2AA3A

Crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
b'TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
total genus 115
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aa3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2aa3A02
4H7PA 1ENZA 3C7AA 1PQWA 4J16A 4NNJA 4TZTA 1XQ1A 1J5PA 3EVTA 3FNGA 3GPIA 3K30A 4MIOA 4Q3BA 5DOVA 1PR9A 4XIYA 2EWMA 4ALJA 4FQ8A 3GAZA 4YEDA 5TX7A 4ALKA 4WLOA 2Q99A 1BWSA 2HRBA 4PZEA 5IXSA 5KNLA 2C7GA 1F8FA 4DBZA 1XG5A 4UREA 3VHRA 4CR6A 4XQGA 1EVJA 2PH5A 4IPTA 5GMOA 1EVIA 5TF4A 2BGLA 2Q2VA 4PFJA 4Z3KA 3WGOA 4O5OA 2Y99A 5A3JA 2IODA 3WGYA 1YXMA 4CV3A 4BGUA 3DO5A 3HDQA 1EBFA 1UDBA 4U5QA 4YAGA 4Z3DA 1HTBA 5GY7A 2VCYA 1A5ZA 1UH5A 1NFRA 2WD8A 1EMDA 1N8KA 4RZIA 1EFKA 3AK4A 5MDHA 4FN4A 4K26A 1LSOA 1U5CA 1VSUA 4XYGA 3RC2A 1RM5A 3TWOA 2ILTA 4O63O 3NUGA 4R01A 4ZN6A 3EGOA 4WLEA 4XYEA 4FOOA 4G2NA 3RBXA 2FR1A 3CH6A 5A5FA 5L3ZA 3LLSA 1IZ9A 1T2AA 2DFVA 2DTEA 3OA2A 2XF8A 4RO0A 2O7QA 3PYMA 1GUYA 3AU8A 1QORA 3C1OA 3ROQA 1WP4A 5DOZA 5ER9A 1GEEA 2YQ4A 5CEFA 4L4XA 1EQUA 1LDMA 1DIHA 2Y1GA 3E9NA 1IOLA 3H3FA 3UGKA 5BQFA 1B14A 1G6KA 4Q3DA 5CDGA 2BH9A 1K6JA 1S6YA 2VOJA 4YJHA 5GZ6A 4R5HA 1NWCA 1HL3A 3F1KA 4R1TA 5FI5A 2GCGA 4DL9A 3E1KA 2FSVA 2PY6A 4YRBA 3M2PA 4D79A 3ZWAA 3GF4A 4ILKA 3R0IA 3PRJA 1ZJYA 4NIMA 5AVOA 3GY0A 1FF9A 4FBGA 2X7HA 1DRVA 1ADBA 1BG6A 1E7RA 3FNEA 4RQTA 1CRWG 3OH8A 1ZK1A 1PL8A 5AXBA 4P4NA 4ZQFA 1E92A 3PTZA 4N5LA 1Y8QA 1N2SA 3HFSA 2ZKLA 3NDRA 5L7WA 1O9BA 4WK6A 4N54A 4CUZA 4OM8A 4NZ9A 4XA8A 4OO3A 1DHRA 4D3DA 1Q2XA 2YY7A 2BFOA 4BKRA 3I9LA 4FFNA 4IZHA 4QFDA 4CM3A 1DIRA 4ZHSA 5IZCC 4YJHB 3S1LA 1ISMA 2CF5A 4DLAA 3P2OA 1V3UA 1ADCA 5EN4A 3EZLA 5I7EA 3GPDG 2BGKA 1DJQA 4Y6SA 5JDCA 1ID1A 4WLVA 1YB5A 2O4UX 4BO2A 4YT4A 2IYOA 3JQ9C 3RUCA 4EZBA 3CZRA 4IS3A 3ZN2A 4BNVA 4YAIA 3ZW8A 3F4LA 5G4LA 5CPBA 5CPFA 4D43A 1ZVMA 2RBEA 1WDKA 1PWXA 3JQAA 1ZK2A 1U8FO 4MKZA 1IHYA 2R00A 3JYPA 3B1JA 4BO5A 4CM1A 4YPOA 2C07A 2C2YA 4CM6A 2DBQA 2X5JO 3OJFA 4RF5A 5TNXA 1JA9A 3HSKA 3K92A 1RM0A 2QZZA 5ICMA 1AUPA 1Q7BA 3WXBA 3LC1O 4CMBA 4BB6A 3QSGA 4GWKA 3PFWO 3GA0A 4ONEA 3V8BA 4TQGA 1IULA 3VH4A 5A4DA 4LSWA 1DXYA 1GAEO 2PGLA 5CDYA 3ZV6A 3KLMX 1GY8A 1NAHA 2C29D 2D5CA 3KOUA 4XIJA 2V6GA 4R5MA 4XQEA 4ALNA 3CMCO 3PGJA 1KVRA 4MVJG 4EBFA 3DZFA 3ICCA 2JD1A 3EUWA 4M49A 1EUDA 3GOHA 3PIIA 3PXXA 2YHUA 1VSVA 3H8VA 1SMKA 5CHEA 3C85A 3RQSA 3WQSB 3GQVA 1YONA 2X22A 3VPSA 1LX6A 7ADHA 1FDUA 3GFGA 3ZNNA 2O3QA 4NR0A 3LZ6A 2R00C 2GDZA 4J4BA 3TL2A 5EERA 4WCFC 1IPEA 4HY3A 4YJFA 1HETA 3HWRA 2Z95A 3DZKA 1ZSYA 4G5HA 2QRLA 2ZYAA 3WBBA 4WOJA 1E1NA 4KMSA 1UXGA 2UAGA 3UW3A 4EEXA 4OKIA 4BVAA 3DBHA 3L9XA 2Y1CA 4K28A 4ZRMA 5IXYA 3DR3A 4FSHA 3D64A 3D4OA 1J4AA 1UXHA 4J4HA 4NFSA 1GL3A 1UP7A 3WIDA 1JTVA 4DGSA 2PD6A 4II3A 2WSBA 3NV9A 4FOSA 3BMNB 4N18A 4J9VA 4OOEA 2FP4A 3FF4A 4GVXA 5JW6A 4DQVA 2Z1NA 1OAAA 1P1HA 2G17A 3AJRA 3PJDA 4BO8A 3UFXA 4PLZA 3E6AA 1X7GA 2JFFA 3I9OA 3ON5A 3PHHA 3VDQA 2O2YA 2Y68A 1U3VA 4BO4A 4BMVA 2Q1UA 5EINA 3GNTA 4FC6A 3ROPA 1CERA 4L8VA 3JQDA 2GERA 3AOGA 2CSUA 4UVHA 4INAA 5IG2A 3ZH2A 4YJFB 3VVBA 1ENOA 4MINA 1JLLA 1YQGA 1Z82A 4U7WA 1K2WA 3OJLA 4LK3A 4LRSB 4XZ3A 3ITDA 5TRTA 4K6FA 1ULSA 4IM7A 4FFOA 5A9RA 2VZ0A 3DBHB 2Y66A 4TVOA 3ZHBA 1CQJA 2BKAA 4E31A 2NQTA 2YYYA 4W7HA 1I32A 2Q1WA 1CWUA 5EMHA 5HS4A 3V2HA 2H5LA 4WEOA 3E82A 2B4TO 3L4BA 2X23A 5KVSA 1JAYA 1NQTA 4OJNA 1XYGA 1Y81A 1E77A 3QIVA 4UUOA 4A03A 1A9YA 1KETA 4B79A 4BKOA 4BNFA 1QXSA 3MJEA 4D3SA 4P22A 3BYZA 5TIIA 2VUUA 2W2LA 3I9KA 2NTNA 3UCEA 1R4MA 2YDXA 4CLXA 2X0JA 5CEEA 1E1MA 1CEQA 5KJ6A 1JKIA 4ND5A 5JNLA 4A0SA 4YBZA 3AY6A 1PX0A 4NHEA 3K73O 2OHXA 3O03A 2GZ1A 1ONNA 4JXKA 1F0YA 3L4SO 4AJ4A 5LCXA 3COSA 4GL4A 4DXHA 4CV1A 2HK7A 1AHHA 3ZGYA 3SJUA 2IZ1A 1ZK3A 2GYYA 3H5AA 1M2WA 1PZGA 3P5SA 3UXYA 1Y6JA 4ID9A 4W7IA 5C3MA 3BHMA 3DDNA 3DFUA 3QRWA 4BS9A 4HV4A 4WOKA 4CUKA 4E5MA 3DZBA 3PGXA 4RPKA 1IY8A 4ZJUA 2OBYA 1KVTA 3WJ7A 1DEHA 4PGFA 2YUTA 5TT1A 4PLGA 5I7VA 3H2ZA 3SEFA 3KTDA 3UH1A 2OUIA 4Z9YA 3WDSA 1FDWA 1DB3A 3DBRA 3LLVA 4JJFA 3TSCA 1NXQA 3DB2A 4J1NA 2X9GA 5AXCA 2NADA 1YO6A 2Q1TA 3JQBC 4OOFA 3RUIA 2JFHA 1ISIA 4CQMD 2LDXA 2Y1FA 1UXIA 3FHLA 4IDFA 1ZNQO 3WJAA 5B1YA 1A7AA 1LXCA 2JKVA 1WMBA 2HAEA 4CJXA 1E3IA 2NSDA 5JY6A 3V1TC 4PZDA 1CDOA 4I9UA 2IYPA 3GHYA 1TT5A 2JFGA 4LSMA 4W4TA 3WMWA 1BDMA 3ZU4A 2BI7A 4B7UA 4CLOA 1A9ZA 3UVEA 2P5UA 3W4KA 1UAYA 4M8SA 2R6JA 2PKQO 5G4KB 4WKGA 2EG9A 4PLTA 5IDQA 3LC7O 5JC8A 3RJ5A 2NV6A 3DMTA 3FBTA 1P1KA 2D3TA 3KETA 1PQUA 1U2DA 3FPCA 1GUZA 3DBRB 1KBZA 3MJCA 5ES3A 3B6ZA 1G1AA 1V3VA 5KIAA 1M66A 1KC3A 4GMFA 2GNAA 4YQZA 1H5QA 2D2IA 3L6EA 5IDWA 5KKAA 3AW9A 1HE2A 1QRRA 2V6FA 3MWDB 3QE3A 1PWZA 2HUNA 3GAFA 1UR5A 3ZHXA 2OGUA 3PYXA 4XJSA 1IZ0A 4GX1A 4YCAA 4AJHA 5JO0A 1NVTA 4FFLA 5THKA 3MTJA 3RUDA 4CLOB 1OFGA 1UAGA 3T4XA 1NR1A 4ITUA 4CLEA 5KOIA 4XRRA 3GZNA 4JP2A 5KJFA 4I9NA 5T6BA 2X9NA 1K3TA 4FJ2A 2Q50A 2BRUA 5DT9A 1GTMA 4KWIA 4GH5A 1KIFA 1DFGA 2NU6A 4XDZA 4RLSA 2EGGA 4H3VA 2EJWA 1YBMA 5TJ9A 1IYZA 5BSHA 4PCVA 4CMIA 3V2UA 3LYLA 1ADGA 2W2KB 2E82A 1NFQA 2NVWA 4HFJA 4F3YA 1CJCA 3ZWXA 2WJPA 4BV9A 1EE9A 4RJTA 3VPHA 4KDFA 3PQEA 4RPGA 4JN6B 2P9EA 4WNCA 4CM4A 4PVDA 3ETGA 2UDPA 2RHCA 4K1LA 3N74A 3EVNA 3IUPA 3GZNB 4Y67A 1DLIA 4BNIA 1G0OA 2HSDA 3ST7A 2VQ3A 2B0JA 3DC2A 4CL3A 3KSUA 5L95A 4EUHA 3TZKA 1LNQA 4Y98A 4B8WA 3VPGA 4I1IA 3LT2A 4JCOA 3RKUA 3GC6A 3WBFA 3ZHYA 4IUYA 1PJQA 3LF2A 3WYBA 4CMIB 1QLJA 3TQHA 1M6HA 2GLXA 2ZJ0A 3JQ7A 5IZ4A 2YV2A 2P2SA 1SOWA 1HE4A 1SCUA 1JU9A 4FCCA 5F1OA 3EZYA 2AE2A 2B4QA 4A27A 4PG8A 2DVMA 1YL7A 2DTXA 4I5FA 3GFBA 3IIEA 5A3VA 2EEZA 3WLFA 1B0AA 2X8LA 1I30A 3M1AA 1X7DA 1R4NA 2CDBA 4XGIA 2GN9A 2X9VA 5A03A 4J7XA 2Y05A 1NTOA 4PLVA 1MFPA 1DC3A 3RBVA 1UXKA 5G2OA 4B3IA 3I52A 1I01A 1R12A 4DIOA 1U7HA 3DAFA 5L51A 2UVDA 2J3HA 4J1SA 1YBVA 4XDYA 3IJPA 1PIWA 4FR5A 2GPTA 1B2LA 5IN5A 1GPDG 4IDAA 1O8CA 1A4IA 4RV9A 4EYEA 1VE9A 4ZQGA 1N9GB 1XU7A 1KY5A 1QYDA 4GGPA 3O38A 1E1LA 3F1LA 2ZK7A 1CETA 1NR7A 1O5IA 2HMSA 2VNAA 3UCFA 3GHHA 2QX7A 5LDHA 2CMDA 1NHGA 4Z0TA 1GUFA 3ASVA 3ZWBA 4BNHA 1NASA 2RCYA 3M2TA 1PL6A 1WLYA 2W90A 4JJGA 3UF0A 4Q39A 3M6IA 3IUSA 3TNLA 3AI3A 1LDYA 4IQ0A 1HE5A 1LRJA 4OH1A 3RUAA 1RKXA 3GDOA 3PLNA 4MVJI 3RU9A 1T26A 2P9GA 2WD7A 3BIOA 3JQFA 1ZEMA 5F5NA 1SAYA 1V3TA 3MWEB 4EEZA 8LDHA 1JN0A 1VKOA 1R0LA 2C2XA 1GQYA 2O2SA 4IJKA 4QO8A 5KVVA 1E6WA 2G5CA 5F5LA 3QQPA 1XA0A 1JW9B 3WGIA 1YBAA 4A2CA 4O59O 2FMUA 3OF2A 1V6AA 2HJRA 2FY8A 2GO1A 5L40A 2CF6A 1D3AA 1DIGA 3I5MA 4E0BA 1PJ4A 3GDGA 3K6JA 4NFYA 1LLCA 1HYHA 1B8UA 2LDBA 3MTGA 5COBA 4XKJA 4S1VA 1DAPA 2YZ7A 4O6VA 3IQDB 3GGGA 2JCYA 1WMAA 1AXGA 3KYDA 4CMCA 2HMWA 3NKLA 5L7TA 3HDYA 5JCXA 2BLLA 1PJTA 2BFAA 2D1YA 2I9PA 2WD7B 2E6UX 3ZZNA 2AE1A 1QG6A 3DZHA 5DZSA 3GNSA 4GAEA 2JCXA 3UICA 2E4AA 1X0VA 1EDOA 5KJEA 4YRAA 3FR7A 3I6QA 4PLCA 5C7OO 5IN4A 3TN7A 3H65A 4R3NA 1ORRA 3RUFA 3MJTA 5EPOA 3D4NA 1NVGA 1PS9A 2H63A 1W4ZA 3GRKA 2QRKA 2Q45A 1ADFA 4NU6A 4J2OA 1R0SA 2DQ4A 3TPCA 1HWYA 3F4BA 2ZQZA 5A9SA 2GZ2A 1VKNA 3AOEC 3DAGA 3DMYA 1P33A 4BO3A 1HF3A 4D45A 1C0IA 4RF2A 4E5NA 1LUAA 2YDYA 3ZV4A 3EW7A 4MVJE 3ICPA 5T64A 2D0IA 1SOVA 2V65A 1KC1A 2JCVA 3BTOA 3E18A 3GMSA 1Q0LA 4UUMA 5I9LA 4RL6A 1YRLA 1HSOA 3KYDB 5J23A 1GYPA 1OOEA 3ZWYA 3NJ8A 4KUGA 2ZB7A 1XKQA 3VZQA 2EW2A 3LQFA 3GNQA 3Q2IA 3WGQA 5JCJA 3AUUA 5G0UA 1VPDA 2H1SA 1UJMA 2Q4EA 3FSRA 3AUTA 4HFRA 3U3XA 5KCZA 3AM5A 1YB4A 3I4FA 3WMXA 1I24A 4UVEA 4FPXA 2EJVA 3RVDA 2C59A 3DL2A 1R0KA 1N7GA 4RVFA 2NTJA 1I8TA 4JNKA 1JKFA 2EKQA 4JX8A 4MP3A 5A9SB 3FRJA 1UZMA 1RPNA 3NTQA 3OJ0A 1AGNA 2OZPA 4BMNA 1ZKMA 2ZCUA 1O95A 3WFIA 1SB8A 3RWBA 1B26A 1PEDA 1E7MA 2WMDA 3P7MA 4GWGA 1NVMB 4MDHA 4CQMA 1MFZA 1WXDA 5KKCA 4KP7A 3CKYA 3PZBA 1O89A 2BFMA 1RYEA 2ET6A 4CV2A 4R1SA 5DP2A 2H9IA 3N7UA 2Y0DA 4BNYA 3E48A 5BSGA 3QWIA 5ADHA 1L1FA 4LVCA 2EIHA 4IJUA 3WNQA 2P9CA 4CQLB 4XR4A 1MC4A 1GZ6A 1TT7A 3OICA 2IEBA 3OETA 4MKXA 1GYRA 1DC6A 1MXHA 5JMPA 4AL4A 5JC1A 3RUEA 4E33A 2AMFA 3VH2A 2W8ZA 4XGNA 3H5RA 4AJIA 1XR3A 1UZLA 4Q3AA 3WSVA 1VRWA 3IDSA 4QSMA 4WPGA 4R3WA 2P91A 4QEDA 1B8PA 4E5YA 1EE2A 3ENNA 4DLLA 1FDTA 3PK0A 2OORA 1AHIA 2HLPA 3GDFA 2FHSA 4MVJM 3BA1A 3PI7A 3QWBA 3KVOA 4K9DA 4CQMB 2J5KA 2NU9A 1KVUA 4IDCA 2BHLA 2Q46A 3B70A 3DZJA 1I3NA 1Q1NA 4BO0A 1MUUA 2GZ3A 2AQHA 4CR8A 4PG6A 2ZATA 4Q3NA 5C5IA 1E3SA 1JVBA 3IJRA 4XCVA 1V8BA 3JYLA 3FI9A 1E7WA 3LF1A 5HS6A 1PJCA 2O3RA 3NX4A 2PZKA 1HDYA 3VZSA 4BNXA 2VT3A 1L7DA 4U8GA 3HDJA 2G76A 3I9MA 3AUAA 4KQXA 5IJZA 3D5QA 4Q9NA 3K9QO 5F21A 5JBIA 4IIVA 2GGSA 3KEQA 2A35A 3W6UA 1BVUA 3MCVA 3WR5A 5ENVA 5L4SA 4XD2A 3GG2A 5IF3A 2X5OA 2NWQA 1DPGA 2VNSA 3NDJA 2RAFA 1NQOA 3OECA 3IMFA 2XXJA 2FZWA 4L4SA 3PJEA 1HDXA 5DCYA 2DPGA 1H6CA 1SEVA 1TLTA 3H2SA 1JDJA 3ZV3A 1W0CA 1TVEA 4Y6PA 5DBIA 3JQGA 1RM3A 1ISHA 1ZZEA 3L6OO 5DP1A 4E6PA 4ZICA 3EDMA 5K9ZA 4BGEA 5COQA 2O4CA 3ZNPA 1NPYA 5IFLA 2C0CA 2D4AA 5CG2A 1MGOA 5HTOA 5CDUA 2AG8A 1QYXA 1GYQA 4RPJA 1BXZA 3ZU2A 4IIUA 1IB6A 1ONOA 2WTBA 1V9LA 4XR9A 4P4GA 4N5NA 2HCTA 4J49A 4MP6A 4NDNE 1HLPA 4J6FA 5T5QA 3IS3A 3GGOA 4JROA 5H81A 3TRIA 3KXDA 2X0RA 4OQZA 4BIIA 1HYEA 3DQPA 1QYVA 4WGGA 3ULKA 4BO1A 4RF4A 1LLDA 3CMMA 3LT4A 4RVSA 1I3LA 2P4HX 4BKUA 5EQFA 3AY3A 2Q2QA 1P3DA 3NTRA 4ALIA 1GQQA 4MJLA 5T8KA 1WZIA 1EQ2A 3JQGB 4E2YA 4YJDA 4UEJA 5JMWA 3BMNA 5JDCC 2CVOA 2E48A 3IL2A 3JTMA 3O8QB 3VTFA 1D8AA 1MV8A 1H2BA 2QRJA 3KBOA 2NVBA 4YJGA 3UUWA 3PDUA 2PLAA 1U28A 3GN1A 2VWPA 1F17A 2FOIA 1UZNA 1A7KA 1PS8A 3WIEA 3TFOA 1ZXBA 4PLFA 4IQGA 2AQ8A 1DFHA 4CODB 2JHGA 3ETEA 3AUSA 3AWDA 3G3EA 3RUHA 1GV0A 2O3SA 6LDHA 4YAJA 4L9RA 4S3MA 5HRUA 3HE3A 3OA0A 4YYZA 3H5NA 1LTHR 4XWYA 1WAMA 1DC4A 2I3GA 8ADHA 3Q2KA 1UP6A 2NNLD 5LDGA 2BMAA 3LT1A 4MVJH 2X5KO 3OIGA 1WDMA 1XCBA 4UVDA 3PZRA 4UVGA 2RH4A 3DOCA 3WFJA 4AG3A 2HQ1A 3OEWA 2IXBA 3E8XA 3QP9A 4AJEA 1BW9B 4ZQHA 2YFHA 1OMOA 2C5EA 3TZHA 4FFRA 4YJGB 5FWNA 1ONPA 3WOHA 5F1KA 3TFQA 5IDXA 4M55A 2RHRA 4GI2A 4GMGA 2GF2A 3SVTA 5A02A 2CZCA 2QZ9A 4TROA 5DCWA 3H3JA 3LU1A 2TMGA 1YL5A 2PGDA 1T2CA 2X58A 1B8VA 4EJ0A 4U0JA 2NQ8A 3CIFA 4OGWA 1EK6A 3S2EA 4FB5A 2EP7A 3W8DA 2ZIZA 4CMEA 1A4UA 1P31A 3DBLA 3IAHA 4WLUA 3V2GA 4W82A 4Q3EA 3OJOA 3GMDA 4J0EA 4R51A 2E37A 5KTKA 4B4OA 2OBNA 1EEHA 3CEAA 3BAZA 1LJ8A 4ND2A 3U4CA 5HM8A 1X1EA 4GSKA 4AJKA 1RYDA 1GCOA 3QV1A 1UP4A 5TQVA 4YB8A 4AJJA 2PK3A 3MJVA 1DHTA 3OP4A 1VL0A 4BNMA 4DYVA 1XWFA 4IJVA 3RFVA 4EJMA 3PWZA 1C1XA 3K96A 1PS0A 3N58A 3RD5A 2ZCVA 3QLJA 4PLPA 1X15A 5L9AA 3C7DB 3I3OA 4DC1A 2BELA 1H2HA 5A9TA 1H93A 2J6IA 1B3RA 5IAAA 3FCOA 4N5MA 3C1AA 3DAPA 4D0RA 2DM6A 4YVFA 2J5QA 2HK9A 3Q3CA 1TA4A 3G49A 4I5EA 4X54A 4HUJA 1SC6A 4UEKA 1LDNA 3Q9UA 4MVJP 5G4KA 3DBLB 2XPCA 1F12A 2P4QA 4CPDA 3TL3A 1QKIA 3W4JA 1Q7GA 4JK3A 1F14A 3L4BC 5CDSA 1IUKA 4JBHA 3ZWOA 1P74A 3GEGA 4J7CA 5B12A 2VHXA 3BMCA 2O23A 3E5RA 2YHIA 3PVZA 1PGQA 3JCZA 1C1XB 4RF3A 3K2BA 1E7YA 5FF9A 5JS6A 2HMVA 3A1NA 4GKVA 5C7IO 4OXKA 4KTTE 5GZ1A 4ZGWA 1ZO8A 3X2FA 4R69A 1PJLA 1Y7TA 4IZIA 4L73A 2QW8A 2EKLA 3SXPA 1TXGA 4E21A 3TF5A 3GVIA 2IE0A 5ICSA 1MA0A 1RWBA 3DBVO 1FDVA 3INRA 1XEAA 3T7CA 1O94A 4CM8B 4EITA 1OC2A 4OSOA 1R6DA 5JYDA 3HADA 5EESA 1C0KA 5B4TA 1LI4A 1D4FA 4JP3A 4UEOA 2YW9A 2OP1A 3W1VA 4BV8A 1LSUA 4DWVA 3LSYA 1I5RA 3FPLA 1B15A 1N7HA 3BMCB 4PLYA 2YHIB 3SBOA 3PP8A 3QY9A 3S8MA 2FR8A 4AICA 4YAEA 5K6AA 4PVCA 2W2KA 4FS3A 1UDCA 1EK5A 4LN1A 2I66A 4BMSA 3FWZA 4DQUA 2O7SA 5JXWA 1PJSA 3FWNA 4I9HA 2OXIA 3FN4A 1Q7CA 4NJMB 4YDRA 4IMRA 4K6CA 2Q2WA 4MO2A 2PNFA 3G17A 4NBTA 4OIMA 4P8RA 4XYMA 1IHXA 3Q11A 5DDIP 4BKPA 3P19A 3DONA 4R1UA 4BNWA 4CMGA 2I67A 4CM7A 2IDZA 2J3JA 3PDJA 1I2BA 2PZLA 3C3XA 5F1PA 1GFSA 1YH3A 3FNFA 2VZ8A 3NT5A 4FFPA 5IDYA 4B8ZA 4E3ZA 3KM0A 3DMTC 1LRKA 4OKNA 3MEQA 3UKOA 4EW6A 3AI1A 5CFZA 1JWAB 1Y1PA 4RORA 1HDGO 1N92A 1T4DA 4J9UE 4BGIA 2QHXA 2DKNA 4L4RA 4YA6A 2VRCD 4BNGA 1I33A 4E32A 4NH4A 4IY1A 2QIOA 1GV1A 3W8FA 3QVSA 1IPFA 4R9RA 5KVQA 3CPSA 5ILOA 2C20A 4L74A 1WDLA 3WTCA 4J90A 2W4QA 2FSSA 1T2FA 1H94A 4HADA 4XB2A 2DLDA 2PR2A 3BTVA 2ZYDA 4MP8A 4WECA 4ZD6A 1U9JA 2I99A 4MIEA 2EF1A 3ADPA 4NG5A 2ZB4A 4OSPA 3OM9A 1E3LA 1ZW1A 4W9NA 2BFPA 2X0NA 5I8WA 1P0CA 1P1FA 2CDAA 1PGOA 3TOZA 2VOEA 4KUHA 2I6TA 2TMDA 4OAQA 3JQ8B 3VPXA 2I65A 4JLWA 2EV9A 3V1UA 4NU5A 1YOVA 1VI2A 4EJ6A 2QQ5A 3PJGA 4MKRA 3JD4A 1D1SA 3OHSX 2EHDA 4F6LA 3G1UA 1LEHA 4J91A 1K6XA 3JYQA 1N9GA 1PZEA 4LMRA 1RJWA 4KWHA 4XYLA 3HUDA 2G82A 4J0FA 2WDZA 4RPLA 3RFTA 3KB6A 1NNUA 1B16A 2NM0A 1C14A 4AJLA 1T1SA 5ITWA 3VC7A 2PFGA 1DAOA 3BTUA 4HX5A 1YB1A 4DLBA 1ULUA 3JQ6A 4JGBA 3GEDA 1ZK0A 4KTVE 3EHEA 4NBRA 2Y1DA 4ROSA 3D0OA 1U2GA 2CVQA 1C0PA 1PQPA 1DIAA 2PZMA 2BF7A 4J1QA 4BL5A 4CL8A 4EGFA 3VVCA 4AJOA 4EUFA 4D41A 2AHRA 4PLHA 3MJSA 2G0TA 2VYND 5I7FA 3QVTA 1U4OA 3A28A 4BNZA 2C5AA 1GD1O 2Y0CA 2UYYA 1YOVB 1J6UA 4J4TA 2FN7A 1C3VA 3JQEA 3PQDA 4QT0A 1LA2A 4PZCA 3ZCXA 3M1LA 2Q3EA 3ZWNA 1U8XX 4O1MA 2NLOA 3Q6IA 1TEHA 2DU8A 3IP3A 3PFFA 3DTYA 1PU2A 1HDOA 5CAEA 2FPPA 2AW5A 5TGDA 1MP0A 1ZIDA 2CNBA 2V6BA 1DIBA 2AQIA 2DT5A 4GX2A 4MIYA 3VZRA 5G0WA 2B35A 1EZ4A 3PHGA 4OXNA 1ARZA 1YVEI 3W6ZA 3O9ZA 4UULA 3IC5A 1NQ5A 4IINA 9LDBA 3GK3A 4FFMA 3B1FA 1GADO 1GR0A 2YFQA 4R54A 3VPFA 4PN3A 3RU7A 3IP1A 1EBUA 1QYCA 3DHNA 1HT0A 3ASUA 3S2GA 1GZ3A 3EYWA 2CVZA 2VZ9A 4A10A 1H9BA 1YGYA 2EP5A 3OIFA 4TWRA 4FC7A 5KJ1A 1QR6A 1H6DA 1KEUA 4ZQBA 4RQUA 4BB5A 1J49A 5BSEA 3GG9A 1D7OA 4H15A 1XLTA 2VWGA 3R6DA 3V5NA 1HEUA 3G0OA 4G81A 3VH1A 5EQDA 1ZFNA 4BNLA 3G1TA 3A9WA 1HXHA 4DREA 2X86A 3HJAA 3CINA 1P9LA 1U1IA 1WWKA 4IXTA 4F6CA 4FDAA 2GD1O 2QYTA 5JDIA 3L6DA 2NVUB 1YWGO 1A27A 3DTTA 3PPIA 5JAIA 4I08A 4FW8A 4IBOA 2JD0A 5L53A 4LMPA 1XSEA 3ENKA 3QWFA 2VYVD 3ANLA 3JQFC 1C1DA 3TZCA 4QUKA 4BNJA 3KEOA 1NX6A 5BNIA 1Z45A 3I4CA 5AXDA 1TI7A 2B37A 5DN9A 4YT8A 3AM3A 1QSGA 1E3EA 4Y8VA 5G0TA 4Z6KA 4NK5A 3E5MA 1BXGB 2BGMA 1HE3A 1AXEA 2YQ5A 3S55A 2ZYGA 3DZGA 3TDKA 2X1HA 4ALLA 4Y6RA 1YDEA 3AY7A 3BMOA 1WW8A 1N1GA 3MOGA 4TRRA 3W4IA 3INTA 5JYEA 1EUZA 1QV7A 2AA3A 1ZSVA 4YAKA 3I83A 3VDRA 3D7LA 3Q1LA 5DBGA 1GU7A 1I2ZA 1R37A 4RDIA 3WWZA 4B4UA 4E12A 4UUPA 4LRTB 5L4LA 4YTEA 3WTBA 2YV3A 5K0ZA 2DBRA 3O26A 3KYCA 4BO6A 5ENDA 5JDIC 4LCJA 5JAQA 5JO9A 4BNNA 3INGA 2B5VA 4L0QA 2EERA 4OMUA 4DYDA 3ZWWA 1FMCA 4CQLA 2WEKA 4YWJA 1Y5RA 4J1TA 1C1DB 1KEVA 3RASA 4RCVA 3V1YA 1N5DA 3T7EA 3BMQA 4PG5A 1LC3A 1XQ6A 1C0LA 3BTSA 4CLRA 3GR6A 3LT0A 3CXRA 1DFIA 4IGFA 4XB1A 3GUYA 4Z0PA 1H6BA 1LLQA 1VC2A 1KERA 3SC4A 1U4SA 3KHUA 4BQRA 1TB4A 4U0KA 4ZRNA 2JJYA 4BKQA 2Q49A 3L07A 3LK7A 3BMOB 4GLLA 4LISA 1ZSNA 5EL0A 3ZU3A 2A94A 3HB4X 4M86A 2EW8A 4GBJA 1U5AA 4D3FA 1FDSA 1OBFO 1PJ3A 2NACA 1E7SA 4FIZA 1PJ2A 2FRDA 1NAIA 2HMUA 3I6IA 2VTDA 5KWEA 3ZWMA 3H9EO 1GPJA 1XIVA 3KYCB 4JBGA 3PWKA 1MC5A 4R16A 3E9QA 5A04A 4D0SA 3KLPX 5KJCA 2B5WA 1E6UA 1YJ8A 2E49A 1LDEA 1MLDA 1U3TA 1ZUD1 3BMQB 3HZZA 2ZTVA 4CLRB 1BSVA 3ONFA 5F3RA 4AFNA 1JQBA 3BZUA 3DXFA 1Y9EA 1RM4A 3NRCA 5BNTA 4TKLA 4TZKA 5AXAA 5THQA 1NYTA 3RI3A 1W6UA 2WWRA 4FGWA 2NUAA 3E9MA 4GSLA 4XGKA 1CQIA 4ND1A 5L4NA 3F5SA 1Y8RB 1EVYA 4QTZA 3DHEA 2FZEA 3UN1A 1GZ4A 1PL7A 1G0NA 1R66A 3WLEA 2W98A 3VKVA 3WSWA 1U7TA 5CP8A 3KRTA 4Q3CA 1AE1A 3VOSA 2I5PO 3G79A 3VH3A 1ENPA 1JAXA 1VJ0A 1XDWA 2X0IA 2ZTUA 5B4UA 2ZB8A 1IL0A 1HDCA 3KSDO 4B4VA 1P0FA 4R4JA 1K5HA 3AM4A 2IZ0A 1E7QA 4BQPA 2PWZA 5IZCA 1T2EA 1CYDA 1GDHA 2VHZA 1Z74A 2X6TA 1NWHA 2CDCA 2SCUA 1YE3A 2AXQA 4ALMA 2I76A 5TLSA 3QWHA 3RFXA 3U4HA 4XJTA 2CUKA 3OMLA 3L9WA 3ORFA 5FFFA 1Q0QA 2Z1MA 2HRZA 4HXYA 3JQ9A 3GZ4A 4NK4A 4OL9A 4QO7A 2O3TA 4LVUA 1MG5A 1PR3A 5TC4A 3U4DA 5JPIA 2VRCA 3D5TA 4YT5A 2WE7A 4DVJA 3FTPA 1FJHA 5TT0A 3QVXA 1BRMA 4E2ZA 2PZJA 4GLOA 4N7RA 2HO5A 5FI3A 1O0SA 3RIHA 1LBEA 3QHAA 1U3UA 3U9LA 3QVWA 2UV8A 3NDIA 4AJ2A 3TZQA 1PTJA 3DOJA 4CR7A 1NPDA 3RC9A 1ZBQA 3OFSA 1HDRA 3ITKA 5GZ3A 1Z7EA 1YJQA 4DRYA 2AEJA 3D1LA 3O8QA 1K0UA 3A4VA 3CUKA 4W6ZA 2B4RO 3GN2A 5DF1A 1Q0HA 4RVDA 2P5YA 3L0DA 1Z7BA 4RVUA 5A06A 3FD8A 3WYCA 3F6YA 3H6KA 4GX0A 4TSKA 3MJ4A 3R3SA 3ADOA 3QJ5A 4DPMA 3DZIA 2Z5LA 3C1TA 1PGPA 1ZH8A 1FXSA 4CUJA 4TRJA 4JIGA 3D3EA 2YJZA 4E5KA 5AYVA 5B4VA 3SC6A 3PWSA 2GSDA 3H9UA 1JKJA 2VHVA 2Y1OA 2NU8A 4TKMA 3EY4A 3ROKA 2DBVO 4NFHA 2PD4A 4QXMA 4D7AA 1Y8QB 4WCFA 3WNVA 4EUEA 2XAAA 1K89A 1LQUA 4IDBA 2JHFA 2ZJ1A 4IJWA 3IKTA 1VL8A 3EAGA 3GH3A 1BW9A 4AJPA 2DAPA 3AI2A 3ZNOA 3HFGA 2VYNA 1E5QA 1PSDA 3C24A 1ISJA 1SO8A 4XYBA 2VWQA 1X13A 4LW8A 1UUFA 1E6EA 2WE8A 1E3WA 3BHJA 4CMJA 5TSDA 3BXXA 5U4QA 1CIVA 4GPD1 3S2FA 2PGJA 3JQCA 1U3WA 1MX3A 4IDEA 4CMKA 4D46A 3TJRA 2C7VA 4TVBA 1SNYA 3JSAA 1XGKA 2NTVA 2A4KA 4E4YA 3RC1A 5FEUA 1J0XO 3JQAB 5G0SA 4KQWA 3UHAA 5JFOA 2GN4A 1ZCJA 1EDZA 1P1JA 1JVSA 3WGZA 2HDHA 4U6QA 1A71A 4WCFB 4AJNA 4MOWA 1M67A 3GGPA 1SBYA 4MVJF 2IXAA 3LVFO 1R16A 4G65A 3NGLA 1BXKA 5T8KC 2PTGA 4CLHA 2VWHA 2O48X 2CD9A 7MDHA 1EUCA 1SB9A 4TRMA 1O6ZA 2VTEA 4R68A 3GVHA 2IEDA 4OYRA 5CEJA 1KEWA 4A5OA 5A05A 5CG1A 4BNUA 3I23A 1E3WB 3TOXA 3B1KA 3E03A 1I10A 2FPIA 4HNHA 4PG7A 5BR7A 1UXJA 4RLHA 1PGJA 5C37A 1BDBA 2O3JA 3KSZO 1X1TA 3ZDFA 3C8MA 1QMGA 3NAQA 4AVYA 4YXFA 3CZMA 3EMKA 1V35A 2JL1A 2F00A 2B36A 1DC5A 4M1QA 2VN8A 2V7PA 4HWKA 3PYLA 3GLQA 4HNGA 3NT2A 4NBUA 3U49A 3RCBA 1ISGA 2POQX 1M76A 2Y1EA 4NPCA 3EC7A 3H9GA 1LDGA 4DIFA 1HKUA 2JAHA 4ZA2A 3JD1A 5BNFA 3U5TA 2ZB3A 3L77A 3B20A 3R3JA 3A06A 4GVLA 4M87A 4WJZA 4DUPA 3Q9NA 4GX5A 2D59A 3D3WA 3SLGA 4WUVA 1X0XA 4J43A 5TJHA 2OP0A 2VYVA 1DBVO 3X2EA 3WB9A 4MVJD 2PA3A 2Q1SA 2VUTA 2IRWA 1XELA 2J3IA 3WWYA 4CM5A 2GR9A 3RBZA 1DRUA 2V6MA 1ISFA 2OOSA 4IDDA 3HG7A 3OQ6A 3DOOA 1BHSA 4J2HA 4CM9D 2G1UA 3F5QA 1DLJA 1H9AA 1T24A 4RDHA 3VZPA 3JQBA 2RH8A 4OXYA 5EIOA 3JD0A 3OEYA 4CM8A 4CMAA 3GVPA 3FNHA 1T25A 1MXFA 4I5GA 4D44A 4I5DA 4CMEC 4NBWA 4B4WA 1R15A 4A7PA 3OBBA 4A73A 6ADHA 3S2IA 3D3WB 1VJ1A 4PIVA 3VKUA 1I36A 3O4RA 3ZW9A 1HLDA 4LGVA 4UVIA 4IMPA 1N1EA 1I0ZA 1P1RA 4GKBA 3ROMA 1KY4A 5JCJD 3HN2A 3RAJA 4IDGA 3GEMA 3I1JA 3STHA 4YACA 2O3UA 3LDHA 5H83A 5CDTA 2WYUA 4HBGA 2GRAA 3LC2O 3WQRA 3OQ1A 5AOVA 2DFDA 4E2XA 1ZMOA 3ABIA 1PZFA 4NJMA 5COAA 3ZWPA 1LC0A 1KS9A 5HWSA 1PGNA 4RGBA 5LC1A 5I9NA 2JD2A 4DC0A 4YRDA 1ZMTA 5JAMA 1I3KA 4IS2A 1R4MB 1Z6ZA 3GT0A 3DEYX 2Y93A 3WQQA 4BNKA 1BMDA 5TS3A 3SJ7A 3PHIA 4DBVO 3RC7A 3VAZA 3T4EA 1M75A 4XX0A 2O50A 9LDTA 5I9MA 5DNAA 1WNTA 3TZ6A 1H0KA 5HA5A 1YL6A 4PRKA 3NT4A 4P38A 3KZVA 2P68A 3GVXA 2D5AA 2AQKA 3ANMA 4Y9DA 1LSSA 1UDAA 3HB5X 1OI7A 4B7CA 5DULA 5I8ZA 1NQAO 3UCXA 2Y67A 2OFPA 5EJ2A 4BO9A 1NP3A 3H4VA 1LDBA 1MG0A 2DUUA 2D8AA 2J3KA 3RKRA 3KO8A 3K2EA 4ND4A 4YT2A 2A9FA 4JQCA 1T2DA 1VL6A 3SLKA 4J3FA 5T67A 1LRLA 1E5LA 2VHWA 4LCEA 1XHLA 4HP8A 2HJSA 3QA9A 3H9QA 4M54A 1P44A 5BT9A 5JSFA 3WG9A 2VHYA 3IOYA 4QX6A 3JV7A 2XXBA 1YDWA 1B7GO 4CMHA 3JQ8A 1L7EA 4DIBA 2AG5A 3U09A 3NGXA 5JE8A 3RJ9A 3EK2A 1Z75A 3NEPX 2ZQYA 4L75A 5BSFA 1TT5B 1M6WA 3KYBA 4RVGA 4WNIA 3U0BA 4BO7A 5DCUA 2X4GA 1E0DA 4J7UA 1EVZA 2C82A 4HFNA 4XRGA 5A1TA 5K6AC 1LU9A 4RZHA 3W8EA 3PIDA 2FWMX 1ENYA 5H82A 1YQXA 4H16A 4QFCA 4FD3A 1F8GA 2QG4A 1WPQA 3JYNA 3C7CB 3FTNA 3HNPA 4R1NA 4L76A 4ZVVA 2A92A 4BUCA 3WYEA 3MOIA 1OZAA 1I2CA 3SX2A 3ZHZA 1W8DA 1DRWA 1ZJZA 4WE3A 4NMHA 4F46A 3RSHA 4KOAA 2WYVA 1VJTA 3PHLA 3Q0EA 4XQ9A 5FYDA 1FK8A 1BGVA 1ZEJA 2EKPA 4IGEA 1NHWA 1SZJG 4RPHA 2ZTMA 4II2A 4DPKA 2DTDA 2GN8A 3PLRA 1KYQA 3WGGA 3ZNQA 3U4IA 4I8XA 3ONEA 3OSUA 2PH3A 1Y9AA 3JQAD 2BI8A 3H7AA 4UUNA 4WASA 2UUOA 5HBRA 3WS7A 3AFNA 5U1PA 3QVOA 2VRBA 4E2WA 4Z9FA 2Y0EA 2WYWA 4R41A 3NTOA 3K31A 1HSZA 4FJ0A 2J8ZA 5KVCA 3FBGA 4DPLA 1BTOA 2VUSA 2R2GA 3NJ4A 4DMMA 4ESOA 4W9NC 4NQZA 4PLWA 3JD3A 3BHIA 1S7CA 2I3AA 3OIDA 1P1IA 4CLDA 3PHJA 1K6IA 4BGVA 3DHYA 3MZ0A 4CM4B 1AN9A 3ONDA 4NBVA 4WLFA 1HDZA 4DQXA 2C54A 5G0VA 4B7XA 2OL4A 3K8ZA 3OJEA 5B37A 2GASA 1D1TA 3PJFA 5MGBA 5JLAA 4QECA 3ZV5A 1A72A 3NYWA 4PG4A 2JAPA 4E30A 1DJNA 2OO5A 2DPHA 4O0LA 2YV1A 4IXWA 4M89A 2WM3A 1SEPA 1T4BA 3QW2A 2HU2A 2IZZA 2H6EA 1X14A 5L45A 1ZXLA 4ZQEA 2NVUA 4JBIA 4B3HA 1W73A 2DBZA 1KVSA 3JQ7B 4EI2A 3WGTA 1YKFA 2PKQP 3HQ4O 1V0JA 3GVCA 3JYOA 1QYWA 1DSSG 4B3JA 1NM5A 1LQTA 2F1KA 4ZU3A 4KUEA 5JY1A 1GQ2A 4BHTA 5A5EA 4OHUA 1F06A 1NBOA 2DC1A 4NJOA 4A26A 3ZU5A 4FGSA 1E1KA 2OMEA 3F47A 1SPXA 4MPDA 4WEQA 5AQ1A 1R4NB 4C7KA 1VLLA 4HKTA 4DTIA 3CE6A 4QQRA 1BXGA 4XQCA 3R1IA 2PV7A 4C7JA 3CTMA 2HK8A 2PKRA 4BOYA 1QP8A 4TMFA 3AU9A 3I9JA 3A14A 3CSDA 4F45A 1Y5MA 1IE3A 1DO8A 4ND3A 3FR8A 4UAGA 2XOXA 1KOLA 4AJ1A 4CV0A 1BVRA 4TRNA 3ZI0A 2DUWA 1WZEA 5ILGA 5I7SA 1KEPA 3RROA 1DOHA 4IQ8A 4R9SA 4HFMA 3QWAA 4NI5A 2RIRA 1WVGA 2AEMA 2CFCA 1LLUA 2HKIA 1JWBB 3ANNA 1LSJA 3AOEA 1VM6A 2AEFA 4YQYA 3WGHA 3ETDA 4XEHA 3UAGA 2UUPA 1HZZA 2EGHA 2Q4BA 3WX0A 3F9IA 3ZWVA 1H6AA 1NFFA 4YR9A 1EFLA 3HN7A 1GCUA 3I9NA 1NPTO 2B69A 1ZK4A 2J5RA 4DMLA 4WLNA 1PZHA 2FR0A 4WCDA 1X7HA 3GUCA 1MB4A 1I3MA 2GUGA 5L7YA 3GRPA 3IKVA 2BD0A 5ITVA 1T1RA 4URFA 1HRDA 4EDFA 3F46A 1Z73A 1ML3A 3OQBA 4MVJA 2B83A 1OC4A 3PQFA 1YS4A 3H9JA 3HDHA 1QLHA 4OQYA 4U6SA 1P45A 2FPGA 3K5PA 4E5PA 3VTZA 1GEGA 3U62A 2W2LD 1HYGA 4Z0HO 4BNTA 4P4LA 1B3BA 2PD3A 3PEFA 5ER6A 2QYSA 5T57A 3DFZA 4KDEA 4Z9XA 5C7LO 3HHPA 4E13A 4CM9A 3DWFA 3JD2A 1QV6A 5DBFA 3F3SA 4DA9A 1CF2O 4KZPA 3KUXA 3D4PA 4GQAA 1PJBA 1YQDA 4JJIA 1DDOA 2HMTA 1XU9A 2VT2A 3WICA 2EXXA 4RVHA 4GGOA 1E3JA 2CY0A 5U9CA 3ZWCA 1P77A 5JAZA 2ZTLA 4D42A 4PRLA 3KV3O 2GN6A 1HZJA 3UOGA 2NU7A 3P2YA 4C4OA 1KVQA 3AFMA 4FJ1A 4W99A 1Y8RA
chains in the Genus database with same CATH superfamily
2PMDA 4H7PA 2VPWA 1U2TA 4KGZA 1KE2A 3RNOA 3N70A 3CZPA 4S1OA 3C7AA 5ESDA 3EH2A 3LKZA 5TMEA 4Z49A 5B58C 4C6HA 2QUKA 1A3CA 3DTNA 3V7NA 4RM3A 4MIOA 3GT7A 4N7MA 1A69A 4ND7A 2Z8YM 1S8FA 4QVIA 3ESYA 3HB9A 4CTKA 2D1TA 2REXB 4ENWA 4DEYA 3S99A 4HLCA 2AFHB 3AEZA 4QZVA 1S1MA 2E1PA 4UUQA 5FOVA 3TB6A 2Q99A 2R8OA 3HVJA 3P0HA 4PZEA 1SG9A 4RIEA 1YC2A 2C7GA 1KDVA 4DIKA 3ZLVA 4DBZA 4DNXA 2OK8A 3EIFA 4F3RA 1DJMA 1M1YE 4O3MA 4UREA 4G86A 3CPJB 2J45A 3TFWA 3LUPA 2WA1A 1EVIA 4CRWB 2E87A 5DYIA 1OLSA 5D2CA 5KYWB 2Q2VA 3OZSA 4PFJA 4O5OA 4ZOLB 3LS2A 2VK1A 4X7MA 3FVTA 2OV1A 3JSXA 2BKLA 1VKRA 3F6BX 1YXMA 1IIRA 3L8HA 4TWBA 3WHKA 5LVAA 8ATCA 4X95A 2HTFA 3R0XA 5EWJB 4BGUA 1P19A 4E5VA 3KBBA 1QVVA 3BK7A 3TTWA 4YAGA 1E1QD 2NXNA 2QE7D 3U3MA 3COVA 4UHKA 1A5ZA 4RZIA 5EIFA 1FP7A 3AK4A 1OUMA 4GT1A 4QLBA 5HGJA 1TADA 1PNTA 1PR0A 2RIPA 3AW8A 1ZN8A 1XO1A 3R3WA 4FEAA 4I3GA 2H9YA 4MZXA 1JZTA 4R2HA 5FAKA 2A1TR 5KHLB 1N2HA 4L9WA 2A9RA 1WZNA 3EGOA 4WLEA 1VE1A 3L7BA 4OGFA 4RD1A 3RBXA 3VYRB 2B4YA 3REFA 4EG5A 3TXYA 2QU7A 3LLSA 5JR3A 3WL5A 2PE5A 2DFVA 2DTEA 3L18A 1BYUA 4NYMR 3PYMA 3THYA 4J76A 3C1OA 1YDMA 1WP4A 2PJDA 3VR4D 4B5KA 5AHWA 1MW8X 1UPCA 2QVYX 2G8LA 2YWDA 5DOZA 3CZQA 2YQ4A 4FBLA 4G0NA 3HCPA 2ZTHA 1NW4A 2Y1GA 1CUHA 3E9NA 3PU6A 5K0FA 1JZQA 1MEJA 5CDGA 3K0AB 4UTRA 2BH9A 1K6JA 1RQNA 4HSEA 5J9FA 4DC9A 1BKSB 5E3JA 2WWHA 5GZ6A 3L7MA 1UK7A 3F1KA 5FI5A 5JVDB 2HY7A 2AOVA 1W36D 4EHJA 1KTIA 3AFIA 4YRBA 3PXBA 5JWHA 4D79A 2W2NA 3SDZA 2BZGA 2QJRA 3VNVA 2DECA 3PRJA 4QKQA 3N2EA 3U56A 4YUYA 4OMFG 1FF9A 3CISA 2P9YA 2Q9BA 3CO5A 1K92A 4FYKA 1DKQA 2GETA 3ENQA 1KO8A 1VQ1A 1YQWA 4YS6A 2JIOA 4MXDA 5JAPA 2VG8A 3GCWA 1LV8A 4G8CA 4GHWA 1NTRA 2PG3A 3OTWA 2ZP1A 4TS4A 5AXBA 1L4MA 4P4NA 1QP4A 4PTLA 5BWLA 3IR5A 5EHQA 1Y8QA 4Z7NB 3OFND 1SA0A 2ZKLA 4B44A 4H3SA 4ASUA 3VYTB 1E1CA 2WUWE 3CE9A 2IZOA 1EFRD 4N54A 4UJ5A 4Q02A 2XE7A 4BX9A 3OWHA 2WWIA 1FFCA 2V59A 3F6RA 2BEVB 5B2EA 1KNXA 1SU6A 1HC7A 4H31A 4IZHA 4QFDA 1WBDA 3ZKWA 4YJHB 3S1LA 2OCAA 2OBBA 1ISMA 2HA5A 3GEBA 2CF5A 5DMHA 3ZCPA 3A3PA 1V3UA 4EWLA 3EZLA 3BEOA 3TLJA 3UK0A 2BGKA 3T1OA 4Y6SA 4MRPA 4DAOA 1T8SA 1EX6A 2X0FA 4N6NA 1U1GA 5EUBA 1YB5A 4UU0A 1DJLA 4X90A 1NVEA 1E62A 3ADBA 2V8BA 2IYOA 3JQ9C 1KZHA 3RUCA 3CZRA 4IS3A 3FETA 4KPUA 3AVOA 5ECWA 4TS9A 2GUWA 2IW1A 4DXAA 3D8SA 5ALKA 2BM0A 1E59A 4IGKA 1PWXA 5GJWC 3N39C 5DYTA 3W04A 4ENQA 4G0PA 5AHRA 3M34A 4M7PA 3PGKA 2JFYA 3B1JA 4KK4A 2C07A 3SHOA 3KKMA 2DBQA 1HLFA 1M72A 1IDN1 2RB5A 2ONKA 5TGZA 3GBSA 4KN9S 2ZGVA 3W9BA 2P6UA 3P71T 1OH6A 2AXNA 5DEIA 4CMBA 4BB6A 2JFPA 4D56A 1A9SA 4DA6A 3KSBC 4GWKA 3PFWO 1ANKA 2XGGA 4RMJA 4CI9A 1GP2A 2I1VB 4KNVA 2WWXA 3VH4A 5A4DA 3A4YA 3LZDA 4KVAA 1M0WA 2IKQA 2PKEA 1YRAA 1S8OA 5D6OA 2MCFA 3VTAA 3CNNA 4CT0A 3PNSA 1XK7A 3DWIA 3KKOA 4B2LA 3O9VA 1ZG3A 3G6WA 4R5MA 4H6PA 1TTTA 1JECA 1OZHA 3JAKB 3PGJA 1GILA 1NOKA 3FE2A 4JU8A 1HG1A 5H0IA 4EBFA 4JI0B 4XOIA 4M49A 4D9FA 3PXXA 2QD5A 3ABZA 3MLEA 3WGMA 1JIIA 3H8VA 1RRMA 3T4PA 1DOZA 3VR1A 2I3DA 3C85A 3W2HA 2HSGA 4I8DA 3SEZA 2X22A 3VPSA 3ZHOA 3NASA 1D5WA 4MMXB 3D2LA 4UKDA 1L6IA 2QVLA 3AT1A 1M0TA 1C2TA 2V1XA 5E7MA 1VTKA 4FI3C 2PKXA 1VJ5A 1O1YA 5DM2A 2J07A 5DASA 3DZKA 1XZEA 2QRLA 3CUTA 4O25A 3EARA 1OJLA 4W5QA 3W5BA 4KMSA 2EWWA 2J9FA 4DEVA 4RTMA 1A76A 3UB4A 4C0KA 4BVAA 1SUDA 1L5ZA 3BWYA 4ZRMA 5C80A 5IXYA 3DR3A 1DWPA 3D64A 4QA9A 3EDYA 1J4AA 3L1HA 2YIMA 1UXHA 1RXWA 4Q9KA 3U80A 2XQIA 4H0CA 4N5HX 4QOJA 1NURA 1JTVA 2Q3CA 3WLSA 3HWWA 5EYPA 3QEMB 4HJRA 4N9WA 1H4QA 2R48A 4EB0A 3UV6A 2YY6A 2H57A 4DQVA 1L1EA 2G17A 4F4UA 4A6PA 1MBZA 2YJ5A 2IVZA 3KB2A 4PLZA 1X7GA 5E3IA 5BMVA 1Z16A 4ZOLF 3GT3A 2OGWA 4OK3A 2Y68A 5ECDA 3AZQA 2I7CA 3K32A 4LXTA 5EINA 5LXTF 5I7WA 5LMZA 1CERA 2LWIA 4L8VA 4ZYVA 5I4KA 4IFTA 3C5VA 3GAMA 1TCBA 3JQDA 3UA3A 5JT1A 4A8HA 2CSUA 5IG2A 4AIIA 5CTAA 4YJFB 2AMJA 4YMWA 1A5BB 1R74A 1NONA 3OZFA 4G3XA 4ZTBA 3LTNC 1OXKB 1JLLA 3DVAA 1JDBB 3EJ6A 4GOMD 2BGJA 4XZ3A 3PC6A 4LRSB 4JI1B 2H5IA 5D5QA 1WDTA 1AN0A 4K6FA 1TZKA 1AKVA 5F51A 4XB6B 2VZ0A 3IR7A 1ST2A 2Y66A 3THSA 3TLEA 1CZRA 1FFDA 1FYWA 3C14C 4ZCPA 5LZ7A 2NQTA 1I32A 5GIOE 5DFAA 2KBFA 2NXWA 3VISA 2ZJYA 4J7AA 4OQDA 1P9WA 1KMCA 4GMDA 4NMWA 3E82A 4QBGB 2W6JD 3SBXA 2X23A 3HPQA 5KPJA 3NKVA 5FPQA 1A9YA 1T5OA 1KP2A 2QM7A 3IJEB 4BJ5A 3NB0A 4ZOQI 2VAWA 2MU1A 3MJEA 4G2TA 1PSWA 3BYZA 1P75A 2V8OA 5TIIA 3BDVA 2W2LA 1U0RA 1Z5OA 4ZEWA 3UJ8A 2HLDA 2J3DA 2PPLA 2XJ4A 3EVEA 4AKEA 4EHNA 2Z56A 2FFAA 4YN3A 5JVDF 3MS7A 4QYTA 2X0JA 3ND5A 3M5CA 4H7EA 4CLXA 1AUVA 2QPOA 5CEEA 3GWGA 2O0JA 2JGIA 1JKIA 4ZI7B 2RG1A 4GZMA 4JUFA 1QVZA 4BWFB 4IEEA 3UXHA 3USCS 4ZMSA 2AFRA 2QDXA 4XE5A 2HXSA 2OHXA 3O03A 4JXKA 1VBKA 3P9XA 1ZWKA 4TMZA 3H4TA 1EGVB 4CV1A 5F7XA 5EFZA 4N82A 5ALGA 2J32A 1AHHA 3ZGYA 4EKDA 1Z2CA 3JQRA 1W47A 3VR3A 2UYCA 9MHTA 1V45E 1HQYE 1ZK3A 2ZRPA 5AUQA 1M2WA 1PZGA 1YR9A 2OO3A 2XWBF 3IT2A 3P5SA 4ID9A 4TX1A 2VSNA 3IAM1 3QRWA 3LOQA 2O14A 4PGMA 3AERB 4WOKA 4B6JA 3DZBA 4EHAA 1IJKA 2ZAYA 1IY8A 1M1ZA 4ZQCB 4GOJA 5LYYA 2OZLA 5TT1A 3ABQB 1P5RA 3CW8X 3H2ZA 1ZMBA 4N40A 2X1VA 4D9CA 2AT1A 1Z2PX 1UBLS 1WXGA 3CY6A 3BL6A 2GK4A 3FY4A 4LYGA 1SUSA 4U2DA 3LLVA 4M4SA 3TSCA 1SKMA 1N0VC 2IVFA 4CIDA 3U1BA 5AXCA 2FFRA 1YO6A 4IFBA 2WJ3A 3K9NA 5JIBA 1KRHA 1T5SA 3WB1A 4BJ6A 5KSWB 2Y1FA 2ID9A 4B4KA 2QD4A 1U5BA 4E07A 3BQMB 1ZNQO 1SBZA 3D3KA 4E11A 1J7JA 3BORA 2JKVA 1YZ3A 3HYSA 1FA9A 1Y4DE 4L8GA 1E3IA 5AJHA 1DP4A 3LAWA 3E05A 4I9UA 3HFJA 2IYPA 1M3SA 3KQOA 2MOKA 1J2TA 2IIPA 2JFGA 2WKWA 3R75A 2WF9A 3T9FA 2O06A 4B7UA 4LX0A 2X0KA 4BLTA 2ZIFA 3UVEA 7YASA 3L4KA 4ZFNA 1CUVA 2ID8A 2ZWAA 3LBIA 5G4KB 4WKGA 1RJEA 2VPYA 4BRUA 4MKFA 1NY6A 4G4SO 4FT4A 3RJ5A 3NWJA 1E2LA 1M6NA 1RWQA 1E1QA 3KETA 2QE7A 1L7QA 1RJ9A 1Y1RA 4R1MA 5CXUA 4CT5A 2C8KA 1G8GA 3S1SA 3UMJA 2J3LA 4JEHA 4JU9A 5ICCA 3EGDB 3MJCA 5CA1A 4HDNB 2J7PD 3MLAA 3ZY2A 3TVTA 4D81A 4ARZA 2EU8A 5GJCA 3T3GA 2IUUA 4GP6A 3N0VA 4TN1A 4GMFA 1W59A 3G2QA 3N8DA 2CJPA 1NDUA 3RWMB 1DQPA 2KJQA 4YQZA 3HJTA 5K4HA 4KGVA 3EULA 3LX6A 3AW9A 3UUFA 1MENA 4OQNA 3MWDB 5FOTA 3QV2A 1G7CA 2HUNA 1SU7A 3VR4A 1UR5A 4MW2A 3U26A 4ZT7A 4PZAA 3PYXA 2BJVA 3BCUA 4YCAA 4IYRA 3AVYA 1ODIA 4MLZA 2MTBA 5IVPA 3NTLA 1RBZA 3F97A 3IX7A 4BFVA 3B1WA 3QX8A 3QHQA 5HG0A 5I9TA 1NR1A 5LP6A 4FX5A 4BVGA 4BAGA 3UMBA 4XWGA 4O1IA 1WU7A 1Z8NA 4DN6A 3K0SA 2R1UA 2X9NA 3UHOA 1K86A 2A6PA 3JASB 4XIGS 1E4EB 2ERYA 1WCXA 1SUCA 2BRUA 3DMFA 2NXCA 3G7UA 1JHXA 3WK4A 3RAFC 1IHDA 4IZ6A 3UJHA 3VPBA 1WB9A 3E2MA 4PYMA 1N9KA 4KKXB 1WD5A 5EKUA 4MCJA 1T0JB 3BWDD 5TMDA 3O8NA 4ETMA 3N2GA 4H6VA 2ORWA 5DT2A 4DNFA 2H1WA 4ZPXA 2IP1A 2A88A 5A7GA 3DPIA 1LPOA 3EBOA 3M5WA 4B3FX 1EXVA 2FPXA 4F3YA 4W9MC 1NXTA 2EAUA 6REQA 2VJCA 2O8BB 2IIBA 3OFNA 4BV9A 4ENVA 1LQ2A 4RJTA 5EIEA 4M1WA 1XDBA 2GEJA 3JXEA 4MS4B 3A6PC 3FFTA 3PQEA 5CTJA 1EFRA 1PZMA 3EMBA 4WNCA 1DKUA 1JT2A 4F56A 3IIMA 2EZ8A 3OE7A 1F5SA 3N74A 4HYQA 4RMIA 4JBYA 4AO6A 1ATIA 1KI6B 1Y1LA 2PCLA 1L7OA 3GZNB 1G0OA 4Y67A 4BNIA 2FH5B 2F55A 4D98A 4JBNA 3EVCA 3H0CA 1EAMA 4QU8A 5B1DA 1JXQA 2QD1A 4RADA 1U1CA 2AN9A 3TZKA 1WY7A 3SQNA 1ZOLA 2Q6TA 3RYCA 2XODA 1V7ZA 4ZRDA 1W34A 1U1EA 3LT2A 4JCOA 3OMXA 4YONB 1KQPA 1OLXA 3TTSA 2ZXUA 3WBFA 4MGEA 3LF2A 3QF7A 1HORA 1GZUA 1GXSB 1NQWA 5UKDA 3BICA 4DQLA 1M6HA 3D7MA 4AC9A 1I3OA 3RREA 2P2SA 1SOWA 1FY2A 3G5LA 2JGEA 4EPXA 1JU9A 4B84A 2A0UA 3T0FA 2A9OA 2CVHA 2B4QA 2I3ZA 4FCVA 1KXZA 1T0HB 2O2HA 4I5FA 2VCHA 3GFBA 3IIEA 4F72A 2EEZA 4PAOA 1WM1A 2GOYA 1WB6A 3OO0A 3Q9LA 2J08A 4R9NA 2OLJA 1OWNA 5HE8A 1P81A 2GWRA 1R4NA 1GR1A 5BN4B 5NULA 5H3HA 1Z4LA 5A03A 4J7XA 4PLVA 4WA7A 3C8UA 3PUJA 3JY6A 4MDYA 2OA0A 2ASEA 1DC3A 1Z6YA 4GQBA 4HRAA 2WK1A 1XZGA 1A82A 5C1PA 1EA5A 5ABPA 3I52A 1I01A 4ZT2A 1I1HA 1U7HA 1T9CA 3G8YA 3LCJA 5L51A 4LHVA 3LVRE 4KBFA 4S24A 2QKYA 1Y3BE 2QYHA 2X9LA 3CKKA 1FDIA 2GPTA 1XN4A 5JRDS 3UV3A 4IDAA 1O8CA 1A4IA 1WCYA 3TLXA 1DBIA 4EYEA 3RBAA 4ZCMA 2RHMA 5JS2A 1GSHA 1ND5A 1O57A 1LX7A 1QYDA 3OLWA 1JHDA 4BLPA 1SZCA 3D7KA 2H29A 3OE1A 4XPIB 2HMSA 1Z4KA 3TZLA 1S4MA 4ANFA 1JNXX 3Q7SA 4X3OA 2QZJA 3FX2A 4LEIA 1ESNA 5BYJA 4DIMA 4DSZA 2PGAA 3ZWBA 3G0GA 3TX6A 3TM5A 4BNHA 3M2TA 1MEEA 1QH8A 1PL6A 2CXTA 4Q4AA 3UJ9A 2Z6UA 3UF0A 3E9RA 4LNUA 3TH5A 3AI3A 2XT6A 4KMMA 1ZR2A 4CFYA 1F2UB 3IMEA 2QWXA 4BEBA 4Q4JB 2OR3A 2WD7A 3D0KA 1RJGA 4LVOA 1X1BA 1ZEMA 3UK7A 4MJ3A 3MWEB 4WESA 4QPJC 1JN0A 5HFAA 1AUQA 3ZLBA 4A0FA 1CRPA 5CFOA 4AZ0A 4EGJA 1D2HA 2WUGA 5ALMA 4PM4A 3TI9A 1LPAB 3ZY6A 1GQYA 4U7GA 3TCXB 2Y71A 4IJKA 1SHKA 1E6WA 3C87A 2FK7A 3EQ7A 1W9MA 2HFKA 2XUDA 3UGTA 2ETXA 2G5CA 4BTVA 1XA0A 4U00A 4GI3A 1SVWA 2CCKA 2PLWA 5GJVC 1WTCA 1H3EA 4BWGA 1QIIA 5KOJA 2BN4A 2VIIA 2PKWA 3OCYA 4D8WA 1PJ4A 2P9BA 2XCRB 2LV8A 1OB5A 4NFYA 3KQSA 3VNAA 3X0DA 5IUJC 1S96A 3IIKA 1Z39A 4YP1A 4FGJA 5J1TB 2YZ7A 3TG8A 3IQDB 3VJRA 3K09C 1TUBA 1FSGA 1WMAA 3P9KA 3O94A 4Y0AA 2HHHB 2O6HA 3DQZA 2OHFA 4CMCA 1FU4A 2WVJA 3PB3A 4AS1A 2Q28A 1AGPA 4QTYA 2GBIA 1EWYA 2HNKA 2BFAA 1CUZA 2I9PA 3LA6A 3O8RA 3GFVA 3AEKA 1FP1D 3ZZNA 2AE1A 4B09A 1QG6A 4KRGA 3RRZA 1VZ3A 4EG6A 1VHQA 5LIPA 3UICA 3RYIB 4YRAA 5KJEA 3I6QA 3WLIA 3KD2A 4R3NA 3VR6D 1H4TA 1LBHA 5IVHA 1I6LA 2W6JA 3PEWA 4G37A 3W6OA 4RKEA 3ACCA 3D4NA 4H77A 1PS9A 4PO9A 4ZVOA 2DFKB 3GRKA 5LLTA 2QRKA 4RDCA 2F1RA 3J81A 2H3EA 1KAMA 2J1LA 2ZT7A 1R0SA 2DQ4A 2WRZA 4J2OA 5CVCA 4DDVA 5JXWA 2VZEA 5HUJA 3DMYA 4DCTA 4PC2A 4BO3A 1NVUQ 1C0IA 2N9UA 5KC8A 3F71A 5E7IA 3GJ3A 4BE4A 4Q6BA 3A1DA 3WMRA 4MVJE 2YXLA 2P8JA 5KYWA 1TEXA 2WDPA 2FG5A 4C21A 1E3MA 1KC1A 2JCVA 3GMSA 3E18A 3KTAA 5EHIA 3L1VA 5SICE 2FWRA 2XWJI 4E1VA 2R4TA 3KYDB 4EUNA 4DE5A 2CN1A 3G0HA 2QTCA 3O93A 3DXXA 2HWKA 3TS1A 5LXTA 1B2RA 1XKQA 3LQFA 3Q2IA 3AUUA 3G5TA 5C52B 4O2RA 4NH0A 4M0KA 5G0UA 1C8KA 3U3XA 3FPJA 4YYEA 5FPSA 2RSLA 1EUQA 1UK6A 1YB4A 5I5EA 4XVHA 2EWVA 1ECFA 3A05A 2XZDA 1QZZA 1GDTA 3DKVA 2C59A 1SZDA 4LSZA 4K88A 3PFNA 1QCCA 4KYVA 2NTJA 1BDIA 4G56A 5JSKA 4HRXA 5A9SB 3OJ0A 1AGNA 4X63A 1NI4A 1UCFA 1GCIA 3AHHA 4X3PA 4PAGA 2C5SA 4Q1CA 3RAEC 3S4YA 3RWBA 1ZMRA 3BIFA 3DZCA 1XVLA 2H4HA 3K0AA 4XM0A 4Q9HA 4TUYB 3QLUC 2H1RA 3AFGA 3IP9A 5IEJA 3A1TA 4KP7A 3ZBTA 1B42A 3CKYA 3PZBA 1CJSA 1DIOB 1F3OA 2HBYA 5DNUA 4MR8B 3LHDA 4DR6B 7MHTA 4AI6A 1N78A 5BV0A 5JVDA 4R1SA 3N7UA 4OUKX 2GEBA 4BNYA 1VE5A 5C32A 4PNPA 3QWIA 2EIHA 4M8IA 3K8YA 1U80A 1OYYA 1KWKA 4CQLB 1LS6A 2IHNA 5J5AA 1TT7A 1GZ6A 3LPLA 1QF6A 2Y27A 3FYDA 4DT1B 2CXUA 3FOZA 3OETA 4LPSA 4MKXA 1MXHA 3RS3A 3S1AB 5JC1A 4IDNA 4LBVA 4P3OA 4E33A 1H85A 1OGJA 1XDZA 2W8ZA 5EJIA 4CI0B 5KZMB 3QE2A 5AICA 3EY9A 1WXXA 1VRWA 2IDKA 2PVSA 1A5TA 2ZQ5A 1OU0A 4QSMA 1NXWA 3A6HA 3LGSA 3NANA 2G9VA 3BJRA 4QEDA 5IABA 1UF9A 2EEPA 2ZT5A 5BRNA 5G41A 1KYYA 1SCJA 3VVMA 3WA6A 2P35A 1XEFA 3PK0A 2O8CB 4BMYA 1AHIA 4PPYA 3GDFA 4I4CA 5DE3A 3EC1A 1L5QA 3T3MB 4WHMA 3BA1A 1ETHA 3QWBA 4K9DA 4Q24A 3WYNA 1GKUB 4Y1RB 4CQMB 4ZYTA 1OX4B 3OY2A 3TW8A 5CYPA 3PC7A 2KSQA 1QGUA 1KVUA 1AUXA 1G7SA 2PSDA 4GI1A 4CE6A 4BBPA 1ML4A 1EWKA 2Z2JA 1O97D 2AQHA 1Y82A 3G0DA 2PMKA 2C83A 1I9GA 2HWYA 2BZ1A 3HSYA 2D7DA 3VYSB 4RTOA 1V8BA 1ZNZA 3JQPA 1E7WA 1M34E 3H5LA 1VMIA 1XXHB 4FSXA 4YRPA 1CR1A 2O3RA 3IRVA 3Q40A 1PO7A 3GQBA 2UYOA 3IBGA 3KWMA 2PZKA 1KZGB 3QVKA 1DQRA 4IICA 1C80A 3T5TA 4X1KA 1QVAA 1QMPA 5SYAA 3OZBA 2INGX 4U8GA 5HP4A 4RE6A 3VU0A 4XXHA 1U8YA 3MRVA 3OQIB 2O8EB 5AI4A 4V2IA 3OQPA 4WDRA 9ATCA 2JKYA 5LDDC 2IA5A 4LS3A 2F3TA 5LKAA 4WN9A 2W5UA 1OSNA 2Q6IA 3MCVA 5SY4A 3N2YA 3CNHA 5FOSA 3ZBUA 4DZTA 4XD2A 4DR2B 2XUFA 4UBOA 1P3JA 3IVCA 2BKXA 1DPGA 3GUHA 3Q98A 1NUPA 4ZXFA 1FFXA 2BFBA 3IMFA 4HLUA 2OD2A 1R8YA 2G4CA 1G8PA 3PJEA 2JS7A 1MN6A 4CIAA 4A6DA 3FWKA 1N2JA 1TLTA 1U2EA 2EFDB 3H2SA 3O4IA 6AT1A 3CVWA 1YSCA 2G1JA 5FNVF 3TQCA 3ZV3A 4Y6PA 3WQBA 3JAKA 3JQGA 3WKAA 1N2CA 4ZICA 5K9ZA 1WEKA 1FS6A 2V45A 4F04A 3FOAA 3HBAA 4BGEA 5JLJA 2O4CA 2YOGA 3H5IA 1YVUA 4BVJA 3ZBQA 3M8KA 3UQZA 4DMCA 5TS2A 5HTOA 2E9SA 3OEHD 1W1IA 3PQ7A 4KBYA 1P4HA 5JD6A 1I4TD 4BC0A 3HA5A 3ZU2A 1I7SB 3SQOA 2G88A 3GFFA 4HDRB 1V9LA 2HIHA 3IMGA 2P0AA 3OWXA 4G89A 2HCTA 4J49A 4MGKR 4N5NA 4P4GA 4TMTA 1PQYA 4J6FA 1CLEA 3N2KB 1D07A 1Y5NA 4GUDA 4P4SB 3EMDA 4PWYA 5J58A 3C48A 3AI7A 3KXDA 3MVEA 2X0RA 5FUBA 4B2PA 1AD2A 4BIIA 5IYZB 5IRCD 3WLHA 3A1WA 2ZUEA 1T5IA 4FP9A 3ZQUA 4RF4A 2ZULA 3WLRA 4RVSA 3CMMA 3LT4A 4KREA 3G0BA 5CMLA 1ZJ5A 4JOQA 4C0XA 1WXWA 4OJQA 1JLMA 2P4HX 2QLNA 2WQZA 3H17A 4FZ3A 5EQFA 5SYMA 1KEZA 4EO9A 2VHEA 1TTPB 3UHJA 4JJ7A 4A91A 3WKEA 4E2YA 1CSEE 3JZIA 4GVPA 5JHHB 4KEAA 2IF0A 3HJBA 2CVOA 2H11A 2OV4A 3HU5A 1J9EA 1GT6A 3ETLA 3JTMA 4FD2A 4FU0A 4R31A 4BBJA 3O8QB 2VJYA 1P5HA 1YULA 1TW3A 1JA0A 3CBQA 3J7TA 2GYWA 4P58A 2FPSA 3NHZA 5EHNA 3S44A 2NVBA 3UUWA 3OE5A 3TUJC 1YASA 3OZAA 1U28A 2KX7A 4AZ3A 2P2ZA 3WIEA 1UZNA 5KQPA 1PDOA 2G07A 3AIIA 4IOJA 4IQGA 1DFHA 2VDLB 2JHGA 4C05A 3AWDA 2XNKA 3IJ5A 3DC7A 3GLIB 1TYCA 1Q7TA 3AIKA 2CD7A 2CT8A 3G2MA 4YAJA 4S3MA 1HX7A 2IXEA 3OU7A 3QOXA 2WLTA 1BFUA 4YC7A 5KNDA 4D4HA 4CKCB 1L7AA 3L5OA 1UP6A 2EJTA 2FA9A 2JARA 4EFKA 1SUAA 3LT1A 3DEJA 2BONA 5K20A 1KMHB 5MFPA 1AQIA 2XSZD 1ZCBA 3OIGA 5TDHA 3ZGLA 2YS6A 5FH9A 4UVGA 4QLAA 2C8VA 2ICAA 3WFJA 2XNJA 4AG3A 1AIPA 1BHQ1 1PNRA 4EKEA 2J5BA 1OIWA 4X41A 3SZ3A 3W7AA 3EBLA 1UK9A 1YRQA 4FHZA 5DH9A 1YZHA 3B85A 3ESQA 2CGEA 4ZQHA 1QQ7A 5H3CA 1A7UA 1M2VB 1UT8A 4FFRA 4N0EA 4DLSA 4TUYF 1A4RA 2OOKA 3E9YA 1XYVA 1Q11A 5IDXA 1TJ3A 4JC4A 2SKCA 3I09A 3KT6A 5FUQA 2PUVA 3P9ZA 2CZCA 1CUAA 4BZZA 2QZ9A 2GJSA 3A27A 1Y6QA 3RVMA 4E1BA 4EARA 4JVOA 5U4XA 3EX7C 3LU1A 1HYQA 5LB2A 3A6EA 2PGDA 4D4MA 5JNRA 2O2GA 2JGKA 3QEJA 1NZFA 3N28A 1MJHA 1XN1A 3ZZUA 1JYFA 4KODA 2NQ8A 2HBZA 4OGWA 1EK6A 2II6A 2VDPB 4G4IA 1MH1A 4OQPA 2EP7A 2FUCA 5I9IA 5DRYA 3Q1KA 1HR0B 4WLUA 3IAHA 3JRXA 4MUEA 3ZEIA 1AGXA 3CF2A 3EGXA 3AERA 3LVBA 4W82A 2VF8A 3NVAA 2ACWA 3QY0A 2E37A 3L6RA 3SG0A 5LJIA 1EEHA 4LHSA 1H2ZA 3BAZA 3QLVA 2C9MA 4H1UA 4ZALA 4ZC1A 1EUCB 3SYRA 1GCOA 1KU6A 4REMA 4IXDA 2TMKA 1TCAA 1WUYA 2AWOA 3COWA 2AHOA 3MJVA 3QYJA 3OP4A 1VL0A 2IDJA 2NSHA 3CX7A 4KBGA 4Y9UA 5AVWA 3VR6A 5ELLA 4U39A 5AVRA 3LP6A 4OLFA 4OUDA 3E2PA 1STOA 3PWZA 5L3SB 3M7IA 5IBQA 1PS0A 3IURA 3N0XA 3QLJA 1TVCA 4PLPA 5L9AA 1KY2A 1XC7A 3C7DB 4N7BA 4C2TA 1J2UA 2IHUA 1H2HA 5DEOA 3NHAA 3CVYA 2A57A 2LUOA 2QT1A 3PRKE 3G2LA 1GAXA 1RP7A 2HK9A 3Q3CA 4RBNA 1BXRB 5BUSA 1RZRD 3T9DA 4GBGA 4P7FA 1VLHA 1Z56C 3P4YA 1GUBA 1QJCA 1P4SA 1QK5A 2CJYA 2DG2A 3BDIA 3C0KA 1PYOA 3U1VA 5DTEA 5BRJA 1E0KA 2WT9A 3DBLB 3G2OA 1XL1A 5EPUA 1J2RA 4P5EA 1G17A 5G4KA 4DMGA 1CVRA 5BSKA 4EFDA 4ILEA 4NL4H 3HU3A 1J2YA 1KMIY 1D2RA 4LCBA 4GXTA 2GPNA 1RAFA 3MW8A 1KK3A 4OFXA 5B12A 4EUSA 2YCBA 4MCIA 3E5RA 1JUDA 2VJPA 2YHIA 1ZN7A 3EGDA 1ORIA 1UDXA 4HDNA 1C4XA 4YRCA 2DH5A 2JASA 4DMKA 4RF3A 4M83A 1E7YA 3W5DA 2PO7A 5C8YB 4O0MA 2CL5A 2R7KA 4GBMA 4UDYX 4Y2YA 4R69A 3MWDA 4O3FA 4IZIA 5BYBA 1BE6A 4L73A 2FZVA 3DDUA 3JZMA 3I8OA 3SXPA 3TF5A 2F8TA 3GVIA 2IE0A 4BQIA 1MA0A 1RWBA 2PV0A 1XRLA 2HRRA 5DI3B 3ZDRA 1JG7A 1QRSA 1D8TA 3INRA 3L5KA 2H7YA 3CXUA 2CLDX 4C0LA 5GTDA 3RSFA 1OC2A 5I45A 1NBMD 3HA3A 2HJVA 3MD9A 1GNPA 1Y4AE 3CH5A 4ZK2A 5JYDA 4A36A 1E4EA 4JOBA 4XDHA 2P11A 4HWOA 1D6SA 2A0KA 2OT3B 2XWQA 1D4FA 4JP3A 4UEOA 3LY7A 3B7WA 3X3HA 2J4CA 3ZWDA 4DWVA 1Q3HA 1I5RA 3ESBA 1Q3KA 2QV7A 3FPLA 5DX1A 4CTNA 3WLKX 5IYZF 2BT4A 5J2UB 5KUTA 2Q41A 2ZRDA 3G2IA 5LQKA 1ELOA 2RGBA 1LNZA 3BCSA 4AICA 3KSAC 3CIOA 5K6AA 4EYGA 3HB7A 1Y9DA 1UEXC 4QYSA 4DCUA 4EQ6A 1TOAA 1DBQA 2O7SA 3C16C 3RVOA 3NBQA 2WMNB 4O4LF 3AKZA 3DCIA 3SEQA 1CFJA 2JGAA 1Q7CA 2D1FA 1EXNA 4MS4A 4ON9A 4NJMB 5FADA 5IAOA 4PC7A 5JXJA 2QL5A 4ABYA 4OFWA 4XWAA 1RZVA 3AG6A 2Q2WA 4NEGA 4PFQA 3L93A 1RD4A 2PNFA 4P8RA 3VNBA 1Z7WA 3AUFA 3CR3C 1FRZA 3EEIA 2ZZNA 1FYEA 1PNQA 3NXKA 1N32B 4PO1A 3HCAA 3FDXA 1SVNA 1JMYA 1T10A 2GCPA 2H48A 3G8DA 2I67A 3AB3A 3C6XA 5FJIA 4CTJA 2IBSA 2J3JA 5FI1B 3U7GA 3ZDBA 4DBLE 4CYMA 1M2EA 1UFVA 4UE3S 3RT7A 1YI8A 3G2KA 2PS3A 2QN9A 3C3XA 1UOQA 1ZI8A 4XX0B 1M6EX 3GROA 3ONWA 1ZD4A 5F2OA 2E0IA 3A6FA 1OR8A 3I4LA 1REQB 4JVNA 4E3ZA 5KCMA 3KM0A 1Y8ZA 1LRKA 4RSMA 2G0AA 5B6IA 4B73A 3A6DA 3PE6A 5CFZA 3RS0A 2GD6A 5IVDA 1YV9A 2WYHA 1JDNA 1XQVA 2XJ9A 1GXSA 4X8MA 2R4QA 4DBLC 1R0YA 4YA6A 4CQJA 1JS1X 3ZW7A 4BNGA 4E32A 1HQDA 5KYUA 3KP1A 4HWRA 2QIOA 3NNDA 1BE0A 5FBLB 4AQYB 2QTVA 1RLUA 2B1QA 4MUYA 1N0WA 2X2FA 3VHLB 1U9YA 2WUEA 3PX2A 1TVKB 3FMGA 3LPMA 3NOVA 1VB3A 1CXZA 1MJ5A 2PBRA 2BIFA 3CX3A 1YT5A 1L5KA 4BZPA 1UBOS 3BF7A 1SC9A 4J90A 3H9CA 2W4QA 2FSSA 2C4TA 1H94A 1N5OX 4HADA 3KJNA 5EA2A 5B7NA 5HK9A 1L4HA 2DLDA 4HQ0A 1IK4A 2CE2X 1X9IA 1XL0A 4LFBB 2IYAA 1P7ZA 1KZ1A 7AT1A 1JNYA 2IHBA 3LNTA 4WECA 3UEOA 4Z4FA 3TGWA 3QM1A 2ZB4A 1QHHB 1QFZA 1E3LA 4OSPA 5LP6C 1ZUNA 3M82A 2BFPA 1Y8AA 2YZKA 1G20B 1MPXA 5I8WA 1P0CA 3BFVA 3E2IA 2CDAA 1PGOA 4FILA 4LBYA 4KUHA 4OAQA 2JAWA 4D8UA 3JQ8B 4RY8A 2ZI5A 2I65A 3HHEA 3OLZA 4PHCA 1W36C 1ND6A 2N3ZA 2ZR8A 2BRUC 1PYGA 2FETA 2ECKA 4EJ6A 3OZ7A 3JVEA 3JD4A 3LG2A 1GGNA 1D9XA 1VLVA 1E18A 1VZ2A 3SQDA 1LEHA 2P2YA 4J91A 1K6XA 3F8TA 4I3HA 4Z3OA 4UPVA 2Z43A 4FYXA 4P7BA 4F3NA 5T4EA 1CE8B 1YCHA 3OEHA 4E03A 5JEEA 5H5JA 4FIDA 1UZAA 2WDZA 1SIWA 3RFTA 2R62A 2PYIA 3KB6A 2ATIA 2XMRA 4NC9A 3FUVA 1UJNA 1W25A 4JQZA 1C14A 1NQVA 3LIIA 4WD3A 1Z4PX 4C7MA 1D2MA 1DO0A 1RRKA 3IUBA 4IJMA 5BSVA 1ZAYA 2ZJBA 3BTUA 3I8SA 1YB1A 1KIAA 1ZIPA 2GHQA 3O8OB 3BIWA 5EXSA 1JALA 4ROSA 4RYDA 1U2GA 2CLLB 1C0PA 3BERA 4Z4QA 1PQPA 4BL5A 2J5XA 4CKBA 4ZVRA 3SP1A 4GOKA 4Q4JA 2RI6A 4D41A 1G8YA 3QPBA 4LKOA 3NIFB 1PEYA 1A88A 4JHXA 2WPDD 1QK3A 3GLTA 4A1OA 3F7OA 2ZBPA 1KXJA 2PWPA 1TZJA 3CH7A 2C5AA 3N6XA 4PNHA 1T15A 3WKBA 1YOVB 2ZUSA 4QYMA 1IK6A 4LI0A 1W9HA 1SVKA 2D2EA 1L5OA 2GF9A 2ZJ5A 3NHYA 3PQDA 4K9MA 4IO1A 2YXBA 3M1LA 4QT0A 3ZCXA 1F4VA 1PJRA 1RYFA 1U8XX 5B1EA 1EJ0A 1V8OA 3PRYA 2RHWA 1KKLA 5FNVA 4WZBA 1SQFA 3FAZA 121PA 2DUJA 1MP0A 2P9HA 2BEKA 2V6BA 3T99A 3UMFA 1QIEA 1VCIA 1U0TA 4KQEA 1IXSB 4JLUA 2H1LA 3RQIA 5G0WA 1XDDA 2B35A 5AOCA 3CKMA 1FCJA 1EZ4A 1CQZA 3ECSA 3STYA 1MQSA 2SKEA 3AF0A 2PTHA 2DJ5A 2QEQA 2ZBDA 4NICA 4RH1A 2L69A 3MTDA 2XVAA 4FN5A 3ANYB 3IT0A 4FHGA 4UULA 3QOYA 4RJJA 4HB3A 5CIQA 3DWGA 3O0TA 2O2EA 4PHHA 3MCZA 4PN3A 3VPFA 5ENZA 1SM4A 3QMMA 4KO3S 3NNSA 4L8WB 1EBUA 2FOXA 4UATA 2F8LA 1SBQA 5CXSA 3SBDA 1EJ6A 4URVR 3ASUA 3S2GA 5CJ2A 4RWEA 3F6SA 4C7BA 5C8YF 2XSZA 4ZVSA 2CYAA 4Q9JA 5JS7A 1SCAA 1V47A 5D7NA 1PW5A 3G68A 2EP5A 5CB4B 1G5IA 3CLSD 2EJCA 5K2MA 1OXBB 3A6KA 4FC7A 3EOBI 4C3ZA 1W2HA 5TQ2A 3W2GA 1I7QB 2OSBA 2PRYA 2W0MA 2BWJA 2LVBA 5EJFA 4LJ4A 4BP8A 1PLLA 5BSEA 1YZVA 1J07A 1D7OA 1T3ZA 3RSOA 5FPYA 1XLTA 1UPXA 5JSYA 3V5NA 2KHZA 5AVZA 3ELWA 3N3BC 5LOVB 3A32A 4UDXX 5EKDA 1OWOA 3PNYA 3IUEA 5FTWA 3BGVA 1T6ZA 1HXHA 5JISA 4GI7A 4CEHA 4MYSA 5LZ4A 4UEQA 1DQYA 3QBEA 3NYRA 4FDAA 3V4PB 4GXRA 3DOFA 4F4JA 4JI8B 1FDOA 2Z3ZA 4C4PA 3HYLA 1QE0A 1CJMA 3CRVA 2NVUB 3T7JA 1A27A 3DTTA 3O92A 1CDZA 2H1FA 3PPIA 4AXXA 3QEBZ 1BU5A 4AG5A 1W2GA 4I1YA 1PSZA 5J2UF 1X1CA 2VJMA 4ATNA 1V7QA 1ORWA 5L53A 1PWHA 2FAXA 5C1BA 1DX4A 1XSEA 2ZPUA 4ARCA 2Q21A 4RZUA 5B3JA 3CZ5A 3W9SA 4BNJA 2FK8A 4W6QA 1XKTA 4F1WA 5KX5B 4B3MB 5GVSA 2DY0A 3AR8A 4HVAA 4OKSA 5AXDA 1YRHA 4A0GA 2OEPA 2OAQ1 4J0GA 5EKXA 3TOCA 3RM3A 3SYKA 4Y8VA 3PD1A 3TBKA 4EZIA 2QUZA 1KNQA 4M7WA 3E5MA 1BXGB 4F85A 1AS2A 5DLDA 1ZNWA 4MWTA 3VGJA 5C53B 2O1XA 1LPBB 1DMRA 3TDKA 1EZ1A 1WF6A 4ALLA 1GPAA 3IKLA 1JB9A 5ERYA 3F4KA 3FUUA 1C7FA 3CB2A 4PTZA 3MOGA 1GKLA 3BN3A 2Q7XA 2RHTA 4FINA 3UK2A 3K3PA 1QFMA 5JYEA 4P0PB 2XMDA 4FGZA 3WYDA 4B2YA 4QUEA 4TUYA 2FMTA 2Z9BA 5CYOA 3Q1LA 2W2TA 1IN7A