3E1GA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 89
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e1gA00
1P0MA 4U2EA 3DJYA 3H1BA 4HZGA 5ALHA 1C7IA 3GBSA 1NU6A 2DQYA 4EB0A 3WA6A 1E89A 1F0NA 3LP5A 4Q05A 5ALDA 3FVRA 1W6RA 4PO3X 1QONA 3WZMA 5D3ZA 4AMYA 4PV7A 3WWOA 4DMKA 1EDDA 1EXWA 1KU0A 3STWA 1Q83A 2HADA 3K9BA 3QBJA 1VA5A 1XQWA 5CXXA 3EQ7A 3AILA 1FFEA 4MQMA 4HVTA 1O6GA 1CUVA 1UZAA 2WFLA 1IUNA 4NZZA 4X85A 4KAJA 4DSZA 5A2GA 5D7BA 2QOEA 4L72A 1XZKA 4MJ3A 3IIIA 1ZD3A 1LZKA 1DX6A 2ZYSA 2B4KA 2ZYHA 5ALYA 4KYVA 1QIKA 5FPQA 4EY5A 4FBMA 1CUJA 3R0VA 1DT3A 1UWCA 4Y2TA 1N5MA 3FCXA 4QDOA 2G63A 3WK5A 1Q0RA 3CN9A 4ZI5A 3V1KA 2WU4A 1EH5A 4K6HA 4OYYA 1GGVA 3RARA 1CPYA 1DU4A 5K3FA 3SK0A 1HBJA 2W22A 1BN6A 3HZOA 4W1RA 2WQZA 3G9ZA 4ZWNA 2LIPA 5CT9A 2QZPA 4C4ZA 3FLEA 1DQYA 4F21A 4W63A 4BC1A 2D5LA 4G8CA 1IMJA 3C45A 3KXPA 3HJUA 2H9YA 1PFQA 4FWBA 5DTIA 5JASA 1L7RA 3MUNA 4BVKA 2HA4A 1TQHA 5DJ5A 1QTRA 4NS4A 1CQWA 4ROTA 1SCQA 4J0CA 4QNNA 2VJCA 1JJBA 3ESAA 5LZ5A 3WK6A 2VAXA 4B9AA 2HA2A 5AK4A 2DSNA 2H7CA 2ONCA 1QO9A 4G9EA 3P2MA 4XJVA 4KJXA 1MPXA 3KSRA 3BL8A 4F0JA 1ZI9A 3H2JA 1B41A 3W05A 1OXMA 2PU7A 4CG3A 3O0DA 1AQLA 2Z3ZA 4B6GA 4JNCA 4JYMA 5ALJA 4X3CA 4DYHA 1EHYA 5AKYA 1UK9A 2OCKA 3IUJA 4EA6A 2WFMA 2WKWA 5SYNA 2ZYRA 4X7BA 1JI3A 2OCGA 2UZ0A 3C6BA 5DWDA 5AI9A 3R40A 2CUTA 1M33A 3WWCA 2XUAA 4H7EA 2R8BA 2GYUA 4UHFA 4DMCA 4FFWA 2ORYA 1WM1A 3C8HA 3F67A 4UHCA 4X90A 1QLWA 5FUMA 3I6ZA 4Q3LA 4PW0A 4G8BA 5K3CA 5EHQA 1W1IA 5ISMA 4BE4A 1LZLA 4WCVA 3ZLTA 5KREA 1EX9A 1YR2A 1THGA 1WOMA 4B0OA 3M83A 1BEZA 1VE7A 5E4JA 1VZ2A 4MQLA 3ESBA 3DL4A 3W9UA 4H7KA 2HA7A 1EDBA 2Z8XA 4DNFA 2CKMA 3WKAA 1J06A 1YCDA 1YAHA 3T52A 3V1MA 3G9XA 2XMQA 3TGLA 4WY8A 4JUIA 2H7YA 2PU5A 4LXGA 5JAOA 3OURA 2JGMA 1QJ4A 3L1IA 1VKHA 1HLGA 5IH7A 4C87A 5JIBA 1GZ7A 4BAGA 2H1IA 2VA9A 4CCYB 1GPLA 2HL6A 4EBBA 2X5XA 3HYSA 1LPPA 1J1IA 5AKJA 1FFBA 5IVIA 1H2XA 2WG1A 4B82A 5EGNA 1CLEA 2JGLA 4KAFA 1BEEA 3O95A 3D3NA 4OCZA 4DNOA 1JU3A 2ZYIA 4GBGA 3AUKA 3W2TA 3FNBA 4FFVA 4MEBA 1YB6A 3N0TA 3KWJA 2XUGA 4UBMA 2HRRA 3PFCA 2OGTA 5C8XA 5AI0A 5KWIA 3WJ2A 1YAJA 3HABA 2GYVA 4BTLA 2PM8A 1CUFA 2ZSHA 1K5PA 5LKRA 1SC9A 2OGSA 3B12A 4HS9A 2JBWA 5JAHA 3HACA 4N8EA 1U65A 2Y2VA 2JGJA 3C43A 3STTA 2D0DA 5I7UA 1GXSA 4GWLA 4AMZA 5AI5A 2EEPA 3DCNA 4LYEA 2XUPA 2HA6A 2QUAA 4QWMA 5FOQA 2VT6A 5ALEA 3STUA 5T4EA 4BVJA 1SCIA 5AK3A 2EDCA 3STYA 3WIBA 5HQ3B 2BGRA 1T4MA 1H23A 4G5XA 1CUAA 1UK7A 5FXMA 2VSQA 5FPPA 2K2QB 4CFSA 4MYSA 3WQHA 4N8DA 1MAHA 4E11A 5K3EA 4E14A 1QIHA 1K4YA 2DFPA 5ALTA 3DYVA 2B61A 4JYPA 1XQVA 1A8SA 3QPAA 3ICWA 5JATA 3WKCA 1QIFA 2HU8A 4PSCA 2WHQA 4AXBA 2O7RA 3QITA 3BF7A 2AJCA 2WIJA 1QIIA 1GQRA 3DL7A 2VEOA 1Z68A 5FLKA 3DYIA 5DNVA 4NMWA 4N5HX 4FKBA 3RK4A 1CQZA 4M0EA 2WJ6A 3PF9A 2QXTA 3ANSA 3C5VA 4AO7A 4KE9A 4BRZA 2GBIA 1WB6A 4RE6A 4WDQA 1MNAA 2XQFA 3E0XA 1XZJA 4B80A 4B0PA 1BN7A 1MNQA 4MWTA 1JMKC 5E4TA 4BTVA 2OGZA 1H2YA 1LBSA 1FJ2A 1E8DA 4Q3OA 2BUAA 2OCIA 2ZJ6A 3BDVA 4GDMA 3A2NA 3I2IA 4G1FA 2O2HA 2PSEA 2QVBA 3TEJA 3WK7A 2C0PA 4L9AA 3ZPXA 5AKHA 5HF5A 3STVA 3I1YA 3WL7A 4FHZA 4MWSA 4LXHA 3D2AA 2J3DA 3WL6A 1DTEA 4DGQA 3AZQA 5AP9A 3WZLA 3LLCA 1JJIA 3HC7A 3F9CA 1MJ5A 1Y7HA 3G0IA 5EIEA 2HA5A 4FNMA 1W4LA 2GBFA 4QDUA 2WIFA 4B9EA 2QXUA 4BATA 4OYLA 2H7XA 1KU6A 1AZWA 4K2AA 1N8SA 3PUHA 1FFCA 5AH0A 1XZEA 4UHHA 5JZ9A 4ITVA 3WKDA 1ZI6A 3CCCA 1P0IA 1W52X 1MAAA 2ZJ7A 1WB5A 5AM2A 3N2ZB 2AJLI 4L0CA 2I78A 3BDIA 2JGIA 2AJ8A 4AO8A 4AO6A 1QIEA 2WHPA 4LYDA 5JZSA 3HI4A 5ALQA 4ETWA 5D3KA 4G8DA 3D2CA 3R3WA 2QR5A 3DEAA 2ZJFA 2Q0XA 3UUFA 4INZA 3E4DA 1K6EA 5AOCA 4X94A 5JD5A 3GELA 1A7UA 3CXUA 1CUDA 1EVEA 2HRQA 2HA0A 3HSSA 4CIBA 3BIWA 1IUPA 1LBTA 1E66A 1X2EA 5ALXA 4DM7A 2GZRA 3DOIA 4U2BA 3QZUA 1MO2A 4Y2SA 1JU4A 3G0BA 2I03A 4UHDA 1AX9A 3A2LA 3G9TA 3AIKA 3ZLVA 4BZWA 5JARA 4GXNA 4H7FA 1BCSA 4Q82A 1BCRA 3F98A 4NVRA 1EB9A 4BP9A 3DKKA 4M0MA 4IH4A 1UOOA 3D2BA 5CT6A 1KEZA 2QMQA 1LPOA 2WJ3A 4WFJA 1ODCA 4LHEA 1R9NA 2XMDA 4ZRDA 5CW2A 1T2NA 3U0VA 4HRYA 4ZREA 4BCBA 4MEAA 4UBNA 3H17A 3AZPA 4WJLA 4Y2UA 1LGYA 1BRTA 3G0GA 4BB0A 4IH1A 3WK9A 1XLUA 1UOQA 3F96A 3C5WP 3EQ9A 2XMBA 3EIOA 3RKSA 4BZZA 1X70A 3DS8A 2QTBA 3OOSA 5AKLA 4H7DA 5DTJA 1AURA 5ALNA 2PPLA 4ARBA 1CEXA 4AZ3A 2V9ZA 4H35A 4AB1A 3KD2A 3C87A 4DLNA 5EIAA 4H18A 4CCWA 4N8SA 1GKKA 4I3FA 3HEAA 1CRLA 3UUEA 2OAEA 3FLAA 1UK8A 1N5RA 5AKEA 4G4GA 5JANA 1G42A 3GA7A 1PJAA 4UFNA 4KRXA 3B3QA 3S8YA 4AN1A 4U2CA 1CUUA 5K3BA 3PI6A 3ZV7A 3OPMA 2HIHA 3DQZA 4EY6A 5JADA 1L7AA 3IURA 3FYUA 4F60A 1XZLA 4LKOA 3U1TA 5ALVA 2WILA 1TCAA 3WWEA 1AC5A 3TRDA 5LKAA 3WKBA 1LPSA 3ESDA 3O9MA 1CUXA 1TKRA 2JEYA 5FP0A 3WYNA 4GEGA 2XUQA 4QDXA 1J2EA 2DHDA 4C6HA 1W75A 1ACLA 5AK6A 2CMFA 1EINA 4QA9A 5LZ9A 4YPVA 4Y2QA 3E3AA 4RE5A 3OTQA 4CI9A 3WA7A 3AJAA 3FYTA 3WWPA 1ZD4A 3GFFA 3BIXA 3JWEA 2WIGA 4C01A 5AO9A 2CZQA 5CH8A 3C70A 3ILSA 5K3AA 2OAGA 3V9AA 3IVMA 1CUWA 4QEKA 5AK5A 5C7YA 3W06A 3VVMA 2XUHA 3DOHA 3LIIA 1C4XA 4Q3KA 2QM0A 4HRXA 1YA4A 1VJ5A 3I2FA 2O2IA 3G0DA 2XLCA 1CUCA 3LCRA 1Y7IA 1ISPA 5A7GA 2GBGA 1LLFA 4HXGA 1K63A 3QMWA 1ZI8A 3HRHA 3QPCA 5C8ZA 4K6KA 3DKRA 2IITA 3LS2A 2Y1KA 1QOZA 3BF8A 5FV4A 5AKGA 3FSGA 4ZXFA 4GLBA 4KACA 5DNUA 3WL8A 4HAIA 2VJBA 4HXFB 4Y2VA 3L1HA 2BUCA 3WIOA 2XQIA 1DQZA 5FKJA 2ZVDA 1Q84A 2BAGA 3OC0A 4HTAA 2HU5A 1VLQA 2J4FA 1H2WA 5K3DA 3YASA 4F5ZA 5FRDA 2GZSA 5EHXA 1XRNA 4XWGA 2B20A 3VJKA 2QRUA 4BC0A 3K6KA 2BCEA 4C4XA 2DHCA 4J0DA 3UMJA 1HL7A 1DX4A 1W76A 4JEIA 3R3UA 5ALGA 4DMFA 3FLBA 4I4CA 2HFJA 3W04A 4MXDA 1QO7A 1QZ3A 3D59A 3S2ZA 2C5FA 5E2IA 5F4ZA 2X76A 5LIPA 5DNWA 1LPAB 4QWWA 4IH9A 5LP1A 5CTAA 5ESRA 4A23A 2ACKA 1MX9A 4P92A 2V96A 4OSEA 5DYTA 2C7BA 3GZJA 2VJAA 2WTMA 1E5TA 2XMRA 4S0XA 2OPHA 4DNQA 1DT5A 3FYUC 5AOBA 4TVKA 5HKAA 3MUOA 1IUOA 3H2HA 4AQDA 1D07A 4FOLA 2RAUA 1X2BA 3O4GA 4LIPD 4B83A 1ZGCA 3NUZA 5A71A 4C89A 1XKLA 4KAAA 4X6XA 2PKYX 3NOXA 5HFAA 1R88A 1XRRA 3DLTA 4XX1A 2JEZA 3IBTA 1MTZA 2WJ4A 3R41A 3ZI7A 4BBZA 5ALIA 2FJPA 2QKYA 3EBLA 3BJMA 3WL5A 3FBWA 3MGAA 3V1NA 4QLOA 4BP8A 1EVQA 1GKLA 1WHSA 3IULA 3A2MA 1AUOA 4X6YA 5ALMA 3WLAA 2V98A 1ORVA 3O9VA 4MYDA 2WIDA 4UFPA 3SX4A 2PUHA 4A16A 4CG2A 4UFOA 4M0FA 2QS9A 1JT2A 1U2EA 1NX9A 2BKLA 1XRQA 1YASA 1R50A 4BYMA 1F8UA 3QMVA 1A8QA 1F0PA 1JJFA 4RGYA 5LLSA 3JW8A 1ODTC 3I2JA 1GPKA 4L3WA 2PL5A 4BRSA 2AJDA 1CUSA 2PBLA 2XT0A 2XE4A 3ANTA 5EFZA 2P8SA 3RLIA 2XUIA 1UKBA 5HK8A 3CCBA 2X8BA 1AKNA 3TJMA 3H2GA 1NU8A 4GI1A 2JGEA 1YB7A 5HZGA 1CUEA 2PSDA 3M81A 5AIAA 1U8EA 4Y2RA 4CCYA 2WUFA 4I19A 3PFBA 4FLEA 5ALSA 3I6YA 2OCLA 5ALFA 3I28A 1ZIXA 2HM7A 4J0KA 4ZGBA 5EHZA 4B7ZA 3FWHA 4Y9SA 4OU4A 4WFKA 1WHTA 3QMMA 5A6VA 5C8VA 1WPRA 3IUQA 3L1JA 5LZ8A 2Z8ZA 2AXEA 3ICVA 3AZOA 3D5EA 3HLKA 2PSHA 4FLMA 5CURA 4OPMA 1IZ7A 1AGYA 1DINA 1G5FA 4V2IA 4KE7A 2XQKA 1R4ZA 1XROA 3V1LA 2WFZA 5HCUA 2HHAA 4OB6A 1XZDA 1UOPA 1MX5A 1EB8A 5AM4A 2IIVA 3LIPA 1C7JA 2IX9A 4Z49A 3I1IA 3Q8WA 2ZSIA 2DCMA 1S8OA 4U2GA 4Y7DA 3QPDA 3VXKA 4YASA 1YS2X 5E4YA 4UBOA 2PX6A 2XDWA 4E46A 2BUBA 5HQ3A 3PF8A 3R3ZA 4X97A 3VJLA 2JGFA 2RGUA 1SFRA 1E8MA 3ZLUA 1TIBA 5DYWA 4WDRA 2ECFA 2WG2A 2V97A 4BCDA 1ORWA 1R3DA 5FDFA 2RIPA 3Q0TA 3I2KA 2CB9A 2B9VA 1ZOIA 3X3HA 2VTVA 1WB4A 1XZGA 1HQDA 4BAZA 4LXIA 2VAVA 1DWPA 3WI7A 1CIJA 5AICA 3IB3A 2QJWA 4QZVA 3I2GA 1XZHA 5AKXA 1G4HA 4BDSA 1K8QA 3D0KA 3AFIA 1EA5A 3D4LA 4C4YA 5AHXA 1XZAA 4Q34A 3PE6A 1THTA 1YA8A 4H7HA 1EK2A 5LZ4A 3WMRA 1XLWA 3W9BA 5T4FA 5CT5A 1MN6A 4P93A 3QH4A 2OXEA 2YASA 4DNPA 5HKBA 4J0HA 2NW6A 1VA4A 4HXEB 2OG1A 1SOMA 1BU8A 5AKKA 1OCEA 1QIDA 1VE6A 2RHTA 4RPCA 4Y2JA 4J0GA 1O6FA 3ZWQA 5JZBA 4YK7A 3D7RA 2C4HA 3BWXA 3EQ8A 2I3DA 1RYYA 4X00A 4DMHA 1WPXA 2PSFA 4OB7A 4RNCA 2WM2A 4XVCA 3I6MA 1QIMA 3WYDA 3F97A 1WCYA 2AJBA 1Y37A 3PICA 4KEAA 4DTCA 3AIMA 2PVSA 5YASA 1XQYA 1XZMA 3RM3A 4UHEA 3B5EA 2BFNA 4H7JA 1CUGA 4X91A 5K5EA 1USWA 1JFRA 4H77A 1XKTA 1LPBB 4AX4A 1YSCA 1QGED 1N1MA 4ZV7A 1FFDA 3DD5A 2JIDA 5C81A 2PSJA 3AIOA 2CBGA 2OQIA 4X93A 4BE9A 3NGMA 1ZGBA 3SWWA 4FDMA 2RHWA 1UK6A 2QJRA 4J0JA 4UBIA 3G9UA 2C58A 4DSAA 2GYWA 3KOOA 2DQZA 3ED1A 2ACEA 4FTWA 4EY7A 4BDTA 4GW3A 1XRLA 2VJDA 1I6WA 1VOTA 4K6GA 3H2IA 1UKCA 5ALOA 5ALZA 3I2HA 2Z3WA 2HU7A 5IKXA 1ODSA 2XMSA 4KR0A 1FSSA 4P9NA 1TRHA 2RONA 3GUUA 4PSUA 1XZCA 1DWOA 2ROQA 4PF1A 1L7QA 1VXOA 5AM3A 1UXOA 5ALUA 3WK4A 4CG1A 3VJMA 2W6CX 2WLSA 1CFJA 1R9MA 3QM1A 2GBCA 5JALA 1GQSA 3AINA 4X71A 1A88A 4OB8A 5HF8A 3BXPA 3FCYA 2XUKA 3GROA 3OM8A 3BE8A 3R3VA 1BROA 2XUDA 4QE3A 6YASA 1ETHA 5A7HA 2G5PA 2Z5GA 3WK8A 2DR0A 4EHBA 3C8DA 3G7NA 3KDAA 2BGNA 2C0QA 4D9JA 4JH0A 2XI4A 1ZJ5A 4KE6A 4UUQA 1E3QA 1TK3A 2CEKA 4ARAA 4UBJA 5JAUA 2VT7A 2VATA 4QDTA 3G02A 3O4IA 5IVHA 4TGLA 3A70A 2QT9A 4ZV9A 5I8PA 5HFNA 3FOBA 2XQJA 3R3XA 5AJHA 4H0CA 3WJ1A 4GHWA 3VKFA 4P08A 3ESCA 3C6ZA 4W1SA 1EK1A 1QFSA 5AI4A 1F6WA 5D6OA 2Y2UA 1VXRA 3G8YA 1JMYA 1CUIA 2OQVA 4FLFA 5BWBA 2WUGA 4UBKA 2WIKA 4A5SA 2HDWA 1IZ8A 1U4NA 1CV2A 3IA2A 4W9RA 2I3ZA 3QVMA 3FAKA 1BE0A 1TAHA 5AOAA 1AMNA 1XZIA 3HXKA 1CVLA 4B85A 5AM0A 5AM5A 2FJ0A 3IUNA 2WTNA 5I9IA 5EIHA 5CH5A 3O4HA 3K2IA 1J07A 1E8NA 4G4JA 4IO0A 2WUEA 1XFDA 3A6ZA 4G4IA 1H22A 2E3JA 3IUMA 3OG9A 4J0IA 4H7IA 1G66A 3V48A 1P0QA 1BS9A 1GPNA 3F8SA 3T4UA 4B84A 5CT4A 5A62A 5HF9A 1SCKA 2WSLA 4EZIA 5EI5A 1UT6A 4W1PA 3NWOA 3VVLA 5LZ7A 5ALPA 4BCCA 5BV7A 1UKAA 5CT8A 1FFAA 4W1QA 1ZIYA 1MX1A 5HK9A 1RP1A 2QUBA 1TCBA 3DDUA 5SYMA 4YX9A 4E15A 1MT3A 5H3HA 5A7FA 4PQEA 2DHEA 5JD6A 7YASA 1XLVA 1Q0ZA 3C6YA 1JKMA 4J7AA 1H2ZA 5CRIA 3H2KA 1P0PA 2ES4A 2OLEA 2YH2A 1QFMA 2WU3A 5ALRA 4WY5A 1ZD2P 4UHBA 3QYJA 2J4CA 2PUJA 2WHPB 5CH3A 2G5TA 3JYHA 1QIJA 4GECA 1XRPA 2HFKA 2WHRA 3WKEA 4XIIA 1LNSA 1HPLA 3PUIA 1XQXA 2JF0A 3IDAA 2XB6A 1LPMA 3VISA 2R11A 2YYSA 1CR6A 4PSDA 4QLAA 5AIBA 5LZ2A 4J03A 4B81A 5IVDA 4U2DA 2O2GA 1TCCA 1IVYA 1YS1X 2FUKA 4TPKA 1UFOA 3VDXA 1R1DA 1A8UA 2CJPA 2Y6VA 4FMPA 2XMCA 4IQ4A 4AZ0A 2VF2A 5ALKA 4C88A 5T4BA 4Y2YA 4OU5A 4X92A 4Q1VA 1EI9A 2WFLB 5LYYA 4BAUA 2XQGA 2XMZA 4WFIA 3H0CA 4J3JA 4KE8A 3M3DA 5BOVA 5DLPA 2RI6A 2WG0A 1ZJ4A 4DIUA 5KBYA 2J3QA 4EUSA 3E1GA 1QIGA 4IHAA 2FX5A 2Y6UA 1QTIA 3STXA 4AN0A 3H19A 2VQ6A 5AM1A 3MVEA 5IVKA 1ZICA 4FNGA 5KWJA 5JYCA 3M82A 4U2FA 1XZBA 1HDEA 5JD4A 3R3YA 4K5QA 5T4HA 2BJHA 5ALWA 4UPDA 4X95A 5K3FB 4EY8A 4Y2PA 5J3JA 5CXUA 4CIAA 2EDAA 1DWQA 3BJRA 4X6UA 3H04A 1CUBA 1GT6A 1LPNA 2XMGA 5AKZA 3CN7A 3H1AA 2G4LA 2C5GA 1OILA 5AI8A 1RWQA 1CUZA 2YXPX 4EY4A 3PDCA 1CUYA 5AI6A 5ALLA 4O08A 1QE3A 2XUOA 3FSGD 4QDZA 3EF3A 4N5IX 1XRMA 5JAPA 4UBLA 3DNMA 1B6GA 3SC2A 1EDEA 3FYUB 4KRYA 3G0CA 4PNZA 5CMLA 4FBLA 4G9GA 1PV1A 1ACJA 3FVTA 4OUKX 1HKHA 4Y2XA 1VZ3A 5AKIA 2XLBA 2XUJA 2HA3A 2O7VA 5HF6A 1ZD5A 2JGKA 2XUFA 1MU0A 5EHNA 3H18A 3O4JA 3WWDA 1XZFA 3KWFA 5BWCA 4BVLA 2WUDA 5DYYA 1CUHA 4OD0A 3C6XA 5CBKA
chains in the Genus database with same CATH superfamily
3EEFA 1VJTA 1ZQ9A 4YTEA 2PL9A 4DLBA 3WIVA 3NRJA 4OQPA 4OJQA 4EDFA 5KNBH 3AWDA 5ALHA 1Z6XA 3RVOA 4FBGA 1VG0B 4KUHA 4NBWA 4RL6A 4D9GA 4Y9RA 3MTAA 2DQYA 2VYQA 4MDHA 1EZ1A 4MLPA 1M9NA 4PIPA 2W5UA 4R2WA 4WCFB 5JCPA 5H81A 3SBOA 2DR3A 4JLVA 4YHBA 3GOHA 1M8FA 3QTBA 2JJ2D 1PU2A 4M54A 1EQAA 4N9QA 1NSYA 1YR9A 2VP0A 2W2TA 3LECA 3FVRA 3T38A 5K8LA 2ZTHA 3EMBA 4HYQA 4S2EA 1GR0A 3AMVA 4X3OA 2WVHA 3RVNA 3RRYA 5CFMA 3ROEA 1WZEA 3RYIA 1GADO 3HB4X 2JIMA 3AT1A 3BQMB 3FGPA 1ZJ6A 1Y4DE 1V7CA 4IKEA 2HEIA 3BFXA 2NYUA 1DAIA 3RVRA 1HFEL 1GQ2A 1GTRA 2OFPA 5CDFE 3JQBA 1YB4A 5CXXA 1U2DC 4F4IA 3C6KA 3IUEA 3MFQA 3ZKWB 3AILA 1PJ4A 4BLVA 3DC7A 4JT2A 4YMIA 5ICGA 4HVTA 2R65A 1UC5B 1T4CB 821PA 5DEIA 1MDFA 4J4TA 4OV6B 3VRHA 3T5BA 1RRCA 4B3DA 1ZM3A 4ZVLA 1O94A 2WQ6A 3KB6A 1I36A 1V3VA 1YU6A 2ZT6A 4CQMB 5F78A 3LT5A 3O1JC 1DCFA 1V37A 2W2LA 2X19A 3IBSA 4GEKA 2IPXA 4O8CA 5I9BA 4UZEA 5I51A 2FLWA 3H9EO 5FNZA 3QBDA 5D7BA 7ADHA 4L72A 1XZKA 3P5SA 3MCAA 3QUAA 1ESEA 2NTJA 4JI4B 1JIKA 3WIDA 4KFUA 2QLBA 4OLAA 1U0GA 1DXQA 4JUFA 2BP7B 4ZT6A 4RFSA 3L3BA 4GS5A 1EBFA 3OH8A 2VJNA 1ZD3A 4LRWA 4JA2A 1LSUA 3LQFA 1V2HE 1I3NA 1Q19A 2ZYSA 2ZYHA 4RENA 4KYVA 5DM70 4D43A 3K2BA 2Q2OA 4FDLA 5IBQA 5JECA 2NU9A 1UDCA 5DKFA 1T91A 1KP3A 3WIEA 4EY5A 1R9GA 1AKYA 2FN3A 4FBMA 4U5XA 5KHAA 1C9MA 2P6RA 3R0VA 5I3CA 1W36D 2CNLA 4PR3A 1M1YB 2WJIA 4Y2TA 4LTNA 1J0EA 1N5MA 3JQ9A 4XFKA 3ON5A 3ZCUA 2G63A 3KEOA 3LZ6A 4G1BA 1BHJA 3NS7A 3UGTA 1OYOA 2DFKB 2VDRB 5AW5A 3ZNOA 3DAFA 4F7DA 3FMFA 3JYQA 1BJRE 4K6HA 1F8XA 1XYVA 1SIUA 2D1RA 2O8CB 4KVGA 5JCOA 5K3FA 3SK0A 3DKIA 1ZCFA 4L02A 5CEFA 4R1MA 4W6QA 1RYZA 1U5CA 1QQ6A 2ZRDA 5JISA 4DV7B 5JYEA 4W1RA 2QPAA 1UIMA 2OCPA 4GPAA 2AN9A 4MRRA 5ENDA 3ZLJA 1X1CA 3EXEA 4GUAA 4XASA 3T0IA 2BFBB 1M2JA 2QZPA 3GAFA 1DS6A 4I7EA 3SHWA 2HSGA 3MFYA 1DQYA 4F21A 4MQLA 4GXQA 1RQNA 4ZO4A 5EQFA 1JXMA 4L4UA 4WZAA 5ECYA 3I42A 4LKRA 3TX6A 4K2HA 3C45A 5FBHA 1GPBA 3W6NA 3VA7A 3E9NA 4Q9DA 4BX8A 2RIRA 2ZBGA 3ND8A 1BIFA 3HJUA 4G1MB 1AK2A 3HVJA 4QJ4A 4FWBA 1DG3A 3AVQA 2BGLA 2GF9A 4TT3D 4NYIR 4TTQA 1JG1A 2HA4A 4R9RA 3UYKA 3X44A 3EOBI 1XKXA 1QTRA 3IMEA 2P9TA 2P69A 4MR7B 5E0OA 2Q3MA 4N12A 2QRVB 1JJBA 2VJCA 5CA1F 5LZ5A 4XQGA 1N33B 4UUAA 3RUCA 1M5TA 2JS7A 4X60A 4YRGA 1FW8A 3LHKA 1GPUA 2FMUA 3WK6A 5A9SB 5FWYA 5L6MB 3PV0A 5BUCA 2OGUA 4DCSA 5K2OA 4NCIA 4ME6A 4BNWA 3DMNA 3T3IA 4G0PA 3EW7A 3LY9A 3RU2A 5IDWA 5E7MA 2AMLA 1G6KA 5EL0A 1T1SA 2NXNA 3ODPA 1ZNYA 1E61A 3VUEA 4A3SA 2AG0A 3JPYA 5IPFA 4G6ZA 3GGJA 3IEXA 4PC3A 2JAPA 4LCBA 2OAP1 4KJXA 3PGMA 3ZCTA 3JU3A 1N2OA 3SKYA 1PT9A 1RRPA 2CL6X 4JUBA 1TO6A 5KVAA 1SPBS 3OEWA 1E4YA 5G02A 1FRVA 1W96A 1B41A 3RDPA 4BMVA 1SOUA 4TLBA 4ECAA 4EJSB 3UK2A 3IOBA 5HKOA 2ENUA 3WFIA 3KJFA 4KJZA 1ULBA 3ZU2A 3VJRA 3I1FA 3IAFA 5FA6A 1L7VC 1VSTA 4NX2A 2QZSA 4DRZA 2VBFA 3V32A 1A9PA 2UZ3A 1QMPA 5A4IS 5LU8A 3X1WA 3LC7O 1E2EA 3L7NA 2PYDA 1Z0KA 2J45A 4GL2A 2ZE8A 1JE0A 2JHCA 1UWLA 4KKVA 3RU3A 3DTVB 3WLKX 2GCGA 3CY6A 3PCXA 1EHYA 1XMVA 3CUYA 4R8VA 4HUQA 1NMZA 2WC1A 4RPKA 5ELXA 1J97A 1ZVJA 4KCGA 3T4EA 3ZHYA 1SRRA 4ZOQI 2YQ4A 1WMSA 2WYHA 4RWEA 4C06A 3LLMA 3MLAA 2VT2A 2WKWA 2YX1A 4R8MA 1OV6A 2BMVA 4W9NA 1UXGA 2KLHA 1YQDA 2O23A 2UZ0A 3COVA 1Y3CE 3E7XA 3FTNA 4U7GA 2YY7A 2DPYA 5AI9A 1PT7A 1HE5A 3R40A 4BLUA 2QUZA 1L5HB 2FXIA 1O58A 1Q0LA 2EGGA 4F3CA 4Q7JB 4H7EA 4WMLA 3VZRA 3Q1KA 4L5JA 1GZSA 4DNXA 1WXXA 3VR4A 2JD2A 4RQBA 2V6JA 4OHUA 2SCUB 4HQRA 4DY6A 2E4VA 4DMCA 2X5KO 4LY0A 2ODNA 1J9EA 4I6EA 4FFWA 2PJZA 4CLHA 2GHTA 1G8PA 2QN3A 5EUQB 4X7RA 2A9VA 4L73A 2JJ1A 4ZMRA 3BIFA 2A0WA 4LVNA 4G41A 3I6ZA 3ZVMA 2IHTA 2VJLA 3P9CA 2O3UA 5I01A 4WWHA 1E69A 2ZDQA 4ZVVA 3W5VA 2CK3A 5K3CA 1GYPA 3TIGA 4MCAA 2NV2B 1A2QA 2FFRA 4F9EA 1D2HA 3M70A 3IRUA 3KXIA 1Z3IX 3FKSA 4UTRA 5ISMA 1V2GA 1OLSA 5I4KA 1XR3A 4D6PA 5K03A 1LZLA 5CDYA 5J9FA 1Z12A 4LOIA 4YNBA 1YR2A 4GYWA 2BFOA 2GPWA 3AFGA 2JHGA 4HDRB 3BH6A 1KYWA 4PRKA 3PZBA 3CE9A 4ZAYA 1TXGA 2J1LA 3KZNA 3PWTA 4S1TA 4NS1A 4DN6A 4AN4A 2NP6A 3CUKA 4ZARA 1Z6YA 1H0RA 221PA 1EXNA 1J7KA 2YNMC 2JFHA 2YIVX 3D3WB 3D4PA 1CZKA 3EZNA 2QZ9A 3IR5A 4KMSA 3ELBA 4N4AA 1Z8FA 2Z8XA 4IF6A 4X7MA 3UFXA 5LBIA 5AJXA 4BQPA 4CIVA 1SURA 1DCKA 2D7DA 1L4HA 3GF4A 3MC1A 4GZ5A 1R4AA 1GCAA 3LTEA 2WSIA 5AJZA 3ZR4B 3KVNA 4RULA 4I5GA 4A0QA 4DDWA 4O2BA 1I30A 1JU9A 4MUBA 1JR3E 2IEYA 5K8IA 4DANA 7MHTA 2P9HA 3ZHRA 2PU5A 4UW9A 3KJXA 4HPJB 3BTVA 1V7QA 3URMA 5DSZA 5C4GB 4EZBA 5JAOA 4M3NA 5K3SA 1NR7A 1AUXA 3Q9SA 4QSHA 1QJ4A 1X14A 2SECE 1QDLB 3H1FA 2BH2A 1HLGA 2V8BA 1JG2A 1N2SA 1M1YE 1V25A 4I50A 4M8IA 4NMMA 1SIOA 2L19A 4AG6A 3GT7A 1KS9A 3E9QA 1GZ7A 4C87A 4BAGA 2ODAA 3CSSA 4Q7LA 4BFXA 2J0QA 3N9IA 3FNHA 3HZHA 3IEUA 1PGOA 4PGHA 1QHNA 1O57A 4KB5A 1GPLA 5TF0A 4C05A 3I76A 3NDPA 3OFNA 3GP3A 1PX0A 1OT3A 1XQ6A 3A31A 5KEIA 3ZDFA 1KWKA 1A72A 1J1IA 1FFBA 2O06A 1EDZA 4R3UC 5CA0A 4BJ6A 5C5EA 5FI3A 4R1OA 1XJWA 2WINI 2DULA 4BO5A 1CLEA 2XIQA 4EW2A 5L4NA 1BEEA 3IALA 3S99A 1A8PA 2JC3A 3EZ2A 3FPCA 3PI7A 4CF5A 1E99A 2R5WA 3LFHA 3UB2A 2AWOA 1FXWA 1J5PA 1RJFA 1YZHA 2CHEA 1Y5LA 2R6JA 2R751 4R05A 1WXDA 1VIDA 2GAAA 3FZYA 4FGWA 2ZR7A 3KO8A 5JNVA 1C9KA 2C9MA 4IKPA 4M1KA 3KQPA 3TXXA 2OO5C 2JLAA 2OGWA 2Q0SA 3UGQA 1QRDA 3Q7QA 2ZXUA 2QN6A 1ZU5A 2XWPA 2CHQA 4EYQA 4QULA 2O2YA 3TIXB 4OJKA 4J75A 3CJQA 5DBFA 4JUCA 4BRWA 3KFXA 5DYIA 5BSKA 4FHFA 3HDGA 2YN0A 4OL0A 4RV4A 1FSPA 3N0TA 4IDHA 3TTWA 4QM6A 2XUGA 4KR7A 3DCJA 1JXAA 4ANFA 3DXFA 1QHEA 2W8ZA 4OHWA 1W49A 2HRRA 1PP4A 5AI0A 4XGRA 1CJBA 2Q4BA 1XVAA 3AQIA 3Q3EA 5EWLA 2RHOA 4LQLA 3USZA 1YAJA 3HABA 4BO4A 1SCAA 5DW3A 2IV2X 4U8GA 2V6IA 2ZSHA 4EY3A 1PLLA 1COWA 1Q2XA 3F74A 3MGBA 4FIDA 4Z0NA 1E2IA 5GJCA 4EF4A 1UBGA 4MV6A 1AQUA 1DEOA 2JBWA 2XOKA 3HACA 3KT3A 2ODTX 3MT0A 4PS0A 4TKZA 3V1UA 1J5EB 1U65A 5IM4F 1WE2A 1A9YA 1NRIA 3K96A 4PTZA 1O0SA 2M98A 4AYXA 3R20A 5TEVA 4DIOA 2D0DA 1N5OX 2OV1A 1WNTA 2IYFA 1GXSA 3LO8A 3HDVA 4I1IA 4GWLA 4V2UA 3RRJA 4AMZA 4F86A 1G19A 2DWPA 2R1ZA 3AIIA 1W93A 2II6A 3LCUA 2XBMA 4RLHA 4DRXA 3ZY5A 3PEVA 2C1EA 9LDBA 1WDKA 2VZ9A 3OIFA 1IPHA 2QUAA 3L7MA 3PFNA 2IXEA 4C1NA 2ZCUA 2JKZA 4N1AA 3V8BA 4BFYA 2EYQA 5ALEA 4QGAA 5AK0A 5KDDA 3I9LA 3HPRA 3RJZA 5FTWA 5TLSA 1W0JA 4FOSA 2IYEA 4DIKA 1PV4A 2AN4A 5FOXA 4AY5A 3I3SR 3EYWA 3D4BA 3QKIA 5JNWA 4I2NA 2BMDA 4HX5A 1LK7A 1DKLA 4RVUA 2BGRA 4ZCLA 3EMKA 3P71T 5MHTA 2FPKA 3B51X 1TIKA 1X0XA 1CIVA 1QTNA 1SULA 2AMVA 2OVBA 3K6JA 1ARZA 2CVQA 3NPAA 3OZ7A 4LNUB 2EFGA 4QU8A 5CFNA 4BZXA 1RKUA 1UQRA 3HJNA 5FPPA 5DLYA 3WYEA 2DUNA 2K2QB 1IZ0A 1H3NA 5J1TB 2E9SA 3E23A 1X1EA 1ZMBA 4V0SA 4Z3OA 2P75A 3OOYA 3GMTA 3V7NA 1QHYA 5K3EA 4ZCRA 3RHZA 4MZDA 4TROA 2PH1A 3F8TA 3LC1O 5H16A 3A1FA 1TF7A 2JIOA 5JZOA 2V54A 4DCPA 2XVXA 4BIMA 5DNCA 1AUVA 2BHNA 5K8JB 4W5TA 1JAYA 3BQ9A 3IIJA 3HMQA 1N0HA 3OCUA 5EMLA 5FTKA 2NVUB 5GIOE 1QM5A 1XQVA 5DCLA 1B15A 3QPAA 4IHQA 1CC1S 1VRWA 2ZRBA 3K2QA 2WTBA 5EJMA 2OYRA 4B6OA 4AROA 2BSXA 3A9WA 2NU8B 1XAIA 2P1RA 1UXKA 3I4FA 1AKVA 2IKQA 2RGCA 1ZX1A 5CK4A 1A5AB 1GUFA 2HU8A 4URWR 2IP2A 1U28A 2IYOA 3BRQA 1N9GA 4M1MA 2C3OA 3EA0A 3QPUA 3NPMA 2BFPA 3QITA 2DM6A 4C0LA 5KQLA 3AR8A 2AJCA 3U62A 5GZ3A 5JJLA 3FNIA 2IH2A 2EKZA 2A3NA 4MARA 3DL7A 1P91A 2P0EA 2VEOA 5A1JA 5F98A 1X1DA 5CHYA 1F12A 3NJ8A 1MOPA 3AHGA 1XC7A 1E63A 3NEPX 2B6HA 3RI3A 1KYYA 1W88B 1P9WA 4GRIA 3CUVA 3ZTWA 3E2PA 4E7OA 3LSTA 4F04A 5FEUA 4PXYA 1HZZA 1YZKA 4LE1A 2FRDA 3GG2A 4NMWA 4D02A 4D98A 3IDSA 4IDNA 4FKBA 1LF0A 1G38A 2VAPA 1SVOA 4MLDA 1CQZA 4MZXA 3ZXUB 4I6GA 2WJ6A 4M0EA 3ZWCA 2ZPAA 1NRWA 4MV5A 4LFBB 4Q3AA 6CHYA 2IKSA 2YFQA 1C3JA 4BRZA 4BN4A 2V7PA 3UATA 1NJ6A 5C7OO 1WB6A 3QYAA 4WDQA 3PGJA 2AG6A 2QM7A 4YEDA 3T3NA 3HY4A 3HO8A 5DV9A 3U37A 1MQSA 2AL7A 1PL7A 2HBZA 4FT4A 4RGQA 3VKGA 3DP9A 1MNQA 3QWAA 5L95A 2G0NA 1JFFA 5AQ1A 3AM3A 5GINE 2ZTLA 3TZEA 4MWTA 3AJDA 1MQ9A 3RSLA 3NQ41 1E9BA 3A1NA 3HJCA 1LSSA 4IPTA 3ULKA 3AUTA 2P6UA 4DB2A 1JMKC 2NXCA 1N2GA 2ZR0A 3LUJA 5KTYA 4QX6A 1NUAA 1XRSB 1IJKA 5ESWA 1KDOA 3R7FA 3K0EA 3ROTA 1BVYF 3RRZA 2RGGA 5DLEA 3NHZA 3UAXA 16PKA 4YT2A 1FLNA 2XKKA 3BWEA 3NNDA 3QV1A 2GEVA 1PO7A 1Q15A 1RXIA 1Z5WA 2NYVA 3DVSX 3LOUA 4V0NA 1F7VA 5IK2D 1GPDG 4B76A 4AIRA 1GNPA 1FBNA 3A2NA 3A04A 2UZIR 3V4PB 3KT0A 1L1EA 1Z4PX 5J2UF 3U4IA 2JNWA 1NPYA 5DK4A 3ITEA 4HR7A 1JSZA 4NBRA 4PIMA 4CIXA 3N76A 4P35A 2QVBA 1LB1B 4A5OA 1JKJA 3N86A 4WNYA 1PGJA 3BIJA 3G1TA 2BKEA 1OJLA 3AO0B 3BXHA 1Y4ZA 3IT2A 1U8XX 4IXWA 4LJ4A 3T9AA 3TR0A 3MNFA 1PUJA 3F4BA 3KLOA 5IWAB 4DR3B 3A1EA 2AD1A 3GN1A 5DHAA 3ZN2A 2HW8A 1JIJA 1CF9A 5IXSA 1HEYA 1YQ9A 1E7MA 4GM1A 3WL7A 4L95C 5HDQA 4EPVA 5GGYA 4MWSA 4Y9UA 5SY9A 3D2AA 5KU7A 2VHEA 1H2HA 1T43A 2CZGA 3CLSC 5EZ6B 5B6IA 4C7OB 1IQPA 1CY1A 1DP4A 1ZXLA 2CUNA 2YMLA 1U02A 3I5AA 4PZZA 4W7IA 3LLCA 3WZLA 4BQIA 1FW6A 3L0ZA 3F9CA 1MJ5A 2FSVA 4NYJR 2EJBA 1Y7HA 3MCWA 1NZFA 4KGVA 4RD2A 5JT1A 3G0IA 4QUDA 1DOAA 2ZAIA 4REOA 4BS9A 3NC1C 3IR7A 3VR5D 3CVWA 5FJIA 4TVBA 5DM2A 2GBFA 3K9QO 3LTNC 4QLBA 1SHTX 1GLNA 1U1EA 2EQ5A 4U63A 2Q5IA 1EBBA 1OMOA 1PR1A 3DMFA 1NW9B 4ZEXA 2R8RA 2C4UA 2EP5A 3H6HA 2P6OA 4IV0A 1U7PA 3P20A 2V8OA 5D01A 2OWDA 2PQ2A 4GVPA 4AMVA 2O59A 3EBPA 4FYPA 2XYVA 1RLIA 3E8MA 3GVPA 3PL1A 3L8EA 2CNWA 3LZDA 4BMSA 4YR9A 1A9XB 1FFWA 1D03A 3NH9A 1PD1A 1REQA 1WXWA 4KO4S 4LYFA 5LP6A 4YA6A 1FP1D 2BTQB 4EK9A 1USIA 3KB2A 1C30B 3V3TA 4KLAA 2WNSA 2ZITA 2NVBA 1P9OA 1B6TA 1Y1LA 3CPHA 4RF5A 4CW7A 2ZRMA 1A69A 2V03A 1Z08A 1Q0PA 3Q6IA 4MDYA 1NNLA 3FJ1A 5UKDA 1XZ8A 3INGA 1QFJA 2Z43A 3N2ZB 2BM0A 3HKBA 4ED9A 2I78A 2R6AA 1SRQA 2YJNA 3JRWA 4TXHA 1PKEA 1XDWA 4IQ8A 4TTTS 4AO6A 4B33A 2O2CA 1X7ZB 4LRUA 1Z4QA 4MKHA 1NLZA 3A1UA 2PEYA 3NP7A 3VX3A 3ANYB 3KSZO 1E1QD 4LQ4A 2MSEB 2UV8A 4B09A 5JJBA 1AGRA 4KYIB 4WVFA 1BD4A 1MF7A 1S1CA 4Q1CA 4DF3A 3T1TA 3MTGA 3ZEAA 4DXHA 2PKQO 2QAGC 3ELDA 1II8A 2VHTA 3IEKA 3LUKA 4LUCA 2UZ1B 3R3WA 2H1RA 3DEAA 1FYFA 1JVNA 3KJZA 1KL7A 2VWQA 4KQCA 1C8KA 1R0SA 2ZJFA 3ACCA 3DEIA 3K9WA 3R24A 5KNLA 4EYEA 1Z56C 5U9CA 3E4DA 1AQYA 4XM2A 1SXGA 4BNFA 4HBZA 3MW8A 4AJEA 4EQZA 1MH1A 1U99A 4N39A 4AKEA 1YFKA 4N7MA 5AOCA 4LFAB 4G56A 1RXWA 4X94A 4QREA 4M8NE 3GELA 3MHPA 2A9RA 2HQRA 5T8KA 2C20A 1A9SA 2Y9MB 4YJFA 3ADPA 1Z0JA 3ORQA 4YI5A 4BFWA 4NXNB 1SHKA 2ZTMA 1M7BA 1NMQA 4RZSA 4NP6A 2AZTA 2O2DA 3FWPA 3S2EA 1M73E 3GJ7A 4DEYA 1J21A 1L7DA 1NQXA 2ZBVA 2WSSD 3IIEA 3RIYA 3ZDCA 1CLUA 2ANCA 3CLTD 1UBEA 3R4CA 2AOUA 3HSSA 2HXGA 2RCYA 3LBIA 4CIBA 1OFHA 4Q02A 3O75A 2ZJ8A 4P58A 1KHHA 1X2EA 3AJEA 4JN6B 3CGGA 2B9EA 1W4RA 3WZ2A 3F6BX 3M4JA 4DVGA 4AM8A 4JKYA 4DM7A 2C5BA 4CODB 2J7PA 4L28A 1RXYA 1CR2A 1MO2A 3ER9A 1JU4A 3G0BA 3KE9A 4OQLA 2F55A 3OSZA 5D3QA 2W9XA 1XI2A 2WU0A 3W8FA 4ZVNA 5BYKA 4QECA 1KJYA 5DPMA 1ZNXA 5JU6A 4Q6BA 1KIAA 3FPHA 2DEUA 1KO8A 4QBGB 2OSBA 3JZAA 4UVGA 5DM4A 4H7FA 1RYDA 1BCSA 1QUEA 3KG2A 3UK0A 3ADBA 1FUKA 1CS4C 1KMIY 1MB2A 1X3LA 4MYUA 4PBRA 4Q82A 1OB2A 4R4JA 3JD2A 1NVXQ 1BCRA 1YMUA 1NRXA 1CQJA 3QENA 5A0TA 3F98A 1E1DA 3AF2A 3BS4A 3B36A 4FFMA 2G40A 3D2BA 5A5EA 2X8LA 3Q12A 3Q7TA 5JXJA 1K92A 2QMQA 3PVZA 4O59O 5FHRA 5IHPA 2ZBRA 2JCSA 1DC6A 4JLUA 3H3FA 3HCRA 2IYNA 5ICCA 5EKDA 1UJ5A 1V1MB 2C7VA 1R9NA 3GRAA 3I92A 3ZD8A 4ZRDA 2H54A 2YHSA 2XVZA 4LISA 5CW2A 3T0FA 1OE0A 1UP4A 4KNVA 3LUCA 1P62B 4DXDA 1A7AA 3PQ8A 3WV4A 4X84A 4BX0A 4YUZA 2WVJA 3U0VA 4HRYA 4MA4A 2I0FA 4YCMA 4FN5A 3DEYX 2B92A 5BSVA 3U1BA 4OAPA 1T2DA 1C3LA 2YTZA 3UAGA 1NF3A 4TKUB 3ND5A 3UBMA 3O91A 4Y18A 4QGSA 3AZPA 3PNKA 4LI3X 3TN7A 1DJPA 1KE2A 2CGEA 1OYVA 1KS2A 1V4VA 2JZOA 4UJ5A 4JBXA 3BL5A 4RHCA 2OFWA 3MRVA 4BO1A 4Z1OA 3BXGA 1MZVA 3PQEA 4NOMA 3I9V6 1B73A 5BSFA 3GRKA 1T0UA 4N40A 3DWGA 3RKSA 3EIOA 3P0FA 1R4NA 1QV6A 1NULA 2O6LA 5DW0A 1OAAA 4E4RA 2C2XA 2AYZA 3COPA 3O8BA 4ESHA 2YJ5A 4POOA 4KPYA 3QHQA 5E1BA 1BKDR 3KTFA 3PHLA 2UXDB 4MUAA 3RWBA 1MHPA 2JJMA 2KYRA 4LA4A 3FCEA 1UP7A 4MIYA 5AKLA 4DLLA 3CX7A 1AURA 2PZMA 4W99A 3DE5X 3T5CA 4MGZR 3FJOA 2PUEA 4R1LA 4D56A 5L7WA 3U7HB 1EJ2A 1EFPB 3TZBA 1FDUA 5HMMA 1EG7A 3LK6A 3PFFA 4MW0A 1ZP6A 2V9ZA 1PX2A 5CGZA 3L8MA 5A3SA 2Y1FA 3FYDA 1JG7A 5MFZA 3GD5A 2Y1WA 3C87A 4AFNA 4HN9A 5IXYA 1JAXA 1KZ7B 5D87A 4Z51A 3UVEA 4CCWA 3UMYA 2A94A 4CI0B 1BVRA 1PJ2A 4N8SA 2W2OA 4ACAA 4I3FA 3HEAA 3NBYC 1CRLA 1L5RA 3OCYA 4RF2A 4EG7A 4URVR 2PUAA 1M2OA 3FLAA 4CM9D 1IEXA 1OA0A 1DO0A 4YP7A 3K70C 5IYZA 3CVXA 4B4WA 1T9HA 4M9SA 2WMOB 3S2YA 1U4SA 3PPYA 3WAJA 5B5SA 1MVLA 4YRMA 4EATA 2VDWB 1O4VA 1SUBA 2VBIA 1XPJA 1XTSA 2HJGA 1WXGA 1RRKA 3I3OA 3JAWA 4JB0A 5D00A 1L8AA 5LYJB 3QE0A 3B6KA 3IO5A 3MOSA 3G17A 1YOVB 2JD0A 1PS0A 2Q3BA 2ZI6A 4JLSA 4MA0A 4UFNA 4DCOA 4KRXA 2RG7A 3B3QA 3TQCA 3G8CA 4LXTA 2B2CA 1GG9A 2C5AA 4RY8A 5E1MA 4B3FX 2P41A 4CLOB 1PJLA 4DTIA 1KGSA 3QWBA 4P7FA 3TRJA 5DOVA 1VJ0A 3DQZA 1T2AA 2Y0DA 5C2JB 3D6MA 1MRSA 3K73O 3VH3A 3GP8A 5CYOA 2JJQA 4F60A 3SC6A 2RBKA 3QOXA 1D4OA 3LUPA 5BSUA 1I7SB 1TK2A 1IPEA 1GGMA 2RHRA 3MWEB 4JQYA 4R9SA 4PHTA 4CBVA 1BFUA 4YGXB 2DP4E 2H1OA 2I71A 4UEKA 5CCEA 5HIMA 3WWEA 2R62A 1AC5A 1WQ3A 4ND3A 1UZUA 2WOOA 1KH3A 4ZJPA 3OJFA 4PSVA 1RADA 3B48A 1SBTA 2E6UX 4UREA 2HRCA 4YQFA 1SOAA 2Q3JA 2GXUA 3K5HA 4P3PA 4YQZA 3ESDA 1OWOA 1ONPA 1ZONA 1UT5A 3RFXA 1JL3A 1S0UA 1TKRA 2BGJA 4KQJA 4CM4A 3HJGA 4CT5A 4DLYA 1L9XA 1R0BA 3ZNPA 4P1ZA 2FFAA 4GNRA 5JW6A 3ANLA 4M98A 4DJFC 1G98A 1YA6A 4JI8B 4JVNA 2IDMA 4DV2B 2XUQA 4KFTA 3Q8MA 4PZ9A 3UT6A 3PC4A 4PPNA 1RYNA 1XZQA 4QHSA 4QYIA 5CG2A 1EXVA 2QLJA 4MW9A 3THWA 3GRRA 3A4TA 1M2NA 4C6HA 2GPYA 4MJXA 1RXEA 2PBZA 3GLGB 2P77A 4MRMB 2I67A 1T9ZA 2ZT8A 2PUVA 3L6CA 2UUCB 4OI1A 5LZ9A 1BHQ1 1BXZA 2OZEA 3B5IA 5GAJA 1F2VA 3HYNA 4CHGA 1TJ3A 3CFYA 4P54A 2B37A 2VDLB 3WA7A 4Z9YA 3F3MA 1LNQA 5DGHA 4PTYA 2P0YA 4GG1A 2E18A 1U8FO 1DEHA 4ARZA 3AJAA 4CKBB 1ZN2A 3B3FA 3P9PA 3WHPA 5FBQB 5HIKA 4M89A 3A1CA 1JHZA 3B6ZA 3EC1A 1VE5A 1Y98A 4HDNB 3IAAA 3A6KA 4XSGA 1S96A 2IEIA 3GQVA 1EZ4A 1E9AA 1EYZA 2E37A 1CJCA 3N1UA 4P2GA 4KPUB 3DLPX 2N1BA 5COQA 2B4QA 3FPKA 2QW0X 4TWAA 2LVBA 1V96A 3K9FC 2GM4A 3RF7A 4N41A 1A5ZA 3CNLA 3GLFA 2QN2A 3AESB 4DLKA 1THMA 3DHVA 3U48A 2P5UA 2H3HA 1CEEA 4XIGS 2B8WA 3ZGLA 2Z58A 1UBOS 2W6NA 2QK4A 4TV9B 4RDHA 4ML3A 1YBAA 4HC4A 1P5RA 2G9RA 2LNDA 1RRVA 2XD9A 5E6RB 3UPTA 1BMDA 1LSJA 1FJGB 1JMVA 1ABEA 1BNCA 4ZPXA 2DUWA 2ZB7A 5I4CA 1RZRD 1JH8A 3Q7IA 2QD1A 3I9MA 4NCXA 4CTOA 2P40A 5EEGA 1WDWB 2VI5A 4PAOA 1PI3A 3QUBA 4FMBB 4AZ0B 4X8HA 3THOA 1YRYE 3WGQA 5KNBD 4Q3KA 3RGGA 4YPOA 1IHYA 1DC3A 1F14A 5FWDA 2IF2A 2YFKA 4PTLA 5DULA 3CIFA 1C80A 1K2VN 1LK0A 1TO2E 3LNCA 2NX2A 4ZVRA 3I2FA 3IRVA 4M9QA 3LCRA 4UUOA 1E2QA 4ZC1A 4BJHB 1Y7IA 4BLOA 2PZ8A 1RQ7A 1M34E 5DNDA 1O96A 4B34A 3LQRA 3SICE 2FSFA 3FMVA 1P9RA 3SKVA 1LLFA 4HXGA 1TFUA 4N7JA 3DEKA 3QMWA 4I55F 2NIPA 2C57A 2W2KA 4IQ0A 3T1YB 1SXJD 4RHEA 4GBED 1LS6A 4G5FA 2W4MA 2IU6A 3O1LA 4UNNA 3NFRA 3NM4A 3FRHA 1B93A 2J5QA 3AP2A 3N70A 5DHQA 4HFMA 4RKFA 2Y1KA 3LA8A 4JNKA 4DCJA 1T13A 2PIAA 1IVNA 5FV4A 5BNWA 1LLDA 1KNXA 5FI0B 2NZVG 4I08A 4C7XA 4S1NA 3GEIA 4PGAA 2ECKA 3A11A 4ZXFA 2D3WA 4GLBA 3C15C 3ZCSA 2XCRB 1IN6A 4L85A 4X62B 2FZEA 3GEHA 2X40A 1YFJA 2EIHA 2WJWA 2BUCA 3WIOA 3T7TA 3U4QA 1RZ3A 2CWWA 4I4TB 3JVIA 2ZVDA 3R9IA 1QBGA 2GKGA 5JI2E 3R7WB 2FN8A 2REXB 3DZHA 3OC0A 3WE7A 4C04A 3GPDG 4YHHB 2VSFA 3R8FA 5LOVA 1VSQA 5BUZA 1XNJA 1ULZA 2H7VA 2YJ3A 5HJ5A 1XF1A 1VDZA 3AOGA 5BY2A 3TKAA 3F6EX 3FFAA 5JI3E 5CPBA 1T8WA 4RD6A 5F3WB 1FXUA 3I01M 1Z4LA 5L7YA 2GARA 2P4UA 1FPMA 4KXUA 5LXTF 3FNRA 4XX0A 3WS7A 1WW8A 5BW6B 4DV5B 2GAFA 4PZUA 1YBHA 4E09A 4J3FA 3RC1A 1BWRA 1UEXC 2CLDX 1OLXB 2FRVA 3U26A 1HLDA 4UPEA 1IJEA 3JD0A 1K5GA 1HL7A 2WY2D 3UMJA 4NL4H 2GJSA 2WJGA 1ZM7A 5ALGA 3LUFA 5AW8A 1QGOA 2BGTA 4G0VA 1EK5A 2AOTB 5C8DA 3IAHA 3NXKA 2HFJA 3RR2A 1C1XB 1Y81A 1SQ6A 3EXIB 2C7GA 4IVRA 4MXDA 3ZZNA 3RREA 2JLBA 4BZQA 2WI8A 1Q7EA 2X2PA 1PWYE 1XCLA 1T9CA 2HDNB 1EQ2A 1KZ1A 2NSLA 2A7QA 4UUBA 1X1SA 2IUEA 3SFVA 1MH9A 1ESMA 4WBNA 4IH9A 4A23A 1J42A 1ZD9A 4ARUA 1G6HA 3GCDA 1DKMA 1PR9A 2FSUA 3MWDB 1I7NA 3QYFA 4RVNA 4XM1A 1NJ8A 3LHFA 3L0IB 1JP7A 4K05A 2XA9A 1IBRA 4QD3A 2GDJA 5E2BA 5DYTA 4BO8A 3MWFA 2A5DA 3IERA 3GZJA 1RPTA 3OT1B 1I2BA 2JI9A 3PRYA 4D4HA 3OX1A 2P7IA 3K8OE 1OWMA 2XMRA 1MJHA 5SYAA 4EUKA 5EJ4A 3HH8A 3AUJB 1DT5A 1TT5A 1WSAA 1JEAA 3K1TA 1OROA 1ITZA 1UZMA 5J4HA 4DSOA 1DC4A 4OKSA 1FRNA 1CS0A 3VR6D 4F4CA 2MSLA 1A9QA 2GGSA 2LGJA 4FOLA 1VG9B 1S2LA 4COOA 4GOMD 1N6PA 5AW7A 2G6BA 1ZGCA 3ZYCA 5KOHB 3KQQA 3DMTC 3GLGE 3ERCA 4ZCTA 3AERB 3SF8A 3K4HA 4UVIA 4DJ5X 2FFQA 3OQOA 2ZTVA 4LVCA 1EE9A 1H85A 3I52A 4UAVA 4M6WA 4UASA 2KBFA 4DR6B 1ND5A 1QAQA 3VNQA 1IWBB 4NU6A 3WV5A 1LVUA 3ZJ5A 1GP2A 3ZI7A 4YI3A 3A6GA 2CJWA 1PIWA 2NN3C 3KR0A 4B2IA 3N6RA 2FJPA 4BGDA 5B37A 2X9LA 2RHLA 2VG8A 4RETA 4MVJP 4X24A 2I6UA 2H5IA 4C0HA 1JILA 2Q5JA 4CM6A 3M6XA 4JUAA 4ZVSA 3V1NA 4BP8A 4BIIA 1EVQA 2C5SA 1WHSA 4D6XA 3J7AC 2O8FB 2YC2C 2OFFA 5HFJA 3QF7A 2GKOA 4NZYA 4TSFD 4OY3A 5F5NA 1O3YA 4EHLA 3HXLA 3A2MA 4PGFA 1OH5A 4A15A 1B74A 2G76A 3LHSA 4NECA 5TJHA 3VR4H 3W5SA 3G6KA 3HA2A 2WZCA 2CNBA 2V98A 4EVQA 1N3IA 1DBWA 1L5FA 3QE2A 3OZXA 3UMGA 4RTQA 4CKYA 4FYHA 2GLUA 2PT7A 5JHGB 2C96A 1FS4A 1CZLA 2GEUA 1XJ0A 1N8NA 1C7ZA 1Y7LA 2GN8A 2IYTA 3L7DA 4XUGB 3MJEA 5E1DA 3ZBPA 2VDKB 5J4VA 4MOWA 2POCA 3KOWA 3NKLA 2OP0A 3QKWA 1QVWA 4Q48A 4WK2B 3MJVA 5LD2B 2A9PA 3G2HA 1K2WA 1JYSA 1NX9A 2BKLA 3NIGB 4GM0A 3DM9B 3K2EA 2GHQA 4W8GA 2E85A 5CYGA 3LKBA 4DC1A 1Z5NA 2IEGA 3MTIA 1ZA2A 2XITA 2OV4A 4OJYA 5E8JA 4BN5A 1F8UA 2A84A 5AHRA 3B9BA 3OD1A 4TT8A 2I7TA 3FNFA 3D7KA 5LLSA 3RYIB 1DKOA 3PTZA 1UP6A 4HK4A 1ULTA 3NALA 3I2JA 3ICPA 5MGBA 3LA6A 4OJMX 4A26A 4YLEA 4LGYA 5LQAA 1ZKDA 1DAEA 3KHUA 4WW0A 5IAAA 3ANNA 4ATNA 2XBUA 2XEXA 1S01A 2WA2A 4Z7NB 5A06A 3A1TA 2QQFA 3N05A 3UMVA 3PS9A 3JQDA 1DRWA 1T5IA 2ONKA 4Q3EA 2NZJA 2L0XA 4RELA 3VOBA 1J4AA 2VVTA 5HE8A 2VJQA 2CLCX 3SE0A 3DV0A 1AKNA 4EJMA 3OUTA 1P75A 3IR6A 3H2GA 4RK4A 3OT4A 2F9MA 3W8RA 1XVVA 1V5IA 1JIIA 2HHCA 2VHJA 2X1VA 4KQIA 3WMEA 1OF1A 1CUEA 3BGDA 3GEDA 2X7JA 3M81A 3P9IA 4QNRA 1FQJA 4AQ7A 1WSWA 1W0CA 4Y2RA 1D0VA 2C9YA 2GDZA 5A5DA 3K0HA 2FWRA 3ADOA 1BVHA 5I8WA 3L8YA 2WUFA 1Z16A 4RFSB 1E4EA 1PDWA 3PFBA 5C7IO 1S8NA 2XEDA 5ALSA 2AK3A 2OCLA 3I6YA 3NX4A 3KZMA 4R6WA 2RH5A 5IJXA 3HP1A 4KBGA 1PT8A 3C1TA 1XWFA 2G8LA 1ZIXA 3BWCA 1K6MA 3PU6A 2DU8A 4UARA 2H06A 4YDQA 4R2KA 2HGSA 4J0KA 5EHZA 1JEJA 3AM1A 1CWUA 3A28A 4MHSA 2NU9B 5CCBA 4NYMR 4RK1A 4Y9SA 4NCBA 1XCJA 2GVZC 2BI8A 3F3KA 3LYHA 1HT3A 4KIJA 4RABA 1HURA 3QMMA 1ABFA 1FLAA 5A4DA 3OECA 4JT9A 2JJ1D 1WPRA 3TLAA 4EM6A 3CUEF 3TIIA 1WKCA 1TCVA 5ICMA 2OAQ1 2EZUA 2IYWA 2X4IA 3CZ4A 3FN4A 2IT1A 1NT2A 1SOVA 4G37A 2CL0X 1ULSA 4G67A 1R6VA 4G1CA 2CK3D 4OFBA 5H9VA 2VXOA 3TQTA 3WWYA 1YVPA 1HSZA 1NQOA 2K2WA 1DJOA 2AG8A 3DT9A 2C1XA 4R7ZA 3VV2A 3SQOA 3FKSD 4L0DA 3VPSA 3DFIA 4YCLA 4TWZA 4ACBA 4PX2A 4X45A 2WAAA 3IPAA 1LW6E 3NDJA 1EGQA 2PT9A 1TQ8A 4Y30A 5CURA 1N4AA 3RTBA 4DUGD 1HXHA 4ENUA 1BX0A 4IAOA 5JWOA 3PC2A 121PA 2XMPA 3AI7A 2AZXA 2I7VA 3NT2A 4K9PA 1GPH1 2PUTA 4OX9B 4BGEA 1PNRA 2ZATA 3B38A 4CQLB 1P4RA 5FO0A 4IIVA 2XWQA 2JDIA 3ENQA 4WZAB 4BNLA 5B4UA 4CG0A 3C7TA 4NCNA 1DNPA 3ICCA 5FUVA 4NTZA 3TCNA 2QDXA 1YHYA 1QFZA 4ZEWA 2VQSA 4LBWA 2AKEA 1Q21A 2R1TB 1H93A 1KQNA 2R8YA 1SU8A 4IQGA 3UJHA 3UUGA 4A2CA 2ZKLA 1DIBA 1VJDA 3CSUA 2KMLA 3JYLA 3I12A 2RGXA 3LSYA 1H42A 2W6JD 1EB8A 2FE4A 2QGNA 1UZLA 1ZGAA 3K92A 4INJA 3EPJA 2OQRA 3EIHA 2IIVA 5K51A 4MPPA 1L5LA 3L82B 4U7FA 3HDHA 8ATCA 3SBDA 2IX9A 1ZJZA 4RTOA 3HJFA 3CLKA 4U1RA 2HJSA 2HIGA 3IC5A 2QVLA 1JF8A 4XOUA 1G5TA 4O5OA 2YOFA 3K1YA 5HVNA 2ZUEA 3TCXB 4HSGA 1KZYC 3U13A 1IU9A 3PHBE 4TMKA 4Y7DA 3QPDA 3L40A 2P91A 3CBQA 4YASA 1YS2X 4KLZA 1TM7E 4W5JA 3GNTA 3SIRA 3IEMA 4ND7A 1KI9A 2ISCA 5CXQA 1YF3A 3PD1A 3QLTA 3DDOA 3UXMA 3HSYA 3ILVA 3PBKA 4E46A 2FQWA 5CITA 5L40A 1YGPA 3TW0A 1OPXA 1LDYA 3IMCA 3GGSA 2VAMA 4AWBA 1TKBA 3MQ4A 1NVGA 2PMFA 4ND6A 3RS0A 2DX7A 2NUAA 1IN4A 1JW9B 4U5QA 4UHJA 1C4WA 1SFRA 1K66A 4J29A 4PFQA 4UMDA 4HNGA 5EMNA 1CXZA 2VCEA 3S1SA 4PHGA 4WDRA 1UJMA 1IDN1 2ECFA 2WG2A 4QYXA 2WKRA 1ORWA 1HE2A 1L7BA 4PYNA 5DP1A 3HUFA 5FDFA 1DRKA 1ENOA 2R60A 1IG3A 2ZK7A 3CEAA 1ZN8A 4PNPA 3HGQA 2E6KA 3VSCA 3KFVA 3ZY6A 2QX7A 2B9VA 4HPXB 1SPXA 1G5HA 2Z1DA 4HCJA 4IG4A 3QTTA 4JWTA 4MICA 4CT4B 4AP6A 4OA8A 3N2KB 4DWVA 4G1UC 1X39A 1WB4A 4EGJA 4HUQB 2PQ6A 1KKUA 5CB0A 4BLSA 2GJ4A 1Y3BE 2YWDA 2XGJA 1HQDA 3A14A 2R00C 2QLTA 3RJ9A 4AULA 3IHLA 4E2ZA 4GX5A 3H5RA 2ZYWX 4BAZA 2CMHA 3JS5A 3GA0A 1JDNA 4I8IA 1XAHA 1DWPA 3P9QA 2JZNA 3HE3A 3K5IA 2B25A 3MF4A 3K6SB 4CT0A 5JNTA 1XDUA 4DB4A 3KOYA 3CR7A 3NKFA 3IB3A 5DX0A 1U7WA 4RYDA 1WF6A 4UEOA 1W94A 2JRCA 3ZDAA 4ALNA 1YS4A 4KDEA 1MORA 1L5WA 4MCJA 3HK2A 2P2NA 2YWJA 2FPGA 3D43A 3KLPX 4ZOEA 5E9AA 3WMGA 2XF8A 3DFKA 4F5EA 2PBFA 4P3NA 3SLRA 5FQOA 2NZUG 1IXYA 2ZR9A 1CJUC 3I32A 4C4YA 4LCJA 4F45A 1I7QB 3DFZA 1Q74A 3AEYA 4Q66C 1H2EA 1DQRA 3LPDA 4P34A 4L16A 3AH8A 1YA8A 1BA3A 1J90A 4RV9A 4ZAXA 1DIGA 5LZ4A 3WMRA 3CLHA 2EGUA 3FZNA 5CT5A 2IOFA 2OV6A 4PQYA 1TQ6A 1G41A 1V6SA 4MVJF 1PNQA 1YMQA 5M2QA 2GM5A 5JUWA 4JKOA 3B1YA 2YASA 5HKBA 3IHKA 1BDMA 3EA4A 4J0HA 4TTIA 1CERA 1Z15A 4FOPA 2GN0A 2HBYA 3CKMA 1OLSB 1DG1G 4N18A 3RTGA 2GAJA 1U0JA 3K0BA 5F77A 5G2OA 1EP3B 3CF4A 4UXJA 2BEVA 1SOMA 1AB5A 2CLEB 3WLHA 1BU8A 1E9DA 3KSAC 1OCEA 4XTCS 3E7PA 1QIDA 1P60A 4IHJB 4AJ9A 4DQ0A 1KOFA 1TVKB 1O6FA 3E9RA 4MQFB 5KPJA 3LT4A 4G89A 1QHIA 4F4DA 3OEHA 1IJBA 2MSDB 2QJTA 3JV7A 3ZWQA 3R6DA 2ID8A 3D7RA 1AKMA 4BXOA 4R54A 1SG6A 1L4YA 1OD6A 3DUWA 2FMKA 1YDWA 4ZQGA 3EG9A 3TI7A 5BXYA 4NPHA 5JSFA 3AP1A 1YJAA 3L6OO 5KI6A 4JQOA 2I3DA 1ISHA 1ZL0A 4KXVA 3VHQA 1T3LA 1R5BA 2QN7A 3L46A 1Z35A 3UJ8A 4DMHA 5H8WA 1OWPA 1F51E 1XU9A 2RK4A 1WPXA 2OVFA 2V7QA 4O2BB 2YXLA 5KZMB 3OCXA 2PZEA 3MMPA 2IZ1A 3IQHX 3D8BA 4IGFA 1EM6A 3AM4A 3DFUA 3LF2A 4EUFA 4CKXA 2AJBA 1Y37A 1WV1A 3G88A 3BWYA 4X1IB 4N0PA 1DUSA 4II2A 3KYDA 4DTCA 4CM1A 3P0RA 4YR7A 1JDPA 2X2OA 4LHWA 1ISSA 4I50B 4MAMA 1JBQA 4EFDA 2YMPA 3RM3A 2XVYA 3GPBA 4RA6A 3I9OA 3I04M 4KV9A 5EE3A 2ZRIA 3HGTA 4HNTA 1P5JA 2ICAA 2PA0A 1J8MF 2BF4A 3A1VA 3NHWA 5J2TB 3I45A 4X91A 3EDRA 4HX9A 4JU8A 5B55A 5EPEA 3VNVA 7MDHA 1KVUA 3URKA 1UIRA 4H77A 2J3KA 2N47A 1KZ9A 3CEJA 5E8RA 3UUWA 2I76A 9MHTA 1LPBB 1DWUA 3T61A 1JAIA 2ZWPA 3TINA 5CA0B 3O4VA 1TCUA 2C2WA 1YSCA 2VJMA 2LP4Y 4MCHA 1QGED 1N1MA 1YBFA 2OG2A 3FI0A 4ZV7A 3WTCA 1J0CA 1W8DA 3A6HA 1UWKA 3GY0A 3HN6A 3AONB 3LBNA 4YLGA 1SWVA 4NZMA 3S2SA 3U3KA 4FEGA 2JFXA 4UTXA 1VL2A 3FPLA 1BRMA 1EFLA 2D62A 4X93A 3MJ4A 3ROQA 4BE9A 2XR1A 4GLFA 2GCOA 1L8XA 4KR6A 4WZAE 3F7MA 5K05A 4XQ9A 3SWWA 5EJAA 2HMAA 2RHWA 1VC2A 2QW8A 3KX2A 2IH4A 1TJ5A 4QOEA 2QA5A 2VDPB 4EI9A 2Q50A 2C58A 4NARA 4XR4A 1J22A 2OENG 3C3KA 3TLCA 5B3JA 1L4BA 2CDNA 1DG9A 2I1WA 3KOOA 3JATA 1UBHS 3OLQA 1VI2A 3MGKA 4QPJC 5JJCA 3ED1A 2ACEA 3F2VA 1AIPA 1D6JA 1FTGA 4PNHA 1U9JA 4EY7A 421PA 5DGCA 4YCBA 4RTNA 3TSAA 3GFBA 4GW3A 1YE5A 1QH8A 3RWMB 3MB8A 4K6GA 5JQWA 4XLZA 4OK3A 3GLQA 4URZR 3H2IA 5DHFA 5TV2A 3X2SA 1NTOA 3SZUA 2QM3A 2XYGA 4O4LB 2D2FA 1U5AA 4KQFA 1W4CA 1RP7A 1VHLA 1Y8RA 1ZMRA 2V4MA 4DR1B 3I2HA 3R6TA 4BO7A 1KSFX 5IKXA 3MBKA 5I9MA 1DRVA 2WBLC 1TF5A 4G4SP 4UULA 5IT4A 1LQUA 4Y67A 5IT5A 3LX8A 4R2HA 2WYOA 3RVQA 3MERA 5BYAA 3TLZA 3A4MA 3GRPA 1FSSA 4O33A 4P9NA 5LYJF 1TRHA 3K0KA 1U3DA 2RONA 1GXSB 1O9GA 3Q7EA 3R6GA 3OETA 4LMPA 1EFVB 4MV4A 5D3MA 1A4IA 4DILA 5L6LB 1DWOA 2NM0A 2V6BA 3NEJA 2IEBA 4J7XA 2DVMA 2ROQA 3OKAA 2YZNA 4OQNA 5EYPA 4PF1A 1L7QA 1VE1A 1XP5A 2OV2A 5CAEA 1CW2B 2FJUA 1XDZA 3TAHA 4Z5XA 1CTQA 2UXCB 2ZZMA 2GF2A 4FI3C 1ZG3A 1Z3CA 5AM3A 3EPHA 1OIXA 1DBVO 2RBGA 4FYYA 1NV8A 4DA0A 3FFWA 3LBHA 5BUSA 3ZW9A 5K3OA 2GSWA 4Q4LA 3Q41A 3L7YA 5C1IA 1Z07A 1HDYA 3OJXA 3T34A 2QYTA 2ZRNA 2XOEA 2C3PA 2WLSA 2C99A 3BPSA 4PX9A 2PKRA 3H9JA 3MAGA 4OL9A 3HY6A 3ZDQA 1XL1A 3JQFC 1KR2A 1R9MA 3VZCA 2P5TB 3COJA 4OG2A 3QM1A 2EBHX 4XWAA 5CU7A 3BORA 3HN2A 2QUHA 3AQ4A 1OH7A 3QUSA 3OIGA 1CETA 3AINA 3VNSA 1RIIA 4WT7A 4A8JC 6PFKA 2FKAA 3PGLA 3EXHA 3VSBA 3HR7A 1SU4A 4RZHA 4X66B 4IDFA 5DSXA 1C3VA 2WSMA 3BMXA 2D74A 2HK8A 1E7YA 5D84A 3TVYA 3RYCA 1ENYA 3WQQA 2M2IA 3OM8A 4JSYA 1LLCA 5FOUA 1KXJA 3U49A 4U7WA 1W47A 2QF7A 1FTQA 2XPCA 3R3VA 5ITWA 3CW8X 2ZG6A 4NNPA 4RH0A 1JB1A 2XUDA 4KITB 2QR2A 1NAHA 3HCBA 4LZOA 4QE3A 2BISA 1K08A 4OQEA 3THRA 3ROFA 3BHJA 3X0DA 3AY7A 1FMTA 4NOJA 3I61A 1YZNA 2EQBA 2RC5A 3OZVA 2WJJA 3DL2A 3DVRX 1M3SA 2GJAA 5KYGA 5A7HA 2BBOA 4ITUA 4UDOA 1WCIB 3T94A 3J81k 5DRYA 3N2EA 1N9GB 3MT7A 1I5EA 2CNWD 3IQDB 3OE7D 2HJRA 1YQEA 2ZIAA 4HDCA 4JJZA 4AQYB 3KDAA 1YVRA 1VE3A 1TI7A 1ZNZA 2C5LA 2X2EA 3WDLA 5CB4B 1CNMA 4JH0A 1LDEA 2HJ9A 4FKZA 5AVVA 3SGLA 1SJ9A 3Q9NA 1SA0B 4UCXA 3NG1A 1I24A 2EJTA 3IP6A 1E3QA 3I0NA 2D2IA 1ODLA 1JQ5A 2RGYA 3DPUA 4TV9F 4UBJA 3T7DA 3ZHZA 5IHXA 3TK1A 5A05A 1N6IA 3GU3A 2X7XA 3X1MA 1QS0B 4C3ZA 4NCJA 1E2UA 4JV5B 1NOKA 2H1SA 4INAA 2VN8A 1AS2A 4HG2A 4AJJA 3PR3A 3G2KA 1DZ3A 3MXTA 2CDCA 3ISTA 3V6MA 2FSHA 3A32A 3F4KA 3SBXA 2BLNA 2OHGA 2XKBA 3C1AA 4P08A 3RUFA 5AYVA 5G4KB 3U44A 4W1SA 2VHVA 3ZE8A 5IASA 4JHLA 1X86B 1XA4A 4HEQA 4X1YA 1F6WA 1FEZA 3AOEC 4M37A 4HH3C 5D6OA 2GN4A 5FBLB 2WYWA 3BAFA 4DA8A 4ETMA 2G4CA 1E9CA 1EPUA 5ICSA 4ZHQF 1ORDA 3WGOA 1VXRA 4MVXA 4J43A 1HNXB 1J9ZA 3G8YA 2G1UA 3RANA 3SZ3A 4BQSA 4DLZA 2J6IA 1P81A 3RFTA 4KOAA 4B3JA 1JFFB 5EUMA 2E1RA 2CFTA 4YRCA 3NTUA 2FUCA 3RG8A 1XKQA 2Q6VA 2LRHA 1T0BA 1QKJA 4I66A 4XCQA 3ZDZB 1U4NA 4TLEA 4PY2A 1Y1RA 3ZY3A 4FR5A 4JS0A 1H5NA 3LY8A 5CLIA 3S2GA 2ZBUA 2VSNA 3FAKA 1BE0A 1TAHA 1J8FA 4M60A 5AOAA 4WLOA 4JJ4A 1A9RA 5F2OA 1XZIA 4LZNA 4WGFA 5BWOA 4TZTA 2PXHA 3BZWA 4FFOA 4CFYA 2P6PA 2P5SA 2HIAA 2IYSA 3QLUA 4DUZB 1H65A 1QGUA 2EARA 3EISA 3FPGA 1YNSA 4A82A 4HXYA 1QDUA 2Q2WA 2M9MA 3PSAA 1RS0A 1YUBA 2ENWA 2AXPA 3PEUA 5CH5A 1OVMA 1Q0UA 1R16A 2D0PB 3GRZA 5H82A 2Q5CA 4DLPA 4IXTA 4UD2A 4I4TF 2WUEA 4FP9A 4DC0A 3EBOA 3R6LA 1JTEA 1JKJB 3QI7A 3TSCA 5BQOA 1RAHA 2Z6UA 2K6GA 1FDRA 1D6SA 1Z6GA 4LNHA 3H5OA 1QVVA 1T5DX 4PANA 2GZMA 2R25B 2QVZX 2YCLA 4EPYA 2PTHA 3F5DA 3CTPA 4OQZA 2Z1MA 2V7XA 2A5FA 1U2ZA 2C9DA 4JOSA 1P2SA 1Z38A 2AFRA 2ZE7A 3X2EA 3O2JA 2GAOA 4G0WA 4ZZ0A 4ZQFA 1NF8A 1H2RS 3CWCA 5CA1A 1W6UA 1NC1A 4YBZA 3I34X 4Z2YA 1QPBA 2FW6A 5LZ7A 3C3PA 4O5AA 3HDQA 5JY1A 1QO0D 1BWPA 2B36A 1VLHA 1Z13A 2R96A 5IZCA 3BEDA 4EI8A 4HWRA 3H86A 3DULA 2HIMA 2B7CA 1OXSC 2YVLA 3R7DA 4YACA 2QP3A 4XWTA 1GCOA 1T8SA 3SZOA 5F2EA 5CT8A 5KYNA 4GGMX 1T1RA 1WO8A 1M6YA 1Q1AA 2G4VA 2I2XB 2O4CA 3ZZUA 4EW3A 1RZUA 4LF7B 5SYMA 3CONA 2ZUWA 5LWHA 1VP9A 2IE0A 2CXRA 3BMNA 1Z39A 4B6FA 4URUR 4WZBB 2DHEA 4IFEA 2M6LA 1JEQA 1XLVA 1KJWA 2I4LA 1GYQA 1SHJA 5TPZA 4B44A 1Q0ZA 5KU1A 3C6YA 1CYEA 3G7UA 4HQ6A 4JGIA 4CR8A 2PMWB 4MLCA 2QY9A 4H3SA 1OJ7A 5LP6B 1H2ZA 1P9LA 3GH1A 5KVVA 3QKRA 5EEHA 4P80A 4DMLA 3RVDA 3CGWA 3GIDA 3WGZA 3PLRA 4JL6A 3HQ4O 4XIYA 5DBGA 4I36A 2SKDA 4CIDA 3ESYA 1P0PA 3DEZA 3GJ4A 2ES4A 4MMYB 1V1JA 4MI9A 5KTMA 2FPIA 3DHYA 2XYQA 3HKBB 1V8PA 1GTMA 1SQ0A 1ZD2P 2VF4X 2CHUA 4WD3A 1YJBA 2VF8A 2XW6A 5LDHA 2GR9A 1P1JA 3UJ6A 2YN4A 2G06A 3K1AA 3NGXA 3OLWA 4LX0A 2ATEA 3NWEA 3ISJA 3OM1A 4RPLA 4OLBA 4BEBA 1Z73A 2HTEA 4GECA 4JBYA 1ECCA 1XRPA 2OCDA 1F1JA 4KK3A 4PLFA 5EIBD 1VI5A 2D8AA 1VBFA 1DDIA 1QWOA 1II8B 1TO1E 1HNWB 3PUIA 1WUHS 4IMRA 4QJBA 5IUKC 1QG2A 1QGDA 3IDAA 3TVTA 1EU1A 3EUAA 3IH5A 3B82A 4JLDA 4QJ3A 1LPMA 5DASA 1BDHA 1NW3A 1CRQA 2IDJA 1NUQA 1ZMXA 3EZ6A 1CR6A 2QTHA 1I5OA 3I09A 5AUPB 4OHYA 4QLAA 2JA1A 4WNAA 4JLBA 2FUNB 1TYBE 2ET6A 3EIEA 4KBYA 2GK7A 3KTDA 4K6MA 2EL9A 2WSBA 1ZESA 4TLDA 4YJFB 4FB5A 3DDSA 1ZCAA 1TCCA 1IVYA 1TA4A 1DMRA 2O07A 3JQ6A 1LWNA 4XXHA 5C3MA 4LGVA 3CLUC 1T4BA 2XCTB 3N59A 1W25A 3DBOB 1T9KA 3ZV5A 1E2HA 3B2EA 4K9SA 2AOUB 2JA2A 3TWOA 2D2VA 1UFOA 3ZBQA 7AT1A 1A8UA 1YXMA 1GVNB 1C9JA 1EHCA 1T0IA 1TYAE 2DBYA 2GEFA 4ILKA 5B1IA 3NC4A 4ZYLA 3ZXIA 5GIPE 3KQWA 1VFNA 1QF9A 4O8ZA 4UCFA 2XMCA 3QU4A 1Z7BA 2ALJA 5TJ9A 5C5CA 1OUMA 4N0DA 4IQ4A 4JMPA 2E5WA 4BMDA 1E5LA 5FPTA 2PUCA 2G07A 1DIHA 1LTQA 4RJIA 2CXXA 2QBYA 2F8SA 3AR5A 5T4BA 3HM9A 4KZKA 3L6RA 4MS4A 1N6NA 1I4WA 4PZYA 1BH6A 5BPFA 5CD1A 4U7HA 3DLHA 1K6IA 1VIAA 3LCMA 5ANRB 1PRYA 3ONNA 2WPDA 1QH9A 5TVGA 1BCSB 1BXGA 3PJDA 1YDMA 3KYJB 3C8ZA 5DLDA 5CCXA 1N7HA 5AHKA 2BSAA 2HXSA 2YIDA 3V7YA 3W2GA 4BFTA 3H0CA 2BI4A 3JD3A 2C9OA 5JAQA 4KE8A 3M3DA 3SJCA 3ZVKA 5DLPA 2ORIA 3GJ3A 4QGFA 4PNEA 1E2KA 4RADA 3OWOA 4RM2A 4QBHA 4DUPA 1R0KA 1CR1A 2Z9BA 3K9CA 4FFLA 4EVIA 3BXEA 3JRXA 2H8GA 3LL7A 1LQ2A 1UBKS 5TXGA 4XDGA 4TMWA 1KVRA 3E1GA 4U3JB 5JBQA 3PJEA 4FJ2A 3IAM1 3CR3C 2FX5A 1ISFA 4QVIA 4BO3A 1FF9A 3M6VA 3EEIA 4HEHA 4AF6A 3STXA 2YWCA 3ADKA 2WOJA 2HF2A 3H19A 2RI0A 1P1KA 1HL3A 5I9TA 4GGPA 2PR2A 1QQBA 1NW7A 2JAHA 4KR2A 4U2FA 1HYQA 4JJ7A 2VXYA 4OOEA 4WBXC 1JEOA 1NASA 1QJCA 2FFBA 2VH5R 4BPBA 1U2TA 1S3IA 4DR4B 2GI4A 1OGJA 1NR1A 2ZRHA 4KP7A 3L9XA 1E9RA 4MPRA 3O2SB 2JHPA 1F1BA 4CE6A 1SCJA 5T4HA 6GPBA 5IW8A 3E1KA 3ZUGA 5KVCA 3PHHA 1QK4A 2I3AA 4NV1A 3DG9A 3ROPA 4EHDA 1P3DA 3AVWA 2O8BB 3DQPA 2ZIXA 3IQGX 2FHSA 1NWHA 3A6JA 1CU1A 3UAZA 1BGWA 5KB3A 2HSEA 4Y6RA 2O3RA 3SJAA 5HUQA 4DV6B 2DGDA 1HC7A 4R8KA 1R4NB 4M2LA 4A2QA 5J3JA 3DMRA 4OIFA 2HJHA 3FSEA 3D6FA 2G09A 2IOFK 3IP7A 2PXAA 5AVKA 1KI8A 2IPMA 1GITA 2RK6A 3CUSA 2PNFA 4NATA 1MC4A 4QXQA 3IXLA 1GT6A 1JT9A 2JFVA 2ZU6A 2X0JA 4ZEMA 2X6RA 3B1XA 1M7GA 1LBHA 1LC0A 1ZAKA 2JLCA 4YJHB 2Y1GA 1OILA 2ODQA 3OKPA 4TOIA 1C9EA 5IM4A 4IIYA 1Y4UA 1AXEA 1RT9A 3GEMA 1OU0A 3H5NA 3HB5X 3PNSA 4J1TC 4EB6A 5HUJA 1CUZA 4DLWA 3LC0A 5GGXA 4DEVA 5AI6A 1IN8A 5EXTA 1WBDA 4A6PA 4BBAA 1Z0FA 1ZR4A 1EVJA 3QV2A 2O05A 3DLBA 1GTL1 3QLVC 4WL0A 4BU1A 5L4LA 5K8TA 1MT0A 5HOQA 4YBRA 3JAWB 1NW6A 1SB8A 1QE3A 1GAQA 3CJRA 4D99A 4B46A 2BFWA 5FA5A 2PEZA 3C5HA 3LFTA 3QELB 4IDBA 2P8JA 4BJ1A 4EJSC 3U19A 4AJOA 2WIBA 3IEPA 3L0DA 3L8DA 4ND8A 3PTAA 4QDZA 1R8YA 3N7TA 3SC4A 3PJFA 2IZOA 5BO5A 2B7BA 1JNYA 3A3NA 3V1TC 4OO3A 1X1RA 1XYYA 4PGGA 4I3HA 1FK8A 1RYFA 3SIPA 3TYXA 4CLDA 3GUVA 1B8PA 3OQ6A 3R3HA 5HZHA 3OE5A 1MX3A 4KRYA 1T0PA 3G0CA 4PNZA 4QL3A 1HQCA 1DO2A 4R41A 4A1OA 4E5UA 2XXJA 4FBLA 3FRIA 1J25A 3WNCA 5EIFA 4EKYA 1WD5A 1ACJA 2OCXA 1ZD8A 3DGFC 3QU2A 4HADA 5CJ2A 1B0ZA