2AA3A

Crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 115
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aa3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2aa3A02
4ZRNA 1ZMTA 2G17A 3C24A 3E1KA 4WOKA 1B26A 1UXIA 1EFKA 2O7SA 3HNPA 4E5MA 1P45A 1EQ2A 1I0ZA 1U9JA 1YBAA 2TMGA 3F46A 3L6OO 3MJCA 4J7XA 3VTFA 1R6DA 1SPXA 4CR6A 4O0LA 4U0JA 3D4NA 1PL7A 1SB9A 5BSFA 4NZ9A 1ADFA 1H6DA 4CMKA 1NR7A 1QYVA 1ZZEA 3CUKA 4BNJA 2NTNA 3NRCA 1C0PA 3PJEA 4AJJA 1VKOA 1HYGA 4ITUA 1TB4A 4HXYA 4PGFA 2DBRA 3GT0A 3JCZA 1CETA 4QXMA 3D4PA 4IXWA 2LDXA 2ZIZA 4FD3A 2DLDA 3DFZA 2NADA 2DFVA 1OBFO 4IDGA 4I9NA 1PSDA 2W2LD 3BTUA 4L0QA 3VZRA 4OQZA 1R37A 4Z0TA 3V1TC 3PP8A 3KVOA 3JQDA 4JROA 4G81A 4ZRMA 1WLYA 4YJFB 3C7DB 5CFZA 1IYZA 2WD8A 1JQBA 3IIEA 5G2OA 4FIZA 1B7GO 1T4DA 4F46A 5JYEA 5DF1A 1LXCA 1PU2A 2LDBA 4II2A 3DBLA 1NFFA 4YQYA 4XQ9A 1H6CA 4EJ0A 4CMEC 1TXGA 2EG9A 3G79A 4CMJA 1EK5A 2VWQA 3D3WB 1Y9AA 2J3IA 4IDCA 2B69A 2PFGA 1DDOA 3WFIA 4E6PA 3AU8A 4WECA 3L6EA 1LA2A 3Q6IA 2GO1A 3IOYA 4DYDA 5CEEA 3JQAD 3ZW8A 1P33A 4CLEA 3QSGA 3U4HA 3ORFA 4D79A 3RSHA 2OP0A 4NG5A 2B5VA 4IJVA 4BUCA 3AUUA 1ZKMA 3FSRA 2VYVD 1EVYA 5F21A 3WQRA 3UICA 3ZWBA 2B4TO 3RASA 4BS9A 1M75A 5K6AC 1ISIA 2I76A 5LC1A 3AUTA 5JSFA 4PG6A 1QV7A 2POQX 4YJDA 4XYMA 1UP7A 2PGJA 3LT1A 2EERA 1S7CA 3QVOA 5C7IO 3OEYA 3C1TA 5JY1A 1HDXA 5T8KC 5B4UA 3IJPA 1GCUA 1P1FA 2W2KA 4XGKA 5TSDA 3U62A 3HJAA 4OL9A 3KHUA 3I9NA 3WMXA 5HBRA 2W2LA 1DLJA 5CPBA 3MEQA 5ENDA 3UXYA 4RLHA 4XYEA 3IL2A 3H5RA 1PS0A 1X0VA 4FGWA 4W82A 1N7GA 5JMWA 4ALIA 1DJQA 1D7OA 4BGEA 3K73O 4ZQBA 4UVIA 3H5NA 3OF2A 3U09A 1Q1NA 3V1UA 1UH5A 4DMLA 2FOIA 2VHYA 3RJ9A 4MP8A 3PXXA 3U4CA 5GZ1A 1DB3A 3OJOA 5A06A 5A4DA 4IS3A 1HT0A 3JYLA 4BNZA 4FGSA 3KTDA 4XQCA 4CQLA 2VRCA 4A27A 2OGUA 1GFSA 3HDHA 3GZNA 4DA9A 3MJSA 1XDWA 5L51A 3HUDA 1GZ6A 4RO0A 4WE3A 1GYRA 3IUPA 2B36A 3WWYA 5KWEA 1L7DA 4J1QA 4PLWA 5EIOA 3MZ0A 4F6LA 1LRKA 1Y81A 3K2BA 1KC3A 4BO9A 1HRDA 1N7HA 1PZGA 1AXGA 1AHIA 4NIMA 3C1OA 3RFTA 3RU7A 2G76A 2OBNA 1NVMB 1I32A 3S2GA 4R9SA 3P19A 3MWDB 5KJ1A 1LJ8A 1I30A 2DTDA 5ILGA 1C14A 4B3JA 5ER9A 4E5KA 3DBLB 1FDSA 1KEPA 4W6ZA 1PIWA 4LK3A 4CV0A 2V6BA 3NDIA 2IRWA 3CXRA 2RIRA 4NNJA 3GDOA 4DGSA 3ASVA 5DCWA 5KNLA 1LQTA 4PRKA 3WNQA 5JFOA 1DFGA 2FR8A 3PZBA 4RPLA 5U4QA 2YHIA 3GEDA 2G0TA 1BGVA 3RI3A 2X9NA 1H6AA 3PFFA 5EL0A 4WLOA 2I99A 4E33A 1XWFA 2BGKA 4U6QA 3JD3A 2O7QA 3OHSX 4U7WA 2O3TA 3ZWPA 2FR0A 2NVWA 2BGMA 2RCYA 2YFQA 4TWRA 4YAJA 1ZH8A 3LU1A 4Q3AA 1QLJA 2R2GA 1U7HA 4ND4A 5JNLA 4MKZA 4MKRA 2DPGA 3G1TA 5I7VA 4R5HA 2JD0A 1UDCA 2J3KA 4YT2A 1SBYA 3PHJA 4O6VA 4XDZA 5JE8A 4IZHA 5G0SA 3TWOA 2IYOA 2CNBA 3RKUA 3UVEA 3ROMA 3GN1A 1GD1O 3IKVA 3KYCA 4J1NA 3ZU2A 3P2OA 2P2SA 3PI7A 1WDLA 1E7RA 2DM6A 4XRRA 1J0XO 4EI2A 3WS7A 5DBFA 4L73A 3EVNA 3JQGB 4JXKA 3OQ1A 4ZQEA 1BXZA 2CD9A 1VE9A 2X9GA 3RQSA 1IZ0A 3ZNPA 3DFUA 3GLQA 4CL8A 3SC4A 4BNVA 3SVTA 4CLOA 3GZ4A 3DMYA 3MJTA 3H2SA 1XCBA 3WQSB 1EE9A 4IMPA 2EV9A 1UXKA 5FF9A 4INAA 4JX8A 4KUGA 3KO8A 3ZU4A 1N9GA 2VTDA 3VPXA 1H9AA 3VKVA 2NU7A 1DAPA 2FHSA 3JQEA 4HFMA 1PGNA 4JJFA 3SEFA 4LGVA 3PLRA 1A4UA 4ZD6A 3GZNB 4CMBA 5G4KA 3A14A 2X5OA 2H5LA 2QZZA 3OMLA 4J2HA 4CV2A 2AEJA 5EQDA 5IJZA 1DBVO 3GVIA 4O59O 2DKNA 3HN2A 4WK6A 1DXYA 3V2HA 4FC6A 3JD0A 1Y6JA 3ZNNA 5AXBA 1LLUA 5DDIP 1GR0A 3DOOA 3O8QA 2NTVA 1B16A 1EMDA 4WLVA 4IJKA 4YRBA 1EUCA 4E5PA 3ZWXA 1XHLA 1F17A 1E1NA 3EW7A 3GPDG 4JCOA 1PJTA 1QG6A 3LYLA 1R0KA 1ONNA 5IZCC 3AW9A 3H9QA 1IPFA 2PKRA 2PH5A 4ILKA 1VJTA 3KEQA 1FJHA 3GG2A 4IJUA 4XQEA 4TZTA 4P4GA 1X1TA 2O4CA 3HB4X 4AFNA 3PJFA 4EUFA 5CG2A 3NT2A 4NPCA 1T4BA 1HLPA 3H4VA 4GVLA 4R1UA 1PQUA 2HO5A 1FK8A 1P1IA 3FHLA 4DRYA 4ZGWA 1FDVA 1LSJA 3OM9A 1XG5A 4XJSA 2VZ8A 3GR6A 3ZNQA 3A1NA 5LDHA 3WGTA 1Z75A 1YQDA 4HBGA 2I65A 3C8MA 3NTOA 1HDYA 4AJLA 5JY6A 4U5QA 2WDZA 4AJPA 3KOUA 2H9IA 2X58A 3D1LA 3RD5A 3PHGA 5A05A 1SOVA 2UUPA 1SOWA 4J91A 1A9ZA 4UVGA 3KYCB 3NX4A 4ALKA 3TNLA 4B4WA 1CEQA 4E3ZA 3G0OA 4BO5A 2AQ8A 1I3LA 4JLWA 4CR7A 4MINA 1VC2A 2QZ9A 1LLDA 2X1HA 3NGLA 3V1YA 4BO4A 3ST7A 3NT5A 3H9UA 1MV8A 1F8FA 3I1JA 1G6KA 2J6IA 1YBMA 1CDOA 2C2YA 4Q3NA 4J90A 1E3WA 3T7CA 5CDUA 1SNYA 2OFPA 2BMAA 3K6JA 3F6YA 3NDRA 4BMNA 3RWBA 2CF5A 3L77A 3WXBA 3E82A 1JW9B 4ZHSA 1M6HA 1HE5A 3WSWA 4FQ8A 5G4KB 5J23A 2J5KA 2IXAA 3PRJA 2G82A 1E3IA 2I5PO 1EUZA 2O2SA 4OOEA 4PRLA 4TKLA 3TPCA 1XQ6A 2VT3A 3PGJA 4FPXA 3L9XA 4HNHA 5KIAA 3LZ6A 3WSVA 4CMAA 4JBGA 4YR9A 1CQIA 4MP3A 3KZVA 2OZPA 4F45A 1VL8A 1BWSA 1YS4A 3PYLA 3B70A 4RLSA 4CV1A 3LT2A 1HWYA 5TGDA 2UYYA 1Y9EA 1QV6A 4JGBA 1JAYA 1SO8A 1GY8A 4GPD1 3V8BA 2O2YA 1J6UA 5IFLA 4GSKA 3HG7A 1YVEI 2X7HA 2NU8A 2DT5A 1AHHA 1T2AA 2O50A 1PZFA 2RH4A 3N58A 4FBGA 4IGEA 3FTPA 3D7LA 4Q9NA 3GY0A 5KJFA 4WJZA 3I6IA 3FPLA 4R41A 1MGOA 4BKQA 4J9VA 2GZ1A 1JA9A 1BXKA 4CLHA 2GN4A 1YWGO 1T26A 3CSDA 4MVJG 4CLXA 2GERA 5T6BA 1X14A 2YFHA 3I4FA 1NHWA 2H63A 3FWNA 3DBRB 4U0KA 4Y6PA 2UV8A 1VJ0A 3UF0A 4DLAA 3UOGA 1PS9A 3O9ZA 5A5FA 1U3VA 3FNHA 3PGXA 1HDOA 3EZLA 1VKNA 1HE3A 1IHYA 3CZRA 3HE3A 2G1UA 3CZMA 4S1VA 3ROPA 3QVXA 1O94A 1X1EA 2C20A 1UZLA 3GA0A 1NVGA 1EEHA 4LCJA 1YKFA 4PLFA 1GUFA 4M55A 4I5FA 4AG3A 2Q46A 2VYND 4L74A 2WD7B 4ONEA 3D64A 3B1KA 4GWGA 4A0SA 2BH9A 1PQPA 4W7IA 1E0DA 3GNTA 2HJRA 3TDKA 5CDGA 1V3TA 2C82A 2EXXA 3F1KA 2JCVA 3U3XA 2FP4A 3INRA 1Q7GA 1XR3A 3LK7A 1TI7A 3AFNA 1PR9A 3F5SA 5JLAA 2ZB8A 1HDZA 4ZQGA 3SC6A 2VWPA 1P1RA 4GX5A 1F12A 1WXDA 1LDBA 5TT0A 3VDQA 2DVMA 1Y8RA 5A9SB 1B8PA 4CMGA 1ZIDA 4QTZA 4MJLA 3ASUA 1U2DA 3TL2A 2CDBA 1PX0A 2EF1A 3HADA 5JDIC 1RM3A 1JKFA 3GHYA 2GN8A 1LLCA 2VUTA 1DAOA 4IMRA 5T67A 5G0WA 1TT7A 3DHEA 1ENOA 2ZTUA 4GQAA 2NV6A 4TZKA 4WPGA 3S55A 2IZZA 3JQAB 1W6UA 4IIVA 4M49A 3GEGA 5ER6A 4W4TA 5DULA 3E9QA 2IE0A 4Y9DA 3GUYA 4UUPA 1I3KA 5ES3A 1Y8QB 4HADA 4XWYA 1SB8A 5AYVA 4DBZA 1UR5A 2HUNA 3KRTA 3W4KA 4YYZA 3ONFA 3S8MA 3OH8A 4OSPA 2O3QA 2WMDA 4OH1A 3WB9A 1XSEA 4CM3A 1PJQA 3COSA 1PZEA 4MIYA 8LDHA 3AI2A 2PLAA 2PZJA 1K6IA 2NUAA 1ZJYA 5A3VA 5HTOA 2PV7A 1HEUA 1RKXA 1CJCA 3DZKA 3PIDA 3F5QA 5HM8A 5L3ZA 3IAHA 1H6BA 3ZU5A 4RJTA 4CM5A 4AJOA 4BGUA 2WWRA 1CYDA 1E7YA 3DAGA 3E5RA 2UVDA 3DBRA 4NI5A 1JKIA 1LSUA 4DPMA 3S1LA 1X0XA 1O9BA 3DZBA 1NP3A 4IBOA 4NK5A 4UREA 4WCFC 5EQFA 2FMUA 3S2FA 1JN0A 5TJ9A 3GGOA 4CM4B 5JDCA 1Q7CA 2PZMA 2VUUA 1BMDA 5L45A 1ISFA 2PD4A 2Y1CA 3WWZA 5F1PA 3AM5A 3NTQA 3LF1A 5B1YA 4DLLA 2PNFA 1E3LA 1MG0A 4GWKA 3BHIA 2CDCA 4BNYA 2VHWA 1NAHA 1XLTA 4OXYA 1F0YA 2NU6A 2GD1O 4E30A 2VCYA 1CERA 4YAGA 2GCGA 3ANMA 5I8WA 1E6WA 2CVOA 2DFDA 2HJSA 4TSKA 3H3FA 1P1JA 4MVJM 5HWSA 1AGNA 4WKGA 5GY7A 2OHXA 3K30A 1E3JA 1ZMOA 5T64A 5FWNA 5COAA 5AXDA 1J4AA 4BNTA 1KEWA 3DBVO 4D45A 1T2FA 3IDSA 3VAZA 2BELA 2PGDA 3B6ZA 4Q3DA 4CLRB 2EGHA 1QYWA 3Q9NA 2PGLA 1SMKA 1GQ2A 2C2XA 3RFVA 5THKA 4PZEA 3TOXA 4BL5A 4OYRA 4BV8A 4HUJA 3RUCA 2P9GA 4DIBA 1JWAB 3WGIA 3WDSA 3OBBA 3WG9A 3BMOA 4MKXA 2YV1A 3WX0A 5DCYA 1K2WA 3FCOA 4CMEA 3UW3A 4BHTA 1N92A 3GFGA 3HFGA 3PHHA 3V5NA 1LSOA 1I8TA 5I7SA 4YB8A 4Z9YA 3P5SA 4K1LA 2BLLA 2H1SA 5AOVA 3ZN2A 4E21A 4ALLA 3ZHXA 5U1PA 1DIBA 3TQHA 3IJRA 1KYQA 1CRWG 1NBOA 3AI3A 4CR8A 3GGGA 4OMUA 1U1IA 2JCYA 4OHUA 1ZK3A 3H6KA 3ZV3A 2XXJA 3OIFA 3GRPA 2G5CA 2ZQZA 3GFBA 4YT5A 3DTYA 4MPDA 1NNUA 4ZN6A 3RVDA 3ZNOA 2DUWA 4TKMA 1T24A 4I5GA 4R1NA 1NWCA 4BO6A 2ZYGA 5DOZA 4CUKA 3NUGA 4XX0A 3OSUA 5A9RA 4EUHA 3LSYA 1EK6A 4TQGA 3I5MA 2Z1MA 1KVUA 1I10A 4PG5A 2CY0A 2W2KB 3AFMA 4BQPA 1GADO 2R00A 3JQ7A 1YXMA 3I9KA 2VYVA 2C59A 3KSUA 5H81A 4NBWA 2IXBA 3P2YA 4NBUA 1LRJA 3RIHA 2HMVA 3KBOA 5FFFA 3AI1A 2ZYAA 1KEUA 1XU9A 3H8VA 4XKJA 5KJ6A 4GMGA 4C4OA 4QUKA 4ND3A 4UVDA 4A2CA 3GH3A 5KVVA 2YUTA 1H93A 3CMMA 5L40A 1R0SA 4CQLB 3AY7A 4OXKA 1O5IA 4YDRA 2PWZA 4PG4A 3D5QA 1IE3A 1NPTO 1QYDA 2E6UX 3DC2A 1NQTA 3ZHYA 4LVUA 1PEDA 5DOVA 4G2NA 5ADHA 4CODB 1YB1A 1Z45A 1NAIA 2GYYA 1E1LA 3TN7A 5B37A 2ZKLA 4GMFA 1KEVA 5CEFA 5L7YA 2D4AA 1UP4A 2QYTA 3PZRA 2PTGA 3I3OA 2GF2A 3AY3A 5TNXA 2Q1WA 3AUAA 3DHNA 1HF3A 4CMCA 3PQDA 2DU8A 1DC3A 1XGKA 1M6WA 4XA8A 4N5NA 3BMOB 2VRBA 1PS8A 3RROA 3E5MA 1Q2XA 4TMFA 2XOXA 3U9LA 3KLPX 1LSSA 2BFPA 2WSBA 1DHRA 1XELA 4YPOA 3DL2A 4RF2A 1LEHA 1WW8A 4ND1A 4RF4A 4EJMA 3PJGA 4NR0A 1TA4A 2O23A 2P9EA 1GPJA 2DAPA 2GDZA 1ZUD1 5CDSA 1RM4A 2HAEA 4L4SA 2YHUA 5CDTA 1PL8A 2D1YA 1V0JA 5AXAA 3DZHA 2FPGA 1I24A 5MGBA 1HYHA 4TROA 4ALNA 5KTKA 3WYEA 3DZGA 2OXIA 1DRVA 4DPKA 1BXGB 3FPCA 3V2GA 5KVSA 3ZCXA 3ZWOA 3ZWAA 4B4UA 1KVTA 5KKAA 4FFLA 1WZEA 1QR6A 3DZJA 4HKTA 2HU2A 1AXEA 1MC4A 5DCUA 2Y99A 1E3SA 2X0RA 4ND2A 3HFSA 3GAZA 1NPDA 5FI5A 4TVBA 3IP1A 2QHXA 2VRCD 4EUEA 5H83A 1WWKA 3UGKA 1C1XB 3GMDA 3KUXA 4JNKA 3RUDA 3ZDFA 4LRTB 3EUWA 2WYUA 2QRKA 4B3HA 2ZQYA 4D44A 1GCOA 3NAQA 5JAIA 2ILTA 3JQ7B 1E1MA 1DO8A 1ZO8A 4J0FA 3JQGA 5F1OA 4NK4A 4H15A 4YJGB 3HSKA 1KY5A 4RPHA 1GEEA 3I9JA 4NHEA 2X5KO 4J1SA 2NQ8A 2YJZA 4LW8A 3VH3A 1LTHR 4BO2A 3L0DA 3IC5A 4AICA 4B7UA 3PDUA 2FY8A 2FSVA 3GOHA 3GMSA 3O38A 1UUFA 2VZ9A 3WGQA 2AXQA 5A5EA 3H65A 2HCTA 3QWBA 2WEKA 4JK3A 1Y1PA 3AM4A 3WLEA 3DOJA 3I52A 2R00C 2GUGA 1ZFNA 2GPTA 1ZCJA 1PTJA 4D0SA 1PJCA 2JL1A 1MFZA 4FJ1A 4B7XA 3TF5A 4E31A 2HKIA 2ZTMA 4B3IA 3M2PA 2NU9A 3ETGA 1KVQA 2FR1A 5IDYA 2WE8A 3OJEA 4XD2A 4QFCA 1GU7A 5I9MA 1EBFA 5KKCA 1E92A 5F3RA 3ZHBA 2VNAA 3IMFA 4KDFA 1PR3A 2JFFA 2NM0A 2VOJA 2O48X 4H3VA 2VHXA 3PJDA 1LDGA 1ZSYA 1LDYA 3BAZA 3SJ7A 3L6DA 3H2ZA 1WZIA 1PGPA 1NX6A 3W6ZA 2VYNA 4TRRA 2Z5LA 1U2GA 4FCCA 5G4LA 3JYNA 4WEQA 1YQGA 4YA6A 4KZPA 1YE3A 5EN4A 1SEPA 3AU9A 2W8ZA 3EDMA 4DYVA 1HSOA 4XGNA 4BNMA 2D2IA 2IZ1A 1P44A 3DEYX 1E7SA 3NEPX 3WIEA 2FPPA 1E5QA 1DIRA 3ITDA 3WYCA 4I8XA 4CM7A 1H0KA 3KSDO 4AJNA 3W4JA 3STHA 1IUKA 3OA2A 4R54A 2Y05A 1U3UA 1KIFA 4IXTA 4BNLA 3MTGA 3C7AA 4KDEA 3RC2A 3WIDA 3KXDA 3FTNA 5L4SA 4RVFA 1JKJA 4UVEA 1P1HA 4QEDA 1O8CA 2ZATA 3GAFA 4BNGA 1B14A 1VL0A 3VPGA 2P4QA 1NXQA 4FFRA 1C0IA 1T2DA 3F1LA 4BNHA 3G17A 1GYPA 2GSDA 4AJ4A 3L4BC 3UUWA 2A9FA 4BNXA 1Q7BA 1TLTA 1B8UA 3ENKA 4QO8A 5TLSA 5ENVA 2HK9A 3QVTA 4P8RA 1T2CA 3UCXA 5C7LO 2B0JA 1QP8A 4G65A 4CUZA 2I66A 4ESOA 3CEAA 2EWMA 5EERA 2CFCA 3DZFA 2DTXA 1T1RA 3CE6A 3Q2KA 3QY9A 3HQ4O 4YJFA 4UAGA 1MFPA 4KOAA 4QO7A 3U5TA 3K8ZA 2NQTA 5JW6A 5CPFA 3RUIA 5ILOA 1R66A 1LLQA 1RPNA 2V6GA 4EEZA 1UXGA 3E9MA 4BVAA 3IUSA 2VHVA 1E3WB 1IHXA 1JVSA 1LDNA 3Q9UA 5CEJA 1PJSA 3I6QA 4MVJP 2Z1NA 1PWZA 5IDQA 3SBOA 2HDHA 2HMWA 4FFNA 4WNCA 3CMCO 3JQAA 4CM6A 1E7WA 4UUOA 4FN4A 1I01A 2GGSA 3PVZA 2AEMA 4RDIA 2C7VA 5F5LA 3U4DA 3Q3CA 1DFHA 2XAAA 5BR7A 4I9UA 1HZZA 4MIOA 5JS6A 4R4JA 4CL3A 1VRWA 1ZEJA 3JQBA 5DZSA 3X2EA 3QVSA 3RFXA 3GNSA 1A5ZA 1M76A 4DXHA 1WP4A 1UJMA 3EC7A 4IS2A 2Q2QA 4WLFA 4DIOA 3DWFA 1FMCA 5CP8A 4YRAA 1SZJG 4CM1A 4WCDA 4RZHA 1H2BA 1UDAA 4L75A 5BSHA 3JQ9C 1IPEA 3B1JA 4PN3A 3RBZA 3UKOA 1G1AA 5BSEA 4FW8A 2ZB3A 4WNIA 4B79A 4DPLA 2EP7A 3DMTA 4CQMB 3HHPA 4HY3A 4YEDA 4UVHA 3RKRA 3EMKA 2X5JO 1I36A 2OBYA 4JJIA 3JQ8A 2CF6A 1NPYA 2GR9A 2F00A 1EBUA 3R3JA 4XR9A 2V6MA 1YDWA 4PG8A 2IODA 4NFYA 5TQVA 1YONA 4FJ0A 1X13A 2ZJ0A 1GTMA 4PLYA 1O89A 1TEHA 4NJOA 4F3YA 1KY4A 2XPCA 1HL3A 4PLPA 1YQXA 4D3SA 1E5LA 4F6CA 3TZQA 1LU9A 3DBHA 2J3HA 4ZU3A 4Z9XA 3T4EA 4D46A 4BIIA 1ZK2A 3ZWNA 1DC5A 2PY6A 2ZTLA 4CLRA 1QYCA 3GN2A 4EGFA 4Z0PA 4RORA 1FXSA 3K9QO 4OOFA 5CHEA 2EJWA 1R4MA 4BKRA 4XRGA 2D8AA 1RM5A 1SAYA 2RH8A 3K92A 2WD7A 4RVHA 5F5NA 2OMEA 1A9YA 3O03A 1Z82A 1XQ1A 1ENZA 2BRUA 5IN4A 3ZI0A 2DBVO 3G3EA 5KCZA 4J7CA 3L9WA 3IS3A 4MVJE 3WJ7A 1X15A 3KYDB 3ON5A 4BB5A 2Y66A 3GVHA 3ROQA 2F1KA 4MOWA 3NV9A 3C85A 2B35A 3GNQA 1NTOA 3BMQA 1H9BA 2PZKA 3N7UA 2Q1UA 4RPJA 1WVGA 4MVJA 3NDJA 4YQZA 4LRSB 2RHCA 1MC5A 3M1AA 5AQ1A 4AJEA 3OIDA 1H5QA 3TZKA 4R51A 3Q2IA 2Q2VA 1DRUA 2RHRA 1TVEA 1B3RA 1U4SA 2Q3EA 5C3MA 3MOGA 3WGYA 5LCXA 2NACA 5FI3A 2AQKA 1C0KA 1HYEA 2YV3A 3R0IA 3OA0A 1UP6A 5I7EA 4IQGA 4YJHB 4ZJUA 1VPDA 4XEHA 3S2IA 1DC4A 1GUYA 3VDRA 2YDXA 1DIGA 1ADCA 3BIOA 3KB6A 4Y6SA 2ET6A 1YO6A 4BQRA 1I2ZA 2V7PA 1Y8QA 3X2FA 4PLVA 4YVFA 4PLGA 4DWVA 4R1SA 5IDWA 1DIAA 1LRLA 3TL3A 3GQVA 4DTIA 1A7KA 4RDHA 2ZJ1A 4K26A 1ULSA 4TRMA 4Y6RA 3NGXA 2YY7A 4RL6A 3VC7A 6LDHA 1RJWA 4BNUA 3WGOA 2D0IA 3WOHA 4L8VA 3DZIA 1C0LA 3ICCA 2JD2A 3VH4A 3ZZNA 2FSSA 5IXSA 2ZCUA 4Z6KA 2VQ3A 4CM9D 1N9GB 4RPGA 1A27A 3TJRA 1E7MA 1G0OA 2V65A 3F47A 4FFMA 4R5MA 4BGVA 3GVPA 9LDBA 3PHIA 3OJ0A 2D3TA 3UN1A 3BTOA 4UULA 4W99A 1J5PA 1GAEO 4BGIA 3MWEB 5DBIA 4J16A 4CM4A 4Q3EA 4M89A 3EY4A 5IZ4A 2UUOA 4OGWA 3RJ5A 4DIFA 3UCEA 3L07A 2O3RA 4R3WA 3L4SO 4UEKA 3QE3A 1W0CA 2P4HX 1HLDA 2QRLA 3I23A 4Y8VA 4EBFA 1R4MB 2AG5A 1LX6A 4DUPA 3JQ9A 3MJVA 4OQYA 5L53A 4DMMA 3N74A 4EJ6A 4NU6A 3WFJA 4WLNA 1FDTA 1EDOA 2BD0A 1U8FO 3EAGA 3I9LA 2VN8A 3KYDA 1VLLA 3JD4A 3ONEA 1ONOA 3TSCA 1BW9A 2Y0DA 2YYYA 2AQHA 1N5DA 2FZEA 1HTBA 2Y1GA 3ZH2A 3WBFA 2JD1A 4B7CA 4BO7A 5JYDA 4N5LA 2WE7A 4YT8A 4MIEA 1SCUA 1K6XA 4BNNA 5CAEA 4M87A 1P74A 5DP1A 4RCVA 4DC0A 2EW8A 4YBZA 5EINA 2EW2A 1BXGA 4GVXA 4BO1A 1S6YA 4R16A 3ZGYA 4JP2A 1JDJA 4FB5A 4UEOA 1KOLA 4BO8A 3ENNA 2HMSA 3GVCA 2JKVA 2W98A 5HA5A 3B20A 3W8DA 4IIUA 5IF3A 1CIVA 4NFSA 4N18A 2EKQA 2I6TA 3WICA 2J5QA 4EEXA 2RAFA 3KEOA 3UH1A 1Z74A 4D3DA 2PK3A 2CVZA 1F14A 1BVRA 3SLGA 5DBGA 1KERA 4IPTA 3FRJA 3LLVA 1H94A 3GDGA 2BF7A 3QIVA 3TRIA 4GAEA 6ADHA 2DPHA 2ZCVA 4YTEA 4YAIA 3OP4A 5K9ZA 1OC2A 4FFOA 1U3TA 4CM9A 5JCXA 2I3GA 1C1DB 4GLLA 3JYQA 2HK7A 4B4OA 3H7AA 4R01A 3OECA 3BMNA 3AWDA 3GVXA 3ZV6A 4GX0A 3IQDB 2NLOA 2TMDA 2B4QA 4OIMA 2R6JA 4FOOA 5TT1A 1WMBA 1T2EA 2EEZA 2E37A 3PWZA 1SC6A 5I8ZA 4GX2A 1OAAA 3W6UA 3SJUA 3EYWA 1WPQA 4MVJI 2X9VA 3HDQA 3WMWA 4IDEA 4K28A 2IZ0A 4J7UA 1VM6A 1I2BA 2A35A 1D1TA 2A92A 1PQWA 2O3UA 1HZJA 2A4KA 4BNIA 4IDAA 2P91A 1F8GA 2ZYDA 2VWHA 1GV1A 2IDZA 1GDHA 2BFMA 1G0NA 3OFSA 4PZDA 5THQA 5A02A 3QLJA 4N5MA 2FRDA 2CSUA 4RVSA 3RUAA 4EDFA 3M6IA 1D8AA 1YDEA 3FD8A 2H6EA 3ZHZA 3ZWVA 1E77A 2Q4BA 1V35A 4JN6B 3D5TA 3MCVA 1L7EA 2AG8A 5KOIA 2P9CA 1NWHA 3MOIA 4E32A 1LDMA 4NDNE 1Y7TA 5C37A 3NJ8A 1H2HA 4GBJA 4WUVA 4ZQHA 5A04A 4RQUA 1ISGA 1HDCA 1U5AA 1Z6ZA 3OEWA 3ZU3A 3HN7A 3KETA 1OZAA 4L76A 1WDKA 3VTZA 3EVTA 1FF9A 1BVUA 1P3DA 3H9EO 5HS4A 3UCFA 2X86A 3VPSA 1AE1A 3WR5A 4CM8B 2CVQA 1U4OA 3DB2A 1YOVA 1KC1A 2CDAA 4LCEA 3DAFA 4W9NC 4YRDA 1HXHA 3CPSA 3WYBA 3VZSA 2Y0CA 2OP1A 4C7JA 5JAZA 4S3MA 1M67A 3BHMA 4ID9A 4DL9A 3I4CA 5F1KA 1N2SA 2A94A 3LC1O 1K0UA 1HE4A 1B8VA 3D3EA 1J49A 1ZVMA 3D0OA 4OO3A 3HDYA 4AJIA 4RVDA 3PYMA 1OMOA 3PDJA 4P4NA 1R15A 3ZWMA 1EVJA 4TVOA 2ZB7A 1YBVA 4FFPA 2AW5A 5COQA 4FC7A 3JQ6A 4Z0HO 4XDYA 1C1DA 4H7PA 2P5UA 4BNWA 2OOSA 1QMGA 4RF3A 3H5AA 3BMNB 4YCAA 2Q1SA 5FEUA 4EW6A 1A72A 1AUPA 5JXWA 1ML3A 2I3AA 3IKTA 5DNAA 2AMFA 3QV1A 3AK4A 3RC1A 1EFLA 1EVZA 3ADOA 3QWHA 4E13A 1ADGA 2X23A 3WBBA 4BNKA 5L4NA 2D5AA 4ZICA 3TZHA 5L95A 1B3BA 4WLUA 3BTVA 4BMSA 3OETA 3O4RA 3HWRA 1DPGA 1PJ4A 2IEBA 4J6FA 4MO2A 4R68A 4A5OA 3H9JA 4FDAA 5EPOA 1ZJZA 4Z3DA 4CMIA 1GPDG 3ZV4A 1D1SA 1IULA 1V6AA 1ZSNA 3GC6A 4AL4A 1DJNA 2CZCA 1KBZA 4OKNA 4OSOA 4LSMA 2C54A 3NYWA 1IB6A 3BA1A 2I67A 3GRKA 1QLHA 1QYXA 3MJ4A 3FNEA 2YQ5A 1CF2O 1E1KA 5K0ZA 1NASA 3FBTA 2Y68A 1W73A 3ABIA 1W4ZA 5EESA 1W8DA 4HV4A 3ZV5A 4KWIA 2VT2A 5TS3A 3WNVA 2NVUA 2GZ3A 4WASA 4LMRA 4GL4A 7ADHA 1KS9A 8ADHA 1NQ5A 4DLBA 1XEAA 1YH3A 2RBEA 1A4IA 1GZ4A 3T7EA 2BFOA 5A03A 1HE2A 3WTCA 5L7TA 3RAJA 1YRLA 2O4UX 1Y5MA 1ZK1A 2FZWA 2P68A 5JDIA 2HRBA 4U8GA 3ADPA 4KTVE 5HS6A 5KVQA 4JP3A 2XXBA 4Q39A 1EVIA 2Y1FA 3JQ8B 2AA3A 1ID1A 1JVBA 4PVDA 2BKAA 3LQFA 1PL6A 3DONA 1Z7BA 1ZK4A 1V3UA 1EZ4A 3DR3A 3JD2A 1YOVB 4IDFA 2DBZA 1R4NB 4XR4A 3BXXA 1NQOA 2WYWA 3CINA 5ICMA 3FN4A 3V2UA 3DMTC 3RU9A 1Q0HA 4XYGA 3QW2A 3GG9A 2FPIA 2C0CA 3TFQA 2DC1A 5L9AA 2YZ7A 3JTMA 1PGQA 1YL5A 2PR2A 2GNAA 5T5QA 4LVCA 4MVJD 4R3NA 5KVCA 4XZ3A 2QG4A 2QYSA 2AE1A 2C7GA 2PKQO 2PZLA 4ZQFA 2EGGA 2YQ4A 4B8WA 3PFWO 1EUDA 1XIVA 4QECA 5DT9A 1R0LA 4M54A 3MJEA 1UXJA 4E0BA 1SEVA 1M2WA 1OOEA 5T57A 4HFNA 1MB4A 4PIVA 5BQFA 4IQ8A 1LNQA 1AN9A 1N8KA 1R12A 3SX2A 1WMAA 2X4GA 1NR1A 2P5YA 3KLMX 2Q99A 4E2WA 5MDHA 3S2EA 1ORRA 2Q49A 3BMQB 4JJGA 3BYZA 3FWZA 2ZB4A 1Z7EA 1MLDA 1UAGA 2QIOA 4IZIA 3RUHA 5JC1A 4AJ2A 1PWXA 4XIJA 1NVTA 3NKLA 1QXSA 1R16A 1JTVA 2NTJA 4PVCA 5BT9A 4ALMA 5I9LA 3WJAA 1JAXA 1DRWA 1YB5A 2IYPA 3NJ4A 3UFXA 4E4YA 3GGPA 3EHEA 4NBVA 4DC1A 2QRJA 2X0JA 1KETA 3NT4A 4KWHA 3VVCA 4QQRA 4AJKA 3GPIA 1IL0A 4FS3A 3MTJA 3VZQA 1KVSA 3TOZA 2GZ2A 5L7WA 3E9NA 3FF4A 3OJLA 4NQZA 3AJRA 2NVUB 1XKQA 5JAQA 1B2LA 1V3VA 3AUSA 4GI2A 4HFRA 1JLLA 5G0VA 4XGIA 4JBHA 1LBEA 5JPIA 1ARZA 2YDYA 2Z95A 3VKUA 5ICSA 4NJMA 5B4VA 4J9UE 3B1FA 5JCJD 1V9LA 5B12A 1Q0LA 4BO3A 4N7RA 1LC0A 3VPHA 1FDWA 1P9LA 5L4LA 5GZ3A 2VWGA 1EDZA 3F4LA 4WOJA 1DEHA 2E4AA 4B8ZA 5H82A 1JWBB 3GEMA 3P7MA 3PEFA 4GGOA 2X22A 5TJHA 3DAPA 5U9CA 4DREA 3LT4A 3W1VA 4I5DA 1VL6A 5K6AA 1RYDA 2EKLA 4TRNA 5KJCA 3QWAA 5ITWA 4YAEA 4BV9A 3LDHA 3M1LA 4IUYA 5IN5A 3F4BA 2PH3A 1VSVA 1Z73A 3BZUA 5JO9A 1UZMA 1K5HA 1ZEMA 2GLXA 1KVRA 3DHYA 4U6SA 3CTMA 4I08A 4RV9A 3PYXA 4O5OA 3W8FA 3BMCA 2VZ0A 4JIGA 4B4VA 3LT0A 4I9HA 4A26A 1OFGA 3OQBA 1BRMA 5A1TA 3U49A 2DUUA 2DQ4A 3C3XA 4J4HA 1V8BA 3GK3A 3DBHB 4NFHA 3QQPA 4I5EA 3ANLA 3I9OA 5JBIA 2HSDA 2B83A 4YWJA 1X7GA 1OC4A 2PA3A 1PJLA 2EIHA 2VHZA 3HZZA 4ALJA 1P77A 3RCBA 1Q0QA 3RBVA 4DBVO 1YJ8A 2YHIB 1Y8RB 4QSMA 2X0NA 5A9SA 2GN6A 4K9DA 4OKIA 3LVFO 1A71A 3ONDA 1PGOA 3BTSA 4CUJA 3EK2A 4BKOA 4E12A 1UDBA 3FBGA 1D3AA 3SXPA 4GX1A 2HMUA 2UDPA 1BTOA 2YV2A 3IP3A 3FR7A 4MP6A 4ZA2A 4PLHA 1NYTA 4GKVA 1DLIA 4J0EA 4HFJA 5JAMA 2JHGA 5JMPA 1DIHA 3D3WA 3AM3A 4D7AA 4JBIA 1PJ3A 1NFQA 3GDFA 5G0UA 2NWQA 1DC6A 1UAYA 4MVJH 5DN9A 9LDTA 1MXHA 3W8EA 4OM8A 3G49A 4NH4A 4G5HA 5DP2A 3QA9A 5BSGA 5JC8A 3GHHA 1LI4A 1ISMA 1Y5RA 3DDNA 4M86A 4NBTA 1GEGA 5TF4A 5IZCA 1D4FA 4HNGA 2C5EA 3GF4A 5ITVA 4URFA 1HETA 3E03A 1WAMA 1T25A 1ISJA 1UXHA 4J4TA 4NJMB 3E18A 3ULKA 3EZYA 2HRZA 4HP8A 1U5CA 2ZTVA 4LSWA 3TZCA 4CMHA 4CLOB 4KQWA 3H3JA 1MXFA 3JYOA 5TX7A 4UUMA 2GRAA 5HRUA 3QP9A 2XF8A 4BOYA 3EGOA 4PCVA 3ETEA 2BI8A 2CMDA 3JQBC 5BNIA 3INGA 4D43A 2BI7A 4OJNA 3Q1LA 4GKBA 5COBA 4KMSA 4WEOA 3WGGA 2B5WA 4FR5A 3K31A 3UHAA 3GUCA 3ICPA 3C1AA 3FNGA 4PG7A 2VOEA 3U0BA 2OUIA 5A9TA 4EYEA 1VI2A 2UAGA 2WYVA 3VVBA 3E48A 4WGGA 5BNFA 4LISA 3WGHA 1U8XX 4HX5A 1BSVA 1GQYA 3ANNA 3K2EA 4NU5A 4Q3CA 4Y98A 3VH1A 4OXNA 4NBRA 3O8QB 2CUKA 3OICA 3BMCB 1ZXLA 4IM7A 5T8KA 1K6JA 2E49A 4WLEA 7MDHA 4E2XA 1GV0A 1BDBA 2Y93A 3KV3O 5JCJA 1O0SA 3E6AA 3KM0A 2QW8A 2JJYA 1GUZA 3Q0EA 2X8LA 1LUAA 4R69A 4O1MA 2O3JA 1ZW1A 5IDXA 3A4VA 4K6FA 2D5CA 3QHAA 4ROSA 5I9NA 1NFRA 3D4OA 3HB5X 2Q45A 3FNFA 2AE2A 2YW9A 3R1IA 2D59A 3DTTA 1VSUA 2E48A 2C29D 4FSHA 2NNLD 5GZ6A 4D3FA 4Z3KA 2X0IA 4C7KA 3JV7A 4LMPA 2Q2WA 4XJTA 1RM0A 2O3SA 3I9MA 1DSSG 5G0TA 3ROKA 3ZWWA 4KQXA 2Q4EA 2B4RO 4CM8A 1DHTA 4P38A 1CQJA 3TZ6A 3BHJA 3NTRA 4RQTA 1BW9B 1P31A 3PPIA 4GSLA 4AVYA 1BG6A 3JSAA 1RWBA 2EKPA 3DQPA 4CQMD 4H16A 1RYEA 2JAPA 3INTA 4PLTA 1UZNA 2JHFA 3ETDA 4M8SA 3M2TA 4IY1A 3WLFA 1GYQA 2AHRA 1N1EA 2OORA 1I33A 4PZCA 3QWIA 3RC7A 4IGFA 4II3A 3T4XA 3AOEA 3RUEA 4NMHA 1ULUA 4GLOA 3SLKA 1MA0A 2QQ5A 1E6UA 4BKUA 4Z9FA 2C5AA 5AXCA 1YL7A 5CG1A 4BKPA 4R9RA 1QKIA 3PHLA 3F9IA 1ONPA 4N54A 3QVWA 4D0RA 1I3NA 1ZBQA 1HSZA 4Q3BA 5C5IA 3QRWA 1E6EA 2PD3A 3ZW9A 4A7PA 1FDUA 1GZ3A 5GMOA 3AOGA 5JDCC 5TC4A 4WCFB 4AJHA 1ADBA 3A28A 4K6CA 1U7TA 3ZWYA 2FWMX 1XYGA 1T1SA 3QWFA 4J43A 3A06A 3VZPA 4E5YA 1HDRA 4PLZA 2PKQP 2HLPA 2Y1EA 3CH6A 1TT5B 1GL3A 4J4BA 3KSZO 1EQUA 2I9PA 1N1GA 1ENYA 1BDMA 4MVJF 5A3JA 2NVBA 4ND5A 4W7HA 1P0CA 3WQQA 3F3SA 3PWKA 1ZXBA 2GASA 3U4IA 2VUSA 4KP7A 2Y0EA 4L4RA 1BHSA 4LN1A 4A73A 3PTZA 1DOHA 2BFAA 2SCUA 4E2YA 5EMHA 4RVGA 5KJEA 4YXFA 2HQ1A 2JFHA 2QX7A 5AVOA 4P4LA 2J8ZA 2JCXA 4OAQA 1O95A 4D42A 4DVJA 5IXYA 1NHGA 3E8XA 4A03A 4QX6A 4EITA 3JQFA 1IY8A 1WNTA 4CPDA 2WJPA 4MDHA 4P22A 2B37A 2X6TA 1LC3A 3VOSA 2OO5A 4J3FA 2GN9A 1A7AA 4XIYA 3K5PA 1QRRA 3DO5A 1MG5A 2DTEA 3QJ5A 2AEFA 1VJ1A 4XB2A 4I1IA 4A10A 3L4BA 1NQAO 4KUEA 3OQ6A 2BHLA 3FI9A 3I83A 3JQFC 3PK0A 5CDYA 4RZIA 2EHDA 4YT4A 1PZHA 1LDEA 4YAKA 1MUUA 4DQUA 1ZNQO 1O6ZA 1PJ2A 2AQIA 1OI7A 3KYBA 1R4NA 1YGYA 3WTBA 2WM3A 1L1FA 3RC9A 3Q11A 4PFJA 4E2ZA 4X54A 2EP5A 2ZK7A 3ZWCA 3OIGA 1MX3A 4TRJA 4CQMA 1YJQA 4RF5A 4CV3A 2VNSA 3H9GA 5C7OO 4DQVA 4Y67A 1X7HA 2W4QA 1JU9A 3RUFA 3VHRA 2PD6A 4GGPA 4YACA 2HMTA 1XA0A 1HKUA 1I2CA 1IOLA 1M66A 1QSGA 4BB6A 4FOSA 5BNTA 4RVUA 4JQCA 2Y67A 4BNFA 2JAHA 1B0AA 3PWSA 4AJ1A 3FR8A 3JQCA 4CLDA 4XYBA 1K89A 2W90A 3RBXA 4EZBA 3O26A 3PIIA 4QFDA 3VPFA 5JO0A 3WGZA 4BMVA 2Y1DA 4W9NA 5EJ2A 4L9RA 1U3WA 4PLCA 2J3JA 1F06A 3DOCA 1X7DA 4RPKA 1C1XA 3LC7O 3LC2O 3ITKA 2C07A 4WCFA 4IINA 4O63O 4BO0A 4ZVVA 3VH2A 3CIFA 3C7CB 3AOEC 3K96A 1I3MA 3PLNA 3R3SA 4GH5A 4YJGA 3AY6A 3UAGA 1ENPA 1U28A 4UEJA 1NM5A 4IDBA 2VTEA 1TT5A 3G1UA 2IEDA 4XCVA 2J5RA 4DQXA 5TRTA 4J49A 2E82A 1P0FA 4J1TA 4IJWA 3PQFA 3JD1A 1P1KA 4L4XA 1EE2A 5I7FA 1PGJA 2FN7A 1GQQA 3W4IA 1I5RA 3HDJA 1XU7A 3JYPA 1CWUA 1YB4A 3OJFA 4E5NA 1E7QA 3TFOA 5FYDA 1MP0A 2BGLA 5IG2A 4UUNA 2Q1TA 1HDGO 4IQ0A 4D41A 3CKYA 3A9WA 4KUHA 4KTTE 2HK8A 1QORA 4J2OA 4XB1A 1C3VA 1ISHA 1ZSVA 4CMIB 2Q50A 2JFGA 3LLSA 1WDMA 4FJ2A 3DXFA 4QT0A 1IZ9A 2EJVA 2NSDA 1K3TA 4CJXA 2Y1OA 2DBQA 4XQGA 4YJHA 1YL6A 3LF2A 2OL4A 5TIIA 4IDDA 5IAAA 4XYLA 4M1QA 1DFIA 3R6DA 2WTBA 1B15A 5B4TA 1PJBA 1LQUA 3PQEA 4HWKA 1ZK0A 4RGBA 5LDGA 2V6FA 4R1TA 1E3EA
chains in the Genus database with same CATH superfamily
2PUDA 3KC2A 5AJYA 2G17A 3ZGLA 3C24A 5KS2A 3V33A 2WHQA 4HNTA 2MYUA 2NUTB 2Y6VA 4WOKA 1GFWA 3QIAA 1AQJA 5DM60 5JPCA 4B5KA 3L4EA 2O7SA 3OIYA 2ZE8A 3VHLB 1O6FA 1JI3A 3HNPA 1P45A 2YHBA 4DZTA 4AWBA 1I0ZA 2GAJA 2OFXA 2TMGA 4N5IX 1GCGA 1VE7A 3I4LA 2RGWA 1SPXA 1UFKA 4WFQA 3TUIC 3G0IA 3H6HA 4MW9A 3ZIUA 3D4NA 4BDSA 1GPKA 4BB9A 2XITA 4CR6A 3OY7A 4NZ9A 1D0IA 1SK9A 1G20E 3QI2A 4Z2YA 1ZZEA 3HI6A 1GRCA 4JT9A 2DT8A 1KI4A 1V7CA 4QD3A 3UW1A 1AUOA 3B5EA 1R5JA 2PZFA 2RGCA 3H75A 1C0PA 2ZIGA 3NDPA 4IIJA 4MI1A 4UC0A 5K1ZA 1D03A 1YS1X 3D6NB 3SJCA 4ITUA 5KYXA 1TB4A 3HN6A 4HXYA 4PGFA 3MWEA 3LDGA 3JCZA 1SY7A 4GZ6A 1CETA 1N0IA 3FHOA 3D4PA 3QUTA 2QM8A 2K87A 1N2XA 2Q5IA 2ATEA 5FL3A 3TQIA 5CVTA 3MTBA 4OEHA 3NHRA 3UGQA 3NDBB 1I7SB 2HHHB 1VHTA 1JQKA 2DLDA 3UHPA 3IIJA 4AN1A 2Z6QA 1NVUQ 1OBFO 1WULS 6NULA 2C9CA 5DGHA 5A0VA 2O6HA 3LBHA 5GVRA 3BTUA 4L0QA 3L92A 2C57A 4OQZA 4Q24A 1ZICA 1ZQ9A 3IP5A 1AS2A 5H1YA 2DKFA 4G4SP 1NJFA 1ZCBA 3MG9A 3PP8A 4PNPA 1SVMA 2CFOA 3AP3A 4DJDC 1SBCA 4G81A 4MUKA 1E98A 1NMZA 4C4AA 5JQWA 4ZRMA 3PXUA 4YP1A 1W52X 2WD8A 1S3FA 5ALEA 1DAMA 1JQBA 4FSXA 5JYBA 1EFTA 1K3UB 4LDQA 4JC5A 3N8IA 3OE4A 1GGNA 2A1TS 2OZLB 3A2KA 2EL7A 2AOUA 3HVJA 4R81A 5HF6A 3G79A 3L0YA 3A6DA 2V7TA 3HSYA 1Y9AA 2J3IA 5AJZA 2XI4A 2YV4A 4FXOA 1DDOA 3GARA 3ILYA 3WFIA 4JNCA 2WFZA 2ADOA 5ABPA 5L6MB 2R86A 3THXB 2PYDA 5FNVA 1U9YA 3BH6A 2ZSBA 1AZTA 4F8JA 1PV4A 3LYAA 3QSGA 3A1DA 1SULA 2WF9A 4NU8X 4W63A 4D79A 5IRCD 3RSHA 4IF6A 4NG5A 1M6VA 3FYHA 4BUCA 2CNOA 4K9LA 3HY3A 2GD2A 3FSRA 1Z4QA 4LVNA 3T9AA 2JFOA 4RD1A 3VR4H 1M75A 3ZWBA 2QMUA 5EWJB 2XHZA 3A9CA 1JIUA 3RSFA 3OUZA 4AO7A 5JWOA 1O5TA 2POQX 2YBEA 4ZO7A 4UTPA 1JQJC 1WB4A 3DMFA 4RSGA 4XEUA 3TGPA 4BVKA 2ZIFA 1TOAA 2GJ9A 3D6VA 2Q9AA 1PEKE 1VRVA 4P82A 3K71B 4JI4B 5A71A 2C2GA 5C7IO 3HNRA 5BUZA 4NPAA 4Q93A 2GM4A 3WQBA 1B1CA 4NV0A 1XAHA 1JR4A 1Z2CA 2C88A 2A6PA 4REOA 3UJ8A 4C05A 4CKBA 4JS0A 5LVAA 1UAAA 4X6LA 4RQAA 3HVRA 3O82A 1TKAA 3UMRA 1LPAB 1URPA 2FPUA 3CZ5A 4M1YA 3OQJA 5BPHA 1GPWB 1MENA 1JDBB 1QCYA 1K68A 5CB4B 4PZZA 1U6IA 1QIHA 3FGNA 1RS0A 2WT8A 4A8JC 1T4GA 3H8JA 3NNSA 2ISQA 3D3QA 4I2NA 5ENDA 4AKGA 1SC9A 1JHRA 4CFYA 4ALIA 3U2QA 1NRIA 1UPBA 2D2EA 1ZNXA 2O2XA 3K73O 3TTTA 1ZKDA 3OF2A 4BGEA 1Q1NA 2HBYA 2I8LA 3U09A 1C8BA 4HNVA 4PM4A 1CUUA 4TUYA 2FOIA 4E14A 2VDLB 4MP8A 5GZ1A 3CEJA 4F72A 4BFTA 3OJOA 5A06A 4BVJA 4TV9F 4DJ5X 3GFTA 5EXPA 4DT1A 3T7TA 1CK4A 1U5BB 1S2NA 3JYLA 5DTMA 3I42A 3I5UA 4FGSA 4BNZA 1WV1A 4ZT7A 3VPAA 4A9AA 3IPAA 1GFSA 4XPIA 2ZVQX 2VPZA 2GT1A 5H16A 4DA9A 5BMVF 2G72A 4IJQA 5L51A 3J81k 1Y4ZA 3LHDA 3L8FA 5FBWB 3B2NA 5LOVF 1GGHA 1V4BA 4FFBB 1C2TA 2QV0A 1GYRA 3QK7A 5E9QA 5FQNA 4OYYA 5LZ5A 4PYRA 3WWYA 4KB5A 3F90A 5HGJA 5KWEA 3RT9A 3DLHA 4J0QA 2HADA 1KSJA 2OV2A 4H6VA 3OJWA 1U7WA 5D2CA 4F7WA 2C83A 3BWEA 3D2BA 1D6SA 3HYTA 4GXNA 4Q5IA 3T41A 5EIOA 3T7DA 4HN9A 1PZGA 1AXGA 4LBZA 1SIUA 1IC6A 1UOPA 2GZRA 3C1OA 5JARA 4MB2A 2GYUA 3FFWA 4CHTA 3ZHTA 4G1BA 1NVMB 4BU1A 1T9HA 2G7MC 4R9SA 2ONJA 3K1YA 4PCLA 1G21B 3AXSA 1I30A 1RJ9B 4TPKA 1KK2A 1KZYC 1OXTA 3A27A 5ER9A 4ACBA 3PLAE 2L82A 4M7WA 1PIWA 1A0OA 4B46A 3CXRA 2RIRA 4NNJA 4HAOA 4DGSA 5DCWA 1Z2DA 1QH1A 4PRKA 3SQDA 2FR8A 2FE4A 3PZBA 4RPLA 4UMEA 5U4QA 5I4BA 4Q4HA 3VHXA 3K5HA 3MSCA 4EGQA 3BBPA 1Z2OX 4E33A 3JZAA 3T5DA 7MHTA 4IMJB 3JPWA 3JD3A 1P2DA 4CTJA 4S24A 3D7SA 3OTGA 3ZWPA 2NVWA 4I1RA 3HKCA 4LJ5A 1BDHA 3HFJA 3AFGA 4D5EA 3QJYA 4GUDA 4YAJA 1WM1A 3C98A 3OZRA 5CH3A 4HWTA 4RVNA 3FVQA 3STWA 4K7JA 3UYLA 3NBFA 4UXIA 2WNIA 3O1IC 4Z8XA 1PWEA 3GRVA 4W6QA 1GZ7A 4B31A 4ZGBA 2AKYA 5HE8A 4Q21A 1UBTS 4QWMA 3R9XB 5C8VA 4M83A 1C7ZA 3VR2D 2C8LA 5A4KA 2CWWA 4FZ3A 2CNBA 2J4FA 1J2UA 4HDSB 4ZO9A 3GN1A 1GD1O 3KYCA 4P4SA 4Q7MB 2JLXA 3ZU2A 1T91A 3VU1A 1WDLA 3Q3JB 3HLYA 4EUNA 3HV2A 1LI7A 1J0XO 2AFHB 5D1NA 1F7UA 1X1AA 3IEKA 3U13A 4C88A 4L73A 3SZLA 3JQGB 1FQJA 1BXZA 2CD9A 2WMYA 5E7IA 5GINE 2ZJ3A 3LBNA 1ECFA 2X9GA 2BE9A 4X95A 1ICEA 3BM5A 3REQB 5ITSA 1J39A 3NAGA 1L5NA 1JGTA 3ZNPA 3EXHC 3WGNA 5H9WA 1E9RA 2B21A 2BKUA 3H3XA 4G67A 4L51A 5CA0A 3H2SA 1QBGA 5EUMA 4RD2A 3BK1A 4IMPA 1LPPA 4JP1A 3ILSA 4JX8A 1UADA 3CR7A 2ZS8A 3ZU4A 3PQ8A 4LKOA 3VXKA 5AJXA 1H9AA 4ASUA 5JBNA 1P4JA 2AUMA 3VKVA 4ND8A 2FHSA 2OLEA 3P0FA 1PGNA 2WWYA 3IV9A 3VPCA 3KQNA 4OXQA 1KNXA 3GZNB 3QVUA 3EGXB 2X5OA 1QFYA 4I50F 2KQUA 1DQRA 3OMLA 3DE1X 1TO1E 2AEJA 1NM5C 2H17A 1PJZA 1DBVO 3PX7A 4B33A 5CLHA 5JD5A 4O59O 4OB6A 4AMVA 2BE7A 2F9MA 3B7PA 4WK6A 2XMQA 1CHDA 2C5FA 2BTQA 1L5LA 3V2HA 4FC6A 1WCV1 1LLUA 2R4QA 4Q37A 1GR0A 2HU5A 2VZLA 3RFCA 4YCBA 3Q9LA 3K72B 1I9GA 2H1FA 4YRBA 5LQKA 5DO9A 3SYKA 3WIOA 2OCPA 3G2PA 5BW5A 1QVZA 3B5JA 1DMRA 4BRSA 5KTYA 4D8TA 2EG5A 1E2HA 1F17A 1USKA 4GL2A 1O4WA 1PJTA 1QG6A 5CT5A 4AG5A 5D3ZA 5HIAA 3LYLA 1L4KA 1RKUA 2LCIA 1R0KA 1SXJE 2O0KA 4FYIA 721PA 2XQGA 3GGCA 3AW9A 3ND8A 4IIEA 2FN9A 1IPFA 1B6SA 2PKRA 3ESBA 3ODPA 5EIBD 4G8CA 1I1NA 1FRFS 1R6XA 1SHTX 4ZVKA 2V58A 4UCWA 1YA4A 4O4HA 2R7AA 4RMIA 2EX1A 2IWRA 3PJFA 4KXNA 5FPKA 2FPPB 1RXUA 2OXTA 1QNLA 1A04A 3KJNA 3LNTA 4OLFA 4NPCA 3OSZA 2GVNA 1IBMB 4HWSA 3FMVA 1VMAA 2G4CA 2WZDA 3ESQA 5F7OA 1AS3A 3IQZA 1D6NA 4U7PB 2HO5A 2AOWA 4PFKA 1AM4D 3BRWD 3FTDA 4DRYA 2OR3A 3D4BA 2BMFA 3KIPA 4C4TA 1FDVA 5I01A 5EP2A 1KHHA 1MVLA 1RXCA 1O2DA 4ABTA 2EFHB 3GR6A 4Q05A 4UUBA 4AP6A 1RI3A 3KQHA 2FZGA 1W5AA 1ILEA 4DA0A 3RLFA 1YQDA 5FFMA 1J9ZA 2HV9A 4BQOA 3TGLA 2I65A 2R79A 4EGSA 3G88A 1CJSA 3NIFB 4OJYA 4RS3A 2OEPA 2UYOA 3AEUA 3INYA 4KIJA 4U5QA 5ALYA 4ZCQA 1ODLA 4BCCA 1CUWA 2X58A 4G5XA 3D1LA 2WM8A 2ZIWB 2NOAA 2FPGB 5EWMB 2Q1YA 3A0RB 3CEHA 2AGVA 3SYMA 2O0MA 3CF4G 4M38A 4R8VA 4UVGA 5CFLA 3NX4A 3FKJA 3L6CA 4B4WA 4CCAA 3N8GA 4E3ZA 3G0OA 4BAUA 3CURA 3VJRA 2HJGA 1IDN1 1JR3E 3KKZA 3NTLA 1LVUA 3C0KA 4JI8B 2OWDA 3H1BA 3OQMA 1YBFA 5DRTA 3V1YA 4BO4A 2R8ZA 1R4AA 5BNWA 3CX4A 3BK7A 4URVR 1U2SA 3AP2A 4U2KA 4V39A 1F8FA 1G6HA 4MS3A 1G6KA 1RHJA 1CULC 3V8VA 2DFLA 5CA0B 2CZGA 3JVEA 1J99A 4QDXA 5G3YA 1EUYA 1J8FA 4Q3NA 3T7CA 3CWZA 1SNYA 2NZVG 2XLBA 1U7PA 2FZKA 1H42A 3HM2A 2VF5X 3NDRA 3G8BA 3RWBA 1DADA 1BNCA 3I6MA 3DM5A 1CY4A 2PWYA 3BXEA 4FT2A 3FUVA 3WSWA 2CXHA 3EGXA 3HB1A 3HR8A 3MJHA 2JGDA 4DWOA 1E1CA 2K2QB 5H7XA 2IHZA 2OAP1 4FSDA 2OD9A 3BA6A 3RIMA 2G82A 1GZVA 1UWLA 3A1CA 2QVLA 1VJCA 2O2SA 2I5PO 3BIWA 3TPCA 2XB8A 3RVSA 1Z2EA 3OT1B 4FPXA 3L9XA 3BD9A 1YCDA 5BSVA 3CM0A 5IPFA 3LZ6A 2M98A 4AS3A 5HJ5A 4IXMA 1JYEA 2WJ4A 3R40A 4CMAA 1CQIA 1SBIA 4IV0A 2HXGA 4NAVA 2OZPA 4ZZIA 3C3BA 4JB3A 4DA4A 4EUSA 3A1UA 1WX1A 4HQFA 4PQRA 5CW2A 3X0DA 4EPYA 2WA1A 1MA3A 4MW4A 4WVFA 1Y7IA 5FUVA 1Y9EA 1XXHB 3M5CA 2EP8A 5ARCA 5IFLA 1WEHA 1YVEI 4LYHA 4XJVA 1AGPA 2YJ6A 3VDXA 4DG9A 1KJ9A 2O50A 1PZFA 2GARA 2RH4A 4CF7A 3GXBA 4KITB 2WHRA 2NW6A 2QL9A 3D7LA 1KH2A 1ZN7A 2HDWA 2Q0QA 2B4YA 3GY0A 4Q9NA 4C5BA 3BWMA 1G55A 2GZ1A 2VC2B 2YMQA 1KSGA 2JGJA 5AWFC 5PGMA 1LS1A 2GN4A 1U99A 1YWGO 4ZEWA 4JL5A 1T26A 3CSDA 2E7ZA 3KK0A 4G63A 2NIPA 3ZKAA 1TM5E 2IYEA 5T6BA 1X14A 2YFHA 4M0FA 3S1AB 3LAWA 1T5TA 3SM9A 5IJ9A 2OHGA 2FFJA 1JQAA 3MERA 1VJ0A 2GRUA 4Z54A 4DLAA 2V9PA 1PS9A 1U0SY 1JR3A 2IU6A 1YB2A 2PL1A 2Q9UA 3WKAA 3H87A 3FSGD 3DEJA 5BW6B 4DNXA 5CFMA 2DQZA 1CPYA 3DGEC 1KGSA 2IYSA 3EZLA 1WCWA 1PBNA 1HE3A 1QC5A 1A9PA 1XX6A 2VA9A 3CZRA 3HE3A 4HN4B 3CZMA 4K8OA 5D1HA 3ROPA 4HRXA 3W04A 3JRXA 1WUJS 1CYEA 1O94A 1X1EA 5HCNA 3AO0B 4C14A 1Y4UA 1EEHA 1ZP6A 1YKFA 1KSHA 5EWMA 4PCAA 4HCJA 5B1SA 2I22A 1GUFA 3VR4D 4BMCA 5JAOA 3T1TA 3BUSA 4UNIA 1HYQA 5IK2A 1WTCA 2VYND 3PQ2A 4IHAA 5C46F 4BFXA 3NPAA 4HWRA 4CF3A 1CY8A 2YCLA 1GNPA 3ROGA 1EVQA 4GWGA 1UPFA 1YR1A 2BH9A 1E0DA 2H2AA 4P32A 2QIPA 2HJRA 3TDKA 3M70A 5CDGA 1V3TA 3GLSA 5KNCD 2RI0A 3AVVA 2IHBA 1ETUA 5EMJA 3INRA 4KBYA 3LK7A 4GI1A 4HZIA 2X2PA 1PR9A 3RRBA 1SXIA 3F6PA 3C74A 3MF4A 4QLOA 4P83A 3SC6A 1QONA 3KQKA 4YMSA 4GX5A 5TT0A 3C97A 3TAUA 1UK9A 3VDQA 2DVMA 3O31A 1Y8RA 2FVYA 3ORRA 1PG0A 2IQ5A 3FCEA 3FRIA 3KELA 3MT0A 1SU6A 4G1UC 4REQA 3V4RA 3N2ZB 1L7PA 2ZJ8A 3MT9A 1U2DA 1V43A 2XE6A 3F7MA 1UQUA 2ZYSA 4AMZA 1XMVA 3HADA 1KJ8A 2YNMD 4IZ6A 1A97A 2VDWB 4XD7A 3B8HA 3SICE 1GQSA 1JKFA 3TRJA 3ZS9A 3ZXXA 1UKYA 1RQGA 5HZMA 2GEBA 2WG0A 5FWAA 1P7PA 4QUIA 5D00A 4ML3A 3PUYA 5G1OA 5G0WA 1TT7A 1ENOA 1QCZA 4WZAB 3DTNA 2NV6A 1EJ2A 2IZZA 2Q6OA 4TL9A 4ZVTA 4ZI7F 3DUFA 2HPZA 1V71A 3VNAA 2B2NA 4MX8A 5DULA 2AF3C 2IE0A 4E3WA 4Y9DA 4YWHA 1N5JA 3D2AA 3FLBA 5BOSA 2O06A 4BX0A 1BVYF 2DFPA 2HUNA 2JFWA 4JITA 3W4KA 2Z6AA 3FKSD 5AK6A 4X7RA 3ZD6A 4TN5A 4ZYLA 2MHCA 2VF8A 1PZEA 3COSA 4MIYA 5EI5A 2OORC 2GEJA 3N6RA 8LDHA 4XM1A 1NMEA 5A3VA 4DKXA 5LKRA 1M2NA 1DOZA 1HEUA 1C9NA 1ZC3A 3PIDA 3E23A 3VR2A 1TYEB 3FXAA 1H6BA 3GFSA 4Q3OA 4LYEA 5F7JA 4D6PA 4E5DA 4TUYB 2VNJA 3MQ4A 3KOYA 4RXMA 4KAXA 5IYZA 1JIXA 4E31A 4NI5A 3DBRA 1POWA 3EXFA 1TMGE 1W29A 4DPMA 2ZRIA 1CEXA 1GT6A 2TSYB 5AKYA 4PAGA 5KYVA 5GVSA 1CIPA 2OPBA 2BJVA 1U5BA 1J56A 4FLFA 3CONA 3N28A 3R0QA 3N6XA 3O75A 4Q4AB 5JYCA 5TJ9A 3GGOA 1Y5IA 1Q7CA 2PZMA 1W2WB 4BBZA 1ESEA 4FQ5A 5DYIA 2PD4A 4RH3A 2BCEA 4LF9B 5F1PA 2JIZA 1V6SA 1MHPA 2JLCA 3HYNA 1VE6A 3NHUA 4X94A 2FR8C 5DMXA 4YONB 4ARZA 5B1YA 3FUUA 5ALJA 2WMNB 2F1RA 2CDCA 4WK4B 2YNMA 1OR8A 2OQIA 3G0DA 5KSPA 1XLTA 2B2XA 3TSWA 3QVVA 4JQOA 4JLMA 4E30A 2VCYA 1I13A 1PDOA 2WC1A 4RESA 4XIGS 5I7RA 1P1JA 4YRQA 3JAWA 4KN9S 2IV7A 4A8PA 3ZCTA 4DCPA 5HWSA 1GFZA 1ZRMA 2P5TB 3K30A 1E3JA 3HU5A 4FFSA 2EQAA 3KXIA 5AXDA 3REOA 4WWHA 2JZNA 3G0GA 4Z99A 3V3KA 1T2FA 1VG8A 4ASUD 3WRYA 4DS3A 3RYIB 3B6ZA 4Q3DA 4CLRB 4F8YA 2AOTB 2BP7A 3RSOA 2EGHA 4I9GA 1ZOLA 4WVLA 5LWQA 1SVSA 2Y2UA 1XB2A 2PGXA 1QHHB 3AKEA 5JROA 4CE6A 2HA3A 3EXIA 5ALWA 3TLAA 5THKA 2E4XA 5DLQC 2FSVC 4F9GA 4DARA 3BWYA 1MJHA 3F73A 3GLGA 5E1MA 3TKLA 3U56A 1X94A 3WG9A 4Q9DA 1XNHA 1YZYA 1TUBA 2V0NA 2YV1A 3WX0A 1K2WA 2K7ZA 4I55F 3QELB 4QREA 1E2LA 1C7EA 5EIEA 4PAMA 2G9UA 2QRQA 3IR7A 4E03A 2H1OA 2R48A 3HA5A 3V4SA 3KXKA 3ESDA 4K1LA 3ZN2A 2DHCA 2H1SA 2JAUA 4WA8A 1ODTC 2R1ZA 2Y71A 1QZ3A 4BAGA 1W85A 1WMSA 2HWWA 5U1PA 3EF1A 3DE4X 3UMMA 3C5CA 4HQRA 4DR2B 1N6PA 1TRKA 3IP6A 1A1SA 1KYQA 2COUA 1NBOA 1YMVA 2C2OA 2H5JA 5FO1A 2PMEA 4OMUA 1XZIA 2VRWA 3LHIA 1E6KA 1VSBA 1Y82A 1Z7WA 3M6FA 1CY7A 3GFBA 4YT5A 1NW3A 4DM7A 3RYCA 2MSLA 1UBRS 4OQPA 2ZBFA 4TOIA 3RDPA 2GKOA 2PRZA 2C58A 1QRDA 3HU2A 4DSZA 1T24A 1P4HA 1X1DA 3KKQA 4R1NA 3U3KA 4ETIA 3KQLA 1KKUA 1WPRA 2WKQA 2XCUA 3X44A 2ZUVA 1O94C 1JWLA 5IH7A 3P0RA 5DOZA 4PZPA 3VFDA 3M4ZA 2J67A 4XX0A 5B7PA 3OOHA 4OFWA 1JKXA 3RH0A 2BCJQ 4IG9A 4ZDWA 2BISA 1P62B 3AR3A 4TMVA 2ZBRA 1PT6A 2Z1MA 1J5XA 2XR1A 4FTWA 1N6OA 2CY0A 4LY9A 2VUIB 2ZU0C 3R6WA 2DFTA 3S7ZA 1TM1E 3QENA 1YXMA 4IHKA 4F4HA 4MA0A 3PR2B 4C08A 1P91A 4YRRA 5TE9A 4A2PA 3S1SA 1GLVA 4NBUA 3HO1A 5L8VA 2BKLA 2GZHA 5K4HA 5T41A 1YR3A 4MUJA 2IUYA 2GBPA 4D56A 4KO8A 3HB0A 2GCOB 1SBZA 3OLQA 4P08A 5ALMA 1RXVA 2QPAA 5KJ6A 3V9PA 3BDIA 1FFYA 3BGSA 3CNNA 3DOUA 1M2GA 4C4OA 4QUKA 4ND3A 3NHZA 4IIBA 3GH3A 3GJ0A 2YUTA 3MCAA 4TTIA 4R9UC 1BFDA 5L40A 2ES4A 4EGAA 1R0SA 3U6BA 3LD9A 4BRZA 4QOEA 3MBIA 4AX8A 4OXKA 4CQLB 3A4MA 2JGAA 1OBOA 3O21A 2R7NA 1M34E 2PWZA 3NHYA 4PG4A 3D5QA 3AMVA 3B9QA 3RS5A 2FF5A 1PYDA 2YJ5A 4K05A 1AQUA 2P3LA 1LWOA 3N1UA 4M9QA 4KYTA 4F12A 5DOVA 2JAWA 4UE6A 3C3JA 5FPTA 4U7TB 4IKPA 4N49A 5ADHA 4CODB 3LHSA 1I4WA 1XD2B 1YV9A 2HQOA 2ZKLA 2ZRBA 4FYYA 4GMFA 4Q9LA 4DLKA 1KQFA 4C3OB 3WHIA 5CEFA 4K9MA 1T3TA 3WWPA 3C3PA 2GF2A 4LNAA 1HF3A 4UU0A 4XA8A 1DC3A 1R50A 1M6WA 1JJAA 2UZIR 5B53A 5BQXA 2BGTA 4IFTA 5FTWA 2RHJA 2VRBA 1MT0A 2AZ4A 4GQIA 4TMFA 3EQZA 3U9TA 3CTPA 5K4GA 3KZXA 3JXEA 2GDJA 4WBSA 2BFPA 1KF0A 1KZGB 1LSSA 3S4YA 1O6GA 3ICQB 2OD2A 1LEHA 2AN5A 5FA5A 1HA3A 2OSBA 3L7KA 5CB4F 4EJMA 5JH7F 5IS2A 5D86A 1Y7HA 1TQ6A 3TQSA 3QUBA 1AKUA 3LIPA 10MHA 5FPPA 4QJ3A 2C3YA 3KB8A 3STTA 1MDFA 1NLZA 2HAEA 4L4SA 3QPWA 4G1MB 4MROA 5AXAA 4DMHA 2JNWA 3ABOB 1T0JB 4L57A 5MGBA 1HYHA 5KTKA 3HKCB 1D2RA 1DRVA 4LZLA 1LQ2A 4CU2A 4DPKA 2XEDA 3FPCA 5IEJA 4LF6B 2FFBA 1OFUA 4B4UA 1JB1A 5AD1A 5B6JA 1Y4DE 5KKAA 4FFLA 1ODKA 5AVTA 1WZNA 1O77A 1N0HA 2XQIA 3MMPA 4JJEA 5IASA 1MC4A 5J43A 4R8MA 4A82A 2WJ3A 4N6NA 4ND2A 3VYVA 2WVJA 2P35A 4NCJA 5IJ0A 2FMFA 1NPDA 3CF6R 2QHXA 2ORWA 1VBFA 2X9LA 4QUHA 4Y3UA 1P1BA 3SGLA 5HVNA 1FJXA 3VV2A 3SYLA 3TXYA 1NF8A 3R5SA 3R8FA 4JNKA 3ZDFA 1JNXX 1CZOA 3DWGA 2QRKA 1FNBA 3M49A 3WB0A 4D0LB 1V95A 2QAGA 5IHXA 5JAIA 2A8YA 1RWWA 1ZO8A 2MIIA 3G8AA 2ONKA 3JQGA 4TSFA 4BVHA 1II8B 3VYWA 2QRHA 1E58A 3HCNA 5DYYA 3HSKA 4D4KA 3QE9Y 3DV2A 2YVQA 1WY7A 2RHWA 3I9JA 2X5KO 4MK4A 2HRDA 2NQ8A 1COWA 1TNDA 1ZVKA 4URYR 4LW8A 3HKDA 3VH3A 5JD4A 3TMYA 4BO2A 4Y7DA 1NQVA 4BWFB 1RRCA 2OCDA 4OMCA 2FY8A 1TMOA 5JUWA 4HQ6A 3UUGA 2NSLA 1UUFA 1P0IA 3KQQA 3K4HA 4JL8A 2RG7A 2HCTA 3H65A 2H5IA 3PNBA 2NMVA 2WEKA 3BERA 3JZDA 2PLWA 4A15A 4JK3A 3HWX1 3FPGA 4WSOA 2HSZA 2R00C 3AF0A 1LJUA 3NM5A 1MVOA 2AMLA 4ZODA 3QSYA 1AKEA 1ZFNA 3BL6A 4CKWA 2XCQA 4V1CB 3CUEF 4D0SA 1T2VA 2VQSA 3D2CA 4MR7B 4X8LA 5AKGA 4RHXA 4B7XA 4MDEA 2HKIA 1E3DA 4A16A 5IBCA 1NQXA 2DCUA 1CE8B 5IDYA 2YIJA 4XD2A 1SZPA 1V11A 5F3RA 3MT8A 2BMDA 1PR3A 1CJKC 4LNUB 4B74A 1CS0A 1WU8A 1GNVA 1D6MA 2A9VA 2NM0A 2O48X 2VK2A 4BE7B 2BI4A 1FFAA 2XVZA 4B85A 5KTMA 5LPNA 3H2ZA 3W5HA 1M72A 3S1AA 1QO7A 2VYNA 4UPDA 1NW4A 3V42A 1X7WA 4Z4HA 1Z9BA 5DISB 2R62A 3DEZA 1T5LA 2PS0A 3QEOA 2V7XA 5EIWA 3RYFB 5EN4A 4G2TA 4JQSA 4KZPA 3OQNA 1RZRA 2PA0A 3EDMA 2CJFA 4OKSA 3T5GA 2BHNA 5DT2A 3FDFA 5FBVB 4D1YA 4XGNA 1N8NA 1VPTA 4O4HB 1JAZA 4ITRC 2AXPA 1LPNA 2I2BA 1C3XA 4FMPA 4QVIA 2FPPA 5JNSA 1JPUA 3TEFA 4YRIA 3ITDA 1US8A 4ZRDA 1RWNA 2B4AA 3AH8A 4XUDA 4CM7A 4ESHA 4Z2AA 3W4JA 4IDQA 3TTUA 4R54A 3HP7A 3PQ7A 1Z4KA 1HK7A 4DCGA 2R1VB 1KIFA 3PRKE 5JT1A 3C3KA 3T1YB 2CHGA 2RKBA 2M6SA 3PDIA 3C2QA 3HZHA 1NMYA 3C7AA 4R3UC 2HHLA 1GAJA 4BYMA 3KXDA 3CGWA 4CG1A 1ZYUA 4QTUB 3COJA 2OHHA 3OPVA 3DMRA 3OFND 3A05A 4Q01A 4XTRA 4B6OA 2N1MA 4ZJYA 5B7GA 5E9AA 4PNZA 3WV4A 1KQOA 2CLMB 4RNCA 3LQQA 1ACLA 3HR4A 1I7DA 1EWKA 1C0IA 2O7RA 4C2AA 4PQFA 4BNHA 4DEVA 3PPXA 3PXBA 4LQCA 2XT0A 3F5FA 4UE2A 4Y1GA 3WZ2A 5MFZA 4U63A 2Y1WA 1A76A 4BNXA 4ESEA 2PSFA 3SR4A 1EM8B 2R84A 2HK9A 2PRYA 3QVTA 4P8RA 1VI6A 3A2MA 3LGXA 5DHUA 5EP1A 3UCXA 3WLSA 1BYUA 2CL5A 1QGYA 4CUZA 1XCLA 1MZVA 1W5BA 1J8YF 3OT4A 1GLGA 2CFCA 2PLFA 4DLPA 1W48A 1T0PA 2OCKA 4JR0A 4BBJA 4EW1A 5C5CA 4YJFA 5BO5A 4UAGA 1MFPA 1QYIA 2B25A 2IDMA 1A98A 4KOAA 3WZLA 1ZMBA 2EQ5A 2IU3A 3D7NA 3IXMA 2Y0PA 3RUIA 3ZTWA 4EEZA 1LLQA 1RPNA 4C3UA 1INLA 4L0CA 4V0OA 4KR9A 3VU9B 4F92B 3QFSA 4UZFA 3UWOA 1E3WB 3QEJA 4LECA 3KSBC 1PYGA 5J1TB 2QMQA 2Z1NA 2NT3A 3SBOA 2XVXA 2HDHA 4XUEA 1YSCA 4ZGGA 2EZTA 2VDOB 4FFNA 5B2FA 4OQDA 1OGJA 4CM6A 1E7WA 4HGNA 1ABEA 4F9EA 2WTNA 4LHXA 1M6YA 2JGDB 3VKFA 1E1CB 1B6GA 3EVGA 1I01A 3IKMB 5J4KA 1C3OA 2AEMA 2X13A 3JAKA 4HXFB 3HY4A 3FY4A 1RPJA 4M9UA 4RDIA 5E95A 1HQYE 4B3FX 2F64A 4C89A 4C76A 2RE8A 4HDAA 3U4DA 2NP7A 3NCHA 3R24A 1SKBA 5D7NA 3VR3A 1BS2A 3OM8A 4MIOA 1HNZB 1JYSA 1N6IA 1Y5NA 2BMVA 4OM7A 3LUFA 1CS0B 1N77A 2GB4A 1S96A 3E4DA 2J3MA 4RK4A 1G19A 4EPWA 4IHJB 3EZNA 2HPHA 2PSSA 4BMOB 5ERYA 1QX3A 4RV4A 4WLFA 4WV3A 1NVXQ 5LYJF 2G1PA 1OYOA 4WNAB 1KR5A 1SC3A 2HCJB 1EZZA 2QWXA 3K09A 3K4QA 1OXMA 3ANYB 1OPRA 1UDAA 4L75A 3I8SA 1PT8A 3W5VA 3W2IA 2WQZA 4M2LA 3B1JA 1GTL1 2G9NA 5J58A 3AFHA 1JZQA 3B3QA 4BQEA 521PA 2ZXUA 1O57A 2FWAA 1HNNA 2HCFA 3ONWA 3PNQA 1ETHA 3VPDA 4WNIA 2EBHX 4RKFA 4LOHA 2V3VA 5J2UA 4YEDA 1UK7A 2QUBA 2ZBDA 4UVHA 3W5BA 2YZNA 3EMKA 1F3LA 2UYHA 1YT5A 2IELA 2YZ2A 1I36A 1GTJ1 4LJ7A 2CHFA 1N2HA 4B75A 4QU8A 1R8QA 1NPYA 3R0JA 1UT6A 3DZCA 3UA3A 1EBUA 1ICIA 3R3JA 1FOEB 2V6MA 4H77A 1YDWA 2CMFA 2IODA 2Q4DA 4V0MA 1YONA 2K4MA 2GNPA 3N8HA 4PLYA 3KFVA 1O89A 1HQKA 1M8FA 5T3YA 3ZY6A 4F3YA 5HKBA 2CXNA 3QTTA 1BKYA 3WL5A 2OBBA 3TZQA 3DBHA 2J3HA 1E6LA 4ENVA 4MKIA 2PRSA 4RIEA 3LL7A 4TS4A 1VCIA 2QDXA 2PY6A 4RXTA 3W79A 2WQ7A 3AVTA 1TADA 1JSXA 1QYCA 4EGFA 1OLOA 3K9QO 3REFA 5CHEA 4U9HS 3SBXA 1AURA 1IH8A 3ZGVA 4BKRA 4K9NA 4XRGA 1IHOA 1RM5A 3I04M 1K8QA 5KYGA 2WD7A 2WZBA 2P2CA 4NCBA 3KJEA 1A9YA 3O03A 3WYFA 1ENZA 2BRUA 3IRUA 1K08A 2AWNA 3R3YA 5IUKC 5AK4A 821PA 2DBVO 5ICEA 4G0WA 1U7ZA 3G3EA 1FFXA 3G7UA 1JPNA 4ZI3A 4MVJE 3ON5A 2CWDA 2RONA 2DQSA 3A6LA 2DFKB 3GVHA 4GLJA 3L7OA 2IKQA 2PZAA 3LOUA 4KQKA 4MCHA 4MS1B 2V55B 3K9CA 4MOWA 1LBQA 1RXYA 1OWMA 3VV3A 1YTLA 3C85A 3A1WA 2EZ9A 1H9BA 1S8FA 2IXGA 4ZO8A 2Q1UA 4Q15A 3B2QA 4YQZA 1CQXA 4RTJA 4GKKB 1P4SA 3B52X 5H02A 3PFKA 4KQ6A 1XTRA 3GJTA 1XZ8A 2YXLA 4TTRA 4A4DA 4REQB 1S2OA 3ZCUA 4FE7A 4R51A 1PR5A 2Q2VA 1NLYA 2FLKA 4LRWA 3AVWA 5JISA 1B23P 2QR5A 4RZUA 2HCRA 1T5SA 3CNQS 2PE5A 1FS4A 4QQKA 5FTMA 5FI3A 4UQLA 2IYAA 3T9EA 4GNRA 2A0WA 1XLVA 1C0KA 1X74A 2ZWOA 4AY3A 2DPMA 1QFZA 4G9GA 4BLUA 1M33A 1RLOA 5C35A 4H0NA 5L3VA 1EA5A 2QE6A 1XTQA 1FNCA 2W6JD 3ONVA 2OGWA 2AZTA 3BAFA 1ULZA 3N70A 3QYPA 3IPRA 4YJHB 3WYDA 4ZJUA 3BOSA 1ADCA 3BIOA 4E5VA 4Y6SA 4ZREA 2C5GA 2WWVD 1PNTA 3M6LA 5FPYA 1FDRA 1Y37A 2DHQA 1D4OA 1P9NA 3N39C 4HWPA 1WPXA 4LYJA 1OIVA 4RC9A 2ONYA 1Y8QA 3ZHRA 5KX5A 3RTDA 2DG2A 5AM1A 3ED1A 3UC5A 1DWOA 1TLLA 4FHDA 4PLVA 1UZUA 3ZH9B 3ZXSA 4PLGA 2AVNA 3IOCA 4RSMA 3FLMA 2CNDA 3NBYC 4R1SA 1E5XA 1RVDA 4IZOA 4IOJA 3KCQA 3IHTA 1P7YA 1ZD5A 4G0UA 1RR6A 3PNMA 4IOMA 2ZJ1A 1E2PA 1GTG1 4K26A 4PYKA 3LRTA 2GHTA 4E11A 2PXCA 2WTXA 3LKBA 3A6ZA 2O8FA 1RCTE 4X71A 3DWEX 3PQ6A 1FEZA 1X1QA 3RREA 4G0VA 2GUWA 2VQ3A 6PFKA 4RPGA 3ZE8A 3TJRA 2V65A 3FE2A 4ZQIA 1SCJA 4KQ2A 2VDMB 3E22A 3OJ0A 4RHFA 2D3TA 4TM7A 2RHMA 4INOA 3VO1A 1GAEO 5DBIA 1Z5NA 3HHEA 1MEOA 1W5SA 2YR0A 3KLBA 4YV1A 3ECAA 4B3TB 1UK6A 4PGAA 3WL3A 2AC2A 3A1EA 2UVQA 1AK9A 3UCEA 3EFHA 2O3RA 4R3WA 3AIIA 4UEKA 4Y9SA 5LLSA 4JI3B 1L5FA 1CJBA 4FFWA 3E7PA 5AHOA 4XOUA 3T8YA 2WKWA 1F0KA 3ETLA 3I23A 5FL7D 2AIRA 1LX6A 2W5UA 1FP6A 3IJ5A 3S2ZA 3TGWA 1MC1A 3H5OA 2DERA 4OQYA 1QUFA 5LQSA 4JT8A 4A6EA 5L53A 1XQYA 4EJ6A 1WL8A 4NU6A 5EVJA 4ZAYA 3WFJA 5K3DA 4O02B 4BZQA 5BWNA 4H4EA 2CE7A 3KPWA 2VN8A 1VLLA 3ONEA 3TSCA 4HZGA 1OUMA 2NGRA 2X5XA 2ZR9A 3WP1B 2Y0DA 1HORA 4JFAA 1CT9A 4HATA 2ZRLA 1P60A 3R6LA 1T9GR 1QPGA 3QF4B 4L6CA 1HTBA 4UFNA 2Y1GA 1DKOA 1R8SA 3ZH2A 3MMNA 4EA8A 3EXIB 2DH5A 2VSFA 2WJGA 2G5PA 1Q6ZA 4WOPA 2A33A 2BONA 4DLRA 5CLJA 1T6XA 3HJBA 2D0DA 3NWBA 3MLBA 5JYDA 4ARCA 2WJ6A 3ELWA 1ZHHA 1T1IA 2YY6A 1JHQA 1SCUA 1Y1KE 1YI1A 4MIEA 4YUYA 2CBXA 4BNNA 3AR4A 2IXDA 1W2GA 1CUZA 4FI3F 5DP1A 5EZ6B 4DC0A 3EOAI 2R9VA 1FFWA 1S2DA 4GVXA 3ROFA 5JAUA 3CRQA 3ZGYA 1NVWQ 1YK1A 4QGFA 5G0VA 1KARA 2Q5FA 3OHPA 5BSRA 1KDZA 1W1WA 4BO8A 3ENNA 2F2TA 3KVYA 3LX5A 5IT5A 4HWOA 5MDHA 1TFRA 4K3UA 5HA5A 3K9NA 2JK1A 1CIVA 4NFSA 4N18A 1AVTA 3N0TA 4RK1A 4UTZA 3UJHA 3KEOA 1Y1RA 2V0CA 5DBGA 4Z0NA 2J1LA 4QUBA 4OHXA 3LLVA 2ZRMA 4X44A 1KE2A 2FEXA 3GDGA 3VR5A 1E2NA 2BF7A 4AK9A 3CKKA 1WETA 2DPHA 3SIWA 4FFDA 3ECCA 3F5MA 4F2DA 2FWPA 1QU2A 4YTEA 5K9ZA 2ZWAA 2YVKA 3H5VA 4GS5A 4N7BA 1Z12A 4OP3A 1NY5A 1UEIA 3VR6A 4NXMB 5JCXA 3EF3A 4GLLA 3JYQA 1D8TA 2BAGA 3IHLA 3LL4A 4LNHA 1LFAA 1RWVA 1VTKA 3OECA 5FR1A 2QI9F 1HUQA 3BXOA 3ZV6A 4GYJA 3I2YX 2P4EA 2GFIA 3IQDB 3QKRB 4GX0A 1ODFA 2NLOA 1FJ2A 1GITA 2D7JA 4FOTA 4F5YA 1ID8A 5DGCA 3F98A 1SD2A 3SF8B 1XQ9A 1QAMA 1SXQA 2BGJA 2GK7A 3N9IA 2BHRA 5FCDA 5TT1A 2J7PD 2GJKA 2GPSA 2EEZA 2E37A 3QMWA 1EFVB 1FRQA 4GE3A 4XJXA 3WLRA 3FVVA 5I8ZA 4X20B 3EOZA 1M9NA 4MPTA 3MOSA 5BSTA 2PNJA 1TVMA 3BHNA 1WPQA 3U4GA 3ZHQA 1XXHE 1XL1A 1FA9A 1KXJA 2FRXA 3EWNA 4WXYB 4ZOAA 4ZZ3A 4IF4A 4LF4B 1Y6QA 2GZMA 5SICE 4PZ9A 5KTSA 1VKZA 2FH5B 3P20A 4AS1A 2C5BA 1RADA 2A35A 3IJEB 1X38A 3VU3A 2VP0A