3E1GA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
239
structure length
239
Chain Sequence
b'FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
molecule tags Hydrolase
source organism Lactobacillus rhamnosus
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
total genus 89
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e1gA00
4X71A 5HF5A 5HFAA 4C01A 1NU6A 3AZPA 3O4JA 1ACJA 4AO8A 1KEZA 4K6KA 2PKYX 5CXUA 2HRQA 1QIJA 3WA6A 2B9VA 1JJBA 4X92A 2H1IA 3OOSA 5ALYA 7YASA 2I03A 3G0GA 3VJMA 2HDWA 4Z49A 1ZGCA 4DGQA 1A8SA 1THTA 3I1YA 2XQGA 4G5XA 1IUNA 3O4IA 3O0DA 4BP8A 4V2IA 2WTMA 2ZYHA 3A70A 1LGYA 1ORWA 3DYVA 3WJ2A 1JFRA 4HZGA 1G42A 3QBJA 2XMGA 3LP5A 3WIOA 1XZGA 1BU8A 1E66A 1H2WA 2Q0XA 5DTIA 4G4GA 3I2KA 5DTJA 5LZ5A 3F8SA 2V97A 5AKJA 4ZV7A 3F9CA 4JYMA 2ROQA 1TCBA 2R11A 1ORVA 1QTIA 4EY4A 4N5IX 3IUNA 1EVQA 2DFPA 3RM3A 1VZ3A 5FKJA 4H7HA 1XFDA 1XZMA 1E8NA 1BRTA 2WG2A 1U2EA 2WUEA 3NOXA 3WL8A 4RGYA 1DWOA 4PNZA 5AO9A 5IVHA 3CCCA 1QO7A 4EY7A 3LIPA 4AO6A 3WZMA 4ZRDA 5AIAA 2WILA 4AB1A 2QRUA 4AMZA 2ZJFA 4HXFB 2VA9A 3H19A 5AKGA 2ACKA 3UUFA 5A71A 5DLPA 5BOVA 5ALFA 3IB3A 1D07A 2QM0A 1XZKA 4QWMA 1BCRA 5EIEA 2ZYSA 4U2FA 3BJMA 2QR5A 5AM3A 2DHCA 1BEEA 3WK9A 4H7KA 5T4BA 1JJFA 4PSUA 1P0IA 4OB7A 2WG0A 1ZI8A 5LLSA 1E8MA 1QFMA 1UZAA 1WPRA 4X7BA 1NU8A 1ODCA 4B85A 1XZFA 3HXKA 5AK6A 4C4YA 2ZSIA 1X2BA 5D6OA 1AUOA 2XMDA 2OPHA 1LPNA 5ALTA 4QEKA 2GYUA 2X76A 1R4ZA 3FSGD 1UKCA 3QH4A 4FBLA 4BRZA 4ETWA 5IVKA 1W75A 1CRLA 1PFQA 4Q1VA 3DQZA 3KXPA 1RP1A 4J0HA 1QONA 2G5TA 5KWJA 2CJPA 5E4TA 4IH9A 5IVDA 4Y2RA 3OC0A 4X95A 2V98A 5AOBA 1N5MA 2XLCA 4CCWA 5HF6A 5EHQA 2IX9A 3AJAA 2GBIA 1UK9A 1A7UA 4KRXA 2OCGA 2Y6VA 4BE4A 4DNFA 2WIJA 3GBSA 1CUYA 3ILSA 4G1FA 5AI0A 3VVMA 4A16A 4HXEB 2OLEA 5AK4A 2JGJA 4BZWA 3D0KA 4Y2YA 5I8PA 2D0DA 1CR6A 3E1GA 4PF1A 3TEJA 2QTBA 4HRXA 3X3HA 5DWDA 1P0QA 4MWSA 1H23A 5ALQA 4JEIA 1VE6A 3H2JA 2OCKA 1AX9A 4UHBA 1QJ4A 3S2ZA 3VXKA 4EZIA 3W05A 3I1IA 4OD0A 1LBTA 1YS2X 1LPPA 1NX9A 5AKHA 1TQHA 1N1MA 2EDCA 1CLEA 4KE6A 5ALEA 3U1TA 1EA5A 3GUUA 1Q0ZA 1SFRA 3M81A 2WHPA 2PPLA 4WY8A 4ZGBA 2ORYA 3EQ9A 1ZIXA 2JEZA 2AJ8A 3LLCA 3SX4A 3DYIA 5CT4A 1PV1A 1EB9A 2RHWA 4E11A 1MX5A 1QTRA 4CI9A 4FNGA 4DSZA 4GI1A 1I6WA 3JWEA 1AC5A 5AIBA 4NVRA 4F0JA 2WJ3A 4GLBA 2HFJA 4ARBA 2XMZA 1XZEA 1Q83A 3ZLVA 4OU4A 2XMSA 1K6EA 4WJLA 3ZV7A 3WWEA 5LIPA 3BE8A 1FSSA 4FLFA 2ZJ7A 3KOOA 4Y2PA 5EI5A 2E3JA 3W9UA 4DMHA 4EA6A 1CQWA 3D7RA 2PU5A 5CBKA 2XQIA 5LZ9A 1A8QA 3HI4A 5AM5A 4EY5A 3I28A 2G4LA 2ONCA 1JU3A 5ALIA 5CT9A 4UHFA 1ZD5A 3V9AA 5EGNA 2XDWA 3AZOA 1BEZA 4X6UA 2BGRA 2PBLA 1UXOA 3R0VA 2VQ6A 5LKAA 5AJHA 5T4EA 4MYDA 5JZSA 3WK6A 4GHWA 3FSGA 1MJ5A 5JARA 3DJYA 2JGFA 3D4LA 1R88A 5K3FA 3B5EA 4FNMA 1SOMA 5JD5A 4QE3A 1XKLA 3UMJA 3STXA 1XQWA 4WFJA 2BJHA 2VT7A 2GYVA 4KR0A 3VKFA 1MN6A 2D5LA 4MXDA 1VA4A 3D5EA 1USWA 1QGED 2W22A 5A7HA 4B81A 3WL5A 1EB8A 1GQRA 3LIIA 1XZDA 4H77A 1L7QA 4UHHA 2PVSA 3G02A 2J3QA 4LIPD 3D3NA 2WIFA 3SWWA 5ALLA 2PU7A 1XLWA 2PX6A 4WDRA 5JALA 2XUGA 4UFNA 1SC9A 1FFEA 2XUAA 3MUOA 3G8YA 3C5WP 5EFZA 5FRDA 5JAUA 5D7BA 1CQZA 2C0QA 3O9MA 3ZI7A 2OQIA 5K3EA 4YX9A 5JATA 4HTAA 5T4HA 3C8HA 5CH3A 3VJLA 2DR0A 3HLKA 5IH7A 1U8EA 3IURA 3G0DA 2XE4A 1M33A 4FOLA 3DCNA 1J1IA 4PO3X 4BVKA 1H2XA 2JGLA 1EK1A 4OYYA 5EIHA 2Y2VA 5AK5A 4G9GA 5I9IA 3WWOA 4FFVA 1OXMA 4Y2VA 4H35A 4X93A 4N8DA 4Q3OA 5ALNA 4IH4A 3ZWQA 3F96A 1KU6A 1B41A 2C4HA 3ZLTA 5I7UA 3H17A 3E4DA 4BB0A 3DS8A 4I19A 2GYWA 2O2GA 1XROA 3C70A 1CUAA 1ZD4A 1XZHA 3C87A 3WK5A 1QE3A 4CIBA 4W1PA 3DD5A 4P93A 3CCBA 4J03A 3WI7A 4E15A 5FDFA 2YASA 2VJBA 4ZI5A 4C6HA 3O4GA 3LS2A 3WK8A 1DQYA 1WM1A 3DKRA 5SYMA 1XLUA 2HU8A 4JH0A 2CKMA 1YAJA 2Z8XA 2QJWA 4QDUA 1J07A 2WHQA 4P9NA 2QVBA 4MWTA 2DCMA 1QIKA 1JT2A 5LZ8A 3G9UA 2HA4A 4UBJA 5ISMA 5ALHA 5FOQA 3W9BA 2HIHA 5AI9A 1N8SA 5AKLA 1W1IA 4QDOA 4RNCA 3BDIA 2O7VA 5JAHA 1ZJ5A 4N8SA 4BC0A 3FYUB 3VJKA 4QDZA 2YH2A 1CUIA 2BAGA 2C58A 2IIVA 1QIDA 1HLGA 2PSHA 3O9VA 4J0KA 4BC1A 1F8UA 1U65A 2GBCA 2HHAA 2CUTA 4AMYA 3Q8WA 5HK9A 2Z8ZA 4BCBA 3RKSA 3ESAA 1CUZA 2WG1A 5ALVA 2VSQA 4UBOA 3VVLA 4H7FA 3GFFA 1A8UA 3IUJA 3E0XA 4BBZA 1WB6A 4DNQA 5AI5A 1DU4A 5ALUA 1HQDA 3PF9A 2H9YA 3DL7A 5FPPA 1WCYA 2WJ4A 4MYSA 5AKZA 5HCUA 5AICA 2IITA 1EX9A 3G7NA 1EK2A 2PM8A 3ED1A 5C81A 1WPXA 2WM2A 2AXEA 4EY6A 1R3DA 3HYSA 3IUMA 1DWQA 1YB6A 2I3ZA 1RWQA 4C88A 5DJ5A 5E4YA 3A2MA 1ODTC 4ROTA 4JNCA 4UHCA 4BDTA 1JU4A 4W1QA 2Z3ZA 3G0BA 5HQ3B 1GPLA 3K6KA 3RK4A 2XQJA 4WFKA 3D59A 2WFLA 3WKCA 3BDVA 3WIBA 3C8DA 4H7JA 2ACEA 4GECA 4BTVA 1Y37A 3QM1A 2Y2UA 4M0EA 4KJXA 3K2IA 2WUDA 1XKTA 4IQ4A 4DLNA 3WQHA 1TKRA 5K3DA 4WDQA 1GKLA 4QDXA 3BL8A 1Y7IA 4IHAA 3CN9A 3W06A 1JMYA 4WCVA 3FLBA 5CURA 4BCDA 3BJRA 1P0PA 1WOMA 2B20A 1QIMA 5D3KA 5EHNA 4DMCA 4X6YA 2GZRA 2QXTA 2XB6A 4D9JA 2OQVA 5LKRA 4G8CA 3D2BA 1CUUA 4OPMA 3GELA 4AO7A 5YASA 1HPLA 2XMBA 3DEAA 2XUFA 4DYHA 2CZQA 2EDAA 3EF3A 1SCQA 4JYPA 2G63A 2JBWA 3PUIA 4DNPA 3JW8A 4AZ3A 4GEGA 3M82A 4BAGA 4B84A 1XZJA 2G5PA 1DT3A 1R9MA 3FCXA 3M83A 4C89A 1CFJA 1QIHA 4EB0A 2OGTA 1Q0RA 2BUBA 4F5ZA 3KWFA 1ZIYA 5BV7A 4HXGA 3HACA 3DOHA 1Q84A 3D2AA 1JMKC 4Y2JA 4YASA 4B9EA 2OCIA 3V1MA 1ODSA 1MO2A 2QZPA 3AILA 2JGKA 4QLAA 5AOCA 3IBTA 2HU5A 1MX1A 2CBGA 4BDSA 5H3HA 2HADA 1AKNA 5ALMA 1BN6A 1DQZA 4O08A 4BRSA 5AI4A 2J3DA 4G4IA 4HVTA 4B80A 2GZSA 1UOPA 2B61A 1E5TA 3PICA 4MEAA 1N5RA 1GGVA 3IA2A 1XRLA 3JYHA 3I2FA 3EQ7A 5KWIA 2JGEA 2B4KA 1GZ7A 2WIGA 1UKAA 3I2GA 5ALDA 1XRRA 3R3YA 1LZLA 3WLAA 1ZJ4A 1XRQA 2BGNA 3MUNA 3M3DA 4XWGA 4DMKA 1A88A 1CUFA 1IZ8A 1BROA 5ALSA 5HKBA 1H2ZA 1VXRA 5K3CA 4AN0A 1AZWA 1CUGA 2XI4A 2VF2A 5CW2A 2FX5A 3DOIA 2QJRA 2VEOA 4U2GA 2XUOA 2XUDA 3V1KA 4IH1A 2W6CX 4DSAA 3UUEA 2JIDA 3NUZA 2RGUA 3F97A 5DNVA 1IMJA 4WY5A 2XLBA 4BP9A 3I6ZA 1XQXA 3NGMA 2UZ0A 5ALJA 3H18A 1L7AA 1QIIA 4OCZA 1WB5A 3BIWA 2R8BA 4YK7A 1DX6A 1CUVA 4W1RA 5DYWA 1GXSA 5FPQA 4KAJA 1CUBA 5E4JA 4W9RA 4GWLA 5JASA 1TRHA 4J0GA 3FYUC 3N0TA 4DTCA 1EVEA 1T4MA 2WFMA 4F60A 3WYDA 4H18A 4I3FA 1F0PA 5JAPA 1DT5A 3PFBA 4UHEA 3V1NA 2C5GA 3QPCA 3AIKA 1BE0A 1XRPA 4BVLA 2QOEA 4ARAA 1THGA 5JD6A 3FYUA 1JJIA 1CUXA 1DTEA 5HZGA 2HA7A 4UBLA 4DM7A 1XZCA 2HFKA 2PSDA 4M0FA 3WKAA 4PQEA 3FOBA 4E46A 1YSCA 4PSCA 2HA6A 1GPKA 2WU4A 3ANTA 3H2IA 5J3JA 4W63A 1E89A 1MT3A 3ZLUA 4ITVA 4UBMA 1ACLA 1PJAA 1H22A 1QZ3A 1XQYA 3V48A 1EDBA 3WWPA 3WKDA 5JD4A 1HDEA 3A6ZA 1IZ7A 4CG3A 4B6GA 1HKHA 5CTAA 4XVCA 1CUHA 4X91A 1CUWA 1DWPA 4H7IA 5ALZA 3G0IA 4FLEA 1R9NA 2AJBA 3C5VA 2OXEA 4Y9SA 3G9TA 4LKOA 2YYSA 5IKXA 3RARA 4B82A 1WHTA 1IUOA 5K3FB 2WUGA 5KREA 3STTA 1CUDA 1XRMA 4L72A 1QIFA 1VKHA 3WKBA 4NMWA 4BTLA 2XUIA 1YB7A 3KDAA 1XZAA 5A6VA 4KE8A 3I2IA 4X6XA 4RPCA 4J3JA 4XX1A 4AN1A 2WSLA 1W6RA 2V9ZA 1VE7A 5AP9A 1XLVA 2BUCA 1B6GA 2ZVDA 3FVTA 5F4ZA 4U2CA 1G66A 4OU5A 2XT0A 5AKKA 3HABA 1LZKA 1GPNA 3G9ZA 1E8DA 3BIXA 4Q3LA 4FBMA 4QDTA 5HKAA 4K6GA 1MU0A 1C7JA 3C6ZA 3F98A 4XJVA 3G0CA 4B7ZA 4U2EA 4GDMA 2J4CA 2CB9A 3WL7A 3AFIA 1MPXA 5CXXA 3STWA 1W4LA 3T4UA 3HEAA 3NWOA 4ZV9A 4FMPA 4H7DA 3HRHA 3FLAA 5AOAA 2FJPA 5CRIA 1G4HA 5JYCA 2PUJA 5C7YA 3OM8A 4M0MA 1QIEA 3FVRA 1XQVA 5A7GA 3AUKA 1WHSA 4K6HA 3YASA 1OCEA 4LHEA 3R3VA 2RIPA 3WA7A 5ALRA 2OGSA 1EDEA 4IO0A 5LZ4A 2O2HA 4KAAA 4Q3KA 3EQ8A 1HL7A 3STVA 4H7EA 3PF8A 3H04A 4FTWA 5AHXA 1AGYA 2HA0A 5AH0A 2QMQA 4FWBA 5A7FA 1HBJA 4YPVA 4AX4A 1DINA 2PSJA 5CH5A 1MX9A 5T4FA 5CT8A 1J06A 2XMCA 1TCAA 1ZI9A 2Z3WA 5AI6A 2HA2A 5AKEA 3PUHA 3AZQA 4L3WA 1UKBA 1C4XA 5FUMA 3C6XA 4UBNA 5AI8A 3N2ZB 3QVMA 3S8YA 3E3AA 4Y7DA 1AURA 5DYYA 2HU7A 3ESCA 2VJAA 4G8DA 1ETHA 1K5PA 2WHRA 2JGIA 4KEAA 1QLWA 4INZA 3WK4A 3A2NA 2C5FA 2JEYA 2X8BA 3BF7A 1ZOIA 4KE7A 1CEXA 2VJDA 1E3QA 3C43A 1EXWA 1YAHA 2GBGA 4CCYB 1AQLA 2XQFA 4S0XA 4Y2UA 4C4ZA 5ALWA 3C6YA 3T52A 4OSEA 2OAGA 1EH5A 5KBYA 2HL6A 5K3AA 4BZZA 3TGLA 5D3ZA 5LYYA 1UK7A 1FFAA 3WWCA 4FHZA 1MAAA 4A23A 4Y2TA 3HSSA 5AM4A 1FJ2A 3LCRA 4OUKX 1JKMA 3P2MA 4X00A 4EHBA 1ZD3A 3HJUA 4BAZA 4HRYA 3U0VA 5AKIA 3WMRA 2OCLA 3WKEA 3BWXA 2PL5A 4H0CA 1BS9A 3BXPA 5ALGA 3PE6A 5EHXA 3PDCA 4L9AA 2CEKA 3HC7A 4N5HX 1SCKA 1EINA 1UK8A 4JUIA 4EY8A 1ZD2P 5JAOA 1QIGA 3AIMA 5JANA 1LPOA 5AKYA 2VAVA 2C7BA 2DQZA 2NW6A 5LZ7A 4U2BA 1TK3A 2RHTA 4G4JA 3AIOA 6YASA 2LIPA 1CUJA 4W1SA 3ICWA 2HA5A 4GXNA 2WHPB 1R50A 1X2EA 4AQDA 3DLTA 2ES4A 5K5EA 2WJ6A 5JZ9A 2RI6A 5ALXA 5DNUA 3TRDA 4RE6A 1GKKA 4OB6A 4FDMA 3WL6A 4C4XA 3QITA 5ALOA 3IULA 2JGMA 1FFCA 4OB8A 3I2HA 3MVEA 4BVJA 1RYYA 1YA4A 1O6FA 1GT6A 1VA5A 3R41A 3WK7A 2WQZA 3OURA 5C8XA 4J0IA 5A2GA 2QUAA 1CUSA 4BE9A 3W04A 3VDXA 4TGLA 1KU0A 4J0JA 4LXHA 4X3CA 2O2IA 3H1BA 1UOOA 2I78A 5CMLA 3ESBA 4K2AA 4QNNA 4LYEA 5HF8A 1YCDA 1OILA 3L1IA 5JZBA 2DQYA 5EIAA 1VOTA 2J4FA 3AINA 2FUKA 5C8VA 5AM0A 1LBSA 3FWHA 2RAUA 3I6MA 4LYDA 1CPYA 1CUEA 1BCSA 1DX4A 1CVLA 2VAXA 4EBBA 5CT6A 4MEBA 4PSDA 4P08A 2WUFA 1EHYA 1K8QA 5JIBA 1XRNA 4Q82A 1QFSA 3WYNA 2XUHA 2QT9A 4UPDA 3B12A 3IUQA 3BF8A 1UWCA 5CT5A 1JI3A 1MNQA 1LPMA 4XIIA 2OGZA 4C87A 2YXPX 3O95A 4GBGA 1K63A 1QOZA 4UBKA 3DKKA 4N8EA 2QKYA 2QUBA 2ZSHA 4AXBA 4B0PA 2ECFA 1TAHA 4G9EA 4MQMA 3F67A 4B9AA 1YA8A 1MNAA 3STUA 3FCYA 5DYTA 1P0MA 1EI9A 3PI6A 4QLOA 4ZXFA 4B83A 3DL4A 3ICVA 3I2JA 4KYVA 1IVYA 5AK3A 4CFSA 4I4CA 1MTZA 3MGAA 2V96A 3R40A 5IVIA 2ZJ6A 2DHEA 1J2EA 3EIOA 4LXGA 2PUHA 5FLKA 3H2HA 3FLEA 1TCCA 3QZUA 4TVKA 4FFWA 2HRRA 4FLMA 3OTQA 3V1LA 2WFLB 4WFIA 4BAUA 1ZI6A 4CIAA 4MQLA 1IUPA 3ANSA 3PFCA 3L1JA 2XMRA 3L1HA 5LP1A 1UK6A 1G5FA 3QPDA 3SK0A 2XQKA 1O6GA 1F6WA 4G8BA 3KSRA 4A5SA 4Y2SA 1VLQA 3R3ZA 1LLFA 3H0CA 2BFNA 1LNSA 1YS1X 1CIJA 4LXIA 3K9BA 1WB4A 4MJ3A 5SYNA 3Q0TA 2DSNA 5HF9A 4NZZA 1U4NA 4ZREA 2WIKA 4AZ0A 4J7AA 1SCIA 4HAIA 5JADA 4BCCA 4OYLA 2ZYIA 3H2KA 3D2CA 1FFDA 1LPAB 5AM1A 4QZVA 4EUSA 3FAKA 4K5QA 4B0OA 1VXOA 3IIIA 3GA7A 2H7CA 3O4HA 2BUAA 2BKLA 3A2LA 4P92A 1YASA 2AJDA 3OG9A 4U2DA 4RE5A 1W76A 4Q05A 4KRYA 3R3XA 1L7RA 3DDUA 4PW0A 3FNBA 4QWWA 5ALPA 3C6BA 1CV2A 4CG1A 2XUJA 1XZIA 2VATA 1VZ2A 4GW3A 3QMVA 2I3DA 2WTNA 2WU3A 5FV4A 1T2NA 4HS9A 5HQ3A 1XZBA 5AM2A 4Y2QA 4KE9A 2XUQA 2Z5GA 1H2YA 4UUQA 3QPAA 2Y1KA 2HA3A 5DNWA 3CXUA 3W2TA 2QS9A 2XUKA 2RONA 3ZPXA 3OPMA 2WKWA 4X85A 5AKXA 1Y7HA 2BCEA 1S8OA 4Q34A 1UT6A 2VT6A 3C45A 5A62A 2WFZA 3H1AA 1XZLA 1F0NA 2X5XA 4UHDA 1AMNA 1ZICA 4KACA 3GROA 3H2GA 3WWDA 3GZJA 1W52X 2JF0A 3TJMA 3FBWA 1UOQA 2XMQA 3IVMA 5E2IA 2H7YA 2EEPA 2OG1A 3HZOA 3R3UA 2PSEA 3R3WA 5HFNA 1VJ5A 5FP0A 2FJ0A 4KAFA 4BATA 2AJLI 2O7RA 2HM7A 4J0DA 4X97A 3RLIA 2OAEA 1Z68A 1X70A 4DIUA 4QA9A 1UFOA 3CN7A 4PV7A 4CCYA 3IDAA 4UBIA 2DHDA 4X94A 2VJCA 1LPSA 4DMFA 2Y6UA 1TIBA 1YR2A 5K3BA 1QO9A 1MAHA 5BWCA 2P8SA 3WJ1A 2QXUA 2AJCA 4NS4A 4L0CA 1GQSA 5ESRA 2ZYRA 1CUCA 1R1DA 5ALKA 2VTVA 5LZ2A 4CG2A 4BYMA 4ZWNA 3VISA 2C0PA 5FXMA 2WIDA 3G9XA 2XUPA 3QMWA 1ISPA 2CMFA 5CH8A 5BWBA 4UFPA 4F21A 3EBLA 5EHZA 3I6YA 1C7IA 4UFOA 3SC2A 5HK8A 2WLSA 1K4YA 3KD2A 2GBFA 3KWJA 1EDDA 3STYA 1BN7A 3DNMA 4J0CA 1ZGBA 4X90A 5C8ZA 3B3QA 2K2QB 4DNOA 4Y2XA 4TPKA 2H7XA 2PSFA 3QYJA 3FYTA 1FFBA 1LPBB 3WZLA 3ESDA 4FKBA 4E14A 3QMMA
chains in the Genus database with same CATH superfamily
2Q62A 1D2NA 2NP6A 1NP6A 3LL7A 4LC9A 1OFUX 1OJ7A 1FDWA 3O4JA 3QELA 2P30A 3VOTA 5IKPA 1ACJA 5E1MA 1EM8B 4FXOA 3L6BA 3PNOA 4B7CA 2P9JA 3OC6A 5BMOA 1SVUA 2HRQA 2P90A 1Z6YA 3PVCA 2D2FA 4MYCA 1QIJA 4NOJA 9MHTA 2I6QA 3N86A 3VKUA 3O90A 1BYUA 1QC5A 2QB5A 3VQTA 3EEYA 4PX5A 3AFOA 2VF4X 2A0KA 3CLTD 3NRBA 5JC8A 1E2FA 3OJOA 3G0GA 3L2OB 1T0IA 1T9KA 1V5EA 3LZ6A 3OPVA 4GXTA 4KPUB 5LDDC 2WB4A 2LDBA 3SHVA 4JLBA 1T2UA 1VKJA 2QZJA 4AZVA 2Y9PB 2B1IA 5FFMA 1RAAA 2N1MA 1EBUA 2PWYA 1K0FA 1P44A 2BEKA 2GX6A 1UODA 3SF0A 1MPTA 1ADCA 1MABB 2Q46A 1DC6A 1U1GA 3FD8A 3O0DA 1BVHA 1J21A 2FP3A 3V4LA 4QIHA 5FNVA 4MWBA 2AVDA 1J0CA 3BIFA 4RETA 3PQ7A 3OFVA 1R18A 2B6HA 3AU8A 3Q0EA 1ORWA 4JB3A 4BMDA 2WMNB 4AMGA 3E5NA 2CDNA 2Q3FA 4JVNA 1IK6A 4GOKA 2BI7A 1T9ZA 3HM9A 1I9GA 2DGDA 3GNSA 3UWMA 1AKQA 1DIHA 3IR7A 1GCOA 1MOPA 1JQAA 2RGNA 3CVXA 3HY3A 3KLBA 4MCJA 2GEKA 2QRZA 3GJ6A 3AOGA 5AJWA 4CKBB 3GEDA 4HZGA 1Q95A 2JGDB 4D41A 2QRVB 3VX3A 2XMGA 3IPRA 1ZM4A 3LP5A 4C76A 2X2EA 2GOYA 2XHZA 4D74A 2Q28A 4U7HA 3GP3A 2O0JA 1M5TA 3MGKA 1YV9A 4BVGA 5KNCD 2W2PA 1G98A 1IN4A 4MV7A 1CQJA 2AMYA 4F71A 3M0EA 1XJQA 2CVQA 2Q0XA 4G4GA 5FYDA 1WE2A 2QDKA 2WTAA 1G21E 3EFOB 3PKIA 4N47A 1KQGA 1N78A 2G83A 1RYBA 2I67A 2RGEA 3F8SA 3K0HA 4W8OA 1FXWA 2GXUA 1H6CA 1MG0A 2XCLA 4WGFA 1GNPA 4GX1A 5J2TB 1L7NA 5TQVA 1CYEA 1FVFA 1KI1A 2RHDA 1QCYA 1ORVA 4HDNA 4QTZA 1QTIA 5IYZA 1LSSA 2P1RA 1Q0QA 1GU7A 4RH0A 3IR6A 2HYDA 3NP7A 2BY4A 5A3VA 2W90A 2AG1A 4YCMA 2DFPA 4P7JA 3RM3A 4AECA 4LBWA 2CFTA 2H29A 4D96A 1KTVA 3WO1A 4RIGA 4BGEA 4FVTA 3CS3A 1E8NA 5D01A 2AEEA 4FGSA 1T1RA 1YDWA 1X15A 1WG8A 3SZOA 3CRZA 5E2BA 2AIRA 2HOQA 5F4BA 1TF7A 5IULC 1J8FA 1XPJA 4GD3Q 4HWOA 4RGYA 1DTSA 1MQSA 5IBQA 3H4MA 3WGQA 1JBKA 1QG4A 1RI4A 5HZHA 1MGPA 2JCBA 3ZKWB 2D1TA 4WBXC 2YKGA 1EVLA 1QO7A 3U1VA 3GLKA 2NPIA 2OZPA 2JFGA 4IWXA 3TUIC 2UZ4A 1TTPB 2OB2A 5BQ3A 1PTJA 2CLOB 3V4OA 5IJAA 3O4RA 4X24A 1AKMA 5BSRA 3NX4A 2CK3D 4BQNA 4EYGA 2PQ6A 1J0XO 2XOKD 5AIAA 1GAJA 1AF4A 1FXSA 2J45A 3NHPA 4MR8A 3CEHA 4X1KB 3T7AA 3LKZA 5E38A 1M8KA 4AB1A 5IFKA 3LWBA 4A0SA 4HZIA 4RL4A 3O2JA 3RFFA 4AMZA 2JRLA 3ZWVA 4AJEA 2VA9A 3JD3A 4KWIA 4TL7A 3GRZA 2ACKA 2A9QA 3WYAA 1CY4A 4XA8A 1RWMA 5KYVA 1BNCA 1ZK1A 4UAJA 3UUFA 1OWMA 2PHZA 3ZJTA 3KHKA 4YP7A 1ENOA 3RJZA 1DCMA 1RVV1 1UBEA 3FR7A 1WU8A 1O5TA 2IODA 2ANCA 4HX9A 4LYFA 4LSGA 2VPZA 2GAAA 4PHGA 1U8FO 3FTQA 4OK5A 3ZWBA 1D07A 2ZYTX 5E9QA 3NDIA 4L15A 1ZITA 4KWEA 2W43A 4JBHA 1DIOB 3QY0A 4QWMA 5LN1A 1Z4KA 1OKKA 1NI4B 1K6IA 5G02A 2HJVA 3EAGA 4M76B 4BLOA 4XCVA 4TV8F 2JATA 1U9YA 1Y9DA 5AVXA 2R87A 3EPLA 4JJKA 2EERA 4BASA 2C8VA 2QR5A 4L5JA 4IHJF 1NRXA 2IY8A 4XSVA 5LQAA 3F5DA 4JJAA 2DHCA 3Q40A 4NYMQ 1W87A 2AQKA 5JLAA 1X87A 4H7KA 4ZPXA 1U2GC 3MWEA 5CA0F 3RRXA 5EUMA 1WCIA 3NT2A 4LUCA 4INJA 5JSKA 4IRXA 3SP1A 3ZQUA 4NC9A 4OB7A 3LX5A 2FPKA 5DHSA 3FNRA 1OZFA 4IZHA 3U7JA 3D0OA 2AVNA 1N1EA 1Y6ZA 2GZHA 3A58B 2UUOA 3EYAA 3OZTA 1E62A 1XTSA 4XQ9A 1UZAA 1VKNA 2FPSA 3O83A 3L7NA 1IB0A 1NU8A 3IV7A 3FBTA 4MINA 1F9AA 2R25B 5KYKA 1BFUA 2WWHA 3NHJA 4UVHA 3MOIA 4YLGA 1IQUA 2RGWA 3HXKA 3WVNA 2EHJA 4H3VA 3RSSA 1OW3B 2WAMA 5H4HA 2GYUA 3FSGD 4FBLA 3L8EA 1UKCA 4D7AA 2PE5A 1KZ7B 1P4SA 4NU5A 4ZU6X 2E82A 2WSIA 2J85A 1KVQA 1SM4A 3WGGA 4DXHA 4GO1A 5IVKA 5JMPA 3O7MA 4H16A 1W75A 2P91A 3G1TA 1CRLA 4BFXA 4Q1VA 3HKCA 3RASA 2BFDB 1OYYA 1RP1A 1KPIA 4LVNA 1XALA 3AEUB 5TY0A 4RD4A 3D6NB 3GQBA 4TTJA 2DULA 4LRYA 3TQSA 1GTG1 2QPLA 3K9GA 3RHFA 5KWJA 4CGZA 1T9AA 1SZJG 2CJPA 4BU1A 4U7WA 2COUA 3ZDCA 2QN8A 2VLBA 3LBIA 2XNDD 1W5SA 1K4MA 1K3TA 4Y2RA 4LWQA 1IWPB 3VBCA 3OC0A 5HM8A 1COWD 1NLUA 4AK9A 1YBVA 2V98A 1NTOA 3B6KA 1NOKA 1PEKE 3JCZA 4QPZA 3QJGA 4X95A 3HKDB 4IIDA 2CLIB 1PP4A 3I9FA 1KAEA 4D26A 4C1NA 3LUBA 1UJ5A 3H0EA 5EHQA 5EMHA 2H1FA 3SCZA 3AJAA 3C5CA 4NX2A 4QAQA 3N74A 1JR2A 3ADPA 3P32A 2P2GA 1V1RA 1L9XA 2Q9CA 2QTAA 2H18A 3MBIA 3QBEA 2V9CA 4KRXA 5GP1A 3TG8A 1NVGA 4L8WB 4BE4A 5JQGF 1IN1A 1OI4A 3JATB 2QTRA 4YJ3A 1PVDA 2V7BA 3ND6A 1J8QA 1A82A 4QGFA 5TMDA 4N5MA 4DMMA 3G9QA 1GO2A 5J4LA 1RR6A 3VVMA 3LP6A 4MGHA 4PR0A 4CKWA 2I2AA 1I36A 3AVQA 2PIDA 4L28A 4RLQA 2IH2A 3QX7A 1RU3A 4L4XA 4WNAA 1YB5A 3OOJA 3L9WA 1TJNA 3VPHA 1FMJA 4JKIA 5I8PA 2D0DA 2CUZA 2VPYA 1R64A 3MIZA 3BEDA 4IUCS 4HRXA 4LY0A 2P3OA 1MV8A 4MWSA 5E9JA 4OP3A 4PZDA 1XJ5A 4PBRA 1U31A 3HBMA 4JEIA 2ZUVA 4JIGA 2DBQA 1NW9B 5DW3A 5ERGB 2BFBA 4FYMA 3AP2A 4BMOB 1YIAA 1PFVA 3JQRA 4JT9A 4QBGB 4MPJA 3MT0A 3BIJA 2A57A 1XEFA 3BHIA 1KMCA 2RGYA 4M1YA 1M1YE 3DE1X 3LZCA 1HX7A 3OT4A 3FFBA 3NBUA 2SNIE 4XJXA 3UV3A 3RV3A 4ENSA 2DPXA 2B4TO 4B6QA 1RWBA 1APBA 3C7AA 2QUKA 1DEAA 5AW1A 3RUHA 4KE6A 1KARA 3ESXA 1L8LA 4EKYA 3AUYA 1AB5A 4F4UA 1XYYA 2E4WA 1NULA 2Z4SA 4YAKA 1GYQA 1TA0A 4HWGA 2P2ZA 5BR4A 3FVVA 5KQRA 1YOVB 1YCFA 2ZUDA 3H5OA 4HGNA 4U9IS 1TB4A 4ZGBA 1L5LA 4AC9A 1LW6E 4DLZA 1D4AA 1T2EA 1CDEA 4PC2A 5J1SB 3Q88A 4H1UA 4WV3A 3UMFA 1SVLA 3LLCA 5EXDA 3SX4A 5FI5A 1QKKA 2MOKA 1G8MA 3ROKA 1XKXA 1NQVA 5FAKA 4BO5A 2YJ5A 1U0GA 1DQRA 1T9CA 1WRBA 1WTCA 2MSEB 1GQOA 2VAWA 4NATA 5DVZA 3R7DA 4CI9A 4M21A 4M46A 2Q2QA 3DE4X 1NUQA 5HIJA 5J40A 5CUQA 3EA5A 4IPTA 3DO5A 1I6WA 1PJ2A 1KYTA 1V9SA 3Q9NA 1PJQA 1AC5A 2G82A 4M0CA 4F0JA 4BZPA 1SUWA 2HFJA 1CXZA 4UM7A 1JN0A 3STHA 4ZICA 4ZN6A 1KEVA 1PS0A 5CYGA 2XA9A 1XYVA 3MUEA 3UAYA 3E70C 4NPHA 4EJSB 5E4FA 4ZYLA 2CV0A 2Q7OE 2Q9BA 3WGIA 3N05A 4BVBA 1FJXA 1ZZEA 1CQPA 1GFZA 2XMSA 5REQA 1A69A 2B2XA 4X61A 4WJLA 4EX6A 4NOMA 1ZXLA 4PG5A 1I4EB 2BTQA 1QGAA 2PL1A 3OIWA 1DG1G 3ZEAA 2FUG6 4FLFA 3GLTA 4B7UA 1B15A 2PX5A 4QUHA 4X8HA 4BZXA 3TR5A 1QV6A 1DWUA 3WRXA 1Q7CA 4M7WA 2OZKA 3EXEA 3KOOA 1PK8A 2NV6A 4AU1A 4JBGA 3H05A 2R1VA 5CGZA 3AEKB 3EF0A 3VR5A 4RTRA 2IPAB 3W9UA 2HRZA 4DAEA 1VPDA 1EUYA 1VJRA 4B3MB 3ZK7A 1PZEA 2JFUA 2OHOA 1QV9A 5DNEA 3VX4A 4E5KA 4RSGA 2D1SA 2F8TA 2IE0A 4UM8B 3LPNA 1P4RA 3M1IA 4QT0A 1QTNA 3PKJA 4HGYA 3LV8A 5AM5A 4UU7A 1JSCA 3ETDA 2VXOA 4EY5A 3GLFB 4FOOA 3THSA 4AKSA 2ONCA 3PZBA 3FM9A 3CBGA 3IIEA 2NSJA 2Z2KA 5ALIA 4Y0VA 5BNWA 2DHQA 4HDKB 4UHFA 2JLZA 4TROA 5L7YA 3LQ1A 2YWDA 1RQRA 1WVIA 3NFYA 4QJ4A 4QU9A 2XWQA 2PL3A 1JHXA 1VPVA 2R00C 3OOHA 3TS1A 3ZV4A 2MTBA 5T67A 3HHPA 3L49A 2I7XA 3CLRD 1KK0A 2XXJA 4FDUA 1AKRA 1PBNA 4MJLA 4D79A 2FCRA 2A1IA 4HX5A 3EGVA 5ABPA 1KXZA 1QV7A 2ZBVA 1K97A 3CZ9A 3AUSA 4U8HA 1XV5A 2ZCUA 4N6GA 2ANBA 2YC2C 3ZHQA 1JEYB 5I7AA 3MTIA 4NG5A 5T4EA 4NENA 4UU0A 1GVNB 4N82A 1JEJA 2OHGA 3BGSA 4CCSA 5IM4A 2ENWA 3C8ZA 1WP9A 3DUWA 1Z5ZA 1UEIA 3EWIA 3JWGA 1MJ5A 3T7RA 2QBYA 1MB9A 5L7WA 1D2AA 4RV5A 3LHKA 1E1DA 4QJIA 2TRSB 4IJVA 3ENZA 2PFGA 5KTKA 1XCPA 3MCVA 1B23P 1JIQA 1AA9A 4BLUA 1OLOA 3OZGA 3EZXA 5EFOA 4ZHQB 2PS0A 3GQBB 3BMCB 1U2PA 1X7GA 3FVWA 4UVEA 3PVZA 4PAGA 1IBMB 3EDQA 2IOFK 1YI8A 2G5CA 1E2HA 1JXAA 3UMJA 3STXA 5ICCA 2ZYDA 5AVVA 1Q22A 2VUSA 4Q03A 1NNI1 5CNKA 4MLPA 1SVNA 3K9QO 4ISBA 4N0QA 3VTZA 2D5LA 1WEKA 4DLRA 1VA4A 3ZD8A 1M0WA 4HJXA 1I7LA 5ESDA 2VJLA 3CEAA 4U6SA 3C3CA 5FPKA 2H1WA 5EJFA 3ZE7A 1UPAA 2YOGA 3NBZC 5C5DA 3LIIA 1I3NA 3D6UA 1P9OA 2ZZMA 2FYTA 2W6JD 4FGWA 2PWAA 4H77A 2IHBA 1IEWA 1L7QA 1P61B 1M1XB 2Z6QA 2A5DA 2VRBA 6NULA 2NYRA 3M6FA 3QOFA 4BX2A 4TWRA 3VPSA 3ETLA 1XLWA 2PX6A 2W48A 4HVAA 1O9BA 4MRMB 4WDRA 5BQ5A 2FLVA 5FTJA 5BSUA 5JALA 3LDHA 4B48A 1GHTA 2GUWA 2HBQA 5AQEA 2JVIA 2XUGA 4HSEA 2BE7A 3PC6A 3K30A 2C3UA 4NBRA 1BS2A 1FFEA 2FB9A 3M2PA 4OAPA 2GPWA 2VDWB 3VYUB 1KP2A 2ZKLA 3N6RA 1V7ZA 4UNSA 4CR6A 3NBMA 4N7MA 1RDFA 3MUOA 3TLMA 3JQBC 3G8YA 4OM8A 4IJMA 4RIIA 3LPAA 3HXPA 1SC1A 2ZAYA 4RANA 2HK6A 5F64A 3C5WP 5B6JA 4B87A 2C00A 2HMYB 4JN6B 2EFHB 2IHKA 2QZ4A 1QDEA 4DLBA 4X1IA 3GEMA 1E1NA 4MKIA 5GMOA 5J47A 1T5IA 1OB5A 4BTEA 2CXXA 4C30A 3NKFA 2BM9A 5K3EA 1P6UA 1J0AA 3OZEA 2AJTA 1KS2A 1GUBA 2HWYA 3GGCA 4R51A 4TQUS 3D3WB 4DWOA 3RIHA 4NAVA 1KEKA 4BMXA 1CLUA 1D4OA 3PZRA 4MW5A 5T4HA 3UGQA 5JXWA 1E1YA 3PPXA 4XM0A 1MJNA 1PK7A 1CY6A 2C92A 3I9MA 4TT8A 3UWOA 2HBYA 2XA1A 3WO0A 8MHTA 2BBSA 3B89A 3CYFA 2DR0A 3HLKA 2E18A 2IQ5A 3CCFA 3IURA 3M1AA 4X84A 4L6AA 3TDMA 3V7YA 4GAEA 3JTEA 4NOLA 5F7OA 4B3RB 1ESZA 5DEIA 3ZIUA 4DWJA 2PZMA 1AQYA 4BVKA 2W6ZA 5JBIA 2FQXA 3DOUA 2H3HA 3CRRA 4IJUA 4Z4GA 3ZHTA 2WJPA 4P3XA 2JGLA 3F7NA 4N0DA 1XXHE 2PBRA 3FGNA 4OYYA 4YJHB 1KMHA 1QF7A 3JASB 5GJBA 4CEIB 4DDUA 3D7KA 2AE1A 2ODWA 3H6GA 3WWOA 1ECCA 3IO3A 4FFVA 4ODIA 1A9ZA 2NZ8A 2WK1A 3IDQA 1VIYA 4ML3A 1T5HX 5I8ZA 5B6PA 1H0HA 4KFTA 2B98A 1DIBA 3ADKA 1BA3A 4E5DA 3EG5A 2D0IA 4L7QA 1M8FA 1PGPA 3F8TA 3NU1A 4TS9A 4ARSA 2I4MA 2WM8A 1ZJ6A 3DLCA 4IH4A 3C48A 3ZWQA 4U3JB 2IHZA 3KQTA 1N2IA 1BGVA 3CX3A 3TTVA 1T1JA 4LJKA 3TSOA 3ZE8A 1TEHA 2IYXA 3F96A 3HRKA 3AXSA 3IH5A 4L9WA 1KU6A 2XX3A 2ECKA 4PQFA 4PXYA 1B41A 3TVTA 1UT5A 3T7KA 3UJ3X 3BREA 2ZS8A 3F4KA 2YIDA 1IUKA 3DQQA 2G04A 3TSAA 2AV6A 1ISIA 3GGPA 4NE2A 3RIMA 4G56A 4LNHA 4E07A 2QN9A 2WV7A 2WWFA 1Y8QA 3H16A 3UT0A 4H1TA 1UMKA 2IHYA 2OO7A 2ZIWB 3W6UA 3Q98A 2GD1O 2QN2A 3GLSA 2X0RA 3ZX4A 1ZKDA 5IUJC 1JP7A 4KGVA 4N0EA 4CMBA 1UBUS 2N9UA 4HLUA 4K7JA 3DS8A 4LX0A 2XBUA 2R2AA 1BDJA 2EGGA 2GYWA 1M34E 4O4JB 4PYJA 1RI3A 1SVOA 1MG5A 2WI8A 1CUAA 2J3JA 2J6BA 4PN7A 4IP0A 1ZRSA 3C87A 3R9KA 1I10A 4GM1A 3TDKA 1FQKA 1DBWA 3DMTC 1MT0A 3N58A 2QX6A 2CF6A 4ZVSA 2ONZA 3IAUA 4QPJC 3PA6A 4ASUD 4P93A 1N2CB 1OI7A 4EAAA 4IQFA 1DFHA 2FG5A 4LXUA 4MMZB 2J9ZB 5A3JA 1YH3A 1FSGA 1XAHA 1BFKA 1JZSA 2VHZA 4HQNA 5DHRA 5I9LA 1HNWB 2R1TA 1OGYA 1YBFA 2WU0A 3R6LA 2RG1A 5ARBA 1H5NA 1DRUA 3EXHB 3PGMA 1U8UA 3A37A 2PX0A 2VJBA 4ZI5A 3RVDA 3X1DA 1GRVA 2IXBA 1FE8A 1WEHA 5DGIA 2QLMA 3FRHA 3PGA1 2JGNA 5FBHA 3MSCA 1TYCA 5SYMA 1B0AA 2IYPA 1CTQA 4JH0A 4MUXA 1C8LA 1EKXA 2R8ZA 1G8JA 2O1SA 1I4DD 3USCS 2PTHA 3E9DA 2G67A 3GMSA 2CKMA 2Z8XA 2Q1TA 2P2DA 3JWJA 4GE0A 4HGZA 1PF7E 2QY6A 3IJEB 1VE5A 3CVJA 4QDUA 4P9NA 4GXQA 1YZUA 4Z4CA 1GITA 4UDXX 2QYHA 5B4TA 1JHOA 5BUZA 3HN7A 4FEEA 4LQDA 5B58T 5TGTA 5AW8A 1JT2A 5LZ8A 2AI1A 5ARDA 5BV2P 5I4BA 1USVA 3G9UA 4HNVA 1W94A 3LTEA 2OZEA 3UW3A 3EVEA 5C4IA 1EFDN 3COWA 4NF2A 5EXEA 2RMKA 4DA4A 5DLQC 4RA9A 3FPJA 1MEOA 1VL5A 4NENB 4QYIB 4W5RA 5ILGA 1FS5A 1DSSG 4E4RA 2WNIA 3BDIA 4NJOA 4FIDA 1J33A 4F04A 1J42A 2IE8A 2EKDA 4FPXA 4YDHB 5JAHA 1ZJ5A 4AJPA 4TMXA 1YE3A 3N7AA 4LQ4A 4BC0A 3WLLA 3N0WA 5C1OA 3I8XA 4X20B 4PLPA 4PTLA 5T41A 1RE1A 5CVVA 1A9SA 1O4VA 2J4DA 3R5HA 3OM1A 2VS1A 1HT0A 2CUKA 2W2KB 2J5BA 1OZGA 2C58A 1HLGA 3KUUA 2I1WA 3H2BA 1AHHA 3DDZX 4HMQA 1CFZA 4K6OA 2VOJA 4QECA 1F8UA 5KHAA 4AG3A 1R6DA 2J6IA 5E0OA 5LU8A 3HGMA 1J25A 3Q8WA 5HK9A 2V59A 2IU3A 2Z8ZA 1NVDA 3KJHA 4ZU1X 4TZ6A 3KQWA 3L1VA 4A27A 3F78A 1NJ2A 2WG1A 5BN4A 2VSQA 1VL8A 5DM0A 1P18A 3LVQE 2HV8A 4I6EA 4UEJA 2G07A 1A8UA 1KGDA 1NG1A 3N2KB 3B48A 4YLEA 3C41J 1P9LA 2ODEA 2REOA 4DNQA 1WSBA 1E4EA 1WUYA 1B2RA 2MR5A 4FKZA 5SYAA 3IT2A 3OIGA 5ALUA 2ZK7A 3PJGA 1TM1E 3U7QB 3IGFA 2PKWA 3E2PA 4DLLA 2H9YA 4KFSA 4CV1A 2RH9B 4QUGA 3VU9A 5ITWA 1JX6A 2QU7A 1U9IC 1A96A 5F7JA 2DBYA 4QO7A 3FIJA 2CLFB 3BD8A 2DBRA 1EX9A 2X1LA 3LX4A 4PLFA 4ZCRA 1TK2A 3VNVA 1RJFA 4U7DA 3P7MA 3KQHA 4E5YA 2PM8A 3H2SA 4LPKA 4GPD1 1IXRC 2Q5FA 1Z08A 3IS3A 3VMFA 4Y9UA 2NUAA 3EXIA 4FN5A 4PO1A 1PZHA 1VI6A 3WR5A 4EY6A 3TRJA 5JO9A 4QTTB 3FMVA 2FSVC 3LLMA 3IUMA 4RY0A 3UAVA 2D2EA 4JBNA 1F4LA 1YB6A 2Q4OA 2EX1A 3Q72A 3HADA 1AS0A 1SH7A 4A8JA 5DJ5A 1BGXT 3CLKA 3NWBA 4GMHA 3U19A 3IEPA 2R3SA 3TECE 5KJ1A 1KPGA 2YTZA 1Q3TA 2LWIA 1GUDA 2P9CA 1SA0B 3S2UA 3WIEA 2WD8A 4PANA 3VZBA 1GN9A 4DIBA 1TEXA 4X1YB 2Z6VA 4PQGA 1N9ZA 1XEXB 2WJYA 1J99A 4KQ9A 2PNFA 4F4CA 3I5UA 3ASUA 3HB9A 1E6CA 3HSYA 5ITVA 4V39A 1FOEB 3HE3A 5DNYB 3HBLA 1FMCA 2AN1A 2ZB4A 4ZAYA 1K5GA 2ODPA 4YRQA 2FJUA 1PDWA 1PIWA 4LMPA 2B7CA 1EWKA 1TGVA 1P6QA 3DGFC 2JI7A 3DLAA 5F2NA 2PX3A 1C3OB 1U5BA 1SEVA 3D81A 2P3QA 3K1AA 5KB3A 2BZSA 1GVHA 4KQFA 5EZ6B 1X94A 4M88A 1J0EA 3U3OA 4G5SA 3GVHA 4HN4B 2BTQB 1ZCFA 4ZVPA 5JNTA 2W8ZA 4AUKA 3NHBA 4B74A 3A1CA 4G1BA 2RHGB 3WIDA 4B3TB 4BXOB 4HDNB 1GILA 3ZJUA 1ID8A 2GPYA 2SCUA 1TECE 3K2IA 4S2UA 4JODA 3EMKA 1P1JA 4MP6A 4TS4A 4CMGA 3Q3GE 2CL7X 2LIVA 4PG4A 2WUDA 2OVFA 1XKTA 4AIRA 3PUKA 3OP1A 4YMHA 5BPHA 5BW8A 1FU8A 3FKJA 3LC1O 3RUFA 5JTTA 1RRFA 1BG6A 2ZTLA 1E79A 4QDXA 4ZT3A 5KQSA 1XPRA 2DFNA 3D8SA 4IHAA 3Q6IA 4Y0AA 3W06A 3OU7A 4LV6A 1HXHA 2O1XA 3FLBA 5CURA 4YAJA 5TB5A 4BCDA 3OZWA 4UQLA 3FR8A 4C0WA 4GNKA 1OXUA 1SU8A 1VRWA 2Z5LA 5EHNA 4DMCA 2XRZA 3H11A 1Y1SA 4X6YA 3VR0A 2Q1SA 2GZRA 4M2LA 3RT7A 3PHCA 4RTOA 4L85A 3G5AA 3ROEA 3P9YA 4REMA 4RMNA 5LNK6 3DLHA 2OQVA 3EW7A 5EJ9A 4NKRA 3T9EA 4L2IB 3KQVA 3D2BA 1BSVA 1E7QA 2FOXA 3V33A 3GELA 3WQSB 4EW6A 3GFPA 3LL4A 1FYWA 1LBIA 3KT0A 4A15A 3AM3A 2ZUWA 1A97A 1DV1A 2DPHA 2OBNA 3AEKA 5YASA 2JANA 2JB9A 3L0BA 3P9XA 1HPLA 4ZI2A 3GLHE 3SF8B 1F8YA 2HQSA 2YHSA 3L7MA 4TXMA 2IW3A 2J0SA 2ZR8A 3M5DA 2XMBA 1Z5UA 4AUNA 2G72A 3DKIA 3IBSA 2CZQA 2VNKA 4MVXA 4GYKA 1JPNA 1IVSA 1SUSA 1XMQB 1PV4A 2UYGA 3ZV3A 2Q7DA 1ZH0A 2II6A 4MWGA 5F1KA 2G63A 2JBWA 4UMFA 1J2YA 2G9UA 4YIKA 3BSYA 1F38A 2OXRA 1VKOA 2RHRA 3AHIA 3DNPA 4OXRA 4OQ4A 4UAGA 5CNIA 4YRRA 4PNHA 3JW8A 1P29A 2WZDA 3CWQA 2YXNA 2J9FB 3OLVA 1NRWA 1H4QA 2IEBA 2PNJA 4GI3A 4MR9A 1I8TA 1EYZA 2B37A 4O4LB 2P2YA 3W3AH 3BTOA 3IFSA 3V4RA 5G0SA 4KH0A 4L6CA 2CLSA 4WIAA 5COQA 3M82A 4PZEA 4CIXA 5A6SA 2XZOA 1M6VA 1D8AA 4LDQA 3SQOA 1FF9A 2IWRA 2P6OA 3KB8A 3M89A 3MHPA 2D0OB 3NASA 3ODGA 2G88A 1YFZA 4HNHA 4AUMA 5FI3A 3UXYA 3D43A 4ZP1A 2PUCA 4CTMA 2C31A 4B4KA 4AKHA 4OXYA 4BPRA 2HBZA 2P6UA 2J8ZA 3H5WA 5J4YA 2PL9A 4DJAA 1E32A 1T2VA 2REQB 5LOVB 4FHCA 3KSAC 3CKYA 2ZU0C 1NIPA 5C8YF 1A9RA 1Q0RA 1XG5A 3JQ9A 4OAQA 4LGMA 2O5RA 1ZIYA 3HO8A 1BMFA 3UK6A 1N5IA 1UWVA 1EZ1A 1WIWA 2J7PA 4IKPA 4KUEA 5IG2A 2BGTA 3I9KA 1QOQB 4Q7MB 1W48A 1FRNA 4YJ3F 3S7TA 5CLFA 1Q84A 3TR6A 1XYGA 3UJ9A 1JMKC 4MHOA 2OY0A 1NJ8A 3GI1A 1WKVA 5EERA 4IX9A 2O8DA 2G8NA 3V1MA 3ER6A 4FQ8A 3T6KA 2GRUA 1H1LA 2Y1WA 4TMKA 2BEVA 3T3GA 4CMKA 3B1FA 3MD0A 1PV2A 2Q1XA 4WVLA 4ZTZB 2I6XA 3JALA 3W5CA 4JL5A 2IT1A 4WNYA 3JQBA 3AILA 5E8JA 1PWZA 1Y9JA 2WAOA 2JGKA 4BLVA 4DREA 5IP5A 1OBFO 3MWGA 4FMDF 4G1VA 4F6CA 2CVPA 3IBTA 2RAVA 4M1ZA 4ITRC 1KFEB 4B6RA 2AMFA 4FX2A 1CE8A 2YV2A 5KWVA 3OUTA 1FDVA 4LKRA 4IIVA 4ZOBA 2CBGA 4YO7A 4N3BA 5EGSA 3PDHA 1N25A 3E3LA 3UVEA 4R84A 4QXMA 4LVOA 4OAOA 4RMJA 1K6MA 1WHTB 1XWIA 1G3UA 2ODNA 3LYLA 4EPTA 2GZ1A 1IHPA 3B38A 3LXUX 1BXZA 4CLDA 1M83A 2VJKA 2NO5A 4ZGGA 3KT8A 1BN6A 1DQZA 2CNLA 3ECSA 1KPHA 4BRSA 1ODLA 1TLTA 4J2OA 4EVQA 2R48A 3P9NA 3TLKA 1FIUA 4Z7NB 4NBNA 1B2LA 4YYZA 3A04A 2BMFA 3EGOA 2NU7B 4UNRA 5BYKA 5C80A 2XGJA 4LYYA 1E5TA 5H1YA 2PEZA 3AJDA 3SJ7A 5EVCA 5HBGA 1BHSA 3PR3A 4MDYA 4KSCA 5FF9A 4CM1A 1WVGA 2IU4A 1S1CA 3LGAA 1NW3A 2EATA 3OA2A 5KNBD 4JIMA 2BL4A 3THYA 3JYHA 1WETA 4RA6A 3GG9A 5AMXA 3I2FA 4OYHA 3VC2A 4M9QA 3EQ7A 5KWIA 2QT0A 2PUBA 2IQIA 4ZOQI 5IT5A 1YBAA 4EMSA 1YA6A 5A5DA 1ONNA 2B4KA 5IW8A 1WD7A 3ENVA 4LOIA 3NV9A 2CNWD 4Q9JA 3CH5A 3N3AC 2Q4TA 2WIGA 1PX0A 5AJTA 2WAXA 3RSLA 2WE8A 4DDWA 1Z16A 1P60A 4EPYA 1KC3A 5ALDA 1XRRA 1V2HE 1MC1A 3HCFA 4FEYA 1J8MF 4ZQBA 3WLAA 5EWJB 5ITZA 4YR7A 2VXCA 1RXWA 3ONNA 3OPXA 1TVKB 3SM3A 1LLQA 5KI6A 4DADA 3SEQA 2VYND 4HDOB 4I5GA 2P41A 5BSMA 4LF6B 2ZJ2A 1WXDA 1H2ZA 3EVZA 1X7YB 2R6ZA 4N39A 4ED9A 2FGJA 2QJFA 4M8NE 2RB5A 3K15A 3NAQA 5LJIA 1KDZA 4D44A 2XKBA 2CV1A 1CUGA 4ZMRA 1KZGB 4DLWA 2XI4A 4AM8A 2VF2A 4UASA 1U7XA 4L95C 1LRJA 3AFNA 4YO8A 3K0CC 1Y1TA 5H02A 2NIPA 4IL5A 3TNLA 3QGMA 5DW0A 1GPMA 1L7PA 4IMJB 3DOIA 1PKXA 3PQEA 3PWKA 2O2ZA 3UK0A 3WGNA 5TS2A 1OXTA 1JS1X 3RTAA 4CL3A 4XWWA 1IN5A 2QJRA 3E9YA 3IDOA 1GNLA 1MRNA 1MIHA 4YCCA 5EJ6A 1MP0A 2J3EA 2O1WA 1I80A 3W8FA 2AD1A 5BN3A 4HOYA 1BFDA 2DLDA 2WWGA 3A31A 2W6CX 3BQNB 3KZXA 3QPVA 4Q9KA 4OHZA 3RSGA 3DULA 3F71A 3V55A 1NZJA 4B5LA 4HC4A 2PX8A 1CF9A 5DNVA 4WY5A 3RS7A 2XLBA 4OBBA 1YS4A 3PNMA 4NIMA 1MOZA 1FVXA 2H8KA 4RTJA 3TTTA 2ZRNA 3K1YA 4UOEA 2JJ2A 3CW9A 5K2MA 2UZ0A 2QVCA 2XXAA 2P69A 2ZE7A 4H4CA 3G2PA 1ZWKA 1U7ZA 2FW1A 1B14A 2QD4A 4WK2B 2B1RA 4Y1GA 1K1EA 2CE7A 2QLTA 2FFAA 1U9CA 3KOXA 5EN4A 4QM7A 2GCEA 1DBVO 2P9QA 2FN7A 5U4XA 5G0TA 3HEBA 4LJ4A 1AV6A 1J00A 1OXXK 2HJSA 1X1CA 3BIWA 2IVFA 2R8BA 4Y2HA 1DX6A 1L7OA 3HO6A 3KWLA 4L51A 4WQMA 4I3HA 2AG5A 3RSQA 1B8NA 2PV0A 2I8CA 2D1RA 3CF4A 1GXSA 5FPQA 3AGQA 5ICMA 1GA1A 1UP7A 3CZAA 4Q21A 4BFYA 1T91A 1OROA 2VSNA 1ZD9A 2I6GA 3NETA 4FC7A 3TW0A 4KSBA 3NDJA 4WKPA 3P8ZA 2FF5A 4W9RA 1XX6A 3VR3A 2LW7A 4HDQB 1U0JA 1TRHA 1GSHA 4MQEA 2IL1A 2PTGA 4J0GA 4DLUA 2O50A 3WADA 3GV0A 4GNRA 3U9TA 1CY1A 4HGOA 1RHRA 5P8WA 4DTCA 2QW8A 1GZUA 4URWR 2JIOA 2QUIA 2BKAA 3SPXA 2H51A 2OILA 3BWMA 3ZVRA 5L40A 1H8HD 3DZIA 721PA 4R01A 4BXOA 3GOHA 3EUWA 3A28A 3NG1A 4GOXA 2I4TA 4F60A 5JXGA 1EM6A 4TUYB 2BRUA 3N8NA 1DUSA 2ZDHA 4I3FA 1E9SA 1W85B 5EKSA 1DT5A 2CXPA 3R0XA 3PEFA 3RI3A 5IC5A 2GASA 2ZRIA 2HTFA 1X74A 4LOKA 4PZ0A 4ZDJA 4BQEA 3OA0A 1IULA 3ZW9A 3ZBUA 2C0CA 4JB8A 5F33A 2QRPA 2O7NA 3UA4A 4E1AA 1Z0IA 1KBOA 2C5GA 2VQDA 4UE3S 3N0VA 3MM4A 4MWDA 3AIKA 4PC3A 3NT5A 3K1JA 2XB8A 3KV3O 3QU5A 1OE0A 1NVXQ 1LWOA 3B2EA 3N59A 1N6NA 4J4BA 1YS9A 3K16A 1WOYA 4LJLA 2CL0X 2R5NA 4XRRA 4BVLA 2GF9A 2X2PA 1HZJA 3CNLA 3ZWNA 5LD2C 4M1SA 4BGUA 1MJHA 2J5RA 1M2KA 4RSRA 5KJCA 1M2NA 1NW6A 4DZRA 1MRSA 2IXAA 1U5AA 4JHXA 4YFVA 2AOWA 1DFGA 4BNHA 1G20B 4B71A 3TQFA 5DT9A 3BTUA 2GI4A 2R97A 4EG4A 5CIWA 1JJIA 4EF4A 1GPYA 3BAFA 3DPUA 4RWZA 1CUXA 1N5DA 1E99A 5HZGA 4FGKA 4JOSA 4UBLA 3UAXA 4YMIA 2QQFA 1NW8A 3KX2A 3J7TA 4AQ7A 2J3MA 2NU6B 1QP7A 1RWNA 4XQEA 1D6JA 3MERA 3H5TA 3WJAA 1JAHA 3GLGE 1ULSA 1OASA 1UT8A 4I5DA 4R68A 2X8JB 3RUIA 1RZ3A 1OYWA 2IHVA 1KI8A 3O8QA 2AYXA 1FVOA 5JQWA 1OV6A 2GF2A 1Z6QA 4KN6A 3AV3A 5DSXA 1VIDA 1BXRB 2ZI6A 3F7MA 3MMPA 5B37A 1SCUB 4TYWA 3EOBI 2VTEA 1ZUIA 2PLNA 3P19A 2HA6A 4PSCA 3U4MA 4MVJE 5CVDA 5JAMA 1EAMA 3H2IA 3E4CA 2ID4A 4WFQA 5CFOA 2VJMA 5IZ4A 6PFKA 1BQ4A 3E9CA 1KORA 3KQOA 4U63A 1A95A 3E7WA 4HYYA 3LCVB 1H66A 2OBBA 2QK4A 3KB1A 5DYGA 3PIIA 4J49A 2Y93A 1YL6A 4KP7A 1DOHA 1SC6A 4B6SA 4E3WA 4FNAA 2C9MA 5EIWA 1QORA 1VDMA 4IXMA 1FP4B 3RANA 3CINA 4HG2A 1P4JA 2VPWA 4AWXA 4MA5A 2FW9A 2YYZA 2TECE 2GM3A 4RAQA 1L4EA 3U7IA 4D4IA 1XT6A 4AS1A 5IPFA 4CMJA 3CG4A 2Z1MA 4A73A 4GZ5A 4M7OA 1YACA 3H9BA 1HKHA 3CX6A 5CTAA 5I9BA 1U90A 2NXEA 3I09A 3GBVA 4RJKA 2IBTA 2V7EA 4H6XA 4OH1A 4WCFA 1GTRA 4TXLA 4CQNA 4EITA 2OCAA 4JLDA 2OO5A 4X91A 3SDBA 2VJPA 3OZFA 3L6EA 1FX0B 2RFLA 5CFQA 4CDGA 1MBZA 3MQ4A 4LHWA 1TC2A 3T35A 5LOVF 3G0IA 3LECA 3RWBA 2YS6A 5DX1A 2YFHA 3AYZB 2VP5A 1VQ1A 2VP4A 4J2TA 2OXEA 2LNDA 3FPSA 4Y9SA 3QEMA 3NATA 1GU1A 3RRJA 1PLLA 4JKYA 3C15C 1NMXA 4K3VA 1NG9A 5MGBA 3B1VA 4J3NA 3NNSA 2AOVA 5HOQA 5KREA 1WU7A 3AB8A 1CUDA 1XRMA 1XD8A 3EDRA 3LBAA 4D3FA 4QNRA 5CYPA 3UWDA 1V1JA 1P91A 4DIOA 4GUAA 4MCHA 4ZO9A 5JPCA 1XHEA 3VO9A 1W34A 5L9AA 1YB7A 3KDAA 3NIBA 2A92A 4RAOA 3UOAB 4L1KA 3FTNA 1S2IA 2LKCA 1MXFA 5TT1A 5A6VA 1UWKA 2PMBA 1UINA 4O3MA 2GERA 5CB4A 1F2DA 1PR0A 4O4JF 3A4LA 1KMHB 1Z25A 2NG1A 2QRKA 3JASA 4RM3A 4X6XA 5TPZA 4J3JA 3GJ7A 3G23A 3AERB 4KDRA 2IYOA 1SN7A 2V9ZA 3I5MA 1B93A 1VE7A 4F92B 1U5BB 3KIPA 4EEXA 1YBHA 1DJQA 1PL0A 1T43A 3KWMA 4XWKA 4UCQA 3ETNA 3ZN2A 4NMHA 3O75A 1GUZA 1H6DA 2IF2A 5J63A 4C29A 2YMMA 4IV5A 1ZGAA 1MC5A 2BUCA 2GEBA 1ZL0A 2NX2A 4PCLA 1V3VA 4R4JA 3HVRA 5K4AA 2J5KA 1KEEB 3T9FA 5JI2E 4Q3BA 1NXTA 4OHYA 1K98A 4EECA 1YMUA 1ATIA 3RCBA 3M6IA 3ZV6A 1JDJA 3NB0A 5EE5B 4OXXA 4YQEA 1VKRA 3CUVA 1G59A 1KMQA 3EG9A 3HABA 4IV8A 4XWTA 1YVEI 1E8DA 1K8XB 2OLJA 4NBKA 4ZCIA 2X42A 3LT1A 5JCOC 4Q3LA 4TLEA 4FBMA 1VIVA 4ITUA 4O2AB 4QDTA 3KEGA 3SOPA 1MU0A 4M8IA 1QH9A 3VHRA 3C6ZA 4XJVA 2B7LA 4CUKA 4EA7A 4GSLA 4DC1A 5KNDH 1V7QA 4PLCA 1Q92A 4B7ZA 2OV8A 1Z12A 4GDMA 1ISHA 2CB9A 2G17A 2ST1A 3CLUC 1IN7A 3KAJA 4MH0R 3TX6A 2RHMA 2B8NA 1L4LA 3D0QA 1E92A 2Q3HA 3ISTA 2QGZA 5CXXA 3SZRA 1DXOA 1O9GA 4XARA 3S2IA 5A5FA 1KO5A 2ZPAA 4NXMB 5CFZA 1GTVA 5BUQA 1PAUA 1G55A 3TBFA 3KKZA 3MA0A 3WS7A 3KQPA 2VBIA 1Z26A 1HEIA 1FP4A 1YWGO 4OTZA 2ET6A 2ZSBA 2QM8A 1V3UA 4NLLA 5AOAA 5IT9A 3RAFC 3OWHA 4F1JA 1PYGA 2X15A 3QQ5A 3OT1A 5FOVA 5JYCA 3PNQA 2Z3VA 4D1YA 1Y6QA 5BW6B 3ZK9A 1D5WA 1SHLA 4EYQA 4LF9B 4KXNA 2X0JA 5KUTA 4O1IA 1EIWA 2CK3A 1RXEA 3VU0A 2P78A 3FB1A 2CVZA 3FVRA 1K4KA 2ZGVA 1CRQA 5LQDA 3P94A 3FZGA 2BWJA 4KAXA 3UB2A 4BNGA 5JYEA 5A7GA 5K0ZA 4FJ2A 1ZVKA 2WVGA 1Y3DE 1IOZA 3DM9B 3HCEA 1GOTA 3CF6R 4LZPA 1OCEA 2CCJA 3OEWA 4RLHA 3P9IA 4L8GA 2RIPA 3FOCA 3H11B 2YN2A 3WA7A 3B1XA 4JT4A 5ALRA 5JCOA 2OGSA 4CEJA 4HK4A 2MMGA 4REQB 2BH2A 1SB8A 4IO0A 4NZ9A 2PN1A 4CKEB 2ZSEA 3JAMA 1Q6ZA 2DFTA 3QLJA 3QW4B 3EQ8A 3I04M 4JU9A 4RS4A 2JZNA 1KOLA 4GOND 4MUKA 3DZJA 3STVA 3CISA 3EOAI 3G79A 3U9LA 4H7EA 3FMGA 4HWPA 3IAXA 4FD2A 5JZOA 5GQSA 3PF8A 3IEVA 1TQ6A 1S5PA 5B30A 4MI1A 1RQ2A 1H1LB 4QXPA 1AF7A 4C2TA 1H2BA 1RE0A 3TCKA 4EVIA 1M76A 3B7WA 2WJGA 1GKUB 2EJVA 2PSJA 2BFCB 1NOJA 2VHYA 5IKEA 4HAOA 1A9XA 4MS4A 1R15A 3WY9A 2Q6LA 1JKJB 1XTRA 1Y9EA 4FYWA 4EGFA 2GD0A 4MRMA 3TW8B 2G1PA 1Q0LA 2HA2A 2YRXA 1DKLA 5A5VA 4TRRA 1W9MA 3LJKA 2FSSA 1U7UA 3PK0A 3LPMA 3O1IC 3AZQA 1CRWG 3CH4B 3ONFA 1CS4C 1G0NA 3LLUA 3UJ7A 2RK4A 2WNHA 4B8ZA 4Z4EA 5GONA 3AWIA 4GF5A 4KYUA 1P1HA 3QF4A 4K0RA 3ZWMA 1AJEA 1DAGA 1CNMA 5JWHA 1B8OA 4BECA 1Z2CA 2IOQA 2O3JA 3GLVA 3DVAB 3LY8A 4PGGA 3TLJA 4F6LA 4Z51A 3H13A 1FS4A 1LVUA 4BZQA 3DHYA 1N8TA 2HU7A 2GZDA 3BCUA 3KZNA 5HHTA 3DP7A 3O9ZA 2BHSA 1RWVA 4G8DA 4Y2GA 4YA6A 4QJBA 2BKXA 1K5PA 1VCHA 2CC2A 1C1XB 3OLQA 3K0EA 4IDEA 4JZYA 3WRYC 2JGIA 1GGJA 2CMGA 3CR8A 4KEAA 1P2BA 3QHPA 1J9EA 4JVMA 1D8TA 4RHUA 4QVIA 2JEYA 2O5VA 3L0SA 121PA 1CG6A 2AFHA 3NDRA 4E5UA 4EYKA 3D8BA 3ML1A 3PSHA 2EKLA 1K86A 4ZT6A 2BFOA 1XLTC 1ZGZA 2I2WA 4MWOA 1CY8A 4IIUA 1YKGA 5FBKA 1E3QA 1DMSA 4LECA 5CK5A 2J0QA 4FZ3A 1EXWA 3SVTA 5C5EA 1HH4A 2P5TB 3QU7A 4RHEA 4CQLB 1BJTA 1TYBE 2GEDA 3OFKA 3ENNA 4O33A 1MW9X 1AQLA 1NBEA 1U2RA 3EQ2A 1JR4A 2CLHB 2COKA 2EBHX 4FKMA 4Y2UA 4DCPA 1C9YA 4RF3A 5EIOA 4OMDA 3C6YA 3B6ZA 3N2GA 4Q3AA 3DWGA 3ZI4A 4LHYA 8AT1A 1EH5A 1C0LA 2J9FA 5MFPA 2GXAA 3DEFA 2Z2JA 2KQUA 5LYYA 2QRNA 3ZUPA 3FTCA 2O8BA 5IYZF 3DC7A 4GYJA 3NP9A 1QSGA 3ESRA 4QUBA 3WWCA 2XB2A 1FSPA 5DP2A 2GAFA 2AC4A 3HSSA 1L5ZA 1TO2E 1FJ2A 2VSXA 2DH6A 5ECGC 1IATA 3LCRA 1JKMA 3HDVA 1B16A 5KDDA 1E2QA 2CB0A 1W2GA 3B13B 3HJCA 4Q37A 4BFWA 1GADO 4EHBA 1WKBA 2FWJA 3I53A 5FAXA 3H1PA 3OQNA 3AP3A 5IN4A 2VHJA 5LA6F 4YIHA 3GPIA 5ARCA 4OBEA 1DAIA 5BR1A 1YZNA 2OORC 3U0VA 4JBLA 4EMTA 1EP3B 1L8XA 2VHUA 1H3EA 1JQ3A 3OHPA 1KO1A 4XSGA 3DA8A 2WWRA 5DE3A 3BXPA 4BU0A 3UJHA 4KVGA 3V32A 2NU7A 5DI9A 4ZAVA 2CD9A 1T0BA 4ZC1A 5I7SA 4RESA 3PDCA 4C0LA 2AK2A 5D3MA 5H16A 2ZS7A 3HC7A 1V5IA 3FCUB 3HU5A 3JQ6A 1YQEA 3KVVA 1GDDA 3GLHA 5FBRB 5JHGB 5AK0A 1UK8A 1AUQA 2I66A 2BPOA 4G01B 5HJ2A 1FZQA 4ZQCB 1ZD2P 3E9NA 1EJBA 2GK3A 4Q16A 1JXMA 4L0QA 4UPVA 5IZCA 1E2MA 2FPPB 1E3TA 3ZLUA 2B94A 1RVDA 5J58A 2B6NA 2OXTA 1R8JA 1QH0A 4NU6A 1OQAA 2VAVA 1LSJA 4OLJA 5AKYA 2C7BA 4CI0B 3UFXB 2NW6A 3L8ZA 2XYVA 2QAGB 1N57A 3H9EO 1O4WA 5GJVC 1SOUA 5CX1A 4LTNA 5EJIA 1KOGA 3DB1A 3AF5A 3QLTA 2LIPA 1CUJA 2QMYA 5HXAA 3EODA 3D6AA 3OCWA 1JHVA 1V3TA 4J16A 3WHKA 3ICWA 4DEXA 2HA5A 1MH1A 1WZ2A 2WHPB 3TZQA 5TR9A 3ZDBA 1L4HA 3QW2A 4EJFA 1VYHA 2HNAA 4DCCA 3RGGA 4AYWA 4AQDA 1RS0A 3M1LA 1DHRA 3TRIA 1G16A 1KVUA 1CR2A 2RI6A 1CZNA 5DN9A 2FZVA 2HCRA 1JQKA 1R4NB 1R6TA 3ONDA 4IV0A 1RHUA 4C4XA 1MDBA 2X6QA 3K9NA 3QITA 5ALOA 3AQIA 4YP1A 4RD3A 1G41A 2E21A 3MVEA 4BB6A 1JPVA 4E03A 2NZJA 4ZAZA 4WOJA 4FFRA 1H69A 1OIVA 2FK7A 1SOWA 2NTJA 2QL9A 4HBZA 4JJ4A 2GD2A 3WTCA 3NKVA 3TPCA 1MD9A 1NLZA 4JFAA 3CLRC 2DECA 4AF6A 1GAWA 3K0FB 1O6FA 4JGBA 1GT6A 3VR2A 3ZDYB 3UO8B 5TRTA 1H85A 1LQUA 2WQZA 2FAXA 1LF5A 4KIWA 4MVJF 1DBPA 4OQFA 1E2LA 5A2GA 1E5DA 2QUAA 2W6OA 3AESA 3NTVA 4XKJA 3L4JA 1C9MA 3W04A 2O52A 1ECPA 3QNUA 5K0FA 1PVOA 1KU0A 1E9FA 1ZKMA 3THOA 1P19A 2VFAA 3ND8A 4EAQA 4LXQA 3BJIC 5DI3B 4U6QA 3AHCA 2P2LA 3TJZA 1UQTA 2Z09A 3OUZA 1XKQA 2PS1A 4LYAA 5CMLA 1GTZA 3ESBA 4QNNA 2CFRA 5GZ3A 3IXQA 4C7OA 3KPUA 1TXGA 3UBMA 2IXTA 3B6IA 4MW1A 5A9TA 3ST7A 1ZO8A 2XVZA 2JAXA 4TZKA 3DTYA 3ZWPA 1JU9A 1XHLA 2ZDQA 3Q9UA 2AI2A 4CL8A 4ARIA 2QVXX 3MTAA 3FDZB 2O8FA 4UUPA 2VYCA 2R1ZA 5CYOA 4PPYA 3T0IA 1QFJA 3UTCA 4K9LA 4C0KA 5BSGA 2E4UA 4K9OA 4BGVA 4BRWA 3ZYZA 3AYXB 4AUEA 5JYDA 1BCSB 2BFCA 3JWPA 5JJKA 1TYDE 1N6LA 3LQ2A 1VG0B 2JIRA 4DY6A 5JZMA 5FBVB 3PGVA 4YRDA 1E4OA 3VOSA 2EOAA 2HQ1A 3KLMX 4HVLA 2ZSDA 3UZUA 1TYAE 5GOZA 2YXBA 3ZY3A 1CPYA 4PAQA 4W5JA 3UANA 2BP7A 1UMCB 3OLWA 4E6EA 2JI4A 2P4QA 2QTCA 5LQNA 3E53A 3KAKA 4IXWA 1CVLA 4AT1A 4B40A 3C14C 3Q8LA 1GPH1 3CURA 4EBBA 4D6PA 1Z0KA 3G0HA 5E1OA 3OCUA 2HJHA 4MW7A 4HWSA 1EHYA 5JIBA 4QU0A 3BD7A 4MS3B 1QFSA 3CVWA 4NZOA 4S2EA 1BKDR 4IXNA 4KR2A 5JSQA 3TLGA 4D8TA 1QYIA 3CE6A 4KO1S 1O97D 1X0XA 3GFTA 4KOAA 4FZVA 1UWCA 1ESCA 3FYHA 4HEHA 3CW8X 5AVJA 1I0IA 3CZ4A 5IKMA 4R9NA 5G1OA 4KNYA 4GL2A 5LUBA 2X0NA 1NBHA 1FFXA 4CM5A 1O1YA 2JJMA 2OGZA 3MJDA 2J07A 4YS6A 5D85A 1O95D 1WXIA 1XELA 4ON9A 3SS7X 2CGEA 3RBAA 5AD1A 5C3MA 1DDIA 1ZD1A 4FN4A 4BFVA 5GONF 3H7AA 3DKKA 3IRUA 4PG6A 3BD9A 1AOXA 1GGFA 2A35A 2QKYA 2PZKA 4AXBA 2W11A 4ZEMA 2VNSA 2YJ4A 1IY9A 4IEFB 1L5YA 1QCDA 4EKNB 4B0PA 4IUBS 3KK0A 3E27A 1PSWA 1HYQA 1TAHA 1GRNA 3IERA 3QYPA 6CHYA 2GHIA 4ACAA 2HWXA 3JVIA 3UH1A 3GRKA 3KVOA 4OO3A 2GEUA 1N2JA 1RKBA 1YA8A 3QF7A 4B9AA 5B2EA 3STUA 2QMHA 2R8OA 3VH1A 1JAIA 3RVSA 2PA3A 3EF1A 1ESMA 1WMEA 4Y8VA 3K70B 4DB4A 3G82C 3FCYA 5DYTA 1MVNA 4DCVA 2Q3BA 3H5IA 4AWBA 4G5HA 4FFLA 1DRJA 3Q4GA 4RJIA 1VI5A 1J9ZA 3MJ4A 4EFDA 1CU1A 4WN3A 4PWZA 4PLGA 2QPAA 1E98A 4II3A 3P4YA 1EUCA 5EQJB 4V1CB 2BDUA 3ICVA 4GR5A 4XFKA 2AZTA 2IEGA 2Q3LA 3F6PA 4KYVA 4LZJA 4YRAA 2NVWA 3JQ8A 2RE8A 4NI5A 1KY5A 1A5BB 3NC1C 3N2NA 3I12A 4IIJB 2H63A 3OBIA 4G5OA 1ESNA 4MYHA 3IIKA 4TTPA 2FWIA 5LQSA 4R9UC 1ULUA 3M5CA 4H4EA 2HB6A 3O2QB 1HNZB 1U94A 4I4CA 4EKDA 4MQFA 2QN6A 3PQ8A 3DKPA 4FM9A 4HGQA 3UKOA 2ZRDA 2I62A 3AO0B 3MYYA 4JA2A 4MGZR 4YQFA 5JI3E 3B9QA 1YJCA 2EARA 3OICA 4TYMA 2FZ4A 3HKEB 1J2EA 1EGHA 2ZR0A 3EIOA 5BNFA 3IQFA 2ZIFA 3RVBA 2PCJA 3M49A 1XA0A 5J9FA 4KR9A 1H3FA 4UUOA 1HE3A 1I3LA 1W36D 5IJ9A 2XB4A 2F3PA 2ETXA 2YVAA 3B36A 2FEMA 2G3YA 1TCCA 1MKYA 4DDHA 3RR2A 1QPBA 1DDOA 4EARA 4TKUB 1EWTA 3BZUA 4BV2A 1R74A 2NAFA 4H6WA 4LHSA 5CPBA 4E1VA 4GVXA 4OYRA 3V1LA 4TMZA 1P9NA 3SDZA 3R7SA 4IDOA 5KC8A 5C18A 4NICA 1IUPA 3VU9B 2B2CA 4NMLA 4LJAA 3NXKA 2C7RA 4P3KA 3VO1A 1ZNZA 2FGKA 2NQTA 5AXDA 2PWPA 1Q1NA 5E1BA 3R0ZA 4BV8A 1GWNA 2OBXA 1VG9B 5LP1A 5TC4A 2XIJA 3BHJA 5EEGA 5TSDA 1I14A 1G5FA 1TQ8A 3QPDA 3A06A 1F2UB 1T6XA 2BR3A 4CV0A 4BO7A 5F1OA 3HJHA 1XTIA 5A6SB 4X1IB 4G8BA 1DX9A 1DQNA 2H2IA 4QXOA 2YCLA 4A5SA 5DMXA 1AT1A 4Z5XA 3R3ZA 5DM1A 5CFNA 2WWXA 1IPHA 2IKQA 2H85A 2V6JA 4MQ6A 4XI9A 2EBUA 2CY0A 4YB8A 3BGOS 4XR4A 1ZX1A 3IT1A 4J43A 3PQ6A 3QVGB 1RXIA 1G6HA 1PZFA 1RLTA 2GA9A 3DOCA 3G2JA 2IUTA 4D0GA 4FFBB 3FPBA 3Q0TA 4NONA 3LVFO 4UZSA 2NGRA 3CLSD 4M9CA 3WLJA 1AKTA 1W9HA 5DBGA 1WPGA 1XCBA 2OFXA 3LVBA 5CM9C 3T5BA 4U4AA 2GETA 1GUFA 5D3MB 4L2IA 3BGIA 4GX2A 4EMUA 5LQKA 3O84A 1XWFA 3HN6A 2D5IA 2ILTA 3BERA 1UBHS 2V3WA 4M9UA 2IXGA 2O6LA 1GFSA 1L1QA 2JI8A 3KEOA 1ZL2A 4II2A 4N7RA 5FORA 5K0LA 2N75A 4DKXA 1Z7GA 3H4VA 3G2KA 4MHTA 2HRBA 3BWYA 1RKVA 3DDHA 2R7NA 3H2KA 1KIFA 3D2CA 1FFDA 1FPQA 4CIWA 5I4IA 3C3XA 5JRDS 2QPTA 5AM1A 3R8FA 1XF9A 4M55A 1FNSA 3P9ZA 3FAKA 2IIPA 2ZG6A 2VZLA 2X8LA 2BELA 3O3OB 4AJKA 4AZSA 3S2GA 4DHWA 1FVHA 2FI1A 4J4HA 1PDOA 1SCUA 1SUBA 4JLKA 1F17A 3GA7A 2VWGA 3F0TA 4G0UA 2BUAA 3D31A 3OFJA 2WYVA 1XOIA 2JKZA 3GFRA 1E4VA 2EC5A 4A6EA 1C1DA 1G8HA 1MB4A 1YASA 1PE0A 2QV7A 3GEIA 3PJFA 4CKBA 3HVHA 3ITEA 4G0ZA 4EJ0A 1DRKA 1UDCA 2RHOA 5FX2A 1TUBB 1VHLA 2F67A 4OX9Y 2PZAA 4AIIA 1U2TA 4B44A 3F3YA 1RPJA 5BP7A 5KSZA 2H9IA 2AK3A 2FR0A 3GY0A 5PNTA 3UM9A 3WNBA 3CT6A 2OCYC 4KRYA 2Q5LA 2H5EA 4FCTA 4YQZA 1X13A 2R8RA 1FYEA 3A05A 1XRJA 1K7FB 5ALPA 4Z6KA 5LD2B 1CV2A 2YHIA 1V5WA 3RWMB 2XUJA 1V37A 2QNRA 1XZIA 1AZTA 5EUCA 1MA0A 2VATA 5C4MA 7ADHA 3P2OA 1SG0A 4QU5A 4R3UC 2I3DA 4MUJA 4RELA 2WU3A 1OR8A 4HDRA 5BRNA 1IOVA 1ONOA 1USIA 1QX3A 2PGIA 3PUVA 2NTNA 1QYXA 3A6PC 1QGZA 1VHDA 4LJ8A 2JIBA 3G7SA 5ICSA 3V3KA 4EMBA 4NY1A 3Q2IA 3SS9X 5LFAA 5KYYB 2I2CA 3JVDA 1A3CA 3H9QA 1JLLB 3W77A 4FFOA 3BXHA 3DAPA 1DVRA 1P9RA 3BH6A 3PE3A 1E96A 4QL3A 4D42A 4B6JA 4DPLA 1JBQA 5KU1A 5BWNA 1UL1X 5HKKD 1TZBA 1E2UA 4NYJR 1OWLA 3BC1A 3CEJA 3LBNA 3L02A 4IFEA 3CXUA 5L3ZA 3ZVLA 1QQAA 2PGDA 3PUZA 1H2FA 2YHUA 2F59A 4MVJG 3COZA 4MOWA 4A82A 1L9KA 4C04A 2CL6X 2JCYA 1XDDA 2Q3EA 4HYQA 2AOTB 1EJ6A 4PS0A 3RVQA 5FPSA 1Y7HA 1MJGA 2BONA 4I6GA 1VM6A 3WLQA 2CXTA 4BY9E 3D54D 2XNCA 1PDVA 5LMNB 1E60A 3R9IA 5SY9A 4GOLD 1M6YA 1L5QA 2WFZA 3Q8MA 3QKSB 2Y71A 3CLSC 5JJIA 4KI7A 2JNWA 2OFWA 2X5XA 4UHDA 5F7ZA 4DCNA 4HDKA 2IF0A 2MYNA 2PMFA 3QBDA 4OOFA 1ZICA 3L92A 2PRIA 4R7ZA 1DZIA 5FL7D 5LBUA 3R76A 3T15A 3WYBA 2F8SA 3IVCA 3LUHA 1T8UA 2YWXA 2CKDA 2P27A 3GZJA 4EB8A 1VJTA 4MV1A 2BDTA 5EYPB 3QKIA 3TJMA 4ZANA 3VDMA 1PWEA 5JSHA 1N2SA 1S01A 1KERA 3I23A 1UOQA 1Y5MA 3ZH9B 3A9WA 6LDHA 4QHYA 4QFBA 5C1BA 2FFJA 2D5AA 5JDIC 1WY7A 1SKQA 1JYFA 1L5WA 2A9OA 2AQ8A 2YWRA 4AMVA 4RU1A 5JJLA 2WM9B 2XNSA 1PD0A 1LWNA 3PTZA 4TMTA 3ORHA 2W0MA 3QBTA 2J5XA 3SDSA 4YRNA 2OBFA 4PYOA 4ZVNA 3K0SA 3THWB 2BBTA 5C3UA 2PSEA 5EEHA 1KJIA 1WUIS 2ZJ3A 1S3SA 3R3WA 5AW6A 3PLAE 3G0OA 1QHEA 1UDXA 2CXUA 2LBPA 3KJQA 4NBSA 4QGHA 4QYSA 4YT5A 5TPWB 4X7RA 3VH3A 2X58A 3L4BC 5A06A 2FJ0A 2OHFA 2OZLB 3MCZA 4GQIA 4KAFA 4KXQA 3EFBA 4NBUA 1JDUA 4B3IA 1PQWA 1W29A 3GLHB 1O2DA 3HY6A 3LC0A 4S1OA 5T3YA 3TTXA 3FI0A 3LXMA 3WMGA 4HX2A 4Z4FA 3OJEA 1JIJA 4LK3A 1V26A 1IDOA 2GFIA 2QUJA 1IMOA 3SLKA 1W5EA 4YLYA 2GYYA 3MWYW 2DWPA 4BVJA 3QUSA 4O4HF 4Q1AA 3AVOA 1TZCA 1KJQA 3OZAA 2BN4A 1X70A 5EHIA 1CULC 5EP3A 3RKUA 1RHKA 1W5FA 1DTWA 4JI2B 4MAAA 3HJRA 4ICIA 1N9KA 3CIOA 2OQRA 2O4UX 3FSEA 4CCYA 5AHKA 3D6HA 2NO6A 1B6RA 3ESZA 1U7PA 3IDAA 4UBIA 3HM2A 4W5TA 1Z5VA 1OYOA 3OJFA 2AN3A 2NT4A 5M5BA 2C42A 2ZSJA 1NXXA 1QAQA 3G1WA 3PRYA 4L57A 5EJ2A 5JU6A 4DMFA 2V0NA 1BMDA 4ND4A 5FR1A 6REQA 5IAEA 2EL9A 3EH2A 1HNXB 3UKDA 1YBMA 1YK1A 3D8NA 1GGKA 4DLSA 1Y5RA 2ZAMA 2AJCA 4JD5A 4Q39A