4PZYA 3VTFA 2Q6KA 5ALLA 3BFJA 3NHYA 5DI3B 2R47A 4DJFC 5B12A 2WNHA 5E1DA 1KYQA 3B85A 3K1JA 2JGEA 3GH1A 5EE1A 3U3RA 4AURA 3NHLA 2D5IA 4OXXA 2BEWB 2RGCA 4PY2A 3ZJUA 2YXBA 2F3PA 3PF8A 2FYTA 2CXTA 1AZSC 4IVQA 4OY3A 1IOVA 3E1SA 3O4IA 2E1RA 3OF2A 3HPQA 4LE1A 4D8WA 3JQFC 5AOAA 5LQNA 1UEXC 4TTRA 1MT0A 2R1ZA 2F00A 1MQ9A 2WSSA 2VDMB 1JKJB 3AY0A 3QKRB 3PNQA 3WNBA 5IAOA 3VA7A 2Z98A 1AE1A 4QUHA 5J4YA 4HBZA 3PZBA 4F1KA 5KSWB 1IY2A 1IBRA 3SX2A 5JJCA 1UXKA 3UAVA 1MH9A 1KF0A 4GG1A 1MAHA 5LQKA 1XL0A 3HUUA 1D8AA 4PPFA 1DBQA 2MOKA 3DTVB 4RACA 5HF8A 4YYEA 4CQMD 1YFJA 4CLHA 3ESYA 3LF2A 3ZW9A 2VQ6A 2I54A 2V97A 1CEXA 3HV2A 2RGWA 4BMSA 3PX7A 1WDMA 1ZISA 1ILEA 2RHOA 1W8IA 3P20A 2RHBA 5CBKA 3EQ9A 1VECA 3U3ZA 3PFNA 1P0MA 2RC6A 5COBA 4I50A 1PVDA 1EP3B 1NULA 3O83A 4GS5A 5CT4A 5ARDA 3R5SA 5FNVA 3RUDA 3VAZA 1A9XA 1P61B 1M75A 2YOGA 3CVJA 3QA9A 1N2ZA 2VJLA 5JSKA 5KQMA 1JSLA 4ENUA 5I9IA 2WG1A 2YINC 1AQJA 1T34A 1KJWA 1H2RS 3JYPA 1EI9A 2QLLA 4R8SA 1BYUA 1NW3A 3P2EA 4JJAA 5E38A 1V43A 2KHZA 4F3NA 5CFQA 1JFRA 1DT3A 2YJ3A 4TMZA 1ZA1A 1ZD4A 4UHBA 3JRWA 4V0OA 1E58A 3L7DA 2P6RA 4AKSA 4X8HA 1NYQA 4OHRA 3NHPA 5FI1B 5KREA 3RNOA 2QK4A 5SZKB 2C5LA 4K2HA 1CUJA 4WOBA 2ZTMA 2GPYA 4KQIA 4M0UA 4P86A 5TSDA 1C1XB 3W3AA 4QXMA 4DN6A 1T0JB 1KVTA 1CUBA 3TDNA 3DO6A 3OIFA 4FGJA 1VBFA 1WLSA 4L76A 4FFOA 4JJZA 4MRNA 1T8PA 1NRJB 3WLSA 3BMOB 2C5GA 1FDOA 2GCEA 5D3ZA 4HSGA 1O5IA 1Y1PA 2ZR0A 3OURA 4FJ0A 1WZCA 1AOXA 2AK2A 4MUNA 1AKVA 1J39A 3Q11A 4X92A 4OUDB 4YMWA 1U7XA 1N33B 1OIXA 4WE3A 2EEZA 2HU8A 2X1LA 5HILA 1R1DA 2CHVA 2GAFA 2P78A 4WXYB 1P3DA 1YR6A 5EFZA 2O59A 2R8PA 1C4OA 1G20B 1I36A 1Z6YA 5DX0A 2E3JA 3QPWA 4ASUD 3KQUA 5D3MA 4QA9A 1KJ8A 2AS0A 4LF4B 5KU1A 2Z43A 5EAIA 1M0EA 4YMVA 1K9VF 2ZYGA 3H65A 3WLNA 4FOOA 1JPNA 4PRKA 4QWWA 2ZDGA 4Q02A 3KVRA 3DFMA 1VSQA 3GEIA 3W5UA 3PKIA 4AUNA 4W8OA 1PN3A 4BUJA 1J09A 2WNSA 3F5QA 4RGQA 3VKVA 4MIYA 4UVHA 1JMKC 1FNSA 2HH9A 4RIIA 4DL9A 5CNIA 4BQEA 1EUDA 1QMGA 4Q4AA 2VYVD 4RHTA 1I30A 2QUHA 4TX1A 3ZE2B 4BNIA 2VXCA 4EG4A 4R05A 3TAHA 1FP6A 4CLDA 2AYYA 3O8NA 2GN1A 4L75A 3KD2A 4MHTA 5D86A 2RC5A 3L6CA 3PNVA 3W9SA 5K8JB 1JU4A 3HEBA 1NPDA 3KOUA 2M6KA 2O8FA 5BSKA 1YS4A 2D8AA 4R7GA 1KA9H 4I8DA 4OAOA 3TGLA 2ZR8A 3A9SA 2ZJ5A 4ZEXA 2O23A 5BVGA 1P7VA 5DGHA 3B9PA 4L6IA 3HM9A 3KTOA 4HWRA 2XA9A 4INZA 1ZICA 4BATA 4KVFA 1MVNA 1GVNB 1JYEA 1QC5B 5KCZA 1LRJA 4U5XA 3LPAA 2P2NA 2SCUA 1QFXA 2A4KA 1I3LA 4GZLA 2AQ8A 4DR6B 1N8KA 1V48A 3O7MA 4ZEWA 2I3BA 2XX3A 2R8YA 4RY9A 3ILVA 1J24A 3D8SA 2ODWA 3PX3A 5AIBA 1C9KA 3HP7A 2PEYA 4MYUA 5F5NA 1HFWA 1N5KA 2GETA 3RODA 1E8MA 3CN7A 3HJAA 4GM4A 1M1ZA 4J0KA 4Q1BA 3EX7C 1T6NA 5LP6B 3MWDB 3KZNA 4ZOLF 4Y2JA 1N0HA 2O8DA 2RH5A 4PAQA 4FT4A 3OJWA 5DX1A 5KDOA 5LC1A 3SBXA 3AP1A 1GG5A 3EPJA 1IN8A 3V6LA 4UZSA 1Y37A 4A73A 3ZV5A 3DBHB 3FM9A 3CIFA 3EZ9A 4EGFA 3ETHA 3GD5A 3QLJA 2HY7A 1HE1C 1YGYA 1VJ0A 3BAZA 3PU6A 4I2NA 4YGXB 5C3UA 4DILA 4DRYA 4F1WA 1K6EA 3C5HA 3LPNA 5K45A 1JIXA 2PMDA 1ZMBA 3ID6C 1XRRA 2HAEA 3EXFB 1X9GA 1C3LA 1L1RA 3T3DA 1KI2A 4MV3A 1FRVA 1E5TA 2VL7A 4EI9A 3K5WA 5IM4A 4C1BA 4X8MA 1UXJA 2MSNA 1A4XA 1KK2A 3N3AC 4OVKA 2CLLB 2F8LA 3E81A 1M1XB 4TSRA 4ZOEA 2E89A 2WG2A 3S1AA 3I9V6 3CZ4A 5DK6A 3YASA 2XGGA 2PGAA 1HY3A 5EUQB 4KPFC 3LX5A 2GN4A 2ISSD 5F1PA 4TWIA 3DAFA 3TMKA 2HJVA 4M1SA 4Z3KA 5GY7A 3RYFA 2NQ2C 1QH0A 3IQEA 1RBYA 5FUVA 3UAXA 5GINE 3WMWA 3IVCA 1X19A 1TTHA 4QE3A 4EGQA 4ZK2A 4HWGA 5B37A 5HJ7A 4ESHA 1B15A 4R71A 1W5AA 1RQXA 1VL0A 2PRJA 4Y2QA 4DZRA 5IULC 4C78A 4KRFA 1MHPA 3KLMX 5JAMA 4DIOA 5JMWA 4JQYA 1XEWX 4KLCA 1QCCA 5LA6B 3E7DA 3PEVA 3ZU6A 1MXHA 1F8FA 2FRDC 1UPUA 5FQNA 4OHFA 3GBPA 4PBSA 5LIRA 1JT2A 1OXVA 4FUTA 3ENKA 3NDRA 2JHGA 4E14A 2C96A 3HKDA 5FWXB 1N0IA 1WCXA 3WYNA 2FPPB 3IB3A 1FX0B 1W85B 1XMJA 1UMBB 5AKIA 3IEXA 5KVQA 2QENA 3JVDA 4OIMA 3D7RA 4R2KA 4Q7MB 1XCGB 1N75A 1R4MA 3D2BA 2F1OA 3KNZA 4BBAA 1AT1A 1Y81A 3OQBA 4CV3A 4ZJYA 3C4QA 5L6LB 4KXLA 2PL9A 1I51A 2WU4A 3MIZA 3G13A 2PX0A 4HBGA 4C0LA 2EZUA 1P2FA 1ZMTA 4TTTS 2KW5A 3S2IA 3SYMA 3I1IA 1L5HB 4AFNA 2DXIA 4AQ7A 5LYJB 1PZMA 4RXTA 3R9XB 5T6MA 1CP3A 2Q7DA 8MHTA 1XJ5A 1EJ2A 1A0OA 4D6YA 3CRW1 1KJJA 1KZHA 3QOXA 4XYEA 5E6SB 5HBRA 4XXHA 1AS3A 1R3DA 2QTTA 3HYLA 3DXFA 1RI2A 2GZSA 2TMKA 4GUDA 1PTJA 4M8IA 4CL3A 4ARIA 3ESBA 3O82A 2J5RA 1ZM9A 4RZUA 4C0HA 4BNLA 1XTVA 4CM4B 3QELA 4R0MA 1QYDA 4OQPA 1GKKA 1U2RA 3R0VA 3ZWXA 4WACA 3HZOA 5E6RA 4EYQA 4CDGA 1E6UA 1WCV1 1EZ1A 1EJ6A 3NHJA 3D7NA 4J29A 4L16A 4W5WA 4I46A 2NV6A 2SICE 2DWOA 1MR3F 2GZRA 4CKWA 2GRAA 1P6UA 3ONNA 1XHFA 4CMGA 2CC2A 2ZVDA 5CM9C 2QTVB 2EJCA 4IUDS 1P1CA 2OBMA 1DDGA 4QU0A 1EFKA 1A97A 3S40A 1ZWKA 4EO7A 5BV1A 1E6MA 3QWIA 4PPQA 3GY0A 4XI9A 2AXNA 4RDXA 3D6AA 2GN9A 1R2QA 2DTXA 2WTAA 1H8HA 4YREA 2AE1A 4KQFA 1GFSA 2GQ0A 4KXWA 2CEAA 2F6RA 4OB7A 1Z4JA 3MFQA 3UW3A 3QHQA 1A96A 1HDEA 1SA0B 1TIPA 2IYUA 4TL7A 1W5FA 1Z5OA 1L7QA 4NP6A 4JLWA 4YN3A 1G5FA 4PIPA 4ZI7A 4QGSA 4ERXA 3D59A 4U7FA 1TNDA 1YZYA 1SXJA 3ZNNA 1QYRA 1CDZA 1Y3IA 1CUHA 5CYPA 4F4CA 3WDLA 3WQSB 2CZQA 4LDJA 3BUSA 3CLVA 4EMSA 1NVVR 2C2OA 1KY4A 4RLFA 4FLFA 5BW4A 2GTHA 2CV1A 2OFOA 5FXMA 3KE8A 5AXCA 2GAJA 3JX9A 3LDGA 1KDVA 4H6XA 5REQA 1LPPA 1GKLA 1QFMA 3PF9A 4JGGA 5EUBA 4BVFA 1NMSA 4ZDWA 4UQPA 2KMLA 4HGNA 4BO9A 3DDHA 1P19A 3NAQA 1S1MA 1M76A 2HHAA 2GMWA 2ZU6A 4P84A 4LGVA 4GM1A 5HDQA 1B8PA 3N6RA 4I4CA 3KVOA 2EKBA 1Q92A 3ZHCA 2QLTA 1OUMA 1ZN9A 2JAQA 3ZG6A 2VKTA 1GZSA 3HUFA 1NN1A 2PN1A 1KK1A 1ODIA 1M7BA 2Q3HA 1IAQA 1XCMA 3CZ9A 5G4KB 4XM1A 5FR1A 3JAKA 3IAUA 3ZWOA 5DI3A 2VK8A 1O1YA 3QITA 1II9A 3ECCA 1P2UA 4R40A 1SD1A 1KSHA 2BEWA 2PGLA 4AX8A 1NUUA 4FKZA 2B20A 1BFKA 3LXXA 1BDMA 3E9YA 1K0UA 2WFZA 4MUGA 4F5YA 4B3CA 5TV2A 5BPFA 1Q3KA 1RI5A 4BNZA 2DR0A 3JS5A 4ZOBA 2R00C 4RPCA 4YNBA 1MJGM 3QKRA 721PA 1JKJA 2JIZD 3A3YA 1UT6A 2IY9A 3INRA 4JSYA 1O95D 2PUJA 4TQ9A 1AU9A 1S8OA 5BR8B 1TA9A 4F4JA 4RTQA 2NZWA 2GT1A 1T3HA 2DM6A 4MULA 4EECA 5ADVA 4QVGA 1XMXA 4COKA 3DTVA 2RGUA 4J2TA 3SAJA 4LRSB 3X2EA 3H7IA 1I8TA 1EFCA 3HB9A 1USWA 2DC1A 1VG9B 3LUDA 5E4TA 1MVLA 3ORSA 3LXUX 4X3PA 5ICFA 3V7NA 4CMEA 4GNKA 4LFBB 2WAAA 3UA4A 2PZGA 1BXKA 3T4XA 3OF3A 1GKIA 3U19A 1PDVA 2GWRA 4GE0A 4ZCSA 4B3IA 2D54A 3GP8A 5FPPA 3SVLA 4FMCB 3GZTB 3S68A 2LIVA 3EIUA 4IWXA 4WNCA 1A7JA 4L0CA 2G9NA 1XZDA 2OZLB 4IKOA 3MGGA 4M1TA 1VLHA 4LGCA 3OCYA 5FTMA 1I33A 1KQPA 1WKCA 2EQBA 3MRSA 3RGWS 3URKA 4YMUA 4PGFA 1GLVA 4HWTA 1P0CA 3BIOA 1DP4A 1NRIA 4JSTA 1AKUA 4ZOAA 3OU2A 2AVNA 3F0TA 1K6IA 1NW7A 2CK3A 2Y9PB 4GQAA 3GPBA 1E9EA 4QLAA 1BHQ1 1RJFA 1YZHA 2JRCA 1C1XA 1E64A 1NC3A 2XBMA 1U3VA 4B76A 2K87A 2GEJA 4D26A 3HA5A 4ID3A 3Q41A 3ZLUA 4NZMA 1S01A 1XRMA 3EOZA 1R50A 3O91A 2G1PA 3BMOA 1YRLA 3LY7A 1Z0JA 1DJNA 1PW7A 2C1ZA 2E5WA 2RGNA 3ODGA 4H35A 1U8XX 4QGGA 3SZOA 5K09A 5FADA 1ZXLA 4X63A 4OUDA 2FZ4A 1Z7WA 3JQBA 1EE9A 2CFTA 4KJXA 3R5KA 5FTJA 5A6SB 3U60B 1FMFA 4GRIA 1IRXA 1OFGA 2VF2A 1RJDA 1FMLA 4N5DA 5ALRA 3UT0A 4UMEA 4AL4A 1GQRA 2HA7A 4EEKA 1G20A 5F7JA 3H1PA 4XJTA 3L8YA 3UXMA 4K03A 3FSGA 3R6LA 4TLDA 1TQ6A 4JBYA 4CIDA 2J4CA 4G09A 4JITA 3JD4A 1MO5A 3IKTA 4BFVA 4QULA 4D0RA 1Q0ZA 1OVGA 3EDOA 4POOA 3SZUA 1H22A 4P9NA 3W5AA 3K9GA 5AICA 1T9KA 4HAOA 2NIPA 4RJIA 4EB6B 2PVPA 3TLGB 1BH6A 1DOAA 4V0QA 4YRDA 5B3JC 1RAIA 4EH1A 3WLLA 1DQNA 5EVCA 2BV3A 3EEIA 3R23A 1K6XA 2K2QB 3C1UA 1SEVA 3EZYA 5CH8A 1S1CA 1G2QA 4DR2B 5ECWA 3ZGXA 1TUIA 1PWYE 2A33A 1COWA 1N92A 2YYZA 4K9OA 4AKHA 2BMEA 2ZT7A 2BHRA 4JGBA 2YZNA 3BCUA 4DXHA 2NZXA 4OHPA 1VQ1A 1Z07A 4N3GA 1YOVB 5DGCA 3OZUA 1TJ4A 3PG5A 4P33A 2R1UA 5DYIA 2ZSIA 4EUEA 5LDDC 2C9BA 1O6ZA 5ILOA 1Q3TA 3S2SA 3QNUA 1W2HA 1P0QA 1DU4A 3DJFA 1LRLA 1YCDA 4UHFA 5AI4A 1EJBA 1JZQA 1Z68A 1PE0A 3BGWA 1QC5A 1TKAA 1YV9A 1WABA 1GU0A 4HDOB 4OKNA 4KMSA 1ML3A 3RSQA 2ZSDA 2ZBGA 2E2WA 1JHOA 1MV8A 2H48A 3MS7A 4B7AA 1XTKA 4Q4CA 1JX6A 4YJ2B 3WYCA 3PLRA 4HO1X 4HFRA 2EFYA 3ZW8A 2H85A 2GARA 1VRCA 2M98A 4IYRA 3QV1A 2WM9B 4TKMA 5FO0A 4ZVSA 5T3YA 3VYWA 3EZLA 1LF5A 3ZVKA 1IK4A 5JNTA 4L15A 5LP6A 3MWDA 4PC3A 3WAKA 4Y1RB 3RROA 2DQSA 3CR3C 4PPYA 2Q07A 3F74A 2OKGA 2E37A 5I4IA 2H0RA 4LV8B 2VXYA 4NABA 5TQVA 1ZK1A 1PAUA 5FBRB 3HR4A 4G36A 1HKUA 1E2HA 3DBHA 3EW7A 3FCCA 3WQQA 3GMTA 3D1VA 3T9BA 4EEXA 5FA8A 4QG3A 5CXQA 2QMEA 4RADA 3UZUA 2XV1A 2Q8PA 3EXFA 4E30A 3FOEC 2I8AA 3DQQA 2PX8A 1ZK0A 4WA7A 1XYVA 2DBZA 3OOJA 3N2LA 4GLOA 1V16B 2N1BA 4QUJA 4A23A 1WNTA 1CR2A 3LC0A 3MJTA 4IIYA 3K8QA 3LT0A 1M3SA 4MQBA 3C15C 2WF5A 4ZCMA 2HMYB 3RVOA 5K03A 3UH1A 4ND2A 2HN9A 3B82A 4I5DA 4HQLA 5BURA 4LFAB 3DKVA 3SR0A 1V11B 1DEXA 1KYVA 1GCAA 4JXJA 3FGOA 3P9RA 2OY0A 3PHCA 4GU5A 1GUDA 3OZEA 4C6SA 1AV6A 4TN5A 5CA1F 4CKZA 3U40A 2OBBA 3P0FA 3Q9LA 1AZLA 4ITRC 1KERA 3VX3A 3BF7A 2B25A 1H1DA 1PNTA 4PYQA 3HXLA 2P6NA 4Y2GA 1THMA 2K7FA 3SD7A 4BHTA 5A5DA 1H3FA 1OIWA 4LRTB 3LI2A 2O8BB 3F6CA 3COJA 2YYAA 4D9IA 5AJYA 1CE8B 1GJRA 1HT1E 3QLVA 4XIIA 2YFQA 1Z0SA 1O97C 2YXDA 5LA6A 3M5PA 1DPFA 4EI7A 4J16C 2ZRFA 4J0IA 4CF7A 1XCOA 1BXZA 2H5EA 2Q2NA 3LX4A 3ZWYA 2JJ1D 2NXWA 2IHNA 4WXMA 3WBKA 4PHHA 3EFEA 2QI9C 5FWXA 3TDMA 4QYWA 3Q5DA 2FPPA 4XYBA 5KNDD 1FX0A 1W85A 1UMBA 3FLMA 1GHTA 4H7HA 1PYOA 2O8VA 3DM5A 1VL5A 4YHBA 3RSFA 3G0IA 5FFMA 3K4PA 4JQOA 4TXHA 4QOGA 4J0QA 5M3BA 3NJ8A 2Q3DA 3ZGOA 5G1NA 5JDIC 1PUJA 3T7CA 4ZVNA 3CEPB 4TYMA 3KO8A 4PFQA 4JYPA 2DLCX 3BJEA 4MUXA 1YFKA 3PUJA 5L40A 1L5HA 3T7JA 4LHVA 1ZZEA 3GFRA 3ICWA 4G1BA 4NRDA 1E66A 1PR2A 2G07A 1SC6A 2CY0A 1CR6A 4TSFA 5JXIA 3R9XA 3KWLA 1K98A 1Z06A 4KH1A 3TJMA 5E6SA 3RRXA 4TKVB 5K6AA 4EPTA 5CH3A 4JBGA 2YWJA 1MOSA 2C82A 3D8HA 4OUKX 1ODJA 1T8YA 1VSUA 4MYCA 1IIBA 4JLPA 1SCUB 2H4FA 5HS6A 3W4IA 5FJJA 4CM4A 4A6XA 3UJPA 3QKSB 5CYGA 5ALWA 2PX6A 1BN7A 3BGSA 3Q12A 2EYQA 4ZT7A 4DSUA 3ADDA 5J43A 2PBRA 1NKTA 3SQNA 3ADPA 3DMDA 1E1NA 1E92A 5JVDB 4L27A 5DE3A 4L6CA 5K2OA 3MVEA 1V9CA 2QTVA 1GDDA 1MB9A 1DBWA 2VLBA 3O8BA 5TMDA 3TKAA 1OOEA 1T9AA 3DWEX 3VU9B 3HO1A 2AZ4A 5IBRA 3A1FA 2NU7B 4NCHA 2AT1A 2RG7A 3SXJA 1Z5WA 3OQIB 9ATCA 2V4ZA 1JH9A 5A0VA 5JCOC 3AB7A 4RV9A 1FNNA 1RC1A 3ZDBA 3MJ4A 4XQEA 1WSBA 1SA0A 1ZIYA 3IPXA 1PD0A 2F3QA 4TXNA 1CERA 2B92A 2D3WA 4OHXA 4W82A 1DAIA 4GGOA 3UV3A 2CVFA 3S8EA 5LL6P 4CUZA 5JUWA 2VDPB 1PJRA 3DD1A 4IIFA 2O2XA 4RZIA 3W5CA 5HRUA 1OROA 1T1RA 5HOEA 2RHDA 4DJJA 5BXYA 5A05A 2D00A 1MJHA 2OCBA 4MVWA 2YX1A 1JQDA 5G0VA 3A0RB 4GLLA 4RLHA 2XDWA 3DMFA 3TOCA 3UMMA 1LLDA 5ELXA 5HXAA 4I8IA 1VA4A 2C2MA 3FG9A 4ENTA 3D81A 3FFXA 2LR0A 2AMVA 4JU8A 2AEFA 3OM8A 4IDFA 4GYWA 4YK7A 2CLSA 2G3YA 5I9TA 2GD0A 5HNKA 3OQMA 4DDHA 2I4MA 4HAWA 2HSZA 4IXDA 3QI7A 4AY5A 1NZFA 2AMJA 5ABPA 2R3SA 3QU9A 4JCCA 2AK3A 3EPHA 2B2XA 3KJZA 2MMCA 2XDAA 2YC2C 2Z2ZA 3JD0A 3PIIA 3AY6A 1TJNA 4G8DA 2KQUA 2CNWA 3PKZA 2F8TA 4G0VA 2FJ0A 3G2JA 3O9VA 4R98A 1P5ZB 3PQFA 2OHGA 2BKEA 5G4KA 3SJUA 2QI9F 2XGSA 3WR5A 2O7RA 3MK31 5TGZA 1WXQA 1GGMA 2ETVA 3I64A 2O07A 1ZITA 3CJRA 4Y6RA 3A1VA 1FTWA 2MSWA 1ZLXA 1AKRA 4KQ6A 1VKNA 2BEVB 7YASA 2BRUA 2P9EA 4QX6A 2BJVA 1JFSA 1PEYA 1GYPA 1Z17A 3DDSA 3L0CA 3LM8A 4MWEA 1PVVA 3HS3A 1OPRA 4YECA 3CVXA 3OT1B 4U2DA 3VZCA 2I7CA 2HW8A 1NT2A 4LNHA 4DYVA 1J2RA 4BFXA 1HRKA 2G25A 2PGXA 3L7KA 2RK4A 1T5BA 4PO3X 4E94A 3MPOA 3BFVA 3NBYC 4U4AA 3DMTC 4H27A 3AETB 4HI0E 2PQ0A 2Y4NA 4G84A 4IRUB 4UASA 4AP9A 4F8YA 4RD4A 1FUIA 2WAMA 1W49A 1ORWA 1VJDA 3AL2A 2D1YA 1QE0A 4OF4A 5E0OA 2RONA 5B1SA 4UU7A 2ALJA 4CQLB 1DXQA 4QRDA 3OAAD 4BNXA 4TLAA 3FUXA 3ER9A 3LUHA 2PV7A 4NBSA 1XEWY 3E9QA 4Q1CA 4R8KA 1G6Q1 3TOVA 3TNLA 5JG7A 2Z6AA 5JJKA 3OT5A 1ZH8A 4S2EA 3A7DA 4YJGB 3AERB 1FDSA 4FQ5A 4XWKA 2NZYA 4I5EA 1HM5A 4EX7A 3QG1A 2E0IA 4ZTZB 4RJ2A 2FKAA 5AI0A 3UKOA 3SLGA 2OZLA 2ZJ1A 4ZZ1A 1K2VN 4ZYUA 4PR3A 3PFCA 1IJFA 5HGXA 5JBIA 1SHJA 5JBNA 1BKSB 2VPIA 4OXIA 1CIPA 3S55A 4DJAA 2YWGA 3K0CC 4IXMA 3SZGA 4MK4A 2H1VA 3A26A 4BRSA 1P31A 4DIDA 2TYSB 4DADA 2JFBA 6Q21A 1G4HA 3U4HA 1E9AA 1EGVB 1M1YE 4LDNA 4MB2A 4TOIA 4LRXA 2Z4RA 1UK8A 3FZEA 2WJ4A 4KWIA 1NC1A 1ECPA 1G60A 1NVGA 3BXXA 3KFXA 2HI0A 4XW2A 1B16A 1Q0UA 3NPAA 3PUYA 4WGFA 3RS9A 1R6BX 5KNCA 1DMSA 3B6IA 2W4MA 3LFTA 1U80A 4RTJA 1E79A 4LOAA 3WFIA 2C9OA 3VPHA 2H2FA 1K08A 1L3CA 3NTOA 1VBNA 2IUSA 4A0RA 5A6SA 2MTBA 2IIBA 2EOAA 3ELUA 1EDBA 3LHFA 1QHXA 1S9HA 4J3FA 2XE8A 3WLQA 2V9PA 1KH1A 2FPUA 3EB9A 4UM5A 1XZJA 1ENOA 4NYMR 4M54A 3A8TA 2GFHA 3ODPA 1CUIA 4MV0A 4QWMA 5EIEA 2R6AA 2CT8A 3IP9A 5TPZD 1ZMRA 3C6KA 3ZLTA 3GA7A 3KAJA 4B6GA 4KV9A 4BBJA 2AR9A 5BQFA 3MWKA 3OZAA 4G63A 4PQYA 3NBFA 5F3DA 4D42A 3FZQA 1U28C 3C7TA 2CLCX 4AP6A 1PWHA 4I1UA 4HATA 1QP0A 2WZBA 4EB6A 3UMVA 2I62A 5IVDA 4HFMA 1G9SA 3S2UA 3TLGA 2Q5EA 3B6EA 1ICEA 3UT5B 3A1WA 4KHZA 3HQ4O 1F60A 2QTBA 3IKMB 4NNOA 4OGKA 1OZGA 3L1VA 4U9IS 5K3SA 2BEKA 4UFOA 5IAEA 3TIIA 2C3MA 2VEDA 3HBFA 3UJAA 2PFGA 3CKLA 4UOEA 1W94A 2A8YA 3ED1A 4J4HA 1QR6A 1OYVA 1VE9A 4AG5A 2Q6IA 2UDPA 4J4TA 4E2FA 5K0EA 4OQ4A 4FWBA 2PJUA 3DZCA 3OQHA 3EISA 4NEGA 4UAGA 4ZWNA 4X93A 1B6RA 4DARA 1YOVA 4X95A 1H65A 3R6TA 3NDIA 2C54A 2GCIA 3RTAA 5J4HA 3OZ7A 4WBNB 3T7DA 1TO1E 4DG9A 3QXCA 5I3ZA 4CKXA 1NF3A 4K88A 1WU7A 4BC1A 1CUUA 2GVNA 2LKDA 2X8BA 3AUSA 4HN4B 5B58T 4KBGA 4LV6A 2H2DA 2PQ2A 3KUDA 4IDQA 4DLKA 1UAYA 3EA0A 4FI3C 1AQLA 5FPHA 4DMRA 4H6VA 4PCLA 1Z0IA 1NYTA 2ZJ0A 1KORA 3P27A 4RIHA 4DR7B 1EVQA 1ZIDA 3PPIA 1FUUA 1VIVA 4S04A 2E5FA 2IELA 4YJ2A 3DEZA 1K4MA 3W4JA 3UJ3X 1LTKA 1SH7A 1DIHA 1M1UA 4CV1A 3SSOA 1JBKA 2Q6LA 1J5XA 1S2OA 3U7JA 3CLHA 4YRRA 3FVQA 1II8B 3BL6A 3DDZX 4Y1RA 2CLFB 3ZHOA 3ZIUA 5FOWA 4TUYB 3LVFO 3WGZA 1T1EA 2DH5A 4MEAA 2WYVA 5AO9A 4R1PA 1J97A 4DXAA 5BSEA 4KB5A 4CETA 4UU1A 5EJ4A 5TY0A 3GROA 2V6JA 1G8FA 1ULAA 4NMXB 3ES9A 4YGYA 4BMXA 4HP8A 3O8DA 2DHDA 3IVXA 4KXMA 3ZK7A 4EWLA 5KVCA 3R40A 2OM6A 2PU7A 2ZRBA 2YUTA 1LD3A 1JQ5A 4PE5B 5CT5A 1J42A 1U5BB 2ONZA 4M1WA 1E4OA 2H00A 3OQJA 5H5JA 1QV9A 5I51A 5C37A 1T8WA 1XTJA 4NCAA 3L0ZA 4OBEA 4PXSA 1B74A 1V16A 3DVRX 1LNZA 4I4NA 5B4VA 4D5GA 1UBJS 4BXOB 1NJGA 3EBOA 2IU6A 3MD0A 4GR4A 5KUTA 2JFFA 4PSCA 1V11A 3Q72A 4A91A 2XUPA 2YBEA 1DFHA 1T9CA 4C14A 4RTSA 5BQXA 5FL3A 3NHSA 1H94A 4L0DA 5TF0A 1FFXB 3PGJA 4C43A 5WRFA 1LSUA 3DOIA 3BDIA 1NBME 2QTWB 1U0GA 5DNUA 2VDRB 4G0XA 2CV0A 4ZQBA 1QH1B 2LVBA 3QXJA 2CFRA 3TZCA 5L3ZA 4FPXA 2QVYX 1XZQA 1P1IA 4KNWA 4XPZA 1D4ZA 2SKCA 2O8BA 1KK3A 1L7PA 4HDSB 2WIJA 1VJCA 3PGKA 4X9XA 5E3HA 4IDOA 3NUGA 5K01A 3KALA 1ORTA 1DX6A 1CE8A 2J6HA 4MPPA 1G2PA 2BFNA 2PVSA 4LCBA 1NQ5A 2PZFA 5AK0A 5B7PA 2IT1A 1RRPA 2JFUA 2LTAA 3CY6A 3CEJA 2DKNA 3NNDA 3GJ3A 3PC3A 4FR5A 5FULA 4QZVA 5AM2A 3M6XA 5A9RA 1JT9A 4EY3A 3OY7A 3ASVA 2A1TR 1V7PC 3ZJ4A 5MN4A 1CY7A 3MAJA 1BYIA 1J56A 1EX7A 4IMRA 4D8XA 3TL6A 1IMJA 2HLNA 3HNOA 3MD9A 5AVYA 1FNBA 1THTA 1PJ3A 4UDNA 2O1SA 3PLAE 3ET4A 2P1RA 2CN1A 2ZB2A 2WQZA 3MOSA 2FSFA 1WDKA 1FFEA 2B4KA 1Z18A 2YCLA 5ITWA 2V6FA 4LVOA 1E6WA 4GXNA 4MW7A 1PKEA 1WVIA 3S2YA 3WRYA 4C06A 4D46A 3OQPA 2G71A 1FTSA 3B12A 3EG9B 4FI3F 4TKVA 1R6VA 1XYYA 1QIKA 1NJ5A 2WFAA 4MQLA 4PQFA 1TF5A 4YC7A 2COKA 2IYFA 1SCUA 3TKLA 3U2QA 4H7FA 2UU9B 2H4ZA 5AYVA 1NVBA 4EJ6A 3VC1A 4E3WA 1JE0A 2MINB 3OUTA 4EVSA 2C1EA 3QKSA 5CB4B 2ZUBA 2QTAA 2JD2A 2PUBA 4KXQA 3N39C 1U0EA 1YZLA 3WZLA 5KWJA 3B2EA 3DE4X 4YRJA 4JVOA 2WWVD 3SBEA 4CKEB 4F4DA 4DDWA 2VF8A 5LWQA 2Z6UA 4AULA 3OE1A 5AKEA 3FUTA 3PZRA 4FOTA 4G1EB 5AW1A 5JVDA 1KZ1A 3SY8A 2NTNA 5CDYA 1F6BA 5DASA 2JIBA 3QH4A 1ZD1A 3IE2A 5JFOA 1MB3A 2XUJA 2PWBA 3E0QA 5AVJA 4QQRA 5HMLA 4HEA1 3U62A 4CMCA 2NU7A 4EI8A 2PMFA 2BH9A 3LZ6A 1A9SA 2DX7A 2ZYTX 3DM9B 3JWEA 3OQIA 4O4IF 4BP9A 4ZXPA 1BXGB 3C3KA 8ABPA 1NUTA 2J3IA 2MWMA 3RIEA 4D96A 1DUVG 1YK1A 3LBHA 3QBVA 5CDHA 1A8UA 5KCMA 3E9DA 1UXOA 3G1UA 3H2ZA 3MTDA 4N8DA 1UBTS 5LDGA 2FQ1A 3TQFA 3FCSB 4CTNA 2WVJA 2J5XA 2XUDA 4G0OA 4JEHA 4UREA 2FEMA 4XCXA 1ZOLA 2X1HA 3IUMA 4FCTA 1NNUA 3UFXB 1LFDB 1C9NA 5KAMA 5FPTA 3U48A 2AYZA 3HVUA 2OZKA 1UK9A 4MOWA 1V3UA 2FUEA 1Q1BA 4LBYA 4YMHA 3NRBA 3D2CA 4KYIB 1A1SA 1GM5A 2I2WA 4QTZA 1M7HA 2ZXFA 4XQCA 1JTEA 3F47A 4QRIA 3F9RA 3AF5A 3DE3X 3NUQA 5GOTA 3FCEA 4PZUA 3WLKX 3VC7A 2EG5A 3CW9A 3IH5A 2CUZA 1BN6A 1R0XA 2VZ8A 2NAPA 3PLNA 4UBLA 5EXTA 4CU2A 5JMPA 2YMPA 4I1RA 5GWXA 4BDSA 4I55F 2NG1A 3PXUA 2WYHA 1M1YB 4ZU6X 5T8KC 1UDRA 1SVIA 1M8JA 3DHWC 3MLBA 3PRHA 1GDTA 5EIXA 2QV7A 4JYZA 4PTZA 3TZBA 4JFRA 1XALA 3IHLA 5SYMA 3VDXA 1CG6A 2RJNA 4DQKA 4M55A 1DMRA 5TNXA 2ANCA 1A4UA 1OWOA 1Z2CA 3PTZA 5DNEA 3LUKA 3UXEA 4IQ8A 4UTPA 4YV7A 2BEVA 3NH6A 3EZ7A 5G4LA 2NXJA 3SBDA 2YWDA 2D2VA 5SY6A 2X9GA 1Y4ZA 2VG8A 3C5VA 3OO1A 1U0TA 3PFKA 3TX2A 4B79A 4CM8B 3KVNA 3PQ6A 4LRUA 1C14A 4RFVA 1XZAA 4PX3A 3OT1A 1QIFA 4PO8A 4CT4B 3QYAA 1W1WA 4IIJF 4KN6A 1DARA 1Z29A 4UBJA 1WDTA 2Q3LA 5CNKA 1EQ2A 4AMUA 1NFQA 1HMYA 2BOVA 3MQ4A 4GKJB 3SEZA 3WWOA 1Z73A 2J46A 4FGUA 4L08A 4W1QA 1M2OB 4D3DA 3K6SB 3ZD8A 3JW8A 2RHCA 4IBOA 1WKVA 2PK3A 3IR6A 1HYHA 1CRZA 1MX5A 1QSGA 5CM2Z 4CQLA 4ZCIA 1T8RA 2D3TA 3QKUA 4J76A 1ZUIA 3QMWA 3TLKA 5KYVA 5HRAA 4AO8A 1M8PA 4BUZA 2QP3A 1QV6A 3COYA 5CVUA 3LYUA 4I9UA 1Q15A 4LHEA 1C0IA 1M73E 1QBGA 4PS0A 4RLQA 2VHYA 4L2IA 1VI2A 1P3Y1 2JAOA 2WJIA 3AERA 2PKRA 3LQ1A 4YJGA 4M46A 1IIRA 1QNFA 5KDDA 4FMDB 1CX9B 2QU7A 3QKWA 3V4ZA 3BD7A 2WZCA 1X92A 2FXIA 2XB9A 3K7EA 2V5UA 4OO3A 3UKDA 5CCXA 3PNBA 4DXDA 1UINA 3B13B 4HXEB 2O4UX 4ZC8A 3HFRA 4KIFA 2H59A 2NVWA 3UAOA 1X42A 1V4VA 1F06A 5PGMA 4ZFNA 1ADBA 3S2GA 1S8NA 1C9YA 2O2ZA 1CK4A 4C0JA 1K5DA 1PZXA 2I1QA 3KEFA 5TT0A 3CNHA 4OXKA 3GGJA 5AW5A 1H6CA 4GOJA 4ND7A 4YASA 5I7VA 3AR4A 1TQDA 4TKUB 3BKXA 5IYZF 2YBDA 1FSPA 2QXTA 1ABFA 4IXTA 1MD9A 2G7MC 4G1CA 1RKXA 4MAAA 2I71A 4P4TA 4OQLA 621PA 4C7KA 4QVKA 4A8HA 4LX0A 1F6WA 3H84A 1BGWA 2ZIUB 1PR0A 1LWOA 1RXIA 4A8JC 5HQJA 2IOFA 2WWTA 5ALDA 3B8EA 4MVJD 4DCCA 1HEUA 4PPGA 1HYGA 1ST3A 1X1AA 1L5ZA 3DV2A 3H83A 3AJRA 3ECSA 2DUUA 4L57A 1O8CA 5BORA 4IV8A 2OP0A 1MN6A 1Q0LA 3G89A 2QLBA 5A0FA 5KPDA 4C0WA 2DP4E 4D0NA 2Q3FA 2YV3A 3NKVA 4JJ6A 2HWWA 3USCS 5HX7A 1RVDA 1Z13A 2HJ9A 3IKVA 1J20A 1A9RA 2GKOA 4P3KA 4XRRA 4HNUA 2QTMA 2G7ZA 5ECGC 3QTBA 1SCQA 5GZ1A 4KIJA 5GIOE 1KO7A 3SMQA 1HX7A 3RVDA 4N0QA 3KJEA 3PYMA 2GJ4A 2G8LA 3AI1A 3KPYA 2AMYA 3FPJA 3CO5A 2JRLA 4G85A 1V8OA 2IVFA 2G4VA 2F3TA 3KPWA 4X7BA 1XFDA 2FQQA 4CKBB 1EFDN 2B8NA 1GYRA 1OR8A 1WW2A 3NGLA 3OA2A 4MYHA 5EE9A 2AFVA 1GNSA 3NG1A 1EXWA 2PX5A 5EMMA 2ONYA 4DCPA 3NHKA 1Q3HA 2H31A 3BE4A 3F5DA 3LPMA 1TMGE 1JKMA 1XK7A 1TM1E 2F59A 5LP1A 121PA 3GEBA 1KMHB 3C6ZA 4PVDA 2R1VB 2BGNA 5KJ1A 4NTZA 1J8MF 4M9QA 4Q3LA 4E07A 4TKZA 3DLCA 4NBLA 1Z8HA 3GIDA 2KE5A 2QA5A 1C9EA 1DEHA 1NTRA 2YL2A 3A1EA 1OJLA 3ELYA 1HT3A 1PZNA 2J6BA 3IAS1 3OFNA 2OYRA 3SIPA 2ZOSA 1WL8A 3MRXA 4Q82A 4CQMB 2QMUA 3ICVA 1LDYA 4HNSA 2CUNA 2AC4A 3BXPA 1IHYA 2GDJA 3AEZA 4N6GA 5BXQC 1X14A 1YGPA 4TVOA 3WAJA 4LK2A 1NJ8A 1X87A 2WICA 4I4IA 2XMBA 2ZJYA 3Q88A 4QFBA 3KU4A 1JP7A 1XCPA 1XU4A 2RK3A 3BZWA 3L40A 2C03A 4MAFA 1PNQA 4MGZR 1UKAA 1XJ0A 4C4SA 1AM4D 1PIWA 3O38A 1ZRMA 2LDXA 4QG7A 5K3BA 1PRYA 3AVYA 4Y6PA 1II8A 2QRGA 5E9JA 1E1CB 3DE1X 2RHHA 4FIDA 4DMHA 3SQXA 4TUYA 4UM7A 1QZTA 3K2EA 4F5EA 4INAA 1X8XA 4MWOA 4ZPJA 4YT5A 2JD1A 1F8YA 4F56A 2IV7A 3D6NB 3ZHSA 1GRCA 4MSUA 4TV9B 3GLIE 4LYEA 1XXHB 3ROXA 2QVLA 2WJZB 1U5BA 5A2GA 2FKNA 2V7TA 4D57A 2YIMA 1CQZA 2WHEA 3KKNA 5DNAA 3SDBA 3TXXA 3RKSA 4AIIA 4ACBA 3OO0A 1PYDA 4F5DA 1U9JA 1XMPA 1M6YA 2XUQA 3VZBA 2I9KA 4MW4A 4BXOA 1CUGA 2BUAA 1CQJB 3EAQA 3DQPA 1LI7A 1G5QA 2XCRB 4R8RA 3EXHB 1RRCA 3WIEA 4BKUA 1J0EA 4C30A 5AKZA 1FFXA 3A11A 3HBAA 2PS1A 1R8SA 3EGXB 4ZV9A 5IXJA 5I6DA 2W00A 4Q3NA 4JBNA 3SHFA 4GKKB 1LWNA 3BDAA 3FPBA 4UD6A 3BERA 1GQOA 3G9ZA 1QH1A 1MRNA 1UFOA 1VIMA 4IZOA 2FDXA 3ZJVA 1NU8A 4U9HS 1WMSA 3IO5A 1GKUB 2OV2A 3FWZA 3GAFA 1R0YA 2WYWA 5JADA 1DXOA 3IJ5A 4HDSA 1OXXK 3N0WA 3UJ7A 4BDTA 1DBSA 1CJSA 3D9QX 1WW3A 4ZDIA 5BOSA 1MTZA 4XEUA 3AHCA 5DIFA 2V7QD 5HF5A 5K0CA 5KYTA 2AI3A 3PHGA 1UR5A 1T1IA 4HEJA 2ZIXB 5F1KA 2FPRA 4IS3A 4ENVA 1OLOA 4E3ZA 3GZJA 3MJRA 3DBRB 4NMLA 3ESRA 3C39A 5T41A 2HR1A 1G5RA 4Q00A 4BZXA 4C4YA 4DV1B 1U0OC 6YASA 3KTAB 3EQ6A 3VJMA 1LPAB 1R9JA 2AQIA 5KJ6A 2GEUA 3FOBA 1GUBA 2JCYA 4RKRA 2E4UA 5MGBA 5L7WA 4FOPA 2M1XA 4HGOA 1YTUA 5LXTB 1RWWA 2YNMA 1R18A 4ZT6A 3L5OA 1FBTA 2P2DA 2P6PA 1G8KA 3IA7A 5CLJA 2ZJ7A 3H8SA 2BCJQ 3EHDA 4GICA 3DOHA 4IO0A 4EY7A 5HS4A 1UIRA 1CZKA 3EG9A 2HB6A 1GL9B 4EUKA 3VTAA 2IDJA 5DP1A 3L1KA 4AJ2A 4WWHA 1P4JA 5J3JA 3NO4A 1KO8A 2AZMA 3BVPA 4K3VA 1R0SA 1OGYA 4Q4LA 1L5WA 3IIJA 5CDUA 2MINA 2WB2A 4OK3A 2CKMA 1JKXA 1ZD3A 2PQMA 3QXSA 4RE6A 4W9RA 1V3TA 5CB4A 2QD5A 4R2JA 4FFVA 3CINA 4CKEA 1N5MA 4WADA 5LZ8A 4MW2A 1TI7A 1LC3A 2AD1A 3KHSA 1F3LA 5EIWA 3U49A 2ZYSA 5HZMA 2AHOA 3O8OA 4HTFB 1O3YA 1UBFA 2R11A 2AX3A 5DCUA 2Q1SA 1N6KA 2PSFA 1A50B 1ZCAA 4HNRA 5GGYA 1K63A 1DG1G 2IXAA 3EXG1 4B83A 4DWWA 4KZPA 1WJGA 2C42A 2IP2A 3PENA 3A3KA 4OAPA 4QASA 4RZXA 4MR8B 4O2AB 1BXGA 3T6KA 2DY1A 3N0RA 4G8CA 1KK0A 1P9WA 4ZMSA 8LDHA 2AXEA 1IG3A 1M2KA 1DJLA 1P0FA 2OCAA 2ZRDA 3ZWWA 3HXPA 3C3DA 1YZVA 1OC2A 2WOJA 2Y27A 3LWNA 4BC0A 2Z1NA 2C1XA 4HB4A 4LXHA 1ZD8A 4M38A 1NOIA 5CR9A 4HAIA 1GFZA 4I9NA 4B43A 2JJ2D 2PYIA 4NYIQ 3UFXA 1GPJA 5K0SA 1OZFA 5LLTA 1QIEA 1Z0AA 2O1WA 3I0NA 4OHCA 5EXPA 3G1TA 4YLGA 1NUPA 3UIEA 4DC0A 3WBBA 1ONSA 5KWVA 1HL7A 1KZ9A 1ZJ4A 1XZPA 4FZ3A 1Y1LA 1ZQ1A 4Z1MD 3HA2A 3QMVA 4D99A 4LY0A 4D6XA 1GO2A 2QG9A 4P36A 1M66A 3BOSA 1PQYA 1G18A 1JU9A 3R7FA 3WLEA 421PA 5FB3A 2PGOA 4BV2A 1UKVY 3PK0A 1RWOA 4O0LA 3P71T 4MUIA 1SN7A 3GELA 1M1YA 3NV7A 3WLHA 2CDCA 1GA1A 2L17A 4RHYA 3AY3A 1NYRA 2VJBA 3GXBA 1XSEA 3OJLA 3Q7PA 3GGGA 2KJQA 4DMMA 5ARBA 2Q3CA 3KCQA 3C6MA 3LQYA 3C8DA 1E0KA 2PWYA 1KC3A 3R0IA 4C6RA 2JFYA 2EJWA 1WXDA 3AHEA 5DN6A 4GAEA 4YRPA 4L5JA 3A2NA 3VXKA 3ZCXA 4DIFA 3GEDA 4YRTA 5G3YA 4PC2A 3NU1A 3H18A 3S44A 4I1PA 1EXMA 2NP6A 4CN9A 1QUFA 4O4HB 1GPDG 3PXBA 4CM8A 1GGFA 1XHLA 4KL8S 1D2HA 1E2KA 1U7DA 1LBSA 3KKOA 3A4IA 1AUPA 2QUZA 2WMYA 3SYNA 1NMQA 3ACDA 1QHNA 1RWKA 1YKGA 4PVCA 3UMSA 1B00A 4ESOA 1N8SA 3AW9A 4UFPA 1G3QA 1E1RA 1NRWA 3UB3A 1M2OA 4YP9A 4P83A 1LVUA 5K20A 5KU7A 3K6SA 4P7JA 3PEEA 1UPCA 4PLYA 3RO7A 2O20A 5EESA 4DLBA 4IM7A 1A5ZA 2JLQA 1TLFA 3I5UA 1SKYB 1CIJA 3IHTA 4YJ3F 4YV0A 3SSAA 5K8UA 4G1FA 1MF7A 3JVVA 4KXNA 4RXUA 2W93A 5DN9A 2P0YA 5DP2A 1L3BA 4WUVA 2FQWA 1NSYA 3QJYA 1QG2A 3FDZB 3UQYS 4TLCA 1JQKA 3ITKA 3RBZA 3U3MA 5IMSA 2HD4A 3PNSA 3EJWA 3AP2A 3K1YA 4Q4HB 3REOA 3T1HB 3BRQA 4K3UA 2P11A 1JILA 1Y33E 1MB4A 4L4RA 2BFOA 1I1HA 2IIQA 2Z2KA 1QQ6A 1C3JA 1XNJA 4RTLA 1AQUA 1WR8A 2EVWX 2L0XA 3Q3GE 1UMKA 4K9SA 5BY2A 4QAQA 3WWCA 4BKRA 1DBIA 1V7QA 3GLHE 2IOQA 5ANRB 4A03A 1DADA 5F2NA 5K8VA 3BXGA 1QG6A 5C4GB 1XN1A 3KB6A 4CF6A 4M8NE 3ND8A 1MGOA 1FTGA 3H5WA 4DLYA 1H69A 3IAM1 2QTFA 4TKUA 5J4LA 4CHTA 4KO2S 2VWGA 1VLMA 1GVHA 4LJ5A 3CS3A 4B81A 1LC0A 4DEXA 3GEPA 1JLLB 3GLKA 3B6KA 4YRCA 4WZBE 4AY2A 3U9LA 2IPNA 1SR8A 2VPXA 1KDRA 1XEAA 1PKXA 5IS2A 3A6KA 4YP1A 1SUSA 1Y4DE 4I1SA 3ZHBA 2NV2B 2WHPB 2H0AA 2LP4Y 3ZX5A 4CYMA 1OFHA 1OJ7A 2J1LA 1MEEA 3WNVA 4OYHA 4CFSA 4DCGA 2I4LA 1NI5A 4I66A 3B7WA 2ZYIA 1ATIA 2FN3A 2QTGA 2EX1A 1CULC 4MV6A 3IP7A 4H31A 3ASZA 3N87A 5A3SA 4BGDA 1FLNA 3K09A 1YMQA 3UGQA 3W2TA 2VHZA 4HEHA 1ZC4A 2CVOA 4FZRA 4CQNA 1UXIA 2R60A 3DONA 3LKZA 1N1MA 4K1XA 3GBVA 3ZWNA 6REQB 5TMPA 3KWMA 1P80A 3D7SA 4CKBA 3QVGB 2CV2A 2VKQA 3BWVA 2ISCA 3H11B 5DKFA 2BGTA 3W5BA 4UCXA 3RSHA 2D5CA 1OCEA 4NBTA 5DB4A 2QP9X 2X3FA 4EFKA 3L1JA 3IOBA 4Q9DA 1AQNA 3FA2A 1ULZA 2O48X 4NEQA 1SOAA 1DRJA 3HJNA 4BE4A 1KMHA 1ZIXA 2R1VA 3N2EA 5AK4A 1NQOA 2W11A 1JI3A 1YWGO 2OO5A 2SBTA 3AMVA 4LA4A 4FYHA 4RHEA 5TVGA 4DT1B 2VBIA 4XDZA 5EXEA 1W7AA 4YAJA 5J59A 5EPOA 3PB3A 2QW1A 5FEMA 3KELA 4RESA 3RQIA 2PJRA 1NZJA 2GGSA 2XEXA 1YDMA 2JEOA 1MAWA 4CQMA 1SU7A 3GPIA 1E2FA 1UOQA 3AWDA 4EVRA 2A9KA 1QF9A 1LH0A 2QN9A 3GJXC 3H4VA 1KI1A 3ZZ0A 2HRQA 4I50F 5FNVF 2H65A 2GAIA 3GMSA 3ZLJA 2IS6A 4G0QA 2J5QA 1Y5MA 2VNSA 3AZQA 3IPAA 2C3PA 1Y7HA 3M70A 4OM8A 5F2EA 1U04A 4EBBA 2WUVA 1JS1X 3MMNA 7ABPA 1B76A 4LJLA 2H0QA 4XA8A 4BJ5A 4DCUA 2DKFA 2GEVA 4WDQA 4R8MA 2JVJA 2GN0A 4FR2A 3EZGA 4JMPA 4Z7NB 4F12A 5ISMA 3RM3A 3D1JA 5SZIA 2FUNB 1E1CA 1T8UA 1A9PA 3U7RA 1GAWA 4JP2A 2VXBA 5IVIA 3Q98A 3CX7A 3LOPA 4N5LA 4G5SA 1I4DD 2N46A 4Q1DA 3ETGA 4O4JB 4D9GA 3WK4A 1I7PA 3MMZA 2PS3A 4TV9A 1WXHA 5CW1A 2ECQA 3ESCA 3ETCA 3JR7A 1RBZA 1WXGA 1KPIA 1DX4A 1XXHA 3LLUA 4KVGA 2XCQA 3UHOA 1EUZA 1KSGA 1BS1A 3HJUA 1ISGA 4DTCA 5ALZA 4DCSA 2FP3A 4E6EA 1UKCA 2QR2A 2XJ9A 1ISHA 2G17A 2X14A 1CUVA 3W5IA 3E5MA 4RVUA 5C0OE 2EFCB 5IBPA 4IAOA 3RUPA 3RS7A 4UQLA 4Y2RA 5EZSA 2F3UA 4U2CA 1DC6A 2AWOA 4C0XA 1CQJA 5I7RA 2RGYA 1CQWA 2NPIA 4YP0A 3EXHA 4YONB 3VC2A 1OY1A 4ASUA 3DFUA 3VDQA 3EWIA 3ISJA 1NSTA 3N7TA 1OGIA 3ZH9B 1K8RA 1NQAO 1M6EX 1YR8A 1KOGA 3EGXA 4CMJA 1SQ6A 1K3UB 4QELA 4RGVA 4WMLA 3V1YA 5CIYA 1WB5A 4C2TA 2JNWA 2ZBDA 3DLPX 4JDUA 1WHSB 4C0BA 3ZCUA 2VSXA 4MJLA 1PG2A 3IDOA 4UOQA 1Z6PA 4R1NA 4CV0A 3VNRA 2HDWA 1D0IA 1EK0A 4PPNA 1ZCFA 1Y9JA 1QVZA 2C07A 2V6GA 3GAAA 4C4OA 4DAOA 3O92A 5AP9A 3TOSA 3DNMA 4FGKA 1A95A 4BECA 1D0SA 1XAJA 1CB0A 4KO4S 4P82A 5LZ9A 3BX1A 2JI8A 3FNBA 1ES9A 2VYVA 1QCZA 2ZIXA 3G9QA 4E33A 4HLNA 5LKRA 1NNLA 1XWIA 3GZ4A 2C4HA 1GPBA 3DBRA 4UATA 3T4PA 3GNTA 4L5AA 3T41A 1XKTA 1RZVA 2OAQ1 3NORA 4DRXB 2FXVA 3V46A 4ZHQB 5HK9A 3IEPA 3KTAA 3N75A 3KEOA 4D3YA 1IPEA 4PRLA 2QX7A 1WETA 4I4LA 3HR8A 3T61A 5L8VA 1ISSA 4HYTA 2C9CA 1ZCZA 2F1KA 1D0VA 3WWPA 4YUWA 1L5OA 1YBHA 2PS9A 2JGNA 4JC8A 1X7DA 2GB4A 2AYXA 4BLSA 3VI4B 4DABA 5JPDA 1ZVJA 3KT6A 1RACA 4Y9UA 1JZTA 4BFYA 4B84A 3LX8A 4N6NA 1R8JA 3E9MA 3IPYA 5FHQA 2QD3A 3R20A 1PTJC 3RJTA 4TMVA 1U3GA 1Y42X 5IJAA 2J9ZB 3NB0A 4Y6SA 4U2KA 5DX8A 3PQ4A 2FSGA 1A69A 2NO1A 2RFLA 3Q85A 1ZIOA 1FFAA 1ITZA 2QRNA 3CIOA 1MVOA 3O4RA 4AECA 2E4XA 4YAGA 5HUQA 3RG2A 3X1YA 2JBWA 1WEHA 4A2CA 1T9ZA 4HDKB 3R8XA 3B5IA 2AIRA 1XKQA 1SOMA 3G7NA 4QPPA 1G0NA 2ZCJA 2D1SA 2I4RA 5JHHB 4KPYA 2X9LA 4HTFA 2GO7A 5HK8A 1N5DA 1E32A 2HWYA 2OCXA 3OD1A 4NH0A 4P8RA 4RKEA 4CF5A 5JRZA 1XKLA 1GSOA 2R44A 1E2NA 1TADA 2QE7D 3GFFA 3ZXYA 2UUBB 1DELA 3A6DA 5EJ2A 3K5PA 4CTOA 4JDPA 4MCAA 1JMYA 1XTUA 4OCZA 5AVZA 1HMPA 1UEJA 2W4QA 4MR8A 4MRPA 4O2AA 3SDZA 1E9RA 1IEWA 1X77A 1FJXA 2IC5A 4MGKR 3ZCRA 4XTCS 5IM4F 1R00A 1TC2A 1NP7A 3NBXX 1VYHA 4I1IA 4HQFA 2FA9A 1Q19A 1L4GA 3IRUA 1SXJC 2O2SA 4DHWA 1IONA 1U8TA 2GHIA 3HJCA 3ZUGA 5B1EA 1UZLA 3R1IA 3C7AA 3LLSA 2XWPA 3L0YA 2G06A 1FF9A 3QVJA 5D6NA 2JC3A 1RI1A 3TL3A 1V1MB 3LTNC 5JDCC 2KBEA 3GJQA 4IICA 4DLUA 3ZOKA 1YONA 1CQIB 1V5GA 4BAUA 1ESDA 1XMIA 2R66A 4PV7A 4C2AA 1LSOA 1TGYA 1XNGA 3QPBA 4ZQIA 5ALVA 4RF5A 3VRHA 2RGGA 1U2PA 3JU3A 4FXPA 4D8TA 3S99A 1DAMA 1T4MA 1D4OA 3GNQA 3INTA 5BYJA 5DTRA 1Y1KE 3QGMA 3UK1A 3K9FC 5F98A 1SC4A 3C6XA 5BUCA 3GLHB 3CSUA 1V5WA 1TB4A 2GI4A 2XE6A 2R7LA 5KPJA 4MW6A 1UOOA 2WUWE 4ZAZA 1X8KA 5G0TA 4LF5B 3OZCA 4N1AA 4KKXB 4DMKA 1RM3A 3F8WA 2QRPA 1FPMA 2BGMA 3IDAA 4HQOA 4WXEA 1OZAA 3OZGA 2FSSA 2QVZX 1GTZA 4QGAA 4WZBB 3FETA 4ZCLA 3V1UA 1W6RA 2XI4A 2Y99A 4EFDA 4QOSA 2IXGA 2KX7A 3RUHA 4Q6WA 2FV8A 2P1DA 3G9XA 2WIBA 3A28A 2CXRA 3GVHA 3OKCA 3QUQA 3SP1A 1KBOA 1EBUA 2ZANA 4LWPA 1E4EA 3N53A 1NW8A 1UDCA 3MJDA 3SKYA 2O5EA 2P9FA 4O4HA 3OIDA 5FAXA 4QYIB 1ZC3A 3TFOA 2VYND 1QDLB 2GM9A 2AOUB 2YASA 2FW9A 3HCWA 1JIUA 3CUTA 3ND9A 1NRXA 3AGPA 3DOJA 1RTTA 4DSZA 1FYWA 2LGJA 1JHVA 2H7XA 2DFPA 3RS5A 3ZE1B 1TUGA 3GDGA 1J5PA 3HYRA 3A9CA 3ZH2A 2IHZA 5F73A 1D2AA 3PFWO 3E2PA 1OYYA 1USKA 3NTRA 4JJGA 1FSZA 2WKQA 4HNTA 1TEZA 3SFZA 1N6OA 3G5AA 4ER5A 4ZRNA 3V80A 3TR0A 4FZJA 3PNPA 2C5HA 2I7XA 1KKMA 2X3UA 4Y18A 5EIAA 2AH5A 1OFTA 3REQA 4D4GA 4R4JA 5C53B 2IS1A 1SELA 1K8QA 1SD5A 1TK9A 2P8SA 3IT0A 1PEDA 4CMEC 2VT6A 5DTJA 4DWOA 1O58A 1WXWA 2GHQA 3ZBPA 4EJFA 3KZ1E 2PRIA 1MDFA 4FX5A 3V4RA 2WJYA 1RQ2A 3FDZA 3GRKA 4BMDA 2W2TA 5JMTA 2ZT6A 2VQEB 1CIVA 2ZSBA 4IIUA 1OVMA 1XAHA 2G1AA 3RDPA 3BBLA 4WY2A 4Q4HA 3RS8A 1OI7A 4UM9D 3BGIA 1GAQA 4ICIA 5EJAA 4DGQA 1ZNXA 3HA7A 4D3XA 3Q0TA 1NXQA 3FRIA 2VTDA 2DBYA 3CUYA 4LDRA 4DCOA 5FT9A 4ZI7F 1M8FA 1NP3A 1YUMA 2GSWA 3C6QA 2BGUA 3HL0A 3WNDA 4S1VA 4L07A 1N57A 3M5WA 4EA8A 1EZ4A 4POAA 3WG9A 2JLWA 5B3LA 3EWAA 4LTMA 2Y67A 3OQ6A 1EPUA 4BJ6A 5BR7A 4HRXA 2WIGA 1ZGGA 3DO5A 1JLLA 3DL2A 1Y8CA 4PCUA 4UVIA 2AUTA 3HCOA 5JNLA 1VCHA 3IB6A 1KL7A 2WJPA 2RGNC 2UVQA 1KOJA 2B8EA 2GJSA 3AI3A 3EVAA 5DNVA 4JB2A 3DE6X 2BJHA 4F7DA 3N8DA 5IC4A 4KWHA 1FSSA 1FSGA 1VZ3A 1AUQA 1CY2A 1I2BA 1N7IA 1R6DA 2FN8A 2JDID 3JQBC 1EB9A 1Q1GA 4JLUA 4WOKA 1QB8A 2H17A 5EP4A 2WHPA 3FKJA 5JNRA 1FFHA 5DWDA 3WWEA 1GZ3A 2RAPA 4QBGB 3FOZA 1YR7A 2CCKA 3QENA 5J1TB 3WK7A 4TZKA 3T3OA 4KACA 1SCNE 4HX2A 1AS0A 2FFJA 1IXSB 3AEQB 4PSDA 1AGNA 4UCFA 2BP7B 2YW9A 3OZVA 4DCNA 2OFPA 4J0DA 3GLIA 3GXOA 2NYVA 3T7RA 4C22A 1J4AA 4IV0A 2D5LA 2I2DA 2QDXA 1Y1SA 3L2OB 5DPMA 1CRQA 3ENWA 4IILA 4WOJA 5HW0A 3TLXA 3KSDO 1UDWA 1XUOA 4RIGA 6REQA 1JIVA 1ML4A 4QQKA 5AI6A 1HEIA 3QVGA 4XSHA 3H11A 3O1IC 3NYWA 1X8LA 2L19A 2L82A 4Q7QA 1IDOA 3PC7A 1WBDA 1IXKA 3DMYA 4JSRA 1FQJA 1M74A 3L0PA 1A9OA 3IFSA 4CDMA 2RE8A 3BJIC 1QV7A 1A3CA 3PQDA 1OKKD 2PU5A 2SKEA 3V42A 5K9ZA 2JIZA 1XEXB 1O95A 1QIIA 1T35A 4ARCA 2W98A 4H6WA 4DT1A 1RWBA 4DE5A 1C2YA 2D1FA 3B3QA 4V0SA 4IWNA 3SN6A 1SKBA 1TUBB 3I62A 4Q7EA 3THRA 5DVZA 3WO0A 4G1UC 5JYDA 4BVJA 3TK1A 3L8ZA 3T9DA 5FORA 4KK3A 4KYUA 1WS6A 1VIAA 3GAMA 4LOIA 5FTLA 3U0BA 3VR3D 1AIPA 2GA9A 2X5KO 1ABEA 2UUOA 2Y0DA 2A4MA 3KSMA 3PGXA 3UATA 4BPBA 2ZRHA 1KO1A 1PJ4A 2V1XA 3BMXA 4QU5A 3TNDA 3F7MA 1PG0A 3EUFA 4JJ8A 4K9DA 1TKBA 1VL6A 4V02A 3VPFA 1NR7A 3E27A 1GGVA 2OCLA 1DDOA 1TM4E 3OLVA 1P44A 2FFHA 3H9CA 1KYWA 5BQ5A 2X8AA 2X1VA 2XCLA 1PS9A 2BJWA 2XWQA 1A5SB 2BE7A 4M0LA 4XOUA 5LP6C 2V8BA 2EEPA 4R2LA 1E60A 4N0EA 5JSQA 5K8CA 3HVIA 1QZ3A 1SBNE 1C2TA 3BRWD 2QGZA 4J0JA 1KKLA 4NAUA 5J5CA 1JEJA 3CUEF 9GPBA 2QP4A 4NYJR 1YI8A 4PR0A 4BLPA 1YVDA 1ENZA 2H5IA 2OXTA 1ZM4A 4HLQB 2UYOA 3AOEC 1DFIA 1NT4A 4O4JA 1NVUQ 3WLJA 3HL4A 3FGNA 1E0SA 2FGJA 4HWKA 4QHSA 1G21B 5FOQA 5TR9A 5M5BA 4N76A 1BU5A 1OIVA 4MI9A 4RVGA 3GJRA 3ZS9A 2A5LA 2DUMA 2JIPA 3L79A 1VPWA 3WL6A 1JWAB 1XD8A 4BWGA 1FRQA 8GPBA 3MJFA 3UUWA 1XAIA 3IO3A 4BVHA 2O4CA 5HWSA 1G59A 4PANA 1Y1QA 3LGSA 4PHCA 3QWAA 5F5XA 4DBZA 3JQCA 3RRYA 1KJZA 2QOEA 1PT9A 2ZRPA 2WJWA 1C8VB 1V41E 2V59A 4A6EA 5H82A 5LMCA 4G4JA 3RHFA 2I3GA 1UDXA 3BHIA 2FLKA 2VS1A 3KBOA 4KN5A 4P0PB 1PP4A 4LXXA 2Q50A 2GYVA 1L5RA 3VZPA 2XSZD 4BV9A 1AQIA 2J07A 5J4VA 1WHSA 2YJ5A 4X5OA 2JCBA 3M6MD 2P9TA 3MB5A 4JP3A 3ON5A 4EG6A 1RRMA 4NEHB 4HG2A 3K9LA 2WILA 3GLTA 1LW7A 3FWNA 3MCAA 1M6HA 4HMOA 1JZSA 3BGDA 3JQEA 2X13A 1J7JA 3NYQA 4TS4A 3QLVC 5EUCA 1NN5A 3VYVA 2BH2A 2HBZA 2QN3A 2C5AA 3Q8KA 2WWRA 4O0MA 4H17A 2IP4A 5JO9A 1Z2DA 1QNLA 4H0CA 3A3OA 1Q16A 3KYDB 3V1TC 2PD6A 1FOEB 3L4BA 3DUWA 5FNZA 3I42A 5D01A 5EYPB 1I0ZA 4NU8X 4ZVRA 5TJHA 4EDHA 1L4FA 1CEYA 2QB5A 1B4DA 4DRXA 4ZHQA 4P35A 5FL7D 1T1JA 1YJBA 1RZUA 3SEFA 3EAGA 4CL8A 5TT1A 2V03A 4B7CA 3ZW7A 1N6RA 1AX9A 1TT5B 1M7GA 2BYTA 4NBWA 4Y6GB 4DMCA 3PRKE 2ZB3A 5EIOA 4A36A 1F8GA 3WYAA 3T3NA 3IEKA 1NXVA 4ZAGA 1ZCJA 4DSTA 4R41A 1ADJA 3IHWA 1ZCBA 4IGIA 3NHAA 2OT3B 4DR3B 1YE5A 1JR2A 1XLUA 5K6AC 1GWNA 4V2UA 1IDN1 3UK2A 4BUCA 1P2DA 3M34A 3DTYA 1SC3A 1U2DC 2V3WA 4B34A 2GAOA 1E9CA 4ZVOA 5HKAA 2JAXA 1QYWA 4ZQHA 5JJLA 1DO8A 1A9YA 1I6WA 1DAGA 1ONOA 4HFNA 3TNFA 4G24A 5LP6F 3B1FA 3L7OA 4YXWD 5F77A 4HDKA 3SR3A 3KP1A 1DQSA 4JIMA 3ZWVA 1Y6RA 1JSZA 2V5VA 5C1PA 4NZNA 3CLUC 2ZJAA 3VNVA 4UKDA 4WZZA 4W1RA 1Q7RA 1GPAA 1ZGCA 2BLLA 4YALA 3COSA 4FYPA 1PL0A 1AKMA 5EVJA 4ZIRB 1YS6A 4BO3A 1U9YA 4MYRA 3CLKA 1ZNWA 1URPA 4NE7A 1BGXT 3H8JA 4FE4A 2PTGA 1SM4A 5IASA 2I7VA 1OD6A 4LWQA 2XY4A 3HKBB 4BX9A 3TPZA 4QO8A 1C7QA 2LD4A 3ORQA 4MB0A 4E11A 5JJ5A 1EUCB 1ZDMA 2DULA 2QYHA 3KOMA 4K9QA 2H1IA 4UNRA 4C1NA 3R0QA 4MRVA 5BSGA 1YVRA 2QTCA 2PZJA 1N6IA 2ZETA 5TARA 4OJNA 2H4JA 3O1JC 4FSDA 1V1MA 3EQZA 2G0NA 3RQSA 4D02A 1QP7A 1YQXA 2HSGA 4Y2PA 5NLLA 2BISA 2A5JA 1BVRA 4MAMA 4DVJA 3FIJA 1CQIA 1YHZA 4C4AA 5KQSA 5M34A 5ED4A 2QBYB 3JWJA 1NUHA 5JS8A 2ICAA 3HSKA 4NXNB 1ZKMA 3V7WA 4U6NA 5KVSA 3D0KA 3ROTA 3N0XA 3K9BA 4MWBA 1OXMA 3NYIA 2OLJA 2WHXA 3L46A 4H3KB 3W3AH 3I61A 4A15A 4J1QA 2AUNA 3GLHA 3IP1A 3LOQA 1ID1A 2AFRA 3CRMA 3IPRA 3TMAA 2BVNA 3CWZA 2VT3A 3IYLW 3QM1A 5LA6F 1EIZA 5LQUA 3AHFA 3BGVA 3M0EA 1KIAA 3T15A 1PZFA 4UEJA 3C45A 5JD3A 2NP7A 2PA3A 2JJ1A 2YJ6A 2WVAA 2VDOB 5J58A 5J2TF 3B9QA 4WZBA 5KNDA 1QDEA 2BI4A 2FETA 3EXG2 4GM0A 1ISIA 3RS2A 2ZE8A 1ND6A 1UZMA 3FGPA 4TL9A 4GD3Q 1N3IA 3OESA 2B2CA 3H5IA 3P45A 3PDHA 3D5EA 4PWZA 4UDYX 5FOSA 3UF0A 5GVSA 2BRUC 2ABWA 4P93A 3BXFA 4O1HA 5M29A 3AG6A 4JODA 2EF0A 2GN6A 1R9NA 4QYIA 1UXHA 1S3IA 3HPRA 5AH0A 4EDFA 5LYJF 2AOUA 4CIBA 3H8VA 1QHGA 3RC8A 4OYYA 2AMLA 4Q1VA 4QNMA 3ZE0B 2R48A 3LF1A 3OLCX 4EEZA 3HHPA 5GM1A 4LBWA 5BRNA 1IK6A 2EP8A 2MYUA 3KV1A 4PZ0A 5DHPA 5CH5A 3TQIA 3DKRA 1CJUC 1OU0A 3IULA 2HA6A 4YR7A 4ZYTA 3ZXUB 3V2UA 2XMRA 2C00A 1U3DA 1EVEA 3K2IA 3MCTA 4PSUA 5EKDA 1OBHA 5H9VA 1CVRA 4C07A 3FMIA 4MIOA 3TTSA 5EHIA 4XWTA 2PDAA 2NYRA 3WB2A 5ALSA 1SK9A 4AUEA 3KLPX 5IC6A 1FJHA 2P6UA 5EHZA 2FRVA 3DFFA 1TZJA 4LYAA 4IH9A 3HCPA 4S3MA 3N70A 3NJ4A 4OLBA 4LG1A 3OMWA 4LXGA 1PR9A 4JUDX 1W6UA 2VDUE 5BV7A 1FNMA 3Q8MA 1PS0A 3OPYB 3GJTA 4NCJA 3PITA 1P5HA 1RE1A 1YJCA 3BIJA 5GV7A 3ROZA 2X7JA 1FYVA 5LCXA 1WVMA 2ZUUA 3DMGA 1STOA 4RIEA 4N9WA 4XIFA 2NSDA 3NBUA 2AFIE 5T4HA 2PUCA 1VJRA 1EXVA 3A32A 4KMOA 4Y2XA 4Y1GA 1PWEA 4GPD1 4UDOA 3W5HA 1OI2A 3CKKA 2HDHA 3V97A 4C88A 2X7HA 3C3WA 3TB6A 2XXBA 1IUPA 4RXMA 4U9UA 4BMVA 1PK8A 2Z83A 5HCUA 3T9FA 4EW3A 5CK5A 1XDGA 1QO0D 4QUIA 1QONA 3PQEA 5BQ3A 2Q6OA 4D3ZA 3M6AA 2GXSA 3G79A 3IXMA 2WJJA 3UAWA 1QIJA 5ERYA 5YASA 2H6EA 3OCZA 2ZUWA 3OPNA 4UVEA 5ENZA 1C4XA 5CDTA 2VIIA 2NO6A 3M2TA 3LYLA 5GM2A 4U7GA 1DQYA 1ZNZA 5TMBA 2UUCB 1JEOA 1CF4A 4YCSA 1VFNA 3STVA 4IVPA 4O59O 1LY1A 2W37A 3AEQA 3AI2A 2QZJA 1ISRA 1E1LA 2BP7A 3MS4A 5A7HA 1O4VA 1FU4A 1UMCB 3T5DA 1BC5A 4MQMA 5FPSA 3HEMA 1BFUA 3A2KA 1NX9A 1XZGA 1UAAA 4MVJM 1N2HA 3ZDDA 3V8EA 1C0PA 1U8UA 3BQ9A 1Q12A 2YJGA 4J07A 1PQ4A 4R9UC 4W8HA 1YA6A 3EVZA 4Y2YA 4TV8F 3PSHA 1KY5A 3RV3A 4HXGA 2EFHB 3H6HA 1ATZA 2EBUA 2H9IA 3E48A 3TIGA 4NAHA 3BC1A 2B99A 3LCJA 2WTMA 1N0VC 2JIOA 4PF1A 1YACA 5SZJA 3AQIA 4EM6A 5HKKA 5KOYA 1C80A 2FZEA 2JBAB 2ZLBA 2VPQA 3WHPA 4DCTA 4ND4A 2GM4A 2YV1A 2ECFA 2H63A 4LPKA 1WW8A 1EH5A 2I3DA 4JROA 4Q47A 5K99A 2PE5A 4OU4A 4UNNA 2UYCA 2E49A 2YHIA 1XEXA 4FS3A 4KQ2A 2O7VA 3A6EA 2DMRA 5FA6A 3RC2A 5JNVA 3U44B 3WZMA 4XSVA 2YZ2A 1SOUA 1TUBA 2PUWA 3RHTA 3B3GA 4DA0A 2MYPA 1RLMA 2EZ4A 2HYIC 3DDUA 3HB1A 5AKHA 4M7WA 3E1GA 3OAAA 3I8SA 5K4HA 4KMMA 1W4LA 3Q15C 3R5XA 3FR8A 3BSFA 2F1JA 1N5JA 3I83A 5DM60 1T13A 4RV5A 1U1FA 4QXOA 3I45A 3J81A 2QVGA 3E70C 5AVVA 4JQZA 1EK2A 4RK6A 3J81k 4E6PA 4F72A 4IEEA 2FW7A 1B8UA 1UBOS 2J3HA 1Q44A 2ADFA 4QSMA 2VJPA 3AR6A 3CF2A 3DE7X 1NM5A 3DR5A 3G8AA 2CHQA 3PIRA 4FMCF 2QR3A 3G2NA 2GPAA 2Q2QA 4O08A 3N8KA 4WQMA 2P5YA 3V2IA 4IQ0A 5HJ2A 3TSOA 3MGBA 3K30A 2ID8A 3BFKA 3ZDXB 1LNSA 4GYKA 4BQFA 5C1OA 4QSHA 1U11A 2GFIA 1TECE 4N8SA 2Z6VA 4W99A 4JUFA 3JR3A 3VSDA 2PSHA 4D4JA 3IUJA 3THWB 2NTVA 1B1AA 3TO5A 4WVLA 4ESEA 2UXDB 3NIBA 4HQRA 1IEQA 2HV9A 3USZA 1QF7A 4LE0A 5DJ5A 1N2GA 1G21A 1X1RA 4O6VA 3B1YA 5C1BA 2K2WA 1A4IA 4RLSA 5AUNB 5JR3A 1XZNA 3A05A 5FI5A 2CL0X 1G42A 3ABSB 2MSDB 2GTPA 4PAWA 3FH0A 3GUCA 3OLQA 4NR0A 2J9RA 3OMXA 2OECA 3GRFA 5JRDS 4UARA 2JVKA 4YS6A 3VR1A 4XARA 4TXJA 1GNRA 3ESDA 4GX1A 4B6PA 3GARA 4P22A 4XVCA 2UZ1B 3MTEA 3LC2O 7GPBA 2J4FA 2HO4A 4KU4A 4EG8A 4CCYB 4ND6A 4BQPA 5H7XA 1LBQA 2PBFA 3MUNA 1WCYA 3ONVA 4MYTA 4V03A 5TPZA 4K28A 1OBCA 4NFHA 5FPQA 3EEYA 2ZRKA 3QSGA 2PO5A 1XRPA 2FMFA 3VPXA 2FP4B 1N9ZA 3LX6A 1HNNA 4KE6A 2WHQA 3ITNA 1CCWA 1GGKA 1O9GA 1AHHA 2UZIR 2VAWA 2Y05A 3LL7A 4HS4A 4LZOA 1YR2A 1FYEA 5BO5A 2EKDA 4F9FA 3HFGA 3P9IA 2BSAA 4G65A 2C2BA 4AZVA 4FWTA 1EXNA 3KYDA 3B51X 4KPGA 2W6MA 2YCBA 5KI6A 2XE4A 5EYPA 3G02A 4R68A 1GCIA 3PJFA 2R96A 3EGWA 4EX6A 5HYVA 1GTG1 5L3SB 3HB7A 5LQCA 4BV8A 1JLHA 3GOQA 1YMUA 1ZL2A 3OEWA 4HLCA 3T1QA 5CCBA 1HZJA 3HXMA 2D62A 4F04A 2FWBA 5DGTA 1TT5A 1M2EA 5IWCA 5THKA 5JBQA 2AOTB 3F2IA 3DYVA 2IZ5A 2PFKA 4BKMA 4P34A 4KNVA 4WD3A 4C4TA 2GJAA 4CIWA 1ZS9A 3WL3A 3WRYC 5CCEA 1YQQA 1XVLA 4XD2A 1N2IA 1NIJA 1F1JA 2HU2A 1GZVA 1TIBA 4J2OA 4D7AA 2AOXA 1N2CB 2RAUA 4EO4A 1NWHA 1RFGE 1TMKA 3R6DA 2NVUB 4ETIA 5HTKA 3HVRA 1SBIA 4XLLA 3UMCA 4YJ2F 2O2CA 4Y7CA 5F35A 2PKQP 2ETXA 2GASA 1XA3A 2RGBA 3FUWA 1GNVA 2OL4A 1UZAA 4WNYA 1OH7A 2IXEA 3MQFA 4OXYA 2Q9AA 4YCMA 2HMAA 1RNLA 4M8KA 4W9NA 1G4AE 3A9TA 2QQGA 5BN4B 3RSOA 4A8TA 3DLTA 5DM4A 3H4MA 4E2WA 5JFTA 4MWCA 2ZKIA 3GJ7A 3IMGA 4GP9A 4NJOA 3NIGB 5IXSA 3TG8A 5J47A 4D2IA 2GZMA 2WMOB 4II2A 3RBXA 4ZIRA 2GR9A 1E7MA 1UPFA 2IYRA 4L8GA 4OQZA 1RRFA 1BE1A 1QRAA 1UKYA 3GCGA 4EGAA 4LC9A 4KR6A 2GOYA 2LNDA 2ZIFA 4FFRA 2J7KA 2R00A 3TW8B 2C7QA 3AQ4A 4XFKA 3M89A 4Z9YA 3HKBA 3ZX4A 1ZHHA 3ICCA 3IOEA 2ZJ3A 2WD8A 4PHFA 4DKJA 3QFRA 4Y0AA 1EUCA 1GUZA 3TX6A 2B1QA 2EV9A 5A1JA 3IP6A 1J0CA 4AY3A 3G0OA 5KTYA 4A1OA 1QCDA 2YRWA 3CZQA 4Z7JA 3OP4A 2JKVA 3E7XA 2IYLD 1BHSA 3C43A 4UHEA 3K0SA 2HBYA 2X2FA 3P4UA 3P9SA 4EHNA 5GMOA 1XDUA 1QB7A 2QBYA 3TEJA 4EUNA 5IN4A 2I29A 5IT9A 1BE6A 2CNKA 1U4SA 1CY0A 4R9SA 2ZBVA 1OLSB 3EIOA 4II7A 1K3TA 5SZHB 4A27A 5CU7A 4XQGA 4RBNA 1KTIA 4Z9BA 4WL0A 1NE2A 2BKVA 2WKPA 2IBMA 2DCMA 2NO0A 3SVZA 2UZAA 3RTDA 1YOBA 4LF8B 2C5EA 4B46A 1JVSA 1T3TA 2H92A 4QYXA 2AN4A 3B6ZA 3I28A 1X1SA 3BE8A 3ZQUA 1M0WA 4A16A 1IHDA 3LKBA 4OQQA 5I47A 1JEAA 2IF2A 1I3NA 4KW7A 2C83A 3HSYA 4LOJA 3CB4A 5K0TA 5ER9A 4BEVA 1ZOIA 3RRZA 4M87A 3KZVA 5JCPA 2Q7XA 4WXRA 4CLOB 4WEOA 2HL6A 3UBTA 4U8HA 1E1KA 1R5JA 4R1SA 4MTLA 5CIQA 4G4GA 1TQ2A 1JYFA 4QREA 2B78A 3RSSA 4L0QA 4E5YA 1FVHA 4BO6A 3ENNA 3M3HA 4HWOA 3QHPA 4KR9A 2JCSA 3W2IA 4RVOA 3GEEA 1Q1EA 1YDGA 4YRGA 4PG4A 1ZD5A 3D4PA 1P9OA 4OHKA 3M83A 3VVMA 2C3YA 3WSWA 3KFLA 5KZMB 3ABRB 5FR2A 1XLVA 3I5AA 1KAMA 4BN4A 4DYDA 5C35A 1CUWA 1VMAA 4ZVPA 1I0IA 2EFEB 2G1JA 4AMGA 3ELDA 2XKAA 2REOA 2UVDA 1X2BA 3E6AA 1IH8A 4HWPA 4GIBA 4FHCA 2FWAA 2FMXA 1TO2E 3A6HA 3FGZA 5F7ZA 5JVDF 2FGKA 4RWZA 4JI8B 4JP5A 1P7YA 5CVEA 1F5SA 2PUAA 5GVRA 4MS1B 3GVPA 1NP6A 4RGYA 2XDQB 3BA1A 4C3UA 2NO9A 3PHBE 1TC1A 4IJQA 3HRIA 4RQBA 3OPYA 4JT8A 3U3OA 2X7XA 4P81A 2C92A 4O1IA 1A8SA 1AD2A 2YRXA 4BVEA 3IA2A 2OG1A 2XAUA 3VSCA 4UDXX 4WLOA 1DKLA 4X1KB 3O4VA 4IZ6A 4IOJA 4JU9A 1MJ5A 2OBLA 1FW8A 2XYHA 4GSLA 2CFCA 4IMJB 1D8TA 2O50A 5K0JA 1OZHA 4Q3AA 4JJFA 1KO5A 2VCYA 3K4QA 2O0MA 3PQ2A 4DLAA 3PWSA 2B69A 3AIOA 1NQWA 4XD7D 4RMJA 5CDFE 1QP4A 3NKLA 2FWNA 2WWYA 1JU3A 2Y92A 5E9QA 3W8DA 2JBHA 4YRMA 4KFSA 3ZWQA 3BD8A 4GH5A 1KFEB 3DDWA 3IRVA 4FMPA 3UCXA 3RKUA 4OATA 4BE7B 4U7DA 3E18A 4AKGA 2D1TA 4CGZA 2I4TA 1D6JA 1NW9B 4OIFA 3H5OA 5F3RA 5JQWA 3FKQA 2Q5IA 4XJVA 1QRSA 1TJPB 2XD9A 3WGQA 5IUNC 1NG9A 3TNJA 1P1BA 3C7KA 3ZU4A 2PXHA 3FLBA 4CM3A 5G0SA 1DUSA 1UMCA 1UC8A 2HFKA 5BNTA 4JN6B 4TSKA 2ZPAA 1KQNA 3CLUD 2IQ5A 3T3IA 4P0TA 3B48A 2EJUA 3LG2A 4J6FA 3SNHA 2JJ8A 3FTNA 2NTYC 3PWTA 3OZTA 1USVA 1LQ2A 1QTIA 3UUEA 1AKYA 2DT5A 4I3GA 1Y3CE 4UNSA 1A88A 3WMGA 5EGNA 1Z3IX 1MAVA 2FWIA 3ANSA 4H3HB 4B82A 3X43A