1GGVA

Crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DIENELACTONE HYDROLASE
publication title Structure of the C123S mutant of dienelactone hydrolase (DLH) bound with the PMS moiety of the protease inhibitor phenylmethylsulfonyl fluoride (PMSF).
pubmed doi rcsb
source organism Pseudomonas putida
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ggvA00
2QS9A 3A2MA 3TRDA 5ALDA 1U4NA 1CUXA 1FFBA 1CUWA 2XMBA 1SFRA 3I1YA 3HI4A 2XQIA 3F97A 4C6HA 1FFAA 3G9ZA 1BS9A 2XMCA 3H2GA 4U2GA 4GECA 5AKHA 5JD5A 2Y6VA 1CUJA 2WILA 2WKWA 4BZZA 4QZVA 1ZD4A 3H17A 5CH8A 5DTJA 2FUKA 4U2FA 1MX9A 2ZJ7A 4W9RA 4INZA 2HM7A 4TPKA 2JEYA 4C88A 1CUIA 2OGSA 1DX4A 5FLKA 1EDBA 5AI6A 1A7UA 1XZHA 3WKBA 2JGEA 4UBIA 5FRDA 3ESAA 3DL7A 4NS4A 4EHBA 5AOAA 4L72A 2ZYSA 1HKHA 4QDXA 5ALJA 2XUHA 5JAHA 1F0NA 1UOQA 4BRSA 3AILA 2BKLA 4QLAA 4K6GA 5LIPA 4UUQA 2GBCA 5LZ4A 1XFDA 4HRXA 2EDAA 2WG1A 1UOOA 4AXBA 4TGLA 1YAJA 4Q3OA 4UHDA 5T4FA 4WFKA 3R3ZA 1THTA 1NX9A 4M0EA 3PUHA 4H7DA 4DLNA 1ZIYA 3OM8A 2ONCA 3EF3A 3BF7A 3VVLA 1CUFA 3L1IA 3QMWA 3TGLA 4H35A 1XQYA 2GZSA 1ZI6A 1XLUA 5AKZA 5CURA 2WHPA 2VJDA 3BJMA 3DS8A 5AKGA 3G0DA 4GDMA 5EHQA 4Q05A 3C45A 2DFPA 3GA7A 1ETHA 3R40A 1XRRA 3W04A 4AMZA 1ISPA 2XQGA 5CRIA 3DCNA 4CG3A 1QIIA 2J4FA 4B81A 4FMPA 5AM2A 1YCDA 1M33A 5LZ2A 2C5GA 2Z5GA 5AO9A 1L7RA 3WYDA 5ALWA 3YASA 3WIOA 2Y2UA 1JKMA 4HXFB 4PNZA 2CUTA 3EIOA 1XZAA 3ZLVA 2VATA 4QLOA 2PU5A 1L7QA 2BAGA 4DYHA 3WL6A 3HRHA 5K5EA 5ALLA 4W1RA 1XRNA 1G5FA 4N8EA 3U1TA 3AFIA 4UBOA 4EZIA 5CT4A 1XZKA 4JUIA 3PI6A 3EQ9A 1R50A 1DU4A 1DT5A 3TEJA 3K6KA 1WHTA 4P93A 4J0KA 1G42A 1QOZA 4X3CA 3GZJA 2VAVA 3IUNA 1JMYA 3BXPA 5ALZA 4CG1A 1BRTA 4AO7A 1E66A 4BE9A 1QLWA 2Y2VA 4UBMA 5FP0A 2XUPA 4DMHA 5AK4A 2H1IA 2C7BA 4GI1A 4XX1A 3H2JA 3SC2A 4YK7A 4X71A 5CT9A 1R9MA 5FKJA 2AJ8A 2I3ZA 1TCCA 2C4HA 4ARAA 4BAGA 4B9EA 5KREA 1CLEA 2XMSA 3WA7A 4G8BA 1CUUA 4YASA 5D7BA 1U2EA 4G8DA 1RYYA 3FYTA 1DWQA 1LBSA 1H2ZA 2Z3WA 2OAEA 2X8BA 3DNMA 5CH3A 5ALMA 4EBBA 4B80A 5DNWA 2V97A 1BN7A 2BGNA 4UHFA 5K3BA 1CR6A 1QGED 2PL5A 2HU7A 4KAJA 1BROA 1AX9A 4WDQA 2Q0XA 3ICVA 3K9BA 3FVTA 4UFNA 4C4YA 3KDAA 3G7NA 2PSEA 4X85A 4B9AA 1R4ZA 3C43A 2HL6A 2BUCA 5HFAA 1J1IA 4CI9A 1QIHA 5LYYA 1BN6A 4B83A 3I2FA 1C4XA 2BUBA 1AUOA 3WYNA 3A2LA 5AKLA 1CIJA 1I6WA 3EQ7A 1U65A 5CW2A 1B6GA 2ZJ6A 2XUDA 4UBLA 1A8QA 5JADA 4BE4A 3D59A 4CIAA 5FUMA 3R3VA 4FOLA 4MYSA 3R3UA 4OB6A 3OC0A 2BCEA 4RNCA 4PSUA 4MQLA 2J3DA 5H3HA 5JD4A 5JANA 1VLQA 1J07A 2H7CA 1HLGA 3V1MA 2VJAA 4H7EA 3WK5A 2WFZA 1XRLA 4U2EA 2VAXA 1F8UA 1VOTA 3PE6A 5DYWA 4Y2PA 5ALYA 4UBKA 4AQDA 4XWGA 1MAHA 1CUCA 1SCKA 2GYVA 3UMJA 2XUKA 2OXEA 4TVKA 3GUUA 3G9TA 4BCBA 2PM8A 1CFJA 5HKAA 1IVYA 1OXMA 4I4CA 4Y2TA 4IHAA 2XLCA 5AM0A 1ZI9A 4PQEA 4ARBA 5FV4A 1P0PA 2GBFA 5AK3A 5K3AA 1ACJA 4Z49A 3V1NA 4AB1A 1GKKA 4DM7A 4PW0A 1HPLA 5ALKA 5ALGA 4ROTA 4OD0A 2OG1A 1EDEA 4J0CA 5FXMA 5DWDA 3IUJA 5IVDA 5CBKA 4DNPA 4IH9A 1Q0ZA 1H23A 1WOMA 3X3HA 3WMRA 5ALXA 2NW6A 5ALTA 3LCRA 4QWMA 4KRXA 1WHSA 2OCGA 4WY5A 2WQZA 4OYYA 1TCAA 2QR5A 2B4KA 4P9NA 4G5XA 2RHTA 4FWBA 5AOCA 1UK8A 2RAUA 4DNFA 2HRQA 2IX9A 4G8CA 1GKLA 4RGYA 2UZ0A 4FLEA 2QJWA 1W52X 4AO6A 3RLIA 2V96A 5K3FA 1PJAA 1JU4A 1E89A 4Y2XA 4CCWA 4H18A 3NGMA 4KR0A 4PSDA 2J3QA 5HQ3B 2CKMA 2XUOA 5HF8A 5JARA 2HU8A 5AKXA 1H2WA 3AZOA 4G4GA 3STVA 2B9VA 4X6YA 4CIBA 1DWPA 3LP5A 3OTQA 4QDUA 1LPPA 4G4IA 5AI9A 1XZIA 1UFOA 4FDMA 4OCZA 3AINA 1C7JA 5ALVA 3VXKA 5KWJA 3A2NA 1QIKA 3DQZA 4P92A 3L1JA 2GBIA 2YH2A 1CUVA 3IBTA 2CJPA 2XQJA 4N8SA 1CUAA 4FNGA 1YSCA 3VJKA 1QIFA 1X2BA 3AIMA 3RARA 2X5XA 4BP9A 4RPCA 1G4HA 4IH1A 3D7RA 3C6ZA 2FJPA 3DL4A 3AJAA 4GHWA 4BTVA 1F6WA 3E0XA 5LKRA 3G9UA 2WU3A 5AP9A 5EIHA 1BCRA 4HZGA 1IMJA 4G4JA 3UUEA 1W76A 2HA7A 2VTVA 2HADA 3C6XA 3QPDA 3D2CA 4A16A 4E46A 2WFMA 5LZ8A 1W1IA 5D3KA 4J0JA 2WJ6A 4OPMA 5FPQA 4FFWA 2ZYHA 3VDXA 3G0GA 3WWCA 3N2ZB 3WJ1A 1DT3A 1IZ7A 3F9CA 1YA4A 2AJCA 4KYVA 2XB6A 3E1GA 4OSEA 3ESBA 1B41A 1QIJA 3ZI7A 4B0OA 1S8OA 1BCSA 1R3DA 4S0XA 4XJVA 2WTNA 1YASA 3WJ2A 1H2XA 1H22A 3QPCA 1EVEA 1Q0RA 3OPMA 4BRZA 5AI8A 1W4LA 5ALQA 5K3EA 2CZQA 1LZKA 1ZICA 1EK2A 3GROA 1DINA 3H2KA 5IVKA 3SK0A 3IUQA 4FLMA 4C4XA 1EA5A 1EK1A 1OILA 3WL8A 2XT0A 3VJLA 3OOSA 5ALFA 4DMKA 2H9YA 1TQHA 1HL7A 3E4DA 4L0CA 2CMFA 1JU3A 3I6ZA 2WSLA 4ITVA 4MXDA 1QJ4A 2XMGA 3I2KA 1MNQA 1L7AA 1Q84A 4C87A 3HZOA 5CT5A 4E11A 2DSNA 4BC0A 1EB8A 3D3NA 5A71A 2JF0A 3DD5A 3FCYA 4X91A 4OYLA 1J06A 3FWHA 4P08A 3HYSA 3HLKA 2VF2A 4DIUA 5CXUA 3PDCA 2ACEA 4GEGA 3H1AA 1YB6A 1LPSA 2R11A 3STYA 4Q1VA 1VKHA 4B82A 4ZGBA 4LXHA 1LPBB 1XZDA 3IA2A 5JASA 5EHXA 3G02A 5E4TA 2W22A 3GBSA 1KU6A 4IH4A 4RE5A 2QT9A 3KOOA 4X94A 3CCBA 1FFCA 3C6BA 1R9NA 4BB0A 2HA0A 4LYDA 2JBWA 1THGA 2QJRA 3WKAA 1EXWA 3PUIA 1CUSA 1CUGA 2VSQA 3VVMA 4IO0A 1LBTA 1TCBA 4YX9A 3FNBA 3V48A 2WHQA 2OGTA 2XUFA 3NWOA 5BWCA 1GPLA 3G0CA 4KE7A 5AM4A 3AIKA 4EY6A 4PSCA 1J2EA 3CCCA 2WUEA 4AZ0A 4QDOA 2GZRA 1ZGCA 4W1QA 2C0QA 2RGUA 2XQFA 4IQ4A 2GBGA 1BE0A 3HACA 5EGNA 4L3WA 4PO3X 1GQRA 3PF9A 2WG0A 5LKAA 3LS2A 2WJ4A 5DYTA 3TJMA 3V1KA 5JYCA 5A2GA 3FBWA 1CUZA 4Q3KA 4D9JA 1VA5A 4CG2A 2P8SA 4KJXA 5CT6A 2BFNA 1E3QA 1QIDA 4K2AA 1XRPA 3R3XA 3CN7A 1LNSA 1XZMA 2VJCA 3KXPA 3M83A 2QZPA 2HA2A 4HAIA 1DTEA 1O6FA 4FBLA 1EB9A 4C01A 1CQZA 4BVKA 3SX4A 1NU8A 1A8SA 1BU8A 4DMCA 3L1HA 4X7BA 3C8DA 3DLTA 6YASA 1TAHA 7YASA 1MJ5A 1WCYA 2JGLA 2RHWA 3LLCA 2AJLI 3BDVA 3BIXA 4DNOA 5HZGA 3ED1A 5AI5A 3ZPXA 1AMNA 2O2GA 4KRYA 1XKLA 2Z3ZA 4XVCA 1FFDA 3A70A 5J3JA 1N5MA 3ZLUA 4BCCA 5JALA 3WZLA 4UFPA 2C0PA 4I3FA 3WWEA 3BDIA 4ZWNA 4EY8A 3S8YA 3PICA 1MT3A 4X93A 4BCDA 4U2DA 4C4ZA 5DLPA 3PFCA 3T4UA 1EDDA 1FJ2A 4ZXFA 2GYUA 1QO7A 4DMFA 5IH7A 1UK7A 1RWQA 3F67A 1KEZA 5BWBA 4EY4A 1MAAA 3BE8A 4K6HA 4UHCA 3WWPA 2HRRA 4X6XA 2D0DA 2IITA 2ECFA 5A7HA 1YAHA 5ISMA 5K3DA 3FYUA 5D6OA 2Z8ZA 1XQWA 4MJ3A 2K2QB 5CH5A 4DSAA 3WK9A 5HF5A 2WHRA 4LXGA 2E3JA 2OCLA 4JEIA 3FCXA 1ZJ4A 2ZSHA 2WHPB 2WFLA 4NMWA 5EHNA 3WK6A 5DYYA 2XUJA 4B85A 5BOVA 2QMQA 1SOMA 1ZJ5A 3ICWA 4HVTA 1XQVA 3VISA 1QFMA 3QZUA 1DWOA 2GYWA 4BYMA 5A7GA 4CCYA 1N8SA 1QO9A 3STUA 4MEAA 3O95A 2HA3A 5ALRA 5JZSA 1GT6A 1IUNA 3R0VA 5ALHA 1UK9A 1VJ5A 2XLBA 3B12A 4Q82A 3HXKA 3WK8A 5C8ZA 3O0DA 2EDCA 3BIWA 4QDTA 5JIBA 2XMDA 3D2BA 4NZZA 4Y2QA 4J0HA 4Y2JA 1MX5A 2WJ3A 4F21A 3V9AA 5E2IA 3D0KA 5LZ9A 3A6ZA 2WUGA 5I8PA 4AZ3A 3F8SA 4LXIA 4BC1A 3H18A 4W63A 4DGQA 3FOBA 3MVEA 3DEAA 5EHZA 3G9XA 2JGMA 3F98A 3B3QA 3HC7A 4KE6A 3KWJA 4BP8A 2ES4A 2BJHA 3MGAA 3DKRA 3W2TA 1MN6A 3QMMA 2XMQA 3ZWQA 4OUKX 4H7JA 2OCIA 2YYSA 3CXUA 1TKRA 4Y2VA 4X6UA 3V1LA 2FX5A 4AMYA 3DKKA 3M82A 3H2IA 1DQYA 1UKCA 1MNAA 3ILSA 2WM2A 4LHEA 3H19A 5AM1A 2PX6A 1ZIXA 2OQVA 2VA9A 1UK6A 5SYMA 4DNQA 1QFSA 1SCIA 4UBNA 1EI9A 2ZSIA 1IZ8A 3LIPA 2WUDA 4KACA 4W1SA 4PF1A 3I2GA 2QKYA 2OPHA 2HA6A 4L9AA 2O7VA 3C70A 4KEAA 4EY7A 3O4GA 1Y37A 3QYJA 2PPLA 3STWA 1ACLA 2G4LA 3O4JA 4LYEA 3IULA 4HRYA 5KBYA 1R88A 4J0IA 4UPDA 2CBGA 4O08A 1G66A 2ORYA 2G63A 3UUFA 4QNNA 3C5WP 3DDUA 3ANTA 2C5FA 3S2ZA 2PSHA 3AZQA 5HF9A 3FSGA 1XKTA 4YPVA 2ACKA 4N5IX 3H0CA 5JATA 5HCUA 5A62A 3FAKA 3O9MA 1QE3A 3GELA 1ZI8A 3WQHA 4F5ZA 2AXEA 3QITA 4J3JA 3JYHA 1MPXA 2DR0A 1A8UA 4B0PA 5C7YA 1GQSA 1WPRA 4MEBA 1DQZA 2HFKA 4ZRDA 3IUMA 3VKFA 3RKSA 3KWFA 1AKNA 3P2MA 4G1FA 1ORVA 5C8VA 3BF8A 4FBMA 4GBGA 2RONA 4FHZA 4MQMA 4N8DA 2AJBA 3I2HA 4X95A 4JYMA 2JGKA 2DHEA 4MYDA 1EHYA 1ODSA 1ZGBA 4PV7A 4AX4A 4WY8A 5HF6A 2XMRA 2HA5A 2ZJFA 1GXSA 4H77A 2PSJA 2QOEA 2QUBA 2XDWA 3HSSA 5LZ7A 3NOXA 1CUEA 5ALEA 2OAGA 2PU7A 2H7XA 1JI3A 1ORWA 3SWWA 4H0CA 1JMKC 2I03A 1WB6A 1QIMA 1QTRA 4BATA 3WLAA 1CUBA 1EH5A 3U0VA 2D5LA 4BAUA 1K8QA 3PFBA 3I6MA 2DQYA 3WWOA 5LP1A 1WPXA 2XQKA 2QRUA 3ZV7A 1Q83A 5HFNA 3FSGD 1OCEA 4GW3A 1P0QA 3I2JA 4C89A 4BAZA 5IVHA 3AUKA 3G0BA 1XROA 3C87A 1E5TA 3VJMA 4OU5A 5CT8A 5ALUA 5CMLA 2WLSA 4FNMA 5AI0A 5DTIA 1LPMA 1K63A 2XUAA 1USWA 3I2IA 3WKEA 1YB7A 5HK8A 2IIVA 2XMZA 3D4LA 3KD2A 1R1DA 2JEZA 1VE6A 2PVSA 2WIJA 3RM3A 4A5SA 5KWIA 1YR2A 1XZCA 2ZYRA 4FLFA 4OU4A 4BBZA 1AC5A 1XZFA 5K3FB 1QONA 1XLWA 4NVRA 5HKBA 3C5VA 1QTIA 1O6GA 2BGRA 5C81A 3H04A 3IVMA 4F60A 2O7RA 5YASA 3W9BA 2Y1KA 4MWTA 2C58A 5LLSA 4ZV7A 1UZAA 3B5EA 1YA8A 3I6YA 5BV7A 4KE9A 5JAUA 2QTBA 1HDEA 4HTAA 3C6YA 4H7KA 4Y7DA 1P0IA 2YASA 3QBJA 5T4BA 4UBJA 1P0MA 2HDWA 2ZYIA 2O2IA 3QM1A 3WL5A 1TRHA 1IUPA 4DTCA 2J4CA 1BEEA 4AN0A 1LPNA 2XUGA 1BEZA 3GFFA 2QM0A 1ZD5A 5AIBA 5ESRA 1E8MA 5FDFA 4UHHA 4U2BA 3WK4A 3O9VA 2ZVDA 4GWLA 4GLBA 4I19A 3WA6A 2JGFA 1K6EA 1E8NA 4X00A 4QWWA 4M0MA 4E14A 4BDTA 3DYIA 4Y2YA 5SYNA 3ESCA 4H7HA 4HXEB 1VE7A 4ZI5A 1MTZA 5AICA 4FKBA 4RE6A 1AURA 4UHEA 4EA6A 4MWSA 3CN9A 4BVLA 5AI4A 4ZREA 4B7ZA 1NU6A 1XZLA 1N5RA 1AGYA 2DQZA 5I7UA 4OB7A 5AM5A 4E15A 3H2HA 5LZ5A 4QA9A 2PKYX 4WCVA 4BDSA 5ALNA 4LKOA 3BWXA 4A23A 5EIAA 4FFVA 4QEKA 2O2HA 1QIGA 1XZBA 2FJ0A 3QH4A 2WUFA 1UT6A 3I28A 2HIHA 1H2YA 4LIPD 3DYVA 1PFQA 5ALOA 5DNVA 2V98A 1X70A 3R3WA 2WIKA 1WB5A 5FOQA 2VT6A 5EIEA 1XZJA 4X92A 3Q8WA 1FSSA 5E4YA 2XUIA 4B6GA 2PUJA 4HXGA 3W9UA 1ODCA 5JD6A 1MX1A 1DX6A 3F96A 2R8BA 5DNUA 3IDAA 1ZOIA 2RI6A 4BTLA 5HQ3A 1YS1X 3G8YA 5AK5A 1T4MA 4CFSA 2HU5A 3Q0TA 4WDRA 2PUHA 3OG9A 1ODTC 4AO8A 1VXRA 4Y9SA 2ROQA 1WB4A 2X76A 1YS2X 3O4IA 2XE4A 5JAPA 4X97A 3HABA 2QXUA 3FLAA 2WIDA 4K6KA 5AOBA 5JZ9A 4G9GA 1CQWA 1JT2A 1KU0A 3QPAA 1W6RA 3M3DA 1CV2A 1UKAA 3WZMA 1JJIA 3AZPA 5HK9A 5AKEA 1W75A 3EBLA 3DJYA 1LLFA 3EQ8A 1XQXA 2I3DA 5A7FA 3R3YA 1T2NA 4OB8A 5E4JA 1ZD2P 1UWCA 4ETWA 1RP1A 3M81A 5EI5A 3K2IA 4Q3LA 5T4HA 2CEKA 2V9ZA 1EVQA 3IB3A 4W1PA 2JGIA 3STTA 5D3ZA 5K3CA 1D07A 4XIIA 3HEAA 2JIDA 1XRMA 5AK6A 3DOIA 3FVRA 3FLBA 5F4ZA 5IVIA 1A88A 1LPAB 2WTMA 4EB0A 1CUYA 2QVBA 2YXPX 2XUQA 3D5EA 2PBLA 2CB9A 3BL8A 3ESDA 4EY5A 1FFEA 3OURA 2DCMA 2Y6UA 1F0PA 4JNCA 2DHDA 2B20A 1TIBA 3WKDA 1IUOA 4JYPA 1Y7IA 5AH0A 3RK4A 3WWDA 5I9IA 5EFZA 3STXA 1X2EA 4J7AA 4BZWA 5AKKA 1TK3A 5ALSA 3AIOA 1AZWA 4WFIA 4B84A 4Y2UA 1VZ3A 4HS9A 4G9EA 1MO2A 2OGZA 3MUOA 4K5QA 1XZGA 4X90A 3HJUA 2QXTA 5AKYA 3KSRA 1VXOA 1XRQA 4UFOA 1UOPA 2G5TA 5T4EA 5A6VA 2OLEA 4BVJA 5AKIA 1K4YA 2H7YA 2PSFA 4GXNA 1CUDA 1U8EA 4FTWA 5AHXA 5IKXA 3WIBA 3D2AA 2WIFA 5DJ5A 1XZEA 1ZD3A 2PSDA 1QZ3A 2VT7A 5C8XA 1Y7HA 2RIPA 2WU4A 4H7FA 3H1BA 1LGYA 2WG2A 3W06A 2QUAA 1HQDA 3WK7A 3WL7A 1CUHA 4UHBA 3G0IA 4U2CA 1LPOA 3O4HA 1VA4A 1VZ2A 3NUZA 1UKBA 1JJBA 2G5PA 4H7IA 4EUSA 1Z68A 3FLEA 3E3AA 2VEOA 3IURA 2BUAA 3W05A 1HBJA 2OQIA 4KAFA 2EEPA 4Y2RA 5CXXA 2Z8XA 2WIGA 3BJRA 5JAOA 4KE8A 1EX9A 4JH0A 4N5HX 1GPKA 4J0GA 1UXOA 1JFRA 2VJBA 3I1IA 4ZV9A 4M0FA 3FYUC 1MU0A 3C8HA 3IIIA 5AKJA 1JJFA 1CPYA 4F0JA 4J0DA 3LIIA 1GPNA 1QIEA 4V2IA 1E8DA 1CVLA 4Y2SA 2W6CX 3QMVA 4QE3A 5AM3A 3JW8A 5AJHA 2LIPA 4Q34A 1PV1A 1GZ7A 3MUNA 5AIAA 2HA4A 1CEXA 5CTAA 2HHAA 4WJLA 1CRLA 3PF8A 1N1MA 3FYUB 1K5PA 4J03A 2XI4A 3T52A 1XLVA 1C7IA 2I78A 3WI7A 4KAAA 3N0TA 3ZLTA 3WKCA 3R41A 5JZBA 1GGVA 1EINA 2WFLB 5ALIA 5FPPA 2VQ6A 1SCQA 1AQLA 2AJDA 2JGJA 3DOHA 2B61A 1WM1A 4AN1A 3QVMA 3JWEA 5ALPA 2HFJA 4CCYB 4DSZA 3ANSA 4WFJA 4QDZA 2OCKA 1LZLA 1SC9A 2DHCA
chains in the Genus database with same CATH superfamily
5HHTA 3W1EA 1N1GA 1Z8HA 4R71A 3FPJA 5DGTA 2CFSA 3FLMA 2DERA 5ALDA 3MWGA 1ESZA 3P8ZA 3MBKA 4J7CA 4EJ6A 1TXGA 5ED0A 8OHMA 2AMFA 4JQOA 3ZK9A 1L5HA 3V8NA 3GNTA 4I7EA 2NVWA 4PN7A 1LI4A 3PQ3A 3F97A 4P38A 1EGVB 1IB0A 3NFYA 4HK4A 1G8SA 4D8YA 2EYQA 1JHYA 3V6MA 2IBSA 5BW6B 1LV8A 4OQFA 3LY7A 4U2GA 4Q9IA 2G1UA 2PWYA 5AKHA 3CGWA 4YUAA 1M66A 3PDUA 2ZJBA 5CCEA 1EFUA 5CFPA 2Q4RA 5E6SB 1VKOA 4WSOA 1ZD4A 4HMQA 3ABIA 1PVOA 1AUXA 2GCPA 1F2TB 1PVVA 4KMSA 5KO2A 3KPVA 2H59A 2QG4A 1B26A 5DTJA 4CIVA 1SXGA 4U2FA 1MD9A 5DM2A 4GLOA 2RH9B 1HO3A 4DCJA 4DBZA 5F23A 2Q6TA 2C5AA 2P91A 2W93A 4YRSA 2G5CA 5IT9A 1KQPA 1R6VA 4INAA 4WXHA 1S7GA 4LHSA 2HM7A 4R5MA 3K0FA 1FUUA 1QGAA 4TPKA 1C50A 3R3JA 3HM9A 4QXAA 2AC2A 2A86A 1JIKA 4R1QA 3UB3A 4PQRA 1D2MA 2H2DA 5CFZA 1OE0A 3GAMA 5JDCC 2D2IA 3QKSB 3O2NA 4RD3A 1DXOA 3KQNA 4MA0A 4R51A 5BORA 2HDNB 1B8NA 4ENQA 1TTPB 1E7QA 4J07A 4NONA 4UBIA 3UMRA 3LUGA 1BXKA 1I3OA 2J0QA 3DHYA 2RGAA 4E33A 1H8ED 3ESAA 3BWCA 4E6EA 5TQJA 2MYTA 4EHBA 1J0AA 1SUEA 1T36B 3P32A 5HP4A 2ZYSA 3H6HA 1KXJA 1HKHA 1GSAA 1IFXA 1RMTA 3FROA 5ALJA 3RVSA 5DCLA 5A03A 1I01A 2CXNA 2H1HA 3HWSA 3IIMA 4UASA 5FI1B 5JAHA 1T0PA 3KEGA 3ZCUA 1U0FA 1VJCA 2BKLA 1P5HA 2GD2A 3RUHA 3QA3E 2O4CA 1UBOS 4IG4A 5LIPA 4JR0A 3WSTA 4UAUA 4UUQA 1HYEA 4HDMB 1VBKA 1DAPA 1E1YA 4PWYA 5I7WA 2HWKA 4K9RA 4OFWA 1FVOA 3MA0A 5AVUA 3JQ6A 3U4AA 3OEYA 2H07A 1IXZA 5DRYA 3QW2A 4HC4A 2MWMA 2YS7A 1JILA 2QYOA 1BC5A 3LCJA 5GTDA 4QGGA 1H85A 2OR3A 1ILWA 3LRXA 1O5TA 4TGLA 4E7OA 5G41A 2REQB 1KP9A 2LWIA 4D8UA 3K9QO 4Q3OA 3MJTA 1W30A 3IBGA 2QQ0A 1IEQA 1G17A 2JH9A 4BY9E 1MOQA 5AW0A 1PG0A 1TVKB 1ZKMA 2Q5QA 1NX9A 4WKCA 2XEDA 1UBCA 1P45A 1BA2A 2VTEA 1YNSA 1UKEA 2GEBA 2VJOA 2VF7A 1H9AA 2W37A 3RS2A 3W5SA 4DLNA 1O9BA 4MVJF 4CR7A 5CDUA 1NVBA 1W87A 3C3JA 2EW2A 1A97A 3K09C 1Y81A 3M6FA 3OIUA 4AL4A 5AW8A 3K6SA 4HH0A 3VVLA 2WZCA 1Q50A 1PEAA 1NN3A 2WIAA 3GNQA 3SHOA 2F59A 3LUFA 1DDIA 1NXQA 4KQKA 2ZR0A 1XQYA 1RZVA 1RE1A 4EB6A 4UUPA 1Y1LA 2GZSA 2ZBGA 1RHKA 1X1CA 3MTGA 5F33A 4DSTA 1VGVA 2VK2A 2D06A 3DXYA 3OLWA 4BVAA 5K2OA 3U4GA 2XYQA 3F6BX 1US8B 5BW8A 1AF4A 5BVGB 4BO4A 3KHUA 5JMWA 2VJDA 4CM3A 1N2SA 2XBUA 2Z9BA 4G1UC 5EMKA 5CX1A 3WNCA 3U19A 1EP2B 1XDGA 2L42A 3DNPA 3PSHA 5KC9A 1PLLA 3OX2A 4WW0A 1U0NA 2BEVA 5DHPA 5BPHA 1FTGA 2J0UA 2AW5A 5EWLA 5LL6P 3C45A 4LZJA 3GA7A 4TS1A 5HIAA 4EGAA 4RYDA 1M34A 4LWQA 4TS9A 2X5KO 2WAAA 3SQWA 1ZAKA 1DAEA 2UZAA 3OZFA 4DDVA 1ADJA 2VXBA 4RGVA 2OB2A 4NLLA 1TZKA 5CRIA 2IQIA 2X2OA 5IWAB 2IX3A 1QQAA 1JLRA 1QB7A 1E1CA 2FLKA 2MYPA 4J90A 1KOJA 2I7XA 4M0UA 4WNIA 3LSTA 1QIIA 2J4FA 2WB2A 2ALJA 4X44A 3W2GA 1ZA1A 1BQ4A 2P1DA 2ZBRA 4N7RA 4FN4A 1YCDA 3D3EA 4D3XA 3ICQB 2DFVA 2QSUA 4GYWA 3M1AA 3U62A 3PZBA 2FSGA 3L84A 2BFWA 4WIAA 2P41A 2YJTD 4R2LA 4XCVA 4E1BA 1GRVA 3F47A 4R1MA 2ZKLA 3IQDB 1XDUA 3HDQA 2P30A 5HMLA 1NJ2A 2APJA 1O8CA 2WWFA 2I2FA 2LPMA 4ND2A 3F5MA 1JKMA 3PPIA 4G07A 1AHPA 3L4KA 3JQGB 1KKLA 2WZQA 1KC3A 1MJGM 3PWSA 2WI8A 4IIJF 1BE1A 3P7MA 3QVGB 3U5ZB 9MHTA 1ZCZA 1TJPB 2WJZB 1C1DB 1QDLB 4D9GA 1GL9B 1TPYA 4DYHA 3KOWA 3HDVA 3RC3A 2NZXA 2VDJA 2Z98A 2QJFA 3HRHA 2A78A 2EKQA 3OY7A 1XRNA 5JSQA 4EYQA 3F3MA 2HTFA 4BJ5A 4IOLA 2A59A 2C7OA 3HO1A 3HKEA 2BKXA 5JH7F 4YIHA 4NCBA 2DUUA 3C98A 3LF2A 1T9HA 2JNWA 3ANNA 2WVHA 5CT4A 1YZKA 4D8VA 1TZJA 3HJHA 4QTTB 2RJ3A 3UVEA 1GXSB 3B53X 3HU5A 3VJRA 3DB2A 2NSJA 1F1BA 3WRWA 1V9SA 4C30A 5J23A 3L1KA 1ACMA 1DU4A 1DT5A 3G5LA 3TEJA 4MUIA 1EJBA 3RS4A 2IPOA 1WHTA 1Z5ZA 3PHGA 1KZYC 4J0KA 4LV8B 4EH1A 2P9JA 4X3CA 3GZJA 4YCBA 5ARDA 2ANBA 3BXPA 5IMBA 1NKTA 2D4HA 2IYWA 1FW6A 3CVWA 4G0WA 4EMUA 1BRTA 1OKKD 1O2DA 2Q46A 3A4MA 3HB7A 1D5CA 1HXHA 4IJUA 2DHRA 2AX3A 1MB4A 3TF5A 1O95C 1D1TA 1M1YE 1CJUC 1XEAA 4JGGA 5B3LA 3UYLA 2QF7A 3AVOA 1QLWA 4HPJB 2Y2VA 3SDSA 4YAUA 5LOVF 3OCXA 3T3EA 5IDXA 2WPDD 3FPEA 5FP0A 2ZRIA 3ZDYB 5AK4A 4DMHA 1NQVA 4XM2A 1KAGA 1C3XA 1LCIA 2QTGA 5ILOA 4YMSA 3IPRA 4I4LA 4JI8B 1QZTA 3LX8A 2ZI3A 1KNQA 1NZDA 4GBED 4EO7A 1NDUA 2JVJA 1O94A 3LHSA 3PXUA 1V2GA 5KHAA 1ZRMA 1P72A 3NHKA 4MYRA 4MRAA 3S2UA 3ZBPA 1ZU5A 4BMOB 3U0BA 5D1NA 1N6OA 1EE2A 2O0HA 5B57C 1P1IA 4KQ6A 5KREA 3DEIA 3BSFA 2ZTHA 3NZEA 4KNYA 1ZCBA 3FA2A 4UHJA 1U9JA 3D3WA 1HNZB 1CUUA 1JTEA 1MCZA 1LWNA 2A9RA 4YRDA 4E94A 2WLTA 2W4MA 1Z4NA 2YY5A 3E2IA 4J0EA 1RZRD 3FYTA 3F49S 4A8JC 4QPPA 1C7EA 1GPYA 4DFDA 1NBEA 1Y9DA 1TPZA 1ZMOA 3AGPA 5GZ3A 4Q12A 1R6BX 3SLRA 5B30A 1HZZA 2HTEA 1NTOA 2OAEA 3FWNA 1VSTA 5IDWA 1FP2A 3N86A 4B80A 1IQUA 4IW3B 4YI3A 2HRBA 4RH3A 5GY7A 5FL7A 2ZYGA 2BBTA 3JS5A 5TY0A 2ZE8A 3LHKA 4GPTA 4HN9A 2EFEB 4YA6A 2I55A 5HIIA 2JZNA 3MSXA 3P19A 5FWXB 1MA0A 3GOQA 3EW9A 4N40A 5F3RA 3PGJA 2VAWA 4F3CA 4CLHA 1NV8A 3DULA 2PUTA 4OHWA 1JTFA 2BHSA 4ZC1A 1EXMA 1J0XO 4M37A 2QLBA 4IXTA 1G8GA 2HB6A 5J2UB 1ENOA 4LSMA 4QTUB 1RLIA 1PZNA 2PLRA 3UJDA 3DVSX 3EDOA 4PXAA 4G5SA 3K9BA 1H05A 2P27A 3EZ6A 2IYRA 3O83A 3S68A 4UFNA 5L51A 5LD2B 3AEUB 3KDAA 1J9EA 1IK4A 3OJLA 1TYZA 5A4AA 5IABA 3FTEA 1BEUB 2DT5A 3VA7A 2VDQB 2HL6A 3C43A 5L3VA 2VYVD 3D7LA 3M4NA 4N7JA 1N5OX 3K94A 4I8DA 3I01A 2C04A 4C07A 5LYYA 4YCNA 1J00A 1O3YA 2O48X 4S05A 3E18A 4KLZA 1DFHA 2LKCA 1M6NA 2P2NA 1FYFA 4F4JA 1XYVA 2A0WA 1T5OA 1ISGA 3BULA 3NKVA 3F46A 3WMFA 4FDVA 1KAOA 4IJVA 3DGEC 1V8FA 4MKZA 5BT8A 5WRFA 5EKTA 4KWIA 2E5LB 2QBYA 4JA0A 5DF1A 1OSNA 4COKA 5JLJA 4MYTA 2LGJA 4HQLA 5HZKA 4C4TA 1U0SY 4IKOA 1VIAA 2ZJ6A 2CNBA 4UBLA 1A8QA 1KO1A 4I3HA 1CEQA 4C0HA 2GHRA 5AVQA 5JADA 4TV9F 1Z3IX 2IZ7A 2A67A 3SM3A 4BE4A 1RXEA 3UK7A 4IIBA 2FAXA 3HB1A 3VR2A 4E3WA 4UOZA 3DFUA 3T3PB 4DXDA 3BMXA 3QYFA 5FCDA 3FKQA 1GWNA 3M7IA 4OXQA 2BCEA 2P6RA 1V5EA 4LA4A 5COAA 1X92A 4Y0AA 4MVJH 5BO5A 2GBLC 4HFMA 2XYHA 2ZSEA 1NMXA 1QDEA 1NWCA 1XB2A 4QIHA 3CEPB 1Y8RB 2PT6A 1J07A 2AXPA 3HXPA 1GLNA 3L05A 1HZJA 3QFRA 4B8ZA 2IF2A 4D80A 2PBZA 3N87A 3ABSB 4PX9A 3VOSA 1TT7A 3DL2A 3ER6A 2XAAA 2YHIA 3GV0A 1N2BA 3KXIA 5JSYA 3P27A 1XTTA 4W7HA 3E84A 1F8UA 4ZU6X 3ROXA 3TSCA 4D6PA 4K9OA 3HDTA 1ZJYA 2VUSA 4ZMRA 4U7FA 2HK9A 3AERA 1A1SA 4CL2A 3P96A 1NF8A 2QUHA 2DFLA 4OA8A 3EUAA 3B6IA 5KDOA 4M1QA 4U6SA 1TTHA 4BMZA 4FB5A 2NU6A 1P1HA 2YJ6A 1AKTA 1SCKA 5AHWA 2MINA 4DBLE 3QVTA 2Q5IA 4NJOA 5IHXA 2GYVA 2FX3A 1GQQA 2QMEA 2SKDA 4RVHA 1ONPA 3TRHA 3U17A 1FCJA 4ZT2A 4D74A 1QKIA 1RLJA 2XITA 2ZAOA 3FKSA 4RZIA 2O57A 2QSJA 5JVDA 1M2JA 3FCSB 1Z07A 4NQZA 4DA8A 2NTVA 3Q8KA 3F3KA 3GUUA 1C0IA 2EP5A 1FDRA 1PR0A 2Y71A 4FOPA 3RAFC 1O03A 2GWHA 2VAMA 1ISHA 3OZXA 5AVKA 1IWPB 3GW8A 621PA 5HKAA 1QPZA 4RK0A 1AHHA 1PR9A 1OXMA 2XYGA 4AP5A 1E5QA 1ODLA 3AO0B 4HDSB 2H31A 1TK9A 2ZB2A 3GNLA 4PQEA 3CE9A 4ARBA 5FV4A 1R27A 2UUAB 4MTCA 1NXOA 3ORSA 1CQJB 2NXNA 1S2DA 4BEWA 1YVEI 3G8DA 4W4TA 1ACJA 1UXKA 3OD5A 4LMRA 1P3Y1 1WCIA 3O4FA 2VJPA 2QD2A 4I5GA 2MMGA 3UB4A 4FGKA 5MN5A 1GKKA 1TJ3A 2HQOA 3C48A 1AQUA 2Y0BA 4ND5A 5BSUA 5F1YA 4TWZA 4GXRA 1NC3A 1OASA 2ODBA 4M99A 3VNBA 2IP1A 5BOSB 4OBBA 2OZLB 4OD0A 3ZZUA 4MVXA 5HTKA 3O8NA 5CP8A 2VJYA 1EDEA 3U16A 1E94E 2VYCA 4MWEA 1YL6A 2QV0A 5DIFA 5DWDA 1T1SA 1U31A 2XHEA 1BMTA 1PUXA 2AOWA 4DNPA 4BNUA 1WOMA 4ZOCA 3S4YA 3JVIA 5CLLA 5K20A 5JJKA 1Y7TA 2C94A 5CK5A 4DREA 1EFRD 1QH9A 4MO9A 4DVGA 1U7DA 1PJ3A 3LCRA 2IT1A 1NE7A 1S7CA 2E4AA 3E1SA 2HQSA 3G59A 4J0QA 4KRXA 4RDCA 3ORFA 3B6KA 1ULAA 2MU1A 3DKPA 1SGWA 2E6KA 1ESEA 2WQZA 3DE4X 3PYLA 4WY5A 1ZWLA 2QR5A 4P9NA 1MHPA 4G5XA 4LXTA 1QCCA 3AVXA 4TXJA 3LOPA 3WLLA 2F55A 1P4HA 4JBXA 3DBLB 3LT1A 3R3SA 4V0OA 1EKXA 1UK8A 1ZXXA 2K87A 4XGRA 1DG3A 5K8TA 4HHEA 2HRQA 1L5GB 1EUZA 4HYQA 1GKLA 4EA8A 2CVOA 1V1RB 5KTTA 3AEKA 3NDPA 4Q5IA 3T4EA 4RNDB 3FPLA 2I4LA 2QDXA 4IILA 4NV0A 3K9GA 4MWBA 3DJFA 2QJWA 4XSVA 5JCJD 2O19A 4W5JA 4CHTA 2I2WA 4WA7A 3THYB 4ZTZB 3DZCA 1ZM4A 3PEYA 4KO1S 4BPBA 4AKGA 1CG6A 3HV2A 5AR1A 3VU3A 4GR9A 3KUUA 3RLIA 2V96A 4LDQA 5TSDA 2ORIA 3ML1A 4FBGA 4JB3A 3EXAA 4MHTA 4UVHA 4POOA 3K0SA 1N2OA 2C96A 1PJAA 5JNTA 2CVQA 4C08A 1PR2A 2IU3A 4WI1A 2VL7A 4LF7B 4BHTA 1I33A 4PZPA 2ACVA 3O8QA 3P2IA 4IOJA 3N0VA 2Q7XA 4QBIA 4I66A 2PKXA 4WINA 5CVEA 5CCDA 4U00A 5B1YA 3I53A 3P0FA 5JBQA 1NJSA 4PSDA 3Q15C 5E95A 5KYUA 2FE4A 4D56A 4X7PA 4CTNA 1JXOA 1YKGA 2IXBA 5HQ3B 2R8EA 2B7BA 3T3DA 2W6QA 2YVLA 4X1IA 3N6XA 1N57A 3WLQA 3OP4A 4GPEA 4F2DA 5LD2C 1TIPA 3WDMA 2AR0A 3AZOA 1A9SA 2H4XA 3E2PA 3EXG2 1G3UA 1TM7E 2ILTA 4G4GA 3A4LA 4HWKA 4UPVA 1DUSA 3RG2A 3T5GA 1RQLA 1FVXA 3NUQA 3LP5A 4F46A 4LHXA 4QDUA 4GM1A 1NVWQ 2VJLA 2FRVA 5ELMA 2JLAA 2MMCA 4C3UA 2OHGA 2QZ4A 2ADMA 4ASUA 3LDFA 4MMZB 3HJAA 3S99A 1SXHA 3GG2A 1ZLYA 1UINA 4YTEA 2Y27A 1E6WA 1Z62A 1HDOA 3KQMA 1EFPB 3K1JA 4OCZA 3Q2KA 2ESRA 1NQOA 1R0CA 2C54A 2JB9A 5COBA 1C7JA 3NEPX 3AC0A 3H1PA 5ALVA 1WMBA 4KIWA 4I1IA 1IZYA 2VQFB 3IKJA 3U80A 1IEXA 1PNQA 1W35A 3A2NA 4I9NA 3DF7A 3W78A 1QCZA 5HNKA 4QD3A 3DQZA 2XWJI 4XYBA 5FBRB 3UGTA 2I5PO 3PQEA 2DE0X 1T0BA 1OH5A 2QJOA 2F67A 3KJIA 4OMDA 3KZMA 2YH2A 2W8BB 5IM4F 4FFBB 3OSUA 4A4DA 3MAJA 3PRKE 1QGDA 4N8SA 1NXXA 4MQ4A 5ESDA 1YSCA 4I2VA 5CEEA 1HK7A 2AOUB 3LC2O 1N3IA 4LW8A 4M0PA 1VDMA 2O1SA 5K0ZA 1AH2A 2X5XA 2IEDA 2DZDA 1L5OA 3C97A 3OZWA 1PR3A 3EDRA 4LNHA 4Q00A 4RPCA 5FUBA 4U5XA 1SXPA 1ZNWA 2OSVA 2FJPA 3S1SA 3FCEA 3RRJA 3ZKWB 2ZJ8A 2KB0A 4DLPA 3ORHA 4BTVA 1UQUA 1XXHE 3JR7A 3LUCA 1GYQA 5LKRA 3QVXA 2C4MA 4QO7A 1Y5RA 1K4MA 3UJPA 3SE7A 3LXXA 1JWLA 4PWZA 4N1AA 4RK4A 4BNIA 1X3SA 2HOQA 2GN2A 4PIPA 3V8QA 4RSHA 4F3KA 2C20A 3GCXA 4PLVA 3AOEC 2R7MA 4OL9A 3ZWCA 3VO2A 3VU9B 3OQOA 2D5BA 3W8RA 4HD8A 2WFMA 4HLDA 2QRGA 4KIFA 3EEQA 3LMKA 4WD3A 4LWZA 3TG2A 2CLOB 4MW9A 4J0JA 5LBTA 2IWHA 4TQGA 4AULA 5FJIA 1YMVA 2P75A 3FNIA 3PJGA 3BZUA 1OWMA 3KCQA 4HB0A 4H9GA 4HOYA 1DTSA 4RAQA 2BFFB 1A2KC 2AFHA 3EEYA 3LC0A 4PPQA 1PI3A 4EUEA 1IZZA 4R05A 3MS7A 3TNLA 2YHAA 3TD9A 5BQFA 1RYHA 2ZYHA 4D3ZA 2JVKA 4FOOA 5TS3A 3G0GA 3MJCA 3N2ZB 1NUHA 2OZVA 4ZCLA 4A0FA 1SH7A 3ZIDA 5H83A 4QTYA 2KX7A 2HJSA 1DT3A 1XF1A 2OUIA 3KTOA 4QOGA 2XRFA 3DP7A 1JIUA 4KYVA 3Q3CA 1T3ZA 1EMDA 1X7XA 4WKGA 3ZNPA 2C3OA 2NSLA 1RWOA 4PG8A 2QNBA 1AHNA 3IVXA 4CV3A 3R3HA 2YJ3A 3A4YA 1NURA 4RYLA 1JEQA 5IYZA 3WAJA 3OZDA 4B0OA 1TF7A 4LHYA 1P9RA 2YV3A 5AUNB 5KU1A 1HTBA 3FNGA 3EHEA 3OLYA 4S0XA 2WTNA 1KNXA 5J5VA 1OLXB 1R9GA 3DYBA 5FV7A 5T5QA 4DJTA 1H4SA 2JI9A 2OECA 1CW2B 3QPUA 1RBYA 4FFSA 3DBHB 4KQGA 2FR8A 2IELA 1I7QB 5K4AA 2NACA 1VLHA 1W59A 2ZSFA 2IU4A 1QKKA 1SOVA 1XOIA 3OPMA 4BRZA 4B1FA 5AI8A 1W4LA 3MTEA 2ZYUX 4NZOA 4DQXA 1DHTA 3MCZA 5EERA 4ZCTA 1BHQ1 3NBQA 1M0SA 10MHA 1GNPA 4DHEA 3AGQA 3VHXA 1EK2A 1Q7GA 1W29A 2IDJA 1TYEB 2PX4A 4MX8A 4Q24A 2VZLA 3UGJA 3I0NA 1RM0A 3GROA 3CUYA 1R4NA 3C3YA 4QX6A 1DINA 1YJXA 5BW5A 4QU9A 4PXSA 1XCOA 1U2SA 3AYZB 4E21A 1U0BB 2FSIA 4OG2A 4P54A 4AJKA 3SK0A 1KETA 3MF4A 2O50A 4ZT6A 3ZHTA 4EIWA 2WW8A 2JFBA 4W8OA 3VM6A 1I10A 4IDAA 4L8WB 4OI2A 1ZVJA 4TYWA 4YV2A 4O4HF 4LF5B 4C4XA 3QLVC 2ENWA 2H1SA 1JFTA 1GZVA 3AP2A 3EXG1 1Y8ZA 1I24A 4LNAA 5U9CA 1XKXA 1N0VC 3WL8A 4F1JA 2WU1A 2XT0A 4XSHA 1Z0DA 2GWRA 3QIVA 5IF9A 5HFJA 2ZDGA 2R6ZA 3E4DA 4L0CA 3KVYA 5ILQA 4QAQA 5FNVA 1HDRA 2CSUA 4W8GA 4YQEA 3NWBA 4XB1A 4JGIA 5CBPA 3FFXA 1XU9A 2OBNA 4O4JF 3VZBA 5FT9A 1XFAA 3IRVA 3U49A 5EGSA 1REQA 3HZHA 2VP2A 2DPXA 2YBEA 3BSSA 3HNPA 3K2QA 4WZBE 3AR2A 4IMRA 3WADA 3KE8A 4WVLA 1KWGA 2BTEA 1JWAB 1JALA 3O8OB 2QVLA 1PUJA 1K6MA 1A50B 2XX3A 1F3LA 1XU7A 2AXNA 2QVCA 4CCSA 1ZKDA 1VBMA 4X61A 1EB8A 3NLLA 2HDOA 2TMYA 1SKMA 4PU0A 3ILVA 3REGA 1E5XA 3FCYA 1QV6A 2ZAMA 1SVIA 3QMPA 2J9FA 1IJBA 2Q2NA 2Q07A 1TQ2A 4NY1A 3R7LA 3IAUA 5HMMA 3ZK8A 2PY6A 1PW7A 1V0JA 1G18A 1K3UB 1XBTA 2YCLA 4DMMA 2ZRCA 4R98A 2CFOA 2IODA 4BBAA 4QYSA 2KYRA 1Q7CA 1V95A 3D7SA 1E1NA 3EBPA 1MFZA 3QBVA 3P1JA 5JFOA 4Q1VA 1SEVA 2ONZA 1ZGHA 4EDHA 2QP4A 2B4AA 4YB8A 4OLFA 3SMVA 3HJRA 1X7HA 3NHPA 1VKHA 1I4OA 3K0CA 4RTNA 1WUIS 3ZGVA 2O8VA 3LUHA 4KK3A 4RKWA 4V0RA 2OYRA 2NTJA 2R1VA 3EG9B 1N1DA 2ST1A 3TDMA 2QRNA 3OMXA 2Q7DA 2J31A 2QMHA 5JXIA 3AVUA 1KMNA 3ANMA 5H4GA 4KGZA 4XD7D 4OH1A 1PN3A 1Q6YA 2A0KA 2A35A 2OT3B 1J8VA 3PT5A 4L4RA 4PY2A 4RE5A 1JG3A 2X7HA 4PPYA 2QT9A 4HH1A 3BILA 3K30A 5DK4A 4C4OA 1R9NA 2QORA 3PVSA 1EP9A 1Z0AA 4U5QA 3SAJA 1IHXA 3V8PA 1ZN9A 1IM8A 1NVFA 1Q1NA 2FW0A 1HQKA 3N8IA 1EFLA 2FHSA 3DXFA 4Q6BA 2M32A 5I6DA 1XAHA 3LDUA 4WZAA 3W1VA 2WWYA 3GPLA 3LUKA 4ZVUA 2JCVA 3IT0A 5SYAA 1CUSA 3LCMA 4TL6A 1SB9A 4TQ9A 3STUA 1VLMA 3OQIA 4RA6B 5FTJA 4EKEA 5FWNA 3ZTTA 1TCBA 3FNBA 2GUWA 1NMQA 1DBVO 2X0RA 3MT9A 4GGOA 3V48A 2XUFA 3EA4A 4EECA 4A36A 1BHO1 4XX0A 2EHJA 4F7WA 3BB3A 4BV8A 1NMYA 3T3MB 4C4PA 4PZCA 1FX0B 1TMYA 1Z7WA 2QUIA 3IOBA 1Z0ZA 4YXFA 1NDHA 4YUZA 3MWDB 5JRZA 5IBPA 1GPLA 3G0CA 5EAIA 4LJSA 1Y5LA 5AM4A 2PUEA 3LTEA 5H68A 2OCXA 5GM2A 4A0HA 2UYCA 2AVDA 3E15A 3RT9A 4B75A 4DLBA 3AVTA 1U1DA 3OZAA 2NZVG 4XWYA 1U5BB 3AIKA 2VDMB 3EFBA 1J2EA 4PNEA 3HN6A 4I6EA 2WY2D 2WUEA 3MCWA 3EPLA 1VKZA 3CLSC 2K6GA 2RG7A 3ENVA 3JRWA 4AVYA 4X9XA 1U81A 2GZRA 3BIJA 2RCYA 3FR7A 4RIHA 1AN9A 2D0PB 4AJHA 4AJPA 5KNDD 4GPD1 4QODA 4BFXA 4XDHA 4PC7A 1N4DA 1FS5A 1Y33E 2RGUA 5EXTA 3RU3A 4Z4EA 4JJ8A 1MXHA 1Q1QA 2GBGA 1E5LA 2GTHA 2GJ4A 1XO1A 3HACA 1G6KA 1OI4A 3O7WA 4QJBA 3EJ6A 1THMA 4EGCB 4FJ2A 2XNDD 4PO3X 4RVGA 5HPYB 2EW8A 3G7UA 5LKAA 4PN3A 5IAAA 5DYTA 1YDWA 3V1KA 2EARA 1XZNA 4YFYA 5KOIA 4NBRA 2Z5FA 3OVMA 2I2BA 4ZU3A 5A2GA 1Q14A 4TLAA 4NPHA 3FBWA 4TZTA 2VHQA 4F11A 5JXGA 1P2FA 1U4OA 5IJWA 3J81A 3UG6A 1CUZA 3DLPX 3DE3X 3VAYA 1YKFA 1JL3A 1ZUHA 2YYYA 3OC6A 5MGNA 3LQKA 3PQ2A 4TUYA 1ECJA 4CG2A 2P8SA 4II7A 2Y77A 4L4YA 1WCWA 2GTIA 2BFNA 3IT1A 2C7GA 3N8HA 5CNIA 5CT6A 5HKLA 3W6ZA 2G70A 3FFTA 2W6IA 4FYJA 1XTZA 4DWVA 3JQBA 4IGIA 1QIDA 4B87A 1POWA 4OXNA 4CKXA 2Z8YM 4NH0A 5HCIA 4QARA 3AF0A 4EQ6B 1TU0A 2PZMA 3W3AD 1SVOA 4MW4A 4PHFA 3CN7A 1LK7A 3DC7A 3NTXA 1Z06A 2JI4A 3NCHA 5HDBB 2V5VA 1GP2A 1MJHA 2JAQA 5FI3A 1ICEA 1PZMA 1O6FA 3IDSA 4FBLA 1ZQ1A 1GG5A 3PHCA 4GOND 1GGHA 4PNPA 2NUBA 3O4RA 1EB9A 1QP4A 4HGQA 5JWHA 4JC8A 3SX4A 2WABA 1H9CA 1ISSA 2CJWA 2ZRBA 3KJXA 4Z4CA 4DEVA 2NZ2A 4GWGA 1WXQA 2R66A 3L1HA 3CMCO 5D8DA 3GP8A 1IN1A 3BDAA 5BN3B 1UFRA 3PFHA 4DZTA 4YREA 4FMDF 1G8MA 4B7UA 1PFGA 4HQRA 3W4KA 3M1LA 3WRXA 3SE0A 4D4IA 4ERXA 1ECLA 2M6RA 4NMHA 2YY7A 1AUQA 4NCIA 1TAHA 4JT4A 1U9IA 2W42A 2VYND 2JGLA 3UH1A 2ZREA 4RJJA 5ES4B 5EESA 2PO5A 4PTZA 4KHZA 3INTA 3KAJA 2Y0DA 2BBSA 3BIXA 4KK4A 4PO1A 5FPYA 2J5BA 3RVBA 4C1BA 2AMJA 4DNOA 1QUEA 3AKCA 3ZPXA 2ERCA 2AXQA 4HTFB 4R31A 2FV8A 2LUOA 3EWAA 1FQWA 4N5NA 3CNBA 4IWXA 4EKYA 5B53A 4KO2S 1YRQA 4Q1DA 5DDIP 1YS7A 2AR9A 4KRYA 1ZC4A 1D9XA 4JUBA 2QWXA 2ZIXA 3L4BA 4KODA 1IN8A 1RI3A 1G1AA 4L8VA 3D7MA 4LWOA 2D13A 3QVWA 1E2IA 2EFYA 2HPVA 2ZSBA 3PC4A 3SZRA 1Y8CA 4DC0A 3AT1A 4PEVA 5JS1A 5J3JA 2C4UA 1RTKA 4PSVA 2VHEA 2XF2A 2NYAA 2VRCD 3HMKA 1V16A 3Q1KA 4BCCA 4C4RA 4IHJA 1TZBA 1G4AE 1DRUA 4P3KA 3TTWA 4UFPA 1RHJA 2Q28A 1F2UA 2G1KA 4WKOA 4FGWA 5B1EA 5ED4A 3F5SA 3ITNA 4R7GA 2P5SA 2M9MA 4ZWNA 1NF2A 1PW5A 2R6JA 4KNWA 4Z51A 4D8XA 3NHFA 1YFJA 3TMYA 3PHHA 2A33A 4EY8A 1KMQA 4FDTA 1WZCA 3ABQB 4C0XA 1DNPA 2Z6UA 1Y8AA 2O2XA 3GLFB 3LCVB 2IOFK 1T9AA 2KWIA 2PZ8A 1F8FA 1OJLA 1MT3A 3C8UA 5IRCD 3A3OA 4MKGA 4BCDA 1FEZA 5DLPA 5EXPA 2YL2A 4RLHA 3UFXB 5G0TA 4WLNA 4WN9B 2XT9A 1OZFA 2GYUA 1H4QA 1GUZA 1IY1A 2XDQA 4TTQA 4KDCA 3LPAA 4RJIA 2Q4OA 2PZEA 3IAEA 1SKBA 3L07A 2I6FA 4AT1A 1KEZA 3R74A 1WUKS 1QBGA 4JROA 5HZHA 1NXPA 3KLNA 3SICE 1NVKA 2E5WA 4MLPA 1T0JB 1CS0B 1RWNA 4MQ6A 1JQJC 4K6HA 4PFSA 3KHKA 4FFLA 3M4JA 3KLOA 3KZXA 3QOFA 4Q7MB 2CVZA 2YHSA 3CFYA 4RM2A 3FMGA 2PCJA 3UAVA 2E21A 2ZJZA 3PUYA 2P4EA 4J3FA 3UOAB 3VZPA 2R8XA 2W0MA 3E3MA 5BV1A 3CEAA 4C2BA 4C7XA 1R3UA 1F06A 3GGGA 1B16A 4QOSA 2EQAA 3GLTA 5IJ0B 1TM5E 7ADHA 4P80A 1CSEE 5D6OA 4QPDA 5BR7A 3FMPB 1VP9A 1ZDMA 3LUJA 3V4RA 1WV0A 2DWUA 2JEOA 2QUKA 4LECA 4MJ3A 3M8KA 1E9RA 3ZCVA 5IXSA 1NX6A 2QW0X 2HY7A 5JC8A 1KAQA 3EVZA 4P7BA 5IFLA 2M2IA 1UPFA 1OBOA 1PK8A 1PQYA 1WJGA 3GRCA 4YAFA 5U1PA 3JAMA 1K3TA 3EC1A 2IDKA 5CEFA 3IXQA 1G21B 3OX4A 3Q98A 1UJ5A 2LCQA 3E61A 5K99A 1HT3A 4DLVA 3IPXA 2DBRA 5J4LA 1NG1A 3FOWA 5JCJA 2V0GA 1X1SA 1LBEA 2JFNA 4ND4A 4A0RA 2V6MA 1SXJA 2PT9A 2A6PA 1LW6E 5G1NA 3WK6A 1WMEA 2QYHA 1PT7A 2Q5JA 3RRNA 1CQIA 4KMOA 5DYYA 4C6TB 4L8LA 4KXFB 1SOMA 2OP1A 3A32A 3ICWA 4I8XA 1JLSA 5JO0A 2VNHA 2OM2A 1XQVA 1J6UA 2EFDB 5F7XA 2HW8A 1I3LA 1ZO8A 4LC9A 1K8RA 2ZI5A 1QFMA 5E38A 3MINA 1H1LA 1V11A 4HCJA 2F9FA 1G0NA 3Q10A 1LSOA 3DO6A 2DFKB 2QRLA 3L1UA 4KPUA 2O8CB 4HX2A 1RACA 2XIJA 3GLHE 3SNHA 2C2WA 3M9LA 3KR2A 1KQNA 2G83A 4UPEA 3PE3A 5K0JA 3O95A 4MTLA 1M5UA 3N2LA 1PJ2A 4N01A 5HJ2A 4BKRA 2Y1EA 3FPFA 2HIGA 5KZMB 1CB7A 4JIMA 1F20A 2BM0A 2MSCB 1DC8A 4K46A 2XLBA 5BSEA 3HWX1 4UATA 1NYTA 3RVKA 4MV9A 4BLUA 3AXTA 3B12A 3OCVA 1DAOA 4EUKA 5AVOA 3ZCQA 4CV0A 3FHOA 1PQPA 2YJ5A 2FPXA 5C8ZA 1ZR2A 3SVZA 1UM9A 2FPSA 3O0DA 3S3TA 2EDCA 1VSBA 3PR3A 4QGHA 3TLGB 4M1EA 5I5EA 3UG7A 5IVPA 2XMDA 5JIBA 4XIGS 5EVCA 5K09A 4MUJA 5LB4A 3RK0A 1B00A 2GHTA 3KHTA 3OPNA 4G24A 3W5DA 2V7TA 3CYFA 5SZIA 2GCGA 2OL4A 1MABB 4MR7A 1T3TA 1CRQA 5F21A 1GNTA 3E0QA 2NV2B 5E2IA 2I8LA 2ZLBA 4POAA 4ALKA 1LDYA 4NFSA 5L3RA 2PT7A 2W2LA 3O31A 4CM4B 3V55A 4LOHA 1B2RA 1R00A 4AZ3A 4D0RA 4V1CB 1OB2A 1Z18A 2CDBA 1FB5A 1JKFA 3H11B 4NJMA 4GQIA 1L8AA 2N1MA 1H1DA 3FRIA 4NBLA 2X1VA 5CPBA 4EGQA 3DFIA 1O94C 4DGQA 3ISVA 2AB0A 2CN1A 4IDQA 4R8MA 5EHZA 3G9XA 2JK0A 2JGMA 4E07A 3VSDA 2D5CA 2DECA 2VSFA 1UMDB 2ONKA 4BNYA 1PV4A 5CYFA 1XCGB 1X1DA 3B3GA 3D31A 1QGUB 2X1MA 3BXOA 3F8WA 3L01A 4ZP1A 3V33A 3NBYC 5DYIA 2J87A 2ES4A 3U4HA 3TX6A 1UZUA 2MSKA 3ABRB 4WZZA 1V3VA 2G72A 3CUSA 5FBVB 5J2TF 3QMMA 4DMRA 4RH1A 3NHJA 1N6RA 2DUJA 1KSFX 4Y30A 1V96A 2YOGA 1FNNA 1VHJA 3BRWA 1HZZC 3KSZO 3QU5A 5TF0A 1YQTA 3R20A 3C1OA 1L4EA 1JDBB 1MQAA 2QZ9A 5I4BA 3ZHVA 4X6UA 2OWDA 3ND6A 5J43A 4HNHA 1PL7A 1NNEA 3QE2A 3HFRA 1I5EA 4PGMA 4QBGB 2POCA 4QRDA 1N2CB 2QYTA 5LVAA 2FKAA 3I4LA 4ML3A 3FB4A 4UM7A 3SC6A 3DKKA 4AMYA 2AMVA 3B2NA 2R8PA 1DQYA 4FCTA 3TB4A 4GL4A 1J7KA 5AVJA 4Z7JA 5LQNA 3K9NA 1QYVA 2BFAA 3DVRX 3E4CA 2C7PA 4LHEA 1W5AA 3KTAB 3UT6A 1PJBA 1YB5A 1L5ZA 2RHRA 2QTLA 3H19A 3K5PA 1DOZA 1ZYUA 1RI2A 1SZDA 5BWNA 3OZUA 1LBQA 3PGMA 3PC8A 3UIEA 4MS3A 4HEA1 3MCVA 3D0RA 4DWJA 5EJGA 5E3JA 3RW9A 1J42A 1SD5A 2YWJA 4WLOA 3K0HA 4P4NA 3NC4A 4K0RA 1ZINA 4FW9A 2A9JA 1U0EA 3PXBA 3FRJA 2X7JA 3K6JA 4HLQB 2AFIE 1S3SA 3JQPA 2GZAA 3E9MA 1SM4A 2BTQB 3CPEA 3PTZA 4GSKA 2JCYA 3H3XA 3EEFA 3FNEA 3OCZA 4W1SA 3NBMA 1YFLA 3TTXA 2FDCA 3K73O 1DBPA 1E2QA 5JNRA 4XEUA 5GONF 3JQAD 4L9AA 3PQFA 3LC1O 2P2ZA 2H5IA 3GIDA 1BAPA 1K8XB 3T7DA 4B4OA 2DWCA 3KYCA 4ZRMA 3CRRA 2Q3CA 5BVHB 2QTFA 3GZNB 3WLHA 1PGPA 3AY7A 4JP1A 5IKEA 2KBFA 3A4IA 3BM5A 1PTKA 3RVLA 5I9LA 2I4IA 5DGIA 1FF9A 1DO0A 3QYJA 2H4WA 4DG8A 3VYUB 3DW3X 5DGDA 4KCGA 2P2CA 1G8JA 1NTRA 3ZE6A 4EG8A 4RD4A 1Y7LA 4JITA 3QVSA 2G4LA 4Z4HA 1QG4A 2VQDA 4EZEA 2PG3A 4U4AA 3IHKA 1KAMA 2BR3A 1C4OA 1K08A 3I37X 1CQXA 3NU1A 5DKFA 3WLIA 1G66A 4NEHB 5B3KA 1VL0A 1I9GA 3U3DA 2ZJ5A 2VPYA 2UUOA 3E05A 2QTCA 4EELA 5TC4A 1IBSA 2YS6A 2BBOA 2EBHX 4MDYA 5LYJA 5H59A 1Z28A 4CLEA 4ZJZA 4TKVB 3RVRA 1WDLA 4DDWA 4FM9A 2C5FA 1JNYA 1M73E 1SU7A 3S2ZA 3GLIA 1BGWA 1K9VF 1HNNA 1LQUA 2G77B 2H2FA 2RJNA 2WU8A 4BVBA 4Z4GA 4PG4A 2HCBA 2M6SA 4N5IX 2XJ9A 2C7VA 4NOMA 1E7WA 3NAGA 4E30A 4ZZ0A 1N36B 2F3SA 1LKZA 3CVOA 2DFTA 3GRUA 1YQQA 3L7AA 3PK0A 4JY7A 2JI7A 1C7RA 5T8KA 3WLMA 1UPCA 2VNSA 2L69A 3GQBB 4BGEA 2P79A 2QN9A 2Z2JA 4G1MB 4O5AA 3WDKA 5KSYA 5AYVA 4Z54A 3M6IA 4D3FA 3QEMB 1V4VA 3W6OA 3FTDA 1O58A 2YXLA 3PCXA 1Z5NA 5FUVA 1WVGA 2P2SA 3QHAA 3KR0A 2HT1A 2HPZA 4F5ZA 2AXEA 4HSGA 3K0AB 5DYGA 5CB4F 4BKQA 4E70A 1Z2OX 1S9DA 2C8VA 3VPSA 2IHJA 3NJRA 1GQSA 4ZYWA 2AD5A 2HZ7A 4OHPA 1DQZA 3G2KA 4ENUA 5A1JA 4WBNF 5LNK1 4I2NA 3EGXB 4LQDA 5ELLA 6CHYA 1JLKA 1MDBA 1S2MA 3VKFA 4XJXA 3I5YA 4YY3B 2YJGA 2YICA 3GJ5A 2IQ5A 3OZTA 3Q0EA 3CT4A 4AZSA 5BUQA 5B58T 3ZEIA 2QAIA 3G7SA 1IEWA 2W71A 3BF8A 3L7KA 3SYMA 4BIMA 4W5OA 4YLYA 4M9XA 1KP2A 1PHRA 3EXEB 3RTBA 2H4HA 4OUDB 2FTKE 4LJ9A 1T4GA 1XTRA 4L6CA 1KVSA 1J2YA 3AWIA 1AQNA 3OQ1A 3TIIA 4F96A 1U1CA 2Y3IA 1SU6A 2ZZKA 1P7WA 3H4TA 4IDNA 4KQCA 2P9FA 3JARA 2V55B 3V7UA 2VNJA 5BRAA 1P73A 1QZUA 1W4CA 4ZDJA 1U3UA 2A9FA 4G0NA 2ZJFA 4LVNA 2Y0CA 2NSYA 4HN2A 3REQB 2ZJOA 3EQ2A 3SSOA 2XZTA 1Y8QA 1HUQA 1GOTA 4OX9Y 3FOZA 1Q6ZA 4O1IA 2NPOA 3RYCA 2F3TA 3G2IA 5CNMA 3QXSA 4F9FA 5SZJA 2OAGA 3SHFA 2LBPA 1ZH8A 3FYDA 4Y1RB 4BNNA 2JLYA 2QLLA 4ZOEA 2ZM5A 3E9YA 1YGPA 4MP6A 2OY0A 3SWWA 3VQTA 4BEVA 4QUEA 4A7PA 3N0XA 3PSAA 3P2EA 4LGVA 5AVWA 2I03A 1Y6RA 3SQDA 4K3UA 4M8SA 1QTRA 4BATA 1HI9A 3DZJA 5GVSA 1UZLA 4BKOA 5TQ2B 3WLAA 4NCXA 3S28A 3T9CA 4XGKA 4C29A 4E7PA 5F9FA 1XD9A 4BAUA 1NVDA 1VE9A 4XARA 2NXJA 3I6MA 3CW2A 2IXEA 5FFFA 4H31A 1BHJA 1U8CB 2XYRA 3AJEA 1YR7A 2J9GA 2XQKA 1AKVA 5T3UA 3HEBA 1GU7A 5AQ1A 3LPNA 1Q83A 1QJCA 1TF2A 2ZR9A 1OCEA 4GW3A 1XCMA 3I04M 5ELXA 3BIFA 1HOTA 3I2JA 4TMKA 1DBSA 4RW0A 3K1YA 4RZSA 4TYPA 4XXHA 3MXOA 3HJBA 2OGWA 3JQFA 4XTRA 3TTTA 2VWHA 3IAS1 4LY9A 1XROA 4G65A 3AF6A 2VPTA 3LOQA 4MCHA 1EXDA 1OGIA 1T34A 4A2CA 3KSUA 2JIZD 2PT5A 1RRFA 4G89A 3K9HA 3RSCA 2WRZA 4A91A 1PCXA 4L07A 2BRUA 3B89A 1WHSB 3ZW9A 2DFNA 4C0BA 4RCVA 1G6Q1 3ROEA 5LP6B 4M9CA 2I65A 4OSOA 4KR2A 3D4OA 3QUBA 1YHZA 4W5WA 2BR5A 1NBMD 1MV5A 1V39A 1DAGA 2WB4A 3EC2A 3I2IA 3QVLA 2OEPA 1DKNA 4G97A 1ZBDA 3DBVO 1ULTA 5TS2A 2J6BA 2XMZA 5BN5A 2YJZA 2VXCA 3PUWA 4S1VA 2AEFA 4B3GA 4YALA 3BXEA 3L7DA 1SBQA 3N0RA 2WD7A 3L0BA 1DIRA 1I4DD 1LK0A 2B1QA 3RFUA 5DU2A 4CGYA 4P5PA 2R7AA 4I81A 1Z4LA 1U94A 3BCSA 4NFHA 5KWIA 2JIMA 1NVAA 1YR2A 2J3HA 4BX3A 3KEFA 3K1AA 4YJ3B 3PGXA 1S3GA 4O2BA 2P2YA 2QQFA 3GLRA 5EWJA 1NSYA 1AC5A 3HBNA 4WTOA 5GIPE 5K3FB 3UXYA 3WGUA 1I80A 1EUCB 2D8MA 1V45E 2KBEA 1MP0A 4GM0A 1W9MA 4I1SA 1XPOA 1E59A 5M3BA 1QX3A 2BJVA 3FMOB 3MBIA 4LQ4A 4D3DA 4YJFB 5IUKC 3C5VA 1Z56C 4IHQA 1QH0A 1O6GA 1VKRA 3NGXA 3E9NA 4EI7A 2AH5A 2A9KA 4OP2A 3HYTA 4R1LA 3Q3IA 2WEKA 4Q4AB 5GAJA 4URHA 5KQRA 3ADCA 1E0KA 2J59A 3NHAA 2R87A 3FJOA 4MB2A 3D5QA 2A14A 5ECWA 3MHPA 3KLMX 1N2XA 3Q7PA 1GL7A 3VOTA 1WMDA 2ZRNA 4DY4A 3ZZ0A 1KHTA 2AFVA 2GN4A 3AU8A 1DKPA 3A28A 2FP4B 2DMRA 4NR0A 4MWTA 5L4NA 2C58A 2PJDA 4YIKA 1Y6JA 4ZV7A 4O2AB 1UZAA 4NOKA 3SYKA 1SOAA 4RQBA 3TIXB 1ZRHA 5ICSA 2XR1A 4DLSA 1X8JA 2HLDD 5MGBA 1U8AA 4HGZA 1J99A 1SXIA 1YUBA 3PQ4A 4EPVA 1ST2A 5JAUA 3P9RA 3VSCA 2QE6A 1J7JA 2FEXA 4FZ3A 4ZVSA 4DC1A 2R25B 1GZ5A 3BWBA 4HTAA 1C1XA 2XOEA 1BX1A 3LG2A 2QU8A 1GA6A 2BH9A 1A9QA 1D2CA 1ISJA 3T9AA 3TTVA 2QRKA 1P0IA 3OBIA 4Z86A 5T4BA 2ORED 4IUYA 3RS5A 3IQZA 3P4XA 4DN6A 2CSXA 3SLGA 1JQ5A 2G6BA 4WNAB 1ZSYA 1IUPA 2J4CA 2ZRMA 1WW3A 4OXKA 3GMIA 4AN0A 3PHLA 4EI2A 3ILYA 1TKAA 3PEVA 4QHTA 2XUGA 5C5DA 3ESXA 3CLUC 3IESA 5H7XA 3GP3A 5ENVA 4BS9A 2B35A 1PSZA 1G5PA 3MB5A 4ALIA 4ZQEA 2WYUA 1ZD5A 5AIBA 4PZYA 1EP1B 3MFQA 3A31A 2ODPA 3ULKA 1Z6ZA 1YR6A 4ITRC 1DC5A 1E4OA 1E8MA 1G20E 2UVDA 3V4FA 4EKIA 3KD3A 4XH9B 3GRVA 1PEDA 4UHHA 4U2BA 4OAPA 5G0VA 2X19A 3WC4A 1YL5A 3OP1A 1TQDA 4GMKA 2TECE 1ZISA 3R9WA 2GT1A 4M76B 3KKLA 3E7FA 3ZGNA 4R3WA 4CLDA 1GZHB 1YIDA 2RAFA 4CXMA 1DC7A 5KOJA 1RYNA 2FR8C 2H4YA 4M0MA 5KVCA 1UMBA 3AI3A 4BDTA 5I7VA 2C42A 3GFTA 1Q0SA 4L16A 1RRCA 5JSFA 4W6QA 3AR9A 4LJAA 3SQMA 4DABA 2ARKA 3SYRA 4ZK6A 4WBXC 4EG5A 2JAHA 2ZRFA 3I52A 2MSWA 2NMVA 1MTZA 2YRFA 2C4VA 4WEOA 1H6BA 2VHZA 5C8YA 2FSVA 2VT2A 2X86A 5FADA 4EM6A 3BMNA 1PQUA 2OFXA 4QG7A 4RE6A 5KNBD 3PNMA 3ZI4A 3CC8A 2WJGA 3CN9A 1JG1A 4BVLA 1IOWA 4A8PA 4HVAA 2DPYA 1GRQA 5AI4A 3ZKAA 4CQLB 1OAKA 3O94A 5KYKA 1Q74A 2QPTA 2E4ZA 2FPUA 3R2JA 1NJ1A 4S1OA 5D5HA 3OQHA 1J2JA 2OCDA 1XTSA 5I7UA 1FNBA 3WNZA 1KMIY 5AM5A 5B2EA 5KNLA 2FFBA 3BQ9A 4OHYA 1F8YA 4I50A 2UUCB 2QLMA 2BGKA 4AG3A 5LZ5A 2HSWA 4QA9A 3NTLA 1M1NA 3ZW7A 2VPXA 2CNWD 3M4YA 1MAWA 2A92A 2PUGA 4QULA 4NSNA 4O4IA 5AJZA 3ZV6A 3B36A 9ABPA 3Q8LA 1L5HB 4JL6A 4LKOA 1BS2A 2PX8A 5DSTA 4MQEA 3S5UA 1NXSA 4A3SA 1IG0A 4FU0A 5IFKA 3GAZA 1YOVA 3DFMA 3P5SA 1HOXA 2LCIA 2F4NA 3DAHA 4DNXA 4UKDA 4WK2B 1QIGA 2QMZA 3F0TA 3TI7A 1S0UA 1J8QA 3EVFA 1BTOA 1Z15A 1B3RA 4OHFA 1H2YA 1PFVA 4W5TA 5IEBA 4RFVA 4HDRA 1NUUA 1TNDA 2E2WA 4GLJA 5K6RA 2FA9A 1BW9A 1N6PA 2BZSA 3I23A 5KNCH 4UVDA 3SX0A 4HDKB 1U8YA 2WIKA 3HXMA 3W7AA 3UCEA 3BJEA 5IDQA 2IZOA 4JJEA 4BEJA 4FGSA 4TMYA 1UP6A 3QSYA 3O8LA 3RS0A 4RD2A 2BLLA 3KG2A 1SBHA 2ZT7A 4MJXA 4X92A 3CUVA 1EDOA 5K8UA 2P9CA 3PEWA 3O8DA 4QXRA 2BGMA 3RVOA 3ZYCA 4F86A 3A4VA 3RYHA 1CWUA 3CPHA 4TL7A 3QEBZ 4DV5B 3GLQA 5FUXA 2OMEA 4GT1A 4HVLA 5BT9A 2VF5X 3FJ1A 2J9ZB 5EKSA 4DJDC 1B0UA 1MX1A 1NHWA 1WXXA 2UVPB 3C7TA 3G17A 5K7SA 5KU7A 3AF1A 2BI7A 2F48A 4WKPA 1VPTA 1C3JA 3QEKA 2PS9A 1JQ3A 3RQSA 4UVEA 4B17A 3WL4A 3A7EA 3B3AA 3N53A 3IIKA 1Z9BA 3K0CC 4L9WA 1P80A 3VOBA 4BB9A 2C82A 2QN2A 2OXRA 4QU0A 1XP8A 4YJHB 1WU8A 2D1YA 3VC2A 4DGSA 3MWKA 1FFSA 2W6JA 3BCUA 1MVOA 5F1OA 3EGCA 4TYNA 2V9CA 3G1TA 4X8LA 1MFPA 5JMPA 3BMCA 1F17A 1GDDA 2B25A 2EWMA 1YL7A 3RO7A 3RFXA 1ODTC 3EUFA 4EFMA 3WFZA 1NASA 2VJKA 3E8SA 2F43A 3KB1A 1P2TA 3HU3A 4AO8A 5LP6F 1QFZA 1EUDB 1U7TA 1K7FB 1LRLA 1ZITA 1OI2A 3H2BA 2C1ZA 2PGAA 1OLUB 1RI1A 1CZOA 3IBCA 4EKNB 3BXXA 4MVJA 1T8PA 3NFRA 2X76A 1U28A 3MERA 2VPZA 1U2DC 1CXZA 4MQFB 2XE4A 3ZHQA 3QKRB 1KMHA 1H0SA 1N2HA 5I9BA 2XSZA 1R0YA 2B1RA 5TB5A 2Q9CA 3RUIA 1QYDA 5ICEA 4DCPA 3WBBA 3TI9A 2QUJA 4LHVA 3FSEA 3X1WA 3O1IC 1YRBA 4C2AA 1RWKA 5JZ9A 4G9GA 4WESA 4JI1B 3KKQA 3E8XA 1PJQA 3NHRA 2OFFA 5CIYA 5FPTA 1KZ4A 2PWPA 4R2JA 3KV1A 3QPAA 3RJ9A 3VPDA 4MI3A 4XYMA 3K31A 4F9TA 2RAVA 4CM9D 4C21A 3L6OO 5DHUA 1ZM3A 3PNQA 6ADHA 1YRYE 3NP9A 1NR5A 4DQDA 3EZ9A 3KJGA 1PDOA 2IPAB 3G13A 1V25A 3K8YA 4K9PA 1JJIA 4IV0A 2PCLA 3VH1A 5I01A 3O8CA 3LWBA 3HCBA 3ZJ4A 3HZZA 3HUDA 2XDYA 1EFHA 4V3CA 1ENZA 5G02A 2H2GA 3R3YA 2ZVJA 4AICA 2A5YB 2X8AA 1GFWA 1WXDA 1NL3A 2C88A 2ZRJA 1RP1A 5EI5A 3FY4A 3T94A 2GM9A 2AHOA 1THZA 3IB3A 2JGIA 4E2XA 4R41A 4UTVA 4MLDA 1XTBA 1T4BA 4DA6A 5KTKA 2QG9A 3VR3A 1L5LA 1EG2A 3EH2A 3DHWC 4N0MA 5JZVA 4TSFD 3AJ9A 4HEA6 2F00A 3VGJA 4LF9B 3ETCA 3PQCA 5BSTA 5L8VA 2CFIA 2UZ1A 5J4YA 4LVOA 3RANA 3QE9Y 2IOHA 5KYYA 3RGWS 3DOIA 2IYZA 4AUEA 2CCKA 3RU2A 4D9KA 5DNDA 1UBTS 3FVRA 4XUEA 3M6UA 1AUVA 5IVIA 3FFBA 3ZXXA 1W2WB 3D0OA 2Y1CA 2ZULA 4NAHA 1CUYA 2WF9A 1GDHA 1HRKA 2FRDA 3KT3A 4L28A 1EUQA 4A1OA 2FDRA 4DR3B 2K4MA 4DIEA 1J1UA 3BL8A 1C41A 2PH1A 4EY5A 4Q9DA 1NP3A 1TJ4A 2EGUA 2RGEA 3ITDA 3O91A 4AKTA 4YP9A 5ICMA 2HI0A 3KZVA 3V42A 2AZTA 3VR6D 4HMOA 4P33A 1F0PA 4RKQA 1KIMA 1HT0A 3DE0X 3JQBC 4W7SA 1WEHA 3OU7A 4ZOLB 4ATNA 5CA1B 5FOXA 5LIRA 4OFZA 5FI5A 4EEXA 2G7ZA 2Q6IA 2BEUB 2DBZA 5FBZA 3ZZMA 2DRIA 5EFZA 5I9IA 3MTQA 4IF4A 4CFZA 2ZPUA 4MGEA 1WQ4A 2P77A 4BNZA 4HPXB 2OP0A 2R8YA 3ND7A 4M60A 4LE1A 4CQMA 1G38A 5JS6A 3U4QA 1TMKA 4U9IS 1FU7A 2A8YA 3ASUA 4TLLB 5AKKA 1YR1A 1GU0A 5ALSA 3CTMA 3NV9A 1KI2A 4MHSA 3WTBA 4WFIA 1JFFB 5KYGA 1RSZA 3WLJA 1JH9A 3B1WA 4F3YA 1T13A 1ZLXA 1B23P 1AZSC 4KU4A 3UK6A 3GRKA 4GFDA 4UM9D 2OOSA 1X0VA 3MUOA 4FSDA 4K5QA 4FSHA 1KPHA 1SQ5A 2JLRA 1KDYA 2WUWE 4JVNA 4YMTA 3F9RA 3VR5H 1D4ZA 1WMAA 2B4RO 3DVAA 3WRXC 2PDAA 3ZI0A 3EVTA 1YA6A 1YHYA 5EQFA 4MV8A 4UFOA 4YS6A 3KETA 1U9IC 5EZYB 3PCRB 3VSEA 3EZ2A 1SZCA 1X7ZB 2B8EA 2XF8A 1B93A 4TVSA 2YWEA 4FT2A 4LRSB 1HWYA 3N2KA 4ZAXA 3VDRA 1YZHA 1Q20A 4GYYA 1S3FA 1KI6A 2PSFA 4EX6A 2BGJA 1EX1A 2A9OA 2E4VA 1OWPA 2NX2A 2NZYA 3OT5A 4AY5A 1GJRA 1P3DA 4KN8A 3ADKA 2GRUA 1YB1A 2YN4A 2OSBA 1CJSA 3TEFA 4NXNB 3L4BC 1P7YA 1Z2PX 5DJ5A 2GOYA 1JQEA 1KO8A 1ZD3A 4DJFC 2I62A 4RJTA 4I9GA 1WXFA 3T7JA 4EW1A 5GZ6A 1YFKA 4F45A 3OLCX 3RHSA 5C1BA 1QDUA 2W2TA 1XYGA 1IBCA 4H7FA 4YGYA 4QXPA 1LGYA 1F60A 3B9PA 1S2IA 1R4MA 1DLJA 4IX9A 4I4TA 3BK1A 3RVQA 4YRKA 1NZFA 8AT1A 5E6RA 1HQDA 3RUFA 4JWTA 1ZG3A 2XGMA 3QX9A 1NVXQ 4BZXA 1A27A 1R8SA 1QAQA 1JA1A 2CNLA 2DTEA 4YJDA 3S1AB 4E5MA 2XRZA 4TYYA 1KEUA 1IXKA 3R1IA 1DLIA 2D2FA 4JLAA 1Z34A 4KUGA 3UKJA 4Y6GB 1HNXB 4C5BA 3PNLA 5EUCA 1EK6A 1QQBA 1A7AA 4RK5A 1LPOA 3O4HA 2FSUA 1MC5A 1VA4A 4ZMBA 2XD4A 3KNZA 2CXPA 1V5FA 3DFKA 2WZDA 4PBSA 1CC1S 2GJAA 3H1GA 4S0ZA 3A25A 3RAGA 1PWHA 1UKBA 3NUZA 4E5YA 4EABA 4H7IA 2GK4A 1NOJA 2JCBA 2YZNA 2PKWA 3E82A 5A4FS 3ZJ5A 4J49A 4EG6A 3ELWA 3MYYA 2NO9A 5JE8A 3BZBA 4JD5A 4UOEA 2N0SA 3IURA 4YRGA 2CC2A 3OFNA 2BUAA 3DMNA 3W05A 3IPAA 2C1EA 4MQ5A 4PZ0A 1U2PA 3ETHA 1ADGA 1MZVA 2R5FA 2XBLA 3TTUA 4KAFA 4REQA 4RTQA 1MO5A 3UAOA 4BNFA 4GM4A 2NUPB 4LK3A 1QV7A 1PIWA 1VB3A 3LP6A 3AJ8A 4ICIA 3TD2A 2YN0A 5IKMA 3DAYA 1FSZA 3OJWA 4OA5A 5JY6A 1QVAA 4KE8A 4QELA 1EX9A 4LJLA 5A3RA 4JH0A 4FUQA 1GPKA 5DNAA 3S2FA 1AGRA 1TYDE 1X7YB 2HRDA 3IJ5A 4M4SA 2VJBA 5EZQA 3I1IA 2EQ5A 1NMSA 3DCIA 3WLFA 1DMRA 1IQRA 2R8RA 2R68A 4YHBA 4AP9A 4F04A 3AG6A 3TFWA 3QE0A 1FP4A 3DWEX 2WWHA 1MU0A 3IIIA 3UC9A 5AKJA 1VL2A 1E9VA 1CPYA 1VMKA 1LLQA 1T5DX 3NNDA 4CV1A 1EK5A 2L82A 5IBQA 4F0JA 4Z2AA 1F8XA 4MB6A 3REOA 5CITA 4Q02A 3L40A 3A4NA 5B1IA 4FSXA 5LU9A 4MSUA 4TV9A 3USCS 1RC0A 2RGDA 2IYLD 1TL7C 2EJCA 4L3VA 5JSKA 2FSPA 2H2IA 3U7EB 5KJCA 4Y2SA 5D85A 3H84A 2WWXA 3VPFA 1MTOA 3IAS6 2WM9B 3IP5A 3V8RA 2LD4A 3ZQKA 1USVA 1R8YA 3CSUA 3FJYA 4AI6A 5JPIA 3NHZA 1SXJC 4UTXA 1FMCA 1LXCA 5TPZD 3ZH9B 2JKZA 1NI4A 2RGGA 5KTNA 1QNFA 4CCAA 4TKMA 4Q34A 2XKKA 1GEGA 5HE8A 1ORDA 1SC1A 3T7TA 5FBQB 3AVPA 3P45A 5AIAA 3U9TA 3NOQA 4F7DA 2M6KA 3TQCA 2X6TA 1BVYF 2PYIA 4K6FA 3IDQA 4CFYA 1CEXA 4TS4A 2UKDA 4US0R 1C9DB 2PGDA 2JBAA 3OJEA 3ZY2A 3M70A 3KDSE 3EA5A 1CRLA 4Y1EA 1PGQA 5DM1A 5JI2E 4KYTA 3PF8A 1E77A 3WHKA 1ZESA 2QNRA 3E5RA 3FTPA 2RB4A 1Y9ZA 4ND8B 4P4SA 1U7XA 3CVXA 2JHAA 1K66A 2VDKB 3AL3A 4C4AA 3B52X 2P69A 2EL9A 1KMMA 4YRQA 3VYVA 2HK8A 3N2GB 1XJCA 1XLVA 2MCFA 4Q4HA 1C7IA 1TADA 2JLUA 4KAAA 1PJ4A 2Q0HA 5E3IA 1A5AB 1IONA 5EUBA 1RAIA 2AW3A 5HGXA 3FSRA 4BP3A 4R8SA 2QTTA 1GGVA 2GPSA 3HB9A 3QLTA 5BNTA 2F62A 2WJHA 2WFLB 4MUHA 4ETMA 1XU4A 1GAQA 4AKSA 4DANA 2OFPA 1JSCA 5IC6A 5JD3A 1D8AA 2YV5A 3RVPA 1TO6A 3N2NA 1DJPA 4CKWB 4RFSA 4XUCA 1ZVKA 4IIJB 2V7VA 3NYRA 3PBKA 1P5FA 3WO1A 2RH8A 3BRSA 1JXAA 1QXSA 4ENWA 2JFQA 4JC0A 1WZNA 5H9VA 2IOQA 4PZLA 3TDKA 1X1BA 3JWEA 5ALPA 1OV4A 4M22A 4YUYA 2J32A 3UTDA 2AE2A 2SCUA 1GFIA 1USIA 2FPIB 3BKXA 3I6IA 3LPLA 2HO5A 1XVTA 3ONDA