3E1GA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase D
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
total genus 89
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e1gA00
3WZLA 1CV2A 2OPHA 2ACEA 4X3CA 5FV4A 3WL8A 5LIPA 5SYNA 3LP5A 3HLKA 3BJMA 4K6GA 4C4YA 3WWOA 1A88A 3A70A 3KDAA 2BGNA 1DX6A 3C6BA 1A8SA 1CQWA 5YASA 5JD5A 1XZCA 5AKXA 5T4HA 4AZ0A 3A2NA 1Q0RA 2PL5A 3K2IA 5JAPA 4Q05A 4BVKA 1K8QA 3HSSA 5AIAA 2B9VA 2WFLB 1UK8A 3HABA 3BJRA 1DTEA 3ILSA 5JAOA 4B85A 2PKYX 5J3JA 1AC5A 1IZ7A 4J03A 5DWDA 2HL6A 3C5WP 2HDWA 3G0DA 3IDAA 4IH4A 1RP1A 3SC2A 1EDDA 4WJLA 4UFOA 4IH1A 4HXFB 3CCBA 6YASA 5ALXA 4ZV7A 3FLAA 3SWWA 3KSRA 4HS9A 4QLAA 2VJDA 3BE8A 1W52X 1TKRA 2OCLA 2OCKA 1QFMA 5EHQA 3ZLTA 1YAHA 2C58A 2XLCA 5JZBA 4J0GA 4EA6A 3W2TA 2RI6A 2VQ6A 4D9JA 4UHHA 5JZSA 2XMBA 1NU6A 5A71A 3BWXA 4Q34A 4DSAA 1DWPA 1CUEA 1H2ZA 2CKMA 2OGSA 4MQMA 1LBSA 4X6XA 5AK6A 1L7QA 4U2DA 2D5LA 1ZIYA 4ARBA 5LKRA 1J2EA 2O7VA 2PSDA 3HZOA 1J06A 2HA3A 1H2WA 3C87A 4NS4A 1DT5A 4B80A 2BCEA 4F60A 2C0QA 4DIUA 4N8DA 2QT9A 3VVLA 2XUAA 3I28A 1CPYA 1E66A 2WIJA 5ALOA 3VJLA 2AJDA 3BF7A 5LZ8A 4C89A 2ROQA 4YK7A 1SC9A 3IURA 1RYYA 4B82A 1QLWA 2JGJA 1QIDA 2OXEA 3PUIA 1CUDA 5IKXA 1QE3A 2VEOA 2GZSA 3D3NA 2VT6A 2C4HA 1JMKC 1IUPA 1JU3A 1JKMA 4E15A 2HU8A 2DHCA 3QITA 4X93A 4OU5A 5I7UA 5JADA 3IB3A 2O2GA 4P9NA 5ALKA 3SX4A 4ZREA 3CN7A 1SCQA 2J4CA 4WDQA 4CG3A 3VISA 4AO6A 2WHQA 3B5EA 3NWOA 2K2QB 3AIOA 3DYIA 2GBIA 3ESDA 4W1RA 2YH2A 2HA2A 2BUAA 4OB7A 1EX9A 4LHEA 4A23A 3WKCA 4KE6A 2XUDA 2WUFA 1W76A 1XZHA 4AN1A 5CH5A 1CUVA 2B20A 5JIBA 5K3FA 5FPPA 2JEZA 1K4YA 4BVLA 1MAAA 1DQZA 2WIFA 1S8OA 1HBJA 2ACKA 2J3QA 5HQ3B 2HRQA 3KWFA 5CH8A 3WIOA 4INZA 2XUFA 5A7HA 3ESCA 2XUHA 3I1YA 4J0IA 2HM7A 4UBJA 2HIHA 2HHAA 2HRRA 1HQDA 5AP9A 3TEJA 3QZUA 4QDZA 2OQIA 2VAXA 1EVQA 3N2ZB 2BAGA 4M0EA 3IUQA 5AK4A 4G4JA 3DYVA 1N5RA 4N8EA 2OCGA 4N5HX 3H1AA 4BBZA 5C81A 3FCXA 1BEZA 4QZVA 3FBWA 4K6HA 4UHFA 3V1MA 3K9BA 3PE6A 3R3VA 1YSCA 1QIFA 1VJ5A 1TQHA 4CI9A 4JYPA 1GT6A 1UKBA 3IVMA 3D5EA 3O0DA 4XJVA 3G9TA 3BL8A 4X7BA 1EB9A 3WL6A 4X90A 1VXOA 1ACJA 3D59A 1QIMA 1NU8A 2XUGA 2CZQA 4BTLA 1JJBA 1ZD4A 1P0PA 4L9AA 5HK9A 3RKSA 4MQLA 1CEXA 4P93A 4JUIA 1UK7A 2AJLI 2X5XA 4B7ZA 3D0KA 1UXOA 1GPKA 5K3DA 2W6CX 2QJWA 3HC7A 5D7BA 3U0VA 4ZRDA 1WHTA 4GBGA 2RIPA 5ALGA 5AI9A 1EXWA 1UT6A 2XMZA 2WUDA 4BTVA 2QR5A 1YCDA 1CUGA 4DNPA 2XMDA 3AIKA 5IVKA 2Y2VA 4Y2PA 4EB0A 3DQZA 2OLEA 3JWEA 1ZICA 5AM2A 4KRXA 3ANSA 1XLUA 1ZD3A 3OG9A 7YASA 5A2GA 3EF3A 3TJMA 4W9RA 4GHWA 4Y2YA 2OG1A 5ALYA 2QJRA 1EB8A 1W1IA 4QLOA 3LS2A 1TAHA 5EIHA 4CCYA 2VAVA 1AKNA 4W1PA 4X6UA 1JJIA 4MWSA 4KE8A 1JU4A 1QTRA 1PJAA 1BROA 4ZV9A 1QZ3A 3AINA 3R3UA 4KE7A 4X95A 2RHWA 3R0VA 2QOEA 1A7UA 1ZJ5A 1THTA 4OB6A 2XE4A 1ZD2P 4KAFA 2AJCA 2HA0A 2QXUA 5ALQA 4DSZA 4WY8A 3GFFA 3ZPXA 2BUCA 3L1HA 4DNQA 3F96A 3IA2A 4OB8A 3E4DA 4K2AA 5AKGA 3U1TA 2PX6A 3CXUA 5HCUA 3MUOA 5DYTA 4BVJA 5C8XA 1BCRA 1G4HA 2H9YA 1H22A 5FP0A 4TPKA 1BN6A 3DCNA 2QXTA 4HXGA 1QGED 5JD4A 2YASA 2WFMA 4BDSA 1AUOA 1FSSA 2ZYHA 4C87A 3STWA 4Y7DA 1TCBA 1QJ4A 1CUFA 5ALNA 3FOBA 1EK1A 4Y2UA 2V98A 1EDEA 1AZWA 1DQYA 4JEIA 1UOQA 5ALHA 1IUOA 5LLSA 1YA8A 2HA5A 4BP8A 1CVLA 4MYDA 3R3WA 4PF1A 1FFCA 1G42A 4QDUA 1BN7A 4PSCA 2XMGA 5AOBA 3PFCA 4UBIA 4C4ZA 3PDCA 5D3KA 4CG1A 3D7RA 4Z49A 5ALFA 4AQDA 2VATA 3N0TA 5AM1A 3WA7A 1OILA 3ZLVA 1MN6A 4Q3KA 3M3DA 5LZ5A 3AIMA 3HEAA 2GBCA 2O2HA 4ITVA 5DNWA 4EHBA 1XZBA 4QDTA 1ZI6A 4CCYB 4X94A 4IH9A 2ZYSA 4E11A 5T4BA 4TVKA 3WKAA 5AKHA 2WSLA 4ETWA 1VLQA 2XQJA 4BCCA 4U2EA 4I3FA 4DMFA 3R3YA 5K3CA 1MNAA 3QMMA 4U2BA 4XWGA 3WA6A 3FVRA 3O4IA 3WL5A 3ZWQA 3O9VA 4X71A 5AO9A 3DOIA 3PI6A 4KACA 3STYA 1N1MA 1CUSA 5JATA 2H7YA 3OC0A 4EY5A 1QONA 2I78A 3QPAA 4Q82A 3R3XA 2G4LA 3QVMA 3F9CA 3FYUB 5E4YA 4UFPA 3WZMA 2Y6UA 1P0IA 4KR0A 2PM8A 3STTA 3BIWA 1TCCA 2ZYIA 4K5QA 1L7AA 3B12A 2CBGA 5AKYA 3ANTA 1D07A 3LIIA 2WIDA 2D0DA 3FWHA 4B9AA 1J07A 5ALDA 1QIGA 1AMNA 4UHBA 3HACA 1LZLA 4X97A 2J4FA 3JW8A 4BAUA 4BE4A 3Q8WA 1H2XA 2WFZA 2ZSHA 5ALEA 1YS2X 1B6GA 1K5PA 5CURA 1GQSA 3VVMA 2PSHA 1HDEA 4B81A 5JZ9A 1U4NA 1Y7IA 4DGQA 1O6GA 4HRXA 4Q3LA 3HJUA 2QMQA 3M83A 2WG0A 5K3EA 2HA4A 3D2CA 1VZ2A 3P2MA 5LZ4A 4Y2SA 5AI4A 4BCDA 3IUJA 2HU7A 2HU5A 5CT9A 2C0PA 4QNNA 1JT2A 2C7BA 2BFNA 4W1QA 4XVCA 4DNOA 1ORVA 4DMKA 5T4EA 4C01A 1JMYA 1JI3A 4L72A 4BRZA 1G5FA 4CG2A 1CLEA 3H19A 3FNBA 3E3AA 3D2AA 1CUCA 4BC1A 3H1BA 3L1JA 2ZJ6A 1QIKA 5KWJA 3F67A 2QUBA 2H7XA 4ZGBA 2P8SA 2DQYA 3AUKA 5BOVA 3W9BA 1WM1A 4G9GA 1YASA 4EY4A 3WWEA 3O95A 3FSGD 1GXSA 2XMSA 5HZGA 1LPNA 5JARA 4J0KA 3GELA 4H7JA 1THGA 2YYSA 4MWTA 1N8SA 2DFPA 1R50A 2VF2A 5I9IA 3AILA 5D3ZA 2R11A 2R8BA 3WK9A 2JF0A 2XDWA 2GYUA 1BEEA 3T4UA 5AICA 2WUGA 5ALIA 3HI4A 3ZI7A 4LXHA 1LPBB 3I2IA 4BP9A 5ALRA 1WB5A 3LIPA 5HFNA 1BS9A 5AOCA 2WHPA 1P0MA 4JH0A 1EH5A 5HF6A 3W06A 2ORYA 4OYLA 5K3BA 3EQ9A 5ESRA 2XUIA 1R1DA 4F21A 4BCBA 5IVDA 1Q83A 3C6YA 2B4KA 4Y2RA 2BGRA 4UPDA 1XRMA 4XIIA 3RK4A 2JGLA 3QMVA 2WM2A 4AZ3A 1AX9A 5KWIA 1HLGA 4J7AA 5IVHA 1XQYA 2X76A 1XRLA 4FMPA 3G8YA 5CT4A 5AM5A 3C8HA 4UHDA 4Y2TA 4N5IX 2I03A 3F8SA 3AJAA 1LBTA 3W05A 3GZJA 5AHXA 5E4JA 4EY8A 4FDMA 3C8DA 2RONA 3QYJA 5C8VA 3YASA 4CCWA 2EDCA 5ALVA 1E8MA 1GPLA 3R41A 5CBKA 1LNSA 3KD2A 4WCVA 4GI1A 5AM0A 2WHRA 3WYDA 2Z8ZA 1USWA 5AI5A 3WL7A 4AX4A 1XZGA 4EUSA 3C45A 4GEGA 4CFSA 1QO7A 2WJ3A 2ZYRA 4DTCA 3H04A 1UOOA 5ALZA 1XLWA 2NW6A 2VT7A 3ICWA 4S0XA 3WI7A 1T4MA 3HRHA 3MVEA 5EIEA 1WHSA 4QE3A 4N8SA 4HRYA 5F4ZA 5DTJA 4L3WA 4AXBA 5CH3A 2I3DA 2H1IA 1LZKA 4H7FA 2DHDA 3I6YA 2ECFA 2WHPB 1ZJ4A 1CUWA 4HXEB 3I1IA 2QUAA 1BE0A 1C7IA 2AJ8A 1XZLA 2G63A 1KEZA 3QBJA 5HFAA 1VKHA 4QDOA 3STXA 4UBNA 5A7GA 1W4LA 2XMRA 1X2BA 4V2IA 4H77A 2PU5A 1QIJA 1X70A 1DU4A 3H2JA 4AB1A 4AMYA 4YX9A 1IVYA 2V97A 1FFAA 1MO2A 1ODTC 2XUKA 4KYVA 2QVBA 4BRSA 5AKJA 1XROA 4UHEA 1JFRA 3V1NA 3B3QA 2Z3ZA 1KU0A 4QEKA 2JIDA 3W9UA 2O7RA 5K3FB 3NGMA 4E46A 4DMCA 3K6KA 4J0JA 5LKAA 1XQVA 3FCYA 2C5GA 4FLEA 4Y9SA 4H7HA 4FTWA 4WDRA 1X2EA 4DLNA 2XUOA 1MT3A 1F6WA 2WLSA 3FYUC 1XRRA 1EDBA 3RARA 2FUKA 4PQEA 1XQXA 5AM3A 1YB6A 3EQ8A 1O6FA 4B84A 4X91A 4NZZA 2HFKA 5BV7A 1MU0A 4F5ZA 4WFKA 1YA4A 4J0HA 1VE6A 2LIPA 2X8BA 4M0FA 5FDFA 5HF8A 2FJPA 5E2IA 1M33A 2Y6VA 3G9XA 4RE5A 3IUMA 1AGYA 5KBYA 1MAHA 1QFSA 4FKBA 4LYDA 3ICVA 3QPDA 3KWJA 4PV7A 1CUXA 5A6VA 3FSGA 2WQZA 1FJ2A 4UUQA 3GBSA 1MTZA 1UK6A 1ODSA 1Y7HA 2GZRA 4G4IA 2EEPA 4WFIA 5HF9A 3WMRA 1XKTA 1GQRA 1H23A 4DNFA 3EBLA 5CTAA 5ALJA 4LKOA 1UZAA 3VJMA 3WK5A 4AMZA 3A2MA 4GXNA 4LYEA 2QZPA 3NUZA 2CB9A 4Q1VA 4BC0A 3PFBA 3H17A 4H35A 2HFJA 4K6KA 4BZWA 4QDXA 1EVEA 3WK7A 1ZGBA 5EGNA 4WY5A 3FAKA 5CW2A 5AKLA 1MNQA 2WFLA 1XZEA 3GA7A 3QM1A 4EZIA 3S8YA 1CUHA 1E8DA 4X92A 1FFEA 1UKCA 1UK9A 5A7FA 1ZD5A 2C5FA 3O4JA 4EY6A 1XRQA 3A6ZA 4Y2XA 2UZ0A 3WK8A 4A5SA 4EY7A 4OD0A 1ORWA 4FBMA 1B41A 4H7DA 4PNZA 2WU3A 4H0CA 2XB6A 1H2YA 1XKLA 4PW0A 3GUUA 3QPCA 5ISMA 4NMWA 5AKIA 2J3DA 1EINA 5HKBA 5JASA 5C7YA 5DNVA 2JEYA 3NOXA 1ZI9A 4YPVA 3WLAA 1AQLA 2OCIA 3A2LA 1K6EA 3BF8A 1CUZA 3HYSA 5DLPA 4IO0A 1E5TA 1Q0ZA 5EHXA 2WILA 5H3HA 1HPLA 2XT0A 3BXPA 4HVTA 1LPOA 1XQWA 2AJBA 1CUUA 3H2KA 4U2FA 4G8CA 4KRYA 1QO9A 4PSDA 4G1FA 1SFRA 1VZ3A 4GDMA 3WK6A 5BWCA 5FOQA 1LPPA 3I2HA 4KAJA 3UMJA 2CMFA 3KXPA 4B83A 5CT6A 2O2IA 5JALA 4FHZA 2OGTA 3F98A 3AFIA 1GGVA 4RGYA 3RLIA 2PSFA 3EQ7A 1ZGCA 2AXEA 4UFNA 3D2BA 4FLMA 4X00A 4L0CA 1MJ5A 4QWMA 4P92A 3QMWA 4OUKX 4FNMA 3ZV7A 2PVSA 3IULA 3AZOA 1AURA 1Q84A 2WIGA 5AM4A 2H7CA 5AK3A 2DCMA 1VXRA 4KAAA 2OAGA 4PSUA 2WIKA 5DTIA 1EI9A 5EHNA 4ARAA 4B0OA 1F8UA 2XQFA 5IH7A 4FBLA 1IUNA 2ZJFA 5LP1A 3I6ZA 1I6WA 4G8BA 4OSEA 2GYVA 3G0IA 4IQ4A 3MGAA 4W63A 2Z8XA 4C6HA 4H18A 1YR2A 4GECA 1EA5A 3G0CA 3WKEA 5CXXA 1CIJA 4UBKA 4G4GA 1DT3A 1MX1A 5ALLA 4GW3A 1SOMA 1VE7A 2IX9A 3OPMA 3H0CA 2VJBA 1PFQA 3DKKA 2JBWA 1YAJA 2GBFA 1LLFA 3G9ZA 1MX9A 1R9NA 1UOPA 3C43A 3AZPA 1UFOA 5IVIA 3HXKA 4ZI5A 5CMLA 5AJHA 5HQ3A 1QIIA 5CT5A 4B9EA 2OGZA 3WWDA 3DOHA 3G7NA 1KU6A 1RWQA 1A8QA 5AKKA 1XZJA 1CUYA 1IMJA 4OCZA 5ALPA 3WYNA 2JGEA 2XMCA 5LZ2A 4YASA 2QS9A 4HAIA 2ES4A 1NX9A 1XZFA 2FX5A 2RAUA 1IZ8A 4G5XA 1PV1A 4UHCA 3V48A 4QWWA 3H2GA 1LPAB 5EI5A 5AIBA 5FUMA 2RGUA 3I2KA 1YS1X 3BIXA 4CIBA 4GLBA 5BWBA 3TRDA 3IIIA 3VJKA 3WK4A 2CJPA 2JGMA 4BYMA 3R3ZA 3PUHA 4EBBA 1E8NA 3DNMA 5DNUA 3VKFA 1QOZA 1U8EA 2Q0XA 4HZGA 5AI0A 1GPNA 4ROTA 3OTQA 2Z5GA 2XLBA 2WUEA 3PICA 3D4LA 5FLKA 5HF5A 4CIAA 4C4XA 1UWCA 2CEKA 1MPXA 1VA4A 3VDXA 5JD6A 1F0PA 3R40A 5LZ7A 4DYHA 3S2ZA 1R9MA 3O4HA 4HTAA 4LXGA 3DEAA 4PO3X 5EIAA 4OYYA 2ZSIA 5T4FA 1DX4A 2WG1A 1P0QA 2V96A 1A8UA 3WKDA 5HKAA 1WPRA 1TRHA 1DWQA 4O08A 4WFJA 3FLEA 3W04A 4DMHA 1CUJA 3G02A 2WTMA 2PSEA 4Q3OA 2Y1KA 3CN9A 3ZLUA 1CRLA 2G5PA 1GKKA 4FNGA 1R3DA 5AKEA 1LGYA 3VXKA 4ZXFA 2RHTA 1XFDA 2E3JA 3H18A 5FPQA 3UUFA 4B6GA 3TGLA 1XZMA 4M0MA 4ZWNA 4LXIA 1R88A 1XRNA 1N5MA 4XX1A 3DKRA 4BE9A 5CXUA 3RM3A 3DL4A 1U65A 2WU4A 1TK3A 1CUAA 2ZVDA 5CRIA 3CCCA 2XUJA 2WG2A 3WKBA 3KOOA 2GBGA 5AK5A 2XUQA 2QTBA 3DJYA 3I2GA 4I19A 5DJ5A 3BDVA 4B0PA 2VJAA 2FJ0A 2JGKA 4NVRA 1EHYA 1R4ZA 1SCIA 4U2GA 1MX5A 2PUHA 1ZOIA 5FXMA 1CUIA 5CT8A 3C70A 3PF8A 3DS8A 1OXMA 2WTNA 1DINA 3DD5A 1CUBA 4UBMA 2QM0A 4W1SA 2B61A 1FFDA 3WJ1A 5ALSA 2BJHA 2XQKA 3WIBA 2W22A 5JAUA 1K63A 3ESAA 5KREA 1BRTA 1QIHA 2WJ6A 4BAZA 3DLTA 1E3QA 5AKZA 4KE9A 4MEBA 4MJ3A 3LLCA 5AH0A 2HA7A 3FLBA 4UBLA 1LPSA 5ALWA 1QIEA 3DL7A 3X3HA 1CFJA 1WOMA 5K3AA 1XRPA 4FWBA 3G0BA 1GKLA 4G8DA 5ALTA 1TIBA 1J1IA 4BB0A 4I4CA 4OU4A 4QA9A 1XZAA 4KJXA 1GZ7A 2DHEA 3BDIA 2CUTA 3LCRA 4E14A 1T2NA 1C7JA 1HKHA 2YXPX 1XZDA 2PBLA 4BAGA 3WWCA 5E4TA 1ETHA 3G0GA 4P08A 2PPLA 3WQHA 3T52A 3UUEA 2BKLA 3MUNA 4Y2VA 3Q0TA 5FKJA 2GYWA 2XQIA 3PF9A 1BU8A 3H2HA 2JGFA 2XUPA 1VA5A 2WKWA 5AI6A 3E0XA 5EFZA 3ESBA 2QKYA 4MEAA 4J0DA 2ONCA 3QH4A 2Z3WA 3O9MA 4MYSA 5FRDA 3IUNA 1F0NA 4LIPD 3WJ2A 3I2FA 4UBOA 3C6XA 3STUA 5HK8A 1E89A 3AZQA 4OPMA 4Y2JA 1Y37A 3JYHA 3V1LA 3M82A 2IITA 2PUJA 1U2EA 1WPXA 5EHZA 4MXDA 1Z68A 4Y2QA 5AI8A 4AO8A 1ZIXA 2PU7A 1XZIA 4RPCA 2VSQA 2DR0A 3GROA 1HL7A 4RE6A 5AOAA 4H7KA 3G9UA 1OCEA 4FFWA 4JNCA 3V9AA 1G66A 3M81A 3O4GA 3FVTA 2QRUA 4G9EA 3WWPA 1BCSA 1WB6A 2EDAA 3L1IA 4BATA 4X6YA 4GWLA 5ALMA 2XMQA 1L7RA 3C6ZA 4H7EA 1UKAA 2OAEA 5JANA 4J3JA 4FOLA 3FYUA 4IHAA 2XQGA 2DQZA 4FLFA 2V9ZA 2I3ZA 2ZJ7A 2IIVA 1EK2A 3V1KA 2DSNA 3STVA 5A62A 3EIOA 4RNCA 4BZZA 4C88A 5D6OA 5SYMA 3F97A 3E1GA 5LYYA 1WCYA 1DWOA 5JYCA 4KEAA 1ACLA 1JJFA 1XZKA 1ISPA 4AO7A 3DDUA 3IBTA 4TGLA 4AN0A 1W75A 3SK0A 1VOTA 2Y2UA 2G5TA 1FFBA 1ODCA 2XI4A 2VTVA 4DM7A 2PSJA 4JYMA 5C8ZA 1ZI8A 4H7IA 1CQZA 1SCKA 4A16A 2JGIA 2BUBA 3I6MA 2VA9A 4X85A 1W6RA 5DYWA 5DYYA 4J0CA 1WB4A 1YB7A 5ALUA 5JAHA 5I8PA 3I2JA 1XLVA 1CR6A 2WJ4A 5K5EA 2HADA 4FFVA 3C5VA 2HA6A 3H2IA 3ED1A 1QTIA 4BDTA 3OURA 3OM8A 3OOSA 1LPMA 2OQVA 5LZ9A 4U2CA 1C4XA 1TCAA 4F0JA 3FYTA 2VJCA
chains in the Genus database with same CATH superfamily
1RRVA 3WZLA 1CV2A 5C7IO 3QSYA 2OPHA 4J2TA 3T54A 4X3CA 2V3VA 1H4TA 2NO9A 3UJ6A 3WL8A 5FV4A 2B7CA 1AXGA 1V25A 4PZCA 1NXTA 3V7FA 3ZC3A 4YCNA 2AC7A 2GILA 2QBYA 3J7AC 2BZ0A 1YDMA 2IHZA 2LVBA 2HRBA 3BM5A 3PGKA 3TLBA 5I4BA 4ND8A 2ZREA 1UC9A 1UT5A 1TM2A 1J8FA 4WWHA 1DX6A 2QX7A 3U62A 2QD4A 4BFWA 1E2KA 4UNPA 2P6RA 2CUKA 2QORA 2QN2A 1T9GS 3K0BA 4KGXA 2E7ZA 2O52A 5IDYA 5YASA 3TX2A 4H17A 1TL7C 1ZZEA 4KLCA 4FI3F 4EJFA 1V1MA 2B7LA 2IEIA 4Y6OA 3C3CA 3UFXA 4AZ0A 2EKZA 1CF4A 1YB1A 1RPNA 1FTWA 1P1BA 1Q0RA 1D4AA 4Q02A 1REQB 5FFFA 1JQ5A 1DJPA 2FYTA 4Q05A 4BO1A 3ZBUA 4BVKA 3PKIA 5KYXA 5EKXA 3W2EA 2BFEA 2Z4RA 2AW3A 3MB5A 1RAGA 4XIJA 4NCBA 1XG5A 3QVSA 4R4JA 3SSNA 1UK8A 2C5LA 4GKAA 3SFVA 4NDZA 1KL7A 2F1IA 2ISQA 4PYKA 1NV8A 4M88A 4DLLA 1G8FA 1Z83A 2Y1CA 4E33A 4QGSA 5B57C 1QYWA 3LWBA 3EXAA 2OORC 4ENVA 4TS1A 2EG9A 2OAP1 4HZUB 3MTBA 2QTFA 3FETA 3NJ4A 1MTOA 4GZ6A 4M0KA 3TZEA 1W6UA 4B85A 3EIXA 2IU6A 1U6JA 2YXEA 3OBIA 1H0KA 2ZDQA 3PQ2A 3DFFA 4RHEA 3ZCUA 4C4PA 3ICQB 2PS3A 4ALNA 2BSXA 1PQ4A 2SBTA 3AVVA 3FOAA 4BVAA 1AC5A 1IZ7A 5EZYF 4HWOA 4DLXA 1QLHA 2HL6A 1EFPA 3HKDB 4ANFA 3FMOB 1WXDA 1EK5A 1F6BA 2YV1A 3NTRA 4O6VA 2ON6A 2J0SA 1V1RA 2I6QA 4YT8A 3HXPA 4MI9A 1QX4A 3MWLA 5LPNA 2QTTA 1NVBA 1J9ZA 2YYYA 2ZSEA 1TCVA 4LQCA 3W6ZA 4RGQA 2H29A 4JXZA 4OM7A 1KDOA 5BN4A 3V2GA 5FBVB 6YASA 1Y1KE 3JAKA 4UVDA 1EDOA 1JHAA 1H1LB 4QIHA 2ZB7A 1TVMA 2IU3A 3G8BA 3LF2A 3NEPX 2NU9A 1G18A 4IIJB 1TUBB 5DULA 2Q50A 2H4WA 1VI6A 4HNAA 1PVOA 5EFOA 2IY7A 1TKRA 3IALA 2OCLA 4PC3A 1D09A 1EVZA 1QFMA 2A5FA 2QX6A 3FHCB 3PNQA 4OFZA 3T9DA 2RC5A 1KO5A 3SGLA 3KHTA 5DOVA 3EY9A 4OQNA 2P6MA 2Z4TA 3RUAA 3HR7A 1YAHA 1NAHA 2C58A 5CLLA 4AUKA 4QU5A 4J0GA 2PL9A 4PYRA 4WRRA 4KN8A 4N7JA 2X2FA 4BLPA 4EB6A 5C32A 4QL3A 2HV9A 2JAHA 3ZX5A 1Y8ZA 5E9AA 3O82A 5IAGA 1UZNA 4M87A 4CF3A 2BKXA 1YHNA 2JBAA 1QC5B 2HD4A 3U60B 2AT1A 2CYCA 2ZDHA 2ZVPX 3LCVB 2C3OA 2EYQA 3KT0A 4XARA 4YWJA 3VC7A 4CMEA 1CUEA 3RJ5A 2W2OA 2JLYA 2PKCA 2PYIA 4D3YA 5FPYA 5T57A 3K3PA 1B3RA 2EEZA 4XPIA 2PE5A 3PLAE 1HX7A 1R8JA 1QV6A 2VHCA 4ARBA 5HTKA 1TW2A 1ZH4A 3LDUA 5JHGB 1ONOA 2D2XA 4P22A 3A25A 3ISVA 2N75A 1Z7WA 3ER8A 3IJ5A 4X63A 4FIDA 4QO8A 4A3SA 4KXQA 1C4KA 1JG3A 2O7VA 3FKJA 2PSDA 4MAMA 3JPYA 1Y4SA 4F2GA 1ATZA 1FLVA 3JQPA 2C2ZA 2HA3A 2R5WA 3OZXA 3AVXA 3ET4A 2BRUC 3FNFA 2PKQP 5IJ0A 3PL5A 1S9HA 1Z6YA 2QU8A 4PSAA 1E1NA 1LVHA 3QE0A 2CK3A 1TJNA 1A9PA 1TMYA 4H1TA 4F86A 1JECA 4F1WA 3UICA 3NDPA 4C20A 4JJGA 4OKNA 5B4UA 4D9MA 5JXGA 1E9DA 3RSQA 1GL7A 1YQUA 2OECA 3CNHA 3ETJA 1XXHB 4WCFB 1F0YA 1PCXA 1ABBA 1CFZA 1YONA 3KJEA 1BTOA 4G5GA 4LAFA 1FFHA 5DN9A 3U17A 3HYRA 2ZB3A 3OA0A 2P7IA 2IHJA 1E66A 1U2GA 2G1JA 3HCCA 5DEOA 4E94A 5A9SA 1ZCAA 5TF4A 2C29D 5IARA 3FOEC 1DGQA 2J9XB 2FEPA 4AYTA 3AXTA 3P0FA 3F7NA 3Q3CA 1DBWA 3PGVA 4JBYA 1I3CA 2MR5A 3UMCA 2ZTUA 3PNLA 1SQFA 5EJ5A 2JJ1D 3PC4A 2A86A 4B82A 2REOA 3CF0A 3PUIA 3R9XA 4L6CA 3GVXA 1ZIPA 2E37A 2OENG 3BWDD 5I01A 3RYHB 4JP5A 2NNLD 4IQ0A 1LFAA 5IKXA 3R0QA 1QE3A 3PIRA 3JQDA 3DTYA 5IK2A 4ENWA 1LSSA 1DXYA 3DQQA 3KJQA 3O2QB 2D1RA 3KB2A 1QCDA 1XAHA 3LA8A 3ODGA 2C4HA 1JMKC 4UCXA 1BW9A 4IWXA 1JU3A 1EGMB 1WG8A 4AY5A 3RFCA 2DHCA 3QI2A 3HCRA 3EASA 3CPHA 1SCAA 3GYBA 3CIOA 3T9CA 3UJCA 1WJGA 1M1NB 3ZWNA 5C7LO 1P9RA 4YJFB 3DEFA 1V4NA 2KSQA 3EYAA 1AHNA 1L7VC 5JADA 3A6LA 5I47A 1FA9A 4MW4A 3GLHA 1K8YB 4NJOA 2ZSBA 3TXYA 4BKOA 4QT0A 3CN7A 3USCS 4I08A 2VBGA 4OLFA 4EJ2A 3MJHA 2FDCA 2J4CA 4WDQA 3RUIA 2IK8A 2XGJA 3PVCA 4CM9A 1KO4A 3U3DA 4AF7A 4QOSA 2LKCA 4C2AA 5ANRB 5B7GA 2HMUA 2I76A 1KOFA 1WDLA 4PRZA 3VR5A 4RHXA 2IPXA 3B2NA 2WHQA 2J07A 5M34A 5C1PA 4LNUB 1F7VA 3LPAA 2X4LA 4G5OA 3LWZA 4URFA 2CDBA 3U44B 5E6RB 5DGIA 2PZ8A 3ESDA 4KI7A 3ZGYA 4G09A 5IDWA 1D4ZA 2ZYVX 3SYNA 1A2OA 1XCGB 2OOKA 3ROMA 2BUAA 2PWAA 3GEMA 3AF5A 1EX9A 2ZETA 3M4JA 1I33A 4L8FA 4UQOA 4JB0A 1Q3HA 4F46A 1CHDA 4AT1A 2PWBA 1Y6ZA 4CI0B 3B6MA 2XEXA 1KWGA 1JEYB 3IKLA 2HCTA 4AFNA 3U7RA 3NM5A 1VGRA 3HL4A 4C2UA 4FZ3A 1W76A 2AX3A 2QTVA 2JFHA 2TMDA 2I67A 4L5YA 2XCQA 2AW5A 4FPXA 3QWIA 4LRQA 5CH5A 3QE9Y 3COJA 1HEUA 3UH1A 5L4NA 1Q7TA 1H2AS 5KB3A 4NBSA 2D1FA 3GJTA 5ICEA 4NQRA 3WVNA 4DN6A 3QW4B 4D4IA 1B1CA 3NANA 1L2TA 4YQFA 1Z4OA 2WJPA 1T8UA 3HCEA 2CKDA 2ZJAA 1G8PA 1TKAA 2YUTA 3DFIA 3ZLJA 2W6ZA 4MW9A 4CV3A 2W2VA 4XJTA 3ZE8A 4F6CA 4FN4A 2JGNA 5BMVB 5TT0A 1M2OB 3UHJA 3ASVA 3JQ9C 2EF1A 3C15C 4HUQB 4D5EA 3HB0A 4ER0A 4BXOB 1KF0A 5KNBH 4GAEA 3WLFA 3DXYA 4QRIA 3M9WA 4HAYA 2UZ1A 1FUUA 3ESCA 4ODIA 3T1NA 1M5TA 3I1YA 2YWFA 2POQX 2NTYC 4J0IA 3GN1A 4PAMA 3P8ZA 3FMFA 1NZJA 1P17A 4WKOA 3WGKA 1P0CA 4F12A 2OA0A 2HRRA 4B8WA 5JH7B 1WV0A 1C1DB 3DW3X 1USVA 1X92A 4JOBA 3PCRB 3SQWA 2WTAA 2EX4A 2VP4A 2Q7XA 3F5DA 2DTXA 4GIBA 4MI6A 5ILGA 2JL1A 1GPH1 4EK9A 4YPOA 2UYHA 8MHTA 2BGWA 4K9QA 2PMWB 3AEZA 2FMUA 3N2ZB 3ZE2B 1L7OA 2FN8A 2YOGA 4ZVUA 3T99A 4OGWA 5AK4A 4GGMX 3PDHA 3ZI0A 1YK1A 3IAUA 1QRAA 3DZKA 3DDWA 3DYVA 3O5AA 2GAJA 4D9EA 4EKIA 3OTHA 1MD9A 1ADBA 5IHXA 3VPAA 3OOWA 1Y7TA 5F4BA 2H1FA 2OCGA 4JHLA 3T15A 4FMDB 2ZB2A 3HO6A 3GPLA 3DZJA 2BTQB 2H6EA 4PZZA 4CR7A 4CIXA 5JQGF 3A7EA 3EZGA 4NONA 1HA3A 1MOQA 1Y8RA 4AAYA 4GZ5A 3BPSA 1MFPA 3ZHOA 5LP6C 1DNPA 2GGSA 1II0A 3OX4A 1KOLA 3DL2A 3FBWA 3JVIA 4HZIA 4YMUA 1XA3A 2DX7A 4MS3A 2EZTA 4BVBA 1D8AA 1GA6A 2A1UA 4M36A 4UHFA 3TTSA 4PPYA 4KFCA 1FQWA 4GBED 3ZHQA 3LPMA 2IUSA 4WQMA 1YIAA 1ZM7A 2H3HA 2PGLA 1KTIA 2W58A 1FEZA 1Z8NA 5EZ5A 2I6XA 4OX9Y 3A6KA 5JCOA 2HJWA 1A7KA 4K28A 5LMUB 3HV2A 2VA8A 3KEFA 4L85A 1P2FA 2WTUA 2Z09A 1T9HA 2F3SA 4JQCA 3TCKA 2GUWA 5KVVA 2GK3A 3N07A 4JYPA 1TQDA 3L8FA 1ZD1A 3IVMA 4KO4S 2JIPA 3ENVA 2JGDA 4QC2A 4B2LA 4RK7A 1S8AA 3O0DA 4XJVA 3G9TA 2BJVA 1SHKA 4P0QB 1JHXA 1GFWA 2QQ0A 3KK0A 1U4SA 4IW3B 4X7BA 1PW5A 2BEKA 1MQAA 1WXQA 2GRUA 1PDVA 2Q1UA 4NYJQ 3L0PA 3HP4A 3IP7A 2I1VB 1X1SA 2LE0A 4K9PA 1U8TA 9LDBA 1ACJA 2P4HX 4ZOBA 2VTBB 3QFFA 1X7ZB 5LQSA 3ZWPA 3OKPA 1J99A 3ZD9A 3TG8A 4LDNA 2A0YA 3U49A 1DIAA 3MMXA 4HWRA 1YRAA 5BSEA 2CCKA 1LRJA 4LYJA 3ISJA 2GCOA 1EJ2A 1EX7A 2PZLA 3INTA 3PQCA 2G71A 3V2IA 2VDNB 2XGGA 4JDPA 5DNCA 2XZDA 3L7JA 4JT9A 1MC1A 1OIWA 3S0JA 1B6RA 1L4LA 1N6HA 3R6DA 5DX8A 3V34A 2CVHA 5CB0A 1XC7A 2AOTB 2AMVA 2QSJA 4OQPA 5FR2A 3HCOA 1JAXA 2C98A 4BO3A 3L4KA 4MQLA 2IYRA 4BBAA 4O2BF 2JIBA 5LQUA 1W85B 2UZIR 4CKCA 3FZNA 5ENVA 2W11A 1KQPA 5DWVA 1AZSC 1CS0A 3OCUA 4IEFB 1XCJA 2JK0A 3W2GA 3WLLA 2G1UA 4EIWA 2EWMA 2PMKA 1PFWA 2WR8A 3JV7A 4GKKB 2CUNA 2P9ZA 5JO0A 1XDUA 1YCFA 3HA5A 1GL6A 3IEPA 4ZRDA 5K8IA 2C7OA 2FUG6 4FFSA 2DF8A 3PQ5A 721PA 1DJOA 2H1RA 2MOKA 2V6BA 2YC2C 3GEBA 3H5WA 2LIVA 3UAXA 4HYTA 4CNQA 4CV0A 3QU2A 4KKXB 5ALGA 5JYDA 2O05A 3FWYA 3VOAA 2ODPA 3OBBA 4C5BA 3DJFA 4N54A 1GG2A 2QTAA 1UT6A 3NYQA 4LNAA 2FSUA 1UFKA 1JDUA 4HAXA 3TG2A 2O1SA 2FZKA 3W8NA 2APJA 1YDWA 5IBCA 1TMKA 4R9SA 1SIBE 1JYSA 1JALA 3JQBC 4BMYA 2JFXA 4FSHA 3WNQA 3HDJA 4XX0A 2H51A 2PV7A 1P4AA 1DFIA 2N47A 3FMVA 1KSFX 4KRFA 5BN5B 4EHIA 2YV5A 5KI6A 3H5LA 4DCPA 5BVGB 6Q21A 3KZXA 2OQ2A 3BMQA 3RRBA 3JARA 3TQQA 3AL0C 2IYNA 4QPCA 1Z8HA 3JWEA 4IKPA 3V4RA 1PJ8A 1ZICA 1FMJA 1WDWB 2Z83A 4ZYTA 5AM2A 3H4IA 4KIWA 1AKUA 2CLHB 1B0UA 1WP4A 3ANSA 3G1UA 1XXLA 3VDQA 7YASA 4QM7A 5A2GA 4DR3B 4NLLA 4NG5A 3TJMA 3FNGA 5TMDA 2QW0X 2DBVO 1L5LA 5E2AA 4EA7A 4LISA 4EEZA 2HGSA 1GGNA 3QTTA 2ODBA 5AW3A 5ALYA 4TXMA 1EB8A 2WB2A 3K05A 1BFDA 1E1DA 1NUAA 4G2NA 5EXEA 4ALKA 4QLOA 4EVIA 1VL0A 4KQJA 2A30A 2F3QA 2YWRA 3KSMA 4IGEA 2UKDA 4JLBA 4D9GA 1QU2A 1U3WA 1AKNA 3NOOA 3D1LA 2H2WA 4LDAA 4FX2A 1JJIA 4KE8A 1DTSA 2XRYA 1QTRA 2OV4A 1A5ZA 3LUKA 4M76B 1BROA 2HLDD 4ZV9A 1JAHA 4ZOLA 2DFNA 1Z0ZA 2JFPA 2ERCA 2ZANA 3GCXA 4MUIA 2Z4SA 3NHMA 4PYNA 1Z8FA 4NEGA 3J7TA 1CULC 2HHCA 1CXZA 3K9LA 3RIMA 4FC7A 3R0VA 2BR5A 2QOEA 4RKYA 2JJ1A 5EHIA 2YY5A 3PEUA 5EGSA 4F72A 2DLCX 1ZJ5A 3EAFA 1NZFA 3K4PA 4FOSA 4GOXA 2E4UA 1QG0A 2TMKA 4KXXA 1YRBA 4QUKA 4DA8A 3AYXB 4NY1A 3RTEA 2YMMA 5GONB 1CNMA 4BWFB 2PXXA 3NU1A 1WXFA 4EJSC 3RIYA 5ALQA 2QGZA 1MFZA 2VYVD 1DRVA 3BWMA 4WY8A 5JECA 1F14A 2VCYA 1E7YA 2FE1A 1P1IA 3NV9A 2R7KA 1YB4A 3R4CA 3RYIA 3CF4A 4ZMSA 3VJRA 4FXOA 1A5BB 3B7PA 4NCKA 3DTVB 2XAUA 3UK7A 2PGIA 3T9FA 2FTKE 3EXG2 1IJFA 3N7UA 4XE5A 3F96A 2FFQA 1MQ9A 5BYKA 1XCOA 4OB8A 2XX3A 1UF9A 3E4DA 4G1VA 1X7WB 2GZHA 4JQSA 4U00A 4ZQBA 3TL6A 5TT1A 5AKGA 2G3YA 1KQOA 2BHLA 1HYQA 2DVMA 2XIQA 3D3WB 3TX6A 3U1TA 4A1FA 1KI9A 5LC1A 2PX6A 4FQ8A 5HCUA 3MUOA 2CN1A 2D5AA 4DV0B 4UUOA 2X2OA 4AECA 1SCBA 1BCRA 3ZWWA 3RRZA 1CLUA 1H2HA 5IG2A 4B44A 1OZFA 3DLIA 4CKWB 4D82A 4OLAA 2NP7A 3NC0C 1H1TA 2VPWA 4C1BA 2FN7A 1UBNA 1QS0B 1WF6A 3FA2A 5CVEA 2O5VA 3ROPA 1HLDA 1O87A 5JD4A 2YASA 4MUFA 5F3WB 3WGOA 3IBCA 3LPDA 3BRQA 2Z9DA 2NAPA 4DADA 1UXJA 2ZYHA 2YIDA 3OZIA 3K1ZA 4C87A 1HXHA 1V8PA 1XZNA 4ZCMA 5DM70 3OQJA 1Z2DA 2WZBA 3IEIA 3QE2A 4FEGA 3VGJA 1TCBA 2HU2A 2EXXA 5HZKA 3SI7A 4S12A 4I1IA 2HIGA 1YI1A 2AKYA 3M4ZA 5FORA 1Z8DA 4O8CA 1GPMA 1XXHE 4QREA 4MV8A 1NW4A 3KKEA 3I6BA 4D8XA 2V98A 1V43A 3IUPA 4KREA 3DBLA 3N1UA 3DMYA 3TTUA 2JZOA 1T9KA 4IUDS 4HN4B 1DQYA 4JEIA 4HNVA 1UOQA 3SC4A 4RA6B 2BR4A 1IUOA 4I8DA 2PGDA 3L49A 1MV8A 1IJEA 2HA5A 5AJZA 4ZVMA 2ETVA 4BOYA 1T9GR 4IIVA 4MYDA 4KKVA 4GMGA 1JDNA 3CV3A 3R3WA 2X15A 1FFCA 4HH0A 4I8IA 1INLA 1GARA 1YDHA 3FDFA 2IE0A 3QYAA 2QMZA 1MA0A 2WV7A 2XMGA 3A6HA 3HXMA 1A8PA 3VKGA 3PENA 5JAIA 3AEUB 4XXHA 3F2IA 3OZFA 3LDAA 4G0MA 3V3KA 1RRGA 3W2TA 1TEVA 2EL7A 3AUAA 3LFTA 3EZ2A 1RCFA 4YMTA 3EVEA 3BGVA 4FDTA 5AM1A 1PS8A 1Q15A 4RSMA 1K68A 1ZL2A 2C2KA 4P34A 1OILA 1ZC3A 3WDSA 3EXHB 1MN6A 3ZU6A 3ZLVA 1U0BB 1DB3A 2YFQA 3SEAA 1ANKA 4L22A 5J4HA 2YXLA 4TYPA 3D8HA 1GTJ1 5LZ5A 5THKA 1MO4A 4IDAA 2C2YA 1X42A 4BNYA 5KSOA 4ITVA 1W4RA 4R8KA 4TUYB 2H5JA 2UXDB 1UAYA 5GJBA 1RPAA 1PYDA 1NA5A 4D4GA 1VHJA 1PS0A 1YFLA 1ZI6A 4GPEA 3BXHA 4EUEA 4KXYA 5TNXA 2CT8A 4WBSA 3RVOA 1U7ZA 4H3SA 3MJEA 3PZBA 4IH9A 3SXUB 1O96B 4BFCA 1VG1A 2Y8EA 4YPFA 1MLDA 5T4BA 2ANCA 4TVKA 3N86A 3PXUA 3U39A 1N3LA 1AUVA 4A03A 3NLLA 4F9TA 1KETA 2JLCA 3KFVA 3NONA 3UJ8A 2QRNA 1BXZA 1KKMA 3MG9A 3PGMA 1U3DA 4B3SB 3NBUA 1ZIOA 4YT4A 2ZYGA 4TROA 3KCNA 1DDIA 5DBGA 5CA1B 3AGQA 4GI2A 4Q6WA 1J2RA 4I3FA 3CO5A 1NVVQ 1MNAA 1PL7A 2R7AA 5JYBA 4CVNA 1KH1A 4P81A 1CIVA 3VU9B 3RSSA 3O4IA 4HQRA 2H92A 2R86A 3ZWQA 3MWDA 5CX1A 4JMPA 2AOUB 2MYTA 2IHTA 4CTJA 5IZ4A 3A1UA 2JAWA 1KZ9A 2NQ2C 2W2LD 4FCVA 1CUSA 5JATA 2HHHB 1YQGA 3QEOA 1P4RA 1EGVB 2FPPB 1NW3A 4R2HA 2H7YA 4YJ2F 2ZQ5A 4BV9A 4P86A 2DETA 2KW5A 3EEBA 1RPJA 1TW3A 1O9HA 2GVNA 3TNYA 3W4JA 5J47A 2GCNA 2PMFA 3BH6A 1PDOA 1QBKC 2B37A 1MOPA 2QL5A 1RTKA 4ZCIA 3SNKA 4WZAB 4MUNA 2VOJA 4UFPA 4JI3B 2ZM5A 1EFCA 4AZSA 2XV1A 1BMDA 3WZMA 4WBNF 1HFEL 5CIWA 2JG3A 1L6RA 4KR0A 4A6EA 4BJ5A 3BIWA 1GITA 4DMLA 4AMUA 3MWKA 5TIIA 1V37A 5DYGA 5GIPE 1RQGA 2NU6B 3A58B 1F2TB 3ZY2A 1ZUIA 4K5QA 3H5AA 1IG0A 4YRZA 3ONNA 1L7AA 2H1CA 4WGGA 5AKYA 3GJ0A 3LIIA 2GZ1A 4F4FA 4Y9RA 2H5LA 1E62A 2NGRA 2R1ZA 4KH0A 5CBPA 4C0QC 5D3QA 3ONVA 2SNIE 5A4KA 3FPCA 2BFFB 4IIEA 4MKFA 3ZWMA 3VOTA 1I94B 5D8DA 3FDZB 6ABPA 3KQYA 5ALDA 1IHYA 2FXIA 5KYWA 1RPZA 2Q6VA 3G2LA 4XUGB 1NKSA 4UHBA 1G4UR 1Y3AA 3EULA 5HGXA 3DEZA 3PKZA 2A9VA 1WPGA 4AG5A 1M67A 3F1KA 4X97A 3GRUA 5G0TA 5JCZA 2J87A 4H3HB 3LUHA 4HX2A 3WFIA 4ZPJA 3MAJA 2ZIAA 3H7IA 3TGWA 3ZIDA 4BU1A 2GERA 3JQ8B 1K5PA 3IERA 2A3RA 3ZU5A 4BKQA 2BMDA 2ZIGA 4H15A 4JL5A 2FFBA 3BE4A 2ZRKA 3D6MA 4KC0A 4KQFA 5C8DA 5JS7A 3GFOA 4A92A 1HE1C 1DDOA 3AUFA 4R2XA 2HR1A 1O6GA 5JDCC 3WYBA 4PX3A 2G80A 3ETLA 3TM5A 3GLUA 4ROSA 4RTQA 2WDZA 2QMQA 4MEJA 5DWQA 1TT5A 2AZTA 2WG0A 2HA4A 2NXCA 1MB3A 1V8ZA 2YN0A 3H1EA 1RYFA 4J49A 4MV9A 4IDCA 3WHLA 9GPBA 2CHEA 4OK5A 4BX9A 4KQ2A 3TRJA 1GV0A 1N2CB 2Q6IA 3O8NA 1XRSB 5DHFA 4LQLA 4MGHA 3ELUA 3U4GA 4RCVA 3COSA 1RXYA 4NPCA 5LZ4A 4B3IA 4I55B 2BH2A 2MMGA 2Y1EA 3HN6A 3LW7A 1RHRA 5TY0A 1PJTA 1RKQA 3HI6A 4TYQA 5JXIA 3Q72A 3ZE0B 3GA0A 4DV5B 5E6SA 4DNXA 4LI3X 1Q0QA 4YBRA 3AM3A 2Y1GA 4X8HA 3TLEA 2IUFA 5T3YA 2XEDA 4PRYA 5JS2A 2R8PA 1TCUA 4D8VA 3DWIA 2HU5A 5CT9A 3F73A 1JT2A 4JCCA 2BFNA 1XA0A 2QZ9A 1VMAA 4OAOA 4KHPB 1Z6ZA 3DXZA 1R0ZA 4FKMA 3TXXA 2EGGA 2GEVA 1XTVA 5IYZF 1CDEA 1DDGA 1MH1A 2BLNA 4Y0VA 5F52A 2QZJA 4EFNA 1JLLB 3UJPA 1BDBA 1SHUX 1HNZB 3QEBZ 2GKGA 3K6SB 1A2BA 2CXNA 3NTLA 1IHUA 2O6LA 5LP6F 1JJ7A 4UVIA 3SEZA 4DR5B 2DQ4A 3Q5EA 4O4HF 3PNBA 1JEEA 1P2UA 2ZR0A 2A67A 4Q9NA 4FVTA 2C5HA 3FNBA 3B85A 4R2KA 2W6JD 3I01M 1OXUA 2EAUA 1VFPA 5DXAA 1PRYA 2AQKA 2WT9A 4JUBA 1BA3A 4JLMA 4B5LA 3NBKA 4OQ4A 2IWHA 1QIKA 2BM0A 1AKQA 1Z2NX 3PK0A 1TEHA 3ZKWA 1A4XA 1DEOA 1QK4A 4UU8A 1ADJA 5J5CA 4D57A 3LXRA 3U7HB 4RMNA 2VC2B 1X0XA 4RIIA 4XGRA 5FHQA 4DMUB 4N5DA 5HSGA 5ITSA 2Q9BA 3WGVA 1YQTA 4AZVA 4GZ3A 3W9BA 1QE0A 1KIFA 4B4UA 2C78A 3B7WA 3VKVA 2O2YA 1Q3TA 4LHWA 4RHCA 3ZBQA 3OEYA 4TXLA 4FUTA 3WWEA 3O95A 5AXAA 2Y1LA 4JGIA 2GR9A 3A2KA 1LPNA 1J5EB 1KAOA 4MWCA 4J0KA 3RANA 1KZGB 3S81A 1KOJA 3IEUA 2R79A 3MTDA 4JXJA 3HB7A 4MWTA 3GJ3A 4MPRA 1Z4MA 3KEQA 1KY5A 3L4JA 4RVCA 5KNDD 1DE0A 4EYQA 3WGYA 3SIRA 3P45A 1G6HA 2F1JA 2R97A 4B4WA 4P4NA 4ZA2A 3KQMA 5UKDA 3DB1A 1YJ5A 3EG9A 3LCMA 3PWTA 5D3ZA 4WHMA 3WL4A 1STOA 2QNBA 3OCVA 3VTFA 1D6MA 1HRKA 2GYUA 1BEEA 4XW2A 5EPOA 1NNUA 1QYCA 3OX2A 1PTKA 3HE3A 4MSUA 2DUMA 3LHIA 1NUUA 1BHO1 2AXQA 2VI5A 2I99A 3DAFA 3N2YA 5ALRA 4ASUD 3LHKA 3O4VA 3FTDA 5LR6A 1PAUA 2WHPA 3B1WA 2ABWA 3S1SA 3SXPA 3R77A 2YMQA 1EFTA 4JH0A 1XEXB 1ZMOA 2MYNA 3R4VA 4A2PA 5KTTA 5KWSA 4KIGA 1NHWA 3K0SA 2AD1A 3DO6A 4OYLA 3ELDA 1KP3A 4GX2A 2DPLA 4J7XA 5KNLA 2XYGA 2P9CA 1K06A 5ESRA 1PBNA 1C3EA 1M8JA 3DPIA 1FQJA 1PL0A 2J3HA 5D01A 4D26A 3AHEA 3M4NA 4IMJB 1E5QA 3FVVA 3L05A 2FWNA 2CJYA 3GMDA 3O0TA 2B4KA 3DT8A 3QPBA 1M1ZA 1ZGJA 1C4OA 2W6IA 4EEKA 2DG2A 2EX1A 4CDNA 4UPDA 1W0JD 3RF6A 1DUIA 2V6JA 4CT0A 1ZK0A 1S7CA 4XIIA 1SZJG 2ADMA 4FQ7A 2IE8A 4RHFA 3E8XA 3INNA 4HJXA 5A3SA 1JKJB 3D8RA 5HE8A 5GINE 4ARIA 4GMKA 4QFDA 1BMTA 1I2CA 1XTBA 1CR4A 2ZIWB 4ZI2A 1MOSA 1AX9A 5I7WA 3CM0A 2GM3A 4EG4A 2CFOA 1N7GA 3ZZTA 5KWIA 1JB1A 4GGPA 2ZRMA 1KP2A 1BE8A 3PTLA 2NO4A 4KQKA 2VNJA 1TO1E 4MDYA 3DEYX 4Z1MD 1ZLXA 5TQ2B 4FMPA 4JYAB 3F8TA 4M9ZA 5CTJA 4JC4A 3O1JC 2YNMC 4WN9A 4X3PA 3C48A 4LZAA 4YDRA 2ILTA 3AFHA 4RVNA 1D03A 3RT9A 1P7ZA 2OHOA 3C8HA 4FJ2A 1D2GA 1G2OA 1ICIA 2II6A 1GPUA 4N5IX 2I03A 4RS3A 4XGKA 2B98A 3KUDA 3VV3A 1Q21A 3WBKA 3AJAA 1XR3A 2BGGA 1I5EA 3WTBA 1YU9A 1DKUA 2X3FA 3K72B 4V1CI 4XVHA 1E9RA 1SKAA 2AWNA 3AR9A 3IBSA 4MAFA 4FDMA 4WXEA 5E4JA 1JP7A 4EWLA 4AULA 2XDQA 1JDJA 5IAKA 1CCWA 1ZRSA 5F77A 5A4MS 4RUKA 1GPLA 2QIPA 4HGZA 1JQKA 1J8QA 1L5QA 1WW3A 3EGVA 2QYOA 1H0SA 3BXOA 1LX6A 2KBFA 4V0NA 3LL4A 5TS2A 5F7OA 3TUJC 2FZVA 3JQ7B 1J1ZA 1ZX1A 3LQYA 2XW6A 1XU4A 2J46A 4BPBA 3EVAA 1K8ZB 4QVIA 3GHYA 4TZ0A 4YRLA 3B1YA 4QGBA 1OFUX 2HQSA 2QM8A 1WEKA 1U7HA 3C45A 4CFSA 2BN4A 1KZ4A 3A28A 1R6AA 2AFIB 3RU2A 1TAUA 1WCIA 3FIUA 4DE5A 1AXEA 1Q1QA 2FWRA 4D46A 4OXQA 2VG8A 3GFPA 1W9HA 3P5SA 1LA2A 3MIIA 3WI7A 2X1LA 2RKOA 2VWQA 3O75A 1BVYF 3R9KA 2AYYA 3I73A 3Q8MA 1T4MA 2I71A 5BV1A 3ADPA 2ZBEA 5KQGA 4JB3A 3TIFA 5KQPA 4YI5A 2W2LA 1RXWA 1C7QA 1JPNA 1XL1A 4G97A 1N6OA 3LLVA 4PZ0A 1T8SA 1XDZA 1WHSA 3PEEA 5KDDA 2JB9A 4N8SA 2AHRA 2LTAA 2Q6KA 4GR9A 1OY1A 1FMFA 1N5OX 1O4WA 1NUQA 1BKYA 2HSZA 2QE6A 3REQA 4I46A 4RVHA 3QX8A 4MTCA 5F4ZA 1H4QA 4L3WA 4AXBA 2C0CA 2J0QA 2BI7A 4HDRB 3RSCA 1VHDA 2X40A 4Q1EA 3LW8A 1R66A 4CLXA 1JEQA 3HADA 4R84A 3S2GA 3SFTA 5TMPA 2D4HA 1D04A 4H7FA 5CVCA 1FNSA 2DHDA 3GUHA 2WYHA 3EBOA 3I6YA 2MSEB 2C4KA 1E99A 1ZJWA 4H4CA 1O97C 2B78A 2HDNB 3F4LA 4BQEA 1ZJ4A 4LVOA 1U1CA 3I8OA 2DTDA 1ZBQA 4H0CA 4KJZA 3C3MA 1SKYB 1LI4A 2QUAA 3CRRA 4EQ6A 1EXDA 4HKTA 1RWWA 2N0SA 3EA5A 3FLMA 2A35A 1ECLA 4ATNA 2WEKA 1QVRA 5D7NA 3A9UA 3CVXA 1D0IA 1BXKA 3NBZC 4J9VA 2QMOA 5BSHA 5IF3A 3E2IA 1BZYA 3UAYA 1WP9A 4N47A 2P2LA 4ZKEA 2YMLA 3CW8X 4LJ9A 3MB8A 2HXGA 2VHJA 3HBJA 3MTAA 4RBNA 5EXXA 5LSAA 1EXVA 2YKGA 1KYXA 1X2BA 4OYRA 1XD2A 4RKEA 1GRQA 3T3EA 2V7VA 4V2IA 4GS5A 4IAOA 4XIFA 3GP5A 5IW8A 4P53A 2HZBA 4PG7A 3E0QA 1JDBB 1JHPA 1DU4A 1R5NA 2CFIA 2VP2A 1OFGA 3J81k 3H8WA 3VR6H 2HXSA 2C42A 5CNIA 5JNTA 4D9CA 1PT8A 2Q9AA 4BMDA 4M46A 4R2WA 4B3TB 2UVDA 3VR6D 4CKYA 1MO2A 2XR1A 1ODTC 1DKPA 3L7KA 4KYVA 4MJLA 2QVBA 1XROA 4KSBA 2PS1A 4US1R 1IN8A 3JWGA 3SHTA 3E5MA 2I6FA 3WQQA 4CEIB 2Z3ZA 4Q9LA 2V7UA 3RS3A 2R44A 2Q21A 3WFJA 4CM4A 4PGFA 3W9UA 1QK5A 1TFRA 1L9XA 3G0OA 4L5JA 3HLTA 3MSCA 5FL7D 1C8BA 2GEJA 5L51A 3KQVA 4ZHSA 3FWNA 2JH8A 1E7SA 4JROA 4DMCA 4F2PA 1ESCA 4NCXA 4TKVB 5MFZA 1P9NA 2O3JA 3RABA 3K6KA 2GRAA 1Z47A 1C9DB 5U4QA 3IFSA 4E4YA 4HBZA 4GVXA 4S3MA 1E2DA 1SXGA 1M5RA 3KBOA 4H7HA 2RJOA 1G20B 2YJ5A 1PZFA 2FSGA 2AR9A 3AP1A 3LM8A 4XCVA 1K3TA 4KUGA 1H0HA 2FUG1 4MA5A 1E9AA 1AIPA 1NVWQ 1PQWA 3VHXB 4D9NA 3BEOA 3EMBA 5HJ2A 5I9LA 1NAIA 3CUVA 4XQ0A 1MJGM 4H08A 3FPJA 4RENA 3ZU2A 2PUWA 3FAZA 3RARA 4WZAE 1BH6A 5IAOA 1SB8A 3AVUA 1Y1PA 5AM3A 4LOLA 4WLNA 5F2NA 3TE6A 4UQLA 1PFVA 4Q1CA 2OO7A 2O8EB 2D5IA 3UTDA 3ZX4A 1C0PA 1NUSA 2AN9A 2VQDA 4KDRA 1RFGE 4D4HA 2JLBA 2KHZA 1LNZA 2PR7A 4AP6A 4NECA 4CQLB 1H4VB 1SD2A 1M7HA 3QKUA 3EOZA 3Q5GA 4BLWA 4F5ZA 4PC7A 4WFKA 1OFHA 4J0HA 4RV5A 3M5CA 4CDMA 1Y81A 5FDFA 1U28A 2BFAA 5HF8A 2DQSA 2ATEA 3DAOA 4M89A 4NJMA 1SH7A 2QLJA 1SVKA 4DCVA 1KFKB 5H0IA 1TIPA 1V2HE 3G9XA 2AWOA 2B69A 2Z2YA 1BWQA 2ZR7A 1RI3A 2O1XA 3MJSA 4RE5A 4RVUA 5H4HA 1AGYA 1VG9B 2QTHA 4M1WA 5BSWA 4JITA 4J9UE 2YJ6A 3SBOA 3UGQA 3HWX1 4QDJA 3KB8A 1U1GA 4KQEA 4LYDA 1ONPA 4ZOAA 1OXSC 3ICVA 3ONFA 3QPDA 4F38A 2G0AA 1QH1B 4Q18A 4DWJA 5B2EA 3K1JA 1R6VA 5IX8A 1SCUB 3OZAA 4RIGA 2IS6A 3QJGA 4ZK2A 4B73A 4Q48A 5DT2A 5HCNA 1KHTA 2DPGA 1FJ2A 3H5IA 3L93A 4OQEA 4PQFA 4AWXA 4MVJE 4DIMA 4QJ4A 4LECA 4X8LA 1FNCA 1R0BA 5KNDA 4QULA 4Q0MA 1FDWA 3IILA 2Q8NA 1ODSA 3U9TA 1JG7A 3LQ4A 1E7RA 3TSZA 4BB6A 2YN4A 3VVCA 1Y7HA 3LZ6A 1QYIA 1Y8QA 2EEPA 4U0KA 5EWMA 2WQ6A 5HF9A 2LBPA 1N2CE 1QFXA 4WX2B 1Z0AA 3RODA 3EVFA 1UFQA 3SBXA 4IGFA 1FW8A 2G70A 2JIZD 1H23A 2BKAA 3AJ8A 2DE0X 2V54A 3EBLA 1E9EA 1H5NA 2FCRA 3H13A 1X74A 3M9LA 4LKOA 4TWBA 5CTAA 3SZMA 3HWRA 1GA1A 5EIFA 3GLSA 1SVWA 1EAYA 3VJMA 4IIHA 3LFUA 4KQ6A 1LDNA 3WK5A 3GRCA 3A2MA 4LYEA 3ZV4A 2V5VA 1XMJA 5K0ZA 4IF6A 1ZRNA 4IZIA 3L1KA 3O8CA 4D6XA 8ABPA 4BMVA 4ZAXA 5MFPA 3NIGB 2CB9A 3HY4A 3BX1A 1YR3A 4DPKA 4NOLA 3C8MA 1M2KA 1II8B 1RYEA 1CX9B 4NBUA 4Q1VA 1XP5A 5DI3B 4CTMA 3PFBA 2RMKA 1L5WA 4FE4A 1HWYA 4H35A 1C3VA 3LC2O 5LLDA 1XTTA 4G85A 3CTMA 2WJAA 3TLKA 4R68A 1ZM3A 6ADHA 4K6KA 4JX8A 1BHSA 1W0JA 5EP4A 1NI5A 1JDTA 3TW0A 1ZGBA 3T7SA 4YACA 1TYZA 1NRJB 3B7GA 3FAKA 4ZAYA 4TWIA 4Q4DA 5B5SA 4TL6A 4PLYA 5I4CA 5LFAA 3GPIA 1YE5A 3S8YA 2V4ZA 1CUHA 1XEWY 1E8DA 3IMKA 3NUGA 4OHUA 4X92A 5CITA 3W2HA 4AVYA 2X5JO 4XH9B 3JYQA 1E1LA 1ZD5A 3OQVA 2G17A 3KYDB 1U7TA 4HZUA 4R1NA 1VE1A 3QY9A 5B1HA 4EBFA 1A1VA 1WHTB 1RE1A 1HG0A 3DE0X 4MW6A 1MB2A 1N77A 3VHRA 1T3ZA 4I36A 2HEIA 4RTKA 1ULTA 4Z4CA 1QVWA 1T35A 1XTJA 3CZCA 1I1HA 4I4TF 1US8B 1Q0SA 1WUIS 2OOSA 2QGNA 3A6ZA 1M74A 4JVMA 4U5XA 4Y2XA 4UEOA 2ZPAA 3FHTA 1RAHA 4X45A 2F55A 4KCGA 1JQAA 1OHHA 2UZ0A 4YV7A 4CU2A 4EKGA 1JLSA 3COVA 1U8CB 4DLBA 1ORWA 4DW8A 1IL0A 3CZ5A 4GLFA 621PA 1B41A 1TU4A 2WIAA 1OBHA 4Z7OB 2ZTMA 1BHQ1 5EZQA 2BYTA 4N6NA 4JUDX 2XB8A 2HMVA 1NZDA 1MC4A 3OZCA 4QGGA 3E23A 1L5GB 5FLEX 1DAIA 3RVMA 3MHTA 3LC0A 3QKRB 1G7TA 3QNWA 5K45A 1JFSA 1G3RA 3CF6R 1H1LA 4KNYA 2C94A 3GGJA 3NHZA 3U7QB 2C9BA 2G9QA 1QXSA 4RF2A 3E9MA 4IIJA 4KXLA 3ST7A 2NUTA 5KTMA 1EINA 4UU1A 2XXBA 2NLOA 5JRJA 5JG7A 2YR0A 4XM0A 1Y63A 1HZJA 4LHSA 4LFBB 4NOJA 3F49S 2CDAA 4YYEA 2YVUA 3E9NA 3DMDA 4P31A 3RSFA 1RIIA 4OUDA 5EP2A 3LPCA 1ENPA 3OM9A 4NPAA 1I14A 1PUIA 1HDOA 2NU7B 3EC2A 4JOSA 4Q37A 4KK4A 1FK8A 1G60A 4KN5A 1MABB 4A0HA 4LX8A 1GQOA 1BQ4A 1YZUA 2CCGA 3CJRA 3E3MA 3KYBA 4A1OA 3S4YA 5KQMA 3QFTA 1SWWA 5EG5A 2BPOA 1QC5A 3IVRA 3EIHA 4KWIA 1WDKA 2GEDA 2IXEA 4X8MA 2BGIA 3W0LB 1HURA 2B6NA 2BZSA 1J0XO 1KY2A 1XUOA 2Y1OA 3C97A 3NC4A 4J07A 4BMXA 5KOJB 1Y3IA 4C2BA 3OP4A 1QB7A 1OV6A 5FO1A 3EYWA 2NIPA 2ZAMA 4MLCA 3R2JA 4HVTA 1XVAA 4TRRA 2HWWA 3R6GA 4QLBA 3D6UA 1XMIA 3WO1A 2ONZA 4Z3DA 4U2FA 2H1OA 1XHEA 1QO9A 5CK4A 3ZJUA 3IKVA 4HF7A 3DBIA 3L8HA 4JDUA 4PSDA 4QTTB 4G1FA 4DXHA 4RCYA 1SVIA 3UC5A 3K9WA 4QGAA 3DTNA 1LPPA 3I2HA 1H3NA 3PS9A 4IX1A 1SBTA 4K46A 3UMJA 4EMSA 3GXBA 4BLSA 4COKA 1PD0A 2BZ1A 2VH2A 1O0SA 5JCJD 4RXUA 5EP1A 1V8BA 1XMXA 5EEHA 4GO1A 3L77A 2IODA 1G38A 1B43A 1CDZA 1GT91 4LSGA 4WN3A 1SB9A 2IOYA 3GD7A 4XUEA 5ICFA 4FHZA 4WCFA 1XXHA 3HHPA 2GZ2A 4KOEC 4B5KA 4I9FA 1PJBA 5JY1A 1VDMA 2HSDA 4S05A 2XB9A 1NRIA 2PSFA 1XQ6A 4NHEA 2QAGC 1ZGCA 4BP3A 2ZUBA 2EFHB 2IL1A 5FNZA 1M6HA 4BQIA 4OQFA 2D54A 4QX6A 4TKZA 3A3KA 3PLRA 4FLMA 4L0CA 3LXMA 2V7BA 3QX3A 1CEYA 2JAOA 3RS5A 4KO3S 3QMWA 5F1YA 3GJ8A 2NSHA 3ZV7A 1M6VB 2PVSA 3IT0A 1NIPA 5JLJA 2C9OA 2PYDA 3RIGA 3RYCA 4S1VA 5JWHA 5LWQA 2FQXA 2KI5A 4RJ2A 1T24A 1MB0A 4WBXC 3T06B 2WUWE 3ZKAA 3RYHA 4DWOA 4KAAA 1H4SA 4Y1EA 2YXBA 3C7TA 3ROKA 4UREA 2WIKA 1XAIA 1JGTA 3WFZA 2H8GA 4TMWA 3OKFA 1IXSB 1I3KA 1E5XA 4XGNA 4FDVA 2I3AA 5FD8A 2XWSA 2AFIE 3G8CA 4TV8F 1SZDA 4ARAA 4B87A 3PV0A 1RI5A 4MQBA 2IYAA 2N1BA 1QDEA 3EUEA 4BO5A 6CHYA 1WXHA 4I4LA 4LWOA 1M1NA 2I65A 5FL7A 4DIKA 1N75A 4YJFA 2XQFA 2OBNA 3SR3A 4D3SA 5IH7A 1LXCA 3B53X 1W96A 3LHDA 4URWR 1RAEA 2FR8A 7ABPA 5LP1A 4BNTA 4IZOA 4PCUA 1L8LA 2CLIB 4D0NA 1SUDA 1UWKA 2EBHX 2VLBA 3LZCA 5TEWA 1GO2A 1LLQA 1PJCA 3I6ZA 5JC1A 4DDMA 1FDSA 4G8BA 1VE3A 3EODA 2WWGA 3G0IA 2GEKA 5AVUA 4IQ4A 4W63A 1ZUNA 2Q5EA 3QKTA 4C6HA 3ILYA 4LGVA 4U7DA 2ANBA 3AQIA 3UW1A 2MHCA 4ZO4A 3LY5A 3KSUA 1EA5A 4FMCB 3U44A 3WKEA 1DLIA 1NF3A 4R1UA 5E6RA 2VWPA 1IIRA 3ASZA 4UBKA 2I54A 4YP7A 5I6DA 4IFEA 1EQ2A 1Q1AA 3T5BA 1XDWA 4Z3KA 3ZDEA 1DHTA 2P68A 1Z0UA 4ED9A 4UJ5A 2XOKA 4FR5A 2GRJA 1U7XA 1SOMA 3OOEA 4GX0A 3GG9A 1W25A 5E3JA 3WLNA 3DOEA 3L7LA 4CIVA 1UXKA 3OPMA 4YFYA 1K08A 1NJGA 1SKYE 1F38A 3FNHA 3UUGA 1EP1B 5CW1A 2IV3A 2XJ4A 4JASB 3KJFA 1GYRA 1O58A 1SMKA 1Z7YA 3QXGA 5TQ0B 1YAJA 3FZYA 4B71A 3SF8B 4ADSG 5FQOA 4ZYUA 3VZCA 4FE3A 4R51A 1YRHA 2C8JA 3IHLA 4FGJA 4Z51A 1R0KA 3EXFB 1R9NA 3GD5A 5G2OA 3UBMA 2XTNA 4K9SA 4BMNA 3KQKA 3KKMA 4LDQA 5BV2P 2BGMA 4HADA 3HXKA 4LMAA 2IWRA 2B4YA 1YVPA 3SFZA 4JI7B 5AJHA 3NXSA 5EJ7A 1DRJA 2AG0A 5BMVA 2ZP1A 1FTSA 4ITUA 1M2OA 1DLJA 3AESB 4OP1A 1PBTA 4WADA 4HUQA 4MRNA 1L8XA 4BXOA 5D3MB 4G0PA 3OM1A 3QEMA 5LU8A 3QWHA 2ZCJA 5F5NA 2OGZA 3WWDA 5FB3A 2IXGA 3BULA 5DSTA 1GUYA 1KU6A 4XWYA 3OOHA 3W6PA 3GEGA 2ZB8A 1OFTA 3LY7A 3O1LA 2OHGA 1WSBA 3CKMA 4DOMA 1QP7A 1UMDA 3KNZA 1C1DA 10MHA 2BKEA 1X0VA 2R7MA 2CB0A 1KAGA 2Q3HA 3B3FA 3BL5A 4OCZA 2QV7A 3GT0A 1FTYA 2AN4A 2JGEA 4WOBA 4RZHA 5L7TA 4XQEA 1QU3A 3AUSA 2OLKA 4LOHA 2O9JA 4IIXA 1KNXA 3PXAA 4PPNA 2O0LA 4PTYA 5DYIA 4HAIA 1NX9A 3RHSA 4FCCA 3QU4A 3KV1A 3ROQA 2GCGA 1UUFA 2DKOA 1XWIA 4R1OA 1SXJC 5HS4A 3CVUA 4IIGA 3FTNA 4G5XA 1PV1A 4GYKA 3D1JA 5AW7A 2YFKA 4JELA 4QWWA 1PFUA 2JIZA 3GO4A 4TS3A 3GPDG 3EHEA 1JNXX 4XZ3A 1G20E 1MO3A 3G2KA 4PX2A 1G0OA 4X7RA 3LQ1A 2F8SA 3RTCA 2PUEA 1DBIA 1B0AA 1Z5WA 4CIBA 1KH3A 2Q8PA 2RHOA 4GLBA 4LXUA 5BWBA 4UCWA 3TRDA 1YUMA 2JC3A 3EF1A 4A5OA 2J1LA 3DAPA 4GF5A 3ABQB 4MKRA 5H7XA 1FP7A 3RVQA 4EHFA 3IP8A 3S2YA 3QBEA 4OXKA 4TM7A 3LWDA 3BAFA 2JRLA 7MDHA 2GEUA 4EBBA 1E8NA 4JA2A 3G2PA 4RSGA 5DNUA 2REQB 1W29A 3GRZA 4O0MA 1OROA 2B6HA 4R9VA 1QOZA 1J56A 4H27A 5FJIA 1PV4A 1DTWB 1L4BA 4Z2AA 4LMRA 2KM1A 2PMEA 5AI0A 4YCBA 3LTEA 3SMQA 5A4IS 2G77B 1P1CA 3OFND 3TS1A 1JG1A 1YCGA 4JWKA 3OTQA 1U5AA 3ZQKA 1WTCA 4B6PA 4YDHB 5J23A 3UHFA 3DDHA 3L3BA 3A8TA 3DE6X 5COBA 5JSHA 5GZ3A 3PICA 4L5BA 2AN5A 1A9RA 2C31A 3D4LA 5ICSA 3HXLA 2PD4A 4N76A 3H3FA 4BQOA 5GM1A 1XMSA 4CYMA 2NSYA 2G9VA 2WYUA 4KIUA 4P7KA 4ZP1A 5LL6P 1PR6A 1B8NA 4BE7B 2CEKA 4PYOA 3H1TA 2NMVA 1NNEA 2FEXA 4Q9HA 1B6SA 3EW9A 3LUPA 4PIPA 4OKSA 1Z35A 5CB6A 3G17A 4V03A 4POAA 2BDUA 4YB8A 1B7GO 1P8JA 3IQXA 3KPUA 4ZO6A 5CAEB 3IRVA 2P3LA 3WAJA 2YCBA 3OIFA 2VTBA 2ZZMA 2AN1A 1X7ZA 2A0WA 4ND4A 4PSVA 4PGGA 5DCYA 1W5AA 1BVRA 3RLFA 1H05A 3B3AA 3S2ZA 3BGOS 3ANXA 1OLUA 4C0WA 2A59A 1FW6A 2O6HA 2I2XB 1GD1O 1JS1X 2PQ6A 1IYZA 1B0PA 4PO3X 2Y0EA 4UU0A 3PQDA 4OYYA 5EIAA 4B7AA 1FQOA 3HEMA 2I9KA 3HYNA 5CYFA 1DX4A 2AOTA 2FPOA 3F3MA 3JY6A 4M3NA 4EB3A 2BOVA 3JTEA 5EE3A 3CLUC 2BP7A 2IC5A 2V96A 1Y48E 3I45A 3I0MA 3JQFC 2BKVA 2IYWA 4HSEA 5K4AA 1TRHA 4BX8A 3UMYA 1TPZA 3T7RA 4RULA 5L45A 2REXB 2X8JB 1W85A 4AURA 3W04A 1SHTX 4EYEA 2C2GA 2VKTA 4US0R 4HX5A 4DMHA 3IQWA 2GPSA 1OZGA 3NBYC 3VZSA 2P5SA 3AEYA 3L6CA 4Q3OA 2PSEA 2NZUG 1S6YA 1VCIA 3DWEX 5C8YB 1USKA 3O1IC 2PANA 1QGUB 3GLKA 2E85A 2G5PA 2C04A 4FNGA 1Q77A 1LGYA 2RHTA 3NP7A 4RLFA 1K7SN 5FPQA 1Y4ZA 4F6LA 3UUFA 4MVJD 3TGLA 4ZWNA 1QFZA 5SYAA 1DOHA 3OOYA 2J0UB 3KSBC 3FKSA 1PV2A 3KXLA 4N7RA 2HN9A 2FDXA 2VKQA 3I64A 1GPDG 4OQZA 3LUAA 1NQ5A 4X8OA 5GY7A 3Q2KA 5HIAA 3GNLA 3G68A 2QVZX 2YICA 3DKRA 4L4SA 4TLDA 3NHRA 3HCAA 3DL4A 3VZPA 3I58A 4PANA 4CW7A 5K0EA 3V8RA 2BGJA 4QBFA 1TK3A 3CA8A 3BMNA 4UE2A 3NV7A 5DTMA 1TO2E 3GDHA 4PLGA 4EMTA 2ERXA 2H4FA 3PR2B 3D5QA 5BT9A 3SBDA 4C7JA 5FLXA 3U3OA 1PZEA 3WKBA 3ZWOA 3ANMA 3WOVA 1PFGA 3MUFA 2B1IA 4MW0A 3HU1A 4DDKA 4K03A 4XB2A 4NCIA 1V39A 4WI1A 1GXSB 2QX4A 3M3HA 4I0WB 4DLWA 4MUMA 2TMGA 3ORYA 2JHAA 2PXAA 1QF7A 2QUIA 5AW5A 2V7WA 5DJ5A 2L17A 2WZQA 3B51X 3QBDA 2CZCA 2DLNA 2D2FA 3X2FA 4R8VA 2OP0A 1LU9A 4QBGB 4AKSA 4LRSB 5JCJA 4DV3B 3NH6A 1DCFA 2FJ0A 4EY3A 2JGKA 2QZ4A 5JNLA 2D1YA 2NM0A 1J00A 4GRDA 4KRGA 4LVCA 2C7GA 1KSGA 2Q7DA 5HRAA 2N42A 3SJZA 2D13A 2I0FA 2SKDA 5ULLA 2XNSA 3SLRA 5F12A 3WISA 4DLSA 1MX5A 1KJWA 1Y1RA 4ZC8A 4LF6B 1GG8A 3NVKI 2BE7A 4EO7A 3N2IA 4ZQHA 1VGVA 1CUIA 3ME5A 2FMKA 2RARA 5CT8A 1J2TA 2OPBA 3C70A 1Z2PX 2PG3A 1T5LA 2NZ2A 3DS8A 1T13A 1KBZA 2F48A 1QYRA 2ZI6A 3COZA 3H2YA 4UAUA 3DOCA 3HSYA 4WZ6A 1U81A 2JD2A 4CT5A 4LDZA 4NBVA 2IEBA 4QUGA 3K30A 4B8YA 2WJHA 4LS3A 4FFPA 1CUBA 4RC9A 1OXXK 1P4HA 5ERXA 1LY1A 1NKTA 2EVWX 4P38A 4W1SA 4ZVLA 3T5MA 2C7QA 4G0VA 1FFDA 5J4LA 2Y1DA 3N2GB 3UMFA 2IBSA 3C41J 3JVUA 3WJ1A 1C3JA 1NATA 2WABA 3L6UA 2VAPA 1T43A 4U7HA 3I12A 2J41A 3N05A 2W22A 4M4SA 5GONA 3JAMA 1K63A 5KREA 5A3JA 4BAZA 4MKGA 3UJ7A 3NEJA 3BXXA 4TSRA 4WNCA 4ESOA 1P4SA 1TYEB 1YT5A 4N0PA 5ED4A 2WQ7A 1B8VA 1IN5A 4KGDA 5BSGA 5J59A 3ZYZA 2WZCA 3R7NA 2DLDA 3TLYA 2O1EA 4MJ3A 5JSKA 1UKEA 3LLCA 2GD2A 3HNPA 5AH0A 3FLBA 1AUQA 4HB0A 2JLXA 2OBMA 3M4YA 1TADA 2IP1A 3ECCA 1HETA 3DTVA 5TDHA 1QIEA 1FX1A 1EUCB 1Y3HA 3DL7A 3FGPA 1NDHA 3KVRA 4HDNB 3UF0A 3U6BA 4MW5A 2L2QA 1EK0A 2FPKA 2AN3A 5KX5B 3X3HA 4RD4A 4HWGA 4MV4A 3I37X 1LDYA 1T2UA 2D5CA 3DXXA 1YR7A 3N0RA 4FWBA 4J76A 4II3A 4I66A 3R7LA 3BORA 3UJAA 5A4JA 4GX5A 2PO7A 3ZIAD 3E22A 1TIBA 3QELA 3AK4A 3L06A 4MUHA 4GOJA 4I4CA 4OOFA 3X44A 3L4BA 2RHDA 3FYSA 5K8TA 1BDIA 3LP6A 1PGPA 4RY8A 4GWGA 2C4NA 2GA9A 5G0WA 2IOFA 3LK7A 4FB5A 4CKWA 4WK6A 3GEPA 2P4UA 1JEOA 3ORHA 4QYSA 3O7WA 1QS0A 2P0AA 4G56A 2E48A 3L6BA 3LKZA 3M5WA 5DIZA 3T5GA 4R3WA 1HKHA 1DHRA 1U8FO 5EUMA 2CBXA 2G6TA 4HAZA 1GDDA 5F5LA 4F8JA 1VSBA 1E59A 1H65A 1K88A 2J33A 2YZKA 3T7JA 2F3RA 2B8EA 2C99A 2ZI5A 3D9QX 2PBLA 3DM9B 4P3YA 1ZQ1A 4QQKA 3E8MA 4MRVA 1G291 2QB5A 3AJRA 3KOWA 5E4TA 5GOTA 3HQ4O 2CFTA 4WV3A 1DBRA 3X1YA 3RYTC 5E2BA 1R0RE 3GFGA 5K2MA 5C37A 2CHFA 1S2DA 4D7AA 2C3UA 3A36A 4FHEA 4QNRA 3MERA 4ETMA 4F4JA 1M2VA 3PHHA 4O2AB 1M83A 2ZJ3A 2GYWA 2NZJA 3V7YA 3PF9A 1BU8A 2BFWA 3H2HA 2JGFA 3BL6A 4O4IB 1RXUA 1W4AA 3Q9NA 1KEVA 2WKWA 3MOGA 2BLLA 4Z9XA 4XWOA 1SBYA 1FYEA 1Y9DA 2ZAYA 3E0XA 4HN9A 2WM8A 4FXPA 3LQ2A 4Q47A 5EFZA 4NYIR 1H93A 3VNQA 5HUJA 3L5OA 1G2QA 2J9GA 2XNDD 3LAWA 2FW7A 4WKBA 3SN6A 2XY4A 3PQFA 1UOEA 3AM5A 2OY0A 2XGOA 3L6RA 5ENDA 1Z08A 2P5UA 1OZ0A 2G06A 4D3DA 4MVJP 4IO1A 4N0EA 3OZBA 1K7FB 1RJFA 4IIUA 4MX8A 4RJKA 2AJTA 5K2OA 3AEUA 1ZOOA 3PR1A 5BXYA 5AVSA 2QM7A 2CD9A 3ZY6A 2PV0A 3STUA 5IEJA 4HNQA 4ZI7B 1E89A 3K2EA 3HVHA 4GH5A 2JHPA 1SXIA 1Y37A 1OAOC 3EXHA 3JYHA 1NLFA 4DIEA 4K0RA 1BG6A 4NBKA 5HUQA 1SOVA 1BOOA 2I29A 2IITA 3SYMA 3ZV3A 1G7RA 4EPWA 1WPXA 1HSZA 2W7TA 4GUDA 2BV3A 4O25A 5HIJA 5EHZA 5HHTA 4U7WA 1LJ8A 4IEIA 4JU8A 3SZOA 4FKZA 3PRHA 1U7OA 3RR2A 3E2MA 3WGMA 4TUYA 2OCXA 3SPXA 5KTSA 4Z9YA 4TYYA 3AVYA 5BYJA 1SC4A 3O03A 4HNGA 1D2NA 4PG5A 1DL5A 3RVSA 3VYTB 4LOJA 3UATA 4KYUA 4NBTA 4RPCA 2FKNA 4V0RA 5AJXA 3QA9A 3SXUA 2O59A 1O96A 4S35A 1HL7A 1KIAA 5F7ZA 5HP4A 3ZYCA 4AIIA 5AOAA 4K26A 2DUJA 3G9UA 2O2ZA 3IUYA 2C8KA 1ZDMA 4H6VA 2FOIA 2YIJA 4L4YA 3RS8A 2FPIA 1JQLB 3UMMA 3F0TA 3BRCA 3ND8A 2GF9A 3ABRB 4FFWA 5EJ6A 3V9AA 3WXBA 3HPQA 5HUHA 2EFYA 2PGJA 1ONBA 5ARCA 1R0XA 2QVYX 2X2EA 3Q11A 4Q7LA 3M81A 3FVTA 5CA1A 3NI2A 4YLEA 3DWGA 2PWYA 4EI2A 1GEEA 1MGPA 3AONB 3MMPA 1NVDA 3W5VA 2QQ5A 2JHCA 5D85A 3K96A 3VAAA 1WSAA 5IAEA 1EVJA 2PQ0A 5KCZA 4UU7A 3CUYA 2ENUA 2EDAA 421PA 3L1IA 3OFNA 4FFLA 2IZ1A 4YUWA 1ZH2A 3VM6A 5JHHB 1OX5A 1NBHA 5JSZB 1MORA 2AOUA 4ILEA 1YZ3A 3QTLA 2Z5VA 1HDZA 3E7FA 4HDOB 4JVSB 1SUAA 3LP8A 3OF2A 2GFHA 5EZ6B 2XMQA 1ZHFA 3ZZUA 3IUSA 2X0DA 2GASA 3U61B 1I80A 2OAEA 1BQ3A 1S1CA 2CVQA 4G1UC 1GJRA 2P9EA 3DVSX 1AVTA 2I7CA 3AY3A 3AF3A 4PGAA 1UMBB 3GIDA 3IVAA 4IIDA 1RQLA 4P80A 1ZH0A 1NG1A 1Q74A 2PKXA 2XQGA 1UANA 3A4VA 4HLDA 5DTQA 1P5ZB 4D41A 4G0UA 3BGWA 4UUMA 1AZLA 1JHDA 3RQSA 5LQKA 1XDDA 1LWNA 3MRSA 5AXBA 3ZCPA 4BMOB 1M10A 5AVWA 2AA3A 4E88A 3FYDA 2NU6A 1ULBA 1EK2A 1F2TA 1R18A 2ZJ7A 3V00A 4F2WA 5A9RA 5CYGA 1OH8A 1P9OA 2PH3A 2Z1MA 1WWKA 3ZVNA 4AWBA 1IZ0A 1J5XA 3PD1A 2JD0A 1VLLA 4ZJPA 5SYMA 3F97A 5HVNA 1NJ5A 4E1VA 1KAQA 3E1GA 2BFFA 3IS3A 3RRFA 2DJ5A 4HWTA 3H11B 3HVJA 5CM2Z 2VQFB 5D6NA 2CLEB 2QLLA 4HR7A 5ARDA 5LA6F 4QQRA 1FSFA 4O8ZA 1N6LA 5DVZA 3WX0A 5JYCA 3WGHA 1PR9A 1JIKA 2MIIA 1U9CA 4U5QA 1C3OB 2CJFA 2Y1FA 2XT6A 1JJFA 3QFHA 3V8VA 1NSFA 3W6UA 4DZRA 5LXTA 4AO7A 3DDUA 1OX6A 1OYOA 1F1JA 2AMJA 4Q12A 5G0SA 5IJWA 4I4NA 3BD9A 1U8AA 4FYVA 5FUYA 2FUEA 3EAGA 4TGLA 5P8WA 3EXIB 1J2YA 2RCNA 3MCVA 4OHXA 5EJAA 3X1KA 3L40A 4AN0A 3R5KA 2OESA 2QVCA 3JQ8A 1U0NA 3STHA 1VOTA 1N36B 2UXBB 1JSCA 1X13A 3USES 2Y2UA 1GZUA 5E6UB 3WJAA 4YHHB 2PAFA 1JLKA 4MVJA 3MWEB 4QTUB 3T9BA 3UHAA 4HUJA 5KKCA 2XA1A 5CGQB 1FMLA 1K9SA 1JLHA 2XI4A 3U7JA 4DT1A 2GN4A 4EW2A 2PUDA 4UOEA 2PSJA