1GGVA

Crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C123S mutant of dienelactone hydrolase (DLH) bound with the PMS moiety of the protease inhibitor phenylmethylsulfonyl fluoride (PMSF).
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords DIENELACTONE HYDROLASE
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ggvA00
1D07A 4RNCA 5AOCA 2G5TA 1CQWA 3A6ZA 1TCBA 3IURA 4B9EA 1ORWA 4X3CA 1XZMA 3O0DA 4BTVA 2GBIA 2WQZA 1DWQA 4TVKA 2NW6A 4OUKX 3H2KA 1JFRA 1CUGA 2QMQA 1U65A 1MT3A 3X3HA 2OQVA 3OM8A 3F98A 4BZWA 4HXEB 1CLEA 4ZWNA 3WI7A 5YASA 4IH1A 5IVDA 5IVHA 2QXUA 1T2NA 4G8CA 5LZ8A 3FYUC 3OOSA 1JKMA 4M0FA 4BE4A 1AUOA 2C7BA 4BP8A 2RI6A 5AI9A 1ZICA 1R50A 3I2IA 5EHZA 3K9BA 4FFVA 5CXUA 4EY5A 1LZKA 5ALUA 3DOIA 2XUJA 3T4UA 3GROA 4UHBA 1QJ4A 5ESRA 1C7IA 1CUAA 4BZZA 1RP1A 1XZCA 2XUAA 1VZ2A 1WM1A 4JNCA 3W06A 5C81A 3H19A 1VA5A 5HF6A 4H7EA 5A7FA 5T4FA 3FYUA 3LLCA 3AZPA 4BAUA 4CIBA 1BCSA 3BIXA 1EH5A 1XKTA 1IZ7A 2CB9A 5IVIA 2VSQA 1WPXA 3OC0A 2HIHA 2WHRA 3F8SA 3VKFA 3I6MA 1MNAA 3UUEA 3W05A 1AKNA 2PU7A 1XRNA 3HJUA 3KXPA 1QIHA 1VZ3A 1AMNA 5ISMA 4ARBA 4BVJA 1WB4A 1Q0ZA 4N8DA 5ALKA 1EINA 3G9XA 4U2GA 5EIAA 4Q82A 3AZQA 3DEAA 5D3KA 4BRSA 2ZSIA 5DYTA 3WKAA 1A8UA 3I2KA 5C8XA 5FV4A 5CRIA 4UBJA 1LZLA 5JIBA 4IH9A 1GZ7A 2RHTA 1YCDA 3VVLA 4KYVA 5CTAA 4IHAA 2XMQA 3FVTA 2QUAA 5LKAA 1DX6A 2EEPA 5CMLA 2XMBA 2XB6A 2O2IA 4X95A 1QIDA 3R41A 4Y2UA 2WU3A 3LCRA 1K63A 4HZGA 3DD5A 5K3DA 1O6FA 2XUOA 4HAIA 2VAVA 2WJ6A 2QUBA 4C89A 5EHQA 3L1IA 2XMSA 1Z68A 1MAAA 3SK0A 2DQYA 1E8DA 1GXSA 3PFBA 2WM2A 3FOBA 1XQWA 2H9YA 3G8YA 3R3VA 3B12A 2XQGA 2AXEA 1FFEA 1BROA 1VOTA 4UBNA 1X2BA 5A2GA 3BWXA 4BRZA 4WFJA 5CXXA 1CUSA 5IVKA 4XJVA 3C6XA 3HXKA 2HL6A 2XUPA 1LGYA 4J0JA 3STUA 4C01A 4QWWA 1CFJA 2WIJA 2DQZA 3AIKA 4BCDA 4D9JA 4Y7DA 4GDMA 2HA0A 3F96A 3BL8A 1VXOA 2GZSA 4FTWA 3KWFA 1ZD5A 3BJRA 2WFLB 1J2EA 4W63A 1CUCA 2WIKA 5ALRA 2OCKA 4U2FA 4W1PA 2R11A 3EQ8A 4OSEA 4DMCA 1WB6A 2I3DA 2CJPA 1C4XA 1BU8A 2QR5A 5CT6A 3WKBA 4U2CA 3FCYA 3FSGA 2XUFA 1ZD3A 3G0DA 2QJWA 4AB1A 2Q0XA 4I3FA 1KU0A 3WK5A 2WTNA 4MQMA 4S0XA 3G9ZA 2WIFA 5ALWA 2BJHA 2PSEA 1R3DA 2BFNA 5HK8A 3F9CA 3FLBA 3N0TA 3UMJA 4P93A 5EHNA 5HKAA 1TAHA 1HL7A 3ZLTA 5CH5A 4W1RA 1BN6A 2XUQA 1FJ2A 5AHXA 4BP9A 1IUNA 3OG9A 3IDAA 4X7BA 3ZLUA 3AILA 1F0PA 4H7DA 2O7VA 1DT5A 3H17A 4FMPA 4G4JA 4UHDA 1F6WA 1CUWA 3WL8A 1YS2X 1CUYA 1OXMA 3FWHA 1EDBA 3G0IA 2C5FA 1LPBB 2CUTA 3DOHA 2VT6A 5LYYA 4MJ3A 5HKBA 3IBTA 4CIAA 2VTVA 2WG1A 2GYVA 1N5RA 4UBKA 1ZIYA 3H1AA 3BDVA 4O08A 1UK7A 2IITA 1JU3A 1VLQA 4W1SA 2ECFA 2XQJA 1XLVA 5AH0A 3FBWA 3R3UA 1QIJA 3PI6A 1B6GA 4IQ4A 4Q3LA 4H77A 2WHPB 4XVCA 3SC2A 4Y2RA 4WCVA 1ZIXA 3YASA 1WHSA 3G0CA 1QOZA 4QDOA 3DCNA 1O6GA 4U2EA 5JAPA 1W1IA 1MJ5A 4WDRA 4CG2A 1SCKA 3WJ2A 1XZEA 3AJAA 5AKHA 3BJMA 3I2JA 3ESDA 3V1NA 3U0VA 2OCGA 3I1IA 4DNPA 1XZAA 4BDSA 3ZLVA 2J3QA 1J06A 1E8NA 3AFIA 2JGLA 2HA5A 4C4ZA 5A7GA 5ALSA 4FDMA 1MTZA 2WG2A 4H7JA 4UBIA 1WOMA 1UK6A 4Z49A 3S2ZA 1CQZA 3U1TA 4AQDA 5LLSA 2WFZA 1IVYA 4LYDA 3O4IA 1XROA 3WYNA 3M81A 3WKCA 3O9MA 3Q0TA 4MEAA 2PBLA 4Q05A 4QDTA 3SWWA 3OTQA 3C70A 2PSFA 5C8ZA 1R4ZA 3EQ9A 4U2DA 4EA6A 5JYCA 3STVA 1QGED 3GA7A 1SOMA 3C45A 4X94A 4XX1A 3QPAA 4J3JA 4HRXA 4KEAA 4UFNA 2JEYA 2JGMA 3I1YA 5AK5A 2DHEA 1JJFA 3WWEA 2XQKA 1LPAB 5E4YA 3HACA 1DQZA 4K6GA 4F21A 3ICWA 5JAHA 4X00A 1LPPA 3PFCA 4AMZA 4EHBA 5HQ3A 4QNNA 1ACLA 3D5EA 4I19A 1T4MA 5ALTA 3WK8A 2Z3ZA 4G8DA 5K3FA 3FSGD 4FLFA 5T4BA 3Q8WA 4FKBA 3RARA 4QDUA 4PF1A 1USWA 2BUBA 5JAUA 4A5SA 1LPMA 3TRDA 5AI6A 3WQHA 2JIDA 1N1MA 2HFJA 1WPRA 2AJDA 3FYTA 2CMFA 4LKOA 5EGNA 4GW3A 4W9RA 4MEBA 2QTBA 5E4TA 5JATA 3CN7A 4UHEA 4KE9A 3R3WA 4QE3A 1SCQA 2ACKA 5LZ9A 3MUNA 3LIIA 1LPSA 1UOPA 1MAHA 2QKYA 4QDZA 2WG0A 4G5XA 1CUVA 2WU4A 2ONCA 4J0CA 5HFNA 3CN9A 5AKIA 1YA4A 2WUDA 3C8DA 1IUPA 1HLGA 5I7UA 4GHWA 4Y2TA 4QDXA 5JZ9A 4ITVA 5LKRA 3GUUA 4J0DA 4BBZA 2XUGA 1E8MA 1UK9A 1MX1A 2H7CA 3D3NA 5ALDA 3OPMA 4MYDA 1QIFA 3V48A 1NU6A 5JANA 4RPCA 1XZLA 4KE7A 2G63A 2XI4A 4Y2XA 3V9AA 5ALHA 4UHHA 3WYDA 2JEZA 5AOAA 4WY5A 1GPLA 1CUIA 4G4GA 3WK7A 1VXRA 3WK6A 4QLAA 3DDUA 1THTA 1DINA 1PV1A 2O7RA 3G9UA 3DL4A 3C87A 4DYHA 4DSZA 1OILA 3ESBA 3HRHA 1P0QA 3DYIA 1E5TA 3W9BA 1BN7A 4H7IA 2XUDA 3WL6A 4E14A 2DHDA 4C6HA 1JU4A 4LHEA 2VATA 2BUCA 5FLKA 4B80A 5ALFA 4E46A 2K2QB 5AICA 2FUKA 4ARAA 4N5HX 5CURA 1N5MA 4JYMA 1JJBA 2BUAA 5JD5A 2BKLA 3C6YA 3RK4A 1F0NA 4G8BA 1HPLA 3STWA 3D2AA 2GBFA 1UOOA 2V97A 4Q1VA 4X85A 4C4XA 1L7QA 2HA7A 4WJLA 1CUZA 2PPLA 5AOBA 4OD0A 4UPDA 3GELA 3WLAA 4EUSA 4BDTA 2C4HA 1XLUA 2OXEA 3GZJA 4BYMA 5HF9A 4I4CA 1W75A 3WZMA 5AKGA 1EB9A 5A7HA 4UBLA 1SC9A 1LBTA 2D5LA 2WUFA 2JGFA 3I2HA 2WUEA 2XMDA 5LZ7A 1W76A 3P2MA 1QO9A 1CUJA 2E3JA 4KE6A 4AZ3A 1GPNA 5KWIA 2V96A 2HADA 3HZOA 3W9UA 2J4CA 3HEAA 3QH4A 2WIGA 1Q84A 4AZ0A 1VE7A 2ZJ6A 4YX9A 3R0VA 1UFOA 3D2CA 2XDWA 4CCYA 4GWLA 5AM0A 4X6UA 1IZ8A 3F67A 1QONA 1W52X 2QS9A 6YASA 2Z5GA 5HFAA 2YXPX 3G0GA 5AM5A 5HF5A 1WHTA 5DTJA 1U2EA 1K8QA 2C0PA 3O4GA 5SYMA 5C8VA 4FNGA 4INZA 2PVSA 1RYYA 4YK7A 2O2GA 1VA4A 1YR2A 4L72A 4X6YA 2V98A 3M82A 1CEXA 4DIUA 4K5QA 1XFDA 4PV7A 5F4ZA 3NWOA 3WIBA 5AO9A 2WJ3A 2B4KA 4OU5A 3D2BA 5K3AA 1ZI8A 2Z3WA 1SCIA 1YAJA 1UKBA 1Q0RA 2RGUA 4NS4A 4V2IA 5LZ4A 1ODCA 2WIDA 2YASA 3QMWA 1E66A 5JZBA 2B61A 1AX9A 4QZVA 5FUMA 4G1FA 5H3HA 4F5ZA 1R88A 1UOQA 1EDDA 5AIAA 2HM7A 5EHXA 3W04A 2XMCA 5K3FB 4AXBA 2RAUA 1H22A 4TPKA 1R1DA 2PSJA 2QXTA 4DM7A 3QM1A 2HU5A 4LIPD 5JARA 2WHPA 1MX5A 2WJ4A 4BTLA 4GI1A 4AN0A 1UK8A 1AC5A 5ALPA 5AK4A 5AKLA 4AN1A 1TRHA 4DNFA 2ZYSA 1AURA 3WA7A 3WKDA 1C7JA 1CRLA 2JGJA 2HU7A 3VDXA 5AI4A 1J1IA 5ALGA 5CT4A 5DTIA 2OLEA 1SFRA 1QIIA 2HU8A 4ROTA 1H2XA 3L1JA 1AGYA 5DJ5A 4N5IX 1K5PA 4Q3KA 4QLOA 1KEZA 2HHAA 2X5XA 3N2ZB 3FCXA 1KU6A 2WFLA 4X97A 1YSCA 2VEOA 4C4YA 1DQYA 4W1QA 4C88A 3G9TA 3AUKA 5A6VA 5LP1A 2PKYX 4WFIA 2PUHA 1MNQA 4H35A 2OCIA 2YH2A 5LZ5A 3OURA 4F0JA 4P08A 3BF7A 4JYPA 5HQ3B 3M3DA 4DGQA 4PW0A 2GBCA 2XUKA 4GEGA 1DTEA 3W2TA 2Y6VA 2OAEA 5EIEA 4ZXFA 3C8HA 1TK3A 3DKRA 2O2HA 1DWOA 4OB8A 2WKWA 2HA3A 2XE4A 3VISA 1A88A 2XUHA 3NUZA 5DNUA 1FFAA 2DHCA 2ZYRA 2RONA 1B41A 4WFKA 3ZI7A 3ESAA 1CIJA 1WCYA 5AKZA 3QMMA 3M83A 4J03A 3FAKA 3QMVA 1K6EA 2JGEA 2ZSHA 3JWEA 4Y2SA 3SX4A 2XLBA 1CUHA 1Y7IA 2OGSA 2DR0A 5ALNA 3HI4A 2EDCA 4Y2QA 2WILA 2XMRA 1PFQA 4Y2YA 2CZQA 2ZJ7A 2PSHA 5ALJA 1DX4A 1Y7HA 3TJMA 1PJAA 5JASA 1X2EA 3FLEA 4K6HA 3WWOA 5AI8A 4MQLA 4X93A 1BE0A 1R9MA 1S8OA 5AI0A 3D59A 4MWTA 1VJ5A 1DT3A 1A8QA 2DCMA 3CCCA 5CH3A 4GECA 5JALA 4JEIA 3LIPA 4WY8A 4YPVA 1EVEA 2OQIA 3HLKA 1EK2A 4EY8A 4U2BA 3H04A 5K3CA 1CR6A 2IX9A 1JJIA 2DSNA 4KRYA 1YASA 3PDCA 5J3JA 3EQ7A 4H7HA 2Y6UA 1HDEA 1ZGCA 1ZI9A 4A23A 5EI5A 1MU0A 3K6KA 5E2IA 5K5EA 5FRDA 1XLWA 2QJRA 5A62A 2OG1A 4B83A 3D0KA 3IUJA 2VAXA 4J0GA 2AJBA 3HABA 3LS2A 2FX5A 5HK9A 5DNWA 3ZV7A 4NMWA 3NOXA 4CFSA 5FPPA 1GQSA 3H18A 3VJLA 2UZ0A 3O9VA 3ANSA 3BF8A 4AMYA 2Z8ZA 1QLWA 3R3ZA 5AM3A 4NVRA 4B6GA 5AM2A 3R3XA 4HVTA 3ED1A 4X6XA 1XKLA 4PQEA 4EB0A 3IUQA 1RWQA 4B7ZA 1FSSA 1QFMA 2I78A 3EBLA 4B85A 5AK6A 4BATA 4BC1A 1F8UA 1YS1X 5LIPA 3QYJA 2ACEA 2XMZA 1HBJA 2CEKA 4UBOA 5ALYA 3I2GA 2BGNA 4K6KA 1UT6A 4ZV7A 3G0BA 2H7YA 2ZVDA 5K3EA 1QIMA 1HQDA 5AKXA 3K2IA 2ZYIA 4TGLA 4X71A 2VQ6A 4RE6A 1XZKA 3V1MA 1G66A 5D7BA 2YYSA 5DWDA 3AIOA 4B82A 1QFSA 3O95A 3DNMA 2GBGA 5FKJA 2WHQA 5I8PA 1XQXA 2FJ0A 3WWDA 4HS9A 1EHYA 5JADA 1MN6A 5EFZA 4F60A 4KJXA 4B0PA 1ZI6A 1UZAA 3NGMA 4X92A 1TQHA 5AKEA 4FHZA 5FOQA 5CT8A 3WJ1A 3WL7A 1XZHA 4KACA 2D0DA 1CPYA 4ZRDA 3QPCA 5KBYA 2CKMA 5CT5A 1XRQA 4PSCA 4ETWA 1ISPA 4CG1A 1THGA 1AQLA 4EY7A 1GKKA 2QT9A 3HC7A 2P8SA 3WA6A 3A2MA 3C6BA 4ZV9A 5AIBA 4UHCA 3DJYA 3I28A 1AZWA 3BXPA 2ZYHA 1TIBA 4HRYA 3HYSA 4Q34A 3WWPA 3JYHA 3I6YA 1YB7A 4EBBA 3PUIA 4KAAA 1EK1A 5BWCA 3PF9A 3AIMA 4CCWA 4RGYA 3ICVA 2OCLA 1GKLA 4Y2JA 1E89A 4BB0A 4UFPA 3DS8A 5FPQA 3IB3A 2C0QA 3TEJA 1WB5A 1XRLA 3KSRA 4Y2PA 3T52A 2W22A 1YAHA 4AO7A 3IUMA 2XUIA 1IUOA 1MX9A 5HF8A 3ANTA 1UKCA 2VF2A 4QA9A 3S8YA 5JD6A 3O4HA 2XT0A 2XLCA 4WDQA 4ZGBA 4BVLA 3CCBA 3QPDA 2V9ZA 5K3BA 5AI5A 1QO7A 3B5EA 5CT9A 4UBMA 2JF0A 5E4JA 1EA5A 1M33A 3EF3A 2VJAA 2XQIA 2Y2UA 3MVEA 3QITA 4JH0A 4J0KA 3BDIA 4PNZA 3H2IA 4CCYB 4C87A 1ZD2P 2I3ZA 4N8EA 3QVMA 4OPMA 2QVBA 3G7NA 3KOOA 2Z8XA 2OGTA 5CH8A 1U8EA 3STXA 3A70A 5T4EA 1NU8A 5D6OA 2OAGA 2BGRA 3FLAA 4M0MA 1R9NA 1BRTA 3WK9A 1W6RA 1UXOA 2AJCA 3G02A 1A7UA 4LXHA 2VJBA 2VA9A 2HA6A 4EZIA 4DSAA 1BEEA 2ZJFA 5ALQA 3ILSA 3WL5A 5FDFA 3ZWQA 1H2WA 1W4LA 4P92A 3E0XA 4L9AA 4P9NA 5DLPA 4L0CA 4J0HA 3PUHA 1H2YA 3DQZA 4ZREA 4N8SA 2JGKA 2Y1KA 2PSDA 4CI9A 1CUEA 1QIGA 2J3DA 3WWCA 4G9GA 3UUFA 1X70A 2VJCA 4B84A 5C7YA 1FFDA 3H1BA 4AO6A 1OCEA 4BC0A 3MUOA 2PX6A 1XZBA 1UKAA 3HSSA 1EB8A 1FFCA 2FJPA 5BOVA 1HKHA 3E4DA 4RE5A 1LPNA 1K4YA 2HRRA 4QWMA 2J4FA 1EVQA 1LPOA 1XRPA 3I6ZA 1ETHA 3PF8A 4AO8A 2XQFA 1ZJ5A 3AINA 3H2HA 2GZRA 5AKJA 2OGZA 1CUXA 3A2LA 3KWJA 4OU4A 4PO3X 4DLNA 1P0MA 4M0EA 4E15A 3DLTA 4UFOA 5ALEA 3PICA 4XIIA 4A16A 1UWCA 4BCCA 3VJMA 4B81A 1XZJA 3O4JA 4OB6A 3ESCA 3KD2A 1CUUA 3I2FA 5ALOA 3D7RA 1L7RA 1L7AA 5ALVA 4DMKA 4BVKA 4AX4A 4PSDA 2JGIA 2WTMA 3H2GA 5EIHA 1LLFA 1CUDA 1ODTC 1QZ3A 1BCRA 2BAGA 4B9AA 2WLSA 4FBMA 2Y2VA 3D4LA 2ORYA 1GT6A 2WSLA 4Q3OA 1ZD4A 1Q83A 1YA8A 2BCEA 4G4IA 3TGLA 1FFBA 3A2NA 4ZI5A 3AZOA 1GQRA 3STTA 4LYEA 3WKEA 2ES4A 4H7FA 3IA2A 2C5GA 1JMKC 2LIPA 4CG3A 3MGAA 3C43A 2HA4A 4JUIA 3V1KA 4GXNA 4EY4A 5DYYA 1JT2A 2HDWA 4HXGA 4FOLA 3FVRA 4H0CA 5JD4A 1XQYA 4FNMA 3E3AA 4KRXA 4MYSA 4BAGA 4DNQA 5DYWA 4FWBA 1ZOIA 4OYYA 1LBSA 1H23A 5ALZA 1XZFA 3R40A 5I9IA 2RHWA 5HZGA 5IKXA 2HRQA 3B3QA 1EX9A 1QIKA 1EDEA 3KDAA 4GBGA 2GYUA 2AJ8A 3JW8A 4K2AA 5AJHA 4G9EA 4MWSA 5BV7A 3WZLA 5ALXA 1DU4A 2PL5A 1XQVA 4IO0A 2GYWA 4DMFA 4B0OA 3GFFA 1QE3A 2PU5A 4LXIA 3WK4A 1XZGA 2C58A 1P0PA 3H0CA 3IULA 4EY6A 2VT7A 2PM8A 3IIIA 5FP0A 2QM0A 1TCCA 1YB6A 3DL7A 4YASA 5SYNA 2I03A 4KE8A 5ALMA 1TCAA 1VE6A 1XRMA 2HA2A 4NZZA 5KWJA 3C6ZA 1MO2A 3WMRA 3F97A 4XWGA 4BAZA 4L3WA 4UUQA 3ZPXA 5KREA 3PE6A 5DNVA 3RM3A 1ZGBA 2WFMA 4KAFA 2AJLI 1N8SA 3RKSA 1BEZA 1P0IA 3VJKA 5FXMA 1XRRA 2W6CX 1LNSA 2RIPA 2QOEA 1U4NA 4KR0A 5ALLA 1ODSA 3LP5A 1QIEA 4PSUA 3RLIA 4H18A 1CUFA 1JI3A 4QEKA 3L1HA 3FNBA 3IVMA 4LXGA 1QTIA 4HTAA 5CBKA 2VJDA 1EXWA 1H2ZA 1NX9A 3C5WP 1IMJA 2G5PA 1QTRA 4BCBA 3BE8A 2B9VA 4HXFB 3IUNA 5ALIA 1G4HA 4OB7A 1G5FA 1ZJ4A 1I6WA 1BS9A 5AKKA 1CVLA 4OYLA 4J0IA 5T4HA 1XZDA 5HCUA 3FYUB 5BWBA 1A8SA 4Y9SA 1JMYA 2WUGA 4E11A 4DTCA 5JAOA 4H7KA 5A71A 4DNOA 4FFWA 3V1LA 5AKYA 7YASA 4OCZA 4X90A 1TKRA 3STYA 3VXKA 3EIOA 4J7AA 2JBWA 1J07A 4BE9A 5JZSA 2OPHA 4FBLA 2G4LA 3H2JA 2X8BA 1EI9A 4GLBA 2X76A 4FLEA 4DMHA 4Y2VA 1MPXA 3DKKA 1GGVA 2HFKA 2QRUA 3DYVA 3WIOA 3QZUA 4MXDA 3QBJA 2H1IA 2EDAA 5CW2A 1ORVA 3C5VA 1GPKA 5AP9A 2DFPA 1CV2A 5AM4A 3GBSA 5AK3A 1ACJA 5IH7A 2H7XA 3CXUA 2CBGA 3VVMA 5LZ2A 1G42A 1DWPA 2IIVA 1XZIA 2XMGA 4IH4A 1CUBA 1VKHA 3R3YA 5D3ZA 1E3QA 2R8BA 4KAJA 4X91A 2QZPA 2ROQA 2B20A 4FLMA 3BIWA 1Y37A 2PUJA 3E1GA 4UHFA 5AM1A
chains in the Genus database with same CATH superfamily
4I66A 3L0PA 4XFJA 1ESEA 4GOLD 5JROA 1D07A 3AJ9A 4RNCA 4E31A 4M1KA 4P4LA 4TL8A 3H11B 2BRUA 2XRYA 1X86B 3AWIA 3HSKA 4MQFA 1ICIA 3GL9A 2JI4A 4YJ2F 4B9EA 2BBWA 4C03A 4MI3A 2CZGA 3E23A 4JXKA 1W85B 1PG0A 1PJ4A 3SKVA 3K4QA 1AU9A 4CGZA 4E2YA 2MT9A 2XYRA 1MCZA 2QZ4A 4LV5B 4N7BA 1DWQA 4RPHA 5B1EA 4AP9A 1T5OA 1JH9A 2FZLA 1KSHA 1FJHA 4CCSA 1DAOA 1RHUA 3LHKA 3M1IA 3L82B 1UBJS 3TKAA 2TMGA 2W2NA 2AEJA 3KQSA 3CW8X 1JFRA 1VCOA 3P9ZA 4O33A 1N1GA 1JPNA 5EZYF 3LT0A 2VJKA 4L28A 3ZWAA 2YJ3A 3VHQA 3AVPA 3DA8A 3K6JA 4QPJC 1X1SA 1GV1A 3UCXA 2FA9A 4XJSA 3P52A 2E87A 3X3HA 1KO8A 2FPRA 3RSOA 5EXTA 3VBCA 3CRQA 3JQPA 4DCJA 1LSOA 5HIIA 3F98A 4ZOLA 4LXUA 1JE0A 4AICA 3GVHA 3JPYA 3TQSA 2FFBA 3WI7A 4CIXA 6ABPA 3X2SA 3RYCA 2BMWA 3PWSA 4Z99A 5D2CA 1HDGO 3E8XA 3R0ZA 1ZN7A 5LM3A 1RMQA 5IVHA 2QXUA 3E22B 4QXRA 2IUTA 1V4NA 3GYGA 2Y1GA 1JQAA 3Q4GA 1OJ7A 2WYOA 5LZ8A 4E6PA 3D31A 3FYUC 1TEXA 1JKMA 2ASEA 2E48A 2J5BA 2ZS7A 1ADCA 4WEQA 4BN0A 4BE4A 3ABIA 4BO6A 5L3SA 1C2YA 1PTJA 1ZYUA 3DAOA 3FVVA 3OTHA 2PN1A 5T41A 1VJRA 2WPNA 1NW9B 1VIDA 3F5SA 1R50A 3I2IA 4K8OA 2HRDA 3K9BA 4L9RA 4NARA 1QGDA 5CM8B 3TTXA 4NWIA 2JRLA 2GJ8A 2DY1A 2YWBA 1VKRA 3HBNA 2ZB2A 5EHIA 2CDNA 2AS0A 4XSVA 1SZCA 2BBSA 1AXGA 1G7TA 2IY9A 3E03A 3SHFA 4C5CA 5AOVA 4UHBA 1OX6A 4K40A 1I6LA 4BEWA 2VYND 5CD1A 4BY9E 2Q2NA 4MQEA 2PMEA 1C3OB 1P4GA 4CM3A 5CBPA 4HNHA 4NK5A 1ZA1A 4BJ6A 2CDRA 3BERA 3NUQA 3IT3A 1RP1A 3LCUA 3O73A 4RKRA 2ZTMA 4Z86A 5ETJA 2ODNA 2JLVA 1NVXQ 2FK7A 3IPAA 2RHHA 4JNCA 1EZ4A 4COOA 2F00A 3GRVA 3K16A 1IJFA 1KDVA 5LNK1 5T4FA 2XVAA 4ZC8A 2PWPA 3W5HA 4PGFA 4ZK2A 4HNUA 1T2VA 1GILA 1Q22A 2HJGA 2VAPA 3DF7A 3GRYA 4U8HA 4BAUA 5A0TA 4JS0A 4ZI7F 3EUAA 2RHCA 1DL5A 4LX8A 3H8JA 3KSMA 5HVNA 3RH0A 5H68A 2JFBA 1PZGA 1FW6A 3NHRA 3SNHA 5K0ZA 3CEPB 5TY0A 3KJQA 4P82A 4BLPA 4OHPA 1QNFA 2R6ZA 2V4UA 1JYFA 1K86A 2ZU6A 3TD9A 5JRDS 1WPXA 2RC6A 1L7EA 1RYBA 3DV0B 3HXLA 3OC0A 5EMHA 1WDKA 1UXGA 4MRMA 1UMCA 5EXDA 2QRZA 3F8SA 1N8TA 2X77A 4LEIA 3Q9SA 3MSXA 3WO1A 3VZCA 3I6MA 3EVBA 4KSCA 1K9SA 1CJKC 3W05A 1V11B 3Q72A 3TTTA 5K03A 2OLJA 3B48A 3LP6A 4JI1B 2PU7A 1FUUA 1XRNA 2YJZA 1IZ0A 3REQB 1YRBA 3SQLA 2J7PD 4RULA 3DHEA 3MOSA 2GS9A 2LBPA 3IE1A 3TWOA 5H4GA 3DE2X 4W99A 1QIHA 1DKOA 1BHSA 4INOA 4CMHA 4FGSA 4BVJA 4L95C 5LR6A 2KE5A 2WJAA 3PJGA 3GY0A 2G9QA 5DI3A 1WB4A 3WGHA 5BR7A 3BBLA 4N8DA 1AG9A 2EXXA 2Q2QA 3HKCB 4YO7A 5AW0A 1ENYA 1G6KA 4U2GA 1L5MA 3RHZA 3RT1A 3PQ3A 2X2EA 3F9IA 3NM6B 1I4TD 1R8QA 3AZQA 3DEAA 3L6UA 3FMGA 3KX2A 5CG2A 2O19A 1DC7A 4MP6A 2EIXA 5DYTA 2R6DA 2GJAA 1WKCA 2WIBA 2GCGA 3HKBB 2FK8A 4KWHA 2BFDB 4ZQCB 4F6CA 4ALIA 1FVXA 4NYIQ 3ZZ1A 2ANCA 2ZBDA 1T8PA 4RH0A 5AUQA 1JA1A 2GPJA 1EM8B 5BQOA 1NNSA 1LZLA 2VH2A 2AHRA 3BKWA 4OQFA 4R8RA 3ZE8A 4L4UA 3EE6A 1SD2A 1SHZA 4BKUA 4CMGA 3WDSA 1RRVA 4IH9A 1GZ7A 2RHTA 5JFGA 3VVLA 1X7YB 3LQFA 5CTAA 4KGDA 2QN2A 4ZVLA 3UJDA 4E4YA 2Q07A 4QPNA 1JVSA 1FP1D 3OP1A 3ICOA 4EGSA 1YUBA 2GBLC 3NHKA 3KR1A 3PX7A 4O4IB 4EVRA 2UYYA 4BFVA 2XMBA 2AD5A 1LC0A 1JFSA 1R5JA 2AYYA 1E6MA 1V47A 2VP3A 3EPPA 3SEQA 4DIDA 1QPZA 1NGSA 1SVWA 5DTEA 1QIDA 3TLXA 3I3OA 2Z2IA 4BWGA 1Z4MA 4P4NA 4EYQA 3FOAA 4XR9A 3VBEA 1EXNA 2WU3A 3LCRA 5LQRA 3DD5A 4FU0A 2XNDD 5IZCC 5K3DA 1D4OA 4L5IA 4HAIA 3BC1A 3AHGA 4IOKA 2VAVA 2QUBA 4I99A 4RMGA 4BJHB 4DB4A 2GLTA 1E18A 4FUQA 1IE3A 2XMSA 1Y34E 4OXXA 2MSCB 3V2UA 1UADA 3QE3A 3JX9A 1KI1A 2EP5A 2O52A 2AUTA 3RC9A 1E0AA 4DPLA 4RNDB 4RJJA 3T9BA 1JVNA 1VMDA 3TNJA 3R3VA 2H9YA 1XLTC 4QUKA 1EHCA 4U6SA 3ZD7A 2EGUA 5JNLA 1G41A 3UENA 2GCOB 3B12A 3EOBI 2H65A 1I10A 3PR2B 5HX7A 2YHIB 1BROA 1R6DA 2MTBA 2RHJA 2WSIA 2Z95A 3C3YA 4Y9UA 4UOZA 1ZPDA 5AVSA 1I94B 4CWAA 1KXJA 4KR7A 1P72A 1RQNA 3CINA 4DJ5X 5A2GA 1U1FA 1J25A 2BR5A 1EJ6A 2QG4A 1B42A 4TV9B 2ZUTA 2HLDA 3IKMB 3MS2A 1VCMA 4NPCA 4BRZA 9LDBA 4OH7A 4ZOBA 4MVJH 2VBGA 1YZ3A 1URPA 4R2MA 5TEWA 3GLGE 1ONPA 2R4TA 3JWPA 3PNBA 4PHGA 5CXXA 3OWOA 3T7CA 3MW8A 1FX0B 3TTWA 3K5PA 3H8WA 2IOHA 2WJJA 3EEIA 2GRUA 1DHTA 2OBBA 2Q49A 1JAYA 1WMBA 2EJVA 2PWZA 2EZ8A 3KUKA 3SQOA 3CG4A 2X9NA 2OK7A 3HXKA 2D2EA 2G06A 3GEGA 5EN4A 3SZLA 3R8XA 1AHPA 3THWB 4JI7B 2F8MA 4J0JA 2IEDA 4NBSA 1CFJA 1V3TA 3E5HA 3PS9A 4LC0A 3OESA 1RMTA 1C0IA 1D9XA 2VKQA 4HRVA 4FHFA 3OQ6A 2DQZA 2FR1A 2NZXA 5JAIA 1U2DC 3TVTA 1JW9B 2QG9A 4ZRMA 4PCLA 4J07A 4S2EA 1DIRA 5IABA 1YF3A 3EGWA 1EFCA 3RUIA 3FKSA 2LIVA 2IWHA 1M5TA 4EFMA 1U63A 2JJ1D 3N2GA 4N12A 3EVTA 4YLEA 1WXWA 3Q8KA 3NDIA 3D5QA 3FPLA 8ATCA 3CWZA 4IUYA 4K9LA 3BL8A 3G1WA 3OBIA 1OFGA 3UAOA 1ZCBA 1HE3A 3TLYA 1QP4A 2JI6A 3KUXA 1E9AA 1E9DA 2QN6A 1X7DA 2A0YA 3DB2A 3DYBA 3MFYA 4XJXA 1LX7A 3A6EA 2QDKA 3NO4A 4TKUB 4BNDB 1IY1A 2FFQA 1W93A 3GJRA 4FTWA 4KPGA 3GHHA 2VZ8A 4TX1A 3OMXA 4R8MA 3L0DA 3W8NA 2HKIA 3BJRA 1AN0A 1V6CA 4R54A 3HN7A 2JA2A 3K0AA 1KNQA 4W63A 1NG9A 1U0HC 1V71A 2WIKA 5GMOA 5WRFA 5HS6A 4HD8A 3WG9A 5HQTA 2I7DA 1QQ6A 3DE4X 3OX2A 1QP7A 2OO7A 2E89A 1PS8A 2QVGA 2FLVA 2R11A 3TZ6A 1FMLA 2J9XB 3EPLA 4M21A 4AULA 1B6TA 3KTAA 2LP4Y 1RZRA 3PXUA 3IQEA 3I04A 2WM9B 2E18A 3D3JA 4Y8VA 1TEVA 3COWA 4LUCA 4B3FX 4MDHA 4BO4A 3ZKWA 3FJYA 4ZYXA 3SWWA 4YAGA 1VE1A 3QFCA 1UP4A 2EJTA 3V4VB 4U2CA 5A3JA 3B52X 2Q1YA 1OT3A 4NE7A 2VTKA 1Q57A 2C9BA 2PFGA 2ZQ5A 3HWWA 5HCIA 1P7WA 2XUFA 2GAAA 4XXHA 5KC8A 4V3BA 3Q15C 4XDGA 1A04A 4LX0A 1KI3A 4KO3S 1D7AA 1P3Y1 1PVOA 4QOGA 1PHPA 2QU7A 1OF1A 4EYSA 1EXMA 2QJWA 3PENA 1Z0SA 4A0SA 1UZNA 2JZOA 3OFKA 3R9WA 1KU0A 4PX9A 1QVVA 3WSVA 2WTNA 5DBGA 4UE2A 1JGTA 2IU0A 2JLUA 3PRJA 1L5OA 2DFDA 3MYYA 3C74A 4UOQA 3GLIB 4YI5A 4P86A 3LD9A 4BBJA 2BFPA 1L5KA 3WBJA 2BJHA 2PSEA 4IIGA 3PFNA 4B17A 1VGVA 3FLBA 3N0TA 4UUMA 4HLQB 2W93A 1HL7A 4O29A 4HPWA 1AO3A 3HYRA 4DLWA 2AF4C 1MB9A 1BN6A 2BMAA 3B78A 3IL2A 1L4LA 3V6LA 4B2IA 1GJRA 5AHXA 1IUNA 3OG9A 3KT0A 1JJAA 5AHWA 2YRFA 3LOUA 1PW5A 4R1NA 2VNKA 1NW8A 1YKSA 1DT5A 1A4IA 1JG7A 1KKMA 2B30A 3FCSB 2FSVA 4FMPA 4G4JA 4J90A 1F6WA 1YRYE 3IKLA 4LSGA 4XM2A 5EZYB 2FFHA 3WL8A 2FMTA 2ZWPA 3IAS1 3L6CA 4ND3A 5KKCA 4G9BA 4MW1A 4BQIA 2CUTA 3GJZA 1AZLA 3WXMA 5E1OA 1TYCA 2P30A 1GGFA 1M1ZA 4MVJA 5LYYA 5EE5B 4RJLA 3SF8A 3IBTA 1XDZA 1PK8A 1TJYA 1Z2AA 2W2QA 4M8NE 2XA9A 1Y4AE 3G2PA 3G23A 5IT9A 2BEKA 2XIQA 2HCTA 2FDXA 2ZAMA 3JATA 4K86A 4R8LA 1ZG3A 1C8KA 1K27A 1KDZA 4HFMA 2VXCA 3RBXA 3VR2A 3NOOA 5A4AA 5CFZA 2C4KA 2UYHA 3EDOA 3H99A 2ZJ3A 4WZAA 3ZC3A 5FUQA 1GYQA 1Y1TA 3L01A 2ZULA 1VLQA 1GZ5A 2ZIXA 2ECFA 4XH9B 1KETA 1KY2A 5BYKA 4C5AA 4DWWA 1E3MA 3CPJB 2BMEA 2GOYA 4ZHQA 5KSPA 3N2EA 5BW5A 4I8XA 3HO6A 1QIJA 3NJ4A 4QC2A 5M5BA 4WMLA 3PI6A 1B6GA 3VDMA 4Q3LA 4TMWA 4WZBB 1P2DA 1ZC4A 2XYHA 3QI7A 3R5FA 4Y9DA 4JYCA 4M83A 3MC1A 1KS2A 4WCVA 1JEYA 1VIMA 2YWEA 1ECLA 4EA7A 4HXYA 4QU0A 1FL9A 1KGDA 1ZIXA 3NTOA 4Z3DA 4QDOA 2XXAB 3LW7A 3PEVA 3DR3A 3RPEA 1DTWA 2WJYA 2YMPA 3GFGA 2W4IA 1XYVA 2WW8A 3ENKA 4RVCA 3VSBA 1NT2A 2BFFA 4WKBA 2O50A 5KO2A 1VL6A 2O0MA 2AFHB 3DEHA 1XTUA 5CLFA 1PT7A 2CK3A 4CV2A 4NDNE 1KHHA 3D5TA 3AEUB 1N1DA 1IL0A 2J59A 4JENA 3WJ2A 1XZEA 3MRTA 3QUSA 4QNRA 3ZE1B 5KQPA 3G1TA 4XIJA 1PGJA 3TLMA 1MGPA 3A6LA 3BJMA 5IUJC 3EULA 2GWRA 3DTVD 4AKIA 4JMLA 3B89A 2JFQA 1A96A 3HR4A 1B8UA 1NFFA 4URWR 5FQNA 4B4OA 1HLPA 2V5VA 1EFVA 1JLSA 1EAYA 2VXYA 3C7CB 2A9OA 3ESDA 3IHLA 3LA6A 3MELA 5DU2A 4NOMA 3V1NA 4D79A 3KLPX 2BM9A 1N2HA 4DNPA 1AMOA 1E3TA 2V0CA 1RWMA 1XZAA 2CFRA 2RAPA 4OVKA 1Z0IA 5FEUA 1KEPA 3UT6A 1XKXA 3KZ1E 4GI2A 5FOVA 1EUYA 2E1RA 2WD7A 2GD0A 1PV2A 4M0CA 5C37A 2JGLA 3PJDA 4CHGA 5LP6A 4CTKA 2HMSA 4LJLA 4C4ZA 5LIRA 2ZXEA 3SHQA 1ZD8A 3VHXB 4CUKA 3ROZA 4FDMA 2WG2A 4FZRA 3T5AA 2F64A 2E5WA 2B5OA 3RS2A 2ZE8A 2APJA 1UK6A 3HJAA 1XU7A 2W2XA 2WMNB 3LW8A 4YAKA 1UJ2A 4V0OA 1DOHA 3MBOA 2CNNA 2YWHA 2AFIB 3FVQA 2M98A 3QELA 3S2ZA 3TIXB 3KEMA 2ZI6A 2R1ZA 3T41A 2Q3JA 2G80A 4I81A 4A0FA 1YFLA 4GXRA 1Y3CE 4O2AF 5HWSA 2QN1A 4LYDA 4DCOA 4UXIA 4UCXA 3UHAA 1G3MA 4M60A 4BFTA 2ZETA 3WGNA 5EMNA 3WYNA 3HFGA 3WKCA 3D8TA 3GDWA 3O9MA 1SAYA 1OAOC 2HK8A 3DEKA 2JASA 4ZO6A 3KKLA 1EYZA 2PD4A 3U4DA 1P2FA 3ZWVA 1WV0A 4FYVA 4MGKR 4FEEA 5KYXA 3OTQA 2PKXA 1ZRSA 2WSMA 3OMWA 4W8GA 4CR7A 3BE6A 3GMIA 5D6NA 4ZZ0A 4W5QA 4D46A 3VZPA 2C77A 2RGGA 4FN5A 2WD9A 4M7RA 2ZS9A 4U2DA 3RC1A 1JEQA 1IOWA 3LX5A 2HXSA 1KC3A 4FZ5A 3MCVA 1ZHFA 3F1LA 3QVWA 4LPSA 3GA7A 1GRRA 1GZ3A 1RJGA 3PPIA 5EC8A 1XAGA 4Z3KA 4O3FA 4RD4A 1RAAA 1SOMA 4ZMRA 3HDGA 4S1VA 1FPMA 1HTBA 3B1WA 1X7ZA 3QPAA 1LWOA 1CERA 4ATNA 5KYTA 3D6UA 1ADBA 4YBZA 5CAEA 4P6VF 2JGMA 3IPXA 2NVUA 2ZRHA 3EYWA 3KU4A 4EHAA 1KERA 4POAA 2IIBA 3O6VA 2GF9A 4WXPA 4IFBA 3H42B 1XCJA 4GYWA 4MUMA 4BQPA 2CB0A 3WWEA 1LPAB 1YKFA 4B8YA 2YICA 4RGBA 5IUNC 4N5DA 1VPTA 2R97A 5CFQA 3FPJA 4HNSA 1LPPA 4GYYA 3D3QA 3QYFA 4HCJA 2AL7A 5TQ0B 2GDZA 2QRHA 1LVHA 1OFUA 3B6ZA 3SFVA 3HCAA 4WK0B 5IUKC 4D96A 1V6SA 1PQ4A 1WHSB 1YGYA 4I4TB 3UG7A 2PGJA 4G8DA 1YBFA 2W6MA 5K3FA 4JVMA 2GN1A 4FX5A 3A9CA 1TZJA 4RPJA 1NE7A 5HW0A 3MG9A 5A5GA 3JQ9C 1TF5A 3OHPA 2NUTA 1CHDA 1K75A 4TRJA 3SN6A 3UIEA 3Q8LA 4QDUA 4NJOA 2QTVB 1ODIA 2ZVQX 5JAUA 4KV9A 5IF9A 3HJGA 1VSTA 4GPAA 3WQHA 1SPBS 3L8MA 5TE9A 4LJKA 3HB9A 1D2NA 3FYTA 1WCWA 2QTZA 3O4VA 3O5AA 3R8CA 2L17A 3OE7D 2C5SA 2F3UA 1IULA 1HFJA 1PSZA 3OFJA 3UNXA 1WR8A 1I0IA 1VMIA 4ZIRB 4LKOA 3TZQA 2P9YA 3K0CC 2ZWVA 4R7ZA 2ZIFA 2OTCA 1TW2A 1E1QA 5JATA 2DT8A 1Y9AA 3NHZA 5CA0F 4XIYA 4R84A 2PZEA 3AUUA 3UWSA 4KE9A 3R3WA 2ZSFA 3R5HA 1TTTA 4JT8A 5F21A 2QLTA 4J7UA 1BS2A 3R74A 1SCQA 3V8EA 2ACKA 4P3XA 4ARIA 1O89A 2PL1A 1TCVA 2F3QA 2VPWA 3MUNA 2WNHA 3E70C 1R5BA 5DV9A 1P73A 1BSVA 1UOPA 2OVBA 1ML4A 3IQGX 4FX2A 1SA0A 2OXRA 4NOLA 3VRHA 3DWFA 2JIBA 3GQBA 1GQYA 3OM1A 5EMLA 5AWFC 8AT1A 2ZZKA 1T5DX 4BZPA 2IZOA 3GRFA 4MUFA 2VHVA 2RHDA 3IH5A 2LNDA 4G5XA 1R2QA 1H2HA 2AFIA 4FT2A 4QBHA 2IH2A 5LP6F 4PPQA 1EGAA 1HWYA 1TVKB 2JHCA 3AJ8A 2VWQA 4KQ1A 4OHYA 5GQSA 5HFNA 3EA5A 1YA4A 4MP8A 4QYMA 4AWXA 1DQSA 1E3DA 2W2KA 5U4XA 3OZDA 4X54A 2J9ZB 5K8CA 4O0MA 1HLGA 1PZNA 1W88B 2XT6A 5CLQA 5IAJA 3ZWMA 2BVNA 3D6AA 1PQWA 4R01A 4N0QA 5H7XA 6PFKA 3OQMA 3MFQA 5SY9A 1NV8A 1O5TA 1S02A 2YZGA 5L4SA 4FI3C 2ZIGA 3L84A 4RLFA 3AF1A 3MILA 4AG6A 1M10A 3R7WA 4Q4JA 1XJ0A 5EERA 2OCAA 4O4LF 3UXYA 4MITA 2X8LA 1I51A 3KZCA 1SXJE 4PO8A 5EWMB 2VUUA 3D0RA 1P5JA 4MYDA 2ONJA 4W5HA 3SD7A 1LFAA 1NU6A 4Q9KA 1Q74A 4FMBB 4RPCA 1RTTA 5LBUA 3VKVA 3ZW9A 2AMLA 4NLLA 3V9AA 2HMYB 4LY3A 2D1YA 4KVFA 1ESZA 1P1HA 2RH4A 4FE4A 5GVRA 4UHHA 4XJTA 1H0KA 2NVUB 2ECPA 1H2AS 4RZ3A 2B4TO 1N5KA 5JNVA 1TVEA 5JCJD 4G4GA 1A8IA 1NURA 2JAXA 5J1SB 4OSPA 3ABZA 1G21B 3KT8A 1E69A 2PKQP 3CRMA 4TWJA 4FYMA 3E3LA 2GA9A 1OSNA 3LCMA 3PXDA 3RVLA 3UWPA 3GU3A 3DDUA 5CYFA 2VVTA 3W5IA 1NW6A 2IS2A 3IDZA 2F17A 4PZEA 4B3GA 2XX3A 2J3HA 3G9UA 3KJEA 4F38A 3MN1A 4M9SA 3KSBC 1B3RA 3EY4A 3IUEA 3CVUA 2E5LB 1HMYA 2YW9A 4DYHA 4WX2B 1OILA 3EC2A 1PP4A 4NYIR 2Q5QA 4JI3B 3UK1A 4YGYA 1O2DA 3ESBA 4LZZA 3O8OB 4JOBA 4V1CB 2VRNA 1WZNA 3AOGA 4RZ2A 3W9BA 4ZOQI 5CK5A 2XUDA 3WL6A 4E14A 1FXSA 1IIBA 2DHDA 4IUBS 2I4RA 3IDOA 2GN8A 1CC1S 3GGGA 4URYR 5GONB 1TAGA 1P81A 2HI0A 4QFCA 5DLQC 2CXTA 3AVVA 4LOIA 3SYLA 2IUEA 2BUCA 4O4JA 3RU2A 3QU2A 2ODBA 4IHJA 2PFSA 8ABPA 2L82A 2QL7A 2RGBA 1W9MA 2GEKA 4HH0A 4IWXA 4KCGA 3W1WA 4E46A 4ZARA 1AKVA 4IG9A 2A5GA 5KI6A 3A9SA 1DKMA 1TL7C 2Q9UA 3QY9A 4N5HX 2HWKA 3ZY3A 4BBPA 5DK4A 4CETA 5KX5A 2O2DA 4MHTA 4JYMA 3I53A 4BMNA 2UXBB 1JJBA 5JD5A 2FCRA 2OOSA 4ZN6A 1Z8NA 1YV9A 3P32A 2QNIA 3C6YA 2UZ4A 2JG3A 2VLIA 2WKQA 1UDBA 2OUKA 3O83A 3FTDA 1Z5GA 1CZKA 2P2LA 2QD3A 3FPGA 3RTAA 2BC9A 3WFIA 1D6NA 4LCBA 1FTGA 1DKRA 1C30B 1UOOA 1ECCA 2WT9A 3B2NA 3GPDG 4R0NA 4X85A 4BVEA 1B76A 4NYJR 5IK2A 1BXKA 3U81A 4C4XA 1NLUA 1N3YA 1ZVKA 2AOVA 1L7QA 2PQ0A 4B3XA 2NSJA 1LLQA 3IB6A 2HWYA 2C1ZA 3HA7A 3KVNA 1U0OC 2P78A 4PQYA 3R3SA 4BS9A 4RELA 1JIUA 4G2NA 4GSLA 1H5UA 1VHJA 2VFAA 5JRZA 1H0SA 4OD0A 1Q16A 3GELA 1W47A 3A1TA 4MV1A 2UZAA 1FTNA 4OHXA 4RZHA 1XT6A 5J2UF 1QFXA 1PLJA 1XLUA 1XF1A 1E2PA 2OXEA 4MRNA 2HHJA 5JAMA 5HF9A 1PVDA 1AKQA 4H0NA 4S0ZA 3VGPA 4I4CA 1W75A 4DMHA 4QKQA 1Z7WA 3QXCA 4FINA 3ET5A 1FLNA 4REOA 1YR8A 2NUPA 2HIAA 1TGYA 3TRIA 4DLKA 2A9FA 3LHFA 4X1IA 1KR2A 4TQAA 1RR6A 2GZMA 4NEHB 1TUEA 1SC9A 2HJWA 2PEZA 2X23A 2XXJA 2LRHA 4AFNA 3RBAA 3UW3A 2WUFA 1TT5B 3I2HA 4XTRA 4FDTA 1O7JA 1Q15A 2HEGA 2ORIA 2XMDA 4MKFA 4AF8A 3FNFA 5BRAA 1DUIA 3ENNA 4M1MA 1Z6ZA 1KP9A 2ZM5A 3P2MA 5ADWA 2CCJA 3F49S 3DM9B 2VP6A 2O2SA 2Y67A 4KE6A 1ZIPA 4W9NA 4AZ3A 4YV0A 4OHFA 3SS7X 4GKAA 2V96A 4PS1A 4E09A 4ENPA 1KF0A 4I9UA 4ND4A 3FXAA 1CIVA 1QZZA 1Z4LA 2J4CA 2QUIA 3E6AA 3O21A 3JCZA 5JG7A 4CDGA 3ZU6A 3EPKA 3VH4A 1FZTA 3PT5A 2J5RA 4DJDC 1RRPA 1VSUA 4PSAA 2XNCA 4A27A 3E9MA 4AZWA 4MDFA 4U6NA 5IAEA 2Y4NA 2GCPA 3QQ5A 3EUFA 5TQVA 2H3HA 4L02A 1YOBA 4WXYB 2GAIA 1BVRA 1JR3D 3ISVA 4ZU3A 1BXZA 1KSGA 2IPOA 1NJ2A 3A6GA 3IODA 3L7BA 4JEMA 4KH0A 3MAAC 2GAOA 5AM0A 3P2IA 1XX6A 4HZIA 3SMQA 4P7GA 5JYDA 4G3XA 4NMLA 4X6UA 4D81A 4RIGA 2DFTA 5F35A 4C7KA 4F96A 5HG0A 1RQPA 2A78A 2O54A 2BBTA 1A5BB 1QWSA 3L0ZA 4NMHA 3PNYA 2A9RA 4OK6A 1FDOA 2E4YA 3GI1A 3MWKA 4NQZA 2FY8A 3QEOA 4P84A 4CLHA 4WOCA 5F9FA 5HFAA 1GITA 1FFXB 3A3PA 4M9RA 1Y0BA 1O97D 1PNVA 2YXPX 5DHQA 2HMWA 2DPHA 1RQ7A 1U9IA 2O07A 3HVIA 4LJSA 4Z0TA 2FWIA 4Q9NA 1V35A 3RV4A 1L9KA 4C9BA 2ZIXB 5SY6A 2QZ9A 5JO9A 1OH8A 1P8AA 2VDVE 3O4GA 3HO8A 3N8DA 3RJ9A 1TA0A 4FFOA 2AC7A 1RZ3A 3FGNA 2FMKA 4KR6A 3GP5A 2BGLA 3GT7A 3KT6A 3MT0A 4GOXA 2QXYA 4O25A 1FYXA 1B0UA 2ATXA 3BB4A 3QE4A 4X6YA 4BWYA 3FMIA 3IVCA 4L8VA 3O9ZA 2Q6VA 4P36A 4ERNA 4W5OA 1O08A 4MW4A 1ZK3A 3M82A 3VO9A 4FHDA 2XKAA 5EJ9A 4AJEA 2Z6AA 2YW2A 3BILA 3TEFA 3NG1A 2HREA 2B4KA 3CUUA 3QBEA 3PC2A 2QLFA 1JQEA 4LNUB 3V7WA 4OU5A 3ZQ6A 2XEXA 3VFDA 1NMYA 2G07A 2XDAA 3WGUA 4RC9A 2X9GA 1BX0A 3QPVA 5KJCA 3I23A 4S24A 4RJ2A 2BJVA 4LWZA 1VYTA 1SCIA 3AJEA 1YAJA 2UZ1B 1DV2A 1Q0RA 1UKBA 2PRKA 2QE7A 3JQFA 4R8SA 5C2JB 3K15A 1HFWA 1JHMA 2HLNA 2YVAA 1DC4A 5LZ4A 2Q7OE 1H42A 2FSSA 2R7AA 3I9MA 4NE9A 4CUJA 4RMNA 4MQBA 1IPHA 1RS0A 5JZBA 1ULHA 1IPEA 1W5TA 3AK4A 1AX9A 1P2BA 3T0IA 3LOQA 2YNMC 4HX9A 4M0DA 3G59A 3WRYC 1KJNA 3ASYA 3E8MA 4AZSA 1M75A 1DEAA 2A1UA 4XCVA 5DLDA 1ZNXA 3ILHA 3SHWA 2F4VB 3EGEA 1N9KA 4LXQA 1XQ1A 3TD6A 1RC1A 1UOQA 2QPLA 2ZGVA 4XTCS 1UWVA 3AB8A 1EDDA 1RI4A 1GTVA 1X3SA 3L93A 4HB2A 4E07A 3D4BA 3OOYA 3EF0A 4LQCA 5E2BA 5E9AA 2ZXFA 3LQQA 1Z5UA 4LZOA 4MVJD 4LY0A 1TI7A 1J0BA 1VE9A 4L4SA 1H1LA 1OHHA 5C1PA 1L4EA 2JHGA 5SZHB 4AXBA 2KHZA 4TPKA 2YMMA 3CR7A 3RJTA 2FSVC 3C97A 4GIBA 4DM7A 3DBVO 3ASZA 1U7UA 5FWXA 3QM1A 1L5LA 5L7TA 1FS5A 3HJNA 4LIPD 1EFAA 2WJ4A 3NYRA 3RS0A 4B4DA 4GI1A 1JZQA 2YJNA 5BUQA 4I6EA 1W2WB 5EE0A 2JJ1A 4TYMA 3AP3A 3DMYA 5BUCA 2WWYA 4AJPA 3VH3A 4NFYA 1T8RA 2R751 2ZBRA 2WZQA 4PWYA 1LI4A 4RVSA 3V1TC 1N7IA 4TRRA 5AK4A 1W87A 3KLNA 2HBRA 5U9CA 3PFWO 3ZEIA 1RI3A 4DNFA 4KIJA 4RCYA 5JFOA 1AURA 1UPUA 2B1JA 4I50A 2V03A 3RSFA 4B3HA 4WKNA 2Z4RA 3RUCA 3WYBA 4RORA 4Z4CA 3U4AA 2GUGA 2FUEA 1NUPA 1CRLA 1GCGA 2HU7A 1JYEA 4DBLC 3VDXA 3PFGA 2O3JA 1Y80A 2QI9F 3NXSA 3TTYA 3NHPA 4PLTA 4E6EA 1GVNB 3C8ZA 3E7XA 1DRKA 3PI7A 3CUTA 4YMVA 3U09A 1E32A 3QKSA 3KQLA 5HA5A 2ZROA 4PYIA 1NKSA 3C3WA 3FZYA 2QBYB 3IPRA 2SNIE 5HXAA 3CVYA 4KN6A 1RLTA 2O23A 1SULA 3H9GA 4EA9A 4YRMA 3ZHXA 3MTJA 1J7KA 5TV2A 5JJBA 4RBNA 2BGUA 3CSUA 4X9XA 5DJ5A 3VI3B 3ZD9A 1PUXA 3DMPA 4M4SA 3NEYA 4MGZR 2FSGA 2C2MA 3B7PA 4NCJA 1DRWA 2XZDA 3QWHA 4Q3KA 4CR8A 2HHAA 1SHKA 5JISA 4RGVA 1C1DB 1CIPA 1KU6A 1XELA 3K0AB 1NN5A 4X97A 5IYZB 3O4FA 4KXVA 5DM60 2VEOA 3P0RA 1GPMA 4C4YA 3AI2A 1DQYA 4W1QA 2BV3A 3SQWA 4R5HA 2YV1A 1DAIA 4J1QA 1ESNA 4C14A 4U7WA 2QVLA 3AUKA 3VKWA 2QAGB 3A1CA 3U9TA 5A6VA 4BGDA 1WXQA 3EX7C 1XZQA 5FL7A 1JIXA 3IAEA 3JQQA 3SICE 4NJMA 4ETNA 4RTMA 2ETXA 4H35A 3U7JA 2F9MA 1SZJG 4K1LA 4HPXB 4FW8A 2ODAA 3MWDB 4XGNA 1NT4A 4V0RA 3ZJYA 4QRIA 3CUEF 3PXXA 4JYPA 5B64A 1R0BA 1XMXA 3I01M 3F7MA 3I6QA 2XT9A 4GLLA 4DA7A 1QHSA 2R2GA 3RVPA 1I1HA 2XUKA 1S0UA 1YJCA 3OLCX 2QYHA 4GEGA 3W2TA 5E8JA 1YB4A 2AFRA 2PGOA 2X14A 4ZXFA 5A4DA 1DOZA 3S1SA 1TLLA 3C8HA 3AHEA 1TK3A 3DKRA 1AKYA 2NUAA 3RROA 4I4TF 1DWOA 1Z74A 3U7IA 4OB8A 1J2UA 2WKWA 3V80A 4MPRA 2HO4A 3ZNNA 1LDEA 3SIXA 3A8TA 5B4VA 1IBLB 4EW1A 1A88A 1LSJA 2XUHA 4IJMA 1KVUA 3I6IA 4ZO9A 5L95A 5G3YA 3B3JA 5JNWA 2KB0A 4URFA 4EY6A 5JCOA 2XAAA 4YRPA 2RONA 4LRXA 4QBTA 1E1KA 5B6PA 3SSAA 3MAJA 3EIXA 421PA 5B57C 3D3EA 4Q3DA 3VNBA 1GNLA 5DNYB 4OAPA 5M3BA 2DWUA 5ESXA 1SB8A 4TRMA 1NVUQ 5A9RA 1NWHA 2AKEA 1OZGA 4IIJB 5AYVA 2XHZA 1R16A 1SQGA 4D9EA 2Q2WA 1FBTA 4DIKA 2Z9DA 4ZZIA 3NB0A 3QMMA 1AB6A 5CCDA 3EHEA 3KYDA 1QHHB 4CJXA 1HZZC 3EOZA 1Q14A 1OBVA 2C54A 4R0MA 3B51X 2Y93A 3MS4A 1OFTA 3OBBA 3PUJA 1EUZA 4TVSA 2ZKLA 3BCHA 1CU1A 5GV7A 1Y1KE 2P27A 4IDQA 5K7SA 3FPHA 1YZVA 2FPOA 1K6EA 2PT7A 2QRNA 2Y1CA 4MINA 4MR7B 1T8TA 2ZSHA 3H8SA 4MW2A 4OBWA 5FOWA 1HI9A 5KPDA 2GB4A 2EJUA 1W48A 4IHKA 4PONA 2QRJA 3UK7A 4IMIB 4F97A 2FMUA 1DX9A 3WNDA 3A4VA 3F9RA 1R15A 2I2DA 3NIDB 3Q6NA 4MUHA 3TGPA 3HI4A 3U1VA 1PFKA 2EDCA 4IIDA 1NF8A 3OU2A 4QTYA 2CNLA 3T9FA 2OWEA 2XOKA 2JLZA 1YQUA 1RADA 2JFYA 4JWTA 2PSHA 4O4HB 2FETA 4LJ9A 3A26A 4BECA 4YDQA 2CK3D 5BV1A 4FCWA 1K6JA 2O0LA 3EVNA 2YV3A 5BUZA 1DJQA 3JQGA 3WWOA 2Y1LA 1PL6A 1YB2A 3EWAA 3S6JA 2NXWA 3OPYI 1Z2CA 3IQXA 1DUVG 5EJ4A 4N03A 2M6RA 3AYXB 3W5CA 2CJYA 3GDGA 4A2CA 1M5UA 2F7SA 1S8OA 3NATA 2AOTA 3D59A 4L2IA 4OF4A 5B1IA 1IXYA 1LBIA 4PLWA 3RFCA 2BFMA 3WAJA 4DXHA 3NQ41 4DL9A 3KPJA 2QTGA 3PQ8A 2ERYA 1DT3A 4JUCA 4LI0A 3U2QA 5AJXA 5E7IA 2DCMA 3NW9A 3UMMA 1HSZA 2VK2A 3H1GA 4DC9A 1SXJA 5EQJB 2VK4A 5TQ2A 5B1YA 4WINA 1N5JA 5JALA 2AFHA 2XCUA 1Q50A 3AL0C 2DUWA 2I34A 4BNHA 1WZEA 4WQMA 4CV3A 1T0PA 1WUYA 4O2AB 4KI0A 4DEVA 3DWEX 3ZDFA 3MF4A 1EK2A 1HTWA 1KZ4A 2P6PA 4G6ZA 5JJIA 1OZ0A 4IXMA 2EGGA 3O93A 4U2BA 2PT9A 1OROA 2O05A 2PLRA 3DPIA 3H04A 1DIBA 5HHTA 1OWPA 2J0QA 5K0EA 1CR6A 3O1LA 3ZS8A 3T3OA 1EXDA 4K0KB 1U0EA 2JLAA 2F1JA 1NN3A 2GNAA 1U9YA 4GX1A 4MV8A 4N39A 4RJIA 1ZM3A 5CLGA 1VP9A 4A15A 1T6BY 3GUYA 4I3GA 4V0KA 4G0PA 5J3JA 3W6OA 2ZUUA 4PBTA 2RJNA 1SBIA 4E5YA 2IYRA 2YHUA 4B47A 1E79A 4U9UA 3UOGA 3VYTB 2VC2B 1GVHA 5FTWA 4YYZA 1F38A 1D8AA 4ZQEA 5FJIA 4FB5A 1IEWA 1MU0A 3K6KA 3JR7A 1GPAA 3ENVA 4D0LB 4QLBA 5CFOA 5K5EA 1W73A 4XKJA 1JSZA 4MPJA 3TLZA 5AW6A 2OG1A 2DLCX 1W94A 3B9QA 4NBRA 4GOND 4YJ3A 1O96B 1WQ4A 3OT5A 3RSZA 3K6RA 1E77A 3VR6D 5BURA 4HYYA 2K7FA 2ZBGA 3DT9A 4JDPA 3BGDA 1EBBA 1PLLA 1QHYA 2QUKA 4YCNA 1JILA 1NR1A 1XJCA 4WZ6A 3ZV7A 2Q3MA 3AONB 2JGDB 2C3MA 2OPBA 4K05A 1E5DA 4KZKA 1JDVA 2Q4DA 4AZTA 1QK3A 3COPA 1BDBA 2JAOA 1GN9A 3NOXA 4CFSA 3EZFA 3HA3A 4R5MA 5DLYA 2P65A 4E32A 1OXSC 2A7QA 2XCLA 3F3YA 2MINA 2NVWA 3ANSA 3O9VA 4S12A 1SQ5A 2WY2D 1Z0KA 1U8CB 1QLWA 1EGQA 3FX2A 3N6XA 4F2PA 4DCVA 2REOA 1W46A 2V7GA 4B3CA 4NYMR 3KOMA 4RIHA 2W43A 2BFCA 1MC1A 4B6GA 5AM2A 5LN1A 3GRZA 4ZO4A 1IDOA 1UIMA 3VPAA 3TK1A 2QQ0A 5LOVA 3QLUA 1JVBA 1AGRA 2YHSA 3BM5A 3IAUA 4X6XA 5C7OO 1E5XA 4D8TA 1G5RA 3W7AA 4MRPA 3P2OA 4PQEA 5FO1A 4EB0A 1TMOA 3HUDA 2PMFA 1SM4A 1H05A 2VCHA 4D4HA 3GZ4A 2HPAA 3QLVC 3LWBA 4H3HB 4LJYA 2I78A 4JJ6A 3CU5A 2Q4RA 3JVEA 4JVSB 1MXFA 3P9XA 4MI9A 4OGKA 4P4SA 4BATA 4S1OA 4DS3A 5JLJA 4CTNA 1XVVA 4J1NA 1PW7A 1AGXA 3EXEB 2R5FA 3H2YA 4RZSA 3H5NA 5TQ0A 4F3CA 4NIMA 1DC5A 1W0KD 3ZK9A 3ZXSA 3BSYA 3B1ZA 1TMGE 3HXMA 2SCUA 2PSSA 3F2IA 3CLSD 3DBHB 1RQ2A 3P9KA 4OHOA 4QELA 1AVTA 2KYRA 4ASUD 5LXTA 4HQOA 3FZGA 1LS6A 3NBQA 3QBDA 4PYQA 3ZVRA 4EPVA 3GG2A 4H6XA 4RD3A 5U4QA 1AZTA 1QIMA 1EFLA 5K3EA 2IY7A 2ZRMA 4U7PB 4JP3A 2KLHA 5JLAA 2VQ6A 1M66A 4UEJA 2YWXA 4BFLA 1YZFA 2RG7A 4JJZA 2O7NA 5CDUA 1C2TA 2WWXA 1KZ6A 2Y05A 3AIOA 3V42A 4B82A 4G07A 4GSKA 5GIPE 2VKTA 4RHEA 3L2OB 4Z5XA 4JBWA 3SJAA 4ZVQA 2FW1A 3EW7A 2O59A 5FTMA 2RBEA 1G5QA 4I5DA 4G41A 5FWYA 1R6BX 2EFCB 2FJ0A 2VOEA 4IDGA 1WDMA 3K9LA 1FU8A 3BMCB 5HTOA 1EG7A 1PUIA 1EHYA 2JBAB 2XA2A 1MX3A 3H4IA 3LC2O 3ETHA 3ND9A 4NABA 1P2SA 3UHPA 3U3KA 5JHHB 3FI9A 4F60A 5BQ5A 1RLOA 3L04A 1GGJA 3C41J 1L5ZA 3P20A 2H16A 3RVQA 2VQDA 4PG5A 3NCTA 3TDKA 5G0UA 1CY8A 2GO1A 2QAGC 2XIJA 3N2LA 4QFMA 5KYWA 3LF1A 1WBJB 5CT8A 2DX7A 3WL7A 1V43A 2H31A 5LYJF 3I61A 4KACA 2D0DA 1CPYA 2AC2A 1UFQA 3K1JA 4I8IA 4ZRDA 4E13A 4EABA 3DL2A 1OE0A 4PPFA 4BLRA 1XRQA 4NBUA 4PSCA 1T0BA 4H31A 1GYPA 4C1BA 5C3MA 4FFMA 3HQ4O 4ETWA 4ZVKA 1IB0A 3N76A 4DR5B 2IIPA 1NWCA 1PJ8A 3E27A 3PZBA 3MWEA 2H4YA 1ZUIA 5HPYB 1AQLA 1IN4A 3HU5A 4Z0PA 3QUQA 5CB4A 2AZDA 2R1VB 1QDLB 1C5KA 4EY7A 1GCUA 3HC7A 1FTYA 3LY5A 4BX0A 2KW5A 2DCUA 1YJAA 1PN3A 2ZVJA 4TSFD 4BLSA 4PTLA 4BNYA 3HNPA 3QSYA 3SZOA 3VR5H 4D26A 1JIQA 4Z0NA 4BMYA 2VL7A 2GHQA 3DULA 3DJYA 3ZE9A 1P7VA 3GJTA 4PY2A 4OQMA 1DFHA 2P4UA 5GGXA 1Z6GA 3G1UA 3IR7A 3TFWA 5J4LA 1WB9A 3IO5A 4HRYA 1M6HA 5KYNA 2BHLA 1S2NA 5J4YA 4AJOA 2G4CA 1E7YA 4ZOAA 2B1RA 1YA6A 1ST3A 5IT5A 4EBBA 2XKKA 2IP1A 3CPEA 2BCJQ 3VU9A 4M0PA 1X80A 1N5OX 4QYWA 1PQYA 1WEKA 4CCWA 3T1YB 3HNRA 1XB2A 4M53A 1YRWA 3ZZNA 1RQGA 1GKLA 4FCCA 1E89A 1G5PA 3WJ7A 2HSDA 3K92A 3R0IA 1N6KA 4PLCA 1C9EA 2BM0A 3R7SA 3A7EA 2QWXA 1OAOA 4BV3A 3DWIA 5DXJA 3HKEA 2ZRQA 1P39A 2JDID 5JD3A 3UBMA 1Z5OA 1WB5A 1QM5A 5BRJA 4M1OA 4RTPA 3UH0A 5K4AA 3TW4A 1EQAA 2D0PB 4F5EA 3RG2A 2OFPA 3GLUA 1TXGA 4ZZ2A 3T52A 1IOZA 2HSGA 5CK4A 2F59A 3EYAA 2H0AA 1KI6A 4DDKA 2IELA 2W5UA 1DPGA 3T5PA 3CKKA 2OMKA 3E2IA 5FUWA 4C08A 3FROA 1O94A 4H60A 4AS2A 3ZI4A 5AK0A 1ZH8A 4HV4A 2Y9MB 4CKBA 4G4SO 2YZ2A 3RFVA 3CC8A 3IP3A 3S8YA 1ETUA 2HUNA 3RKUA 3X1WA 5JD6A 1CQIA 3O4HA 4EEXA 4C3VA 1G3RA 4F2DA 2I4LA 3PJRA 2ODQA 2R00C 3EXHA 1OX4B 4CMAA 3H2BA 1B2LA 2BOVA 5IXJA 1GV0A 1UJMA 4ER3A 3QYPA 3KPYA 3GRCA 1EE2A 4ZGBA 5M04A 5L6LB 3JAKA 4D44A 2P9TA 3EMKA 4BVLA 3ZXUB 2WTBA 3LI2A 3MJTA 4C7BA 2JHPA 1ZH4A 1MDBA 1NRJB 5EE1A 3WYAA 3N6RA 4UZEA 5BSRA 5ITZB 1PDWA 4URZR 1Y6ZA 4XYLA 4F3TA 3BN3A 4UBMA 4D9HA 5KTKA 5FLYA 3KQTA 1YB1A 4ZDWA 2ZITA 7AT1A 3JRXA 1F9EA 3VC7A 1O1YA 2J9FB 4LPKA 1I3KA 2X5NA 3GYBA 3TI9A 4ZQFA 1DJPA 3L7NA 4FONA 1SEVA 5TMBA 3IEUA 3MT8A 4IV0A 3I9KA 1JQJC 3UTCA 1QHXA 2PH7A 4GSYA 2A84A 2TS1A 2XQIA 3IQIX 4M7PA 1MIOB 1RP7A 1T0UA 2WAAA 3MVEA 2PXHA 2Q6IA 1OPRA 2WWTA 5I7EA 1W34A 3WISA 2F43B 3GFPA 2NO9A 4L3OA 4GPTA 4PNZA 1C30A 3W8RA 3ONDA 4JQZA 3H2IA 4FR0A 1UM9B 1G0NA 1TU0A 1XQ6A 1ZD2P 3JXEA 4C87A 5BMVA 2ZUEA 1NFRA 1EFRA 3GH1A 3WGQA 1UBGA 1WTCA 2QL9A 3G8DA 3RRZA 2BEWB 1TB4A 3I01A 3AEUA 2QVBA 3HFSA 3QIVA 1B43A 1R3UA 4TXHA 1Q1ZA 3KOOA 2QTAA 1MV5A 1CY0A 1FFHA 2VRWA 2WSSD 2QNBA 3EVEA 3MRSA 3L41A 1BIFA 2Z1NA 1JF8A 4L51A 3B2EA 3AB3A 3PNQA 3V8QA 1U8EA 5EXXA 3DV0A 3ER6A 4JC8A 4BMXA 5JNRA 3F4KA 4X60A 1XCGB 4NK4A 3B85A 1UPCA 1XVAA 3N8HA 5T4EA 4I5GA 3KVRA 5KOJB 3SBOA 1Y33E 5JJLA 1T4CB 4O8CA 3IHWA 1KVSA 1D09A 4IPTA 4ENRA 1T1GA 2BFEB 2WUVA 2JIOA 3C14C 3SP1A 5FAKA 3DZFA 4M0MA 1R9NA 1BRTA 3BPSA 3MCWA 4WIAA 3TAUA 1R5OA 1GUBA 1Q0SA 1THMA 5JECA 1V9CA 2AJCA 2IY8A 1ZVMA 2WJZB 2DBZA 1NF3A 1QF9A 2WT4A 4L4RA 3RRMA 4UNRA 4C1NA 1QBKC 1V16A 2VUSA 2YMQA 3MT7A 2GM3A 1OOEA 3T3EA 1POWA 3UB3A 1PKEA 1XHEA 2VA9A 3PQ2A 4EZIA 1QHIA 1YVUA 2VOJA 1J4AA 1E1CB 2P79A 4LF4B 5HTKA 4L7QA 2J4DA 3ZOKA 2QROA 3L7MA 1JPJA 3TW0A 3WL5A 4JKOA 2ZW9A 2P7HA 3ZWQA 1EK5A 3HZZA 3U1BA 1UFRA 1JE1A 1UZMA 4FHEA 1NLZA 4ZCMA 1P61B 2DWOA 1H3NA 4MUXA 2C82A 1JLRA 1W4CA 1K88A 1V8PA 4FQ5A 4PG4A 3E0XA 4P9NA 1AA9A 4UM7A 3U4CA 5AJZA 3ZWBA 4J0HA 4LFAB 3I0MA 5E4FA 1H2YA 3ASUA 4CF5A 5J43A 1ESCA 2PK3A 3R7FA 4GVPA 4C0LA 4CL0A 6GPBA 1LW6E 8MHTA 2ZUVA 4UTZA 4WXRA 3T9DA 3KIPA 4O8ZA 1NYLA 5EP4A 3TQCA 5HJEA 5IU6A 4OA8A 5JC1A 4NY1A 3UUFA 1GLGA 2VJCA 2G5GX 1A50B 5C7YA 4XVHA 3H1BA 3Q1KA 3G7SA 3PEYA 3BD9A 1C1HA 4B75A 1ABBA 5E6SB 3KQUA 4NFLA 1B74A 1UZUA 4JLKA 5E9QA 2CFSA 3Q5EA 4G26A 1XZBA 3N0VA 3KAPA 3IP7A 2XITA 1FX1A 3MJRA 1MG0A 1MDFA 3HSSA 2PJRA 1L4NA 3VH2A 2I62A 3OIUA 2Q45A 4GPBA 2IYVA 1FFCA 4TYQA 1G7CA 1JA9A 1L4BA 1XO1A 2Q3LA 1I6KA 4GS5A 1HKHA 3OVMA 2L18A 5B4UA 2CL5A 3S7TA 3QFHA 3DHVA 4GLFA 4HAVA 4TWBA 2I2XB 3KALA 3NKVA 3H5VA 4DT1A 5DSXA 3LQKA 1Y6QA 2HRRA 3E2MA 4P7JA 5FOTA 4D4JA 2NOAA 2HYIC 3CUSA 1JKJA 4MX8A 1A2QA 1BXGA 1OFUX 2HXGA 2XH8A 4MWCA 1XRPA 2X9QA 4XLTA 2P0YA 2DR2A 5BP7A 1CG6A 1J8VA 2PZJA 3PHCA 3TOCA 3ZZMA 3DXYA 4CODB 4KQWA 2GCIA 3RF7A 4C4AA 1UDXA 2XQFA 2F43A 2H5EA 4OQNA 1Q1GA 4FZJA 4HBZA 3AINA 1BJKA 3U7EB 4MCHA 2CNBA 3QPBA 3H2HA 3UT5B 3V2IA 4EVIA 5CVUA 3SFTA 4IVPA 2GZRA 5CB6A 4QPPA 2YCBA 4AYXA 5G53C 3TF5A 4KTVE 3MTEA 1ESMA 3O82A 3SZ3A 3AKZA 1IAQA 4PO3X 3A2LA 2DKOA 1GUZA 2CLFB 2OO3A 3IOMA 3OF2A 1CEYA 1FDUA 3CT4A 3FFTA 1G20B 4E15A 5BSEA 3ORQA 2EZTA 2GVNA 4XYMA 1FXWA 5ALEA 1GPYA 1PRYA 2K5UA 1ICEA 5G4LA 3W2GA 3RNLA 1P4HA 1V9SA 4HQFA 1O95D 2IWRA 1ZUNB 3GJQA 4C22A 2Y1WA 4ENVA 4YMHA 1P7ZA 1UT8A 5I4KA 1XHLA 4EAAA 4EUNA 3FMOB 4KMRA 3UF0A 3EAGA 4XFKA 3PNMA 1Q5PA 3FJOA 4PLGA 2YDYA 1UBUS 3FTPA 2NUTB 5IF3A 3AI1A 4WI1A 5KTYA 3VC3A 2D1FA 5ALOA 3D7RA 4PG7A 5EXPA 1GZ4A 4LWOA 3EA0A 3PEEA 1OU0A 1YBAA 3H5IA 4KNYA 3NDBB 3R9XB 2WDZA 4FOPA 3TMAA 3C4VA 1FUEA 4PSDA 2JGIA 2WTMA 2WZBA 4IMRA 1JHVA 3RHSA 2CL6X 3X1KA 2XJ4A 3QEKA 4MB0A 4B6OA 5ITSA 3NM5A 5EIHA 3KK0A 2DE0X 4DQKA 2HLPA 1NQVA 4ZVVA 3TYXA 1QZ3A 4YQZA 4YCDA 4AAYA 3D1LA 2UYGA 1Q7CA 2Z2ZA 4Y7CA 3BRWD 4UOEA 1DEXA 2A57A 1VMAA 5ILOA 1KAMA 1AH2A 3CJTA 5TB5A 3D4LA 5KTPA 2NTJA 4MJ7A 2LCQA 3KCNA 1A5ZA 4HDAA 4OX9B 2P2ZA 3LBHA 2FWBA 1PF7E 5FNVB 1Z7YA 4XLLA 3PJFA 1B8PA 3CWQA 1U0TA 3L46A 5DM1A 3UAYA 5GY7A 1L3BA 4JUAA 3TEMA 4KN8A 3QX9A 4IRUB 4XEHA 1Q83A 4Q18A 1V45E 4JV5B 2H4JA 4TWIA 3AM3A 4NHEA 2NSHA 4TVOA 3HY6A 2BCEA 3FI0A 4ZOCA 4WW0A 3TI7A 5AUOB 4G4IA 4UU1A 4F4DA 3A2NA 3OCJA 1NVMB 2PS9A 2GD1O 2ZBVA 3FGPA 5D01A 1S4QA 1IU9A 1DE0A 4IQ0A 4LYEA 4OGFA 1J00A 4H7FA 4F4JA 2QRGA 5LL6P 3J81k 3THSA 3TPFA 1HF3A 2CEAA 3B20A 3FNRA 3EZGA 3EDQA 3LT5A 3NT4A 4OLHA 5E95A 3L8EA 5H59A 5T6MA 3R5XA 4EJ6A 5ABPA 4JYZA 2GK7A 1NV9A 3NC0C 4DKJA 4GXNA 5CDGA 3EEYA 1N8NA 3DVRX 4F72A 3NX4A 4ZANA 1JT2A 3HADA 2ZEJA 4XIGS 2JFNA 1UJBA 1Y42X 3H9UA 3PL5A 3HH8A 1NVWQ 2FSFA 3PHLA 2ZG6A 3OPYA 4JN6B 2WHEA 5NULA 5IJWA 1SNYA 5JD4A 2FWMX 1J0CA 2QTTA 1BXGB 4HGQA 2Q4TA 3KQQA 1PJ3A 4MYSA 5LB2A 2D8AA 2OQRA 4R1QA 4ZEXA 4KH1A 1T3GA 2IYXA 4PM4A 5DYWA 4LDNA 2OHIA 3ZV4A 1I5RA 4IVNA 4WLNA 1B8VA 1LDNA 221PA 3R40A 3VV3A 4CM4B 2DPLA 3DBHA 4E2XA 1RWKA 2RHWA 2ZZNA 3ZCXA 1TM4E 2FOXA 3FKSD 1V8FA 4TSKA 1CYEA 2B4YA 2HRQA 1EX9A 1G2IA 1QIKA 1TRKA 1EDEA 3AKEA 3I4CA 3W3AA 1E2BA 1HDCA 2HYDA 1DPFA 1CS4C 2IJGX 5A3SA 3LUPA 3U39A 1FP7A 1LQ2A 2AFVA 1YK1A 5BQPA 1CQXA 2IVZA 4K2AA 1OXTA 5AJHA 1A9SA 3MHPA 1I80A 1OIWA 3KQOA 4G9EA 2W48A 4XQCA 4BNJA 5BV7A 1F9AA 5JEEA 1MQSA 1ZHHA 3WZLA 2UAGA 4F86A 3ZW7A 2X1LA 9ABPA 3F3SA 5EZYA 1ZZEA 1NXXA 5EKTA 3KJFA 3FNHA 2EBFX 5LA6F 4IO0A 2Y0EA 3OZXA 4ZDJA 2GYWA 3O8QB 4MVJM 3SIPA 3L0IB 3T3DA 4BNLA 3GC6A 2RGWA 3NKLA 1PFYA 4AD8A 2WTEA 5FBZA 1T1JA 1Y6RA 3U4IA 4WWHA 2X0EA 3EIUA 4GR9A 2VBFA 4O6VA 4UNPA 3REQA 3EUWA 3A1NA 2C58A 4TKMA 4AF6A 4BQNA 1UBEA 4HF7A 3H0CA 5E2AA 1Z8FA 2GK4A 4TWZA 1UBSB 3KT3A 1R7RA 4AN4A 1QRRA 1WVIA 3GT0A 1UJ4A 1F20A 1NBME 1HZZA 5MHTA 5GPBA 2JJYA 1YB6A 5C31A 2JANA 5SYNA 1NDHA 3KHKA 4IQGA 4KE8A 5ALMA 2ZT7A 5KZMB 3EQZA 1EVJA 3O8RA 1PJ2A 3WYEA 2QYOA 2HA2A 1I3OA 2FGJA 4OP3A 5FNZA 5CDTA 3LUBA 1VDMA 4OHVA 4Y3UA 5L4LA 5J2TA 2A9VA 4MWOA 2UU9B 3KB1A 3DMDA 3IOYA 3KEFA 3RC3A 5HKLA 3ZCRA 2LR0A 3P0FA 4PPNA 3JAWA 4U7HA 5M2QA 1HEYA 1ZSVA 2B92A 2PJUA 4N5MA 3UAGA 5EA2A 1O9GA 4M87A 4BAZA 1O0CA 3O3OB 3DKPA 1GAJA 4FYYA 4UUQA 5FUBA 2WF8A 5KREA 2O5RA 4YAWA 4HSGA 4N6GA 3ZTTA 5K2OA 1L7BA 3KSDO 2MR5A 4M22A 4O1IA 5G1OA 1KKUA 4BV2A 1GZVA 2Y4OA 2A5LA 1HNZB 2B8NA 1C4OA 1Z15A 2CLLB 5KU1A 1TO6A 1JPVA 1ZNYA 1ZMRA 5KYUB 1N8SA 1WMSA 1MABA 3NC1C 3QQPA 1QYIA 2ZPUA 3FPKA 1VIYA 2GZ2A 2JARA 2BKAA 4CTOA 4HTFB 3N0WA 1TM5E 3UV6A 3C4JA 3IAAA 1XRRA 2R8OA 3EIHA 2PG3A 5KNCA 1Y7PA 4LGCA 5FCDA 3PKJA 4YAIA 1QQ7A 3CVWA 2BZ0A 5HZMA 4QFDA 4J76A 2IHVA 4XWKA 4R1OA 4P0QB 2ZVPX 1A82A 1CWUA 3FIJA 1GZ6A 1KJIA 2UVQA 2RJ3A 3ECAA 1XU9A 1NBOA 3JQ9A 4BGVA 4BNTA 4PSUA 4MUIA 2XZTA 3DD1A 4AY2A 1OVGA 1RI2A 5I6DA 1SIUA 4UJ5A 3B1XA 2Z4TA 3W5JA 4YWJA 2Q9BA 3ZZ0A 2SHKA 3DV2A 5AHKA 2P3SA 3AHCA 4QEKA 2HCJB 3RS7A 5HSGA 2NT3A 2XD4A 1PJZA 2C4MA 4D43A 2LZ0A 3JVDA 3L18A 1QTIA 1FYWA 3TSWA 3VYSB 1H2ZA 3LUAA 1XCOA 4UNIA 2GBLA 2XVZA 4KPUB 5IAKA 5KHOC 5KJ6A 2GN4A 2EX4A 2IA5A 2PH3A 3QELB 1UANA 1J2TA 1MMFB 5CDFA 1AK1A 1QG0A 2PL3A 3LAWA 4AJNA 1JBKA 4HRAA 3EDMA 3I42A 2POCA 3MBKA 1DQRA 2GESA 4JLBA 4JLOA 4OB7A 3ZHYA 3HXPA 1G5FA 2C04A 4QYSA 1BHJA 2R6GA 4D4GA 1AV7A 2FHPA 3C5EA 4WESA 1KFBB 1U5BA 3P4UA 4KIGA 4C3ZA 1U2GC 1X9GA 5BWBA 1A8SA 3HDTA 2NXEA 1JMYA 1I4OA 2WUGA 2P0EA 3JVVA 4F6RA 4OP1A 5A06A 4DTCA 4IX1A 4H7KA 1FRVA 3GJ4A 4IDDA 1W36D 2ZKIA 1F6DA 1ZH2A 5AVXA 5LA6A 4DNOA 1V2GA 3NFRA 2J9RA 4BO2A 3V1LA 5AKYA 5E1MA 5EP1A 5B1HA 3UG6A 1IUKA 3NASA 1M6VB 1PNOA 2VSYA 4OCZA 4X90A 5J4HA 1UBRS 3T5MA 2O2YA 1ZNQO 2D1RA 3KOYA 1OXBB 3EIOA 1Q7EA 2A86A 4PRYA 2JBWA 2Z08A 5E38A 4HVCA 1WXXA 1EE9A 3OQVA 4KIFA 1QGUA 2VA8A 3CZ5A 3GAAA 3OJOA 3Q7SA 4KC0A 3V8VA 5JZSA 5K4HA 1FZQA 3AMVA 3HYNA 3N8IA 1JPUA 1G18A 3FWYA 4N0DA 2XE8A 3KLMX 5DBEX 3H2JA 3QOYA 1Y3AA 1C9MA 2HF9A 3PE3A 4TL6A 4IGFA 3D9QX 4N7RA 5REQA 1J8DA 5K0SA 4B3RB 1E7MA 1K8RA 2VS1A 1Y8RB 3ZGLA 3V97A 4GLBA 1P2TA 2BGJA 2X76A 4FLEA 1ODFA 1T2CA 3NBFA 5A4MS 2V7PA 3ITEA 3O1IC 4LXXA 4EHFA 1NHWA 4W5RA 3P2JA 4YRJA 4NENA 1IC6A 1X7GA 3DKKA 5BQ3A 1E3WB 4X1KB 2RKBA 3TOVA 3JRWA 1KQFA 2VNJA 4KSBA 1M3SA 4K88A 2IE0A 2JAWA 3DYVA 1JALA 2P9FA 3WIOA 4C0JA 2PY6A 4MXDA 3QBJA 2C2GA 1IRIA 1GSAA 3FMPB 5L3VA 2EDAA 2O5EA 1PR5A 4H1VA 2J08A 3B6MA 1ORVA 2V7EA 4WEOA 3C5VA 4YRRA 4YRZA 1GPKA 4O5OA 4BKMA 1B8OA 1KAEA 1TYDE 1N5LA 2BFBA 3EZ6A 3F6EX 3KQPA 1ZMTA 1EE1A 1GL3A 1VRVA 3ZI0A 4G0YA 4YRIA 5IDQA 2DFPA 2J0SA 1F8FA 4KFRA 3GBSA 4ALNA 2XWQA 1BRMA 4AKSA 1CB0A 2QW0X 4WLEA 2Y0PA 3SSMA 1KO5A 1JHQA 4FSXA 1Z56C 2HSZA 2H7XA 3PTLA 2CBGA 4XD2A 6REQB 4QSHA 1BA2A 1QG4A 4A4DA 1Z82A 3OLVA 4LRUA 4MK4A 2Z4SA 4L9SA 1M7BA 2NG1A 4I5FA 3SDBA 1T8UA 4X8LA 3WMWA 2AF3C 3BAFA 1GAEO 1XN1A 3WTCA 1KFKB 1BCSB 1HURA 4HFNA 4FQ8A 3EBPA 3K30A 4IH4A 4RV9A 1NKVA 4U9HS 2PQ2A 2YWFA 4ARUA 4DEXA 5C4MA 4KVZA 1VKHA 2X6TA 3R3YA 4G86A