2AA3A

Crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
b'TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Plasmodium vivax
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
total genus 115
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aa3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2aa3A02
4MVJE 4BO4A 2FPPA 3OEWA 1LDMA 4YJHB 4A7PA 2X1HA 2HRBA 1G6KA 1YDWA 4HNGA 3TSCA 3ZNOA 4EITA 5DP2A 3WQRA 2DQ4A 2Y1FA 5H83A 1HDRA 4N5NA 5HBRA 3HFSA 5KNLA 4OGWA 2HCTA 5F5NA 3CTMA 2BFOA 4GMFA 5IZ4A 5F1OA 3LSYA 2OMEA 4FOSA 3TOXA 3PQDA 4E5YA 3LU1A 5L3ZA 4XA8A 3ZWPA 2PD3A 1Y81A 1Y8RB 1TT5B 3EW7A 4YAJA 1UH5A 1EUDA 3DWFA 3RUEA 1PS0A 3QSGA 3PWZA 3DTTA 3BHMA 5A1TA 3OEYA 5ADHA 3M1LA 3P2YA 3GFGA 1E3JA 4ND5A 2BH9A 2B5WA 4B7XA 4BS9A 4KTVE 4CM8A 1MUUA 4CUKA 3JQFA 1WAMA 4O63O 3FI9A 1K89A 4B4OA 1ISIA 2BRUA 2Q3EA 3OIFA 3CSDA 4NG5A 3DZJA 4WECA 4JXKA 3D1LA 3VPFA 4J4HA 5IZCA 1BSVA 5CDGA 2GPTA 1X7HA 3ENNA 4YA6A 5MGBA 5EPOA 3H5AA 3QHAA 2PGDA 1E0DA 3GDGA 1GUFA 4W4TA 2ZKLA 1PWXA 2RHRA 3RSHA 4YT2A 1LRKA 1DLIA 3EHEA 3AUAA 2VRCA 1HEUA 3K31A 3IJPA 3FPLA 2Q1UA 3D7LA 4B8WA 4E3ZA 4D3FA 1Y7TA 1MXHA 3DZGA 5KCZA 1C0PA 2D0IA 1A7KA 3OJFA 1Q7CA 3NRCA 1XEAA 2C59A 3PK0A 1KBZA 3WOHA 3HZZA 2AQ8A 5K6AA 4CQLA 2Z5LA 1U3VA 3WFJA 2IDZA 1PJ3A 1DHTA 4CUJA 1ZBQA 4RZIA 2QW8A 3PYMA 2QYTA 3LC1O 5T8KC 4E30A 2HMUA 4Z0HO 1Y9EA 3DBHB 4NBWA 4ESOA 4DIFA 4K6FA 2PTGA 1LSUA 4A27A 3EMKA 4AJKA 3I52A 3GG9A 4YACA 3TZKA 2Z95A 1NFQA 3AM4A 5A5EA 1ZJZA 3H2SA 4RGBA 4R1TA 4RORA 4KQWA 4CV2A 1JKFA 1HLPA 1GFSA 3RUHA 1FDSA 3I4FA 1QMGA 2PNFA 4EGFA 1E7WA 1R4NA 3U9LA 3BMOA 3FPCA 2PD6A 3LT1A 1LC0A 1ZSNA 3MOGA 4MOWA 4BGIA 2EWMA 3PVZA 4QECA 3N74A 2CD9A 3RUAA 2PV7A 4AJ1A 2NQ8A 4Q3DA 1DXYA 1ORRA 3KXDA 2ZTUA 4KTTE 4O59O 1PL8A 2X0JA 4FC6A 3EGOA 4CM9D 3I23A 4LMRA 1T4DA 3H3FA 2LDBA 4UULA 3KEOA 3M2TA 2D59A 3G79A 1QG6A 1WMAA 3QJ5A 4RV9A 3GDOA 1GUYA 3HDQA 1C0KA 1E6UA 2NU7A 2PLAA 3DZHA 1F8FA 3NTOA 1U5AA 3QVSA 5L4NA 3C7DB 1PJBA 4BKPA 1EUZA 3P2OA 3LC2O 1PJTA 3D3EA 4BO5A 3IAHA 3ETDA 4YAGA 2VZ0A 3P7MA 5AYVA 2NTNA 5JYEA 1EBFA 1KVTA 2NVUA 3OQ6A 3AOGA 3E5MA 2G1UA 3KYCB 3STHA 3GGGA 1C0IA 1CRWG 3H9UA 1Z6ZA 4IBOA 4WE3A 3SX2A 4AJ2A 1U5CA 1DRWA 1GQYA 2FR8A 5A5FA 1VSVA 5T6BA 1HE4A 3H5RA 1MP0A 1PGQA 2DM6A 2F00A 1GTMA 1F12A 3I3OA 3WIDA 4QSMA 3GVXA 4OSOA 4PLCA 4R41A 4J49A 3AUSA 3ANMA 4Q39A 3WQQA 2VZ8A 1YS4A 3LDHA 3JTMA 3ADOA 5AXCA 1YL7A 3OETA 5HWSA 1J4AA 1JTVA 4HXYA 3FR7A 1DIGA 2VHYA 3EYWA 4CR6A 4IJVA 3CZMA 4TMFA 2NLOA 3RKRA 2YUTA 2Q99A 4YRDA 2HMWA 3LT0A 2WE8A 2CVZA 2NTVA 3F5QA 3M2PA 3KYBA 2HJRA 2NU6A 4FGWA 4TZKA 5JMPA 1DC5A 3VZQA 3GAFA 4GKBA 1NBOA 3K96A 2ZYGA 3GUYA 3ZHBA 1F17A 3LT4A 3W8DA 2EHDA 4PIVA 3QY9A 2ZATA 4BO7A 4AL4A 3HWRA 4HX5A 3INGA 4W7IA 1EQ2A 3KSUA 3KSZO 4DPKA 3JQFC 4G5HA 1GQ2A 1V0JA 4MP8A 5A9SB 3S2IA 3K2EA 3EUWA 4ZGWA 4OQYA 1JN0A 1Y8QB 2ZK7A 3I83A 3ONEA 1U2GA 1KVUA 1E7MA 4FFMA 4J4BA 2C82A 2GYYA 3WB9A 4B4VA 2TMGA 4BMNA 1FMCA 5B4VA 5CFZA 4IDDA 2IZZA 1FDTA 4PLZA 1MXFA 4ZICA 2HQ1A 4MP3A 3FHLA 2BKAA 2Y1DA 1MGOA 5JDCC 2WD7B 3AM3A 4BNVA 5C7LO 3TPCA 3WMWA 4XEHA 3ZNPA 1ZH8A 2VYNA 5F1PA 3M1AA 3HADA 4BKOA 3PFWO 2JCXA 4XIYA 2Q45A 4J16A 1TB4A 2EF1A 3GVPA 3LC7O 2C20A 5JDIA 3BZUA 5F5LA 2GZ1A 4Z9FA 2AMFA 1BW9B 1F14A 3WBFA 4CUZA 4FCCA 4R3NA 4XRGA 1OAAA 3P19A 2YV3A 1LBEA 3TNLA 1PZHA 4NFYA 4HNHA 4E2YA 2ZYDA 3WJ7A 1IULA 4XKJA 5DT9A 5COAA 1QLJA 3CMMA 1TEHA 2EKQA 4H7PA 4Q3NA 1HSOA 4BMSA 3DZIA 4PLTA 4E0BA 4EW6A 1Y1PA 3E9MA 1PQWA 3ZU5A 5A9TA 2AG5A 4LCJA 4KDFA 1KY5A 2YHIA 3E5RA 3VOSA 2CFCA 3JD1A 4XGKA 1I3LA 4QXMA 4ZRMA 1Q2XA 3LVFO 5JSFA 3V2GA 3WGZA 2DU8A 3LQFA 4INAA 4ZRNA 1UP7A 2E82A 5AOVA 4Y6PA 1YL5A 4BNIA 3PEFA 4GLOA 3GZNB 3I4CA 2OGUA 3DAPA 1RYDA 3DOCA 1QYDA 3HDYA 5HA5A 5ICMA 2RIRA 1J6UA 3JQAA 3AM5A 4ZHSA 3TDKA 3JD3A 2Q1WA 3ENKA 4PVCA 2SCUA 4XJSA 5COQA 1E6EA 1LLDA 4CM9A 4D7AA 5L9AA 5ER6A 1CERA 1R0SA 2BGLA 4EEZA 2OHXA 2X6TA 4WLEA 4BMVA 3K92A 2P5YA 3Q2KA 5FYDA 3OA0A 1Y9AA 5TNXA 1KERA 5ENVA 3WFIA 1KY4A 4D44A 3MJTA 1A27A 3GMSA 4GVLA 3GPDG 3K8ZA 2AEMA 2X0IA 4CQMB 1E6WA 4QFDA 3WDSA 4BIIA 1KEUA 3KETA 3KLMX 4H3VA 4WCFA 3D64A 3B1JA 4JROA 5TT1A 3DB2A 1W73A 3H8VA 3IMFA 2P4QA 3RC7A 2VOJA 4BNHA 3FNEA 4N54A 3PXXA 2JL1A 5CDTA 3C1AA 4RVGA 5CHEA 3ZWWA 3UVEA 3RUDA 1K6IA 4HADA 4KWHA 3ZH2A 4ROSA 1MFPA 1WZIA 5DULA 2JFFA 1HWYA 1QV7A 3NGXA 1LDGA 2I76A 1UDAA 5LDGA 3V5NA 1HE5A 4EI2A 1ID1A 3BHIA 1IOLA 1JVBA 3BA1A 1P1RA 3JCZA 2D2IA 3LF1A 4JP3A 5DCYA 1IE3A 1PJQA 1NWCA 1Z7EA 1NHGA 1NQOA 5T64A 1UUFA 1YH3A 3GHHA 3ZU3A 3DMYA 3L9WA 3UXYA 1LRJA 1CJCA 1PJ4A 4PLPA 3T7CA 1AXEA 1E77A 4HBGA 1O9BA 4J9UE 3AU9A 1YB1A 4MIOA 1BRMA 4JK3A 4OH1A 4HFMA 2AHRA 1CDOA 1SC6A 3C85A 3U5TA 5L7WA 1T2DA 3G49A 4ZN6A 4RL6A 5TS3A 4RLSA 3GFBA 3AFNA 1FXSA 1G1AA 6ADHA 2Y67A 1LQTA 3ROPA 4EUFA 3WWZA 4NFSA 1E7YA 4J7CA 4RPJA 2WWRA 4MDHA 3PHHA 3DAGA 4UVGA 4DIBA 2GNAA 3D5QA 3EK2A 5ITVA 4TRNA 2X0RA 4IJKA 4D41A 4CMHA 4LVCA 4MJLA 1U1IA 1F0YA 1HYHA 3UCEA 1DFIA 3WICA 1OMOA 4BGVA 1I2CA 2PWZA 4L76A 3F9IA 1I10A 3L6DA 1NP3A 1E92A 1Q1NA 2ZB8A 4LMPA 4R4JA 3EZLA 3RBXA 2R00C 6LDHA 4FFPA 4OSPA 4D46A 1HZZA 4XYLA 2Q49A 5BNTA 4RLHA 1WP4A 2AA3A 4WLUA 3K6JA 5L40A 4CMEA 4BL5A 4YAIA 3TL2A 3RBZA 1U8FO 1DIHA 1D4FA 2DFVA 2JD2A 1JVSA 2BFAA 2F1KA 5JYDA 1BDMA 1RM4A 4F6CA 1PQUA 1PU2A 1X15A 1PJLA 4CLOA 2DFDA 4G65A 1AHIA 1T1SA 3ZWXA 2P9EA 1Q0LA 2Q1SA 2Y1OA 4CQMD 3A1NA 3PDJA 3CH6A 4UUMA 3GF4A 1JDJA 2WYVA 3VH3A 3VTFA 1D3AA 1X13A 2FY8A 1E3WA 5BSEA 5MDHA 1I36A 5A9RA 2VT2A 3ASVA 2HLPA 1UP4A 4R5HA 3NJ8A 1LLUA 4WUVA 5BNFA 3UOGA 4OKIA 2HO5A 3NKLA 3VVCA 4CJXA 5F21A 4GI2A 2EJWA 4PGFA 3HB5X 1W4ZA 5EQDA 2PKRA 4YT5A 4DC1A 2CDBA 4Q3CA 4QUKA 1U9JA 2ZB7A 3DZFA 4TVOA 1PTJA 2PZLA 4FFRA 2EW8A 1AUPA 5F1KA 3GOHA 1Z82A 1R0LA 3H5NA 5THKA 3N58A 2EEZA 1ONPA 3PHLA 5DBIA 3H6KA 4J1QA 1W8DA 1X7DA 5ER9A 1O5IA 4LSWA 3W8FA 3H65A 4CMAA 3DZKA 2PGJA 4BO9A 4Q3EA 2PH3A 1XIVA 1O95A 1NTOA 2JKVA 3DHEA 4A03A 5JY1A 4XWYA 1EFLA 1ONOA 2O50A 1BGVA 3ICCA 3WYEA 1ZW1A 3PHGA 4GBJA 4L4XA 3PFFA 1B3RA 4E32A 2EJVA 3PZRA 3W4KA 3IQDB 4FR5A 1YWGO 1NYTA 3PWSA 4NPCA 2RCYA 5JO9A 4R1NA 4YXFA 5K6AC 4S3MA 3WJAA 1T1RA 4RO0A 2EP7A 2AEFA 2FRDA 3LYLA 4JJIA 4MVJD 4XZ3A 3RU7A 4JQCA 1DJQA 5KJ6A 2QG4A 4J7UA 1ZSYA 1LUAA 2UVDA 3KLPX 3BYZA 1L7EA 1KVRA 3WGOA 1QORA 2J5KA 4C7KA 4CMCA 3GEMA 3NAQA 4W7HA 1VL8A 1LXCA 3PHJA 2WSBA 3BMCB 4IPTA 1T24A 2PD4A 2O3JA 3DEYX 3GMDA 1DFGA 4FBGA 1BXKA 1GEGA 4NZ9A 5IN5A 1CETA 3V2HA 1IZ9A 4HWKA 1NXQA 1E1NA 4MKZA 3RBVA 3V2UA 4AVYA 4DIOA 1UDBA 3OF2A 3MZ0A 2ZTVA 3ULKA 3JYPA 1R37A 3VPSA 1V35A 1X0VA 5I7FA 2IZ0A 4Y6RA 1QKIA 4PZDA 3ZWAA 5CEFA 4DL9A 3OM9A 3WGYA 1P44A 3Q9UA 4U6QA 1H6AA 3JQ7B 4RZHA 5B12A 4MO2A 5T5QA 5ENDA 3F4LA 4YQZA 3Q3CA 3D4OA 4A26A 1NR7A 4UVDA 4I5FA 1GV0A 3PZBA 4TQGA 5JS6A 4GSKA 5DF1A 1Y8QA 3V8BA 1E5QA 3NT5A 4CM1A 1XHLA 3QWAA 2NM0A 4I5DA 1I24A 4PLYA 3WTBA 4GPD1 4FN4A 4B3HA 4CM5A 1D8AA 3U49A 4R69A 1GAEO 4CM3A 2FR0A 3MTGA 5I8ZA 3E03A 3C24A 3AOEC 4FW8A 5DBFA 3S1LA 3I9JA 2GZ3A 2O3SA 1LJ8A 5COBA 4NU5A 3COSA 5IG2A 2O7QA 3QWIA 3QQPA 4P4GA 3KBOA 4MVJM 4RVFA 3RIHA 4DTIA 3TQHA 2PY6A 5JAIA 2BI8A 3A06A 4D0SA 2I3GA 2X58A 4IQGA 3RCBA 5HM8A 1I2ZA 1CIVA 1GZ3A 1M6WA 2Q4EA 1BW9A 2ZCUA 1GPJA 4BB5A 3NX4A 4BNGA 1B0AA 1GY8A 4RVSA 4QX6A 4YJGA 2BMAA 1WWKA 2X9VA 4XQCA 2B4QA 2VQ3A 3BMNB 3GUCA 3PWKA 3ONDA 4YJFB 1ONNA 3RU9A 1PR9A 4IGEA 4U6SA 5ILGA 4JN6B 2BD0A 4AJIA 2ZTMA 5JBIA 4BNMA 2Y1EA 3HJAA 2OORA 3JD4A 4FFOA 1P1JA 2NADA 4DGSA 4PLHA 5KJ1A 1B7GO 3RC9A 4IXTA 4WOKA 4XDZA 3TRIA 1P3DA 1PX0A 3HB4X 4BOYA 4BO2A 4D45A 3HN2A 4CMKA 2C2XA 1EFKA 4BKUA 1P0CA 4IGFA 3OJOA 3GZNA 1JKJA 1R66A 3SLKA 1ADCA 2Z1MA 5JCXA 3ZWVA 2CDCA 1X14A 4DVJA 2AEJA 4DXHA 1K2WA 3KO8A 2H63A 2UYYA 4R9SA 4UVEA 1H6DA 4P4LA 2DPHA 4LK3A 5B4UA 4EBFA 4KUGA 5CDUA 1ZK3A 4DREA 1MV8A 4YT8A 4Z6KA 3GVHA 3GK3A 4XRRA 1DEHA 1GYQA 1LNQA 2GD1O 4L4RA 4DUPA 3IC5A 4R01A 4II2A 3WX0A 4FS3A 4NJOA 1HDXA 2Q4BA 1DSSG 1H9BA 1I33A 4AJ4A 3H9EO 3NDJA 4XQ9A 4OKNA 4MVJA 3CZRA 1K0UA 3KVOA 3L0DA 2EXXA 4YTEA 5IDYA 2PFGA 4L8VA 2E49A 3K73O 1YL6A 3HUDA 3E9NA 5JDIC 4OOFA 5JO0A 3NEPX 3RC2A 4BNYA 2JAPA 2J5RA 1WPQA 1DIBA 1GL3A 4HKTA 1SCUA 5G2OA 5G0VA 4YWJA 3DBRA 2X8LA 4M1QA 2P2SA 3FD8A 1HDOA 1QYWA 2DLDA 4BGUA 1T4BA 3EVTA 5IZCC 5C7IO 2Q50A 5IJZA 1QP8A 2X9NA 2P9GA 3WGIA 3UCXA 5KVVA 2XOXA 1LLCA 4BNXA 3OIDA 3PP8A 2YJZA 4I9UA 3MJVA 3T7EA 1NWHA 4CR8A 2YDYA 5EESA 4C4OA 2EP5A 4BO6A 2TMDA 5G0WA 3ROQA 1BG6A 1ZMOA 2QZ9A 5KKAA 4CMIA 1DIAA 1R15A 2GN6A 1JAYA 3QWHA 3O38A 1WXDA 5T8KA 1Q7BA 2GF2A 1NASA 3E48A 1O8CA 1NPYA 3JYNA 2HK9A 3PRJA 2YY7A 1M2WA 3QRWA 5IXSA 1M66A 1OBFO 4N5MA 4BNJA 4OQZA 2HMTA 3ROKA 1ZEJA 1CF2O 4LW8A 2DC1A 3H4VA 1YJQA 4WCFC 5JAQA 5I9MA 1GYPA 1E1KA 4KQXA 1VI2A 4RVHA 3AOEA 1EZ4A 4KDEA 4NI5A 1ZUD1 1P0FA 3UFXA 2EKPA 3L4BC 1ISMA 4Z0PA 2DTEA 1GPDG 5KVCA 3X2FA 3GC6A 2O3UA 4GX5A 2I6TA 2QRLA 2I99A 1A5ZA 3SXPA 3ZNQA 4DMMA 4Y98A 3U4DA 1HSZA 4HFNA 3WYBA 3QE3A 3NDRA 1GQQA 4EJ0A 2OXIA 2VYVD 1XWFA 3E6AA 4CMJA 1DAPA 3A9WA 4YDRA 3R0IA 4YCAA 4ZQFA 5DN9A 3WGHA 5IDWA 1GUZA 2E37A 3JQ9A 3BTVA 1EK6A 3DBHA 2J8ZA 5I9LA 5EL0A 4M87A 2VCYA 3PI7A 3C1TA 2B4RO 2P9CA 3FR8A 4UUPA 1ENYA 1Y6JA 4Z0TA 4PLVA 1N5DA 3Q0EA 1YO6A 4CM7A 3JQBC 3JSAA 5I9NA 1UAYA 1SO8A 4XGIA 4CL3A 1YKFA 2VHWA 4U8GA 5FFFA 3RUIA 1LSSA 2X86A 1TT7A 2D5CA 3U09A 4K1LA 1GADO 2YHIB 1HT0A 5CG1A 2PKQP 4FJ1A 4YAEA 2G17A 1GDHA 3L4SO 2UAGA 3RJ5A 2H9IA 2HRZA 2C07A 2YV2A 4OO3A 4MIEA 1YOVB 4B7UA 2E48A 5I7VA 4PLFA 4YQYA 1N1EA 1X0XA 3LLSA 4E2XA 1P9LA 4GKVA 3ZNNA 4LRTB 3FWZA 4AJPA 1N1GA 1I0ZA 1QLHA 1UZLA 1XU9A 3R1IA 3TWOA 3KOUA 5G4LA 5HS4A 4YT4A 4N7RA 4CMEC 1ZFNA 3VC7A 3JD2A 3VKUA 4J90A 4TRRA 1ADGA 2A94A 2H6EA 2ILTA 3TZHA 3SVTA 1O0SA 4II3A 1ZZEA 2D5AA 2NVWA 3BMQB 4XCVA 2JHFA 5KOIA 1NHWA 2EG9A 4CQLB 4HFRA 2XXBA 4R68A 3TN7A 3ABIA 4LVUA 8LDHA 3PJGA 2VNAA 4IY1A 5A3JA 1AXGA 5L7YA 5L7TA 3DC2A 3JQ6A 3GRKA 3S2FA 1GR0A 4J7XA 4RDIA 4IDAA 3AY3A 2HDHA 4J4TA 5JFOA 3QVWA 2B5VA 2PKQO 4D79A 5FWNA 4U5QA 3IP3A 2VN8A 4J9VA 1EEHA 4NJMA 4OL9A 3TFOA 3U4IA 1U28A 2Q46A 3JYLA 4YR9A 1H93A 4XR4A 4AFNA 5CEEA 3JQDA 1C1XA 3BMQA 4TROA 5G4KB 4U0JA 4XD2A 2DAPA 3VPXA 3GHYA 4A5OA 2NNLD 2YV1A 1JA9A 4I9NA 2VHZA 2DTDA 2C5EA 4NQZA 4JLWA 1NM5A 3CEAA 4YJHA 2O3RA 2Y1CA 1R16A 4F45A 3F46A 2C7GA 3AY6A 2Y05A 4OHUA 2NV6A 4PFJA 1WMBA 1VKNA 4R54A 2G5CA 1RKXA 1JAXA 4WOJA 3MEQA 4RF5A 3HDJA 3K5PA 2P68A 5KJCA 1B8VA 1NVMB 1B14A 1DO8A 4XIJA 4M54A 5G4KA 4Z9YA 5G0UA 4RVDA 1EVJA 4IINA 1SEVA 2ZTLA 3TL3A 2XXJA 4IDEA 4YRAA 1H2HA 4ZU3A 1HETA 3B70A 4O5OA 5U4QA 2ET6A 1H0KA 1HDCA 3CPSA 4I1IA 1EQUA 1NPDA 4J91A 4L75A 1VC2A 1C0LA 2IEDA 3ZWOA 4JBHA 1BTOA 3W4IA 1VE9A 4Y8VA 3ANNA 2UV8A 1A7AA 1R0KA 4YJDA 2I9PA 3R3SA 3L4BA 3LF2A 5EIOA 2J3JA 4AJJA 1YJ8A 1XYGA 3Q2IA 4KOAA 1U8XX 1Q0HA 2QZZA 3KYDA 3E8XA 4XYEA 4FQ8A 1IY8A 2GSDA 3GGPA 4W6ZA 1V3UA 2X4GA 1F8GA 5JDCA 1RYEA 2B69A 1YBAA 1K6JA 5U9CA 2WJPA 4XYBA 4DLBA 2FPGA 3JQGA 2NWQA 1HXHA 1HE3A 2NACA 1ZKMA 1NQTA 2DUUA 3JQAD 4RF3A 2JFGA 1N9GB 3V1TC 3VHRA 3FSRA 4ZQGA 1LRLA 3JYQA 2V7PA 3NYWA 4BV9A 4Q3AA 1Z74A 1K6XA 1P1KA 1B8PA 4R1SA 1X1EA 4R5MA 3AY7A 1NFFA 3DDNA 3JQBA 1IHYA 3FBTA 5G0TA 3K9QO 1DC3A 2IYPA 2HU2A 4UEJA 1U4OA 1YONA 1N92A 1ZSVA 2B0JA 4AJHA 1HL3A 2OP0A 2D1YA 4O1MA 4CLRB 1V6AA 4RQUA 1PR3A 1RJWA 4UVHA 4UEOA 1DFHA 1I5RA 1PJ2A 4Z3DA 2FZWA 3F5SA 1JLLA 5TJ9A 4DYVA 4YJGB 3IL2A 3BTUA 3H9JA 4KP7A 3IJRA 3KEQA 2ZIZA 4X54A 2VWHA 1NQAO 2JCYA 1SPXA 2ZCVA 4YJFA 3QVXA 4E6PA 2E4AA 4BQPA 4OMUA 1C1DA 1PGPA 3NTRA 1P77A 3SJUA 1I32A 5ES3A 3INRA 2OO5A 1EUCA 3WGTA 1QXSA 3D5TA 4HUJA 3DOOA 3GT0A 2JD0A 3OQBA 4GSLA 4CQMA 1VSUA 2W8ZA 1IYZA 1AN9A 1XR3A 1WDKA 4RPHA 4XYMA 1PZFA 2WMDA 4J3FA 4CMGA 3SLGA 4ND4A 1HF3A 2D8AA 3KV3O 5HRUA 2IYOA 3PLRA 2YYYA 3MOIA 4IMRA 4PCVA 3AI1A 3WTCA 1UAGA 1NPTO 1YB5A 2VOEA 4Y6SA 4BNUA 2CF6A 3F4BA 4C7JA 3KYCA 1SBYA 3NT2A 4H15A 1CQJA 2CY0A 4IJWA 3QP9A 2HAEA 3HQ4O 2EGGA 1ZK1A 3IUSA 2OUIA 5DNAA 4BNWA 1YDEA 4BB6A 3KZVA 2VWGA 5JCJD 2UDPA 1IUKA 2YFQA 4A73A 2EERA 3RFXA 3RFTA 1ZVMA 2CZCA 2G82A 3NTQA 3ZV3A 3DQPA 3X2EA 7MDHA 2RAFA 4MINA 2GCGA 5I8WA 3L07A 4DQVA 2E6UX 4CL8A 4FFLA 3PQFA 3BIOA 2FWMX 1MB4A 2Y66A 1ZNQO 1HDZA 1FDVA 1NAHA 4K9DA 5F3RA 3OHSX 2OFPA 1UJMA 3DO5A 1IL0A 4GX2A 2X5JO 4QO8A 4UAGA 4ONEA 3VTZA 4NBVA 1XCBA 1YB4A 3DBLA 1LSJA 2CSUA 4W9NA 1MG0A 3QIVA 1B8UA 2PR2A 1T26A 4JBIA 3HE3A 2BI7A 5A3VA 5C37A 4QEDA 3GG2A 3IIEA 4CV0A 3ZU2A 4CLEA 4N5LA 3PYXA 5I7SA 2FZEA 3LT2A 4GH5A 1PWZA 1E1LA 4RPKA 1ADBA 1M6HA 2GZ2A 5LCXA 4R1UA 4ALLA 1E7QA 1HDGO 3FBGA 1ULUA 2EIHA 2XAAA 4UREA 4BNTA 4NBRA 4IZHA 5JCJA 5IDQA 1DRUA 2WE7A 3UGKA 3FN4A 4PG8A 1LQUA 1E7SA 3GN1A 4IIUA 3HNPA 3FTNA 4XGNA 4B3JA 1R6DA 3UHAA 2OZPA 3HDHA 4BNZA 3WG9A 4ID9A 4UVIA 2VWQA 2PK3A 3FNFA 3LZ6A 4E2WA 4BHTA 1ZIDA 2GDZA 1VPDA 1ENOA 5THQA 2X23A 4M86A 1P33A 2CMDA 2GASA 3DAFA 3LLVA 5I7EA 3WSWA 4TSKA 2QHXA 4OYRA 1Z45A 1BDBA 4IDBA 4WNCA 1KEVA 5KJEA 2W2KA 4KUHA 3Q6IA 4W99A 3Q1LA 1Y8RA 3EZYA 3O9ZA 5CG2A 2FN7A 2FP4A 2D4AA 1Q0QA 2PA3A 4PG5A 1WDLA 4BNFA 4EDFA 5DCWA 3Q9NA 1LI4A 5T67A 3ZI0A 2ZJ1A 2Y0DA 2OBNA 4HY3A 2RBEA 4CM8B 3ST7A 1R12A 1MLDA 1PS9A 2EKLA 1U3UA 3DOJA 1BVRA 3CUKA 3GR6A 5TQVA 4BNNA 5DCUA 4QFCA 1K3TA 8ADHA 2W2LA 3C8MA 3NUGA 1T25A 1QSGA 4TWRA 4J1NA 1GZ4A 1LU9A 1ML3A 1MA0A 1MFZA 4E21A 3HHPA 2YZ7A 2ZB4A 1N2SA 1LLQA 2Y0EA 3WSVA 1LDBA 4NK5A 3Q11A 3L6EA 2V6FA 3FTPA 3VAZA 2OL4A 1NNUA 1ZK2A 3WWYA 1A72A 4W82A 3SBOA 5JPIA 4D3SA 2HJSA 2VYND 1VJ0A 3QA9A 3CMCO 4IXWA 4O6VA 4RF2A 1KC3A 1UP6A 4RCVA 3W6ZA 2EW2A 4RDHA 2VUSA 4BQRA 4QO7A 4XB2A 4RJTA 3IS3A 1PJCA 3JV7A 4ND1A 1VLLA 5J23A 1SAYA 4IZIA 3LK7A 3HN7A 4BNKA 3BXXA 4K26A 2DBVO 4K28A 4QT0A 2I67A 2C2YA 4FDAA 1UXGA 2J3HA 5TC4A 2NVUB 4ALMA 5GZ1A 2AQIA 1LEHA 1LDNA 3DHNA 1SOVA 1V8BA 1DB3A 1R4MB 1AE1A 3IDSA 4PZEA 2P91A 2HSDA 2UUOA 3ZGYA 1E3LA 3TFQA 1UZMA 2B37A 2RH8A 2BHLA 3K30A 1C3VA 1QYXA 5EMHA 5IN4A 1YVEI 4WGGA 3DHYA 3CIFA 4MVJF 5TJHA 3A4VA 2B4TO 4XX0A 1HZJA 2EGHA 4WCDA 2HMSA 2YQ5A 3S8MA 5GMOA 1O94A 4J2OA 2W98A 3ZV5A 2BGMA 2GN8A 2WD8A 4F3YA 5CAEA 3FF4A 3PPIA 4AICA 4CLDA 1VL0A 2DBZA 3G0OA 3GN2A 4I5GA 4JJGA 5TX7A 3RASA 1J5PA 3TZQA 2J3IA 3ICPA 4FJ0A 2FPIA 1V9LA 4JGBA 5CEJA 4ALNA 3L9XA 4OOEA 2A92A 3PGXA 4PRKA 4NJMB 4E5NA 4EYEA 4R16A 1ZK0A 2Q2VA 3AI2A 3BTOA 5JE8A 1YQGA 2ZB3A 3JQ8A 3PJEA 1SMKA 4YRBA 5JAMA 1FF9A 3MJCA 4NBTA 3UW3A 3AK4A 3OMLA 4AJEA 5JNLA 5TLSA 2VUUA 4XB1A 3PGJA 2XPCA 1E5LA 3I1JA 1MC5A 3F47A 4MVJI 2LDXA 3ITDA 1SNYA 1GZ6A 1I01A 1QR6A 1LA2A 2AQKA 5TIIA 1GYRA 4G2NA 4I08A 4EJMA 4G81A 4PLWA 3ETEA 4PG6A 4DA9A 4ND2A 4Q3BA 1EE2A 5TSDA 1ZMTA 1XG5A 4MIYA 4AJNA 4L73A 4EEXA 4WK6A 4JX8A 3DMTA 3OSUA 4L0QA 5H81A 1FDUA 2QQ5A 3DFUA 3AUUA 4DRYA 7ADHA 4XQGA 1KS9A 3QLJA 3RC1A 1XQ1A 3UH1A 2JHGA 3PYLA 5A05A 3VZPA 1IZ0A 5JXWA 5C3MA 2R2GA 1J49A 4WLNA 2B83A 2PZJA 3WQSB 5C7OO 3AI3A 2NUAA 2OOSA 2NQTA 2OBYA 1U2DA 3RD5A 4OXKA 1PSDA 3UUWA 4H16A 3F1KA 3UN1A 4EJ6A 3GQVA 4PG4A 5A4DA 2JJYA 2CNBA 1HDYA 1T2EA 3GA0A 3UICA 3VZSA 3RAJA 1YOVA 1KC1A 2I3AA 4FFNA 5JAZA 3QV1A 4GMGA 1YBMA 1L7DA 1C1DB 1BMDA 4AG3A 3KSDO 1SOWA 4FJ2A 1A4IA 4CR7A 1DAOA 4ZQEA 1EDZA 3RUCA 1DIRA 3I6QA 5A06A 4A0SA 2BFPA 3ONFA 4F6LA 3M6IA 2VUTA 4LGVA 3UKOA 2HK7A 4OIMA 4L4SA 3ZWBA 3VH2A 2P5UA 3JQGB 3GVCA 1X1TA 3QVTA 3NGLA 4J0EA 3VH1A 3BMOB 4TZTA 2JFHA 1ZXBA 4J0FA 2C29D 4WLOA 1HRDA 2UUPA 1KOLA 3JQ7A 4JCOA 3S55A 1Z75A 3W8EA 3WNVA 4BO0A 3L6OO 2QYSA 4OXYA 4BV8A 4JJFA 3WYCA 4RQTA 1ISJA 4IDCA 2YQ4A 1ZEMA 4E31A 2JD1A 4OJNA 3W4JA 1DJNA 1H5QA 2O3TA 4PN3A 2CUKA 3SC4A 2O48X 4MKXA 1WNTA 2CVQA 3NT4A 1VJTA 3I9KA 1PZGA 4P22A 4CLRA 3GNSA 1PS8A 5IFLA 1OI7A 5HTOA 2W2LD 3WR5A 3RJ9A 2X7HA 3GNTA 4CV3A 4KMSA 4GVXA 4LCEA 2ZQZA 3U4HA 1EVYA 2O2YA 3I9LA 2ZJ0A 2VYVA 4PRLA 5L4LA 5FI3A 2I66A 1JWBB 3JQEA 3DL2A 3T4EA 5A9SA 3C7AA 4RPGA 4IS3A 3KTDA 3QW2A 1UDCA 3ZWMA 2X5OA 5KKCA 1F06A 5DOZA 2D3TA 4YPOA 3OBBA 1G0OA 5JW6A 1GCOA 2DKNA 4FPXA 2BFMA 1B2LA 3ROMA 5EQFA 3G1UA 3BHJA 3VH4A 2HKIA 4D43A 2DTXA 4WNIA 2X5KO 3INTA 4J1SA 4ZQBA 1NX6A 4Q9NA 2WM3A 1O6ZA 3I5MA 2O23A 4DPMA 4Y67A 3ZZNA 2YW9A 2VHXA 2RH4A 4CPDA 2IODA 4CV1A 3QWBA 3G1TA 2AW5A 4MVJP 3U3XA 5K9ZA 1HYEA 4IQ0A 5AVOA 3FNGA 3GAZA 3VPGA 2WTBA 2NTJA 4K6CA 5GZ6A 2HMVA 4P8RA 1EE9A 2HK8A 3G3EA 1E3EA 1P1FA 1Z73A 2WYUA 4WCFB 1OC2A 3I6IA 5DZSA 5KVSA 3FRJA 3DONA 4CMBA 2DBQA 4GQAA 4TVBA 1B16A 9LDBA 1E3IA 3KYDB 2O7SA 1DRVA 2YFHA 1S6YA 3RQSA 1P45A 2PGLA 2CF5A 4JNKA 3WS7A 4FD3A 4JIGA 3DZBA 1M67A 4AJLA 2Q2WA 1GCUA 4FC7A 3AJRA 2IZ1A 4I8XA 4RF4A 2HUNA 3CKYA 4NNJA 1TA4A 3C3XA 4M8SA 2V6GA 4XDYA 3JQ9C 1EDOA 2G0TA 4DQXA 5IF3A 2P4HX 3GPIA 4IIVA 4CMIB 5KTKA 5JC8A 4M49A 1DDOA 5ICSA 1Y5MA 2DBRA 2IRWA 2VT3A 3WLFA 2WD7A 2QX7A 4IJUA 3WGGA 4UUNA 3MJSA 5AXAA 3ZHZA 3UCFA 1UZNA 3O8QB 4NR0A 1ARZA 4P38A 1C14A 1G0NA 2QRKA 3KM0A 3MWEB 3VDRA 3WNQA 1ULSA 3E9QA 3ORFA 4W9NC 4E12A 4YYZA 2H1SA 3SC6A 3ZU4A 3D3WB 1HLDA 1GD1O 1TXGA 3PLNA 4IS2A 1PGNA 4TRJA 1YGYA 5ITWA 1AHHA 4M55A 3WLEA 3H9QA 1VM6A 4MVJH 4NFHA 3BAZA 1T2CA 3RI3A 4CM4A 3RVDA 1IHXA 1NFRA 2VHVA 4BO8A 5L45A 1TI7A 3ANLA 4ILKA 2GERA 1VRWA 4L9RA 4XR9A 5T57A 3R6DA 4WLVA 1U7HA 3F6YA 4YB8A 1EVZA 5U1PA 1TLTA 4GX0A 3O8QA 1ZCJA 3P5SA 1PZEA 2O4UX 4J6FA 3HFGA 4IM7A 1OC4A 2X0NA 1XKQA 5TT0A 1U7TA 3GNQA 4R9RA 3GDFA 1PL7A 3NJ4A 1D1SA 4FSHA 3FNHA 1UXKA 3ZHXA 1KEWA 2Y1GA 1PQPA 3IUPA 1Q7GA 3DR3A 3RROA 4PZCA 4CLHA 3MJEA 3QWFA 3B1FA 3MCVA 1PJSA 4BO1A 2GUGA 5L53A 3B20A 4ALKA 1P74A 2DT5A 4E2ZA 4DQUA 2C5AA 4MVJG 3TZCA 1YRLA 5EERA 2W4QA 3U62A 1GV1A 4GLLA 1O89A 1XA0A 4FIZA 3S2GA 4AJOA 3FCOA 3ZWYA 4CM6A 3IKTA 2VNSA 3KHUA 3TOZA 3OH8A 4I5EA 4NU6A 3O26A 1E7RA 1OZAA 3ASUA 1A71A 2PZKA 3MWDB 1TT5A 1RM3A 3PIIA 3NV9A 2QRJA 2GO1A 1M76A 1JW9B 2VZ9A 5B37A 5KIAA 1T2AA 2IXBA 1K5HA 1RWBA 1HTBA 2VTEA 3DFZA 4E5MA 2POQX 4TRMA 2G76A 4GGPA 3ZV4A 4DLAA 2JAHA 1HE2A 1NQ5A 3E82A 1DPGA 3CINA 3WMXA 2O2SA 4ZVVA 3PIDA 4NMHA 1YE3A 3WBBA 3SJ7A 1SZJG 4URFA 4FOOA 4D42A 4KZPA 3D4NA 3GEGA 1V3VA 3DBLB 4R3WA 4DMLA 3A14A 2BLLA 1D1TA 3PHIA 4WKGA 2H5LA 4BUCA 1CEQA 4YEDA 1I30A 3GRPA 1N7GA 1I3KA 2AE1A 1SB8A 4PLGA 1AGNA 4LISA 1E3WB 4BGEA 1E1MA 1BVUA 4GWKA 5TGDA 2C54A 4BKRA 1BHSA 1Z7BA 1HKUA 3ZHYA 4J43A 3AWDA 1ZJYA 1DC4A 2Z1NA 1TVEA 3GH3A 4DPLA 3H3JA 4YAKA 1H94A 2GN9A 3O03A 5BSGA 1PEDA 1ISHA 2Q1TA 4FGSA 5IXYA 3K2BA 5JY6A 5C5IA 4LRSB 5H82A 5DDIP 3E18A 1PGJA 1XDWA 2CVOA 4TKMA 1XLTA 1KYQA 4GX1A 1M75A 2NU9A 3JD0A 1H6BA 3IP1A 4DBVO 5CPFA 1WVGA 3VKVA 1GEEA 3O4RA 3TJRA 4OM8A 4JBGA 2BELA 3VDQA 3W6UA 1L1FA 1MG5A 4WLFA 3A28A 4DBZA 1VKOA 2I65A 5ILOA 5AXDA 1T2FA 5HS6A 5DP1A 3JQ8B 2JCVA 1UXJA 3DTYA 4PVDA 4RVUA 4CLOB 1P1HA 4QQRA 5TRTA 2V6MA 3ZWCA 5A04A 5IAAA 2NSDA 1I8TA 1BXGB 1P31A 5L95A 5A02A 4EUEA 4ALJA 4OAQA 1EBUA 1SEPA 1YQXA 2WEKA 3BTSA 1C1XB 3OP4A 5JMWA 2DPGA 1XGKA 1LDYA 3ITKA 1WZEA 1U4SA 4EZBA 2Y99A 4PG7A 4CODB 4IDFA 1BWSA 4L74A 4EUHA 2R00A 3W1VA 4I9HA 2BF7A 3GZ4A 4NK4A 5CDSA 4MP6A 2AQHA 2X22A 3CE6A 1IPEA 1U3WA 3JYOA 3L77A 4XYGA 5BT9A 2GLXA 4DC0A 4B3IA 4MKRA 1BXGA 1PL6A 1LSOA 2C0CA 2WYWA 2Q2QA 5JC1A 1B26A 5BSHA 2O4CA 1FK8A 3I9OA 1MX3A 1ZK4A 1A4UA 1R4NB 4B4UA 4BNLA 3N7UA 5FI5A 1N9GA 3OJ0A 2PH5A 5G0SA 3ZW8A 2FR1A 1E3SA 1S7CA 3HSKA 1QYCA 4WASA 5CPBA 4NH4A 4BVAA 3U4CA 2VRBA 3BMNA 4E5PA 3IKVA 2DUWA 5DOVA 4JP2A 4YBZA 3TZ6A 3CXRA 3D0OA 5FF9A 5GZ3A 1R4MA 1JWAB 3VVBA 3HG7A 1ISGA 3H9GA 3G17A 5BNIA 1I2BA 2Y93A 2IE0A 2NVBA 1WDMA 4DLLA 1XSEA 4LN1A 4A10A 4LSMA 2AXQA 1XELA 4IUYA 1CWUA 4Z9XA 4B7CA 5BQFA 2AG8A 1RM0A 4NIMA 1B15A 1YQDA 4A2CA 4RPLA 2J5QA 2PZMA 3H7AA 4E33A 1RM5A 5L51A 2EV9A 4YVFA 3BMCA 5BSFA 4NBUA 2QIOA 4O0LA 1LDEA 1VL6A 1NAIA 3RFVA 3OFSA 1NVGA 1DHRA 3OQ1A 4ZA2A 1JQBA 4S1VA 3VZRA 5AQ1A 3GLQA 1ENPA 5CP8A 2V6BA 2AE2A 2VTDA 2BGKA 1EVIA 2FOIA 2FSVA 2Y0CA 2C7VA 3ETGA 1LC3A 4UUOA 1U3TA 1YBVA 4BO3A 4WPGA 4GAEA 4BKQA 1ISFA 1MC4A 1D7OA 4HFJA 4IDGA 1UR5A 1ZO8A 4Z3KA 3GGOA 3ON5A 4F46A 2ZYAA 2IEBA 3SEFA 4J2HA 1OFGA 2VWPA 1CYDA 2J3KA 3I9MA 3WXBA 3ZWNA 4GWGA 3TF5A 4WEOA 5B1YA 3C7CB 2GR9A 3FWNA 3DBRB 4NDNE 4TKLA 4WJZA 4KUEA 2FSSA 1B3BA 1IPFA 3RUFA 3V1UA 3ZN2A 3R3JA 5A03A 3VPHA 5EN4A 3AU8A 4KWIA 1BXZA 1EK5A 1KEPA 2V65A 1IB6A 2YHUA 1H9AA 1H2BA 1DC6A 3H2ZA 2NU8A 4J1TA 3ZDFA 4D0RA 2A9FA 3I9NA 4B79A 1JKIA 3OECA 2FMUA 1A9ZA 3PJFA 3PTZA 3F1LA 3EY4A 1N8KA 3B6ZA 3D3WA 3PDUA 3WIEA 3PJDA 4GL4A 5LC1A 2W2KB 3KUXA 5L4SA 1KVSA 3KRTA 1EMDA 1ADFA 2FHSA 2XF8A 4E4YA 3ZCXA 3RKUA 2DVMA 2X9GA 4HP8A 1LX6A 4E5KA 4CM4B 4N18A 3E1KA 1H6CA 1OOEA 4DYDA 4M89A 3DBVO 3UAGA 2Y68A 3S2EA 2GRAA 5EJ2A 4IMPA 4ITUA 3JQCA 3AFMA 1W6UA 1SB9A 2GGSA 2IXAA 3KB6A 5LDHA 3OICA 1PIWA 2B35A 3ADPA 3C1OA 4R51A 1X7GA 2CDAA 3ZW9A 1P1IA 4OXNA 3PQEA 3B1KA 9LDTA 1GU7A 1I3NA 1N7HA 1LTHR 3WGQA 4ZQHA 1WW8A 2W90A 3OJLA 5B4TA 2WDZA 3U0BA 3NDIA 1QV6A 4FB5A 3AUTA 1QRRA 4XJTA 3F3SA 1V3TA 3EC7A 4GGOA 2GN4A 1FDWA 3AW9A 1VJ1A 2B36A 2ZQYA 5IDXA 3GVIA 2R6JA 1NVTA 5K0ZA 2A35A 3MJ4A 2RHCA 4U0KA 4ZJUA 1PGOA 2O3QA 1I3MA 3EAGA 1DBVO 1NR1A 5BR7A 3IOYA 3OIGA 5KVQA 4B8ZA 1CQIA 3D4PA 3V1YA 5FEUA 5KWEA 4CLXA 4ZD6A 4UEKA 3EDMA 5KJFA 1ZXLA 1KIFA 1RPNA 3QVOA 4B4WA 3EVNA 4P4NA 3ZV6A 1Y5RA 4XQEA 4IQ8A 5JLAA 3JQAB 5CDYA 1JU9A 3GY0A 4ND3A 1UXIA 1KVQA 2YDXA 4NHEA 5AXBA 3RWBA 1XU7A 5GY7A 3DXFA 1W0CA 4D3DA 1WLYA 1UXHA 1XQ6A 2VRCD 5TF4A 4WEQA 4DWVA 3UF0A 3T4XA 2OP1A 3MTJA 2A4KA 1YXMA 3GEDA 1HYGA 3OA2A 4U7WA 4QTZA 1DOHA 5EINA 2I5PO 1KETA 4HV4A 1DLJA 4Y9DA 1J0XO 2J6IA 5DBGA 1FJHA 4MPDA 1ENZA 1A9YA 1QYVA 3OJEA 4E13A 4ALIA 3DMTC
chains in the Genus database with same CATH superfamily
2JI7A 5EWLB 4JYCA 4WNAB 1CY0A 1TJPB 2X0KA 3EVDA 3PQ8A 4I3FA 4GD3Q 2JLYA 1OW3B 1H8EA 1CZHA 4MEJA 4P82A 5DP2A 1EFAA 3FMPB 3WQRA 3DKIA 2NUBA 4D4GA 1RQ2A 5H83A 4B35A 4ZCLA 5CB4A 4IIGA 4OHCA 1QH8A 1LVHA 1O6GA 4GMFA 4OGFA 1YTUA 3AXTA 5I9SA 1M34E 2XMSA 3HSYA 2G88A 3LO8A 3LU1A 3JAWB 4S1NA 1U1FA 5EMKA 2G70A 4MX8A 3DWFA 3ZD8A 2BKLA 3C3JA 4G0PA 3QOYA 3QSGA 4J8PA 5KYUA 1J7JA 1F20A 1RVDA 2HBZA 3E3NA 3JX9A 3LXUX 3OUZA 2WV9A 4PZUA 3SBEA 3DTVB 3QQ5A 5LPNA 1W34A 2ZG6A 2XVAA 3GFGA 3P2YA 3GRRA 3L8YA 1RJGA 1YNSA 4KTVE 3UMRA 3ZHOA 4CM8A 4CUKA 3LUAA 4QDKA 2IUUA 1QGUB 1K89A 2VT7A 4Y9RA 2Y1XA 3MWLA 3JASB 4I0WB 3EGEA 3L0SA 4NG5A 1Q16A 1X7YA 5GOTA 1MEOA 4WECA 2QPLA 1QHEA 3VPFA 1YMQA 4YRKA 5IZCA 1BSVA 4KQCA 3FFXA 3ENNA 4DDWA 4RNCA 5C5DA 2EFGA 1L4EA 2PGDA 3IP7A 2VKQA 2ZSDA 3GDGA 2WIBA 3A2LA 1NMYA 4Q1FA 2Q9UA 1AQ6A 2I34A 2I2CA 3GMIA 3T5DA 4AN4A 5B55A 4YT2A 1LRKA 1DLIA 3EHEA 2A1UA 3H6GA 2CLCX 5E6SB 3RG2A 3ROXA 5K2OA 3V4LA 2ISQA 3D7LA 5EPUA 4B8WA 3F74A 4X66B 1Y7TA 2WG0A 4RY2A 2K87A 4NOMA 5AIBA 1C0PA 4P5PA 1BCRB 2APJA 3GUZA 3HXQA 3DFIA 1Q7CA 1SUPA 2BP7A 1RC0A 4BKMA 2C59A 2HYDA 3LRTA 4GPZA 2R4QA 5DKFA 2NN3C 4Q7LA 4FMCF 3D81A 3O3NB 1U3VA 2IDZA 4CHTA 5IASA 4L08A 3HJBA 4D3ZA 4CETA 4EPXA 1IZ7A 2QW8A 3PYMA 3RYHA 4LY9A 2QYTA 5T8KC 1RRKA 1Y9EA 1NBHA 1FVFA 3GXBA 5G1OA 4QL3A 1LSUA 3M82A 1K75A 2HC9A 4Y3UA 4KN9S 4AJKA 3GG9A 1S2LA 5B7NA 2OKCA 1GCGA 4DMCA 5JNWA 3DOUA 5BV8A 1ZJZA 3H2SA 4PHCA 1W4CA 3EXG1 4IUBS 3I45A 1K7FB 3VNSA 4LXIA 3ANXA 4Z4GA 1JKFA 2A84A 3DCJA 3PGMA 3LZCA 5CVEA 2NOAA 3I4FA 3L4KA 1EP2B 4PRYA 4EGFA 5M29A 1Q1GA 5DM2A 2V74B 3U7RA 1L8XA 1KYVA 1CY7A 1UFQA 1ZSNA 2V59A 3ZE8A 5JJLA 3HO6A 5BNWA 2EWMA 3U7JA 4L2IB 3PVZA 3IHTA 2CNKA 5JQGA 3LHKA 3QVGA 2PV7A 4KXXA 5FR1A 1ORHA 2P11A 3D3JA 3GIWA 4K03A 4CN8A 4DQLA 1GU0A 3F5DA 1ORRA 2ZAMA 1OBCA 3OTQA 2YZGA 3PGVA 1UDWA 4AS3A 1PL8A 3HACA 1ESNA 3K9WA 4FC6A 3EGOA 1CSEE 1S02A 2RJ3A 2H31A 3GOQA 4FE4A 4JI1B 4LMRA 4CM9D 2VBGA 4RC9A 4UULA 4TKVA 2D59A 3FCEA 3OM0A 3E0XA 3IBYA 4R84A 4H3KB 2EX1A 5DRTA 2NZVG 4OCZA 3K1JA 3HDQA 2NU7A 3A1EA 3NTOA 3ENWA 4MUAA 4LGMA 5DK4A 2QD1A 3L1HA 3OF3A 1E60A 2G06A 3TLYA 1QP7A 1PJBA 1W1UA 4Y6LA 3IPRA 2O5EA 3SDBA 1W0KA 3JARA 5E9JA 4AUNA 1PJTA 4L9WA 3IAHA 2Q6KA 3ETDA 1SOUA 2VZ0A 5AYVA 1ABEA 2NTNA 2O14A 3UUEA 1KVTA 1F4VA 2QRGA 1R8QA 3FHJA 4W5OA 2V1UA 2HHLA 3AOGA 3EIXA 3R4CA 2JJ1A 4H7DA 2G1UA 4Z8XA 2BM9A 4EGCB 3GGGA 3CX3A 3LK6A 5AKGA 1Z6ZA 1R9NA 2OZLB 5D2CA 3KALA 1USUA 2FR8A 1N3IA 4TKVB 1VSVA 7ABPA 1AS0A 5CYPA 4IDNA 5T6BA 1MP0A 2VHJA 2F00A 2PS3A 3ZGVA 4CF3A 4KGDA 5JJKA 1DMSA 1ICIA 2A5JA 2Z30A 1S9DA 4J75A 4OSOA 1KZ9A 1G5FA 3COYA 4PLCA 3S0JA 1YT5A 4Q5IA 4DKJA 4AY2A 4QXRA 1UT8A 2WDPA 1L7VC 1E2EA 4EOGA 3U31A 3GGJA 3LS2A 2FZ5A 3N75A 3WQQA 4YV2A 1QNLA 2H7YA 3FCUB 2VZ8A 4DNXA 5AXCA 1DAFA 4LOJA 3RVQA 3VYWA 5L3SA 1JIIA 2JIZD 3VKGA 1CW2B 3LLMA 4G85A 4C05A 3PKJA 1IY0A 4ZP1A 4PQFA 5DN6A 2O1XA 4G0VA 1GZSA 2WJGA 4MULA 3REGA 2JFZA 2OORC 3F7MA 1N5MA 2YW2A 1U9IA 2F62A 1Z7YA 5LYJA 3JATA 4LDZA 2HJRA 4TZKA 5CFOA 1QFXA 1K2VN 1PFYA 4R9NA 1IY2A 1DELA 3O92A 3ZYZA 1CEYA 3K96A 1OV6A 3MMNA 1AZLA 4FBMA 3FIUA 1F17A 5AHRA 5EMMA 3ZCRA 3N28A 3WK9A 1FFDA 4O2RA 4KEAA 2UZ3A 4KR0A 3W8DA 2I9KA 4IZOA 1CUEA 1D2NA 3QYFA 3QY9A 3NNSA 4BO7A 2F3SA 4BEBA 4BPBA 3INGA 4B6RA 1EQ2A 2B8WA 2E9SA 5KWVA 3KSZO 1UMCA 1FUKA 1GQ2A 1N2CE 2ODWA 1R18A 3EXIA 2ZGVA 3EUWA 1TF7A 4LX8A 4OQYA 3R76A 2ZK7A 3C3KA 3I83A 4Q93A 4TQUS 5KTMA 1EWQA 1OGYA 1J8DA 2IUFA 3OAAA 4XSVA 1SZPA 1E7MA 3TQOA 4ENWA 1DBWA 4FFMA 2RIPA 4Q82A 3ZV7A 3T54A 3A32A 1I1HA 2QRUA 3BBLA 4J4BA 2YL2A 3UFXB 1AQIA 2C82A 2GYYA 2VZLA 2W37A 1VCIA 2V8OA 3RJZA 2VF7A 1FMCA 3HVKA 4B4VA 4ZQIA 5BVGB 4EMSA 2KMLA 1PV2A 4IDDA 1RAHA 3W6NA 2IZZA 2DWPA 3DG9A 1MXFA 4ZICA 4DZRA 2A9OA 5P21A 2V5VA 1JJIA 4JJ8A 1E61A 2BMVA 4GOND 2ODBA 5D3QA 4UHCA 3S40A 3TEMA 3V3KA 4ZI7A 3QX7A 4XEHA 2OCKA 4DJJA 5C7LO 1EM8A 4ID3A 1FSGA 1T0JB 5FPKA 1GQFA 1L7OA 3N2LA 1IC6A 2XTAA 4BKOA 4WBXC 4LC1A 1T91A 1KI8A 2JCXA 4I81A 3TLCA 2GK3A 2H4YA 2HHCA 2PUWA 3GVPA 2EF1A 3KHTA 2C20A 1CPYA 5DTRA 2EWWA 3GGSA 3RVNA 2QNBA 1UJ6A 2HA6A 4LUCA 5F5LA 1YDGA 2CHFA 2GZ1A 4Z9FA 2AMFA 2G9ZA 2WG1A 1REQA 4D9CA 4DUZB 4TWZA 2R4UA 4CTJA 1J9ZA 3KZNA 5BUZA 2P7HA 2PUGA 2R5NA 2C9BA 4K46A 5TGTA 2JFYA 4GT1A 2AUNA 3CPJB 2F8MA 2F8TA 1XAHA 4E2YA 1ODFA 1NLUA 4AZTA 2L18A 1EDBA 1Y42X 2YY5A 2ZIGA 4H6PA 3H1EA 4JA0A 4KFRA 2XA9A 1V7ZA 5K7SA 3NR2A 3ICOA 3V42A 2F9LA 2FJPA 5IBQA 1W19A 1P81A 1QPZA 4UUQA 2AG5A 5A9TA 4HLNA 5JECA 2YHIA 1WMFA 3CISA 4LOKA 2J9XB 3M7IA 1G8JA 3HZRA 4ZRMA 1VQ1A 5FPSA 1HGXA 1Q2XA 2YNMA 3E2MA 4N9WA 2QUHA 3CB4A 2GDJA 4CG3A 1UP7A 3ABOB 3BXOA 4LE1A 4ENUA 2HWKA 2GS9A 2P6NA 4Z53A 3T1TA 4KYUA 3ETHA 3LY9A 5ICMA 1Q11A 1S96A 2PSSA 2RIRA 2AR0A 2P41A 3AM5A 3AEKA 4JOBA 1MHTA 4EG5A 1TMGE 3NTLA 5LQMA 2EC5A 2BLNA 2YMMA 5COQA 4CM9A 2IUSA 3EZXA 5CB8A 1R0SA 1MW9X 4WLEA 1NG1A 3SQXA 1EX9A 2GPNA 3Q2KA 5KX5F 5TNXA 1YQTA 1KERA 3IR5A 2QG6A 1M2HA 1KY4A 3C39A 3M34A 3LFHA 2QBYB 4IHQA 4DM4A 1A27A 3GPDG 4M88A 1DKUA 2XXAA 4CQMB 3MWDA 5BSMA 2IOFA 2N42A 3BC1A 1I9CA 4QFDA 4QLAA 1RXSA 3WDSA 3IH5A 1ZH0A 2WJ6A 1Q22A 2ZRMA 3WAJA 3L02A 1JSXA 4JROA 4L85A 1SA0B 1PK9A 4HNTA 5ESWA 3RC7A 2P4QA 3KD2A 4N54A 4OV6B 1U90A 1NMEA 4FYJA 4CKWB 5JATA 3CZAA 5CDTA 3HHEA 1RQPA 3C1AA 4KN6A 1BGWA 5T3YA 1NOKA 2C3YA 4PN3A 1FL9A 1Z8FA 2FK7A 4TTIA 1KORA 1KH1A 1MFPA 4YDHB 1WZIA 5DULA 3SSAA 3AKDA 5IYZF 1HWYA 3NGXA 4WN9A 1LF5A 1LDGA 3K8YA 1UDAA 5CB4B 1WB9A 2J0EA 5KAMA 3SGLA 4P86A 1Q0ZA 3X1XA 2Z4SA 3KTFA 2WVJA 1JVBA 3BA1A 3IPCA 4HMOA 4JHXA 2BDEA 3KFVA 4EECA 2ZAYA 3HYLA 1NWCA 1Z7EA 1NHGA 4JMPA 4QOGA 3BQMB 1NQOA 1ZHHA 5T64A 4HDCA 4D5GA 2J33A 1SC3A 3SMQA 5HZGA 2ALJA 4C7KA 4ENTA 4JNCA 1TA9A 4PLPA 3T7CA 2FPSA 2E18A 4PZAA 5D87A 5BMOA 2FG7C 2QPAA 3TTXA 3PNKA 4WFJA 4LDQA 4D9FA 4JK3A 4AN0A 4ETMA 1CDOA 3C85A 5L7WA 3U1VA 1T2DA 4KGZA 4AWXA 3CH4B 4MQLA 3FWKA 5TS3A 3KAQA 5HP4A 1UPFA 2FW9A 3DV0A 1LQTA 2O1SA 3TPFA 3ROPA 2O8DA 3VU1A 1VP9A 2HQSA 1WXEA 1E7YA 3GGCA 4J7CA 1NRWA 4RPJA 1PNQA 5DYGA 2RG1A 4E1BA 3D5QA 3G5AA 4W1RA 3TBHA 4JZYA 1NKVA 1BXRA 3C74A 4EYQA 4QYWA 4D41A 2FFQA 1M5UA 1HYHA 2J7PA 4BGVA 1OMOA 3NAGA 4L76A 4HN4B 2IPNA 5ALYA 1IMOA 4EY8A 3OEHA 1A4XA 1FP4B 2I4OA 3C43A 4R4JA 3RBXA 2R00C 1KDRA 5FR2A 2PX0A 2HCRA 4F4JA 2J4DA 2QM0A 4CF7A 9ATCA 4FFPA 4IH1A 4OSPA 4D46A 4KNWA 2Q49A 4RTPA 4RLHA 2YIDA 3K6JA 2F4VB 4CMEA 4BV2A 2DHCA 3TL2A 1TTPB 4MV0A 1AMUA 4DJEC 2ZUWA 3P0RA 4EHIA 1QH8B 4H9GA 3FDXA 2JD2A 5JYDA 1BDMA 2BWJA 4LYHA 2TECE 4DYHA 1SHKA 4CLOA 1ZIYA 4RADA 1T1SA 2ILVA 3LGAA 4RTJA 3W5DA 3MTAA 2Q1SA 4OQEA 3A1NA 2XECA 3NS7A 4FSDA 3EE6A 1ZN7A 2ACVA 2H0RA 4HDNB 3DE4X 4EPYA 4QATA 1I9GA 1X13A 4V02A 2A8YA 4J16C 5BSEA 1QE5A 1KNXA 1YMUA 3ETLA 3JVIA 1FRZA 2PL3A 1WUYA 4PSKA 1SUDA 3BJRA 3NJ8A 1ZU4A 4R5HA 5BNFA 2V7QA 5K0LA 4F5DA 5JH7A 4OKIA 2HO5A 3NKLA 3MVEA 1RQRA 4CJXA 3AIIA 3AEZA 1COWD 3EXHA 3D7MA 5EQDA 4ZCRA 4BQNA 2CVPA 3SNHA 4YT5A 4EELA 5IH7A 1E4OA 2P27A 4QUKA 2ZB7A 4K0RA 3BA6A 5HIAA 3R75A 4FFRA 1C7JA 2EW8A 4KE7A 4MEBA 4LJ5A 3GOHA 4QDUA 5AJUA 4I1PA 1VKJA 1Z82A 1OZ0A 1R0LA 4QU0A 1E5XA 3H5NA 5BW8A 4EA9A 2ZITA 5THKA 1C0EA 1X7ZA 1B4DA 2ZE7A 3PHLA 3PXGA 1PUIA 5JQGF 3OQIB 4BP8A 1RYNA 3CONA 3RSLA 2AGVA 2KB0A 4LSWA 4DXDA 4Z1MD 2J5XA 4JB8A 5A0FA 5BY2A 1UEIA 2PGJA 4Q3EA 4BO9A 2PH3A 2GN2A 2X76A 3MGGA 2J48A 4NDZA 4XFJA 1JYEA 3G2OA 4X41A 2Q5HA 3VNBA 3T15A 2AX3A 4QOEA 4WIAA 3QITA 2UYGA 4C0JA 1U0HC 3QUQA 3EF0A 1NGSA 1ZW1A 2HLDA 3PHGA 4GOXA 4J0HA 3K70C 4GBJA 3V4VB 1S8NA 2P0YA 1EUQA 1MHPA 4L4XA 5BYKA 3W5AA 3M81A 4M37A 1R64A 3SC2A 1L7XA 4AQ7A 3L7BA 4QU8A 3EQ8A 5CAEB 3G68A 5KYNA 1GA6A 3DAHA 3R7BA 3ABQB 2W2OA 1QCZA 2R6CA 4JVLA 1CR1A 1NYTA 1R9GA 1UOQA 4NPCA 2RCYA 1JIQA 2R6DA 3AFOA 3NYRA 4L22A 4R8LA 3W2IA 4EF4A 5JCPA 1S1CA 4BBJA 4IIXA 3WJAA 5AHKA 4RO0A 3K4PA 4K3VA 4MVJD 5CX1B 4OAOA 4WHMA 4JQCA 4QYIB 1DJQA 5KJ6A 1E9CA 2OHJA 3IV9A 4J7UA 3HU5A 1SBQA 4R3UC 5DEOA 3WGOA 1KP3A 2ACEA 2EF0A 2J5KA 2WWTA 2ZWVA 3GEMA 1GQSA 3LWDA 3M9WA 3QENA 1QV9A 3WLIA 4CMCA 3NGMA 5FJIA 4WI1A 5JD5A 2D1QA 3PHJA 3I09A 2Q4TA 1T24A 2O3JA 3GMDA 1DFGA 4GZLA 3BCUA 2GCOA 1BXKA 2W6JA 1I4OA 4NZ9A 5IAKA 2GNOA 2P65A 1LK7A 5M3BA 1IM8A 4BUZA 3V2UA 2QMHA 5LBIA 4AVYA 2PBZA 2JLRA 1N4AA 5AI9A 4MDFA 1R6VA 3V8EA 3G7UA 1SXJE 5FOVA 2DGDA 2EBWA 1X38A 2I4TA 3FPEA 5FHQA 5I3CA 5KTPA 4C6HA 3BK7A 1SUIA 3TUZC 1Y5NA 2Y4NA 4WVFA 4KAAA 1DS6A 4Q37A 3HVUA 3VTKA 1QKIA 2ZUFA 4PFSA 2IL1A 3K35A 5FB3A 2Q8PA 4JZKA 1AM4D 4B4DA 3Q7TA 1TKAA 2CYAA 2XR1A 3D9QX 1YCGA 1OLSA 4U6QA 2UZAA 3COVA 4C4RA 3E3MA 4KQHA 1RI1A 4HDQB 3HUEA 3D4OA 1LPSA 4YQZA 3GEHA 3AFIA 2P40A 1HLFA 3D1JA 1P5HA 3R0VA 1A2KC 5JNTA 9ABPA 1L3BA 4I5FA 5AM0A 1OHHA 5DF1A 1Y8QA 2JFQA 3WL4A 4UZEA 5I47A 1ZGBA 1EFUA 4A6XA 1RAGA 2GBLA 2BSQA 4LFBB 1E6LA 3QUAA 3B6EA 4MUXA 2A1IA 2XQVA 5JSYA 1QP0A 1XO1A 1Q0SA 4R8SA 3ZKAA 4XIFA 4COKA 4R1MA 4UNIA 4X7RA 1D8AA 5HW0A 2QNIA 3B2NA 1ORTA 2AFHE 3F2IA 3WGKA 2P6PA 4HN9A 3RT1A 1OXXK 2NZ8A 3AOEC 4FW8A 4JC8A 4GQBA 3FVTA 4LJ6A 2O20A 5DBFA 1T8SA 4IHJB 2O3SA 3GLHA 3PXCX 1G3QA 2EJBA 1Z34A 5BR4A 1LJ8A 3QVVA 2WVHA 2JBHA 3SI7A 4NU5A 3COSA 5IG2A 3QWIA 4P4GA 3RIHA 3GT4A 1PK7A 3HP4A 3SFZA 2IIPA 4ZTUB 2XCSB 2Z09A 5JWHA 1H0HA 4C5CA 2O8CB 4IIJA 1KJJA 4RTOA 4A5SA 4XVRA 3UJ3X 3A06A 2UXCB 5K20A 4DLXA 4HUQB 4IQGA 1XEFA 2VXCA 4ZVUA 3ZVNA 2ZCUA 1TOAA 2OAEA 3VKWA 3ZUPA 1VOTA 4EQZA 3VHXA 2BTOA 2IIBA 2Q3LA 1HFEL 4LOIA 5EJGA 5BN4B 4RKRA 4D02A 3GP3A 1FUEA 1WWKA 2X9VA 4QNNA 4ZOLB 2B4QA 3A11A 4B8YA 3PWKA 3REQA 3DE5X 2LTAA 3SZGA 4ZQBA 2RGNC 1ESEA 4OPMA 3FPSA 3W9YA 1YC5A 4MUBA 4UJ5A 2BD0A 3L8FA 1NI3A 3YASA 2Z3ZA 3IUEA 4F86A 1TUBA 3RSGA 3RVOA 1UFVA 2OORA 5BQXA 1SVLA 2OK7A 5F1YA 3EEYA 1O87A 4F12A 5IJAA 3ZBUA 1V39A 2KHZA 1CQZA 5F78A 2M6KA 3D0KA 4AZ3B 3AJDA 1KU0A 4E70A 5HF8A 4V0RA 1U2QA 2N3ZA 1GCIA 4RJJA 3AT1A 1C7IA 5T3UA 3OKAA 3SYNA 5H4GA 1MB2A 1W76A 4LF8B 1JEEA 5T4FA 4D82A 4H18A 1JKJA 4F2PA 4O4HA 4U7TB 4DCSA 1ADCA 2JA2A 2Z1MA 2H9AA 5G02A 4HEHA 1KHTA 2CDCA 2EFHB 5JD3A 1KEEA 1QDUA 3EBOA 4R9SA 2LE0A 5JRDS 3OOWA 1H6DA 3AEXA 4UVEA 3ZBQA 4MRMB 1TGVA 3VR2A 4EBFA 5B4UA 3KQNA 4KUGA 2XDAA 2OGZA 4AX4A 4YT8A 3QBEA 1XZGA 1ZL2A 3FPHA 1DEHA 2HEIA 2GD1O 2YWEA 2GFHA 2QN2A 3WIVA 5EIXA 2C3MA 4Z5XA 4Q3KA 1CQIB 1U81A 4F93B 3JZFA 3ZS9A 4UBKA 1H9BA 3PTLA 1FP2A 4XQ9A 3GUVA 4OKNA 2RSLA 4MVJA 3HVJA 2DWOA 1K0UA 5AVVA 5KWJA 1PLKA 3DVQX 3L6BA 4Y6OA 4RTKA 2CLEB 4KIUA 1T9CA 1UBFA 4L8VA 1XTZA 4XM2A 4K88A 4NMXB 4HS4A 3HN6A 1CUXA 3IBGA 4E5VA 4IRXA 1G98A 2D0OB 3QFSA 2J5RA 4TL9A 2IHNA 2YRWA 2Y2UA 1TYAE 4TYPA 3B38A 4B09A 1EXVA 1EKXA 3S29A 4QUBA 4YROA 4OK5A 4BFLA 3OTIA 3H5TA 3HM9A 4YWJA 3ER8A 1VGQA 4FW9A 1RQLA 3QF4A 4UE2A 4NC9A 1RXWA 3BRQA 2G4LA 2P2SA 3UMVA 1X19A 1DUVG 1QYWA 2P30A 3U4MA 1NBMD 3EA5A 1ZGAA 3IIKA 2B3DA 3G2IA 3S68A 4B2YA 1JJAA 4BGUA 3CO5A 2DG2A 3ZHTA 1I4TD 3I9V1 4CIDA 2CCGA 3EVTA 4A15A 4N0EA 2Q50A 2GZAA 3GQBB 1G8FA 3RRYA 1MENA 2BHNA 3RSOA 5C7IO 1NQXA 3G2JA 3MWGA 3OOHA 1GP2A 5JG7A 2ZSAA 1IY9A 1LLCA 3GJ0A 4B2IA 3I0NA 5FORA 4PX9A 4C78A 3EEOA 4JXZA 1XTIA 3DTNA 5A7HA 1KYWA 2KBEA 3MJVA 2YJTD 3T7EA 3OLYA 4HQ6A 2YDYA 3S99A 1N34B 2AZTA 2ZS9A 3ECCA 3I8OA 4LCBA 3LSTA 4HZGA 1KOFA 2W8BA 5G0WA 2H85A 3WKAA 5JPDA 4BCBA 1AQJA 4A16A 1WKBA 2GF0A 1FVHA 5FOUA 2BGRA 4DSTA 1KMHB 4OH7A 1U5BB 3L82B 1FSFA 1JAYA 4OFXA 3DNFA 3ZKWB 3A6EA 2ZT7A 3O38A 1KKLA 5IWAB 4F3TA 1UANA 2W6QA 2PU7A 2XDYA 1NPYA 4PCAA 2HK9A 3SKYA 3M4NA 4YUWA 1RACA 5IXSA 1WA5A 1P7VA 4OYHA 2PO7A 4TXJA 3AONB 1D09A 4RHCA 3V6LA 3UA4A 1J90A 1TDJA 4BNJA 3O90A 1UL1X 4YGXB 1ZEJA 3V4FA 3F3MA 4TYQA 4P5EA 4MPPA 1DKOA 2AJCA 3LBFA 5SYMA 2JCBA 4RFSA 4EQ6B 3DLHA 1GYPA 3GYGA 1KOGA 1OREA 1VI2A 4M7RA 4TKUB 1RQ7A 1H2AS 5AK6A 5CA1A 1FP6A 1Z25A 3I01M 4NI5A 4NNPA 4UAJA 3FG9A 3WIBA 5HVNA 3MPOA 1P0FA 4BU0A 2EKPA 3KS9A 3L4BC 3RWOA 4F3RA 1VLJA 4FR2A 1WS6A 3CRW1 2DTEA 1Q7EA 2GTHA 3GC6A 3ET5A 4GX5A 2I6TA 4AIIA 2QRLA 1Z68A 1XTTA 2PKEA 1QO0D 1XTKA 3AIOA 4KR6A 4N01A 1QGAA 1T1GA 3RSFA 4DV6B 3HCNA 4HFNA 1UOPA 2FEWB 4RK4A 5B1SA 2CV0A 4HYYA 2BOVA 3NBYC 3NDRA 3BJMA 5M34A 1CKEA 3HJNA 2QP3A 2R3SA 2ZJ4A 2ZWIA 3GCZA 3I28A 1FC0A 1XWFA 2VYVD 3E6AA 1XEWX 4TMZA 4YDRA 3VOAA 3UV6A 1L4HA 2AOTA 3AR2A 4ZOLF 4ZQFA 1ZL0A 3LI2A 4ZDKA 1GUZA 2VYFA 4MS1A 4QYMA 4O08A 5F73A 1UZUA 4OXXA 3GDHA 1EB9A 1EK6A 3DBHA 1U7WA 2J8ZA 5EL0A 3TCKA 1QQAA 4G6ZA 2ZJOA 4UHFA 3PCXA 3RVLA 2B4RO 4U7FA 3R8CA 1KY2A 2IP2A 1B2RA 1ENYA 1Y6JA 4TVKA 4UUPA 4Z0TA 2IZ7A 4CKCB 1LV8A 3JSAA 4CM7A 1NYLA 2VIIA 1L1EA 4JFRA 2EKZA 3I76A 2FE1A 2ZIFA 5FFFA 3CN9A 1LSSA 3RUIA 2X86A 7MHTA 3DL0A 3U09A 1LI7A 5ESXA 3OFND 1RHKA 1VMKA 2YHIB 1JEDA 3SYKA 6AT1A 1D5WA 1PHRA 4IYJA 1MC8A 4R81A 2AI3A 2BJWA 2PKQP 2VDNB 3I2GA 3H7IA 2NUTA 3S1SA 3L4SO 4OI2A 1GPMA 1A8HA 2BT4A 2CW5A 1ZA2A 3O3OB 3HYCA 1YOVB 2GZSA 4HAZA 4MQEB 5FOWA 1BWPA 2FEMA 4FBLA 5L3QA 2HHHB 4G4SO 4YQYA 1X0XA 4YJ3B 3LLSA 2AZXA 3DYIA 2F1RA 3FWZA 2XMRA 1AGPA 2M98A 2YS7A 1OTXA 4R8KA 4AJPA 1I0ZA 1QLHA 1U3DA 1VJGA 1MABB 1W30A 2P4EA 5G4LA 3UATA 3V7YA 4YT4A 1NR5A 2GPJA 1WTCA 3H04A 4CMEC 3A6PC 1W46A 4N48A 1GNRA 4J90A 1ELOA 1ADGA 2IOFK 2H6EA 3M6VA 1V96A 1O8BA 2W0MA 2OC9A 4FNAA 1O0SA 1ZZEA 5T41A 2NVWA 2ZBEA 3KNZA 5IU6A 2AMLA 3TOSA 3A1SA 4JI2B 1EESA 1NHWA 1T4CB 1QQ6A 1M2VA 2GBCA 4QQNA 2P1RA 3DNMA 3NOVA 4UPVA 5FBLB 1X86B 4K6OA 5KB3A 3HZOA 1FS6A 1JE1A 3MSXA 2O54A 8LDHA 3D6HA 2XDQA 4G37A 4BYMA 3X1DA 4BVKA 4YONB 2ZI9A 4IY1A 5A3JA 5K0CA 1UKCA 1T3SA 3DEFA 3FLAA 3JQ6A 4QREA 1N8TA 3GAMA 2FQXA 5AJZA 1GR0A 1QS0B 3INNA 4RDIA 2GBIA 4IDAA 2AYXA 1VFPA 4ZAVA 1T5OA 5KSZA 4J4TA 2PKQO 2ZR0A 4U5QA 3IP3A 4HK4A 2VN8A 4J9VA 5EAIA 5FWNA 2W42A 2VI5A 3HNOA 1JT9A 5HQ3B 1UBJS 3U4IA 4B74A 3TFOA 1TMKA 4V0KA 1H93A 4ZO6A 3ZDXB 1LPAB 1C1XA 1XCJA 3BMQA 3WNBA 1QIGA 1KZ7B 1SZDA 2YNMD 3HJGA 5K3FB 1XNJA 3OX3A 4MS3B 3HXMA 3PNQA 1UK6A 5E7JA 3ICQB 1Q21A 1GAXA 2TSYB 3F2VA 3P4UA 1KR2A 3TD9A 2Y3IA 5KTSA 5D84A 4EHDA 3EPHA 1Z2NX 4ZOQI 3B6MA 3P9CA 3B7WA 4F2DA 2PWAA 3RQIA 3WHKA 4MWSA 2V54A 3RODA 4W5NA 3HU2A 3CX4A 4AY3A 4NCAA 2YINC 4NENA 5ALGA 1BS1A 3WDKA 4X85A 1N2GA 3LQ2A 1YZTA 5EQJB 4OHUA 3T9BA 1MMFB 4PFJA 4Y7DA 4DADA 1RKXA 1JAXA 4MUMA 3CX6A 1X8XA 2QQGA 5TXGA 4LHZA 3PI6A 4P36A 3ZIUA 4IVQA 4YYEA 1P4AA 3WXMA 4YCJA 5KOHB 1NVMB 2GJKA 2WNHA 4XIJA 3BD6A 4DEXA 5G4KA 1GNTA 3PFGA 5G0UA 3KAJA 1LS6A 1KJQA 4ZZ3A 2NPIA 1QJCA 2XXJA 2Q9CA 1HT1E 2VPQA 3L7CA 1H2HA 3NALA 4EHKA 2XKKA 4J0CA 3Q7EA 2EL7A 3T8YA 4ZTZB 1YR9A 3EG9A 1M6EX 1ZJWA 3O31A 4YMGA 5JC8A 1T3TA 1D4OA 1KZ4A 1C0LA 1XZLA 2ZBDA 1S0UA 4KVGA 5KEIA 5LD2B 1LH0A 2OWDA 4IO0A 5H7XA 1BTOA 1L8LA 4MK4A 1Z37A 2IUTA 1E2GA 3FHTA 3OEEA 4Y8VA 4BMYA 1R0KA 3EN0A 3K71B 3LF2A 2J3JA 3IILA 1AKQA 2Y92A 1O6BA 2WAYA 4PS1A 4ND6A 1AMNA 2HNKA 2FRVA 5DHUA 3NYQA 1NONA 1U8XX 4MGHA 1IG3A 1GM5A 1Q0HA 1BU8A 1FLNA 1HT2E 2QZZA 2WC1A 3E8XA 3KYDA 4LQCA 4ZGGA 2OILA 4K9OA 4GICA 4EG6A 2GJ4A 1GRRA 4Z7OB 2C04A 2MSCB 3DHWC 4G1MB 2B69A 4FLFA 3IDOA 3E58A 5U9CA 3W6OA 4X5OA 1IBLB 3UBTA 3UV3A 3LP8A 1JPNA 4IGAA 1NQTA 1XMPA 4H4CA 4EUNA 2JFGA 4RIHA 1MTOA 5KYWA 4EUSA 1JKJB 3G8YA 4DV1B 2EP8A 3M0EA 1LRLA 3JYQA 2V7PA 1BCSA 1QP4A 1XT6A 3BX1A 3QYAA 3RAGA 4V0SA 2PUDA 1OLUB 1T9AA 3IV6A 4IFIA 4UUAA 4DCTA 2HY7A 3JQBA 1IHYA 4QPZA 4YRPA 3L41A 4P80A 5BYBA 1AGRA 3TRKA 2LD4A 1NTRA 2BMFA 1VRCA 4UEJA 1U4OA 4AJHA 4LZOA 4YDQA 2D7JA 3P0JA 3VR0A 2VAXA 3CLUD 4LOAA 4JL8A 5TQ0A 4Z4EA 3QPVA 1V8OA 4O1MA 4OLJA 4PSUA 2AIRA 3EVZA 4EY3A 3PHBE 5A6VA 2Z57A 5C34B 2IY8A 4DCNA 1VBMA 3HCDA 3I2IA 1UQRA 1DFHA 4O4LF 1JG2A 4XEUA 4ODIA 3RVMA 3VHXB 3PC3A 1PNVA 2PKXA 2ZVQX 1I5RA 3H5IA 3O4FA 5IF9A 2FZWA 5TJ9A 4YJGB 4GEGA 4MKHA 4EMTA 3W5UA 5J4YA 3H9JA 2RI1A 3WQHA 1CJVC 3DBOB 2ZIZA 3N3AC 4TSFD 2VWHA 4X54A 4IL5A 3THOA 1U0SY 2XRYA 4REQA 4E6PA 1WKVA 4LSZA 5CH8A 3TCNA 3AHCA 4DRXB 2FLKA 1C1DA 3NTRA 4LHWA 1P77A 4M7PA 3SJUA 4B3XA 2O2GA 1TUBB 5CLFA 1I32A 4ZCSA 3VBCA 2J31A 3KPYA 4G0UA 4JOQA 3T34A 1YZQA 3H16A 3WGTA 3X1WA 2JIBA 3L3BA 4S2EA 3OQBA 3B53X 4CQMA 2ZULA 2O19A 4WOPA 2DWUA 1IYZA 2PUVA 2PX4A 2BZ0A 2V4UA 4L8WB 4L51A 4XYMA 5JXGA 2XWSA 1HPLA 1RWOA 1YR8A 2WMDA 1J24A 3DXXA 3HXKA 3P2MA 2XOKA 1GNQA 2WAOA 3HXPA 1EJ2A 1GXSB 2H1FA 1RRMA 1EX7A 1HF3A 1VJCA 2D8AA 3KV3O 4RH0A 2IYOA 2IZ6A 3VR4A 2HH9A 3PUYA 1N2CB 2AK2A 4IMRA 4CKWA 1RPZA 1L5RA 2P4UA 3T3OA 2WIJA 1NPTO 2VOEA 4F97A 2CF6A 2ZR8A 1VHJA 1GTG1 3DOIA 4C7JA 1I0LA 2Q5LA 5A5DA 4F6RA 1PWHA 2FOXA 4BFYA 3HMKA 3NIDB 4A92A 2HAEA 3F6RA 1OYVA 3HO8A 1PG2A 4YCDA 1YDEA 5AKXA 1ZI9A 3L7YA 4ZJZA 2H9YA 5M5BA 5IMSA 1BE1A 1JQLB 2EERA 3HU3A 3RFTA 1P5FA 3WL6A 2HCJB 4ENRA 1DKMA 2CZCA 2O0LA 4RVNA 3TAXA 3WRXC 6ABPA 1NOIA 1RCFA 1TQHA 3NTQA 1QF6A 3WYDA 4DVGA 1VBNA 2NV0A 2RAFA 3CJQA 1ZRNA 5B3LA 2BIFA 1N7IA 5BQ3A 2OQ2A 4DR1B 2GPYA 4CL8A 2W2MA 3CRVA 1DQYA 3DT9A 3PQFA 3LGSA 2CK3A 1OX6A 2P6UA 4BU1A 1B8NA 1U2RA 4FEAA 4XOIA 1HNNA 1HDZA 3R6WA 3RFFA 3KJNA 4IAOA 4K9DA 2Z4TA 4HDRA 4FNMA 5F4ZA 1UJMA 3DO5A 4N0QA 1IL0A 4QBIA 1PVDA 4QO8A 4UAGA 5AKIA 4ONEA 4NBVA 5KCMA 4MIKA 1XCBA 5J9FA 3I2YX 4D6PA 3JAMA 4PX3A 2CSUA 4D8UA 2A5GA 2ATXA 5HK9A 1B8UA 2ADMA 2GPBA 2PR2A 3R2JA 1T26A 3BL6A 4HDKB 3FFAA 3HE3A 1FUUA 2BI7A 3J7TA 3ESAA 1BX3A 3GG2A 4QEDA 4FNGA 4X8HA 2IHJA 4CV0A 1XDGA 3ZU2A 3GU3A 4N5LA 3ZR4B 1Y9DA 2FZEA 1YCHA 1ZWLA 4C7OA 1LBHA 1J97A 2IUEA 3LT2A 1JHDA 1U80A 4RPKA 1NV9A 3A3PA 2V0GA 3KOXA 4BX8A 2GZ2A 3EZNA 1CU1A 4IJ5A 4ALLA 2IS4A 1FNCA 3U26A 2Z1DA 3UMGA 2EIHA 3ZOZA 3LRXA 4CHGA 4BNTA 5JTUA 3H2KA 2FJUA 2PT6A 4S12A 2WE7A 5DTJA 4QU5A 5K3BA 2WA1A 1RWXA 2O57A 3C3MA 3LV8A 4PG8A 1OBHA 5EEHA 3ZY4A 1KIAA 4IIUA 3T3MB 2G1JA 4XGNA 4NCXA 1XMIA 1A98A 4PE5B 3NUQA 3UHAA 4NOJA 3D2AA 4BNZA 5JSUA 2G8NA 2A9VA 4IIHA 1G21A 2JFOA 1P2UA 1LQ2A 2XWPA 3OPMA 4UVIA 5JI2E 2Q7DA 3N1UA 1G5HA 4ANFA 1ENOA 2H92A 2BBTA 4BZQA 1XMOB 3LLVA 1IAVA 3OZDA 4PHFA 1OFVA 4C9BA 3TLAA 1K86A 2W6IA 2BZSA 2QHXA 5EUBA 2HFKA 1Y1RA 1MAWA 4EI8A 1Z45A 1E2JA 5IK2D 1KI7A 3KSRA 2AFIB 5J5CA 2B1GA 1QFMA 2HU7A 4RS3A 3RR2A 5BP7A 3ZX4A 1PFVA 2W2KA 3E7PA 4GXTA 4ZVLA 4CKEA 4Z4HA 5FD8A 3L6RA 2JFUA 3BF7A 3O9ZA 4WBNB 1KAEA 3V2IA 2FP4A 1Y6QA 4EK9A 4YRJA 1SCNE 3HY3A 3JQRA 2PRJA 3GJ3A 1F8YA 1LI4A 2AFVA 3ZDDA 3ZI0A 1KY3A 4AKIA 4M60A 2ZJ1A 2JASA 3HY4A 4O4IB 5BMVA 3ZXXA 2OBNA 3BE6A 3A9CA 4UM7A 1BEUB 3B5IA 5K8UA 2RBEA 1SQGA 1ZI6A 1GZDA 2BGNA 2HGSA 3A0RB 3C8DA 4CM8B 2WOOA 1GSHA 4YRQA 4EENA 5E3IA 3E3LA 1MLDA 1RWNA 1JI3A 3Q88A 4LNUB 1ESDA 4Z8YA 3ZHUA 5TQVA 1FW6A 1YR1A 1E3TA 4KR2A 2PVSA 3C8MA 1T25A 1RDFA 4ZAGA 3DP9A 3QMVA 4J1NA 1GZ4A 2PQMA 1NG9A 1LU9A 1ML3A 2VQDA 2X42A 3C6ZA 2RMKA 3E22A 3K4QA 3JR3A 3QG1A 4E21A 5MN6A 3GBPA 1LLQA 3G5MA 1DV2A 1O2DA 3OCVA 1EVKA 5HJ2A 1LDBA 4C7MA 4WZ6A 3L6EA 3FTPA 1E1RA 3B7PA 3Q41A 4OI1A 7AT1A 4D3SA 2WU0A 4CTOA 2PUTA 3BN3A 5JPIA 4Q1CA 4G1FA 3X3HA 2VYND 1KRWA 3QA9A 3OUTA 4O6VA 4DCGA 2DFKB 4ES6A 2ZIUB 5JVDA 5KQGA 3SPXA 3LUKA 3GLGB 1C9MA 3PDIA 3HCOA 2VUSA 1E1CA 2B7CA 2BP7B 3HCPA 3NIWA 4X7PA 4BQRA 3Q3HA 3W04A 2OFWA 2JHCA 2QWXA 3DE1X 3I3SR 3IS3A 1KFJB 4AUKA 1QGYA 1VLLA 5K8IA 5LM3A 3AJ8A 3EFBA 3LCUA 4FD2A 1JQ5A 2F9MA 3HJHA 4K26A 4KQ1A 3KCNA 4MRSA 4FDAA 2VQEB 3FTFA 3CS3A 4Q3OA 1XD2A 4UE6A 3PITA 4PXAA 2F90A 4HVTA 1SKMA 3U6KA 3JAKB 1POWA 4O2BA 1X7WB 2OLJA 5M04A 2IYQA 1XMXA 1AE1A 3KXLA 2II6A 3GBSA 2H5JA 3IAUA 3L0CA 4LJ4A 3SS7X 5T7BA 2P91A 4ABTA 5KHOC 2BMDA 3IP8A 3LCJA 3LG2A 4JV5B 1UZMA 3DW1X 2FVXA 1B76A 2BHLA 3PUHA 1QTNA 1QZUA 1IDN1 3PEWA 2XNKA 3QYPA 2FZGA 3BERA 4M9XA 4L16A 1GTRA 3CIFA 3Q40A 3KZXA 5TJHA 4DDVA 5C4IA 4XX0A 5C0OE