2AA3A

Crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
TPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 115
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aa3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2aa3A02
3PTZA 3B1FA 4JXKA 4Z0TA 4U8GA 3WIEA 1NHGA 3ZWMA 2QRKA 3TQHA 4ZRMA 1E3SA 2CNBA 5TQVA 1U3WA 2IZ1A 2W4QA 2VZ8A 4LRTB 2DPGA 1PL7A 1V8BA 4N54A 4PLYA 3ZW8A 1UP7A 5BSEA 4J1TA 2WJPA 4FOSA 2IYPA 4DBVO 4CM9A 3DMTC 5KJFA 1CEQA 3LYLA 3T7CA 4GX1A 3GQVA 4F45A 2OUIA 3F47A 5BNFA 1Y8QB 1NYTA 2ET6A 5CP8A 4ALKA 3RBXA 3EMKA 3DXFA 2W2KB 3NV9A 3HN7A 3GVHA 3PHHA 3Q2KA 1DBVO 4Q39A 3GGOA 1DHTA 1UXHA 2ZTMA 4NHEA 3L07A 4H7PA 2CVOA 2B4QA 4IQ8A 1Y5MA 1JKFA 3RUCA 3FR7A 4GLLA 1A7AA 1GZ4A 1U3UA 4MKXA 2NLOA 3GR6A 4J43A 4W7IA 4BIIA 2FZWA 3FD8A 2GSDA 1U7HA 4YQYA 1EVZA 3GUYA 4OHUA 1E77A 3Q0EA 5L9AA 4HFJA 4XJSA 3ETGA 4K9DA 1P1IA 3KUXA 3NUGA 4BKOA 5G2OA 2AEMA 2OORA 1QLJA 4M8SA 3PHLA 5A05A 3HZZA 3RVDA 3U4DA 3QWHA 1MXFA 3KM0A 4ZA2A 4WLEA 1I36A 2RAFA 4HFMA 4EZBA 4LSMA 3HUDA 5IJZA 4JP2A 1BW9A 4E5NA 1SPXA 2VHXA 4C4OA 5IG2A 1BVUA 1HLPA 3E9NA 1V6AA 2P91A 1EQUA 3JD1A 3OBBA 2AG5A 2OBNA 1P1FA 5IXYA 3WJAA 1SOVA 3TFQA 4ZGWA 2H1SA 3GNSA 2H5LA 2V6BA 2QRJA 1MG0A 3IC5A 3FI9A 5TSDA 3HDJA 4L76A 5KCZA 1DFHA 1TT5A 3OM9A 1NQAO 3P7MA 1AXGA 3K2EA 1TLTA 4RDIA 2UV8A 1JU9A 4YAIA 4KUHA 4R1SA 2GD1O 2YDXA 3U49A 1T2CA 5L7WA 2GN4A 3IJPA 5DT9A 4CLHA 2EWMA 3LK7A 5EIOA 3KYCA 4AFNA 3JYNA 2VN8A 4K6CA 2VZ0A 1EVYA 3ONDA 4LISA 5LCXA 2IDZA 1M66A 4PZDA 4RGBA 4IQ0A 4RZHA 3EK2A 1U28A 1IY8A 1NWHA 2X86A 3HHPA 4DLBA 1ISMA 3OQ6A 4ALJA 3AW9A 4R16A 2AEFA 4CM9D 2JJYA 3AOGA 3LF2A 2OXIA 3S55A 1BGVA 1NPTO 2HDHA 2Q49A 1NR7A 1JDJA 2E37A 2CY0A 2J3IA 1PS8A 4YT2A 2OL4A 1A4IA 2HRZA 4M49A 3D3EA 1F17A 1KVTA 3E9QA 3F5QA 1R15A 4BUCA 1CDOA 4XGKA 4BB6A 4CR6A 1LLQA 5A4DA 4IQGA 1NP3A 3JQCA 2G1UA 1XU7A 2A35A 1FK8A 1LDNA 4RVSA 3FSRA 1R6DA 2WMDA 4ND1A 4XQEA 1YXMA 1DLJA 4MVJM 1PJLA 3A06A 4ND5A 1Y9AA 3B1JA 4M87A 1C1XA 2X0IA 3V5NA 3UICA 3PWZA 3ZWVA 4CLOA 3RWBA 4IDAA 1S7CA 2J5KA 2GNAA 5JDCA 1Q0HA 4PG5A 2ZB3A 5I8ZA 3ZZNA 3OJOA 1GQ2A 2Q1SA 4CR7A 5DZSA 5JDCC 4F6CA 1ML3A 4LMRA 2X5OA 4Q9NA 4TRMA 2BGKA 4B8WA 3KYCB 4D42A 4JIGA 5B4VA 4DQUA 1NXQA 2X9VA 2G0TA 2FZEA 3F1KA 3OH8A 3PGJA 3FWNA 3ZV6A 2VTDA 1GDHA 3L9WA 4LVUA 4IS2A 1CETA 2GGSA 1PQWA 2ZTVA 4XYGA 4GGPA 3ZCXA 1GCOA 1Y9EA 2PZLA 4L75A 3ZV4A 4ID9A 4ZQHA 1IZ0A 1XQ6A 5ENVA 5T6BA 1X7HA 4BO1A 2WD7B 4O63O 1K6XA 2PZMA 3HG7A 3OECA 3V2UA 3OP4A 2DBQA 1L7DA 4IMPA 4R3NA 4J4HA 2ZB7A 4J9UE 1ENZA 4B3IA 4DYDA 5KJEA 1SNYA 5ITVA 2NWQA 4B4WA 3H6KA 1DIRA 1ZK1A 2FPIA 3EGOA 5JCJD 3ENKA 3GVXA 4QT0A 1NFFA 1DIGA 3K31A 1ZK2A 4HADA 3LT1A 1FDWA 2C0CA 5DNAA 2J6IA 1C1XB 3ADPA 2CFCA 4L74A 4M55A 3MTJA 3I9LA 5F21A 4CLOB 4YT5A 1OFGA 3PQEA 1U5CA 4NG5A 3JTMA 5JNLA 1Q0LA 4CV3A 4BNYA 2CVQA 1A7KA 3RFTA 4QO7A 4J3FA 2NU8A 4BKUA 1VRWA 3QJ5A 4WOJA 4XYEA 2Y99A 2C7VA 4KDFA 3SEFA 2PKQP 4LN1A 1TI7A 5TT1A 3BMOA 2D5AA 2EP5A 4J9VA 1EVIA 5KVSA 4OKIA 3G0OA 1CIVA 3I3OA 3OICA 4YTEA 5MGBA 1LRKA 5A06A 1T2DA 1DJQA 1N9GA 1WDLA 4WKGA 4NK4A 4J49A 2UUPA 3Q11A 1JAYA 3GAFA 3I83A 2HK8A 4RCVA 5KKCA 4R54A 4PFJA 3ZV3A 4CQLA 3FHLA 1KEWA 3V1UA 2O50A 3H3FA 2GZ2A 4II2A 3KB6A 4WOKA 4CUZA 1H6CA 5ADHA 3AOEA 3HB5X 2OP0A 2HMUA 4IZIA 4PG6A 4UAGA 1A9YA 4HBGA 4I5EA 4K6FA 4YJFA 1ZIDA 1LQTA 3AOEC 3ROMA 3W6ZA 1OAAA 1WNTA 2JFGA 2O3QA 2VRCD 2ZJ1A 1I3MA 3WFJA 3V2HA 1VL8A 1ZNQO 3F5SA 2B5VA 3O9ZA 4DVJA 4DMMA 5T8KA 3CUKA 3OFSA 4D3SA 5AXCA 3K2BA 1OC4A 1E1LA 4PG4A 3NJ4A 4GBJA 4QUKA 5T8KC 1D7OA 1UXJA 4U6SA 4CM5A 3FPLA 3OJFA 4EITA 2P5YA 4U0JA 5IDWA 1D8AA 4XR4A 2BMAA 1G6KA 4OXKA 3V2GA 1E7WA 1X1TA 3EW7A 2AW5A 1GZ3A 4AJJA 3RUAA 5CPFA 1PJ3A 4J6FA 3BMNA 1Q7GA 2V6GA 1I32A 3QWFA 1UDCA 1EUCA 4R41A 4XGNA 3O4RA 1N9GB 3QP9A 4KZPA 2A4KA 4M89A 2GR9A 1GR0A 1ORRA 5TF4A 2BFAA 3WGIA 4UUNA 1YL7A 1EVJA 4ZQGA 4TRNA 3PDJA 4CQLB 1F06A 4BO6A 2PKRA 1ISIA 3DFUA 3FBGA 3W4KA 1YBMA 5JCXA 5G0TA 3WYEA 1TVEA 4Q3BA 5JMWA 2C5AA 4GL4A 4QX6A 2AE2A 4XIYA 2X5KO 1QP8A 4WEQA 3KTDA 4B7UA 1NFQA 4GPD1 1G0OA 3ZN2A 5AQ1A 2P4QA 1H2BA 5JFOA 3DTTA 3KHUA 2Z5LA 3DZKA 2TMDA 4ZQFA 4Z3KA 3TF5A 1O89A 5KJCA 3E9MA 3GDGA 5I9LA 5C37A 1DJNA 1ZO8A 2JD2A 3P2YA 1N92A 2Y1EA 2B83A 1XSEA 4GX5A 4B4VA 2UAGA 3E18A 5DN9A 3NDIA 4IDEA 3M6IA 4JN6B 4RO0A 3WIDA 4FS3A 5A9SA 1LSOA 1MB4A 2Q1UA 3JYLA 3TFOA 2UYYA 4RF4A 4YWJA 1U3TA 3BMNB 3H9QA 3R6DA 3JD2A 2WYWA 3H4VA 4CM4A 2Q99A 1U8FO 2BGMA 3Q1LA 2J3JA 1GU7A 1P1HA 4E6PA 4YCAA 3PDUA 2EW2A 3AUTA 4PLTA 4IGEA 4ND3A 1B15A 2PKQO 1ZFNA 3QWBA 3RJ5A 1ENOA 3INTA 3TDKA 4B4UA 2VHYA 3JQ9C 4M1QA 2X7HA 3PWSA 3ITKA 1R66A 1X0XA 2NM0A 4BO8A 1DC3A 4JNKA 3VPHA 1Z45A 3QA9A 3A1NA 3GZ4A 4DGSA 3K96A 1RYDA 1HKUA 5KOIA 3SJ7A 1VL0A 3VPGA 3ETDA 4NZ9A 2GRAA 3DAPA 3PQFA 2JD1A 4BGIA 4ROSA 3ZI0A 1AHHA 2DQ4A 2GUGA 2FMUA 4RQUA 4OM8A 3CTMA 3IKTA 1RKXA 2FN7A 4YEDA 4A26A 3STHA 2O3SA 3FPCA 1GYRA 2VT3A 1QYVA 4J7XA 5A9SB 3MOGA 2WTBA 4C7KA 2WD8A 3PLNA 4WNIA 3K30A 3FCOA 3HDQA 2AQKA 3D4OA 2Q2WA 1K89A 3PJDA 4YRAA 4E2YA 5IFLA 1Z75A 4Z9XA 1N7HA 1SAYA 1YDWA 2D5CA 3M1LA 5L7YA 3S2EA 1AE1A 1EZ4A 1U7TA 4BNGA 5CDUA 4CM4B 1TB4A 4RF2A 1MUUA 4AG3A 4HV4A 3H5AA 4YQZA 4JJGA 2XF8A 4E30A 4CQMB 1N5DA 3ZNQA 2JL1A 3GGPA 3BHJA 4BV9A 4E5YA 2VWHA 3H9UA 1HE4A 3RUEA 2JAHA 4L0QA 4CM1A 3SVTA 2YDYA 1F14A 1VE9A 1I8TA 3G17A 3KXDA 3O8QA 3WGHA 1ZUD1 1P74A 4JLWA 5K6AA 3WYBA 4D0RA 1NVGA 5L4LA 5T67A 3EUWA 2I9PA 4XR9A 1QV7A 5I7SA 1DAOA 1M6HA 1V3TA 2GZ1A 2PA3A 4FQ8A 3U4IA 4GX0A 4H3VA 1KERA 4TMFA 2O7QA 3WFIA 2EF1A 2HMVA 1ZMOA 3DC2A 1YB1A 1YJQA 2PFGA 1LLDA 4PLHA 3I9MA 1A71A 1QLHA 1PL6A 2ZIZA 1J5PA 4CQMD 5JO9A 1E7SA 2W8ZA 1WMAA 3AI3A 3TZQA 1B16A 1HZZA 2ZJ0A 3CKYA 1LBEA 1WLYA 3QVTA 2FHSA 4O6VA 1YVEI 3E6AA 1DRVA 1VSUA 5DDIP 4OOFA 4UVHA 4CLRA 1BVRA 3WQSB 2V6FA 1MFPA 3MEQA 4WCFC 1GUYA 1PSDA 3I9KA 2AEJA 3CEAA 1A4UA 5DCYA 4GAEA 4CLDA 4W9NA 3U5TA 3E48A 4BNTA 3ETEA 3UCXA 4CMCA 3O26A 3D1LA 4W9NC 1Z82A 4FSHA 3UHAA 2I99A 3U4CA 3L77A 2WEKA 2W98A 2B4TO 3O8QB 4MDHA 4BNWA 2WSBA 2E4AA 5AYVA 1UDBA 4GVLA 3V1TC 4BGUA 2ZK7A 3ENNA 1A9ZA 4BNMA 1PR9A 1PR3A 5IN5A 4MINA 1PGQA 4E2ZA 3K9QO 1U5AA 4YRDA 4D3DA 5G4LA 4ZU3A 4RVUA 1ENPA 1GUFA 2VUSA 1ZCJA 3FN4A 3UFXA 4FN4A 1YOVA 1GAEO 1KETA 5JYDA 2BD0A 1UAGA 3SXPA 3OHSX 3D5QA 5ILOA 2FP4A 4E0BA 4AJIA 1W0CA 2WE7A 2DFVA 3LC1O 4LMPA 2DLDA 5GMOA 1MLDA 4LCJA 1ARZA 3N58A 1EUDA 4BNJA 4YDRA 1O9BA 4GSKA 4CLRB 3JD4A 1B8PA 1OI7A 1OZAA 1E1NA 1U8XX 3KYDA 2IEDA 4PLGA 4O0LA 4PVDA 1ZXLA 1PS0A 2I67A 3L4BC 1M2WA 3ORFA 3LC7O 4BMNA 4IIVA 4CMKA 4Y67A 3KEQA 1DO8A 4HFRA 3OA0A 4AL4A 3C1OA 5KJ1A 4Q3DA 4FD3A 5TJHA 4FJ1A 4HNHA 1E5QA 5G0WA 1IL0A 3WNQA 4D46A 4E21A 3ZU4A 2GYYA 2PLAA 3OMLA 1HF3A 4DPLA 1N8KA 3VC7A 4TVBA 3RUIA 4YR9A 2WDZA 4UVIA 1L7EA 3VAZA 3MJEA 4BS9A 2VOJA 3RCBA 3D3WB 1O95A 3QY9A 3FNGA 2POQX 4OH1A 4PN3A 2VWGA 3OIGA 1CRWG 4J91A 1PU2A 4NBVA 1YOVB 4L4SA 3RFVA 4NR0A 2X23A 4FC6A 1NAIA 1YL6A 3GZNA 3W8FA 1ISFA 1T2AA 1ISJA 4XZ3A 1AN9A 4JBHA 3TZCA 2ZYDA 1XGKA 4MP6A 3WTBA 3OETA 3O03A 1XG5A 4R1TA 2Q4EA 1B3RA 1KY4A 2FR8A 4FJ0A 1XYGA 1BMDA 5G0VA 1T1SA 3LQFA 3D7LA 4MVJP 2HJSA 3UKOA 1D1SA 5L51A 3DR3A 3PFFA 1P1KA 4WE3A 5H81A 1ZMTA 4FFPA 1P1JA 3TZKA 1D3AA 3WLFA 5BR7A 2DC1A 1UZMA 3VH2A 5A9TA 2R2GA 3KYDB 2X0RA 3SBOA 1TEHA 4CMIB 2ZYGA 1H9AA 1CF2O 1DXYA 3C3XA 1SBYA 3CSDA 2BGLA 1Q7BA 4P4GA 1ZBQA 5ER6A 2VUUA 1X14A 1E7RA 2O3RA 2B4RO 1YRLA 5C7LO 4YVFA 3MTGA 4KUEA 3WJ7A 3MWEB 4RDHA 3IQDB 3UF0A 2B35A 3OSUA 4NBTA 2NTVA 2LDBA 1GQQA 3T7EA 4EJ6A 1EUZA 2DKNA 2Y1CA 3KSZO 4N5MA 1I33A 2B37A 2FWMX 4CMEA 4YPOA 3NT5A 1HE3A 1PQUA 2BF7A 4G65A 4L9RA 1OBFO 1Q0QA 1V9LA 4CMEC 5A02A 2RHRA 1YS4A 1N2SA 4EI2A 4KQWA 3F3SA 2P5UA 3GZNB 5COBA 4Z6KA 2HO5A 3H5NA 5G4KA 4IM7A 4XQ9A 4R3WA 9LDBA 2X0JA 2CVZA 4XGIA 1N7GA 4EYEA 4YJHA 3COSA 4KTVE 3RQSA 1GYPA 1KS9A 1I24A 2A94A 4O1MA 5CDGA 3TSCA 4C7JA 4WK6A 2JKVA 2CF6A 3R3JA 4MOWA 1FDVA 1HYEA 1FDTA 1AGNA 3T4XA 4NDNE 3AY3A 3PJFA 5ILGA 1QXSA 5IZCA 3L9XA 4J2HA 3TJRA 4EEZA 3K73O 3FR8A 4W4TA 5IZCC 3WG9A 4FGWA 4XKJA 4BO2A 1J4AA 1DFIA 1R0LA 4KQXA 1U2GA 3S1LA 1KIFA 4BNXA 2WM3A 5EESA 5K0ZA 2PNFA 1QMGA 4D45A 1T2FA 4O59O 4RPGA 5HBRA 4YACA 1AXEA 1IZ9A 4J0EA 5EERA 2RBEA 1OMOA 5HM8A 4U6QA 2Y66A 4TKMA 1PGNA 3G49A 4TRJA 3EC7A 3ZWAA 4JGBA 1PJSA 1T26A 4LW8A 1H2HA 3I9OA 3X2FA 1VLLA 2YQ4A 1U9JA 2CD9A 5U9CA 2PZJA 4XJTA 1P3DA 4ND4A 1CQIA 3GVPA 4IIUA 5HA5A 3VPSA 4ITUA 2OOSA 4B7CA 2PH5A 3NAQA 3OJLA 5G4KB 2NACA 5JCJA 4EJ0A 3GVCA 3QV1A 1YQDA 4MVJA 4Q3EA 1UDAA 5GZ1A 5L4NA 4YJHB 1EBFA 4ZVVA 1CJCA 3M2TA 2Y93A 4PCVA 3WR5A 1Y81A 2DTDA 3DZHA 1RM0A 3CZMA 3JQFA 3JQ6A 3WMWA 6LDHA 3MJCA 2VOEA 1UH5A 4GGOA 1J49A 2O3JA 1FJHA 3ZNPA 1PJ2A 2C2YA 1NWCA 1K5HA 4PVCA 4YA6A 3GGGA 2ZCVA 1WW8A 2TMGA 2WD7A 2QYTA 3PQDA 3DZJA 1IHXA 4IZHA 3E1KA 4QXMA 2C29D 2CDBA 3GNTA 4FGSA 3S2IA 4IJKA 1KEPA 1YL5A 3UN1A 4BO0A 2ZB4A 4D41A 1GFSA 1HSZA 4EJMA 2VRBA 1M67A 5BT9A 3GFBA 4A73A 1HT0A 2ZATA 1KOLA 1SCUA 3CMCO 4PRKA 4XIJA 1NVTA 3GOHA 3PHJA 4HY3A 4Z9FA 3TOZA 1GADO 4UEOA 1WWKA 4NJMA 5DCUA 1RPNA 1MGOA 1X0VA 3IL2A 4ZQBA 4GWGA 1LC3A 3B70A 2W90A 4F46A 1C3VA 1O5IA 3RUHA 4IY1A 1X7DA 1VKOA 2VRCA 4U0KA 1F8FA 3KETA 4UVEA 2J5RA 4P4LA 5B4UA 1HDYA 1VKNA 2VYVA 3C24A 3QRWA 3Q3CA 4WLVA 4E5MA 1C0KA 2Z95A 3GLQA 2AA3A 5CDSA 3IIEA 2EKPA 1B0AA 1SMKA 2JCVA 1T24A 3NGXA 1XA0A 2P9EA 4B3JA 3LU1A 4FIZA 3OQBA 2VWPA 2PR2A 2PWZA 1HXHA 4MIEA 3ZV5A 4BV8A 3EHEA 3PLRA 5DP2A 5C3MA 2C54A 3ZDFA 3QIVA 1ADCA 1E3IA 1WZEA 2OBYA 3D64A 3RD5A 1YJ8A 2ZKLA 4ALNA 3VVBA 3FBTA 3H65A 1JAXA 1SB9A 2PV7A 2AQIA 3KSUA 1DPGA 1X15A 3FRJA 1IPFA 5G0UA 4BNNA 4MVJD 3ROKA 3GRPA 2DUWA 2DVMA 4Z0HO 1LC0A 3QVWA 3I9JA 1LUAA 1W6UA 4AJEA 3I6IA 1ZJZA 1B3BA 4NJMB 2X0NA 3P5SA 1HDRA 1UXKA 4RPJA 3P19A 3LSYA 3SLGA 1HDXA 3EYWA 4KP7A 3DBLA 3WXBA 5AVOA 1BXKA 4WLNA 4G5HA 1HYGA 1Y6JA 1YQGA 2ZB8A 2V6MA 3C8MA 1I2CA 1PGJA 3U62A 1KBZA 1P31A 3EVNA 3WMXA 4N5NA 1ZKMA 4Q3AA 3VTFA 5L45A 1SO8A 1V0JA 2EKLA 3TNLA 2O3TA 3ZWCA 5IN4A 3UVEA 1F12A 3QQPA 4A0SA 3LDHA 4OAQA 3KV3O 4E13A 3UOGA 3WB9A 1BDBA 3DBHA 1JLLA 1QR6A 4AJHA 2QQ5A 2DU8A 2WYUA 1PZFA 1I30A 2Q45A 1P77A 1YDEA 3ICCA 1M75A 5L3ZA 3TL3A 4HKTA 4BNIA 3ZWYA 4BNZA 4QQRA 3QHAA 3RC1A 1WXDA 3H5RA 5THQA 2EERA 2YHIA 3VZPA 2A9FA 3GMSA 3BMCA 5IAAA 2VYVD 3IP3A 1PQPA 5EMHA 4OQYA 3HWRA 1GL3A 3ROPA 1G0NA 1NASA 4BQRA 1R4MA 4PLCA 4AJ2A 2H9IA 2CF5A 3JD3A 4PIVA 3TPCA 2XAAA 4Z0PA 4ZD6A 4RL6A 4DLLA 3DBLB 2YHUA 1VSVA 2VUTA 1E3LA 1LDEA 2E82A 5I7FA 4DREA 3WWYA 3GDFA 2O3UA 3QLJA 4MVJI 1IE3A 2AQ8A 4WNCA 1QYXA 4UEJA 2PGDA 1NPYA 1LJ8A 3VH1A 5ER9A 4BB5A 3JYOA 4RVGA 5F1KA 3WDSA 2D3TA 2FY8A 1YONA 4ALLA 3GUCA 4BNLA 3Q2IA 4YAJA 1PX0A 5L95A 3DBHB 5JAIA 1Z74A 1KVQA 2OP1A 4U7WA 1PIWA 4QO8A 3HSKA 4CM8A 4E5PA 5KIAA 3GDOA 1X1EA 3KRTA 4JK3A 4DC0A 4HX5A 1MX3A 1ONNA 4B79A 4L8VA 3LVFO 3ABIA 3BIOA 2O4CA 3GEDA 4D43A 2C20A 3AUAA 3ZWNA 4IDDA 4J4TA 3ICPA 2J8ZA 4AJ1A 4FFOA 5A03A 4S1VA 2YHIB 3RASA 4OXYA 1YO6A 3BMQA 4FFNA 2X4GA 3H7AA 2PY6A 2BKAA 4XYLA 1I5RA 3HDHA 2X22A 3CH6A 3IP1A 1H94A 3PYMA 3BMCB 1UP6A 2YJZA 5JY6A 1ID1A 3ZNNA 5CAEA 1B8UA 2OMEA 3CE6A 1R4MB 2OZPA 5A3JA 4CV1A 2SCUA 4XQGA 5HTOA 3A28A 3VOSA 4BGEA 4ZICA 3DTYA 3OJ0A 1E1KA 2P4HX 5KVVA 3KLMX 3RUDA 2X1HA 3H8VA 2HLPA 3L4SO 1QG6A 5JBIA 1R0SA 2NUAA 4D0SA 3GT0A 3UXYA 1XR3A 5LDGA 5HS4A 1RM5A 1N1GA 1UR5A 3E5MA 2DTEA 1XCBA 2CDAA 1XHLA 4HFNA 5C7IO 1TXGA 1V35A 1LU9A 1PJTA 3EZLA 4OGWA 4M54A 1BTOA 3PRJA 5THKA 4YBZA 1X13A 4MJLA 4UULA 1WDMA 2YY7A 4CQMA 1QRRA 3H9GA 4NH4A 5TLSA 3X2EA 2J3KA 3D4NA 1PJ4A 3I6QA 4IMRA 4OL9A 4BO5A 4MKRA 4NU5A 5JMPA 3QW2A 3MJVA 3RSHA 5CG2A 3GPIA 4KMSA 3GH3A 1XELA 3PZBA 2IEBA 4K1LA 4CM8B 2Q3EA 3RC9A 5CFZA 4CLXA 2W2LD 4PRLA 5I7EA 5AOVA 3WGTA 5EPOA 3AI1A 4R9RA 1LRLA 1Y8RA 1T25A 4A2CA 3I4CA 2HK7A 3L0DA 2C2XA 5JLAA 3JQDA 7ADHA 3BMQB 2D2IA 4FFMA 1TT7A 5COQA 4JBGA 2CMDA 3DB2A 3DONA 3CMMA 5JDIA 1EBUA 2WE8A 1H5QA 1YH3A 3NTOA 4KWHA 4J1SA 3A4VA 5TT0A 3VH4A 5JDIC 3DOOA 2QZ9A 3PJGA 4IDCA 4Y6SA 3GN1A 4HNGA 4QEDA 5U4QA 1U4SA 1EK6A 3MJSA 4GKBA 1YE3A 3AUSA 1ZW1A 4YAEA 5FEUA 4XX0A 1UP4A 4R68A 2BHLA 3DHEA 4IDFA 2BLLA 5G0SA 1PL8A 3VTZA 2IZ0A 3WOHA 4BL5A 1GUZA 3SC4A 5FI3A 2DAPA 4BNHA 1D1TA 1DRWA 2DBZA 4XCVA 1B2LA 4RPLA 2X9GA 4OSPA 3GEGA 4CV2A 2EJWA 4TRRA 4CL8A 1P9LA 4BNVA 5LDHA 5COAA 5GZ6A 2EGGA 5FFFA 1KC3A 2NVWA 4GSLA 3TZ6A 3VPXA 3DAGA 1ZZEA 4BGVA 1D4FA 2VT2A 1Q1NA 1Z6ZA 4EBFA 2ZYAA 4J4BA 1LLCA 5I9MA 1M6WA 2YV1A 1V3UA 2GN6A 4D7AA 4DIBA 1Y8RB 5BSHA 4W99A 3F9IA 5GY7A 5K6AC 1HE2A 4TZTA 5DBGA 4UUMA 4DXHA 4H16A 3PWKA 4EUFA 2Y1FA 8LDHA 2B36A 2J5QA 5TIIA 3H3JA 3DDNA 4R01A 4WCDA 2NV6A 1DC4A 1Z73A 2PTGA 3PJEA 3A14A 4MIYA 5TC4A 5TS3A 3C85A 3DZGA 4O5OA 1QV6A 1ZSVA 4TKLA 3JQ8A 4W82A 3E5RA 1GZ6A 4OOEA 1NTOA 3DMYA 4IUYA 5B4TA 4IBOA 1J0XO 3PEFA 1ZK4A 2NQ8A 3VZSA 3D5TA 1JKIA 1M76A 4MKZA 1ADBA 4MP3A 1C14A 4OO3A 2Y0DA 2JHFA 1XEAA 3MOIA 3OEWA 1HE5A 4FC7A 4I1IA 4OIMA 4RVHA 5A9RA 4I5FA 5FI5A 4OYRA 1K3TA 3SC6A 2YV3A 2I76A 2B69A 2DBRA 4OQZA 4DWVA 3ONFA 4I5DA 4NPCA 1U3VA 3TN7A 4RZIA 4J7UA 3W1VA 3ZU2A 3AM4A 4WPGA 5DOVA 1ULSA 4UEKA 4DYVA 1PZHA 4NFSA 4RF3A 5IDQA 1DSSG 3IOYA 1NBOA 4RVDA 4CLEA 4FJ2A 4CM7A 3DAFA 3TZHA 4LSWA 2R00A 1CYDA 4YJDA 1ONPA 2D1YA 4WECA 4CPDA 4ZQEA 2EW8A 3ASVA 4M86A 3D3WA 4I08A 3Q6IA 2ZQZA 3I5MA 3UAGA 2BELA 4NBRA 4BNFA 1KVSA 2FOIA 1BHSA 3RC2A 1W4ZA 1LDYA 4CR8A 4HUJA 3V1YA 1K0UA 3JQ8B 1UZLA 1IUKA 4MPDA 1LSSA 2DPHA 5JPIA 1ULUA 3RU9A 3L6OO 2FRDA 3C1TA 4HWKA 5CEJA 4URFA 3MZ0A 5JC1A 2CZCA 4IJVA 4IXWA 2C82A 1GYQA 5H82A 2YZ7A 3DEYX 5A5FA 2I6TA 2F00A 3BZUA 1E1MA 3ASUA 4XB1A 4AJOA 5MDHA 2HKIA 4CMIA 4YYZA 1VM6A 1U2DA 3TRIA 3UH1A 3DZIA 2HMSA 3AM3A 2ZCUA 2J3HA 5U1PA 3BTUA 4BKQA 2DT5A 4IJWA 3GEMA 4JP3A 1F0YA 2XXJA 4GMGA 1PJQA 4INAA 3OA2A 1U1IA 3R0IA 1RM3A 5DBFA 1O8CA 2VHWA 1G1AA 1NQ5A 3F1LA 2Y1OA 2WYVA 2Q50A 4UVDA 5TX7A 5AXBA 5CDTA 4ZN6A 4NI5A 2GERA 3F46A 3FF4A 3DFZA 4P22A 4R1UA 1PGPA 2XPCA 3EDMA 3H2SA 4NBWA 1EMDA 5AXAA 1GCUA 4E3ZA 4R51A 3KO8A 3JQAA 3VKUA 2BRUA 1MV8A 4CUKA 1H93A 4FFRA 1GEEA 2GF2A 1ONOA 2D4AA 2CDCA 2QRLA 3LLSA 4JX8A 2EHDA 5C5IA 3WTCA 1E7QA 2DTXA 1MG5A 1HSOA 4QTZA 3WWZA 3GG2A 1LDGA 1CERA 4HP8A 3NYWA 2GO1A 5JXWA 5HWSA 1K6JA 3KOUA 3VZRA 2VTEA 1FXSA 2Y05A 4I9UA 4TROA 4XWYA 5TGDA 3TWOA 4DUPA 2ZTLA 1Y1PA 3B20A 3IDSA 3Q9NA 4Z9YA 1MC5A 3R1IA 5J23A 1Y5RA 4Y9DA 1J6UA 3RU7A 2IRWA 1B14A 1BXGA 2VZ9A 5BNIA 1H6DA 3WGGA 2IXBA 2EGHA 1YWGO 5KWEA 2HJRA 2O23A 2BH9A 1RM4A 3NTQA 1GPJA 4CMBA 1BSVA 4KOAA 3ZWOA 4PGFA 3EZYA 1P33A 2QHXA 1FDUA 1LEHA 4PZCA 3ZWPA 3DBRA 2VHZA 3PVZA 2YV2A 5I9NA 4N18A 3RKRA 4E5KA 2NVUA 3GA0A 4WUVA 4UREA 5A04A 3AU9A 3GRKA 3JQAB 4DIOA 2EIHA 2LDXA 2GPTA 2ZTUA 4CMAA 3ZH2A 1MC4A 3I1JA 4DQVA 1C1DA 3DMTA 3CIFA 3PIDA 4X54A 3FNHA 2VNAA 4TSKA 4DPKA 1PZGA 5DOZA 3BTVA 1UXGA 1VL6A 2PK3A 4WLOA 3BA1A 2RH4A 2EG9A 2GASA 3GAZA 2EKQA 3DZFA 3WBFA 4DLAA 5I7VA 3ANMA 2VYND 3S2FA 2C59A 4XQCA 4PZEA 5BQFA 2GLXA 4E12A 1MA0A 3L6DA 1ZSNA 1BXGB 1EK5A 5H83A 1HRDA 3DL2A 5EJ2A 1DC5A 4UVGA 1MXHA 1YGYA 3FTNA 1JWAB 1JQBA 3BHIA 1LDMA 2NNLD 1DDOA 3F4BA 3JQAD 1KYQA 3PXXA 4RPHA 1WDKA 2Q1TA 1GPDG 1C0LA 2NU9A 3DBRB 5C7OO 1X7GA 3B6ZA 3LT0A 4IGFA 4E2XA 1HL3A 2JAPA 2JHGA 4JROA 3HQ4O 1PZEA 4XYMA 3E8XA 1NR1A 3KLPX 1FF9A 2NVUB 4G81A 5EINA 3ZHXA 1WP4A 3INGA 2RH8A 4Y6PA 1E6UA 2P68A 4PLFA 1IULA 4XDZA 3WSVA 4L73A 3I23A 5T64A 3EVTA 1C1DB 2V7PA 1S6YA 1XQ1A 3IUSA 4Y8VA 2BI7A 4WLFA 4EGFA 1K6IA 3NRCA 1EQ2A 3ZHYA 1H6AA 1XWFA 5F5LA 1IOLA 5A3VA 3WYCA 1A72A 5JYEA 3I9NA 1N1EA 3VH3A 2DBVO 2VCYA 1VJ1A 3VDRA 4CM3A 3KSDO 1OC2A 3ZW9A 3JQFC 4R4JA 3ZNOA 2NADA 5DP1A 4RQTA 1O6ZA 1T1RA 4A5OA 2X8LA 2P9CA 3RROA 1LSJA 1NAHA 4EW6A 3PHGA 2F1KA 4HXYA 3ZWWA 5JY1A 1FMCA 4FBGA 3C1AA 3PPIA 4II3A 3W4JA 4RF5A 2OO5A 1U4OA 2Y67A 3OQ1A 4CL3A 1Z7BA 2ZQYA 2O7SA 3BTSA 4AVYA 2I3GA 2QIOA 3HNPA 1YQXA 3MJTA 3HFGA 3OEYA 1PEDA 1BXZA 3GK3A 1IHYA 4ZHSA 1E92A 2OGUA 4R1NA 1HDOA 5JAQA 3GG9A 3H9JA 3UW3A 4CJXA 1ZEJA 1PWZA 1HDGO 1GV1A 4XYBA 4AJ4A 3D0OA 3U3XA 1CQJA 5L53A 3GFGA 1QYCA 3O38A 3HDYA 4LVCA 1EE9A 1GV0A 1PTJA 1ADFA 4JQCA 4G2NA 4GLOA 4FPXA 4B3HA 2I5PO 1DAPA 1GEGA 1BW9B 1I2ZA 1NQTA 3JQGA 4L4RA 2Y0EA 3KVOA 4EEXA 1L1FA 4ND2A 2VWQA 2Y0CA 1B26A 1JN0A 1ZK0A 4P4NA 4YAKA 4BO4A 1E3WA 4MVJF 1QYDA 3VVCA 3QWAA 4PG8A 4F3YA 1PJCA 2Q1WA 4YJGA 4BNUA 5CHEA 3DHYA 4BHTA 1UJMA 3P2OA 2ILTA 2XOXA 1TT5B 8ADHA 3QE3A 5F3RA 3CXRA 2B0JA 1I01A 1SZJG 4LCEA 3NTRA 4PLZA 4RVFA 5EL0A 4BOYA 3AFNA 3DQPA 2C5EA 1E3JA 1HEUA 1T4DA 3LZ6A 3KEOA 3RAJA 5CEFA 2IODA 2HMWA 3RUFA 2YFHA 1SEVA 1W8DA 3PYLA 4MVJE 5IDYA 3IAHA 2I65A 3WGYA 4E4YA 1ISHA 3GY0A 4N7RA 4ZRNA 2JCYA 1E6WA 4BNKA 4E33A 3VKVA 1NPDA 4GI2A 3GHYA 1QSGA 2RHCA 4CMGA 2G17A 3DZBA 3RKUA 1E6EA 3PFWO 3MJ4A 2AMFA 3SJUA 1T4BA 5L40A 4DC1A 2H6EA 3TL2A 5TNXA 4BKPA 5EN4A 4BKRA 2O2YA 4H15A 3FWZA 4J90A 1GQYA 3JQGB 3PHIA 4BVAA 2PD4A 2I3AA 4AJNA 2AXQA 1B7GO 5LC1A 5ES3A 1V3VA 2X9NA 1E3WB 1EFLA 1W73A 3E03A 4RLHA 5HRUA 2HQ1A 4YJGB 2QYSA 1DIBA 5I8WA 3I52A 3R3SA 2B5WA 1P0CA 2G82A 5KJ6A 1KC1A 1UZNA 5GZ3A 2HUNA 3OIDA 1ZEMA 2NTJA 2GZ3A 1DIAA 3PZRA 3M1AA 1AHIA 5T5QA 4BO7A 4JJIA 4AJKA 1KVUA 1A27A 1Q7CA 1LQUA 5JE8A 5JSFA 3OF2A 4J2OA 1GY8A 4EUHA 1DRUA 1LSUA 4PLWA 1LX6A 1LRJA 3LT4A 1P44A 4DPMA 1DFGA 3PI7A 3C7CB 5DCWA 6ADHA 1E7YA 3W4IA 4FDAA 2X58A 1HYHA 2EXXA 4F6LA 3LLVA 4FCCA 4J0FA 3FNFA 4OMUA 2H63A 3RBVA 1ZJYA 3RFXA 4YT8A 2HK9A 4OXNA 1XDWA 4DIFA 4BMVA 4U5QA 3K8ZA 2W2LA 4A27A 3QVXA 2FSVA 1EE2A 4OKNA 2E48A 2PGLA 4R5HA 4YXFA 1AUPA 1C0PA 3HADA 1QKIA 2V65A 3PGXA 3W8DA 1P0FA 4GKVA 5IF3A 5JW6A 3HN2A 4E32A 3HFSA 2I66A 3NGLA 3WNVA 1E0DA 2OFPA 3N74A 5BSGA 4YAGA 3QSGA 2VHVA 2D59A 1NX6A 3AM5A 4UUPA 1HETA 1K2WA 1UUFA 2Q2VA 2Q46A 5KNLA 1HZJA 4YT4A 1HDZA 3ZGYA 4GQAA 1ZK3A 1R37A 4NNJA 2FPGA 2WWRA 3AFMA 2YW9A 3WX0A 4AJPA 1I10A 2YQ5A 2Q4BA 4RJTA 4EDFA 2UDPA 3T4EA 2JFFA 3RIHA 3F6YA 3C7AA 3U4HA 2Y1GA 3OIFA 2Z1NA 1DLIA 4FB5A 3U09A 4AICA 3QVSA 3WLEA 3Q9UA 4AJLA 4CMJA 5K9ZA 3VDQA 4B4OA 2BFOA 4W7HA 2EV9A 2RIRA 1CWUA 4J16A 1KEVA 1I3NA 3BMOB 3FTPA 2VQ3A 3ON5A 2JCXA 4EUEA 3AK4A 3GPDG 5DULA 4IINA 2E6UX 1UAYA 4ALMA 3WGQA 4GVXA 4KDEA 4TQGA 1WMBA 7MDHA 3GHHA 3KBOA 4UUOA 5IXSA 5JAMA 3KZVA 2Y1DA 3HJAA 4I9NA 4NFYA 5ENDA 1O94A 4I8XA 3W6UA 1I3LA 4R5MA 3GNQA 3M2PA 2AHRA 3WQRA 4CUJA 1NHWA 5DF1A 1VJTA 1TA4A 1GD1O 3ANNA 4YJFB 4IJUA 1YKFA 1YB4A 5ICSA 4RV9A 1ZSYA 2XXBA 1DB3A 2CUKA 1KEUA 3BTOA 3EY4A 3SX2A 3NT4A 2FR1A 1E5LA 5JAZA 4MVJH 1B8VA 2YFQA 3N7UA 2PZKA 1LNQA 1YB5A 2A92A 2AG8A 2AQHA 3DOJA 4IDGA 3ST7A 2D8AA 4CMHA 3OJEA 3GMDA 4WLUA 4DA9A 2FSSA 3K92A 2Q2QA 2DUUA 1DIHA 3K6JA 4MO2A 4P8RA 4DBZA 3CZRA 4I5GA 1BG6A 2HSDA 3WGZA 1DHRA 4WJZA 1KVRA 2IE0A 2IYOA 3CPSA 1HLDA 4JBIA 3DHNA 1ZH8A 4NK5A 4RPKA 3U0BA 1VPDA 5CPBA 1JKJA 1KY5A 3KYBA 4IPTA 1WPQA 3F4LA 4FR5A 3ZHZA 5A5EA 4XRRA 4A10A 4FW8A 3SLKA 3JQ9A 1JW9B 2O2SA 3ZWXA 1O0SA 4QECA 3H9EO 4B8ZA 2EEZA 1HDCA 4IXTA 4DQXA 3S8MA 3UGKA 3JD0A 1HWYA 2HCTA 1PWXA 4R69A 1PS9A 3L6EA 4GMFA 3C7DB 2AE1A 3A9WA 4IDBA 2UVDA 2Y68A 3DO5A 4A03A 3DWFA 1BWSA 4IS3A 3JYPA 1LXCA 2NU6A 4QFCA 4TZKA 4XA8A 1RYEA 2GCGA 2GDZA 1DC6A 2HAEA 2UUOA 4K28A 3RBZA 3UCEA 4I9HA 1LDBA 3GC6A 4Y6RA 4PG7A 3GN2A 1IPEA 1Q2XA 3ADOA 3IJRA 1EEHA 3ZHBA 4D44A 5L4SA 4E31A 5FYDA 4RORA 4L4XA 4BMSA 5KVQA 3TOXA 2FPPA 5KVCA 1LLUA 1RWBA 1C0IA 2NSDA 1H6BA 1IYZA 3JQ7A 4E2WA 3S2GA 4XDYA 5CDYA 1R0KA 4DMLA 4NFHA 3NDJA 4NBUA 5JO0A 3BYZA 1ZXBA 1SOWA 1P1RA 2C07A 3FNEA 5F1OA 3IS3A 3LF1A 1LI4A 1QYWA 3HE3A 4P38A 3V8BA 3UUWA 4D3FA 1SB8A 4J7CA 1LA2A 1R4NA 3QVOA 3G3EA 3MWDB 2VNSA 1RJWA 3RJ9A 9LDTA 5FF9A 1WAMA 3PP8A 3QWIA 4XEHA 1WVGA 1XKQA 5JS6A 4J1QA 1PGOA 3JYQA 1DEHA 4XB2A 3HB4X 5AXDA 4NQZA 4XRGA 4NMHA 2DFDA 2GN9A 2NQTA 1XU9A 4FOOA 3AJRA 4PLPA 4A7PA 3ZU5A 5IZ4A 5TRTA 3VPFA 2O48X 2Z1MA 3AY6A 1LTHR 3K5PA 5HS6A 3WICA 1OOEA 3ITDA 5T57A 4ESOA 3LC2O 3DOCA 2HU2A 4TWRA 2HMTA 3AI2A 4Z3DA 5TJ9A 1R16A 1EDOA 4WCFA 2OHXA 1EDZA 4DL9A 1P45A 1NQOA 3H2ZA 1BRMA 3JSAA 1NNUA 1BDMA 3JQ7B 3AU8A 3NT2A 3GF4A 4KWIA 4WASA 1VJ0A 2R00C 3AWDA 5BNTA 4D79A 4XD2A 3ZU3A 1T2EA 2QX7A 3BHMA 3PYXA 2BI8A 4CODB 3ULKA 4K26A 4WGGA 4B7XA 3MCVA 4JCOA 1WZIA 1NFRA 3AY7A 1XLTA 3JV7A 4PLVA 4NIMA 4ZJUA 1GTMA 5IDXA 1DOHA 3WSWA 1R4NB 3ONEA 3VZQA 2JFHA 5ICMA 4NU6A 3I4FA 3NDRA 3RI3A 3ROQA 5F5NA 4BO3A 1HTBA 1MP0A 3E82A 5ITWA 3G79A 1EFKA 1E3EA 3U9LA 2X5JO 3ZWBA 2QG4A 2YUTA 1SEPA 5DBIA 3GVIA 2FR0A 4MIOA 4Q3CA 2NVBA 4ILKA 1JVSA 1IB6A 3IUPA 4CV0A 2EP7A 4BO9A 2PD3A 3BAZA 5JC8A 2BFMA 3AUUA 4RLSA 2EJVA 4GX2A 1I2BA 2JD0A 1PJBA 2BFPA 5B1YA 1I3KA 2PD6A 2QW8A 5EQDA 3JQEA 4JJFA 2O4UX 4YB8A 3WGOA 1NVMB 4WCFB 1JWBB 2VYNA 5B37A 3NEPX 4R9SA 5A1TA 2IXAA 4Q3NA 5L7TA 2DM6A 1ISGA 3L4BA 3RC7A 3G1TA 1VI2A 3NKLA 3DBVO 4MVJG 4Y98A 3UCFA 2GN8A 3VHRA 4QSMA 1A5ZA 3NX4A 1VC2A 4N5LA 1JA9A 4KTTE 5FWNA 2D0IA 4CM6A 3CINA 3WQQA 1H0KA 1YBVA 3W8EA 1UXIA 2C7GA 4TVOA 5F1PA 4OSOA 4GWKA 1I0ZA 1Z7EA 1MFZA 4FFLA 3PK0A 4DRYA 4S3MA 4BQPA 4DTIA 3EAGA 1JVBA 4W6ZA 4LRSB 1Y8QA 2YYYA 3IMFA 2G76A 4ALIA 1ENYA 1ADGA 4QFDA 4NJOA 2W2KA 2NU7A 2RCYA 2R6JA 1R12A 5BSFA 1JTVA 3WBBA 2G5CA 1FDSA 1QORA 4YRBA 2P2SA 3G1UA 1XIVA 2NTNA 2E49A 5CG1A 1Y7TA 3BXXA 2IZZA 3INRA 4GH5A 4OJNA 3PIIA 2PGJA 2HRBA 1YBAA 5EQFA 3D4PA 4WEOA 1F8GA 2PH3A 3B1KA 4MP8A 4KUGA 5CEEA 4J1NA 3ANLA 3IKVA 3JCZA 3WS7A 3JQBA 3NJ8A 1ZVMA 3LT2A 2P9GA 1E7MA 2CSUA 5KTKA 2QZZA 3JQBC 4LK3A 1SC6A 4LGVA 1NM5A 4ONEA 1H9BA 2X6TA 5KKAA 5B12A
chains in the Genus database with same CATH superfamily
1SQ0A 3VOBA 4MHOA 1W52X 1E4VA 1O2DA 1KZYC 1U7UA 3Q8KA 2M1ZA 4CV0A 1II8B 4BQEA 5KPJA 2ZCJA 5T3UA 1TK2A 2MSLA 4UUAA 3G0BA 3L5KA 4ZRMA 3OX3A 2IZ1A 4R8KA 4N54A 1CS4C 3BVPA 1XLWA 1L5LA 3X1WA 1FDOA 4J1TA 4RZ2A 4ZVNA 2ZIEA 4F5WA 2WJPA 3GA7A 3KQSA 4KR9A 2H3HA 3KQQA 3KNZA 3V3TA 1D9ZA 2BHNA 4GX1A 4A0QA 5FPQA 5KX5B 2OUIA 5BNFA 2OOKA 1NYTA 2B8EA 5CU7A 1JNXX 2Z3VA 4K87A 4HC4A 5D6NA 3RBXA 3D8BA 3DXFA 3GLGB 3FOZA 2YL2A 1SBTA 1AGXA 1JG4A 1QHYA 4PZ9A 1Z6XA 3T7JA 1VRVA 1WQ3A 3LAWA 3I2GA 3K8OE 4CG0A 4B5LA 3L1VA 3JQPA 4IEIA 4G8BA 3B3AA 3Q2KA 5HGJA 3PG5A 4MVWA 3F3MA 4B2LA 4NHEA 1UXHA 2ZTMA 2VSYA 3G7SA 3O2JA 4FUTA 2DULA 4MEBA 2JBWA 3W3AA 2B7CA 5E1DA 1XCGB 2WZCA 1X3SA 2CVOA 2GHQA 2XUJA 3DAOA 4JH0A 4HL6A 4V0ME 4PYJA 2P79A 1Y5MA 4U39A 3B82A 4GMKA 5DHRA 3BD7A 2YWRA 4GLLA 2VTBB 2J08A 3VGPA 1A7AA 3NHRA 4OY3A 3BWCA 3THRA 2H54A 3WK4A 4TXLA 1U7HA 3U31A 1D1QA 1U5BA 1EVZA 3DSRA 4ML3A 4PHGA 3GLTA 4ZYXA 4HFJA 4XJSA 3ETGA 5AJWA 2RBKA 1A1VA 2JAOA 3PKIA 4B7AA 1WE2A 5FLKA 5ALWA 4BKOA 5A4IS 3F73A 5G2OA 1QLJA 3G5LA 3R5JA 3RVDA 2P4UA 4JKYA 3QWHA 3HJCA 3OZIA 3HWX1 5F64A 2BFDA 3OO1A 2D06A 2N46A 4HFMA 4OB8A 4LSMA 3HUDA 4K8RB 3R0VA 3WWDA 1BW9A 2I2CA 2YHAA 2ECKA 4KO2S 1CW2B 4DCGA 3LKVA 1O5OA 4X63A 4ZOBA 5BYJA 4EGSA 4B75A 4QU0A 1GLGA 1WDWB 4Q01A 2BIFA 3FMGA 1EQUA 1T1EA 2BBTA 3PNQA 4LNHA 5IXYA 1SKYB 2GPAA 1R0YA 2GA9A 2X5NA 3RBAA 5KREA 3MILA 3U3JA 3IC5A 3FI9A 1ACLA 4MIKA 3ENVA 1C80A 3TRDA 4TTRA 1G55A 4HWGA 3A1WA 4A1OA 1VKHA 2XE7A 3N9IA 3AF2A 3NTLA 3U4GA 4O2AF 2C9MA 1JJAA 2PUJA 4ES6A 3R41A 2XWJI 2ZRKA 1J0CA 4R1SA 4GXQA 4ZI5A 2G8NA 1G5RA 2BBWA 4CLHA 3LK7A 5EIOA 1HG1A 4DBLE 1EWTA 5FDFA 1UMCA 2KHZA 5DRTA 1BDHA 5ETJA 1NLUA 4MEAA 1EVYA 3ONDA 4JJ4A 5B2EA 3WNDA 1SRRA 2QN6A 2R44A 3AF5A 4NONA 3M8KA 4KN6A 4BJ1A 2IY9A 2VBCA 1U28A 1IY8A 1ZWLA 4DDKA 4MROA 3HGQA 2X4LA 2V97A 2YV4A 3GGSA 1U5BB 3HFJA 4DLBA 1XZJA 1SWVA 3IHWA 3PKJA 1U28C 3EF1A 2Q62A 1HX7A 1V5FA 2JJYA 5AKHA 1P7PA 2P8SA 5F2EA 1BGVA 5BORA 1HT3A 1IBRA 1Y3DE 2HDHA 2OCPA 4RWEA 1P91A 5D2CA 1SXPA 1PS8A 4LPSA 1CEEA 1HFJA 3V7UA 2BFDB 1BGWA 1J2YA 1N57A 1P7ZA 3H8SA 4UM9B 3HP1A 1TEVA 3OKCA 3EGEA 2AG6A 5I4BA 4JVMA 2XADA 2J0UA 1RAAA 1ZA2A 5CBPA 5DM70 1EB8A 2PT5A 1LDNA 3IP5A 3K9GA 3NH9A 3J7TA 3NALA 3QF4A 3HCEA 4TT3D 4UOZA 4AS1A 2FMHA 1PJLA 4MVJM 1C8BA 2Y4NA 4N3NA 1NC1A 2A6PA 2V5VA 5CT9A 1Y9AA 4KGVA 3PDHA 2C8KA 3A8TA 4JVOA 5KTRA 2XWQA 2G80A 2R1ZA 3IILA 4I66A 5FUBA 3UICA 3ZDXB 4EX7A 5C1DA 3PWZA 3ZWVA 4CLOA 3RWBA 4IHQA 1J2JA 4YONB 2H52A 1ZIPA 2VG8A 1Y4AE 4QAQA 2IV3A 5B3JC 4LWZA 1Q0HA 1RKVA 3UMVA 4ARUA 3BE6A 3RAPR 1XRQA 1MCZA 5I8ZA 3ZZNA 3UMBA 3MLAA 3WLLA 1FFAA 5DXJA 5LA6A 3ZBQA 3R5KA 3AM1A 4MQMA 5I45A 4TSFA 1A2OA 3C15C 1UMCB 2GN1A 4P3XA 1QJCA 3IR6A 5AW7A 3NHMA 2X9VA 3KZ1E 3UJDA 1B73A 1S0UA 2JAXA 1YKSA 5EXDA 3URMA 4MULA 2QTZA 4UM9D 3LD9A 1E9BA 1CETA 3AILA 2W2XA 2PJUA 3GT7A 4OKSA 1JQDA 1Y9EA 2GCEA 2COEA 4ETIA 5HMLA 2HV9A 3CF0A 3W2EA 1XVLA 3W77A 4EB6B 4QDZA 1I6MA 3RAFC 4EKYA 1Z0FA 1DO2A 1XQ6A 2ZEJA 5ENVA 5FUWA 2F67A 4ARZA 1EK2A 5D84A 2QTWB 3OECA 2YJGA 3OP4A 4BRZA 5ICEA 4IMPA 1IM2A 1U81A 2L42A 2A9KA 1WPGA 2ZB7A 4FEGA 4J9UE 4NPHA 2GD0A 5ICGA 4JX9A 3L46A 4V24A 5FWYB 2WINI 2VPXA 2J0UB 5CBPB 5E4YA 4OMCA 3GFPA 5EE5B 1PJAA 3H6KA 3IXQA 4Z4IA 2Z0MA 1OWMA 3EEBA 4CKWB 3KQNA 3D1JA 1DIRA 2XNSA 1RCFA 1S8FA 1CS0A 2DPXA 3O5AA 1Q0TA 3OQVA 4HADA 1IXKA 1GO2A 1NDQA 4RA6B 1NG1A 1PK8A 1MO6A 2IYNA 3TECE 4L74A 1HR0B 3MTJA 2J07A 4MPTA 4CLOB 2CKDA 4TLMB 3TUZC 2VJCA 3MHPA 1D1PA 2A1IA 2VA9A 1V2HE 3T34A 1G20E 3T7RA 1CDDA 4JU9A 3IVGA 5GVSA 1WPRA 3RRBA 3KDSE 3IAFA 3J80A 4MJXA 2BM0A 3KKPA 4QXAA 5LA6B 4BNYA 1AA9A 1A7KA 2PZAA 1ZNXA 1VE3A 3LT5A 2DRIA 2IPAB 2Y99A 1VI6A 3CPHA 1N1MA 2F1IA 4J2TA 3RRFA 2YZNA 3W5IA 3BXPA 2M32A 2FZCA 3SBXA 1TI7A 5TT1A 2WA1A 2PV0A 2ID7A 1MAHA 1XDSA 2BDEA 2D5AA 4MX8A 3BFVA 5KVSA 3G0OA 3UFBA 8OHMA 3QBVA 4YTEA 4HGRA 5MGBA 2AUTA 1T2DA 3G7NA 3TQCA 4NK4A 4J49A 1Z7YA 1LBIA 3O1IC 4JLAA 4JL8A 1CR6A 5EIWA 4MWBA 1C50A 4QUIA 3MS7A 1JAYA 3ADBA 3I83A 2HK8A 4KPEC 1GAWA 4ARZB 2GPNA 4EUKA 5IANA 4PFJA 3P9YA 2HT1A 3E84A 4LHEA 1KEWA 2PTHA 4IYJA 3H3FA 3NUQA 4MRNA 3HI4A 5HF5A 1W5AA 5LJIA 4JJ7A 3SZUA 4FZ5A 1F8XA 2GZHA 5AKYA 1WM1A 1DKNA 1NF3A 1I0LA 1A9YA 1DAEA 2CFSA 4I5EA 4K6FA 2FEWB 5E4FA 1LQTA 2BGRA 2BM8A 3ROMA 4PNEA 1JH9A 4YJ2A 2CMKA 2JFGA 2XOKA 4TSFD 3EEOA 5KC9A 4C7OB 1I3MA 2IPNA 1AC5A 2VXYA 3ESAA 3HN6A 3PICA 3F5SA 1WUIS 1ZNQO 3ISTA 5T8KA 4EB3A 3D3JA 2IZOA 1U80A 1OC4A 3CUYA 2W4MA 1TQ4A 3NW9A 5AXCA 3VNSA 1BROA 1TNDA 4AX4A 2HSEA 2ID9A 5GJBA 3IQIX 5T8KC 1D7OA 1T8PA 1IQRA 4CM5A 1NW3A 4HYQA 4FWIB 3HB1A 4U0JA 3ZWQA 4GC5A 2GBFA 4XR4A 4FGKA 4O4JA 3AUXA 4I1YA 5IX8A 4LDZA 4ZOAA 2V4MA 2BMAA 4PANA 4OXKA 4IUCS 1E62A 1ZVQA 3UTDA 3EW7A 3G0GA 1Z2NX 4HK4A 3V2GA 4W6QA 2IHZA 2P1ZA 4OL0A 4UJ3A 4PS1A 4F5YA 3CFYA 4E46A 3X3HA 2FFQA 3IP6A 3BPSA 1SD1A 2OGWA 3W04A 1UBJS 4IZOA 2WIFA 1J24A 1SHZA 1IG3A 2W00A 3B1VA 3LY7A 4JENA 2AN5A 4M89A 3KZCA 3CF6R 1GR0A 3OM1A 5TF4A 3I5XA 4D6PA 3S28A 3LZCA 1Z0JA 3PDJA 1F06A 3GUHA 4LWQA 3DFUA 3HVJA 2C7PA 3FBGA 1KI2A 3QYFA 3L7IA 2N1MA 4PWZA 1QH8A 4LV8B 3WYEA 2F8TA 3TLYA 1BDIA 1TCAA 3F6SA 3LCUA 1WBJB 4GYYA 1TM7E 4B7UA 1NF8A 4I4CA 5A62A 2MR5A 4GPD1 1G0OA 2I2DA 3AR2A 4MR7A 3L7LA 4YJ2B 2P4QA 3KB8A 3DTTA 3KHUA 2Z5LA 2O1WA 2TMDA 4KN8A 5FH9A 1Z26A 2JJQA 2N9UA 3C6QA 1R00A 1I7NA 4ZV7A 4Z3KA 3DLHA 1O89A 5KJCA 3E9MA 3HB0A 4NXNB 2VQFB 4B9AA 5C37A 1DJNA 4G56A 4HXGA 5IVHA 4L3VA 1X94A 2WTUA 3BRSA 4G07A 2Y1EA 1XSEA 4B4VA 2R5FA 2EIXA 1ZLYA 2Z3WA 2BW0A 4JN6B 3HKCB 4FS3A 1XMSA 4O4JB 3WIDA 4CI9A 2HA3A 1PX2A 3IB6A 3IUJA 3IUQA 1GPUA 4KO8A 2QD3A 2Q1UA 1K98A 3JYLA 2UYYA 2HNAA 3LPAA 2MYUA 1TZMA 5ALDA 5TQ0B 5AK6A 3R6DA 3SLRA 4Q82A 2WYWA 3M5DA 3N86A 4MGEA 4OFZA 5JPDA 3LH5A 1WKVA 3NZEA 1N0HA 1CVRA 2BGMA 1NUQA 2ZULA 1P1HA 2B6HA 4E6PA 1U8YA 1KHHA 2EW2A 3I37X 4ND3A 1B15A 4LY6A 4UCWA 4XSGA 4X8HA 1CU1A 3UK7A 3BH0A 1ENOA 4EA9A 2I6GA 4LBYA 3JQ9C 3MN1A 1F2UA 4OATA 1IY0A 4ARAA 4B4UA 3RLIA 4W5HA 3AP1A 1JI0A 2FNAA 2NM0A 3AXTA 4BO8A 3EOBI 1QH8B 3VHLB 1DV1A 2IVFA 5KWJA 4YC7A 3TPZA 2WLSA 5C35A 4LBVA 3CWZA 4BCCA 4GRDA 3KQMA 4MR7B 5CYOA 1XKLA 2GS9A 5F9FA 1H22A 2GRAA 3GEHA 4G1MB 4LK2A 1S3GA 2FSPA 2W2NA 3DAPA 3RIEA 3TR6A 4KO1S 2BUBA 1UANA 4FKBA 4ROSA 1ZPDA 1AHHA 2C4MA 1W4CA 3RVPA 1N5LA 3ZI0A 3B1YA 2QGFA 1XDGA 5GV7A 5CAEB 2G5GX 3C3PA 5FI1B 2E3JA 4G5OA 2AFHE 1T1IA 1UWCA 2VHQA 3PUXA 2VT3A 4OHVA 1QYVA 2JLCA 3ZH2A 3MT0A 2VZLA 3NANA 4PPGA 3MOGA 4Q4AA 2AGVA 4Q93A 1PDOA 3TTSA 1MIHA 4AMYA 1UEXC 4RKYA 4DN6A 1V7CA 3FCOA 5CXSA 4N82A 3WWPA 3MRTA 1K89A 3IVMA 4GBMA 4RZXA 1IN6A 4JR0A 5AOBA 4PXAA 1TYBE 4ND7A 4GXTA 2LIPA 1AE1A 4YRGA 5BXQC 1UEIA 1MUUA 4HV4A 2QTBA 1X9IA 4KQJA 4O8CA 3CR8A 4QHTA 4YP0A 2JF0A 3WKCA 4N03A 1XHEA 4CQMB 1SA0B 1V1RB 1N5DA 1M74A 3UWPA 1MQ8B 1Y9ZA 2YJTD 1ISRA 4BV9A 1JHXA 2ODQA 1H5NA 1NW6A 2PGIA 1JQ5A 4LE0A 4O08A 1JHVA 4WJKB 4ZXFA 3ZG6A 1HE4A 4CDNA 1VMAA 4D99A 5CIYA 1R0XA 1TW2A 1VDZA 2FPKA 1AT1A 4L0QA 1F2UB 4BDSA 4ABTA 5JEEA 1AKUA 4URYR 4X7MA 2YYSA 2YDYA 1F14A 2HBQA 1Q2UA 2QMHA 4M98A 4EY3A 4NYIR 3ZY6A 3LP6A 7ABPA 3WGHA 1SK9A 4LYDA 4MA0A 4FIDA 4C0QC 2QE7D 3A2NA 1FBTA 5K6AA 2ZUEA 1NDUA 3GJRA 2CNWA 3KYIB 4NCHA 3W2GA 3EUWA 2PEYA 1BCSA 3S8EA 1P4GA 4LOLA 3MSXA 5I7SA 1DAOA 2GNOA 3AKCA 2PSDA 4RKFA 1N6NA 1UMDA 3U4IA 3EXIA 4KLNA 3WFIA 1KERA 2HOQA 1RKQA 2HQSA 2EF1A 5DYGA 3V9AA 3KD3A 3QVLA 2JI4A 4NYMR 1R74A 2BFEA 2QW1A 3VU8A 3WB1A 1YJQA 2PFGA 1LJLA 4PLHA 5FQOA 1ZCZA 3S8YA 3VA7A 1I1HA 1UXOA 1QLHA 4CQMD 3L6UA 3VPDA 2HHCA 1UBRS 2J0EA 1QGYA 2A88A 2I54A 1ZOOA 3AI3A 2PPLA 1XD2A 3B5IA 4Q4AB 5JS7A 4BLSA 3B1XA 2JFBA 4DDHA 3MGCA 2A0XA 4WL0A 5L3QA 4EPTA 2CZQA 2ONYA 4E7PA 3ZYCA 3KLNA 1VSUA 3GGCA 1E0AA 3WQSB 4LF4B 4P5EA 5D86A 1UIRA 1VI5A 3MEQA 4G9BA 4KIWA 3D81A 1QHSA 2FEOA 4IIYA 3THWB 3THXA 1VHTA 6PFKA 4GC9A 3EQZA 3K15A 1IEWA 3W5SA 421PA 1Q44A 2GVZC 3B12A 1RAFA 3A3YA 3HMKA 1KTIA 3ZU6A 1MC8A 2N0SA 5EE1A 1Z7GA 3ETEA 1W5SA 4TLDA 4BNTA 4GPBA 3D1LA 5KDDA 5J3JA 1NLZA 1JSCA 3M9XA 2AXNA 1MIOA 2XUOA 3KVNA 2QYHA 3UHAA 4EA7A 3VNRA 3RWOA 4D80A 3E3LA 5JSHA 4OHXA 4NESA 4RHYA 3QJGA 4HN2A 5CH3A 4LC1A 1NXVA 2B4TO 3OUZA 4IYRA 3WKBA 4Z5XA 4BX9A 5HE9A 2DG2A 1T9GR 4JT4A 2WSBA 1DQPA 3PD1A 3IAS1 3LYHA 1CR1A 4D4IA 4EO9A 2BSAA 3MNFA 1BMFD 1XTZA 2WC1A 1RZ3A 1W36B 3S1SA 1L5MA 2YBDA 1BCSB 3AR3A 4CU5A 4XW2A 5FTNA 4MQEA 1UMDB 3DNPA 2Q1XA 1GZHB 2O2ZA 3EXIB 3W7VA 4ER0A 4RVUA 1GUFA 2GT1A 3IT1A 1Z0AA 4IWXA 1YTUA 3FN4A 2F1HA 3SS9X 2BFEB 3CRRA 4LV6A 1GAEO 4ZU1X 2WAYA 5LUAA 1EVLA 4ZWNA 3M5WA 2BKVA 4ZO4A 2QVLA 3QVKA 3BBLA 3ILHA 1W85A 2JLZA 1JDBC 2OVFA 4XDGA 1EP9A 4FVTA 3HBAA 4FFBA 4LPKA 1XD2B 5FV7A 4MQ6A 3PNLA 1KDVA 5GMOA 3ICWA 1M1ZA 2QU7A 4TKZA 1Z13A 1VHWA 5L3QB 4BNJA 1NIPA 1TMOA 5DTMA 4ND8B 3WJ1A 4XVHA 1OZAA 1OI7A 2JIBA 1K4KA 1GTL1 1U9ZA 1W88B 2CLHB 3NPAA 1E1NA 2VS1A 3THXB 4HDRB 2QTAA 1OY1A 2IEDA 4MRVA 4PLGA 3T0FA 4BJ5A 4TWBA 1NW7A 4IX1A 2RHGB 1VZ3A 1P2FA 3FCEA 3BD8A 2HNKA 3CUSA 3DMFA 4OJYA 1W36D 2ATCA 2P78A 2DFKB 5AVZA 1ZN8A 4GDFA 3FDXA 2QRHA 3VR1A 4Y67A 1MIOB 2ZRAA 4KL8S 1DO8A 3BMXA 4NEGA 2VLIA 2O57A 4UTXA 1Z4LA 4Y2SA 5DKFA 4AL4A 1JEAA 1GR1A 4Q3DA 1C7QA 1HNWB 1E5QA 1UFQA 4E21A 4X62B 1FCJA 2PLAA 4C2TA 4MKFA 4M0UA 2VAMA 4F2WA 2HADA 5IUNC 1ZICA 1KDTA 3ZGXA 1WPXA 1UINA 4TVBA 3LBIA 4XUCA 3RUIA 3WOVA 3KJIA 4EYKA 1L7EA 1QGDA 3FF1A 4BS9A 3RCBA 1O95A 1FPMA 1W4AA 4MQEB 3FNGA 2W22A 2ZG6A 4D0LB 4MV5A 2AFVA 1P4AA 2POQX 4ETMA 1E2IA 2VWGA 4LYHA 1GGVA 4ZREA 4E6EA 1O95C 3HXMA 3AHCA 3RHFA 3EF3A 3E7WA 2Q2NA 5EXTA 4L4SA 4YCSA 3STVA 1E98A 2X23A 3K70B 2Z2XA 3SIRA 1JDBB 2MMCA 4RIIA 4LVOA 1PKEA 3FVVA 4WV3A 4XZ3A 3O82A 1VLJA 3DZDA 3TZCA 1W85B 3VC3A 1QWSA 2IY7A 5EIHA 5HMMA 1Z68A 4FFBB 4HB0A 3GELA 4YAFA 3D3KA 3IJ5A 4P31A 1HEIA 5EI5A 3LQFA 1N5RA 2HJSA 3G0HA 1KK1A 3DR3A 1D2HA 5H81A 2D1QA 5K0SA 1JR6A 4X90A 3CB4A 1P1JA 2F9FA 3SIWA 3DDHA 1L1EA 1KNXA 1Z36A 4X71A 2FPUA 1CT9A 1DDGA 2BHRA 3OMWA 3HL4A 1P72A 1VBFA 3AYXB 3U3RA 1NSFA 4U2DA 3F6RA 1E99A 2BONA 4M6WB 1DUVG 2C92A 4CMIB 4ZVTA 3SZMA 4BC0A 1B6RA 1A8UA 1DXYA 1WSWA 1FZQA 3C3XA 1SBYA 1D6MA 2AFRA 3I2HA 5ARDA 5LQCA 3GH1A 2EL7A 2O2HA 3IOEA 1EGVB 5EPEA 3R6LA 4BNDA 3CLRD 2Q7OE 3V8NA 1J9EA 1F5SA 1JIQA 1PR6A 4JQOA 1BYIA 1SM4A 3K70D 4ZT6A 1ES9A 4R3UC 1G16A 4KUEA 2E4WA 3R0QA 4RFVA 5DISB 3WJ7A 4QOSA 4AY4A 3OSUA 4QARA 5JXHA 3IBSA 4NBTA 2LDBA 2CHFA 1GQQA 1BCRA 1P1CA 2G40A 5DT2A 3T7EA 4K40A 4WH0A 4XI9A 1SUCA 4N5MA 1I33A 2FWMX 3KR2A 4CMEA 2H1WA 3NT5A 3QUQA 5IW8A 1G9TA 1YZQA 3ER8A 1WS6A 1V9LA 4CMEC 3ZZTA 4KGZA 1YS4A 1RAHA 4QPCA 1EWRA 1PG2A 2CLOB 4XPIA 5MN5A 4HJRA 2QYOA 3OEEA 3P71T 1R1DA 4QTYA 5KYYA 5COBA 5C3UA 3B60A 4IM7A 1ZU5A 3EUEA 3U39A 1FYXA 3Q7TA 1ZCBA 2MOKA 2AZTA 1ZS9A 3U7GA 2I55A 1X1DA 3COSA 4F8EA 4ZOCA 1KS9A 4CWAA 5BQXA 1C9NA 1F48A 5C52B 4PRYA 4V2UA 5DGCA 5FBHA 1NXWA 3X2SA 5KPDA 4WK6A 1H3EA 2G4CA 4FZRA 1VPEA 4F4UA 4ZARA 3RC8A 1OSNA 1AGNA 5F52A 1EVQA 4D3YA 2CUNA 1QH0A 3AY3A 3PJFA 5ILGA 1QXSA 4BBAA 2JZCA 3CQ9A 3OLQA 3GT3A 1PQ4A 4Z2YA 3EOZA 3B78A 3TJRA 4EPVA 4EEZA 1SU4A 1O95D 4J03A 2AN3A 3IQFA 3CEPB 3FGOA 4MCAA 3SFZA 2G25A 5KB3A 1R0LA 2OORC 4BNDB 2P3SA 3LVQE 3UNXA 2FKNA 3GUVA 1YR7A 5CM8B 1Q0PA 1XF1A 4BFXA 5KNCA 3GU3A 5KNDA 3LBAA 4XUEA 4YACA 1AXEA 1ULAA 2C77A 2HRQA 1AQIA 2RHJA 3HJRA 2IOHA 1BS1A 5K3CA 3ZLVA 3GLIE 1OMOA 1EFHA 2IP2A 3R3XA 4L72A 4U6QA 5K4GA 1BCRB 4FSDA 2WSIA 4TRJA 2EZ8A 1U1CA 2YN2A 4JGBA 4ME6A 1T26A 4LW8A 4PYMA 2OZVA 1V1JA 6CHYA 4RA9A 4Q47A 4Y2VA 3L7MA 5CVCA 3K9CA 4OXIA 1U9JA 3X2FA 5HJ5A 2XBMA 2PVPA 1C3JA 1QGOA 3ZQ6A 3HJBA 3I61A 4BEJA 2ATVA 5HA5A 4IIUA 1QVWA 3O1JC 1BE0A 3C8UA 4XPIB 4F2GA 2OOSA 8GPBA 5LNK1 5KYYB 4K9MA 4HBZA 3NAQA 2IZ5A 3QX8A 2K7FA 2NACA 4M21A 3I2JA 4L22A 1Z4JA 4WTOA 2YOGA 3GRRA 2QN7A 2F6RA 2ZT8A 3PNPA 3PT5A 2NGRA 1QGED 4IH4A 4ZZ3A 4HZUB 1TKAA 1ILWA 2O14A 3M2TA 2Y93A 1POWA 2ZBEA 5JEDA 2VHTA 1AGYA 1W9MA 2VDVE 1FNDA 3MD9A 3DZHA 4GEGA 1QO0A 1RM0A 1Z4KA 3CGGA 1J0AA 3EXG1 3U40A 3WMWA 4WCVA 3T5BA 5FL3A 2AOXA 3ZD9A 2O3JA 3ZNPA 4A0RA 3WMGA 1PD0A 4OU4A 1NWCA 4PVCA 4I14A 1O9HA 5CTAA 3OWXA 1KFBB 5AOCA 1PR1A 2WD7A 3MBOA 2IXFA 3TFWA 2YJ3A 3PQDA 5DN6A 2ADFA 4IDQA 1IHXA 1PBNA 5DIFA 1VYHA 2RHOA 5F9MA 4ZVLA 2PMWB 4Y1GA 1YL5A 3KWJA 1ESEA 1Z56C 5JCOA 2H0QA 4EJMA 3LUHA 4HI0E 2E85A 5JAHA 2ZSHA 5JCOC 3MXOA 2Q28A 2BEVA 3R24A 1QJ4A 3LX5A 1HT0A 2YWHA 2GHRA 1GJRA 1I9CA 1CC1S 1GAXA 4IVRA 4Z1MD 1TO2E 2C00A 3TOZA 5B36A 1GADO 4BXOA 1E4OA 1BX1A 1C7FA 1OFUA 1K6MA 1TAHA 1WWKA 2F62A 3L05A 2WJ3A 4RA9B 1RPNA 4UAVA 3RYFA 1ZRMA 4P83A 4UQLA 3IL2A 5DEOA 4QYMA 2D2EA 4RVCA 3GCWA 4WNYA 3B70A 5HUJA 4CF3A 4F46A 1UFOA 2D0DA 1O5IA 1P29A 4K9KA 1U1FA 1YV9A 3PX7A 4QXOA 3U2QA 2ZM5A 1NXPA 1H1TA 1L1RA 1X7DA 2VRCA 4QBGB 4U0KA 4X8LA 4BE4A 4ER3A 4ZMRA 4UARA 3KETA 4LDAA 4B85A 4U7DA 4C14A 1FTQA 4G1EB 4JSRA 5B4UA 5BV0A 2VYVA 3C24A 2VYCA 3L1UA 1C0KA 2D1FA 4DJAA 2AA3A 3ESDA 5C18A 3J81k 1OLUA 4F1KA 2JGIA 1D5WA 1B0AA 1SMKA 2XBUA 4WBNA 5JAPA 1CZRA 4JYBA 4OK6A 5KNCD 3MJFA 5KNDD 2O05A 2P9EA 3LU1A 1KPGA 1UKCA 4PFKA 4FIZA 4M0PA 2DQZA 4RL4A 3SX4A 3HVHA 4B80A 4IKPA 1FYDA 3KKEA 3QMWA 2W2VA 3ZV5A 3EHEA 2OQIA 4BV8A 1CUCA 4KR0A 1DG9A 2NSYA 2WTAA 2D0OB 3LCJA 4JBXA 3FYUA 4WKBA 2ID4A 1EDDA 3D5EA 3HM2A 5F3WB 4XWTA 4A6EA 1ADCA 1E3IA 5K0FA 3D64A 1E1RA 5L3RA 3HFRA 1L7QA 3D4LA 3DQQA 2QRMA 3FYUC 4JLMA 5E9QA 3H65A 3IBTA 4U7JA 1VHLA 1H0HA 2XZTA 4WKPA 1N5JA 1U0RA 1JP7A 2PV7A 1TJNA 4PONA 3JASB 2BEVB 3EWSA 3KSUA 1X15A 3QU7A 2OYSA 4GZ6A 3M1IA 3R6WA 4OJMX 5FT9A 4BNNA 2YHSA 3ENQA 1T10A 3GRPA 1Z22A 5C5DA 3DGEC 1LC0A 2QL6A 4YJ3A 3ESYA 1Y98A 2ZJ7A 4PNPA 3I9JA 4BXOB 1LUAA 1M8JA 3I6IA 3RYFB 2COUA 4EP1A 1HDRA 4M0DA 2MSEB 5DNCA 1KXJA 2REBA 3N70A 3EMBA 1UBSB 2I3ZA 1NJ2A 1CVLA 4L8GA 5AVOA 1BXKA 4WLNA 3QYPA 4G4JA 3KXIA 4G5HA 3GJ6A 1D0VA 1I6LA 1Y6JA 3IURA 2V6MA 3NR2A 3C8MA 1QRSA 4N0EA 4QNMA 2ZRCA 5CCXA 1QUEA 2YWXA 3ND8A 3WZLA 1VDMA 1BHQ1 3PTAA 3CX8A 4Q3AA 3VTFA 1NUAA 4B3CA 1XZAA 2W6PA 1OLUB 2XHEA 1ZN9A 3ZWCA 1GHTA 1RVDA 3BD6A 3UVEA 3MTAA 4YP1A 1F12A 2ECOA 2HT6A 1PO7A 2XMGA 3N2LA 4C29A 4WBNB 4U00A 1H8HD 1EVKA 4R8VA 3T1HB 3S6JA 4C2BA 4MQUA 3SF8A 4DG5A 3TW6A 3HDVA 5B1EA 3EDOA 8ATCA 4MYRA 1YSCA 1BDBA 1JLLA 3O83A 1L5WA 2W43A 2DU8A 2WYUA 1PZFA 2A5GA 2YRFA 2Z8YA 3T3HA 3ZQJA 3UJNA 3U3MA 3TRKA 4V3CA 1OAKA 5T4BA 3SNHA 3R4VA 2WG0A 3FYUB 3GCGA 5ALLA 1MGPA 4PX5A 5E3JA 3HXKA 2XUQA 4XQ0A 4X0EA 3TLCA 3KFLA 1T91A 4QQRA 3ZY2A 3QHAA 4D9JA 3KKMA 4IVNA 1MF7A 5D5HA 1WXDA 5THQA 1CTQA 2YHIA 1D0SA 2D13A 2OBXA 2FVXA 3DV0A 3GMSA 1MOPA 2HA2A 4H77A 4YJ3B 2P6UA 4Q18A 2POCA 2ZSAA 2A33A 5IAAA 2VYVD 4GW3A 5K4HA 5IS2A 1PQPA 3ROPA 2I4NA 1DBSA 2M6KA 4BASA 1P7WA 4R2LA 4G4SO 1NASA 1Y4UA 1E6MA 2ACEA 2W93A 2QZ4A 2H9IA 3T5PA 2IUYA 2VJNA 1TYAE 3HJNA 4FYMA 4DLLA 3NETA 3ZGNA 1VA5A 4B6PA 1E3LA 1QAMA 3EWNA 4IV5A 4PHCA 4B6EA 4DREA 5LZ8A 2HGZA 3WWYA 2GEVA 3GDFA 4JODA 5K6RA 1NBHA 3QLJA 1H2EA 1KYIA 1YI0A 4JD5A 2JFNA 2V6IA 3M82A 3OF5A 1DDIA 1QYXA 4OGKA 2NZ8A 4G2TA 4GOXA 1G6Q1 1Q15A 2QTCA 5ER9A 5TMBA 3GMTA 3HB9A 4PW0A 1E1RD 3ZS8A 4RVGA 4NDZA 4BB5A 5IVPA 3NWJA 3AVWA 1S7GA 3SDSA 5CVJA 2D3TA 4AP6A 3GUCA 3KT0A 3Q2IA 2WFMA 3U81A 2JW5A 3ZDEA 3WFZA 3SF8B 1OGYA 2IHJA 4UNIA 1X9GA 5AK3A 4RS3A 5L95A 4YQFA 1JLLB 3P9NA 3FWHA 2FFRA 4M7WA 4HZGA 4KSCA 4N8SA 4OLHA 4QO8A 3JZMA 2XUFA 3NFRA 3KRTA 4YIKA 3VU9A 1SCIA 1MX3A 4YNBA 4B79A 3Q1KA 2F48A 1CD5A 3IAS6 3A36A 1ABBA 1RBMA 3T9FA 2O07A 2R86A 1CP2A 2XQFA 4K2HA 4DEXA 5BMOA 1XTUA 4D43A 5JR3A 2OUKA 4IDDA 4J4TA 2W42A 3QKUA 5KYNA 1DKRA 1ZI8A 2YHIB 5AJVB 1YO6A 1JT2A 1CJUC 2G36A 3QBTA 1HORA 4JWKA 2BKAA 1Z08A 3CH6A 3ENWA 1UP6A 5FQNA 2HYDA 4ZYZA 1ID1A 1ID8A 1YU9A 1YQUA 1B8UA 2OMEA 1ZH2A 1NT2A 2FWBA 1CQXA 1RFLA 4XQGA 1SRQA 1C9MA 2KMLA 4EH1A 4F9FA 5K01A 1UL1X 3VOSA 4BGEA 5HTOA 4OPMA 4RSGA 3RR2A 1RP7A 1WX1A 4RY9A 2X1HA 5D5QA 2BKLA 2P40A 3AKDA 2VCEA 3H8VA 1IUNA 1UOOA 2R6AA 1S3FA 4D0SA 1QTNA 3IE0A 5HS4A 1N33B 4UW9A 1N1GA 2IYYA 4A0FA 4UAJA 2JHPA 2Q1YA 5C7IO 1T34A 4QOFA 4I8IA 4PFSA 2IDKA 3EZLA 1GQSA 5THKA 4HH3C 1I4DD 2G4VA 1EUYA 1QIFA 1U8TA 1Y7HA 1CJTC 2H0AA 3EXEA 2YY7A 4JT9A 3HGTA 4NH4A 4JI6B 2FQQA 2QLFA 1R8SA 3X2EA 2GEFA 3ANSA 3B6IA 3I6QA 4FFVA 2IP1A 4KIJA 4NU5A 4TLBA 5BN4A 1IJBA 2OFWA 4L5AA 5IRCD 1ECJA 2GKGA 3UJBA 2HA5A 5CG2A 2RC5A 3IUNA 4QNRA 1U99A 4IHJB 4LX8A 2RGNA 5HHTA 2GZDA 3OCXA 2DR3A 3VU9B 1R5BA 3TTWA 4PRLA 4UNRA 2RGNC 3N75A 5I7EA 1LV7A 1YQQA 5AOVA 1U9IA 3KE9A 1ZCFA 3KOZA 4O2BF 2AB0A 4FZ3A 4G0ZA 4ZALA 4YP9A 3UHPA 2AZ4A 4TN5A 1U9IC 4DWOA 5CX4A 4EYQA 3U1TA 1WU7A 4UMVA 4U9IS 3RTDA 1T9KA 1Z8DA 1GPYA 1DXQA 2D2IA 2B7LA 2EZ9A 2Y1LA 3WGLA 4MDFA 4QBIA 3OX2A 4FCWA 3TYXA 4JBGA 1U90A 2ZLBA 4M9QA 4MGZR 4QL3A 4N0DA 5AM3A 1L5YA 1H5QA 4FYVA 3SIXA 4X66B 1HGXA 1U0SY 1BWPA 2ZJ2A 2QZ9A 4ZODA 3FNRA 1TJ5A 1XAHA 4IDCA 3UAVA 4A16A 1U4SA 1CR2A 4EG4A 1BQ3A 2IOFK 5GGXA 4OI0A 1XPUA 3B38A 3CZ5A 2AR9A 1UJBA 3G23A 1YE3A 4MKIA 3RABA 2X2FA 4UBIA 4DDVA 2NPIA 2WWHA 4PSDA 1UP4A 4DB4A 2IPXA 4R68A 2GA8A 2JLSA 3L7AA 1UBGA 3LK6A 4D56A 3E7FA 1J0EA 4FFSA 4JB2A 4HHEA 4N7BA 2PSJA 2XDYA 4YAWA 5DNWA 2HCFA 2PLFA 4TTQA 3MBKA 4NZNA 1F9AA 3SC4A 2DAPA 3DOUA 1DRWA 5TEVA 1KQGA 2DBZA 3EXEB 2FAXA 4PAOA 2QF7A 1V9SA 4CV2A 1XZEA 1QX4A 1BFKA 5COAA 3K6KA 5FFFA 5GZ6A 5BN4B 3ZE9A 4EKEA 2QTNA 3TZ6A 3VPXA 3ZGZA 3NASA 3DAGA 1VIYA 1USUA 1ZZEA 1JR3D 1LTKA 1TDJA 4BGVA 2Y0PA 2D54A 1D4FA 1G42A 2Q0XA 3UPTA 1VHDA 1KOJA 1I0IA 3PNYA 1T9HA 5KBYA 4MW0A 1KMQA 4A2QA 1CUBA 1LLCA 4XXHA 4AULA 3CW2A 4N3BA 1V3UA 2IIPA 4N0PA 5CLJA 4DIBA 3BGWA 5BSHA 1BD3A 3ETLA 3QE4A 1T1JA 4GF5A 3I8SA 1RJEA 3F9IA 4PIPA 4FFDA 1RTTA 4W99A 5GY7A 3KELA 5HZGA 1BN6A 4N49A 2H2DA 2IL1A 3QNWA 4RK5A 5IK2D 1HE2A 3I2IA 3TTYA 4FZVA 4YJKA 4DXHA 2CXPA 3VVMA 2OAP1 3W9UA 1NKSA 3ZD6A 2HSWA 1JBEA 2C0PA 1GTRA 4Z3OA 5BSUA 4R01A 1RI4A 2GVDC 3O2SB 1Z73A 4MIYA 4MUNA 1VCIA 3QMMA 2C1XA 3DKRA 1JEQB 3OI7A 4TS1A 5AKLA 4F71A 2O5CA 1JGTA 1ZSVA 2BFFA 4Y2PA 3OCZA 4R2IA 4C76A 2WKSA 4UNNA 1JEYA 3TLKA 3D6TB 2QLNA 4E1VA 4FK8A 3D7RA 2ZYTX 3D5TA 2IV7A 1DKOA 3EPJA 2B99A 4MP3A 3FTEA 3SP1A 4TV9A 1UC5B 3VNUA 2Y0DA 4B31A 3MOIA 1F8YA 1NJFA 2ZQ5A 4I5FA 4MUYA 4Z51A 4MNTA 4OYRA 4EFDA 1BZYA 2ENUA 5ULLA 2X2PA 2YZGA 4MRRA 3SC6A 5JXGA 2DH5A 1U2TA 4N76A 4L2IA 1TTQB 3M4NA 3NP7A 4DWVA 1Y8ZA 3OF3A 3H2GA 2BJHA 3L8HA 1KA9H 3ONFA 5C81A 1KI7A 2IJGX 3A1FA 3ABOB 4IL5A 4RZIA 3KQLA 3STXA 5KVAA 1U3DA 1ULSA 1A9OA 1V95A 4FEYA 1PZHA 3L6CA 4M8IA 4NFSA 4Q7EA 4BQSA 1BDJA 3IOYA 3FKSD 1K8YB 3ELDA 3ANXA 4RVDA 4X9XA 1R64A 4Y7DA 5A3SA 3DAFA 3C4QA 5SY4A 4RY8A 5F23A 5JTTA 2R00A 1TTPB 4QPPA 4I2NA 3VV2A 1CY0A 1CYDA 3BK7A 5JSKA 1FTWA 1W2WB 3JAWA 1KYYA 1ONPA 4YMWA 4AI6A 2D1YA 5TDHA 2IX3A 2FSUA 4PU0A 1DARA 1AU9A 4F04A 2PWYA 4M86A 1KFEB 3D3WA 1O7JA 2WPDD 3Q6IA 2D7CA 2HI0A 1OB2A 2BELA 4YRPA 4YN3A 2P35A 3AF6A 4OBEA 3LLMA 1E2JA 1M2VA 1PHRA 1WVIA 3T8YA 2QT9A 4AM8A 4BWVA 4ZCIA 1H2YA 3RC2A 1AKNA 1RYHA 1W4ZA 5LNK6 3U60B 4ZYVA 3V1YA 1L8AA 1Z34A 2CWWA 2WW8A 5AW0A 1JIJA 4INPA 3G9UA 1N4AA 1JH8A 2OYRA 1JEYB 5JZOA 1LSSA 1SC1A 4LFCB 1I2DA 3RU9A 1OFUX 1WD5A 3L6OO 5EJIA 1FTGA 4IO1A 2OQ2A 3NQ41 1GVNB 3OPXA 4TV9B 4LF5B 3ZDQA 2CFIA 1FPQA 3TS1A 3DEYX 2AMLA 2LCFA 4QPNA 4F1WA 3GLHA 2ZITA 5IAOA 2I6TA 1V4VA 2P8JA 4PM4A 4KRFA 3ASUA 4L2IB 4XB1A 5H80A 4AJOA 3LW8A 5MDHA 3GA5A 1U2DA 4K88A 4E09A 4W5JA 4UDOA 4GE0A 2J3HA 4Y2QA 2IHVA 3BTUA 4IJWA 1U2DC 4FDUA 1Z8HA 1BKSB 3H19A 3GYGA 3HZRA 2FSHA 2J6BA 4INAA 1U1IA 1KR5A 3R0IA 2JZNA 3LKZA 3QKSA 1E5VA 4L9SA 4O1IA 3VI3B 3L3BA 4OA5A 1G1AA 4F4IA 4X8OA