3E1GA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 89
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e1gA00
5AOAA 5C8XA 3WKDA 1ODCA 1ISPA 2YH2A 1DWQA 3LIPA 3M82A 1UFOA 5BOVA 3WL6A 4AXBA 2X5XA 4NZZA 1JKMA 3U1TA 5IKXA 4P08A 3ZWQA 5JYCA 6YASA 3DJYA 3AUKA 5HF6A 1NX9A 1LPMA 4Q3OA 4M0EA 3YASA 4DSAA 2X8BA 3WJ1A 3M83A 4JYPA 1ZIXA 1EDBA 3VISA 2XQKA 4C01A 2Z3WA 1CV2A 2QTBA 4OB8A 1JJIA 3C8HA 1JMYA 4LHEA 2Y1KA 4BTLA 5HQ3B 3OC0A 3EIOA 5LZ9A 2XUDA 4ZV7A 2G63A 3QPCA 4DNQA 1PV1A 1CFJA 1H2ZA 1BE0A 3IB3A 3WWDA 3DL7A 2NW6A 2OPHA 4AZ3A 4ARBA 1G4HA 3F96A 2I78A 3MVEA 1XZJA 4CG3A 4EY7A 1P0PA 1XLUA 5F4ZA 3DQZA 3C6XA 3GZJA 5E4YA 2XUOA 3OG9A 4OPMA 5JZ9A 2WFZA 3HRHA 1XRRA 4ZI5A 5AKJA 1CR6A 4X7BA 1LZKA 4B6GA 2WLSA 4G5XA 5AKZA 1EDDA 4B9AA 1HDEA 4L9AA 3HLKA 5T4BA 1LNSA 3HYSA 5AJHA 4N8DA 2P8SA 4L72A 1G66A 4OU5A 4D9JA 5CBKA 5HK9A 1HLGA 1CUIA 5AM1A 2B9VA 3T52A 1A8QA 3R40A 1BCRA 4CCYB 4QLOA 5AKYA 3G7NA 4ZGBA 4G1FA 5ALVA 5JASA 1FSSA 2WFMA 2WFLA 2V9ZA 5DNUA 5IVIA 2D5LA 3R3ZA 4X95A 3PF8A 3WKCA 3AILA 4C89A 4QWMA 1GPLA 1XZEA 4X6XA 4K6GA 1QO7A 3O95A 3IUMA 3C6ZA 5AH0A 5AO9A 2RI6A 2WQZA 5ALLA 2VQ6A 5FLKA 4DMCA 4Q3KA 2VTVA 3BDVA 2R11A 5CW2A 1BRTA 2HRRA 3WZMA 1ODTC 5JANA 1AKNA 3I2JA 4KE6A 1U2EA 1H2XA 5A7GA 3VXKA 4CG1A 4QZVA 3R3UA 2ZVDA 3NOXA 2VJCA 1H22A 2H1IA 1GQSA 3PFCA 3FYUC 4JUIA 2VF2A 1CUYA 4MQLA 4Y2XA 3Q0TA 3ESBA 1YR2A 1DWPA 3CN7A 4UHFA 5E4JA 1VE7A 1QIGA 4IH4A 1ZIYA 4UFPA 2CBGA 5DYYA 3ILSA 1DQZA 4UPDA 4PW0A 4KE7A 4QE3A 5HKBA 1DQYA 3F98A 2CB9A 1ZJ5A 4DSZA 5K3BA 2QJWA 4KRYA 1E3QA 4WDQA 2HA7A 2ZJ7A 2J3DA 5E4TA 3WZLA 1E5TA 4J03A 1K6EA 1H2WA 2PSDA 2Z8ZA 4UBLA 3DEAA 2DR0A 2LIPA 5K3CA 4UHDA 2WIJA 1OCEA 1SFRA 2JGEA 3ICWA 4J0HA 4FFVA 1CQWA 2XB6A 1XZHA 4BP9A 3OTQA 4IH9A 2XUQA 1ZD4A 3N0TA 5LZ2A 3MUNA 2Z8XA 4EB0A 5T4HA 2XUIA 2AXEA 3WK4A 4AN0A 1VZ3A 5C7YA 3I28A 4PQEA 1CPYA 5H3HA 5D7BA 3G9ZA 5A71A 4QDXA 5ALRA 4J0KA 4KE8A 1IZ8A 2AJLI 4HXEB 2PUJA 4AMZA 2VJAA 2B20A 3CCBA 1YA8A 3ZV7A 1XLVA 5FPQA 1YB6A 4KYVA 5EIHA 2XMDA 3C5WP 3WKBA 4Y7DA 3FYTA 3QITA 2QUAA 4QDZA 1BN6A 2WTNA 1Q83A 4BB0A 2PVSA 5FKJA 2W22A 1K5PA 5ALSA 4WJLA 1J1IA 4JYMA 5D3KA 1LBTA 4BVJA 3ESDA 1R9MA 3BWXA 5EIEA 4QWWA 1CVLA 2C0PA 3U0VA 1GT6A 4AN1A 1W4LA 3EF3A 4RNCA 1UOOA 2QXTA 4GEGA 4WFIA 5CXUA 2XUKA 1EVQA 4Y2UA 2WG0A 4U2FA 5LZ5A 3B5EA 1UWCA 4BBZA 1UK7A 4KAFA 2HRQA 4X91A 2V97A 1MN6A 3V1MA 5JD6A 1AZWA 3DLTA 1CUZA 1IZ7A 4I4CA 4U2CA 2QKYA 1EX9A 1SC9A 5A6VA 2OAEA 3BIXA 5DNVA 2GBCA 3PF9A 2BGNA 3C70A 4JH0A 3E3AA 5ALYA 1F8UA 5DLPA 5LZ7A 2DQYA 3HACA 1W76A 4A5SA 1Q0RA 3PFBA 5LIPA 1D07A 3WIOA 1AX9A 3ICVA 1TK3A 3R3XA 1UK9A 3JWEA 1JU3A 2OQIA 4PO3X 2WUFA 4FLMA 3HC7A 1XZAA 1FFBA 4HXFB 3VVMA 4BC1A 3G9XA 3M81A 3WQHA 4X3CA 1QIEA 1QO9A 5K3FB 4CCWA 2PX6A 4A23A 4E15A 4K6KA 2OCIA 4X92A 4EZIA 3FYUA 2EEPA 5T4FA 3IUQA 5ALMA 3V1NA 2BAGA 4HRXA 4J0JA 1GQRA 4RE5A 2H7YA 2G4LA 2GZRA 3MUOA 4C4ZA 1TQHA 3IIIA 1CUHA 1DX4A 3TGLA 1CLEA 2WM2A 3O4JA 4BATA 1MPXA 4X6UA 2DSNA 1ZI9A 2YYSA 4GXNA 3V1KA 2J4CA 1ZICA 3AZQA 3HEAA 5AI0A 1THTA 4LYDA 4Y2YA 5D3ZA 1MAHA 3H19A 4HZGA 2O2HA 1XZBA 4U2DA 4OCZA 3WMRA 2WUEA 2HIHA 2GBIA 3WKAA 4Y2JA 5FOQA 2ONCA 3HI4A 4DYHA 1ZGCA 1SOMA 3WK6A 1TIBA 4ZRDA 2IIVA 1DX6A 1AUOA 5EHQA 4KR0A 5FRDA 3P2MA 1QJ4A 4JNCA 2JEYA 2W6CX 2QXUA 5ALZA 2GZSA 1QFSA 2Z3ZA 2OGTA 5ALIA 4B0PA 1UKCA 1J07A 1XRMA 1ODSA 4A16A 5HCUA 3G9TA 4C4YA 2UZ0A 4F0JA 3B3QA 2VAXA 2Z5GA 4OYYA 5HFNA 3FSGD 3I1IA 3VJMA 4EY4A 1MX5A 1C7IA 4DNFA 2HA3A 4UUQA 1CUSA 2XUGA 1JU4A 4PV7A 4HXGA 4J0DA 2X76A 4MYDA 1N8SA 1XFDA 2XUFA 1PFQA 4MYSA 4N5IX 4RPCA 4INZA 2RONA 3W9UA 1IUNA 4FLFA 1CUBA 3QMVA 2CZQA 2WKWA 3WWCA 1Q0ZA 3I1YA 1THGA 1XZFA 5HF8A 4AO6A 1ZI6A 4KE9A 5IVHA 4ZWNA 3D0KA 4QDUA 5AP9A 2BUCA 2GYWA 1CQZA 2C5FA 2GYVA 2C4HA 1XRQA 4Q82A 1ZD5A 1ZD3A 1CUVA 3D2CA 3BIWA 5ALWA 2I3DA 3RLIA 4QDOA 1EDEA 1GPKA 2Y6UA 1UZAA 1WM1A 3DOIA 5K3AA 3A2NA 1FFDA 4C88A 4GECA 4PSCA 3WK9A 4P93A 5HZGA 4CFSA 2OGZA 1ZGBA 1AC5A 3D7RA 2OCKA 3EBLA 3PI6A 3QM1A 4OU4A 5CT8A 2CMFA 5HF5A 4BC0A 1CIJA 1N5MA 4YK7A 3ZI7A 2PSHA 2WHPA 3D2BA 5LP1A 1BN7A 1I6WA 2E3JA 2XLBA 4U2BA 5KBYA 1PJAA 2PPLA 3HSSA 3H2HA 4BZWA 4MWSA 1C4XA 4MWTA 1AGYA 3H2KA 1HPLA 4XWGA 1USWA 3WL5A 4WDRA 1QIKA 4PSUA 3LIIA 3WYNA 3R3YA 4Y2VA 5T4EA 4MEBA 3ANSA 1EK2A 3H2JA 4W9RA 1K63A 4S0XA 1F0PA 1G5FA 1TAHA 3H17A 1A88A 3WK7A 2XMBA 3ANTA 3STWA 4H35A 3G0BA 3WK8A 3H1AA 1P0IA 1B41A 2VT7A 4QDTA 5JARA 1LPNA 1XZDA 2IX9A 1RWQA 1UXOA 4BZZA 1BCSA 5A2GA 2Y2UA 2XMQA 3MGAA 3O9VA 5CH5A 4BAZA 1HKHA 3TRDA 2DCMA 1Y37A 5LLSA 1OXMA 4H0CA 1QFMA 2O7RA 5AIAA 4N8EA 2AJ8A 3STXA 4BCBA 3FVRA 1LBSA 2HM7A 5J3JA 3BJMA 4UFOA 5JADA 1VXOA 1EK1A 3VDXA 1ORWA 3HXKA 1QIFA 3R3WA 2QS9A 4W1SA 3DDUA 3BF7A 2QT9A 5FV4A 1XZMA 1O6GA 2OLEA 3F67A 5AKIA 4Q05A 1H23A 3ED1A 3R0VA 3SX4A 1XZLA 1EH5A 5HK8A 5CMLA 3D5EA 4B7ZA 2JIDA 4XIIA 1KU6A 4H7KA 2B61A 4CIBA 1VZ2A 4KACA 2QMQA 2OCGA 1WB5A 5JZBA 1YAJA 3W05A 2WU4A 2GBFA 1XKLA 1E89A 3FLAA 1XRPA 4MQMA 4UBIA 4IHAA 1JFRA 3UUFA 1R88A 4YX9A 3I2HA 4H7HA 3N2ZB 2VA9A 1XQVA 1DT3A 4UHHA 4NVRA 3QH4A 4F21A 2ZYSA 3AIOA 1QIJA 4C87A 4G4IA 4HS9A 5EGNA 5AI6A 1ORVA 1ZD2P 2HFKA 3FLBA 5KWJA 4H7JA 5AI8A 2VJBA 1QE3A 4KAAA 3W2TA 1XZCA 2HDWA 5SYMA 3BJRA 5I9IA 5E2IA 1EXWA 4YASA 1VJ5A 3A2LA 2PSFA 1YSCA 1BU8A 2JGMA 2XT0A 4DGQA 5AM4A 4K6HA 3DNMA 1E8MA 4X94A 3WLAA 5HQ3A 4E14A 3C6YA 3ZLVA 5CXXA 3ZPXA 4EY6A 3EQ9A 3C45A 4BP8A 3PUHA 1U65A 1XQXA 3F97A 1CRLA 5FP0A 2ECFA 3IA2A 5CTAA 1ACLA 4W1QA 4LIPD 1CUCA 1QIMA 3I6MA 1E8NA 5EHNA 4EY5A 4EBBA 1QIHA 1W1IA 5ALKA 4WY8A 4XJVA 5EHZA 3VJLA 4N5HX 4U2GA 4BTVA 3S8YA 3RK4A 1WHSA 2B4KA 3W04A 1FJ2A 4M0FA 4Y2QA 1AQLA 4E11A 1MNAA 1LPPA 1XKTA 4GBGA 3E0XA 3WKEA 3KXPA 3D3NA 4OB7A 4NMWA 4X97A 2EDAA 2PU5A 2VJDA 4FDMA 5LKRA 4TGLA 1C7JA 4ETWA 2WG2A 2FJPA 3DL4A 2XLCA 2ES4A 4LXGA 1H2YA 3D2AA 1L7QA 3PE6A 2QVBA 2ZYHA 4B0OA 4J0GA 2C7BA 1J06A 2CUTA 1X2BA 2VSQA 4DM7A 4W1PA 3GUUA 3S2ZA 2WIFA 1E8DA 1YS2X 4Q1VA 2ORYA 4CCYA 1MX1A 3GBSA 4X93A 3QMWA 3DYVA 1EB9A 4FOLA 5CT5A 1DWOA 3CCCA 1VOTA 1JMKC 2K2QB 2WIGA 5ALJA 4TVKA 1MX9A 4O08A 4UHCA 3WWPA 2QJRA 3H0CA 2HA2A 3FWHA 2HU8A 1JJBA 4EA6A 3KOOA 2C5GA 1XLWA 1YAHA 2WUGA 3C6BA 5EIAA 1CUXA 1EA5A 4QEKA 4G9EA 1BROA 5AKKA 5DWDA 4WY5A 3NWOA 3D4LA 1BEEA 3E1GA 2GYUA 4H77A 3DCNA 4DNPA 5CH8A 2XMGA 3V48A 3R3VA 1CUDA 4AZ0A 1ETHA 3I2GA 3T4UA 2VAVA 5JAUA 2J3QA 4H7FA 4BYMA 2YXPX 3IURA 3FNBA 5ALOA 2OCLA 3VKFA 4ZV9A 2WHQA 3IDAA 1W75A 2HU5A 5EHXA 5LZ8A 4GLBA 2Q0XA 2PBLA 3G0GA 4DMHA 3C5VA 2HADA 2AJDA 3PUIA 2PSEA 4G8DA 3DYIA 1HQDA 4BCDA 1M33A 4B81A 5AICA 3WIBA 3G0IA 3UMJA 4X00A 3FSGA 1YA4A 1ZOIA 5AHXA 1QIIA 3NGMA 4AX4A 1QOZA 1EVEA 2JGLA 3WL7A 5ALDA 3BDIA 2PM8A 3K2IA 2VT6A 3K9BA 3OURA 3BE8A 1WPRA 1R50A 2ZSIA 7YASA 1P0MA 5IVKA 3AINA 1R4ZA 2RAUA 1FFCA 5JATA 3G9UA 1SCIA 1J2EA 1IUOA 1MO2A 3I6ZA 2WUDA 4TPKA 5ALTA 3FLEA 3I2KA 4J3JA 3QBJA 5LKAA 4AB1A 3RM3A 1GXSA 2WFLB 1FFAA 5AK3A 4GHWA 5C8VA 3EQ8A 1CUUA 2WSLA 4B82A 1MAAA 2XUHA 3FBWA 2V98A 5AM0A 1MJ5A 2XE4A 1L7RA 1DINA 4BRSA 3L1IA 2HL6A 2PL5A 5EFZA 1WHTA 4DLNA 2HU7A 2H7XA 3IUNA 5FDFA 4P92A 3STVA 5K3EA 2EDCA 4FFWA 4C4XA 3FAKA 1OILA 1MT3A 4MEAA 1SCQA 4UBNA 4UHBA 2CKMA 1KEZA 3G0DA 2I03A 5AK6A 2RHWA 5ALFA 5A7HA 2H9YA 4J0CA 4RGYA 3LLCA 5ALXA 2YASA 1R1DA 1CUWA 3SK0A 1BEZA 2O7VA 1QTRA 4OYLA 2PSJA 5A62A 4UBMA 3RKSA 4I19A 5AI9A 4H7EA 1WOMA 1AMNA 3QZUA 4AO8A 3E4DA 2BKLA 4FKBA 2Y2VA 2BCEA 3QMMA 1T4MA 3SC2A 4UBOA 1F0NA 4G9GA 3HJUA 3LS2A 1HL7A 5EI5A 1AURA 5CH3A 5JD5A 1UOQA 5JD4A 4U2EA 4IQ4A 1ZJ4A 3STUA 3L1JA 1Z68A 1JJFA 4M0MA 1GZ7A 2RHTA 4DMFA 1MU0A 1XZKA 2IITA 4E46A 1NU8A 1QGED 3KWFA 2WJ3A 4DIUA 2XUAA 2HA4A 1S8OA 3WI7A 1X70A 3DOHA 4X85A 1LGYA 5DNWA 3DD5A 4IO0A 5CURA 3AZOA 3H1BA 4X71A 1Q84A 2RGUA 5K3FA 4CI9A 2QZPA 2ZSHA 1XROA 4PSDA 4OSEA 3HABA 3NUZA 5AI4A 5DTJA 1UK8A 4GDMA 1R3DA 5HKAA 1XRNA 5HFAA 2XMZA 3AZPA 4G4GA 4X6YA 2JGIA 1UKBA 1EHYA 1O6FA 3DKRA 1UK6A 1JI3A 1VLQA 3DKKA 1QLWA 5DTIA 4LXIA 4G4JA 3TEJA 3F9CA 2WILA 1TCCA 2AJCA 4JEIA 1T2NA 2O2GA 2DHDA 3O0DA 1L7AA 4BE4A 4DMKA 4FLEA 4L0CA 4GI1A 2R8BA 3GELA 1HBJA 4FMPA 4LYEA 4F5ZA 3EQ7A 4L3WA 1GGVA 1SCKA 4Q3LA 1XQYA 3K6KA 2HA0A 1B6GA 1W6RA 3H04A 4DNOA 1QONA 4AMYA 5BWCA 1LPBB 2HA5A 3ZLUA 2ACKA 2C58A 2XQJA 2ZJFA 2ROQA 4EY8A 5SYNA 3W9BA 1K8QA 2CJPA 3WWOA 5C8ZA 2XMRA 5A7FA 1WB6A 4ITVA 4FWBA 3WYDA 4BVLA 5CT9A 5AKXA 3VVLA 2WTMA 4OUKX 5JAOA 4BAUA 1CUGA 4FBLA 3STTA 3FCYA 2QOEA 4QNNA 4V2IA 5ISMA 5I8PA 4WFKA 2JF0A 4Q34A 3A2MA 1WCYA 5DJ5A 1VKHA 4KAJA 2VEOA 3W06A 2FX5A 5DYTA 3LP5A 2BUBA 5LZ4A 1XRLA 3I6YA 2OQVA 1CEXA 4KJXA 5ALHA 1WB4A 4W1RA 2AJBA 1CUFA 5C81A 4CIAA 4QA9A 3ZLTA 5AM3A 2V96A 3O4IA 5KWIA 4AQDA 5IH7A 3R41A 5JAPA 3FYUB 4XVCA 3HZOA 3BL8A 5AK4A 1UT6A 2DHEA 4Z49A 5AM2A 3GROA 1ZI8A 5HF9A 2GBGA 2QM0A 4EUSA 5CT4A 1R9NA 4UHEA 2WIKA 4BVKA 2BFNA 2BGRA 2XQGA 2HFJA 4F60A 4WCVA 4B85A 2FUKA 1IVYA 3A6ZA 4N8SA 2JGKA 2QRUA 3IUJA 1NU6A 5AKGA 2ZYRA 3OM8A 5AKLA 1G42A 4ZXFA 5AIBA 2XQFA 2DHCA 2WU3A 2C0QA 2O2IA 4PNZA 5JIBA 4BRZA 4FNGA 1BS9A 1UOPA 2JBWA 1WPXA 4ROTA 3X3HA 4FBMA 3DS8A 2ZJ6A 4YPVA 3L1HA 3PICA 5AKHA 2J4FA 3IULA 1A8SA 1JT2A 3WWEA 3AIKA 3LCRA 3B12A 3G02A 4NS4A 4W63A 2ACEA 5YASA 5JZSA 1FFEA 5KREA 2WG1A 1IMJA 2OG1A 2XUPA 2DQZA 4K5QA 1DU4A 2QUBA 4Y9SA 3C43A 4PF1A 4RE6A 1RYYA 3C87A 5ALGA 5AKEA 4X90A 2WJ4A 4DTCA 4BCCA 1QIDA 3O4HA 1GPNA 4G8CA 5CT6A 1EI9A 3KWJA 5K5EA 1U8EA 3KD2A 1LPOA 2JEZA 4I3FA 1MTZA 1VA4A 2BUAA 3I2IA 4B84A 1EINA 3TJMA 3I2FA 4Y2TA 5ALNA 4QLAA 1N1MA 2HA6A 3O4GA 1F6WA 1TCAA 2PU7A 3FVTA 4Y2PA 3JYHA 4UBKA 3SWWA 4FTWA 4GWLA 3C8DA 4J0IA 2OAGA 3CXUA 4XX1A 1ACJA 5BWBA 3PDCA 3AIMA 2WJ6A 4HVTA 5CRIA 1N5RA 1VXRA 2XQIA 2VATA 5ALEA 3AJAA 3A70A 1KU0A 4KRXA 2DFPA 1EB8A 5D6OA 3IBTA 3IVMA 5FXMA 3FCXA 1X2EA 3RARA 3KDAA 2ZYIA 3OOSA 3O9MA 2QR5A 5FUMA 5ALPA 3G8YA 4KEAA 4FHZA 3OPMA 4GW3A 4ARAA 1YCDA 2G5PA 2PKYX 2CEKA 4LXHA 5AOBA 4B80A 2OXEA 3ESAA 4BDSA 1P0QA 1LZLA 5AOCA 5AM5A 2FJ0A 2PUHA 3G0CA 5DYWA 2D0DA 3CN9A 4LKOA 5I7UA 1Y7HA 4Y2RA 2WHPB 4G8BA 4CG2A 4UBJA 4ZREA 1A7UA 4HAIA 1QZ3A 4BDTA 2XMSA 1TCBA 2XUJA 4IH1A 1VE6A 5JALA 5AI5A 5ESRA 1DT5A 3M3DA 4MJ3A 1CUEA 4K2AA 4J7AA 3V9AA 1E66A 2JGFA 4EHBA 5ALUA 1QTIA 1LPSA 5ALQA 4H18A 1YS1X 1GKKA 4HRYA 4OD0A 3D59A 3F8SA 3QPAA 1XZIA 2WIDA 3Q8WA 5FPPA 1YASA 3GA7A 2RIPA 3STYA 4WFJA 3WJ2A 3BXPA 3H2IA 1A8UA 2H7CA 4FNMA 3WL8A 4BAGA 1LPAB 1TKRA 4UFNA 3QPDA 2OGSA 3H18A 1K4YA 3UUEA 3JW8A 4Y2SA 5LYYA 3WK5A 1CUJA 1CUAA 2Y6VA 1MNQA 1UKAA 5AK5A 1VA5A 3BF8A 2G5TA 5BV7A 4BE9A 1W52X 3GFFA 1GKLA 3ESCA 4C6HA 4B9EA 1Y7IA 4OB6A 3FOBA 1YB7A 2XI4A 2HHAA 5JAHA 3H2GA 2XDWA 4HTAA 2XMCA 2I3ZA 5K3DA 1XQWA 1U4NA 4AO7A 3WA7A 2WHRA 4B83A 4H7IA 3AFIA 3VJKA 3V1LA 1DTEA 1XZGA 4MXDA 1TRHA 1LLFA 3QYJA 3KSRA 5IVDA 2BJHA 4H7DA 4P9NA 1RP1A 3QVMA 2JGJA 1IUPA 3WA6A
chains in the Genus database with same CATH superfamily
1LTQA 2VHEA 2H5JA 3DHVA 1A7AA 5C8XA 1F14A 1ODCA 2FR1A 3WYAA 4NPCA 5CLQA 1VTKA 1W73A 5K09A 1ONSA 3VSDA 5BORA 3UQYS 1NV8A 3HHPA 3NB0A 4O3FA 1NNUA 4C04A 4LZNA 3EEQA 1M6YA 1ZP6A 3TUIC 4UNNA 1D4FA 4H3HB 3NANA 2X5XA 4DG5A 2C7OA 5C7IO 1WP9A 2FSVA 1BG6A 1QNLA 3ZWQA 1V16A 1BC5A 1G3RA 3LVFO 4UPVA 2C7VA 6YASA 2E1RA 3EIHA 5LOVB 4UE6A 3RRBA 3SYMA 3JALB 1HETA 2Q4BA 3KLOA 4AP5A 4WLVA 1IZ9A 4PTYA 2HDHA 2IYPA 3G1WA 3LKVA 1RBMA 2X8AA 1T10A 1XU9A 3N2EA 4JT2A 16PKA 3Q9UA 4QC2A 4R1NA 5HJ2A 1RKVA 2HTEA 2X6RA 5I9SA 5JPIA 1G59A 4FGSA 5LYJF 4WX2B 2VTBA 3FPKA 4U7TB 4DG8A 4COOA 4L75A 4BX0A 4FZ5A 4RTSA 1GM5A 1W2HA 2X8BA 1UEIA 2AEFA 2GJ4A 3GG2A 3KBBA 1Q14A 3M6XA 4KQXA 1IAQA 1IAVA 2HEGA 4PYIA 3OTGA 4JYPA 1EDBA 4ZVNA 3NTUA 5IUJC 1SU4A 2V54A 1EK0A 1TEVA 4OA5A 5ENZA 3AHFA 4OOFA 5EIFA 4ZAVA 5CVCA 3UB3A 5A4JA 4L4SA 5DTMA 2YV5A 2WZBA 4WXYB 5HOEA 5DNCA 1V6CA 2DKOA 3U17A 4O2LA 2AFHE 4XFDA 5KAMA 1NQOA 5AESA 3COWA 4BV3A 1LBHA 1XTPA 3QVUA 2C2ZA 3ZS9A 2VCYA 1XA4A 2C3UA 4GRIA 4LHEA 4QIHA 4OLFA 4DR3B 1TM3E 3RT1A 3E84A 3S2UA 1QANA 2JL1A 2QAGA 3OEEA 5REQA 4IIUA 3PGA1 3SLRA 4LVOA 4B43A 4NV1A 4AJ2A 1EJ6A 1XMSA 5LZ9A 3JQFC 2IHUA 3AWDA 2VZLA 4P3OA 1EIWA 2H18A 2RI1A 1S1MA 3K5HA 4PZYA 2JFPA 2FFRA 3PEEA 2A5YB 3DFMA 4FMDB 4I3HA 1RWOA 4KIJA 4Z4HA 5BQFA 3TTWA 1H2AS 3ZWXA 1YACA 3QEJA 5IANA 4Q9JA 1XP8A 4DR1B 1RYZA 1URPA 4JBHA 4P86A 5FJJA 4GE3A 1GZHB 1YZKA 2PMEA 3SVZA 2OENG 4X64B 3IB3A 3IPAA 3OCJA 4FYWA 1LCIA 1IULA 4NXNB 3TBHA 1P29A 4GI3A 2OPHA 3LT1A 4N9WA 5A9SA 1TM2A 1PQWA 1XCJA 2I78A 3DAGA 5E6SA 3GLQA 4MS4A 3UICA 3OLQA 3WLIA 1TT5A 2OHJA 3T3GA 1E6MA 5IYZF 3H1TA 3LWNA 4ZCQA 4F04A 1VJDA 3DMRA 4UDYX 1DADA 1P0PA 1Q19A 2HCBA 5CA1F 4R2WA 4H3VA 1LJLA 1G6OA 3H2ZA 5TF0A 2CMDA 2POQX 2XEDA 4BPRA 5BSFA 3M4ZA 5C53B 1Z35A 5E4YA 2JZNA 4EO7A 2IKSA 4ZIRA 4GVXA 2OPBA 4G1UC 1ZITA 3AR9A 1PV4A 2G6BA 2GOYA 4V24A 1OX6A 4K9NA 2ZS9A 1XMOB 4QUHA 2P90A 1KAQA 3HO1A 3BREA 1SU8A 1XRRA 4ZI5A 4P4UA 2VR1A 2P69A 1UFQA 2I34A 1U3WA 3PKIA 2JI9A 2ZJ4A 3Q12A 3KOMA 4G0NA 4B6GA 3INYA 1XVLA 3GRUA 2WLSA 2BFBA 4QT4A 4JSTA 3EWIA 1QYDA 1VYVA 4ZGWA 1EDDA 4JP2A 3EIUA 5G1OA 5J2UF 1W4CA 4LJ5A 2ZR9A 4F6CA 2D7DA 3DB1A 4RAOA 3UMFA 1KI2A 1KQNA 4IV5A 4KXUA 2G28A 1YZUA 4F5EA 4RBNA 4YRQA 3HYSA 4G4SP 3D8HA 4UD2A 2VQDA 3T0GA 3GMSA 3SCZA 1TK9A 1GKIA 1VPLA 4OLJA 4L72A 5HVNA 4OGKA 2AZ4A 2FN3A 3L0BA 4RTRA 5EHIA 1G66A 3NRBA 4YT2A 5LD2C 3SYTA 1VECA 4D9JA 5CBKA 4NHOA 3L7AA 1CUIA 3WDKA 5ADVA 3L7JA 5AM1A 5K8TA 1R10A 4MKFA 4Q4HA 1O9BA 1KRXA 3CKYA 1LX6A 3ENWA 4TTPA 4NE2A 1DXQA 5FLXA 3ZQKA 4BV2A 2OV4A 1WB9A 4CCYB 2Q6VA 3KLBA 4QLOA 5AKYA 3QVWA 5EJGA 4MW9A 4UXHA 1TA4A 3RIHA 1P4AA 1H8HA 3O94A 4YMVA 2H06A 2RBKA 1JR6A 2ZSFA 1SQGA 4HVLA 3OTOB 2AC7A 2ZZKA 1PJLA 1C80A 3ODPA 3OT5A 4IXTA 4UULA 1LA2A 3Q3IA 4MGEA 3PEVA 4E33A 2V9ZA 3JRWA 2FDCA 5DNUA 3KSBC 3TW0A 5BN5A 3HUFA 5FQNA 3WO1A 3UFXB 2QTWB 1F2TB 3NHZA 3B13B 2R4TA 3R77A 3GFGA 3CJQA 3I0MA 1JQ5A 3JZFA 3QI2A 4QWMA 4C08A 4HWTA 1GPLA 3C7AA 1PNOA 1CZUA 4L15A 1KDYA 1XZEA 3VX4A 3BB4A 4E2XA 1UPUA 2FWBA 5FA8A 5DGCA 3S99A 4CDMA 4TLBA 2NVWA 4Y0VA 3F6SA 2CD9A 2AG8A 3MCWA 3G9QA 3CFYA 3EDRA 3VSEA 4MYUA 3G23A 4PWZA 1R0XA 3MN1A 5E8JA 1R5BA 2XPCA 3S68A 3S44A 3WDMA 2VUHB 3FZQA 1QMGA 3DPIA 5AH0A 4BMNA 3WGJA 4C4TA 5FA5A 4E1BA 4OHZA 2YV2A 1FTNA 4MPPA 1IEVA 1KH1A 1NNEA 4Q3KA 4INOA 1YVEI 4LBWA 2PX3A 4L4XA 4QHYA 2XNJA 5TY0A 3CZ5A 1G19A 3VBEA 2ZRLA 6NULA 1G3UA 3I52A 3PEWA 3GLIA 2MSDB 1AKNA 4BZQA 6GPBA 2ZATA 2P2CA 1NQUA 4Y6SA 1LBIA 3NEYA 1H2XA 3W4IA 4N47A 2DPHA 3VXKA 3FFAA 4HDKB 4IOJA 4I7EA 3NKVA 2I4NA 4ZVRA 4EKNB 1OB2A 4CG1A 2X14A 4XUCA 3NOXA 2IK8A 4URXR 1ORRA 1H22A 1HM5A 4P5DA 2ERXA 3KPUA 1E61A 4FGZA 1N33B 5CNMA 3PFCA 5FBLB 4EIWA 2WBLC 2EFJA 3PUXA 3L8HA 4LSGA 5FLYA 3P9IA 2DYKA 3SLKA 4MQLA 2EL9A 3P2YA 3CZAA 4P4NA 5BW5A 1YZGA 4GGPA 1TX4B 4I2VA 4N41A 3FD8A 2JH8A 2CDBA 1QIGA 4Y3UA 5M29A 2P67A 4IH4A 2BGIA 5J2TF 4QLBA 4DAOA 2AT1A 3BILA 1RWWA 3DOOA 4MVXA 1QGDA 1DQZA 5TQ2B 2X2FA 4K9QA 4PYNA 1E18A 2B4QA 2Q2NA 3HYCA 4BB6A 4KE7A 3A3KA 2NQ8A 4YRCA 2HJGA 2FK8A 1DQYA 1EEHA 2O1WA 3HU1A 4NYMR 1PT8A 4I1PA 1CIPA 1EWVA 2O8EB 4PTLA 4KRYA 2ZLBA 2GCNA 3A3PA 4BO3A 1UMDB 5INTA 3PXEA 1ZN8A 4PNEA 2LDBA 4H1VA 5E4TA 2REQA 3OQOA 1XNQB 3D1LA 2BI7A 3HFRA 3W79A 1AKMA 5KNBH 3VH4A 4IVPA 3DXZA 3K9CA 3KQOA 4MI3A 4RKFA 2BONA 2FZ5A 4II7A 1VL0A 2HQOA 3H87A 3PXAA 4K1LA 1LSSA 2RGXA 2WIBA 3MCZA 4UNIA 1SKMA 2DY0A 4LC0A 4TVBA 1Q7RA 1C1HA 1JIXA 1NDQA 1PCXA 1XDGA 3CQ9A 3QPVA 3GLFA 1ZM9A 2ZSAA 4L22A 1D2NA 3H2SA 3QW4B 4UHDA 3SBDA 3GFQA 3O84A 1OY1A 5BSMA 3ZWDA 3RYCA 4UJ3A 3RNOA 2K7ZA 1WUJS 4J4BA 2QMYA 3D3JA 5HKLA 1OWNA 2JGEA 4J0HA 4Z7NB 2A0UA 2PLFA 5JU6A 2I9PA 1L7OA 2HCTA 3PFKA 4KDEA 3A37A 4R1OA 4UNPA 4ECEA 3OUUA 4EG3A 1AJEA 3K1JA 1K0FA 3SR0A 3GGSA 1HRDA 3ZQ4A 2NUPB 5A4FS 3N0TA 1BQ4A 1F0KA 2IW1A 4V3CA 4S24A 4QU8A 4DWVA 3FMGA 1QPGA 4EB0A 2RH9B 2V03A 3E7DA 2H4YA 4BOYA 5A9RA 1ENZA 4EB6A 4OJQA 5T4HA 3QYAA 1OYOA 1Z3IX 3AF2A 1NOKA 3GO4A 3RRNA 4HPWA 4RABA 1K08A 4EG8A 4JI5B 2FPGB 5K8JB 4TXMA 4KN9S 2NUTA 3Q87B 1KK0A 4Z4CA 4JT9A 5BVGB 1XR3A 5D7BA 3OFND 4G37A 2GM9A 4IDEA 4Z4FA 4L8FA 4XSHA 1RXVA 4JJ6A 5ALRA 1K6MA 1Q0LA 2R79A 2HY7A 3LD9A 4ZVPA 1ULTA 3PQ2A 4KPUB 3UA4A 5EINA 1NVVR 2OXFA 3JQCA 4AMZA 4DV0B 2QLFA 4JJ4A 1OREA 1ISFA 1J8QA 4CEHB 4RVHA 3HJAA 3QE4A 3I6BA 1YB6A 1SEPA 1AIPA 1EVLA 1WV0A 1FXWF 1KTVA 2J30A 1IOLA 4WD3A 3AKZA 5BSUA 2PZEA 3RUDA 2Y67A 3DZJA 2UUPA 1TUEA 3H3XA 2V9PA 3FYTA 4Y7DA 3E05A 2YQ5A 1PW7A 4GR4A 1BN6A 1JHOA 4DCGA 4ZDJA 3L0OA 5K4HA 1Y7PA 3ZVNA 2O6HA 2OBBA 3JARA 2C9YA 2H63A 3NDPA 4RH0A 5BO5A 2PA3A 2O8CA 2AYYA 2B92A 4FHGA 1TPYA 1L7NA 4W4TA 5FKJA 2P9CA 4G0VA 4AKGA 1IC6A 1JHUA 2Z9BA 1ADFA 4UUOA 5ALSA 4EMSA 2PGXA 3GPDG 1L1RA 4DCSA 1XJCA 1MXFA 3VC3A 2VJMA 2E7ZA 4D6YA 1EGMB 5FHQA 1ZA2A 2P0YA 4OL9A 1P1RA 2PXXA 4M1TA 4ZQHA 3CA8A 3IRUA 5BSHA 1LBTA 1CZHA 3RU3A 3FYCA 4BGIA 1NRJB 1P4RA 2PXHA 3ESDA 1MGOA 1C4KA 1R9MA 1SUSA 2C5LA 3CLUD 1HE4A 1M6VB 2A58A 2PMFA 3QUQA 1KIFA 2C0PA 4QWWA 3WGZA 4Q15A 3S1SA 2HHHB 1KNQA 1KXZA 1J97A 3EY4A 2O8DB 2I3GA 2QW0X 1Y8AA 2CSUA 3CG0A 3KLPX 1UOOA 3SKYA 3T9CA 3ZZ1A 1MJNA 1TK2A 3EGDB 3KBOA 4GEGA 4M1ZA 3RADC 1VI5A 4CEJA 2YMMA 5CXUA 5KVCA 2AMJA 4TTRA 5KQLA 2XUKA 4DA4A 3CBGA 4QYIB 2VCEA 5K0ZA 2PMKA 2C1ZA 3BYZA 4U2FA 4XEUA 4BFUA 3L4BC 3KEQA 3K2EA 3I9LA 3DBLB 4X9XA 3PGLA 4URYR 1CG6A 2ZPUA 5E6RB 4DBVO 3QEMA 1P75A 4M7RA 4BBZA 1UK7A 2V7XA 2HSDA 1BJKA 1BMFA 3NQ41 5EESA 3VO2A 3ICPA 1T35A 4H4CA 2AR7A 2FHSA 3ASYA 4H3SA 2H1OA 1MR3F 4KV9A 1Y9EA 2RAPA 1A82A 3DMFA 2B2XA 3SC2B 4PG5A 1SC1A 2WWXA 4WT7A 5I3CA 3JSXA 4CETA 2Q3CA 4JLOA 3X2SA 2QVYX 1XQ9A 3FVQA 4EUEA 1MB2A 4RTOA 1CUZA 5DM1A 1CBUA 1RMQA 4TTTS 4AS2A 5ABPA 5KNCH 2WQ6A 2OV2A 2R0QC 3EXG1 3SFZA 3EZ9A 2VL7A 2QKYA 2PVPA 3M4NA 1PFWA 3BIXA 4R7GA 2C88A 2VT3A 2P9HA 4M99A 1X8JA 4M2LA 2VWQA 3PF9A 5HUHA 3C70A 3E3AA 2MMGA 3F5QA 1AOXA 5ALYA 1SO8A 1EXNA 3K0CC 3TJRA 2YY5A 2DQYA 5LDHA 2AJTA 1H69A 3B53X 3C8ZA 1Y34E 1JFFA 5KMGA 1AB5A 1E64A 3L77A 4M86A 1Q7EA 3DMPA 1B4DA 4W9MC 1OGYA 3ECSA 4H4EA 4DDWA 1PJZA 2CXXA 1GCUA 4KAXA 4D4HA 3IHWA 1D07A 4I5DA 1G0OA 2W8BA 4IJUA 4WUTA 4AQ7A 1KMHB 1E4VA 1QCCA 5E6UB 5GV7A 5M7EA 1QXSA 2BP7B 2C2HA 3HCEA 1QR6A 2HLDA 4R5HA 5BN3B 1QC5A 5TEWA 5E9WA 1OV4A 1E1QA 5BUZA 4DJDC 1A97A 1OGIA 3M34A 2NMVA 1VKZA 2OQIA 1QRDA 2QL7A 3BE6A 4WLOA 3GARA 1LI7A 1R16A 1DC5A 3TNJA 1X7WA 3HC7A 1ZW1A 4U2KA 3NVDA 2QRKA 1XZAA 2FQ1A 4S0ZA 1FPMA 1A9YA 2QLBA 1IBCA 2X9LA 4HXFB 3VVMA 4EW3A 2AI2A 2I8CA 3GVPA 4Y9TA 4Z4GA 5K4AA 2NTNA 3IKVA 4YUXA 3WQHA 4L5IA 2JEOA 5FUVA 4EO9A 4MP3A 1J9EA 1XPOA 1QO9A 1G3IA 3GMDA 3U9TA 3W8EA 2ONZA 1EPUA 2C5AA 2WA2A 3I9V1 2MSKA 4O1HA 2E6KA 3P9ZA 4X1IA 3OJOA 5AUQA 2XW6A 3G89A 5CVEA 4X92A 3IDQA 4Q01A 4EZIA 3QPWA 2LCFA 1PV2A 2BHRA 3DMGA 4Y1GA 2VHXA 3O7WA 3DWGA 3LHKA 3DVSX 2JI7A 2D5IA 3ZLBA 5L8VA 3KXIA 3CVJA 3IUQA 4AZ3B 4Y6OA 4RGBA 1M1NB 4KQJA 4MMZB 5LYJA 1MJFA 1L5GB 2BM1A 4B75A 4DCCA 3V1NA 4BWFB 1RHUA 4OGGA 4PAOA 4D8UA 1HA3A 2CNWD 2FSUA 1JUDA 2P1DA 1YGPA 1AO3A 1X0VA 2BTQB 2GZRA 1PT9A 2WKRA 3AF3A 3BXHA 1I2CA 4JI1B 3H8VA 4YBRA 1HDZA 3K2QA 3TDNA 3WLEA 3EXIA 3T94A 1J7KA 5LL6P 2IC5A 1DS6A 4IQGA 4JD5A 4ZAZA 3UWOA 1M3SA 4F91B 1GDTA 3NJ4A 3IIIA 1AK1A 2FPRA 2ZBRA 3KVOA 1IN8A 2QU8A 3O1IC 4I66A 4PIPA 4Q37A 1CQXA 5EMJA 5T8KA 2XCTB 1DX4A 1SCDA 5CIWA 1LDBA 3LUHA 4MVJP 1PS0A 3O47A 5EIBC 1CLEA 4BO4A 3VVBA 7AT1A 4JQYA 3IJPA 1JHYA 2Q1SA 3NP9A 4BATA 3NWJA 2MHCA 2DY1A 4B3CA 3ISVA 3KDPA 3BFVA 2J0VA 1TZKA 1ZI9A 2YYSA 4S1NA 2CLIB 1YJ8A 3F1KA 3V1KA 1OFUA 2Y93A 1P7VA 1DMRA 4KMSA 1N32B 4I81A 4YJ3F 1RJ9B 3Q88A 4BO1A 4HWGA 1THTA 1CE8B 3PVCA 4LYDA 2BMVA 3ROKA 3N7UA 1HDYA 3RVPA 4QSHA 2EBHX 3H19A 1GTRA 2QQFA 3AG6A 2JJ1A 1NVBA 3PYXA 2Q3LA 2V6FA 4F2HA 4RQAA 4CCSA 4AI6A 2HIHA 4DLZA 3BSSA 4KNVA 2GBIA 1YE3A 4YACA 2X3UA 5FOQA 2E5FA 2NYVA 4V02A 3PQ5A 3TF5A 4B6JA 3WJAA 5FWDA 4DKXA 1QHGA 1SOMA 4F7WA 5FEMA 1LV8A 1YBFA 4PX3A 1V7PC 2O7QA 2R751 3B8HA 3MGCA 3RIYA 2A67A 2D5AA 2YBDA 3NM4A 2WV7A 3B8EA 3QWHA 1F7UA 3LK6A 2A59A 1Z0IA 1W47A 1ZGHA 1P77A 4EW2A 1CEYA 2AB0A 3ECCA 2A9PA 4LVUA 1I1QB 2V7GA 5G0UA 3S5JA 3AUTA 2ZE7A 1HI9A 1OV6A 3ORRA 4D02A 3R9WA 1WUKS 4OMUA 2LKDA 3WLKX 4TRNA 1Z2CA 3LZCA 3JQBC 5CVDA 2IHVA 3A1CA 1V5FA 2GN4A 2JJ8A 3KT3A 3G2LA 4RZSA 3AR6A 5CU7A 1P1CA 2TS1A 1HNXB 4AJ9A 1WAMA 4AWAA 1A9QA 2OGTA 4MOWA 4EDHA 2YFQA 4RORA 2HJWA 5ALIA 4RLQA 2AN9A 5EZ6B 1VGVA 4K40A 4QPDA 3L41A 2JHCA 5LM3A 4MPRA 1FMTA 4MVJH 2F9FA 1NW8A 4BU0A 2UVPA 3G9TA 4KH0A 1JPUA 3P0FA 3ST7A 1ZIPA 2C5SA 3N5CA 5H4HA 3SE0A 1SKAA 3U7JA 2VAXA 3MRTA 5GVRA 1UEXC 1I2BA 3FSGD 1QQ7A 2Q1YA 2BISA 3EOAI 3I1IA 3O2SB 4BEWA 5IF3A 1I4OA 3O31A 3BK2A 4UTVA 3WVNA 4X8MA 3UATA 4DNFA 3PDHA 3QVLA 3HFJA 4U9HS 1FRVA 2G1AA 1HURA 1KQPA 1R4AA 5JDIA 2V6MA 3VAZA 3QOYA 3P0EA 3RRYA 2ZE5A 4J0DA 1Q1BA 4MYDA 2ZJ1A 3EWNA 3LP6A 1FP2A 1N8SA 2G88A 5A0TA 1RIFA 3GZ4A 5EXTA 3LTNC 5AW3A 2P1RA 4ZAWA 2A88A 1YTUA 1H9CA 3M4XA 2ANBA 4RPKA 1PTJC 3UK2A 2C4KA 3WYEA 4MYSA 1Y4UA 4TMWA 2PX8A 2DPMA 4CXMA 4YJFB 1NJFA 1MV5A 2CN1A 5JSFA 4RWEA 4BO5A 2DF8A 3IX7A 4KI0A 3EVAA 3RK0A 1ZMXA 3TZBA 5JMTA 5KSPA 1XU4A 4UAUA 1G8JA 4BKPA 2YC2C 4NC9A 2VEDA 2YS7A 1KH2A 3KKKA 8AT1A 4DHWA 2PKWA 3QTLA 3WWCA 1XF1A 4FUQA 1L7VC 1G2OA 1P9RA 2WD9A 3OX2A 1O0CA 1XZFA 3FFXA 4PU0A 3RHFA 3BGDA 1BJTA 3DFIA 1ZI6A 3H11A 4V0LA 3ZNOA 4FFMA 2WTBA 1AKQA 4TX1A 1OX4A 2VJQA 2XTZA 3G1TA 4MVCA 3D0KA 2CMKA 3UMGA 4PSAA 2XBMA 3WYBA 4YCNA 4I4TA 2JCGA 3HVUA 3RYHA 1NWHA 1TJ3A 4YJGB 3LE8A 3UCFA 3MMNA 1YZHA 4HR7A 3JQ9C 1CJUC 4H0NA 4Q82A 4TUYB 1I5RA 2GN8A 3GJ0A 5DSZA 4KPYA 4RPIA 1G38A 4BFXA 1FK8A 3A1FA 4CQMD 4ND8B 4JUCA 4MCIA 1CUVA 4CQLB 3BBPA 3BIWA 3DCJA 3N28A 2ZM6B 4IZ6A 4Z1OA 3E7FA 2ENWA 3B1ZA 4KQMA 4P5EA 4W5JA 5CK5A 4GX0A 4M1EA 1PFVA 4GBMA 3RREA 1VLMA 5AUOB 4Q48A 4G0QA 2OMKA 1UZAA 4EAQA 1BZYA 1WM1A 3AI3A 4YREA 4EGCB 4DR2B 3DXFA 2X41A 1BXZA 1GR1A 1NQ5A 4GMHA 4ZTBA 3B82A 1NURA 2AUTA 1IJBA 2E4XA 2F90A 2GILA 2GPNA 2RGNC 2R96A 3AC0A 3HR8A 4LI0A 3O1HB 4P93A 4TKLA 2FETA 2OMEA 4CFSA 5IJXA 4BL5A 4DSOA 1ZGBA 1UR5A 1AC5A 3C48A 5ENDA 1O95C 3GB9A 5A04A 5FPKA 3EBLA 4LHZA 4D4MA 4CCAA 1GFZA 4CGZA 5DNYB 2XOEA 1L9KA 1S2NA 2ZROA 5JWHA 3RYIA 4B3HA 5BN4A 4KR3A 1G8GA 4GM4A 3BTSA 4Y9RA 1BDBA 5HZKA 4YRIA 4KITB 2FH5B 4YK7A 3I5XA 2PQ2A 1XB2A 3C74A 2PSHA 2C59A 4N3AA 5FI1B 3ZI7A 4F86A 5J2TA 1Q92A 4KX5A 1L7XA 2E3JA 2XLBA 4U2BA 1P4GA 4DCJA 1COZA 3T7AA 2O7NA 1UBSB 3FNQA 4OQYA 1O6CA 1YC5A 4G63A 2P65A 4AT1A 3GN2A 4MK4A 1CYDA 2XXAA 3LBYA 3O75A 1GAWA 1W46A 3H2HA 3JPWA 3VZQA 2PGNA 1OI2A 4AIIA 4BZWA 3AUYA 2PMBA 3L9XA 3QOXA 4FK8A 3C3BA 1C4XA 4MJXA 3DH0A 5KSZA 1AGYA 2EZ4A 4MR7B 1ZKMA 1YR9A 2VWHA 5BV0A 1XYYA 4WDRA 3DT6A 4PSUA 3O74A 3WYNA 1OZFA 1GUBA 2QP4A 1ZD8A 3LM8A 1W85B 2HB6A 4G5HA 2OHIA 4Y2VA 3GXBA 1KKLA 3WB0A 5T4EA 1P45A 2SKCA 5K0TA 2CYAA 1L9XA 2XKAA 4FD2A 1IY0A 1JDTA 1G4UR 2OZPA 3M3PA 3Q6MA 3TKLA 4DREA 4YUZA 3AHEA 3H2JA 3QVVA 5DCYA 4ICIA 1N2CA 4M87A 3I9OA 1N2XA 5G1PA 1K9SA 4F3CA 5DLQC 5JY6A 3HKEB 1U8ZA 5TPWA 2MSWA 3U3OA 4DANA 3TN7A 4B3XA 1X80A 1GNTA 4WWHA 4EYSA 5EXSA 2V1XA 3CNNA 1PNTA 2ZI6A 1MPTA 3TZQA 2WWIA 2JAWA 4ILEA 2C0CA 4JQZA 1FUEA 5KYXA 2COKA 2SKEA 2FR8C 4J90A 5TMBA 1NOIA 2OECA 3DF9A 4GZMA 4S35A 1XZDA 5CR9A 3DP9A 4JVLA 1I1HA 5H59A 3P2JA 3N86A 4IWXA 1VMAA 1W4ZA 5G4LA 4QXOA 5L3QB 4MGIR 3DO8A 3R5HA 1X7HA 3RFXA 4DYVA 2BELA 1EQAA 2OBXA 1O1YA 1T8UA 3KFVA 3K8OE 4BAZA 3C7DB 1I6LA 4HGPA 2IYSA 4BMVA 3A7EA 3ZHXA 1UXIA 2EFEB 3JQ7A 4MGZR 4LDPA 1EX1A 5D1NA 1QFMA 1SKUA 4LW8A 5DX8A 1SZPA 4ENPA 4PBRA 1WZCA 2VYNA 1B0UA 2VK2A 3AGQA 4HNGA 5AIAA 1MH9A 2ZJOA 1CRZA 2YRWA 4R2JA 3STXA 4FB5A 1HZZA 4MVJF 2R60A 3AVPA 1A1SA 2H16A 5DEIA 2YRFA 4B79A 5HJ7A 4EJ2A 3TX6A 1OH6A 1PDWA 2G5CA 1M2OA 1KI6A 2YWGA 4TTQA 3EC2A 3CUKA 3IV6A 1VXOA 1EK1A 3I6QA 3VDXA 4AX8A 4BNKA 1FSFA 1FXWA 1X1CA 1SOWA 4KXYA 3CR8A 3Q3VA 4ZCPA 3GJ5A 3FZEA 6LDHA 1Z8NA 2IF2A 4W8OA 1PJBA 3WO0A 2CLHB 1B8PA 3I3OA 3T8YA 4C0JA 3C1OA 3DWEX 1V6SA 2OM6A 3KZCA 3PU6A 3PVSA 5KQRA 3T34A 1YR7A 3HTXA 1P61B 1YBAA 2H08A 4HPJB 4NAVA 4YLEA 3LBAA 3WSVA 1RBYA 3RIGA 3LRPA 1DFIA 4C4RA 2Y1OA 2P2LA 4QTZA 1EUDB 4RIEA 1AXGA 2ZAIA 3LQRA 3ED1A 3LBHA 3TL2A 5BT9A 2ABWA 5JNWA 1SVWA 2IVFA 4FBGA 4ZQCB 1XZLA 2VSFA 4AD8A 5KYYA 5F51A 4R3WA 3OOEA 3L07A 3QUCA 4E07A 3FTEA 1TLTA 1U7ZA 5LP6F 1FRZA 5H82A 2A7XA 4URVR 3MT0A 5L3SA 4WSOA 2IHJA 3DD1A 2B61A 2J7PA 4CIBA 4Q1EA 10MHA 4FGKA 4CM9D 3GBPA 2I67A 4E13A 4KACA 4LWQA 2ATXA 1WKVA 3QBDA 4MWCA 3IR6A 4QFBA 5AR1A 4ZVQA 5AW0A 1FJXA 4OUDA 3AHDA 4DDUA 2B3TA 3IV7A 2M9MA 1O8BA 3UOGA 3IE2A 5BWLA 5F76A 1GGNA 1U6KA 4HWSA 3TCKA 1E2PA 3DQQA 4HN2A 3CINA 4X63A 3KOUA 2GFIA 4L8YA 5K01A 4OAPA 1EEXB 4UBIA 1KJQA 3LI2A 5K03A 4GPD1 4G1CA 3UMVA 2IDZA 4R3UC 4W5HA 4MRRA 3WGKA 4A6PA 4CL3A 5KOJA 4C2TA 4DAEA 5AHKA 5DHRA 4LF6B 1R88A 2EIXA 2B82A 3A6GA 4PZ0A 2EWVA 3I2HA 3ETNA 5DRTA 4XRRA 4DEYA 1JYSA 2WSMA 3PXBA 2RGAA 2AS0A 3CKLA 1MJGA 3K0AB 3TTUA 1JLRA 3UAOA 4RGVA 2HX1A 3ONVA 4OKNA 4UHHA 4O5AA 2GF0A 1UPAA 2ZJZA 4JOQA 4RKQA 3ZHSA 4L95C 4YAEA 4F21A 2BR3A 1ANKA 2QP3A 4GI7A 1QVVA 5A5EA 2AN1A 4PYRA 2ZYSA 3A4IA 1AY0A 3DAFA 3BD9A 2JIZD 4C87A 3HWRA 5DO9A 1BRMA 3HV0A 4HS9A 3LBNA 1V6AA 3UXMA 2BV3A 1IEQA 2IOFK 1SD5A 3D3WA 2IXAA 4GFDA 3O8OB 1ZD2P 1JBEA 1PQ4A 3FLBA 1CZLA 1N1EA 3N3BC 4JLUA 1A76A 1KS9A 1OFIA 2R8OA 1I2DA 2C7QA 4DMLA 3FPLA 2WYWA 2OXCA 3P9RA 3LUBA 4N7BA 4NEQA 4R8SA 3QTTA 2SBTA 1K27A 3GJYA 3R7SA 5IT0A 3WLMA 3NAQA 4ZT7A 1LQ2A 3LBIA 4AG5A 3WGLA 3FF1A 1T2FA 1YH3A 2BD0A 4FIZA 1Z6QA 1KZYC 1QE3A 4AW9A 5I7VA 1QRTA 5HZMA 3HXOA 4JI4B 1O5IA 2Z08A 3DSRA 3FNHA 2GMWA 1P5ZB 3WRXA 4ZGGA 2D8MA 2PLAA 3REFA 1DCMA 1RTTA 1NJ6A 2I7XA 5I9IA 1VMIA 4R16A 3PIDA 4R51A 1UINA 1JDNA 1SHZA 1YQUA 2DUWA 1TIKA 5E7IA 4ETIA 4QM7A 1IFXA 3BXOA 3PSHA 2RKBA 3E9DA 3OLVA 1NLMA 4F9GA 4YI5A 3ZD7A 2O2EA 3OJFA 4XIFA 3RUAA 5AM4A 3NUGA 4DR7B 1YJQA 3D6HA 3D6UA 4N7MA 4N3NA 3EH1A 1P74A 1V11B 4G36A 1UJCA 1DX9A 4F9FA 5FOUA 5HQ3A 4E14A 2V7VA 4CU2A 4EQ6B 4PYQA 1ATZA 1Z6GA 4GC9A 4JJAA 5KNBA 5D86A 4LNUB 4EY6A 6ABPA 3ZV6A 2O2ZA 5KX5B 5DRYA 3MAGA 2MTBA 2N47A 2X5OA 1GAEO 1XQXA 3FI9A 3MLAA 5DM0A 3LV8A 2C5HA 3IA2A 5CTAA 3L6RA 3ADPA 5FWAA 1EGVB 4LJ4A 1DO8A 1XC7A 3GJZA 1QVZA 3PDUA 3I6MA 1E8NA 3TECE 3L4KA 1YVUA 2JHAA 2I54A 4XVRA 4Z86A 1XRSB 2CE7A 1MLDA 3Q10A 4QG7A 4EBBA 2EBFX 1W1IA 1R00A 2W6OA 4TLMB 5CEFA 3ND6A 1GWNA 1UBCA 1GHTA 1V4BA 4FUTA 4YONB 4BTVA 5KNDA 2QLTA 1RXCA 1UXHA 3CF2A 2ALJA 1JW9B 4WKOA 3V2IA 3KKLA 3OF2A 5ITVA 2QX7A 1UBRS 1L0BA 3GLHA 4Y2QA 1UJNA 3DTTA 1M2WA 2GNOA 5B4UA 1KI7A 5EZYB 1Y6GA 4HUQA 4G1MB 4ZOAA 4Q12A 4D4JA 1E7SA 2D54A 2F3UA 1U4OA 3BE4A 3KXPA 1IHPA 2NPOA 2Q1UA 1U7HA 1Z3CA 1VIMA 1ZUIA 3LY9A 3OZEA 2OYCA 3G7UA 4KV7A 4OGFA 5FI5A 5AVUA 3PJFA 4MQ6A 1FVXA 1FDIA 3DEIA 2BEWB 2FQQA 5B3LA 3V8MA 3D8BA 1M6WA 4TGLA 4A26A 4YMLA 2VSXA 3EDYA 3HB9A 5H9WA 4D92A 4Q66C 4DLXA 5FBWB 1E5LA 1GTJ1 1UAYA 5HFJA 4QGAA 1MW8X 3FIUA 2BHNA 2FJPA 1ZBQA 1C3VA 2QPLA 3H3FA 3JU3A 2JCYA 3Q5DA 4PCLA 4ZVVA 4IDGA 3U1VA 1SBCA 1A9PA 2RAVA 3VZSA 2RHHA 5TLSA 1SMKA 1QFZA 1NXXA 1N5KA 2CYBA 2P5YA 1WD7A 4RLHA 1LDMA 1K2WA 3TKAA 5TQVA 2XTJA 4GI5A 4BE7B 3ASVA 2IXBA 1MAWA 2QD5A 3GQVA 1KF0A 2OQ2A 3MFYA 1JR3E 1I7PA 3MLBA 4EKEA 1L7QA 3IT3A 5DZSA 1QQBA 4OX9Y 2VK1A 3SBOA 3WXMA 3E3NA 3O91A 3S2IA 4B0OA 3CVXA 4OX9B 4FDUA 2C7BA 1Y3CE 1NBHA 3BN3A 2H3EA 4DJAA 2X7HA 3D1JA 3PCXA 5DIZA 3VQTA 1QM5A 5HGJA 1M0WA 1S9DA 2Z04A 3Q72A 2ID7A 5KC8A 2AG0A 3E3MA 4LF9B 2BRUA 3EYWA 3ETEA 3VYWA 1FX1A 1CKEA 2ORYA 4HS4A 2AOTA 3NASA 1ZCAA 1A2KC 4BNYA 3VJRA 1W96A 1V37A 1II0A 4UEQA 5LC1A 4B35A 1V39A 1XP5A 3U60B 2X0EA 2OA0A 2FZCA 1BKDR 2NQTA 5CT5A 221PA 3CCCA 5BWNA 1VOTA 1V16B 4NBRA 1ZVVA 2OZEA 3LNTA 4QPCA 2HK7A 2JI6A 2JFZA 2TMGA 3FUTA 2ZSBA 5ALJA 4KR2A 4NYIR 5CAEA 3N8KA 1MVOA 3D43A 3RGGA 3LGXA 2XB9A 4CODB 5F5XA 3CRMA 2ZI9A 3M9XA 2VPTA 5TQ0A 4O08A 1CDDA 5TMPA 1IK6A 4M8IA 3LQQA 2VTBB 3F74A 3ENQA 1M10A 1KJWA 1GL3A 4GYJA 2B8TA 3DVAA 3UHAA 3ZWPA 3I9FA 4D80A 4EA6A 1RM4A 4UM8B 3A6EA 4MCJA 1ECGA 1Z07A 3MTAA 3WTCA 1E9RA 1ZC4A 1SK8A 2RMKA 2WSSA 4BRZA 5A5VA 3FOWA 1GP2A 3WQQA 1BROA 5DWDA 4POAA 4BB9A 3CISA 5FUQA 3NIDB 4IZHA 4MIKA 4LF4B 1CF2O 2JD2A 1G0NA 4XTRA 4GLFA 3FKSD 5EUMA 3AJRA 4RM2A 4KKVA 5FFFA 3OTHA 4IDBA 4EYGA 4YJHA 2C97A 2PUBA 3L8MA 1KDRA 1KH3A 3C7KA 5AXAA 1KRHA 1ETHA 3QVGA 1M2VA 2PWZA 3IHLA 3PWSA 3ZE9A 3OWOA 4ZYZA 1KOGA 1C9JA 2XWPA 3P9YA 3H9BA 4TMZA 5REQB 1P1HA 2JFNA 4MNTA 4MQ5A 3GP5A 5KQMA 4IMRA 4RETA 5ULLA 1G41A 4M7WA 1U9JA 3B3FA 3O38A 1J9GA 1TJPB 4QEDA 1A9ZA 1W9MA 5FT9A 3BB1A 1O97D 2E4ZA 2B5OA 4RH1A 4YROA 2L69A 1J42A 3FUCA 2GHTA 4R1SA 2C42A 2O6LA 3GUCA 1KZ4A 2HGZA 1ND6A 3R5SA 1LDYA 5ALOA 4YP6A 3WFZA 2A33A 3BRSA 1WCIA 1KQOA 3TOCA 4RDCA 1JLSA 1DDOA 1XD9A 3QBTA 1M9NA 3B52X 5JCJA 3Q2KA 4BNZA 5JPDA 3VPDA 2ZVPX 3O3OB 2X1MA 1Y8CA 3M5DA 5A9SB 1USUA 1R0RE 2J5QA 4DOMA 5CA0F 3KKNA 3WJ7A 2XTNA 1LV7A 4MS4B 2Z1NA 4LQLA 5E6SB 4FXOA 2ZBDA 1WY7A 4EECA 1FS6A 1TT5B 3E23A 1V45E 2OT3B 3GIWA 2AI3A 4UZFA 1G7CA 4E51A 3LUFA 2YVUA 3A05A 4HDRA 3HO8A 3L0IB 3T9AA 4TMXA 4DSNA 1QBGA 4N7RA 5EKUA 2QRLA 3H9JA 4D3DA 3ZK9A 2RAFA 4OGWA 1SU6A 3KU4A 3FVWA 4C20A 2UDPA 1C41A 3WYFA 2GA9A 3F9IA 2VDPB 2H52A 4ZIRB 2J1LA 1ECLA 5JHGB 4HB2A 2QRVA 2WVHA 4QATA 5FBVB 1HQDA 1XAGA 3P1JA 3ZUPA 3IMGA 4KLNA 2E55A 1MRSA 1YC2A 5D5HA 3OZIA 5KAPA 4ZVOA 4LRXA 3ISTA 3SQLA 3UHOA 2W2OA 2HAEA 1KAGA 2VRCA 3IIJA 4K7JA 4BRWA 4RQBA 2I7CA 3R3JA 4H9GA 4RCYA 2DQSA 3H1GA 3SAJA 1BKSB 1ZOIA 2PWYA 3JV7A 4J9VA 4XIJA 3MWEA 4AX4A 1N75A 2GTHA 3T5PA 1JBQA 4KIFA 3ZU6A 3WL7A 5KNCD 1JFSA 3U49A 1WZ2A 3MIIA 3T7IA 1XEWX 1DOHA 4P7BA 1CT9A 1EX6A 4ZEWA 1Z6AA 1UXGA 1XTBA 2D2VA 4BP3A 1R50A 2G5GX 2R6GA 4BMXA 2ZSIA 1S8NA 3DTYA 3KHUA 3CF4A 7YASA 4DCVA 5U4XA 5IVKA 3NBYC 1KI4A 2ADMA 1UWKA 3AQIA 1IHDA 1MFZA 4Q9DA 1LLQA 5FTJA 1ODJA 3M6LA 5TNXA 1FFCA 5JATA 4AZTA 4Q4HB 4EDFA 2GZDA 3G9UA 5KOHB 4JEHA 5JS6A 2PS3A 2YVAA 3DEKA 4A0HA 1UIMA 5JECA 1MO2A 5JEEA 5IFLA 4QODA 4J1QA 2FZVA 1CVRA 1IWOA 1ECPA 2F6RA 2GPTA 2WUDA 3Q5GA 4C6TB 1MOQA 1WABA 4AMVA 2LWIA 4TPKA 3A4VA 4ZYUA 3FLEA 1XPUA 2BJWA 3U3RA 4U3JA 2W0SA 4NL4H 2PFKA 5LKAA 3V4PB 1WXXA 2FXIA 3BPSA 1GPH1 1FXSA 1GXSA 3RASA 2JHPA 1DC4A 5DGDA 4RC9A 4PLCA 2ODPA 3MQFA 4M7PA 4CEIA 1FFHA 1Y7LA 1UP7A 3BM5A 3QFCA 5BN5B 4FZRA 1XYVA 1U9IA 4KDCA 3E0QA 1DKMA 3KB8A 1CUUA 3PRKE 2P3OA 4LUCA 2WSLA 1WCWA 2I1LA 1VBKA 3UBTA 4GZ3A 1NTOA 3D7KA 4HFNA 5EEGA 4B82A 2ZM5A 1TGYA 1MAAA 3HG7A 2YYZA 1ZQ9A 4LFBB 4B6FA 4K9PA 4AJPA 1D1PA 2FW1A 1U1GA 4FYYA 4L0QA 4P1ZA 2EW1A 1MJ5A 4US0R 1KDZA 1OXVA 2OCBA 2WMOB 3AJ9A 3GCGA 3OFSA 3VC2A 1L7RA 1DINA 1L5YA 1O5TA 2AK2A 3IAAA 3NKFA 3AU9A 1XTVA 3L1IA 2OV6A 2ZI7A 4ALIA 2DLNA 1KK3A 2A9OA 3ZTTA 3EFEA 3ZU5A 2QB5A 4U5XA 1F17A 3RF6A 3UCXA 2HU7A 3ZHRA 3TB6A 4JBWA 1RPNA 4RU1A 5FDFA 1F3LA 4CKCA 4R2MA 5FEUA 5JXIA 1XNRB 1LTHR 4WOCA 4XQ0A 3DYBA 4PLYA 2PZLA 3KKQA 1ADYA 2BGGA 2ZCVA 5CLJA 3GLIB 1MT3A 1P2FA 3I64A 4JLPA 4MEAA 1SCQA 1OXXK 1PL7A 2BWJA 2UVQA 4MINA 1NX6A 4UBNA 4XZ3A 5BV1A 1L5VA 2JJYA 4FC7A 3G0DA 4MKRA 4F3RA 1RWBA 2IL1A 4F1JA 5KTNA 2I03A 3ED5A 4C3OB 4C2BA 1JG2A 4RDXA 2KJQA 1MGPA 5SY6A 5B1YA 5A7HA 4BECA 1C50A 1KI1A 4BQIA 3ESQA 1ICIA 4FI3C 4JASB 3LLCA 4MVJA 2WJAA 1X7YA 1DLJA 1QUFA 2PO7A 1NVTA 4MH0R 1R1DA 4OQLA 2C96A 3OE7A 5A0VA 2G1JA 1LU9A 2O7VA 1I30A 1DOZA 3D54D 3NVAA 4CMAA 1NG9A 1XVAA 3RKSA 3NNNA 3IBGA 5DHFA 3ZJ4A 3KHTA 4WLUA 2W5UA 5AI9A 4DIFA 5CD9A 4H7EA 1WOMA 1RWMA 1AMNA 3IBYA 4I5FA 2J41A 3GP3A 3MRSA 3HCCA 4JP3A 1KR5A 2BKLA 2BCEA 3QVOA 4HSEA 2X0IA 3UMCA 2BFCB 1T4MA 2PWAA 2X2PA 4MV1A 4MRAA 3H2YA 1C0LA 4QYWA 3UAWA 4EHIA 5C8DA 1A5TA 2ZYAA 3KJNA 1BD3A 2WT8A 3RU2A 2FEMA 2WF6A 4G9GA 2PRKA 5DTEA 3UGQA 5L7YA 3AF4A 4IGAA 2HGSA 3FETA 1HL7A 3TGWA 3K6SA 2OORA 3L8YA 2IYXA 1GPBA 4JQOA 4OSPA 1W30A 1NQTA 1NI3A 1VPTA 1XTTA 3PD1A 5FO1A 3T61A 2H4WA 3TFQA 4BIMA 3IAS6 1GRNA 2IZOA 2ZTVA 2REQB 2YNMC 5LP6A 2XVZA 4FMBB 4U2EA 4Z3OA 2IH5A 1JB1A 1BVHA 1XQ1A 2Y99A 4IEIA 5IAAA 3O8BA 4MI1A 4M0MA 2CV0A 1GZ7A 3NCHA 2VP5A 1N4DA 1OC2A 1OA1A 4JLVA 2ECPA 5EXEA 1CDEA 5F21A 1F5SA 3RW9A 5BR8B 3OP4A 1MQ8B 2QNIA 2ZB3A 1L4HA 1S0UA 3WGYA 1B14A 1QGED 3GJSA 3ZXSA 4EJ6A 3GLFB 3MCTA 4DIUA 2D5CA 3V7FA 1OFHA 2N75A 1R0WA 2FMXA 2PA0A 3OTIA 3RYCB 1LXCA 3CYFA 1ES9A 5CJJA 1E96A 3P27A 4WHMA 3B60A 1O0BA 1GEEA 1RRMA 1AHIA 3QU4A 2N46A 4GGOA 1FJHA 4MUEA 4GD3Q 4X1KA 4L16A 3GFTA 2JCBA 1P7YA 2CWWA 3EGCA 4LY0A 1LGYA 2IXDA 4MLZA 2PFGA 4FOTA 4ND2A 3R1IA 5CUQA 4EB6B 1J99A 2GETA 4RJJA 2VH2A 2B8EA 2YR0A 2Z5LA 1M8FA 4GBED 3CVUA 1GADO 3T5TA 4TKUA 5LQRA 2AIRA 3ZS8A 4IGIA 2YHIA 2VC2B 5D84A 3PENA 3BKWA 1M67A 3H1BA 4QU5A 4WECA 2NUTB 4HNVA 4MDEA 4RVNA 1N1DA 1ESNA 1IIRA 1UXJA 2IYQA 1D2RA 3DDOA 3F47A 3GMIA 4PTZA 5DBEX 5K3FA 5B4VA 3NV7A 3RO7A 2DT8A 1HL3A 1EM6A 1Y80A 2C8LA 2WDPA 4JXKA 5JSHA 4DDHA 4CDNA 1ZNYA 3N53A 4NU0A 1OAOA 1K7FB 2I66A 3HABA 1T24A 3VKWA 3AMVA 5EMLA 1WHSB 1UK8A 4GDMA 3CIOA 2ZIUB 1GN9A 1OR8A 2HMTA 1LSOA 1M73E 3QE0A 4UUNA 5BURA 2VZ0A 3ELWA 3MJVA 4V1CI 5HKAA 5HFAA 2VSNA 2VQEB 2VP3A 3C5EA 2J4DA 5DYIA 2AQ8A 2JGAA 4FOPA 3RPEA 3AZPA 1N5LA 3FHLA 5JMOA 2O2YA 2P6PA 4ACBA 3CLKA 1LQTA 4G4GA 4J2TA 4U8HA 3RS9A 4UNRA 5JJBA 2FPLA 3Q9NA 3W77A 3FWYA 3N1UA 1OZGA 2RBGA 1F3OA 1MO5A 3JARB 2C4TA 4M53A 5HS6A 3DKKA 3NYQA 5B3KA 2O8CB 3R74A 1IXKA 1NLYA 3DDZX 5L4LA 1PT7A 2JAPA 3ZNPA 2YFYA 3AEQB 4FGLA 3TEJA 3COYA 5AW5A 3UZUA 6AT1A 3THYA 4WKBA 5K0LA 3FXAA 3MPUA 5HM6A 1ND5A 3L8FA 3RANA 3AFMA 5IT9A 2IYRA 2BM8A 1T2NA 3HYRA 4JEIA 3BCSA 2ZS8A 4OH1A 2ZWMA 4BBAA 1JKJA 1XVUA 3F7OA 1D7OA 3MXOA 4HB0A 4U5QA 5T5QA 3K9FC 3PX3A 1ORHA 2O3RA 2VHCA 3PQFA 4KLCA 5LQSA 2HQRA 1C2YA 2BSXA 1DEXA 1Z7BA 2L2QA 2ZQYA 3JYQA 4JLMA 1M54A 3GUHA 3D02A 1SBQA 3GDFA 4FMPA 4F7DA 3L7OA 3FAZA 3BMQA 3AEZA 3LHSA 3Q1LA 4K2HA 1O94A 2Y27A 4QGHA 4F5ZA 4FHCA 3W7VA 1FTSA 3TLCA 5JAZA 1ONOA 3OPYA 2Z30A 4FX5A 4CEJB 4TS1A 4ZMBA 5HIIA 1M74A 1S3FA 3K6KA 4II2A 3WNCA 3T9DA 1KTIA 2C3PA 3PNVA 2QIPA 4YJ2A 1YUNA 3L1KA 4B3GA 1C7ZA 3ZXXA 4RQTA 1IRIA 4RZIA 1OTHA 3PFWO 3QEMB 3QI7A 2WNIA 1S2GA 1VHTA 1PYOA 1EFTA 3JVUA 4R54A 4ESOA 1IHYA 1YB5A 3ABQB 4EY8A 1UPBA 2D00A 3MQ2A 1TQDA 2EERA 4E5VA 5TS2A 4J4HA 3PQ6A 3OHMA 1SVLA 1GFIA 2X4GA 3G5LA 2FV8A 5EZ5A 1IPFA 4BP1A 2GEBA 2D1SA 1PWXA 2EFDB 1JDZA 1PVDA 2IYWA 3HDYA 1T2UA 1WB6A 2H85A 3IPRA 3K92A 3P52A 4ITVA 3SJZA 1DFHA 4C7OA 3VNSA 3WYDA 2BEVA 3QKWA 4CM3A 1JIUA 4Q6WA 1X9IA 3N74A 1E5QA 1WCXA 2Q9BA 5PNTA 2W2VA 3U7IA 1I0ZA 4A0QA 3L92A 4OHYA 1M2GA 2AFRA 1X74A 5GMOA 1N2SA 1SAYA 4BLUA 1W5SA 1YR6A 1TRKA 3F5DA 3IE0A 4DFDA 4XRGA 2HO4A 3ZYZA 3E27A 2ZYDA 3PIRA 1JFFB 5KMGB 1OYYA 2FW8A 4P4TA 3FCYA 4ERNA 5EJ6A 3RVBA 4JWTA 2J3EA 3H8SA 2P1ZA 5F33A 2QOEA 3TL3A 4FFBA 2Q9AA 4XUDA 3KJXA 1Z6YA 2W8BB 5ED0A 3DR5A 4M9CA 4XWAA 5ISMA 3LUAA 1EWTA 4Z0PA 3FHTA 1AQNA 2YN2A 2YW2A 3L02A 3LT0A 5IT4A 1DCTA 4Z1MD 1X9GA 5FBKA 5T3YA 3ENKA 5EJ9A 1OLOA 3A2MA 3LLSA 3GF4A 1JG3A 4YFYA 5CYPA 5AHRA 5AK0A 5AVJA 2I62A 5DJ5A 3RSHA 3UHPA 3X1XA 1BWRA 1GGFA 3TTXA 4YS6A 1T26A 2FX5A 3IVXA 4RK7A 5M5BA 3W3ZB 2RHBA 5L3VA 1X7WB 4QICA 3C0KA 4BMYA 1XRLA 3B6JA 2XCOA 3I6YA 3M8KA 4JWKA 4GSKA 3HE3A 3H9UA 2HSWA 4GLJA 4YV2A 4GPEA 1S2DA 2PT9A 4KJXA 5G0WA 4Z7QB 3RUHA 2QE7A 4CR6A 2HEIA 2Z1DA 4ZVKA 2ZI4A 1M8GA 1U0FA 3FCCA 1UKYA 1WXWA 2C2XA 2J48A 4KGDA 1RE1A 2I6XA 3AF5A 3NBXX 4MTCA 1JXQA 4O4IA 4XGQA 2IPLA 4GC5A 5J5AA 1UQTA 3O4IA 1AK9A 4FYKA 1HWYA 4D4KA 5ITSA 1ZAYA 3R7DA 1JZSA 2AN3A 3R41A 2BF7A 2CW5A 1FQOA 5CB6A 2P77A 3VNQA 5BXYA 3K0FA 4A91A 2NU6A 4MUIA 1P19A 3NETA 3V32A 4DJEC 1Q0UA 1Y3HA 5C1PA 1ODLA 4A0FA 1FRFS 3C3XA 1ZRHA 3K5WA 3TRIA 1HV8A 1T2CA 3MTGA 4WKPA 1NE2A 2VNHA 1KO5A 1Q57A 4EG5A 2WJWA 4FYJA 3ZI0A 1CCWA 5C5DA 5LYJB 4Z49A 4DB2A 5AM2A 3LYHA 3ZGNA 1LNQA 3KYBA 4LVNA 1EZ1A 4DY4A 4R31A 1YQ9A 2PS1A 4EK9A 2FX3A 2AMLA 5K0NA 1CR4A 4NCHA 1R9NA 3PR3A 1YTLA 3EXIB 3IVCA 1RKXA 2C98A 2AXNA 2BFNA 4FHEA 4LPKA 2GD6A 4HXYA 4YECA 3RRMA 4BNWA 4KB5A 3KJQA 2FN4A 5JYBA 4S2UA 1FRNA 3CUWA 5FA6A 2XQGA 4E1VA 3GJRA 2BSQA 3DBOB 2G4VA 3QA9A 3CW8X 5TS3A 1KE1A 2I2AA 4B85A 2FUKA 1V7ZA 4PZAA 2QN7A 2AW3A 1A0OA 1CXZA 2JGKA 2QRUA 2YDXA 4IRXA 1JHVA 1V2HE 1Z8FA 2ZI5A 3G79A 3QFFA 3LL7A 1U1EA 4WGGA 1DARA 2PQMA 3H1EA 1Z5UA 2CHEA 1TZJA 1C1XA 3CB2A 3A6DA 3FHCB 1R8XA 2BZ0A 4D4LA 2XSZA 2Y1CA 2JI4A 4L02A 1S01A 1NLZA 2C0QA 1NT4A 3AR5A 3FKQA 3R23A 4KMRA 3AL0C 3GEBA 3IQDB 4ZT2A 1DJOA 3IOBA 2PUGA 1BS9A 1DJPA 4TWJA 1FEZA 3FPBA 3I8SA 5A3JA 1T8WA 5KVVA 1KOJA 2JBWA 1WPXA 2PKRA 1ECCA 4EH1A 2P9QA 2ZTMA 1TC2A 2I1WA 1BTOA 4YQYA 4EF6A 1P18A 5BYAA 1VL8A 1GU7A 1E2DA 8LDHA 3C97A 3TW8B 1USGA 5I9MA 5BQPA 3L1HA 3BWBA 5D51S 2C2OA 3PICA 3IULA 1U0JA 1GQQA 1A8SA 2VWGA 2XUZA 3N2GA 4C14A 1R5OA 3QRWA 1WBBA 3SIPA 1EXMA 2ATVA 2YHAA 3LCRA 4HP8A 3JZIA 3VPHA 2Y0PA 5HOQA 1V95A 3G02A 2PMWB 4HGZA 1EE9A 3R9KA 4KOAA 1QGAA 2QSUA 3A0UA 2WG1A 4MKIA 5A4AA 5KREA 2X5NA 1FP6A 4K5QA 5LMCA 2G25A 2W71A 1CX9B 3FYSA 4M9ZA 3EW7A 4IDOA 1BHJA 1QE5A 2QUBA 3P26A 2I1VB 3C43A 2NSYA 4PF1A 3DT9A 2UUOA 1FQWA 1Z6TA 3D5QA 3ABIA 3Q3JB 2PS9A 3QXXA 3ITNA 4G65A 1MZPA 3C87A 2G83A 2ZYGA 1NY6A 5CXQA 1R6TA 2I4MA 4DZTA 2G40A 5AMXA 1BXRA 2WJ4A 1RCUA 4DTCA 3TLBA 5IJ9A 3L0CA 5IJAA 5HYVA 4Y6PA 4V3BA 2X58A 4C0LA 1GCIA 3QLEA 3KWJA 2YOGA 2R1VB 2ZRAA 1YRWA 5KCMA 3TO5A 5K5EA 3RAEC 1FW8A 4C0WA 3LLMA 2YWDA 1RKQA 2GJ9A 2WJZB 3MMPA 2UVPB 4EGSA 2CFRA 1QGUB 1AUVA 2R84A 3HMKA 5FULA 1U8EA 1VLZA 5LQCA 1J8DA 3E2PA 2P78A 3TLJA 2V59A 4OQQA 1TB4A 4PZEA 3JZAA 5ELMA 3KD2A 2V3WA 5EPEA 1FY2A 1U63A 2BFFA 1FVOA 3E5HA 3F6YA 3MEQA 1D6SA 3CEHA 4JA0A 5FPTA 3RSLA 2ZUFA 4TWRA 3LPLA 5CHYA 1E7WA 4EM6A 1OX5A 4HMQA 2EJTA 2PXCA 1DNPA 4U7WA 4C5AA 2HK8A 5A0FA 4DE5A 3DO5A 4AZWA 3OD1A 3I2FA 3PNSA 3I04M 2Q7OE 4ZOQI 4Z99A 2XCSB 5HTKA 2CXSA 4QLAA 4GKJB 3PFNA 3NBMA 3FF4A 3ZVKA 4P7KA 3O4GA 5HHTA 1M5UA 1VL1A 1A9SA 1JEJA 5BRJA 3TJZA 5LB4A 4UBKA 1U7DA 3GJTA 5F3DA 2FSVC 1ZSNA 4BFLA 2OK8A 4RJKA 5DT9A 4FTWA 1OU0A 2RC6A 3C8DA 1JSCA 4J0IA 2AD5A 4MW6A 1AZSC 1JEQA 1CJBA 2C3YA 4C30A 3DLHA 3PDCA 4JBGA 3KM0A 1RHKA 5CDHA 3EVDA 2WJ6A 2PGIA 3SP1A 1TT7A 5CRIA 1TMGE 4CJXA 3IHKA 5EQFA 3ACDA 2BGUA 1Q50A 3OMXA 1P8JA 4QSMA 1SC3A 1C14A 4EF5A 3LWDA 3TW4A 1F4LA 3A70A 4E3WA 1NVUQ 4TT8A 3CNEA 3H11B 4R9RA 1ABBA 1GITA 3KKPA 4FD3A 4C7KA 3HJCA 1IATA 3RSOA 4UQLA 2ZUSA 5I9LA 1FNBA 5D6OA 3IBTA 3IVMA 1T4CA 1XHLA 1C8KA 2F3QA 3MELA 3I01M 4F4UA 3GXOA 1X2EA 4RPGA 2IBTA 1FP7A 2Q9CA 4AZVA 3ECAA 2ZYIA 1FNSA 4GSYA 3KVRA 4NENA 2GHRA 1G8HA 1G3QA 3O9MA 2R7AA 3D0QA 2VLBA 3DAPA 2QR5A 1MO4A 3BIJA 3QKSB 2WWGA 5ALPA 1AA6A 4FSDA 5JG7A 3T4EA 5COQA 1W34A 5TPZD 4KEAA 1D6NA 3O26A 1OFTA 4E5MA 4GW3A 2Y0EA 3M9LA 2G5PA 5B7NA 3PNQA 1D4ZA 3ER9A 1I33A 5CBPB 4DWOA 5CFLA 4X5OA 1E32A 4CQJA 4DRXB 1AQIA 1G1MA 3SZOA 4ZZ1A 3T5DA 4BPBA 1OXUA 4GOJA 3AVYA 5HMLA 4F4IA 5C35A 3G2HA 3HBNA 4PCAA 3UJPA 3LX4A 2OXEA 4V0RA 1P0QA 4C07A 2QLJA 1WU7A 1LZLA 3T7KA 1JIIA 4UVHA 1TI7A 3SEZA 5B57C 1UCFA 2PGAA 4G81A 1H93A 1ZRMA 2PH7A 4PYKA 1E60A 1L1EA 2Q3HA 4RK0A 1UMBA 3H5OA 4XFJA 4E88A 5BN4B 3RYIB 4GPZA 5IZCA 1JJVA 1LS1A 4GAEA 1M1ZA 4X1YA 2QX9A 1M2KA 2ZBFA 4XR9A 3TR6A 4YY3B 1Y7HA 5J2TB 2XDAA 1NR7A 4RZ2A 2QZSA 3U4IA 4KTVE 4MWZA 4ZREA 4BFSA 1KMMA 1QZ3A 4BDTA 5HDQA 4YMSA 5F3RA 3KX2A 1A2BA 1PTKA 1T3ZA 2IZ1A 4LPSA 5IKOA 3AT1A 3SEAA 1SHJA 3BRQA 5JNTA 2XXAB 1LFDB 3K71B 4KI7A 1AD2A 3L7NA 4A27A 2JG3A 2CVOA 5GY7A 2XB8A 3UAGA 2QZ4A 3S2EA 1O3YA 4A36A 4FMDF 3RQSA 5AI5A 5ESRA 3OVMA 2IHZA 2PT6A 4RKWA 4LGYA 1PFYA 4RVFA 1DT5A 1Z7WA 4OHMA 2M1ZA 3EEBA 1KO8A 4OFWA 5EG5A 1CUEA 1Z6XA 4RFSA 1BFUA 3N8IA 1YV9A 3EK2A 2ZDHA 2NZYA 3VPXA 3KQLA 4EHBA 4P22A 2XMPA 5ALUA 1N2CB 4EKGA 2OSBA 4FEAA 1NNLA 2QM3A 3DHEA 1V8BA 2AE2A 2B1RA 1IBMB 5TPWB 4LXUA 2CFCA 2AG6A 1E3TA 4EMUA 1LPSA 1KYWA 1X80B 1VYUA 2OXIA 4ZO9A 2FMIA 2HXYA 5B6IA 3AVWA 4Y6GB 2P3SA 2J3KA 5IDYA 3EZYA 1RM0A 1UAGA 2QTCA 3KR9A 4PRYA 4TROA 1ZM3A 4F93B 3JYLA 5JFOA 5DN6A 3HA3A 3Q8KA 3DMYA 1XD8A 3QPAA 1WTCA 4ES6A 5ES3A 4F96A 3GRVA 4ARUA 2ZIVB 1P33A 3GFBA 5H83A 3W5JA 1W87A 2RIPA 2EATA 1BSVA 2OUIA 4IF4A 4FP9A 3AIIA 3L7CA 4BQPA 2Q9UA 3UV6A 3H2IA 5AVYA 3OCVA 1D8AA 4HVAA 3FOZA 2JGNA 3GWGA 5EWMA 2RGBA 3FPFA 4QJ4A 3AHCA 3PQ3A 4L8WB 4A0RA 2JIMA 4UCWA 1DBRA 3JQ7B 3ENNA 3E8XA 4M89A 1AN0A 1NFFA 4MICA 1V25A 3K9WA 1K4YA 1M8PA 3HB5X 1BXGA 3CT6A 2P35A 3UUEA 4C0BA 3OAAD 2OYSA 3L0DA 4XJXA 3V9PA 4WJZA 4ASUD 2HQBA 2EHDA 1RZ3A 4NCAA 4R98A 4XCQA 5KQSA 1A72A 1T8TA 4AKTA 2WJHA 4P54A 3QX7A 2DX7A 3LUGA 4MKXA 2Y6VA 4F56A 1ID8A 3OEHA 2NV0A 2FOIA 1M2OB 1BD4A 1KI6B 2JA2A 3A11A 3PCRB 5TX7A 3RFFA 4BNXA 1Z5GA 1FU4A 2PLNA 1VA5A 3BF8A 5EUQB 5AJVB 5BV7A 1ZFNA 1H6CA 2XR1A 1NVWQ 3VZCA 3WMXA 3OX3A 3E18A 4LJ9A 5T6BA 1P1KA 4JOSA 1TA0A 3RFTA 1GKLA 2CLKB 1E1YA 3TMYA 5CCEA 4KXLA 3WNDA 1Q1GA 4Q1BA 1P5HA 3WBKA 2JHFA 2QZJA 2SHKA 2TRSB 2J5XA 2VUUA 4MR8A 4WFQA 2OC4A 5EFOA 5DV9A 4ITUA 3PLRA 1XF9A 3VSCA 2XI4A 2LV8A 4I50F 5BOSA 2N9UA 2Z6VA 1HOXA 3CNLA 3U62A 1WU8A 4ZO4A 4IGKA 3F46A 4FNAA 5KYYB 2Z0MA 1WZNA 4LQCA 2PZMA 5M2QA 3P9SA 5CJ2A 4V2UA 2JS7A 3WV4A 3EQ2A 5L3SB 2HTFA 4IRUB 4PLPA 1E2EA 2EL7A 5K3DA 3WHKA