1GGVA

Crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIENELACTONE HYDROLASE
publication title Structure of the C123S mutant of dienelactone hydrolase (DLH) bound with the PMS moiety of the protease inhibitor phenylmethylsulfonyl fluoride (PMSF).
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ggvA00
4KAFA 2G5TA 4X3CA 1QIKA 3I6MA 4ARAA 4OPMA 4IQ4A 1LZLA 2WU3A 4PQEA 1VXRA 2WHPB 2PSEA 4G9GA 4H77A 3VISA 4F60A 3IIIA 3E4DA 3H2GA 2XUQA 4MXDA 4PF1A 5LZ8A 4UFNA 1SCKA 1LBTA 4X95A 5I9IA 2I78A 4EBBA 4G4IA 1QOZA 2WILA 1MU0A 3KDAA 5EHZA 2H9YA 4ITVA 1M33A 4UHHA 4OYYA 4C6HA 5JAPA 2PM8A 1EINA 3S2ZA 4B81A 5ALNA 3VXKA 5AK6A 3FLBA 3W9BA 2OCIA 3NOXA 4IH9A 5ESRA 4M0FA 1XRMA 4UBLA 2QXUA 1TIBA 2X5XA 3LCRA 1HQDA 2ZYRA 4TPKA 4Q82A 1AKNA 3G9ZA 2Z3WA 1A8UA 1LPBB 2H7YA 4KRXA 5K3FB 2RIPA 1BN6A 2CKMA 4Z49A 2BFNA 4H18A 1XZJA 3WWPA 3QH4A 3GELA 4AMZA 1L7QA 1N5RA 3IUJA 5AM3A 3H2KA 4YX9A 1TCAA 3AIMA 1IZ8A 1ISPA 4W63A 4OUKX 1N1MA 4A23A 5FDFA 1U65A 2Z8ZA 1J1IA 1Q83A 2VT6A 4EB0A 3UUFA 5DNWA 3M3DA 3BF7A 1XKLA 3DKRA 4QA9A 5SYNA 5JAOA 2GBCA 5EGNA 4MEAA 2WJ3A 1DTEA 2AJLI 4BCDA 1BCRA 5A6VA 3LIPA 5ALGA 2DQYA 3IUQA 4EY8A 1YAHA 4XX1A 2O2GA 4OYLA 2PSHA 5AK3A 1CRLA 3QYJA 4DMKA 3O4HA 4GLBA 5EIEA 5FXMA 2OPHA 2XUAA 2ZYHA 2DHCA 2AXEA 2VTVA 4KEAA 1JFRA 4QNNA 5IVHA 3GROA 2BGRA 3VJKA 4B0OA 2V98A 3PE6A 4TVKA 4HRYA 3KXPA 1WB5A 4GI1A 1D07A 3WK8A 3QMVA 5I8PA 4J0HA 2AJ8A 4PO3X 3I2JA 1CUDA 1EK1A 4C01A 2QRUA 3N2ZB 2IX9A 4MYDA 1NU6A 3Q0TA 3I1YA 3D0KA 4H7EA 4K6GA 4BVLA 3V48A 1LPAB 1W4LA 3AINA 3DEAA 5AKKA 5ALQA 4OB8A 3R3UA 3LIIA 4DGQA 4QDTA 2EDCA 3ZV7A 5AJHA 4K6KA 1U8EA 5F4ZA 1ZD5A 2VAXA 1LBSA 2JGEA 5C81A 4I3FA 4F21A 3NUZA 3C70A 4UBKA 5FPPA 3QPCA 2BUAA 1ORWA 1UFOA 3R41A 5ALMA 4AQDA 2I03A 4KRYA 5C7YA 4QDZA 3DCNA 1BS9A 2CEKA 1GQRA 5DWDA 1I6WA 5HKBA 1DINA 3I2GA 1ORVA 3H2JA 4J0KA 2YYSA 4X92A 2WIFA 2WM2A 3ZLVA 1XRQA 4WY5A 2HA3A 5ALSA 3BIWA 4QLOA 2X8BA 1YASA 2FJ0A 3C87A 5FPQA 5CT4A 4AO6A 3WWOA 1TK3A 2XQJA 1IUNA 3FCXA 2ZSIA 2P8SA 2C5FA 2Y2VA 4G8CA 1WCYA 5AM4A 1CUJA 4Y2RA 5LKAA 3O4IA 4H7JA 4FMPA 5C8XA 3DOHA 2GZSA 1PV1A 2WIDA 1J2EA 3STWA 3TJMA 3VKFA 4FBMA 1JU3A 2OG1A 3MGAA 5JD5A 3C6YA 4K5QA 1ZJ4A 4BZZA 2XLCA 4UBIA 5DYWA 2BUBA 1WB4A 4K2AA 4BCCA 4Q3OA 1SC9A 3OURA 2QKYA 5D6OA 3FSGD 2JBWA 3GA7A 1DU4A 4D9JA 3DL4A 3H19A 2JGLA 5AK5A 3I2FA 4P9NA 4W1RA 1XLVA 3DYVA 1ETHA 4WCVA 4X71A 5T4FA 3RK4A 4Q34A 3WK7A 2G4LA 3C8DA 1XZIA 1CV2A 2GBIA 1XKTA 4NS4A 1O6GA 3FWHA 1P0MA 5A62A 4UBNA 1WHTA 3STYA 4G4JA 4H7KA 3E0XA 1AUOA 1K6EA 1MTZA 1YB7A 3AJAA 1CR6A 1XZDA 4G4GA 2JF0A 5HZGA 5EHNA 4J7AA 4XWGA 4ZREA 3BXPA 1DT5A 3D5EA 4BAGA 1XQVA 3M83A 3R3XA 3QMMA 4JNCA 5CT8A 2WG0A 2ONCA 4C4ZA 1SFRA 4A5SA 1W75A 4KAAA 3STVA 2XUKA 4EA6A 3V1LA 3B3QA 1AGYA 2CZQA 3SWWA 5AP9A 3DOIA 4PNZA 2QMQA 5C8VA 5EI5A 1WB6A 5T4BA 4UHFA 5AI8A 5AI9A 5AOCA 4Y2PA 2JGIA 5K5EA 1A8SA 1XQYA 2XQGA 4ZXFA 2B9VA 3C5VA 5ALIA 3K2IA 3BWXA 3G9TA 2GYUA 3QPDA 2C0QA 1R4ZA 2XUPA 3WYDA 3D3NA 3WWDA 4XVCA 3H1BA 3WK4A 3MUOA 2HA6A 3DQZA 1Q84A 4IH4A 5LIPA 5ALWA 3G0DA 3G0CA 4X90A 4HAIA 1Z68A 3EIOA 4HXGA 1MNAA 5CTAA 5AM1A 4FLFA 4AZ3A 4IHAA 2XUIA 4MEBA 2OAEA 1WPRA 4U2EA 4OCZA 4H7HA 4LXIA 4LXGA 4AB1A 4GDMA 4F5ZA 3HYSA 4FWBA 4U2CA 5ALEA 1LPPA 4CCYA 2HU7A 5KBYA 1CIJA 4MYSA 3I6YA 2XMCA 5CH3A 4K6HA 1L7AA 4Y2QA 3HRHA 4L0CA 1E5TA 2QT9A 3DL7A 2JEYA 3PF9A 2Z8XA 4C87A 2I3DA 1USWA 5JATA 4ZWNA 2ZJFA 1RP1A 5ALUA 5AICA 4FOLA 1W1IA 3R3WA 3RLIA 1XRLA 3I6ZA 3C45A 4EUSA 5ALJA 1HDEA 1U2EA 4C4YA 4FFWA 1VE7A 2WIJA 4Y7DA 2J4CA 1XRRA 1VXOA 4FKBA 1E66A 1TCCA 2PUHA 1R50A 3PICA 3FYUA 2VJAA 2AJBA 4C88A 1TRHA 1ZGCA 3L1HA 3FVRA 4Y2UA 1KU0A 2BUCA 1QFSA 5AOAA 4G8DA 1DQZA 2OGSA 4DSZA 4FHZA 3SC2A 3YASA 1Q0RA 2EEPA 3KD2A 1G4HA 2XLBA 3DYIA 3B5EA 1K5PA 1EVEA 4RPCA 2GBFA 1CPYA 1ZI9A 3S8YA 2B61A 2K2QB 5D3ZA 2JIDA 3D7RA 5AKGA 4QDOA 5BWBA 4BAUA 1G42A 4LIPD 1OILA 1A88A 3IULA 4G8BA 3AZQA 3O4JA 3W06A 4UFPA 1TAHA 1EVQA 1YAJA 3A6ZA 5JAHA 1QLWA 4KJXA 3F96A 3DJYA 4UBMA 3SK0A 3BDIA 4PSUA 4V2IA 3SX4A 2WG2A 4B80A 1ACJA 3WK5A 1CUSA 5AHXA 5FOQA 4AN1A 1MN6A 2PBLA 2QJRA 3KWFA 3WL5A 1GT6A 2OQIA 4RE6A 5ALTA 1P0IA 3V1NA 2ORYA 1RYYA 3WI7A 2C4HA 5CMLA 1DWPA 5FUMA 5DYYA 1BROA 2WFMA 2C0PA 1QTIA 2RONA 3O9VA 1GGVA 4X6UA 4GW3A 2JEZA 5FV4A 5E4JA 2CUTA 4H7IA 1R88A 4G5XA 4KR0A 1CUHA 1ACLA 5JZBA 3WQHA 1QIHA 1YR2A 4E14A 1IZ7A 2PSDA 3OPMA 2ACKA 4C89A 1NU8A 1GQSA 5BOVA 4X6YA 5EHXA 2XB6A 4EY4A 5ALHA 5HF5A 3FYUC 4X93A 1O6FA 5IVKA 3G8YA 4E46A 3CCCA 1EX9A 1ZD3A 2OGTA 3G7NA 1VOTA 3T4UA 5A7GA 1B41A 1UOPA 4BTVA 3TGLA 3AUKA 4DIUA 2QM0A 5IH7A 5LZ2A 5AH0A 1QZ3A 3OM8A 4QZVA 1QTRA 2H1IA 5LZ9A 5EFZA 5CXXA 2RAUA 3PFCA 4MWTA 2PSJA 4Y2YA 3IB3A 4KE8A 3ZLUA 4W1SA 3M82A 1L7RA 5HF6A 3B12A 2BJHA 4AO7A 5DNVA 4X94A 2BKLA 3QPAA 4J0CA 2DHDA 3UUEA 1XRNA 4BP9A 3WIBA 1UKBA 2V97A 3EQ9A 1N8SA 4C4XA 1EDEA 2YXPX 1LPNA 5CXUA 1CUUA 4DMFA 5BWCA 5KWJA 1IMJA 2WFLA 3O4GA 4OU5A 1YA8A 2PU5A 2HADA 2XMBA 3FNBA 4GEGA 4M0MA 5EHQA 1Y7IA 4UHDA 5ALZA 1K8QA 5DJ5A 1EH5A 1VKHA 2WQZA 2XI4A 3L1IA 5AI0A 4OB6A 5FRDA 3U0VA 1K63A 3Q8WA 4YK7A 4NVRA 1DX6A 3HABA 3V1KA 1C7JA 4CCYB 2HL6A 1CEXA 2QS9A 1FFEA 4ROTA 2XMZA 2CB9A 2WG1A 1DT3A 3VVMA 1H2XA 3GUUA 4B9EA 5HF8A 4PV7A 5HQ3B 2VEOA 1H2YA 4B85A 4DLNA 1FSSA 2DQZA 3H2HA 4N5IX 3IURA 1WHSA 4PW0A 3N0TA 4I19A 1CUXA 4CCWA 4N8EA 1UK6A 5AM2A 1RWQA 4WFJA 4E11A 1KEZA 2WHRA 2DR0A 2HFJA 2WSLA 3M81A 4NMWA 4Y2SA 4UHBA 3DDUA 1ZGBA 4N8SA 1EDBA 1UKAA 3R40A 1MNQA 3O95A 2WUEA 4U2GA 3WIOA 5ALKA 1QIJA 1LLFA 1TCBA 4HS9A 5AI6A 2XMSA 3WKAA 1IUPA 1XZAA 4BP8A 1UOQA 5ALDA 1CVLA 2PX6A 5JARA 2J3QA 4WDRA 4BVJA 3QITA 3C8HA 3F67A 1A7UA 3ZI7A 2FX5A 1JMYA 5JAUA 3WL6A 2GZRA 1WOMA 4DTCA 2XUDA 4JUIA 3AZPA 1XQXA 3EQ8A 1C7IA 4WFKA 2DSNA 3ANSA 4KYVA 2QUAA 4M0EA 1BE0A 1SOMA 1GZ7A 1EK2A 3WL8A 4DM7A 1E8DA 5ISMA 3UMJA 1LPMA 5CH5A 3I2KA 3CN7A 2HA5A 3LP5A 4FNMA 4A16A 2ZJ6A 1F6WA 1HPLA 4W9RA 4HVTA 2B4KA 4U2BA 3H18A 1HKHA 2FUKA 5FKJA 3RKSA 4ETWA 2QZPA 2J4FA 1IVYA 1XZEA 1LNSA 3WL7A 1XROA 1H2WA 5K3FA 2OCLA 2PL5A 2Z3ZA 3FLEA 2RHWA 4H7DA 1XQWA 1FFDA 4Q3LA 4WY8A 5A7HA 1CQZA 1EI9A 5YASA 1H22A 3G9UA 2H7CA 4FTWA 2PPLA 4JYPA 1XZLA 2WIGA 1CQWA 2V9ZA 2JGJA 5LZ5A 1XRPA 1F0PA 3F98A 3FCYA 4GWLA 5HF9A 2WLSA 4EZIA 4MJ3A 5DLPA 2NW6A 5HK9A 3ED1A 1AQLA 3IBTA 4INZA 3W04A 1KU6A 4JH0A 3WLAA 2HU8A 4Q1VA 3EF3A 2Y2UA 4MQLA 3DNMA 5HFAA 2PU7A 4E15A 1U4NA 2WUFA 1S8OA 5ALLA 4W1PA 3QMWA 4XJVA 3WMRA 2G5PA 1X70A 3HXKA 5LZ7A 4EY6A 4BVKA 4YASA 4J03A 5K3CA 3AZOA 1SCIA 1BEZA 4J0IA 4FFVA 2C58A 2XUFA 2HA2A 4DNFA 4BDTA 2OXEA 2HM7A 1SCQA 3C6XA 4UHEA 1XLWA 2GBGA 4ZV9A 5AM5A 1CLEA 3F9CA 1J06A 3CN9A 1VA4A 1UK8A 5EIAA 1EA5A 3WYNA 3ESCA 3WJ2A 4P08A 1OXMA 4HXFB 1YS2X 2BGNA 1XZKA 5AKLA 1QONA 4QDXA 3PI6A 4BAZA 4B83A 1Y7HA 4JYMA 4L72A 2HRQA 4BBZA 2WFLB 1T4MA 1CUCA 1JJFA 2ACEA 3NWOA 5HK8A 3ESBA 2XUGA 1GKKA 1JJBA 4WDQA 4FDMA 4BCBA 1PJAA 4ZV7A 1GPNA 4AZ0A 5JANA 1LPOA 3D2AA 4X97A 3VJMA 2WKWA 3JWEA 3K6KA 4LXHA 2ZVDA 4AMYA 4U2DA 4CG1A 3H04A 2O7RA 2QTBA 2DHEA 1BCSA 1N5MA 5E4TA 1GXSA 4RE5A 4UBJA 3ZPXA 7YASA 1CUFA 1MJ5A 4OB7A 2X76A 3R0VA 4J0GA 2YH2A 1MAHA 2RGUA 4S0XA 3IA2A 3PDCA 3PUHA 3W9UA 2OLEA 4FNGA 2WTNA 4B0PA 4DYHA 5K3AA 5KWIA 1ODCA 3ANTA 1QIEA 1X2BA 4P92A 3ZWQA 3A70A 2DCMA 4AO8A 2R11A 3V1MA 1ZJ5A 5ALPA 2ECFA 4GECA 3IUNA 5CT9A 3EBLA 4B6GA 1W76A 4LYEA 5AIAA 1CUWA 4TGLA 1DWOA 3R3VA 2FJPA 2XMRA 3ILSA 3A2MA 2QUBA 2W6CX 2IIVA 4Q05A 1E8NA 2WUDA 4QE3A 4H35A 2RHTA 1A8QA 2HDWA 4PSCA 4UUQA 4ZI5A 3NGMA 3VVLA 2HA0A 5EIHA 3G0IA 1J07A 1UOOA 3C6ZA 5D7BA 4X85A 3TEJA 1FFBA 2VT7A 4DNQA 2QXTA 2WIKA 3BL8A 5CT6A 5K3BA 4L9AA 3G9XA 3HEAA 3JW8A 5ALXA 2XQKA 2HIHA 2G63A 4CI9A 2BAGA 5DTJA 1JT2A 3I2HA 5AIBA 3HI4A 3I1IA 4EY5A 1R3DA 3KWJA 4EY7A 1UT6A 4HTAA 2EDAA 3H2IA 3KOOA 4Q3KA 5FLKA 1JMKC 2WHQA 4HRXA 3WKBA 5HKAA 1TKRA 1THGA 2O2HA 5JD4A 2ES4A 3STUA 4N8DA 1UWCA 3DD5A 3I2IA 2QR5A 5IKXA 3F97A 1EHYA 1GPLA 1CUBA 1DWQA 3F8SA 2LIPA 3AIOA 3O9MA 3MVEA 2XQIA 1JJIA 4QWWA 2VF2A 4FLMA 2OAGA 3HSSA 1XLUA 3AFIA 2HA4A 4J3JA 2VJBA 2GYWA 4N5HX 1UZAA 5JYCA 2ZYSA 1QJ4A 1LGYA 4BATA 5LZ4A 2XMGA 4KACA 2HHAA 4KAJA 4B7ZA 4IH1A 3K9BA 3QM1A 4UFOA 4QDUA 1MO2A 5ALOA 2Y6UA 3MUNA 1ODSA 1P0PA 5ALYA 4BB0A 5T4HA 2XDWA 1YS1X 5JZSA 3V9AA 1BEEA 2B20A 4W1QA 5AKHA 1VZ2A 3WJ1A 4XIIA 4OD0A 4GHWA 3G0GA 4CG3A 3BE8A 3C6BA 2QVBA 3FBWA 1R9NA 2CJPA 2IITA 3D2CA 1ZI8A 2WTMA 3ZLTA 5E2IA 2Y6VA 4UBOA 3WZMA 2WUGA 4BE9A 4G1FA 1QIDA 3VJLA 5KREA 4WJLA 1ZD4A 1YSCA 1YB6A 4CIAA 3EQ7A 2VSQA 4BC1A 1AX9A 1GPKA 3BF8A 4CFSA 2DFPA 2OCKA 4AN0A 1GKLA 4WFIA 4CG2A 5E4YA 3VDXA 1E8MA 2ROQA 1CFJA 5AKJA 2HU5A 4QLAA 1F0NA 4KE7A 2R8BA 5AKXA 2V96A 3HLKA 1VA5A 1AURA 1QIIA 1UK7A 4QEKA 4X91A 5AI5A 1PFQA 1AZWA 1XZHA 3LS2A 5K3DA 3WWEA 4H0CA 2Q0XA 3RARA 4ZRDA 4B82A 1ZI6A 4L3WA 1QGED 1G5FA 2PVSA 4G9EA 3T52A 5AI4A 3WA6A 2PUJA 1ZICA 4B9AA 1EDDA 3A2NA 1E89A 3QBJA 1MX9A 3QZUA 4Y9SA 1ZIXA 1FFCA 1VZ3A 2VATA 4I4CA 1FJ2A 5A71A 2JGKA 1HBJA 2VAVA 5SYMA 2HA7A 5IVIA 3AILA 3FSGA 3R3YA 4BYMA 5AKYA 2OGZA 4KE6A 4LKOA 4ZGBA 1JU4A 4UHCA 5AK4A 3FYUB 4DNOA 2YASA 2UZ0A 3BJMA 5IVDA 3WKDA 4BRZA 2VJCA 1AMNA 2ZJ7A 2Z5GA 4J0DA 3OG9A 1Y37A 5A7FA 1XZGA 1TQHA 1W6RA 3FLAA 2WHPA 2D5LA 4FLEA 4F0JA 2D0DA 3WZLA 1F8UA 3ICWA 2QOEA 1THTA 3C43A 1JKMA 3WKCA 3HJUA 5AOBA 4O08A 1ZOIA 3FOBA 1QIGA 5HFNA 5HCUA 2JGMA 1W52X 3HC7A 1LPSA 2PKYX 1Q0ZA 3DLTA 3PFBA 4J0JA 3H0CA 5K3EA 1AC5A 2RI6A 4HXEB 1H23A 3PF8A 2H7XA 1QIMA 1CUIA 4DMCA 1OCEA 2OCGA 1ODTC 3H1AA 1P0QA 3CXUA 2CBGA 1CUYA 5I7UA 2XMQA 1XZBA 1JI3A 1CUAA 5BV7A 4AXBA 4MQMA 1YCDA 1UKCA 1DQYA 5ALFA 1EXWA 1MX5A 1R9MA 2WJ4A 3HZOA 3IVMA 3I28A 1E3QA 4YPVA 3U1TA 2O7VA 5ALVA 2ZSHA 2XUOA 1WM1A 5JADA 3WA7A 2AJCA 5A2GA 3A2LA 4QWMA 3OC0A 2HFKA 2OQVA 1QO7A 4DSAA 2J3DA 3WWCA 3FAKA 1H2ZA 1B6GA 1YA4A 3X3HA 3FVTA 4DNPA 1MX1A 2I3ZA 1VE6A 1T2NA 4OU4A 4HZGA 4Y2TA 3BIXA 5LYYA 1BU8A 1UXOA 2VQ6A 3CCBA 1HLGA 1CUZA 5ALRA 4RNCA 2CMFA 3IDAA 4KE9A 4BDSA 2WU4A 4OSEA 5J3JA 2VA9A 1QFMA 5D3KA 1X2EA 3STTA 3O0DA 5LKRA 4EHBA 2HRRA 3C5WP 1C4XA 3G0BA 4X6XA 3D4LA 1MT3A 3GZJA 3AIKA 5H3HA 4DMHA 1QIFA 1EB8A 3PUIA 4Y2XA 2W22A 5CBKA 1MAAA 2BCEA 5AM0A 5C8ZA 4RGYA 3TRDA 4X7BA 5CH8A 4U2FA 3FYTA 5CT5A 5AKEA 1K4YA 3DS8A 1BRTA 4BZWA 3WKEA 3GFFA 1XZCA 3E3AA 5JIBA 5LLSA 5LP1A 1WPXA 3IUMA 3R3ZA 2E3JA 5JZ9A 1LZKA 1QO9A 2ZYIA 5AKZA 3D59A 3KSRA 3G02A 1NX9A 3JYHA 3L1JA 2PSFA 4LHEA 2XUHA 1XFDA 2XUJA 1ZIYA 1CUGA 5JASA 3BDVA 2Y1KA 4BE4A 2WFZA 1ZD2P 1BN7A 2XQFA 3ESAA 4NZZA 1VLQA 4BC0A 4JEIA 5JALA 5CURA 5FP0A 5AKIA 1EB9A 4FBLA 3ESDA 1R1DA 3W05A 3HACA 1HL7A 3E1GA 5HQ3A 2O2IA 4BRSA 3H17A 1IUOA 4BTLA 1CUVA 2AJDA 4MWSA 3LLCA 1QE3A 1DX4A 4ARBA 2C5GA 2JGFA 4GXNA 4P93A 5CW2A 3P2MA 4CIBA 2GYVA 3GBSA 4IO0A 2XMDA 4UPDA 2WJ6A 5CRIA 3W2TA 4PSDA 1XZMA 4AX4A 2XE4A 4Y2VA 5DTIA 4H7FA 3DKKA 1MPXA 5T4EA 1UK9A 5JD6A 1FFAA 1G66A 2XT0A 5AO9A 2VJDA 2C7BA 4LYDA 3BJRA 3STXA 1CUEA 6YASA 4B84A 5DYTA 4Y2JA 3WK9A 2QJWA 3WK6A 3D2BA 4X00A 3OTQA 1XZFA 5DNUA 3RM3A 3ICVA 1VJ5A 4GBGA 3QVMA 3OOSA
chains in the Genus database with same CATH superfamily
1D6NA 3HJCA 3IQGX 3SDBA 4KAFA 4BOYA 4W7IA 4YDHB 4MGIR 5LOVA 2BF4A 3ROTA 5JHGB 1KTVA 1UBSB 3AJRA 3KJNA 3V3KA 1O0SA 2IDKA 3H87A 3MS7A 1FSGA 3ESRA 2YV5A 1HNWB 5BVHA 4YWHA 2QV0A 4ARAA 5C5DA 3ETJA 4OPMA 2UYYA 4P3YA 4V02A 4LMAA 1QWOA 4IQ4A 1LZLA 2WU3A 5LP6A 3LCUA 4PCLA 3W9SA 3DE4X 4NCXA 2JZOA 2XCRB 2PSEA 4H77A 1VG9B 1Q16A 2Q5OA 4Y98A 3AUAA 2VTBA 3CNOA 3O31A 4HQFA 4NPHA 4Y9UA 1WXEA 1WXIA 4C43A 2VNKA 3BE5A 4YJHA 3H2GA 4MVJP 2VBGA 2XGSA 3EEIA 4MXDA 1Z2OX 5AVQA 3PKJA 1EE2A 5LYJB 3EAFA 4WH0A 3TLJA 4D46A 2EW2A 4O4LA 1KJWA 2AOVA 2J9FA 3ONWA 1LBTA 4ZAWA 3C7CB 1DJPA 3ZXIA 4YONB 4X95A 5I9IA 1Z17A 2R7NA 3EQ6A 4ZEWA 3I6IA 4EBBA 1QOZA 2WILA 4PBSA 2Z83A 4I1OA 3IP8A 5KTMA 3NTUA 3VAYA 1AHIA 3NNNA 1FSPA 1ZU4A 3D7KA 3AB3A 3EASA 1SQFA 3OJXA 4M89A 4ITVA 2FW8A 1ECJA 1V11A 1OJ7A 3LLUA 5IJXA 5CLHA 4UHHA 1MV8A 4K28A 4PTLA 5B2FA 4BMOB 1Z3IX 3QQ5A 1SCUB 4HTFA 4PZ0A 5LNK6 4C6HA 2PM8A 3WYAA 4ZCTA 1UPFA 3T8YA 3KT6A 5K0GA 4UTRA 4B81A 2FQ1A 1U2QA 1ZOSA 1CYEA 4B3GA 4XQEA 3W9BA 2DBRA 2GN8A 1YUMA 3DXXA 3B52X 3NOXA 2OILA 4HH3C 1UXJA 1TPYA 3C3BA 3Q7IA 5EJFA 3UK1A 4US1R 1F5SA 1XRMA 4K1LA 5I3CA 3TMKA 5DI3B 5KYXA 4Q48A 1WSWA 1GDDA 1XAJA 1XTRA 2OCPA 2VNHA 3EWNA 2HK8A 2E1RA 2X5XA 1RQPA 3EPHA 4KO1S 1CJMA 2J3LA 3KU4A 5MHTA 3I6BA 1UFRA 3FOWA 4PHHA 3KDPA 2OAQ1 3F90A 1UF9A 4HB4A 4YVFA 2CNKA 2Z3WA 1MEOA 1Z7EA 4ZYVA 3JD3A 1LPBB 4GOJA 1F3OA 3KM0A 2G70A 2H18A 4HGPA 4ND7A 1C9MA 4BYGA 2XYRA 2Q0SA 2IZ0A 2CL6X 1VPDA 1Z34A 2OXRA 3AERB 3RV4A 4AZWA 3TLEA 3OFJA 3EFBA 4EW1A 2UV8A 5K8CA 1BA2A 1E1DA 1M83A 4Z49A 1QPZA 3WR5A 4RK6A 2RHRA 2GAOA 1XWFA 5TGZA 1W73A 4N6GA 5EMMA 1ZNWA 3SJ7A 3DBLB 3PLNA 1P1FA 4HN4B 3EPKA 4LJAA 4BVHA 5IDWA 3IHLA 3PFFA 2B4YA 4UREA 2ZIGA 4JDPA 3EULA 4BGVA 3BE6A 1LC0A 3HXPA 1CZUA 5B58C 1NMXA 3VDQA 3H2KA 1CFZA 4IIYA 4FFOA 3WS7A 4YX9A 1TCAA 3AIMA 4A8TA 3BT7A 3WLSA 2AUMA 5HIMA 2RHCA 1CDOA 1P3JA 1P74A 1GFSA 1E63A 2SBTA 3E9CA 3L82B 4G09A 1UXKA 4IIJF 4K0RA 3LT4A 4PPFA 4RORA 5FEUA 2CNWD 1Y89A 5KSYA 4IHJB 2XCQA 4EPWA 3AR3A 3C41J 2HI0A 1EK5A 1Z33A 4MRVA 3V7NA 3NPMA 4WOPA 1B14A 2HMTA 4BJHB 1Z6XA 1YDGA 2RGAA 2NTJA 3HSYA 3R5XA 4NAHA 3UXEA 5C35A 2C59A 5C51B 1D7OA 3PJEA 4QJBA 3HXMA 5F9HA 1RWBA 3SEZA 3TOVA 3TIIA 2P1RA 5EWMB 1CJCA 2GXAA 4ARCA 2JFPA 4ER3A 4YLYA 4EB0A 1AK1A 1T0BA 3UUFA 4X62B 2REOA 3OLWA 1B6SA 5DNWA 4AJOA 3KQSA 3BF7A 1CYDA 3THSA 3UJ7A 3DDSA 3GLKA 2OZPA 2P7IA 4PAWA 4R2WA 3K1YA 1HQYE 1ISFA 1O03A 4URYR 1Z0IA 5EMLA 2QMEA 5HMMA 1NJ6A 4HNHA 2NSDA 5LL6P 4PX5A 3LXRA 3OKAA 3U9SA 4MDEA 2FR8A 1NUUA 5SYNA 4KVAA 2BHRA 1VJ1A 1Z47A 1AHHA 2VRNA 4E5SA 4LFBB 4R0MA 3JVDA 2BDUA 1KFCB 2ZWOA 2HO5A 4YLGA 2P30A 4CEJB 2Y1WA 1S8AA 1DTEA 2GCOB 4BCDA 2ZM6B 1GV0A 2VDPB 5EXDA 3VR6A 3ZX5A 3PQCA 2WM3A 2B8TA 2XD4A 3CJQA 3P71T 4NRDA 4NYMR 5JLAA 1G5RA 1U9JA 3EGDB 4BWYA 2FI1A 1THZA 3WDMA 2DQYA 2OV1A 3UANA 1EEXB 4JBIA 3IUQA 2BLNA 3P2IA 2O3QA 4QO7A 1RYZA 3K0KA 2EKPA 3K2EA 3FTEA 1TT7A 2H2FA 3C3MA 4OV6B 5KJ1A 5BSRA 2C3UA 1RT9A 3KSDO 2DGDA 1SY7A 1ENPA 3W3AH 5I45A 1WRBA 2F3TA 1JHUA 2CK3A 6LDHA 2ZIVB 1TJNA 2XWSA 4TXNA 2BDEA 4DBLC 2B35A 4TMTA 1NWHA 2WJWA 5SZKB 4ABTA 2ZTUA 4DWWA 3N5KA 3TTYA 1UBUS 2V58A 3DMPA 2H3EA 4PCAA 1Q77A 1A9TA 3CR7A 3T06B 2I1VB 4GLBA 5I01A 3LZDA 5I8WA 5FXMA 3JYQA 2FV8A 4DV1B 3SYTA 2XXAA 2QNRA 2QX9A 4ZVSA 4MVJG 4NCNA 1GD1O 4OI1A 2C54A 2K7ZA 1KXJA 3BFXA 3VR5D 4XM2A 1WZEA 5AW7A 4X20B 1GWNA 3TNFA 2LTAA 2V9PA 3AQ4A 5TRTA 1V4VA 2DBZA 1VYTA 1KK0A 2FZGA 2P5SA 4IJ6A 2GJ4A 3X43A 3PE6A 1T9ZA 1M1ZA 2VSNA 5TS2A 2HT6A 1Q7EA 7MHTA 3KQQA 1CDDA 1G7RA 2R6AA 1JLLA 3HUFA 3KXPA 5HBGA 2QRQA 4MJ7A 1WB5A 1R6DA 4GI1A 4JZYA 1RHMA 4N47A 1GUBA 3WK8A 2A1TR 2M6SA 2AI2A 4NNOA 5I8PA 1DO0A 2FMHA 1DG9A 5HILA 4O25A 2AJ8A 3DVRX 3DH0A 5L7WA 5L6LB 1KQ3A 1ZW6A 4MH0R 3S1AB 4P22A 4Q3AA 3IKJA 4M1YA 4TN5A 1KDRA 3CZAA 3N2ZB 3NFYA 3PQEA 3ZD7A 3G1WA 2JGAA 2IX3A 3W2HA 2CKDA 3ZCTA 2PS3A 4I5DA 4LXQA 4K6GA 4QJ3A 3ZWYA 2V5AA 4E5YA 5BSUA 3QEOA 3AVWA 5JISA 2PWYA 1L4UA 3W90A 1FYFA 2YJTD 5DNEA 2H48A 1FYXA 2WV9A 4GYJA 1ZP6A 3AUSA 3MS4A 4UAUA 3HKEA 1AUVA 3OBIA 2WJGA 3VOBA 3BMNB 3R0JA 3UK6A 4ZVQA 2QHXA 3LXXA 4OH1A 3HCAA 1KAHA 1QYCA 3K0FB 1T6YA 3GF4A 3PITA 3SR0A 4CM5A 5A0FA 2AE2A 3M89A 1RLTA 3ZV7A 4NOLA 4BV9A 3LMKA 5T8KC 4LFCB 1PR6A 1Z9BA 2W58A 5IDQA 4F97A 4HUQB 1M9NA 1HI9A 5HE8A 3SQNA 1Z5GA 1FEZA 2HZBA 3TINA 3KOUA 2R6ZA 4LV6A 5C81A 3S81A 3ZS8A 4I3FA 4F21A 2HSJA 1DBRA 1E9FA 2P69A 1N34B 3QPCA 1AOXA 2HUNA 3F6YA 1ORWA 4FFNA 2BZ1A 1ISRA 2VDKB 4J43A 4ODIA 1TEXA 5HKLA 3RFVA 3ROPA 5G02A 3NPAA 3K70C 3LQKA 2Q4EA 2AJTA 2RAFA 1I6WA 3AEKA 3R20A 4RD4A 1MP0A 3MSXA 1DINA 1RRGA 3ANNA 3DMDA 3GGJA 3I2GA 1F2TB 2ZI4A 4J0KA 2DG2A 1WMSA 1MABB 3MPUA 2YYSA 3TECE 4X65B 1KEWA 2JIOA 5KDLA 1BA3A 2WM2A 1ZVQA 1PZNA 4A6XA 4ZJYA 3AEUB 4HAYA 1C8KA 2BEUB 3INYA 5BV1A 3NHJA 4RS4A 1M2NA 4WY5A 1ZJZA 2HA3A 2YNMA 1DV2A 3N8GA 4LOKA 4M98A 1N57A 4M1SA 1AB6A 3LTEA 2TSYB 2V7UA 3BB1A 3VU8A 2BI4A 5KHLB 4OX9Y 2H06A 2NNLD 4O1MA 4HCJA 3EEYA 4RHCA 3TSOA 3L9XA 4QLOA 5BPHA 3DZBA 1KP3A 3C87A 3OZ7A 3JZFA 5FPQA 1A9ZA 2NXEA 5CT4A 4A8JC 3FCCA 2AMFA 3B89A 2YWJA 4HDKA 3LYHA 2C2YA 1F2VA 3CRW1 5JXHA 1IUNA 2XYPA 3QWIA 4UDOA 1NW9B 2EHDA 2ZSIA 1E5LA 4ENSA 3M5CA 1BDJA 1E2DA 1WUKS 4UTOA 1DDGA 5G1OA 3AGQA 2VJYA 3IP6A 3BH6A 3E53A 4Q7EA 5A5FA 4OIMA 5ADVA 1CUJA 5LKAA 2TRSB 3EXG2 5DHFA 3RREA 3AB7A 4LDQA 1DQNA 3PVSA 1JDZA 2HZ7A 2QNIA 5FCDA 4PBRA 3DLAA 3OZBA 2ZSDA 3COSA 1CY7A 4W7HA 1PV1A 5KKNB 3BJIC 1J2EA 4ZZ1A 5AQ1A 3TX2A 3VKFA 1NNUA 3H9GA 3CA8A 1J20A 2JCSA 3JPWA 2OG1A 4MP6A 1BDBA 2PJRA 3ILHA 4ND2A 5JD5A 1PX2A 3MELA 1ZJ4A 4BZZA 4JJZA 5KYUB 2EAUA 4OVKA 4Q5IA 4TLLB 4Z9XA 4XXHA 1R5BA 2NV6A 3NBZC 4HFRA 1XRJA 5IAAA 1WB4A 2LKCA 1TUBB 4MHSA 1K86A 3HKBA 4BCCA 4UJ3A 5JAMA 1VP3A 4XARA 2RHOA 1RRCA 2FYTA 4Z4FA 3I12A 2V7VA 1SH7A 3TVDA 4N7BA 3MJVA 3DMGA 2HLDA 3FSGD 3NIBA 1NN1A 4JFAA 4QVKA 3ZBPA 1Z8HA 1SCAA 2JBWA 3FNQA 4YROA 3DL4A 4KL8S 4WTOA 3SS7X 1XF9A 1QPBA 4JVLA 1IBSA 4RXUA 5A3VA 2E6UX 2VBIA 3U3XA 2A78A 1WW8A 1ZMOA 1W96A 5TPZD 1R6VA 3GN2A 2AFVA 1KOGA 1N7GA 1ETHA 2ID7A 1GQ2A 1QX4A 4DM4A 3KOWA 3ANYB 3O4VA 4V3CA 1I0IA 1Y5IA 3NFRA 4OGWA 4XSHA 4DCCA 2ZYWX 3RK4A 4HDRB 4LPSA 3TB4A 1NQTA 3TH5A 5B4VA 5DM60 2EFGA 2G4LA 4HDCA 1AUQA 1K2VN 2C5AA 1KBQA 1V7CA 1CV2A 2X3UA 1CP2A 1FQOA 3DFIA 3NAZA 4UZSA 1EWTA 1MB9A 2KLHA 1K8XB 3IOEA 4ARIA 1NW8A 1P3Y1 2YVQA 2AYXA 3LW7A 4NDNE 1BD4A 1Z56C 3ILYA 1Z62A 3L0OA 2IP4A 4NS4A 3ZHTA 1OZGA 2V3VA 1FLDA 2AMVA 3DMNA 2X1LA 1PR0A 3NBQA 2RHGB 2OFFA 4HQOA 1UC5B 2DPHA 4G4JA 4A82A 1OBHA 2I8LA 1QGYA 4DG8A 1G6HA 3ONEA 5KTTA 2DPLA 4KXFB 2OCDA 4BMZA 1BHJA 1KEUA 3PC8A 2QU7A 3ISJA 3I01M 2VOEA 4R51A 3ZWDA 3PWSA 1Y8ZA 3H8WA 2GZDA 3OCJA 4CQLB 4V0OA 5EHNA 2QMZA 1HMPA 3CZ9A 2PUAA 2VA8A 2X9GA 4QRDA 5EVCA 5IBRA 1E3WA 2CZCA 4MWBA 4XWGA 4IGFA 4ZREA 4ZALA 2Q7OE 4EI8A 4B3TB 4ZT2A 4C3ZA 3HM9A 4U5XA 5E7JA 4E30A 3Q2OA 2IDMA 5BRNA 3FTDA 3FH0A 1SUDA 3HR8A 3VYUB 4RKEA 4UNNA 1DJQA 1U28C 3WOVA 3U5ZB 5C8YA 4KQKA 1NBAA 3MINB 4FN5A 5CT8A 4MUHA 2WG0A 2ZT5A 3GAMA 5B3JC 4NBTA 4A5SA 2FA9A 2ZRLA 4GM4A 1V5IA 4RTQA 1UKEA 4RTOA 4E7PA 1I1QB 1YQWA 3F49S 1JDJA 3T9EA 2QVXX 2JH9A 1SU4A 2WT8A 2GK7A 1ZY2A 1RLJA 4IV5A 4IWYA 3ZJYA 1PJLA 3HI6A 3QVGB 4OJTA 4URFA 3SWWA 1QCDA 3BMXA 4PNZA 4INJA 4WA7A 1MVLA 4L2IA 4Y0AA 5DHQA 3CUWA 4YXWA 3TKYA 1TO6A 3KKZA 2FQXA 1PLLA 2GASA 3GJ3A 4Q02A 3EEOA 1WD7A 5MFZA 4F38A 4GPIB 1G8HA 5IC6A 1H2BA 3DR5A 5AI9A 2EBUA 2Q4BA 4HEA1 4JC0A 4Y2PA 4JLBA 1X9IA 3PLAE 1GHTA 2D5AA 1U1GA 3EGOA 3CLSC 4A1OA 5L7TA 2BKUA 3DLHA 3EVAA 1GT91 3OZEA 1QBGA 5JDCC 1G98A 5J4VA 1YMUA 4YRTA 1QUFA 2JGNA 2NTEA 3IQEA 5DBOA 2QX4A 4C3UA 5HCIA 3TEMA 2P9QA 2IEIA 5ALIA 4S12A 5HEKA 3VKUA 3DZFA 2J08A 2ZYDA 3K2IA 3L6RA 3VMFA 3HWRA 5JCZA 1VBKA 3V8VA 5BMVF 1I80A 1QUEA 2C0QA 4UUNA 5DHTA 4FZVA 4GR4A 1YXMA 3WYDA 1QHGA 3NX4A 4NQZA 2G17A 2N0SA 2HC9A 3H5LA 3WWDA 3H8JA 4JLWA 1U98A 2IUTA 4GPBA 1D6SA 4MJXA 4UAJA 4QDJA 3H1BA 3OHSX 3MUOA 3DBOB 4JBXA 4N54A 3LPMA 3ZCPA 5B12A 1N33B 3PQ7A 4KO8A 4M53A 3NHYA 4IBOA 5C1IA 4MR9A 2HA6A 4QQNA 2X0FA 3DT8A 4EG5A 4NBUA 2G1JA 1P4HA 1TOAA 1JSCA 3L02A 4HAZA 1T6ZA 3R5KA 4J16C 4NJEB 1VJCA 5ALWA 1W36D 2ODWA 3E8SA 3G0CA 4JT4A 4DQVA 3VYSB 4HAIA 4C08A 2PFSA 3RSQA 5IT9A 4HXGA 3L0SA 1DOZA 4JU8A 4DLXA 3IP5A 3IAXA 1BJTA 4Q0MA 2E21A 2NU8A 1MOQA 2GPYA 3H2SA 3LOPA 1NSFA 1QS0B 2FSIA 4MKXA 1NJFA 4NJMB 4CLHA 1DI0A 5JLJA 1DJMA 3HFRA 4M1OA 1NHGA 4RZQA 3D1VA 2JI9A 2BEWA 4AZ3A 1C3LA 3D02A 4MEBA 4U2EA 4WV3A 2PD6A 4OCZA 1MAWA 2CV2A 4B2YA 2GJ8A 3THWB 4AB1A 4B31A 2Q6OA 3SAJA 2A9KA 4AUKA 1KRWA 2VNJA 4DXDA 1BJKA 1BTOA 1CHDA 1F60A 1DIBA 2O8VA 3OVMA 4FWBA 4WX2B 4U2CA 4RSMA 3RHSA 2AYZA 3WDLA 1NW4A 3KC2A 3JU3A 4U9HS 4BPRA 4CLXA 1O3YA 1W30A 4YJGB 4XIJA 3SXPA 2E4ZA 1GRCA 2POQX 1EU1A 5E38A 3L8CA 3HL4A 1H6DA 3S2IA 1QH1B 1DEXA 4RX1A 1MQ9A 5I7HA 4R8MA 4GVLA 3K8OE 5CH3A 1WBJB 1X77A 1GPWB 1YR6A 2CYBA 3LT0A 5FA6A 2NVWA 3QLUC 1NJ5A 1K89A 1H2AS 2HJRA 1R0KA 2NGRA 1EGAA 2PT6A 4TMWA 2QT9A 5DBFA 5DTEA 1G20B 5IN5A 5KTRA 1N6LA 2LNDA 4IGAA 1TZKA 1K7YA 2C4KA 1W9HA 2I3DA 3E9MA 3W3AA 2XWJI 2ZJZA 4ZWNA 2R3SA 4ZCPA 5B2ZA 2QTZA 3P9KA 2BE7A 1U1DA 2WAMA 4QXRA 4RJLA 1LBQA 1OKKD 2JGDA 4P2BA 2JASA 3PNPA 4G5OA 1G6Q1 4N7JA 4PYIA 3RRNA 2ASEA 2ZCUA 5DNDA 5INTA 5ALUA 3AL3A 4RV5A 1BZYA 2AZDA 1E79A 1FJHA 4M8LA 1W1IA 3ZU6A 3R3WA 2GPTA 4M76B 3RLIA 1PSWA 2ODTX 3T5DA 1YQGA 2LCIA 1G2IA 3LYLA 2Q07A 3H6HA 3NEJA 5FF9A 1XFAA 5C18A 2Q21A 5BNZA 2YINC 2RGWA 4F1KA 1ORIA 3ZI4A 1JNYA 1HDEA 2PT7A 1U2EA 2OV2A 3R3SA 3D6JA 5HWSA 2WIJA 2E6KA 2FCAA 4B4WA 3LDAA 4I4NA 1RBZA 1VXOA 1E66A 2OHHA 3A4VA 3T3PB 1QVVA 3ZE9A 2WPDD 4MQEB 2QD3A 4LJLA 2G71A 1YS6A 3IESA 4GKVA 4IJVA 3KAKA 3VHRA 2OWDA 3LO5A 2O2CA 5LWQA 2AZXA 4PIMA 2PQ0A 4ILEA 4LRSB 1EEHA 3RSFA 1UT8A 2ZAIA 2ZPAA 1QQTA 3ESXA 3FYUA 4W8OA 3JQAD 3SOPA 3NM5A 5B7PA 5IMSA 1KR2A 3Q4GA 4ZICA 2MSNA 2QY6A 4AQYB 4BQOA 4OHYA 3S2YA 3QUSA 3T3HA 1I01A 3DNPA 3N39C 1TJ3A 3RC2A 4TMFA 2O3UA 1LA2A 1I7DA 3NR2A 1M54A 2YYAA 3C3KA 3PC3A 4Y2UA 1KU0A 1TF2A 1Z35A 5F7JA 2EZ9A 3I0ZA 3UJAA 4QTTB 4DIKA 4Z54A 4LJ9A 5H3CA 1GNQA 4ZVLA 2V4ZA 4R8LA 1G19A 5JZVA 3P9IA 5HS4A 4BGDA 4OBXA 3BXXA 3Q1KA 4HDMB 1RZVA 2HLHA 2WWXA 4ZOBA 3JZMA 3WGGA 4BQFA 2OMKA 2PR2A 3QWHA 1U9CA 1FDIA 3CZRA 4K9KA 2Z57A 4YCAA 1G38A 4FC6A 4Q93A 4ZAZA 4G85A 1KYVA 1G4HA 4IMIB 1DARA 5FLEX 3GJ4A 1T3HA 1KORA 2VUIB 4FHGA 3IO3A 4LNUB 3B1XA 1RM0A 1JQJC 1CPYA 2FN9A 2VYQA 3KYDB 4K6CA 2V7BA 2B4AA 3T0GA 5AUPB 2ZZMA 4ACBA 1OXXK 4QJIA 2PN1A 2YL2A 4R2XA 1GNTA 3ZE8A 1SEVA 1KJYA 4BO8A 3S8YA 2B61A 3FRHA 3KJQA 4A5OA 4D4GA 3BIJA 1M0SA 2V8BA 4U6QA 5AKGA 1IM2A 5AXCA 1UM9B 2D7JA 5DXFA 5JPIA 1AMUA 4QDOA 4C7KA 1MR3F 1QQAA 1HE2A 2UZIR 5BWBA 3NGXA 4QUGA 4BAUA 5LDHA 5B7NA 1KE1A 1G42A 1JTVA 2JIMA 4OFWA 3MQ2A 1YC2A 1KS2A 1PI3A 1IY8A 4O33A 4QOSA 5DDIP 3ZVKA 1K9SA 3O4JA 4XLLA 3PRKE 4C7XA 5IKEA 1G4AE 4UFPA 5JZMA 1UEXC 1WSDA 3MRXA 4MRNA 1TAHA 1EVQA 3V1YA 5JAHA 3V8QA 1M1YB 5JWOA 4HP8A 3THYA 1XMQB 3SHTA 1U2GA 3DJYA 3UMFA 4ID3A 2GAFA 4ZVPA 2F1KA 3EOBI 5I8ZA 4ZCIA 5JH7F 1U3WA 2AN3A 3D6NB 1ZSVA 3SX4A 2QVGA 1YU6A 4FPXA 4ARZB 5JS7A 1AT1A 1VGVA 5IX8A 4K87A 3EZFA 3MERA 5AYVA 1JA9A 4AIIA 5FOQA 4ANFA 4DQUA 4AN1A 1MN6A 5FJJA 4MIOA 3ZHQA 5JSFA 2W6JD 1BX0A 2YV3A 3KWFA 4GNRA 2HCRA 1JHQA 3WQBA 1NUAA 3HEBA 3T12A 5I7EA 2DWCA 2X13A 3A9CA 4DCVA 1AGRA 3ZD9A 1MZVA 2GPAA 5CLJA 3UJ9A 3PX7A 1YS9A 1T0PA 3PNSA 2QL7A 4IJ5A 1Q0QA 3OLYA 3RS7A 1BRMA 2IHNA 1KHHA 2DRIA 2C0PA 4H08A 3U3DA 5GIPE 4M4SA 3TCXB 2EKBA 2LBPA 1GTMA 1WXFA 1M75A 2HQBA 5FYDA 2BELA 4CEIB 5BSTA 3DWGA 4IVNA 1J8FA 4EPXA 2D54A 2H65A 1Z0SA 2MSCB 1GGVA 1VL1A 2VPWA 2R6GA 3EH1A 3NHSA 1VSVA 4F56A 1RXVA 5GV7A 3VR0A 3H84A 3N1UA 2CUTA 1V25A 4H7IA 1ONBA 2NXNA 4AY2A 4Q9DA 1KK1A 5P21A 4AJ2A 2Q2OA 2XB9A 4GZ6A 2WVJA 3F74A 3GA0A 1I2BA 4NMXB 3OF2A 5FOUA 3UV3A 5JZBA 3WQHA 2J6CA 4PO1A 1NR1A 2AEEA 3PXBA 1FDOA 3F3YA 4KXMA 1PQ4A 1QV7A 2DT5A 2FOXA 4OXQA 4GGMX 4E14A 4DIOA 5ITWA 3JQ9C 4PIPA 3ZHZA 1P7ZA 1ZUNA 2H1HA 3LX6A 3L5KA 2CZGA 1XN4A 2J3IA 2P4QA 3MT0A 3PDUA 1ENOA 3RT1A 2YBDA 4CFZA 2CDNA 3R77A 1KA9H 1C4WA 1GQSA 2JAUA 3OWOA 2CSUA 1P81A 3PFNA 1KPIA 1P17A 1E7RA 4E5KA 1NVFA 3HLTA 3CGGA 2QEQA 5FWYB 2HWUA 3VPFA 4MQFB 1G7SA 1WQ4A 3KZOA 4I3GA 2EQ5A 2VP9A 5I9MA 1Z0UA 3ITDA 3PR2B 3TLXA 1YONA 1V5GA 4JP8A 4EY4A 2R7AA 4J1QA 4GNKA 1D7AA 1RCTE 2CFSA 2Z4RA 3HRKA 4OLFA 4V0RA 4EHAA 1FDRA 1I24A 4JMPA 1JQEA 3F2VA 3I39X 3PNYA 3PDWA 2BEKA 3AOGA 3DZCA 2EL9A 3LRXA 2MOKA 3AXSA 3EY9A 4Y9RA 5D5PA 4L27A 2YFKA 3L6OO 1EUDB 3WDSA 1YR8A 1PV4A 4KI7A 3G8YA 4TRJA 4BEWA 1DKOA 2JIZD 4TZTA 3P0JA 3RQSA 3WNBA 1ZD3A 3GVHA 3FUXA 4DCMA 5HX7A 1VOTA 2H4FA 3T4UA 4ALMA 4ZO8A 3G3EA 3P52A 2D5CA 2Q29A 5A7GA 1CVRA 1B41A 1P7WA 5DYIA 1RJ9A 1Y33E 2G9RA 3HU3A 1NUPA 1Z0FA 3BM5A 1EFVA 3LUHA 2R1TB 4P58A 4X54A 4MP8A 1IRIA 2ZWAA 3RVDA 3KQUA 3HVJA 4DIUA 2PE5A 2BRUC 3A1DA 4MGEA 1AG9A 2Q41A 4ZAFA 2ZIAA 3H86A 4A0SA 3DTVB 1PF7E 1RLMA 1X39A 1ML3A 2O4CA 4CHGA 4DG5A 4UQOA 3K9CA 3QE3A 2CVFA 2VYVA 3HUEA 3NQ41 1JPUA 4I2VA 4DB4A 1G41A 4J7CA 5KINB 2ZZNA 3GEPA 4GIBA 5COAA 5F1YA 2FRDA 4ZDKA 5CXXA 4TVOA 3L4BC 4EVIA 2NP7A 1LEHA 2Q5LA 2ZBVA 4RJIA 4WWHA 4YUZA 2GPSA 1RBQA 2BVNA 2IRWA 1QPGA 3IB3A 4KO2S 4PYQA 4WA8A 1AGNA 1WR8A 3ZLUA 2UXCB 3IGFA 3N59A 5AJWA 5E6RB 1OWPA 3A28A 4PVCA 4JAVC 3ZTTA 4AO7A 3S8MA 3PD7A 3NI2A 3NG1A 3B3JA 3MGGA 5DNVA 1KQNA 3S2UA 1IQPA 2FPUA 1DBIA 4Z53A 4ZOLF 3LRTA 1OX6A 2AIRA 5HKOA 1JVNA 3PVCA 3EDYA 1I7LA 1VMEA 3GAAA 1TQ4A 1HURA 2DHDA 3AVXA 4BP3A 4ZA2A 4IZIA 3AO0B 1ABEA 2WD8A 3UMCA 4DV3B 3EQ9A 4TTTS 3ZWXA 5TQJA 1N8SA 4XOUA 4ZDJA 1EDEA 4DR2B 1XNJA 4JV5B 3OM1A 4IIUA 5E95A 1GUZA 1UT5A 1FYDA 4IR7A 1OX4A 3GZNA 1GUDA 3D6TB 3OAAD 4OM8A 3WNQA 4EYKA 5CM8B 1N6RA 2VKTA 3H9CA 5KQLA 2PKCA 1BHO1 3OQ6A 1XTJA 2QSUA 3HCBA 1GSAA 1JIJA 1KIAA 1SBNE 2CDBA 3DAHA 4E1AA 3IOBA 3T3EA 1FDWA 4A91A 2GAJA 2HEIA 3X1DA 4G0MA 3W9YA 2XMBA 3DEFA 4F85A 4GEGA 4MP3A 2HSWA 3AHIA 3HU5A 4M0MA 4BWVA 4C1NA 4J1SA 3ZVMA 1YGYA 1EUCB 5FI3A 1Y7IA 3FWNA 3KLOA 3OE1A 3V7YA 4TTIA 1Z38A 4E5UA 4EO7A 1CJSA 1VKHA 4JX9A 4RVHA 1EWQA 3L1IA 5AI0A 1Q5PA 4OB6A 4REMA 1C8VB 5FPHA 2OB2A 4TTPA 3IEPA 2QMUA 4P81A 1WPQA 4BNNA 1EVKA 1Y6RA 4II3A 3H0EA 1QYVA 4UATA 4YK7A 4UOEA 3BULA 3CRRA 3O73A 3P20A 2PGOA 5IRCD 1YB4A 3AKZA 4NECA 4I4TB 1NP7A 5AVSA 3HABA 3V1KA 2QPAA 5EQDA 1SXJC 3BIOA 4YAIA 5CYFA 2DUUA 3AT1A 3BEOA 5JTUA 4D9IA 2BKAA 1O54A 4Q1AA 4CCYB 1ZEJA 3L6UA 3PC2A 8AT1A 1F4LA 1U9IC 2HF9A 3R0ZA 1CEXA 2L2QA 1T4CB 3H3XA 3NC0C 4ROTA 3HB0A 5E3IA 3TPZA 5ADUS 1Y80A 1XELA 1FXUA 5TGTA 3BAZA 3FR8A 4B9EA 3L01A 2V3CC 3IMGA 3WLIA 4QUBA 4XB2A 3HFJA 4C0XA 1GUFA 2VEOA 1H2YA 1W5AA 1C9KA 3NTQA 1R4AA 4JA0A 1A77A 4MV5A 5GINE 2FGKA 2IE8A 1VBFA 1L8XA 2J46A 3HB5X 4DLNA 1RJGA 3RVKA 2Q9CA 3BGOS 4LMRA 2DQZA 4PINA 4WBNA 2ZTMA 3AI7A 3H9UA 2HSDA 3ZY4A 2YFYA 3HNRA 4G01B 2BM9A 3D8UA 3AHJA 4ACAA 1JHRA 2W6OA 3JR3A 1RI5A 1SHUX 2E4WA 3A3PA 4IO1A 4JI2B 4BFZA 4F6RA 3VSBA 2ORWA 2OV4A 1G2QA 2FHSA 4XIFA 4E11A 1WSBA 1E3EA 2CE7A 1QORA 4D9GA 1WCIB 4FI3C 3KT3A 1INLA 2C3PA 2WSLA 2NU6B 1A71A 1YHNA 1E4YA 2C07A 3GRKA 5A4IS 1VIYA 2HMAA 3L1KA 5G3ZA 4E07A 3DDUA 4K81B 4R8VA 1ZGBA 4A10A 3FJYA 1AKUA 5B4UA 1TU0A 2ISQA 1IBRA 2J9YB 2IYOA 5FBKA 2OCAA 3NKFA 3O95A 3GIDA 2GKGA 4M0KA 3UM9A 3LQQA 4U2GA 3WIOA 3R9WA 2O8FB 2VBFA 1XNHA 4KITB 2PX3A 1KIMA 1Y1PA 3ROQA 4RCVA 1O9HA 4HRVA 1KMHB 4IXDA 1Y81A 4FQ5A 3AIIA 5T64A 5K6AA 4ZYWA 2XBLA 3W5AA 2R47A 3AFOA 4A2PA 4P7KA 1JEYB 5B57C 3RC9A 3LC0A 1IUPA 3WKAA 1J09A 1ZCAA 4AJEA 5CCEA 1WBDA 2ZBPA 3VBCA 2EZUA 4AG5A 1ISIA 1C9DB 1ZJYA 4F96A 1CVLA 5C2JB 5LQCA 3SEAA 4CTOA 2IU4A 4RULA 1GGNA 5CLGA 5AT1A 5BN4B 1RBMA 1MIOB 2IXEA 4NMLA 2FF7A 3F6BX 4XPZA 4UEQA 4C78A 1KH3A 4LF4B 3M5DA 2C9OA 3QELA 2QVZX 3C8HA 1G3UA 2IGTA 3LW8A 2VH2A 2YZ7A 1TVKB 3DBVO 1R64A 3K6JA 4LN1A 1M34A 2H4HA 2AR0A 3SC2B 1E6UA 3DZ8A 1VRWA 2QUZA 4EI2A 4JA2A 1JEQB 3WL6A 4XTCS 3A37A 1ENYA 5H4HA 4BNJA 1WOMA 2WSYB 1FRZA 2WKRA 2ZB4A 2V0GA 2CXTA 2QYTA 3HR4A 4DQDA 2HWXA 3J7TA 3MGKA 1IHYA 1IWPB 2HDHA 2O4UX 3Q7TA 2NP6A 2FSUA 4JUIA 3GMSA 1VPEA 1XQXA 1FS4A 1ZD1A 3VSCA 4EG4A 5BVHB 5KU1A 3URMA 3MWYW 5E9WA 2IYUA 2QUAA 4CM8A 4CODB 1BE0A 4DLLA 2B4TO 4F8JA 1XIVA 4LVUA 1C9EA 5CG1A 3PI7A 1IDOA 5FYQA 1GZ7A 3COJA 1JHXA 1OD6A 3RE1A 4EARA 4JOBA 2DECA 4R71A 5FTLA 4DM7A 1UAAA 3GLHE 2YHIA 3FMPB 2O5VA 2W2MA 3BFVA 3OLQA 3N0RA 1Y0BA 3QF7A 3RIEA 5C31A 3IH5A 1T43A 4O4LB 2J9FB 3RC1A 2CXXA 4QPDA 4XM1A 1V35A 1ZCZA 1V6AA 2I3AA 3OIVA 3NOQA 4GXTA 2DQ4A 4V2UA 2JBAA 2CBXA 2O52A 2PLRA 3D3WA 3PGJA 4ND5A 4EJ2A 2D0PB 3BMCB 1OYOA 2ZJ6A 3TVYA 2CW5A 2JJ1A 2PZLA 4Q16A 3VR5H 3FVVA 2WJHA 5DGIA 3P4YA 3BREA 3KPYA 4HVTA 4R31A 3U4QA 3O8OA 1KZ6A 3GDHA 1UAYA 3ER8A 4FCWA 2GDZA 1CR4A 4CM3A 5I4IA 5JAIA 3V4RA 1QWSA 3L8MA 2FUKA 5ICMA 1SCNE 4JASB 4JJAA 1U3UA 2RBKA 3ANXA 2QZPA 2J9ZB 2SHKA 5KVSA 4BLUA 3RUPA 1XROA 2IOQA 1T29A 4Q7KA 4FFSA 5ITSA 3OQIA 1Q17A 2GFQA 1XQWA 3LFUA 1HX7A 1D4OA 3E22A 2R00A 3WTCA 1RE1A 1RM3A 2Z6UA 3OIUA 4WY8A 4Y1EA 2QNBA 2XE8A 4Z3DA 1D5WA 2D4AA 4ZGWA 1EI9A 2O5RA 3GUZA 4NBKA 3CRQA 3U3JA 4GL2A 1WG8A 2PGXA 4Q03A 4QGFA 5GP1A 1E2GA 3UUGA 3WGMA 1YBVA 4OI4A 3ST7A 2WIGA 1V16B 3E6AA 1YVDA 4KIJA 3AXTA 3BDAA 1OASA 2ZR8A 2ZI6A 3HSKA 1ETUA 3C6QA 4ZHSA 5DTQA 3BERA 3K5PA 1O8CA 3WL4A 2C7OA 4IQGA 3QXCA 3WLKX 4LGMA 3FBGA 2C0CA 4RU1A 3WY9A 5H3LA 3M6LA 5HF9A 5B64A 3OQNA 1A4IA 1RWKA 4UTNA 1DG1G 1QGAA 2CJWB 3MWLA 1GIAA 1XQ9A 3PYXA 3ZV6A 3JYNA 4CQJA 4MVJD 1GTL1 1T34A 4FFDA 5CXSA 5DLPA 3RGGA 5DI9A 2AD5A 5GZ1A 1NF9A 5CFLA 4QM6A 1TA9A 2F3QA 2GZ2A 4OQ4A 4INZA 1WNTA 3P1JA 5IS2A 2GCEA 4K9LA 4EMBA 1KU6A 2FPMA 3GGOA 3RS4A 1XDWA 3E0QA 5D1NA 3SEQA 2VF8A 4LSZA 3WLAA 1Z5VA 5A02A 4XWKA 5BNTA 4G1MB 3AFHA 3PQ4A 5M3BA 3ZD6A 4R05A 4Q1VA 2ZAMA 1O08A 3UW1A 1YRYE 5JS8A 1XP5A 2EX0A 4QELA 3GEHA 1BFKA 1BO6A 1H5UA 1N2ZA 2AKAB 4F45A 1Z4IA 2UZAA 3H0KA 3QIVA 3IR5A 1RRKA 3PXDA 2CT8A 1Z83A 4W1PA 5DLDA 2G5PA 3HXKA 4EY6A 3N7TA 3E35A 4Z8YA 2EKLA 1TK9A 3T5BA 2YQ4A 2NZUG 4CKBB 5U4XA 4WCDA 1VHQA 1IXZA 1AF4A 1BWQA 1NL3A 1ZH2A 4ZK6A 2GUWA 3OIDA 1E1RA 2YWCA 3ORYA 4HDOB 3OKCA 4J0IA 4B6SA 4XYBA 1PL6A 2GO1A 2JEOA 3DO8A 5EXSA 1Z4OA 4DNFA 1PUXA 2VRBA 3EUWA 4LJKA 4LUCA 2XQVA 3RSCA 2F48A 2OXEA 3EARA 3L6DA 2HM7A 4L75A 5SV2A 3VV3A 2FWNA 2QUJA 1G5HA 2VCYA 4KFUA 1ZISA 5CBPB 2QQGA 1AS3A 3C6XA 4QXQA 3AGPA 3L18A 2DFNA 2ZTHA 1PW5A 1XLWA 5GVRA 2Y1GA 3JZDA 2GBGA 3CRVA 3I04A 2D5BA 5T6BA 1HYBA 4MHOA 3NVKI 3EYWA 4MCIA 2X22A 1P9RA 2X5KO 2ZXEA 1SG9A 3IAS1 5K8JB 3M34A 2Q3EA 1UINA 3PA6A 1JHPA 4PPNA 5F3RA 4EB6A 4BU1A 1I13A 1UK8A 4DLUA 1EA5A 5IMBA 3NEYA 4OQDA 1E6CA 3WJ2A 4ASUA 4KZKA 2NAPA 4WKOA 2XYHA 4HXFB 3O82A 4A9AA 5E0OA 1KDOA 1ZS9A 3RAJA 1NW6A 4JQOA 4E5PA 3IPAA 5EJ8A 5JYEA 3H16A 4JR1A 3HB7A 1XZKA 1XEAA 5AKLA 2BFAA 4PLWA 5BORA 4JLAA 3FTQA 1EFPB 3F4BA 4OJYA 1YGPA 4B35A 4LNHA 4HWSA 1Y7HA 3Q5DA 3KUDA 1WCWA 1FSZA 4HPJB 4L72A 3S7ZA 5A9RA 4H1VA 4IJKA 3GRFA 4BQPA 2RG7A 1X94A 2NQ8A 1E7YA 2HRQA 3B6KA 2YS6A 3JAKA 3L84A 1PLKA 2BC9A 1V3TA 3OFND 5D00A 1OGJA 3VNVA 1XZPA 4MLCA 1U8ZA 4GLLA 2WFLB 3GAZA 3Q12A 3CLTC 5HTOA 1CUCA 1G21E 2ACEA 1Y1TA 1T3SA 2AX3A 3AFMA 3FWZA 1E2LA 4IIJA 4F2HA 3N5CA 1GKKA 4G0NA 3GGGA 3TQCA 1QP7A 5K2OA 1XDSA 2XXBA 4CRWB 1UDRA 4I99A 3JQEA 1V9CA 1S89A 3L07A 4MI3A 1JLSA 4AZ0A 5JANA 3NDBB 3SSOA 5COQA 5KVCA 1T5BA 4F91B 521PA 3MQFA 2O8DA 4BO1A 1VCMA 2PBZA 4CCAA 2UYHA 4MVJF 3O21A 1U02A 1PFGA 3C7TA 2ZVDA 3ICCA 3L4KA 2IYVA 1RQXA 4HI0E 4U2DA 3TAUA 4AKSA 3UFXA 1ZL0A 1IRXA 4M6WA 3I5UA 4WNAB 1KF0A 1SPBS 2B7BA 2BZGA 2O7RA 3H04A 3N28A 4Q15A 3ZXXA 1EK0A 2O7NA 3OLXA 4D56A 1ONNA 5DLYA 4JB2A 5E4TA 2HK9A 3B78A 3TUJC 4EBFA 5C32A 3RIGA 2OZKA 5GGYA 1FZTA 1IMOA 1NJ8A 1GXSA 4RE5A 5F5NA 3S40A 1NV9A 4QYMA 3JD0A 3P27A 5ERYA 4I8IA 5CLQA 1QOPB 2ZQ5A 4MRMA 7YASA 2AFRA 1JZSA 1MJ5A 2D00A 3HKEB 3WL3A 1S4MA 5LQDA 3UGJA 1WKBA 1PW7A 1YB1A 2XMPA 5FB3A 3PU6A 4OP3A 4DJAA 3U56A 3Q2KA 4J0GA 3ZTWA 4CTJA 2VHWA 4K0KB 1G8PA 2HDNB 1RRPA 4X8MA 1NWCA 4MWZA 1OXTA 4ZK2A 5C46F 2X8JB 1TAGA 2A33A 2PGJA 1GLGA 2J3KA 1NXSA 4HOYA 2QN7A 3OFKA 4IEFB 2X9QA 1RD4A 3E8MA 2OBYA 1UP7A 4EPTA 1E3IA 3D6MA 4WLEA 5K3AA 3TAXA 3COWA 2ID9A 2VVTA 4DYHA 4ENUA 5IJ0A 5EIBC 1X2BA 2R60A 3KFLA 5AJZA 1QAOA 4XZ3A 5D84A 4I9GA 2R11A 1FL9A 5ALPA 4H0FA 5EMNA 1XAHA 5K51A 4YMTA 2DP4E 3DE5X 1WKVA 4N9QA 2GMWA 4Q1EA 5KPDA 2R86A 4RPJA 1I1HA 5CT9A 1LW6E 3AEKB 1RXCA 3HHPA 3S7TA 1S2GA 4LYEA 4CL8A 1CK4A 4JP3A 4J2OA 1RFLA 1JHOA 1EM8A 1SPXA 4CIVA 1R8SA 2CHQA 2H5EA 2UZ1B 1N9KA 3NVDA 4JOQA 3X2FA 5CA1B 4DVJA 6REQA 5FV4A 3SBXA 1G17A 4X1YA 2O3JA 4EPVA 1WU7A 3KHSA 3AL2A 3ILSA 2D3WA 4FEAA 1TU3A 2EYUA 4DGSA 3GJQA 4OGFA 3G8BA 4YRBA 4V3BA 4PXAA 3UQZA 3IEUA 4Z51A 2Y1DA 3IP3A 1WXDA 4YY3B 3A58B 4GICA 3FUWA 4Q05A 4Q4JB 4BO9A 3AP2A 3CSSA 2HPZA 3P0HA 3Q9LA 5BW8A 2Q2QA 2UZ4A 4H35A 1Z45A 4HDKB 4BNHA 4CN8A 1ARZA 2ZP1A 1REQA 2Q3HA 1A8QA 2RH5A 5C1OA 3SIXA 5GTDA 4ZI5A 1WABA 1XZNA 4O2LA 2CLDX 3P2KA 3VVLA 3QPBA 1F1BA 3PUZA 1P0CA 1VL2A 5BSMA 1AQ6A 4ETNA 1RDFA 5TF4A 5CD1A 1DFHA 1H93A 2OQRA 1HE5A 1X80A 2A1TS 2JVKA 4LJSA 3C6ZA 4GOMD 4LNAA 4RIGA 5D7BA 5EIFA 4V1CB 5J4YA 3ETGA 2OG2A 5CT6A 3BL8A 5K3BA 3BZWA 5U9CA 3G9XA 2FUG1 3CUVA 1SUFA 1L5VA 3JW8A 7ABPA 5DNCA 1XTQA 5J2TF 1GGKA 1IM8A 3PJFA 3DMHA 3OZGA 2ZB3A 4C2AA 4C4AA 5CG2A 2RH4A 2YQ5A 1IOLA 2JI7A 1UBOS 2G63A 1OIWA 2HIHA 1A9YA 2P9ZA 4J49A 3SZGA 5KYKA 5C52B 3GJ7A 1WNFA 1ZHHA 4HNVA 3K5IA 3I2HA 4L57A 5AIBA 3BWYA 4DUZB 3I1IA 3L8ZA 1NLZA 1R3DA 3ORRA 3TSAA 1L7MA 2VZ9A 3NBKA 5IUKC 4HTAA 4IUCS 1ID1A 2PA0A 1BH6A 3HKBB 4HH4A 3T15A 4F2GA 1CHNA 4GKBA 3H2IA 2OESA 2NZ2A 3SBEA 3N0VA 4Q3KA 3H1PA 1LRKA 1D09A 1ZRNA 3TL3A 1C0KA 3M4YA 4NF2A 3S8EA 4QQKA 1JMKC 3DOUA 4GR9A 4Q4DA 5B55A 3DMTC 5HE9A 2XYGA 1B1AA 2XVYA 3B3FA 2Q5JA 4C03A 1QK4A 3BMOA 4I55B 4QBGB 1QRSA 4NQRA 3IT0A 3A9VA 4JVSB 1U5BA 4CUJA 2EFCB 4KGVA 4MO2A 5JCPA 2BHLA 4FSXA 4TM8A 1THGA 5JD4A 2IS4A 1F8YA 1O6ZA 2ECKA 4FXOA 3DD5A 4NI5A 4YYZA 1WB9A 3PXEA 4L8GA 1AN0A 5IKXA 3ZCXA 1M1UA 2RARA 1J8YF 4JBYA 1EHYA 2JHAA 2D1RA 2OZLA 3AVOA 3KB2A 4DRZA 5KMGB 3KE8A 1GDTA 5LQNA 1H05A 5B37A 4AJ4A 3OX1A 4PGHA 3MVEA 5BR8B 4AS1A 2CHUA 1JJIA 2ON6A 3KLBA 4ZI7B 1XA0A 2P40A 4KNYA 5LA6B 1P80A 3TUZC 1N2XA 2FXIA 4AI6A 2VHCA 1J56A 2OAGA 3H65A 3UH1A 5HZHA 2ZI7A 2YVAA 4RF2A 2Z9DA 2I6QA 2NUPA 3G88A 3PNQA 4QHTA 1UR5A 3GLHA 1C2YA 4L3OA 1SM4A 3CZ4A 3PL5A 1QHHA 2HJVA 3IKMB 4YMSA 1Y3HA 3AFIA 4ZAYA 5FUYA 3NYRA 3R23A 3UB3A 1P2BA 5IH3A 4KWCA 1XK6A 3VZBA 2VJBA 5BNWA 2GYWA 1WBBA 4TS4A 2GCNA 5C5CA 3PV0A 5MN5A 2H11A 5K2MA 3VR5A 2FFAA 3QKRB 3D4NA 4LTDA 4QFMA 1OTYA 4CIWA 1E3WB 1LGYA 2P9EA 1SU6A 4UVIA 4L08A 4EHKA 1M7HA 2O7SA 3U62A 5LZ4A 1VHLA 5TV2A 2Z3VA 1Y3CE 2REXB 2B99A 1M76A 4KACA 4Q39A 2RH8A 3QJYA 4JQYA 1RKUA 1TVEA 2ZIUB 2HHAA 1AQUA 3Q7RA 1HYHA 5C8YB 2HBRA 3O8QB 4KAJA 1R4MA 2IYAA 3NUGA 4MZDA 1CT9A 1DE0A 2C42A 2HBYA 3ZYCA 4WVLA 1IQ0A 2J9RA 4IGKA 4E3WA 1LRJA 2PH1A 4QDUA 4X84A 3V34A 2C83A 1YD7A 3QLTA 3V6MA 4C0SA 1UKYA 3IKVA 1HDXA 2UYCA 2QN2A 3CRNA 4JSTA 3T4PA 3VBEA 1QV6A 2P1DA 2RK4A 5G0UA 4B43A 1RTKA 3QA9A 3RRXA 4L2IB 2HH9A 3PQ3A 2ZSFA 4JJKA 2CCGA 2A9QA 2WT4A 3EZ9A 4M37A 2ZYUX 1GO2A 1Q22A 2CFOA 2QG4A 3A1SA 4P4NA 3HMKA 4EA7A 1U9YA 2VNSA 5TIIA 1H0RA 1FNBA 3VA7A 2IHYA 3OJOA 3TW8A 4CG3A 1JECA 2FRVA 3LBFA 1BE6A 5DTRA 2DZDA 2W83A 2OCYC 4GS5A 5DK6A 2ZI5A 2J5XA 2FMKA 2M9MA 2CV0A 1KVRA 3N2YA 3ZBUA 4FUQA 1DAFA 2C5SA 3NOOA 5JXIA 3P45A 2BWJA 3OCUA 3C6MA 5EJMA 4E3ZA 1XVTA 4R9UC 3FLMA 4WK6A 4A0GA 4D5GA 1CIPA 3O2QB 1IH8A 3OTHA 1WOYA 3CUKA 2EFYA 2ZFUA 3CZMA 3K09A 1ZD4A 1YSCA 3UOWA 1NNSA 3BCSA 1ZKDA 1XEXA 3KP1A 3RTDA 3SOZA 1E6MA 4EEZA 1WY5A 2VHQA 1EJ2A 4LJRA 3TGPA 3EXFA 1YJXA 3L0ZA 4KQMA 1YB6A 4YACA 5KS2A 2FXVA 4QRHA 4HNTA 3EEFA 2VSQA 2JIQA 1OPRA 2ZJ3A 2YN4A 5TMDA 1AX9A 2ARKA 2F9LA 4F4UA 3RBXA 1GPKA 4BLOA 1AQIA 4CF7A 3VV2A 1HOTA 2NU8B 4GKKB 3C97A 2XGOA 1EK6A 2BEVA 2YMQA 4WFIA 3TK1A 4LE1A 3NT4A 3MK31 4MITA 5E4YA 3KFXA 1R0LA 3VDXA 1E8MA 1GG2A 4KUHA 1A2KC 5B3KA 2HRDA 2ROQA 4V0SA 4F2PA 1BE1A 3IDSA 2YX1A 4CQMD 1LDMA 4TKMA 5FADA 5ADHA 4FB4A 3BJEA 3K70D 1UIMA 4PM4A 1T26A 3AR5A 4F3NA 2WJIA 1YULA 2DWPA 3DR3A 1VA5A 2GDJA 2II6A 3RYIA 2F3RA 2DPMA 1AURA 4ZVNA 4EYEA 1R0WA 2C3OA 5ICGA 3CH7A 4G0UA 4QEKA 1M2EA 1WTAA 4AJPA 3D54D 2GGSA 4QRIA 4X1KA 6CHYA 4QC2A 2P4EA 1Q3TA 1O58A 2NACA 4J8PA 4WKPA 2AB0A 3OTOB 3WWEA 1IOWA 3X1ZA 1NVKA 1DOAA 3RARA 3ZHRA 1K7CA 2O14A 4JLVA 5IG2A 1FCJA 1G5FA 4OHRA 1EQUA 2PVSA 1MH1A 4G9EA 4UE2A 5JCJD 1RJWA 4BNWA 4UVHA 3DEIA 3WYFA 1GPYA 5AVJA 1R12A 2A4KA 1RLUA 3GFSA 4YQEA 3R8CA 2JH8A 2ERYA 3P5BA 3PQ6A 3Q88A 2PUJA 1PZMA 2CL0X 4TKZA 1ESCA 1YB2A 2AZMA 4JLNA 2EARA 2GEVA 2H51A 2Q6LA 3RG2A 3QBJA 1ADBA 2R79A 2XB4A 1JE1A 4GMXA 2JGDB 1TLTA 2H2HA 2NO9A 3PRJA 1FFCA 3KTAA 4AY3A 5L40A 4L7QA 1JH8A 1LQ2A 3A26A 3JYOA 1D8AA 5BUQA 4RIFA 1G5IA 1ZMXA 2AZ4A 2ASVA 2OP1A 1Z4JA 2KJQA 4B8YA 1I6LA 3FCUB 2ENWA 2C77A 4EL0A 2QUKA 4ZO6A 2JGKA 2VAVA 2FEKA 2VXCA 4HWTA 1KEKA 1H4QA 4E1BA 4RXTA 4EJSA 2JH3A 2OSVA 3FSGA 5CA0B 1VLZA 3IVCA 4DA7A 2OGZA 1R8QA 5LU9A 4ZV4A 4YP0A 1Z75A 4JMLA 4B6RA 1G21A 4H59A 5ITZB 2G9VA 3UT0A 5J47A 1IK6A 3ECCA 1FRFS 4Q66C 4RKWA 5LWHA 1FIUA 2HQRA 2QGZA 3FGNA 4P33A 1EG7A 1L7NA 3BD6A 4JBNA 5DN9A 1J9GA 5FOTA 5TPZA 1Q44A 3RS0A 1L5NA 4J29A 3QOFA 3B60A 1UC8A 2A30A 2V4UA 3FYUB 4R1QA 1EE1A 1BJRE 2YASA 3BKWA 4HB3A 2NZVG 3NDRA 3I9JA 1NUHA 3UAZA 2PX8A 3H8VA 4Y6PA 3MG9A 4MQ4A 4KMRA 3MMNA 4PZ9A 1PTJC 1GUYA 4AL4A 3ZGYA 2NVOA 4QPPA 2ATIA 3PIRA 4KTVE 3VDMA 2MHCA 3WICA 1XZGA 2DR2A 2R65A 1FLVA 3N0WA 4IV0A 3EPLA 1KZHA 2D8MA 3FLAA 4BWFB 4TVSA 4X7RA 2OYSA 5DLEA 1L9KA 1IN5A 2UAGA 2ZUUA 5JSYA 1FRNA 4IJQA 3EVTA 1R5NA 3AKCA 3M33A 1BMDA 3F6EX 3E23A 3IT2A 4ZT7A 1BFDA 3LKVA 4UXIA 3X44A 1K27A 1H1DA 3E8XA 3PE3A 4OOEA 5HSGA 1U2PA 1LV7A 4MYCA 3S2FA 4BU0A 5JSQA 2QOEA 2VAMA 2Q7DA 4DCOA 1XEWX 1KJNA 2O0JA 2TECE 4U7GA 1L0BA 1YL7A 1BVRA 4JL6A 3TBHA 3WKCA 5DZSA 1Z18A 3OEWA 2QQ5A 4NBVA 4DLVA 3TPCA 1KI6B 2YHBA 4UEOA 2YICA 4ZU3A 3GA5A 4D9CA 4DN6A 4ATNA 4LF9B 4BFLA 5AJXA 4I5FA 3SYKA 5HCUA 1JKXA 1QKKA 5CFMA 3QUAA 4AMGA 3GFBA 4CMGA 1GCAA 1W0CA 5I7FA 1C9NA 1OXSC 4FYMA 4J0JA 3TDMA 4B33A 1Z4NA 5JXJA 1O87A 1FC0A 4LY3A 3H0CA 3GDFA 3KJEA 1TD9A 4ZEVA 2I4TA 3ZGXA 4R2MA 4HXEB 1R16A 1H23A 4L16A 5EP2A 4U3JA 2REBA 4YP7A 1E4VA 1ONSA 4GXQA 3DZJA 1I5EA 2EX4A 2Y05A 1OCEA 5LBIA 1W35A 4HX9A 3L7BA 2QRMA 1UP6A 2QSZA 2YDXA 3D7MA 3RAGA 1HR0B 5IULC 3IVRA 2DUMA 1ZIDA 2J3MA 4HB2A 4QUEA 1P0QA 4KXXA 4JT8A 2H29A 4RDHA 2GM4A 1PZHA 2HPAA 3OIFA 2IXBA 1E0AA 1PD1A 3L8HA 2PO5A 2QP4A 1DLIA 4CW7A 3H1FA 4MKGA 2B8NA 2CL5A 2J6IA 4HYYA 1O5TA 1ANKA 3TRFA 1PSZA 1PNTA 2ZRDA 3LY8A 4KB5A 2V7WA 3EEBA 5GONF 1H0KA 2CLIB 1XVVA 3T5AA 2KMLA 4FU0A 3EDRA 1Z6ZA 1UKCA 1AA6A 3VOTA 2YDYA 1Y3IA 3H2BA 3CLSD 4XEUA 3GFVA 1R9MA 2WJ4A 3L0CA 3VGJA 1KC3A 2AEMA 3U7IA 2O3SA 3SHQA 5DMXA 4R4JA 1P31A 2HXSA 4B3FX 2OBLA 4YPVA 3U1TA 5K9ZA 4JL5A 1F2DA 4MW1A 1YTLA 2O5CA 3EDQA 3GT3A 4G5HA 5ALVA 1RI1A 1RS0A 1W581 4Q7LA 5HM6A 4YCMA 2GA8A 3K1AA 1A3CA 4RADA 5C5IA 5LM3A 2Y9MB 4WCFB 4LS3A 4X6LA 3G82C 5SZJA 5A2QA 1DXYA 4GQAA 1NSTA 3DE3X 3M4XA 5I4CA 4QEZA 4BB6A 1SRRA 2Q4OA 2MYPA 2N47A 4M3NA 4YCDA 5EUQB 1ZUNB 4GMFA 4EOGA 5B30A 4YJFA 4K6MA 4BB9A 4NG4A 2EL7A 2JCGA 3FAKA 3TYXA 4XGIA 5K0EA 2Q99A 1B6GA 1E7MA 3DMFA 5ICCA 3PS9A 5BQPA 1QG2A 4E2YA 1QK5A 1UJ2A 2RB5A 3NNDA 2W6NA 4YUVA 2FMIA 2R0QC 2MMCA 1T2NA 2Q4RA 3FHCB 4OP1A 1VIMA 4KJZA 5CDUA 1U0FA 2ABWA 3C5HA 3OQVA 5F7ZA 4KV7A 2HMSA 3BS4A 3CVUA 3CINA 4IFBA 1GAEO 3WFZA 1Y3FE 3N8NA 3S2SA 4CM4A 4F1WA 1N6NA 3BCRA 4UM8B 1HLGA 1C81A 5FL7A 2X5OA 4YXFA 2ZIXB 1C7QA 3UWSA 3GIWA 3QVOA 3AI2A 5JH7A 2R66A 3M2TA 2Q3DA 2W8BA 5I47A 3IDAA 4LDZA 4ER5A 3TN7A 1II8A 2RHJA 3E7WA 5C4GB 4BDSA 5JS1A 2X15A 1CJVC 1H3NA 1RKBA 4LYAA 3MJEA 2OGWA 4KODA 1HDRA 4BKPA 5AVXA 5JS2A 1QU2A 1W59A 1EXVA 3QUQA 1WF6A 1T9AA 1NQWA 3IUEA 4MWOA 1IZZA 1O94C 2FSSA 4A73A 4MPPA 4F72A 1Z2PX 2FEAA 2F1IA 1C4XA 4DYDA 2X5JO 4CEHA 1YCHA 4Q37A 2DBVO 1PYDA 1FA9A 1TCUA 1U2DC 5H3HA 1D2MA 1NVGA 4GD3Q 4TQAA 4DMHA 1QZXA 3DVQX 2W90A 1K97A 1IEQA 1QIFA 4AG3A 2DU8A 2VYFA 4MPRA 4KGXA 1FLNA 1W2GA 3HYLA 2G7MC 5C8ZA 3NDIA 4X7BA 3WWYA 4EFKA 4W4TA 2D2XA 2FG5A 3MLEA 2X2EA 3DS8A 2CXRA 2VQDA 3PWTA 4CKYA 1OV4A 3PZBA 2B4RO 2NO1A 5EQJB 1UZNA 4RTJA 4BLQA 3RVRA 4BZWA 1NVDA 3EBOA 1NBMA 2G28A 5D3MB 1NG1A 2FEXA 2FPKA 2ODAA 2WPDA 4Z1MD 3OIWA 5KNLA 3RASA 2QQFA 5T3YA 3SVTA 1PYOA 4PC1A 5DIZA 5T7BA 1H5NA 1PNOA 2PZEA 3MGBA 4TN1A 2NVBA 1FYEA 1PEKE 2LUOA 2RC5A 4TYQA 4XLTA 3SQDA 4RJTA 5CB4A 1W34A 5HIJA 5JRJA 2DM6A 2JK0A 1WPXA 3H8SA 3JQAA 4J07A 2WM8A 1Q1GA 5C7OO 3OD1A 5JXGA 5TLSA 1N0WA 1HNNA 3QTBA 4IX1A 3RDPA 1I4WA 2ZYIA 4WKBA 5AKZA 1A27A 3WNVA 4Z2AA 2UUBB 5C8DA 1OX4B 3NHLA 4CT4B 1AUPA 3GL9A 4LSWA 5LPNA 4PGMA 1JLMA 1G7CA 4OMFG 2Q1TA 2CLMB 3JSAA 4POOA 4TLAA 2NO0A 2XUHA 4PONA 1I0ZA 3QUCA 4NCHA 3V80A 5EIXA 1Q7GA 5JJIA 1T2DA 2Q9BA 3J81k 1XFDA 1JB1A 1XPRA 3DF7A 4QIHA 5BQ3A 1WMBA 1W87A 1XHLA 1P60A 3KPUA 3O8NA 4HPWA 4INAA 4UCQA 3BDVA 2JW5A 4URWR 5DHAA 4ZOQI 3QEJA 4BE4A 4C7JA 4EAQA 1Q14A 2NU9A 5B7GA 2WFZA 1YNOA 2IV3A 4C7VA 3ESAA 4UNPA 4GZMA 1N1EA 2C2ZA 2OKGA 2SECE 1QTQA 4FT4A 4QT0A 1F51E 1PJ2A 3R44A 1F38A 1UPAA 1N2BA 3LBYA 5FP0A 1XVAA 4ZQCB 4FBLA 5DW3A 4G5YA 3ESDA 4KCGA 1THMA 3CEHA 3D5TA 5CIYA 3IT3A 1TECE 3SYLA 1AE1A 5IT0A 4LF7B 2O2IA 4RY9A 4ZC8A 4MR7A 3KLNA 4KTTE 4U8GA 5EWLB 4D9EA 3EZXA 1PUJA 4KWTA 1N5IA 3ZIAD 4ERXA 4F9GA 2AJDA 1FNDA 3RO7A 4MO9A 2GPWA 2VWPA 1MJFA 3NWBA 1MJGM 4MWSA 3VMMA 2E85A 3A2KA 1QE3A 5EHIA 5TQ2B 1DX4A 1O96A 4K9QA 1GSIA 3GMTA 1DL5A 3KX2A 4FGUA 4FYPA 5G4LA 3W4KA 5LQJA 4KLNA 2FZCA 1MA3A 1H3FA 1N1DA 3MJFA 2PUTA 3P2MA 4C7OA 2B1RA 3IERA 1RWPA 4GQBA 4CIBA 4CU2A 4GX0A 4OLHA 2Q5HA 2FWAA 2GYVA 1OI3A 4TX1A 2XMDA 2Z5LA 4MYUA 3WNCA 1YFZA 5CRIA 1MJNA 1RKQA 1GZVA 4ZOLA 1GA4A 4HG2A 3W2TA 3RVSA 4AX4A 2XCTB 3EA5A 3NT2A 1GYPA 2W6JA 1OREA 4L5CA 4RD0A 2C5EA 4BX3A 3MHTA 4DIBA 3W5CA 5LSAA 3KR2A 5IDXA 1ZD8A 3EXHA 2DJIA 5EFOA 1M2HA 4XASA 5ANRB 4LGYA 2CD9A 4KK4A 4MVJE 1FFAA 1VJ0A 2PNFA 3L6BA 3PHJA 5AO9A 5H83A 4J3NA 4BS9A