1U2SA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in complex with glucose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords sucrose-phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 92
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1u2sA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1u2sA02
2VKQA 3CNHA 4HGPA 1TJ3A 2RBKA 2I7DA 4UASA 1ZS9A 1LTQA 2JAOA 4BEVA 2G09A 5ALGA 3I76A 3B9RA 3I1YA 3RF6A 1QQ7A 4RESA 1NF2A 4GIBA 2RARA 1T9ZA 2YMPA 3M9LA 5AW4A 2JAWA 4YIKA 4YCNA 3ZWDA 3SHQA 3QU7A 3L0BA 1YDFA 4NABA 3QU5A 3WKAA 2OYCA 1L7PA 1IWOA 5ALJA 3SMVA 3DV9A 2WM8A 3N5KA 2FUCA 5AW6A 3B8EA 4NAVA 3AR8A 3L5KA 2W43A 2C8LA 3ZUPA 3W5BA 2IA5A 3KOOA 2CFSA 5AKXA 1JUDA 4JB3A 3ZW7A 1RRCA 2IOFA 4DCCA 2HCFA 3NRJA 3QX7A 1SU4A 3FPSA 3ZU6A 5AVRA 3W5CA 2GO7A 1Z4KA 2FPXA 5ALFA 3UMGA 4UMDA 3AR7A 5AM5A 1VJRA 2G0AA 1S2OA 4ZEWA 5IT4A 5AW3A 1J97A 5AI9A 5AIBA 3J7TA 5AK5A 1Q92A 5AW1A 2OM6A 2FPWA 2OA0A 1NRWA 5AW0A 3S6JA 2P69A 1FEZA 2DQSA 4BEWA 3ZTWA 5ALWA 3MC1A 1U2SA 3L8EA 3QYPA 4HGOA 4UMVA 1XPJA 2GMWA 1Z4QA 1U7OA 2R8YA 1RKVA 2HF2A 5AK6A 2ZG6A 3IB6A 4I9FA 4Y3UA 5ALRA 3QUTA 1ZD5A 2YFYA 3QNMA 3U26A 5AVTA 2WF6A 2YBDA 4MUMA 2CN1A 2GHTA 1ZOLA 5ALPA 2Q4TA 4IFTA 1S8OA 5AKKA 4UM5A 3DNPA 4C4SA 3FGOA 5AVUA 2EATA 2YY6A 2ZBGA 3ZI4A 5AI4A 3A1DA 2FI1A 4F71A 2HX1A 4DW8A 4ZEVA 1L8OA 3R9KA 3A3YA 2WF7A 3WKEA 1RMQA 3N28A 3AR2A 3SF0A 3NIWA 4I9GA 1VFPA 2X4DA 5AI5A 3ZVMA 3ET5A 4Y2XA 3SD7A 4J2TA 4Y2SA 2FPSA 4XPZA 3FZQA 2YJ5A 1U02A 1WR8A 4KX3A 3ZVLA 1RLTA 1WZCA 4HGQA 5ALSA 3WGUA 3AR6A 1N8NA 1N9KA 3PGLA 4YH1A 3MPOA 1RPZA 4L6CA 1O08A 4L57A 1Z4LA 5T41A 2C8KA 3W5DA 2QYHA 2G07A 3KC2A 2B8JA 1TA0A 5AM3A 5AI8A 2R8ZA 3BA6A 3E81A 2FUEA 3QXGA 5AVXA 2NO5A 2MSNA 4C4TA 5ALVA 2YJ3A 4BBJA 5IS2A 1RQNA 2GFHA 1RLOA 1ZD4A 3AR3A 3E58A 3QUCA 3OCXA 3L8FA 2HHLA 3QU2A 4AP9A 3MMZA 3WK8A 2BY4A 3DDHA 2CFTA 4IG4A 1TE2A 1F5SA 4FYPA 5AKYA 1Z4NA 1WVIA 3L1UA 4OFZA 2RAVA 2HI0A 3BWVA 3W5AA 3MN1A 4E88A 2I55A 3A1EA 3R09A 1X42A 3U7EB 4C4RA 3WKBA 4NWIA 1Z4JA 1RKQA 3NANA 2EARA 4KNWA 3N8GA 2YJ4A 1MH9A 4UU1A 1J8DA 3L8GA 4Y2UA 4EENA 2IOFK 3EWIA 5ALOA 2YMMA 3M1YA 4BKMA 4ZEXA 5ALMA 3U7HB 1Z88A 2Q4RA 5AW7A 4OD0A 4BX0A 4KYTA 4OCZA 2B1QA 2R8XA 3ESQA 5AHXA 3QU9A 3IJ5A 1Z5UA 3PDWA 2W4MA 2HF7A 4Y2JA 5A3QA 5ALZA 1CQZA 2I54A 2G06A 1ZD2P 2PKEA 3NUQA 5ALNA 1YJ5A 2FPUA 3K1ZA 1PW5A 4G9BA 4BYGA 5AVQA 2I33A 3WK9A 2HSZA 3DAOA 5ALYA 1ZRNA 2G80A 1QH9A 5AKZA 1RLMA 4YIHA 1RKUA 5ALEA 4QJBA 3L7YA 2R8EA 2ZXEA 2C9MA 4BX3A 3ZWKA 1L7MA 4GXTA 2WF9A 1Z4IA 3ONNA 4EZEA 4BNDA 5AKHA 3OCVA 3ET4A 2ZBEA 2YJ6A 5ALLA 3I6BA 1CR6A 4CF5A 2G1AA 4UMFA 3B9BA 3WK4A 2WF5A 1T5TA 3ED5A 5AM2A 3N07A 1ZJJA 4Y2YA 4QQFA 4YGYA 5AM1A 5A3RA 2W11A 4CF4A 1EK1A 5AKEA 4H1WA 3RFUA 1O03A 3U7FB 5ALDA 4YCMA 5JJBA 3UMBA 5AI0A 2JARA 4XOUA 2EAUA 3D6JA 1Q91A 4BX2A 3ZVNA 3CZ4A 3IRUA 2FEAA 2YN4A 2RB5A 2BDUA 5AVSA 2HDOA 3ZX4A 2HEGA 3NAMA 4CE6A 3GYGA 1L6RA 4CF3A 4KX5A 4UATA 3SLRA 5ALQA 5AW2A 1YV9A 4KN8A 3HLTA 2NYVA 2P11A 3VAYA 2WHEA 3A1CA 3AR5A 5AI6A 3P96A 1L8LA 5FP0A 3QU4A 4F72A 4Y2QA 2OBBA 3OCWA 1YS9A 3EF0A 1TJ4A 5ALKA 4EX6A 1SWVA 2FPRA 2B82A 4UARA 2NO4A 1ZD3A 2JGAA 3UMCA 2Q5EA 1SWWA 5AVVA 1L7OA 5AW8A 1XVIA 1T5SA 3AR9A 2ZOSA 2B30A 5AW9A 2HO4A 2AMYA 2O2XA 1QQ5A 3E84A 4J03A 3KD3A 1QYIA 5AIAA 1Z4OA 2BDEA 1RQLA 4UW9A 1K1EA 3L0YA 4HGRA 1XP5A 4XE5A 2MU1A 1TJ5A 5AM0A 3AR4A 4O8CA 1Z5GA 4JDPA 4FFDA 2HOQA 4CNQA 4EELA 1Z4PX 3NASA 2IOHA 4UU0A 1LVHA 2QLTA 2ZBFA 2B0CA 5ALXA 4RETA 3FM9A 4HAIA 4HYTA 2P27A 4AS3A 3R4CA 4KNVA 5AW5A 3ZTYA 2I6XA 3L8HA 2P9JA 2C88A 2IYEA 5AK4A 4DWOA 3L1VA 1RMTA 2ZBDA 3WKCA 2GHQA 5AICA 3E8MA 3PCTA 3F9RA 3QUBA 4NV0A 2D2VA 5ALTA 4UAUA 5AKIA 4YCLA 1RMYA 3NALA 5AK3A 4Y2RA 3QGMA 3QLEA 3I28A 5A3SA 1Z4MA 1VJ5A 2C4NA 2JAUA 3WK7A 5IT0A 3OCYA 4MWOA 4Y2VA 3U13A 1AQ6A 3KDPA 4B6JA 2B8EA 4FE3A 3WGVA 3OCUA 4G63A 4DFDA 4L6AA 3SKYA 2G08A 1WPGA 3EF1A 3WK5A 5E0OA 4UM7A 1Y8AA 3OTQA 3OPXA 5AVZA 4AS2A 2AUTA 2WF8A 4BNDB 4XQ0A 5ALUA 4UAVA 1RC8A 3FVVA 2AGVA 4NFLA 2ODAA 3QUQA 3EPRA 4PNHA 4OHFA 4UMEA 3SKXA 5AVWA 5AM4A 3UM9A 2PQ0A 3PGVA 5ALIA 2AH5A 1EK2A 2CFRA 5AKGA 1YMQA 3U7GA 4EEKA 1QQ6A 2B1RA 3U19A 2FDRA 2YMQA 3KZXA 1RDFA 5ALHA 4EX7A 3FPBA 3WKDA 3OCZA 2WFAA 5AKLA 3WK6A 1NNLA 1U2TA 3KBBA 3TLMA 3N1UA 1YNSA 2PR7A 5AESA 1U7PA 4Y2PA 5AKJA 2O9JA 5AVYA 3ESRA 1L7NA 3L0CA 2I34A 3HYCA 4Y2TA 4HGNA 1KYTA 1ZRMA 3ZX5A 2YMLA
chains in the Genus database with same CATH superfamily
3MRTA 3LDAA 3WLNA 3KQWA 3B6ZA 3K9LA 3Q5DA 5BSEA 2HQOA 3B70A 4B44A 2I7DA 1C7QA 2Z5VA 4U2CA 4Q4AA 3E18A 1DXOA 1TUEA 3EGXB 1G16A 3L07A 3S2ZA 5KX5B 4DILA 3NPMA 3PX3A 2X0FA 1K08A 1AM4D 3B9RA 1ISPA 4KIJA 4CKBB 5KPDA 1DCFA 2NVYB 2QL5A 2QS9A 1NSFA 2GILA 1E6KA 2GLXA 2BV3A 3PEVA 1JPUA 2JDID 3LP6A 4I2NA 3CS3A 3ZHTA 1FFSA 4DLAA 3DL4A 5KOYA 2FLVA 2FMKA 1XMOB 1DAEA 1N92A 4DIFA 1YDFA 1ZNWA 4ZO9A 2ZR0A 1GYRA 5IFLA 3NEYA 1NWHA 4TRMA 3HFJA 4RH1A 1IHOA 1VG1A 1BXZA 2WM8A 4NJMB 3EW7A 2GHIA 1MVOA 3FFAA 1N32B 1XL0A 1WQ1R 4PFKA 2L82A 1EU1A 2BYTA 1T6BY 5AW6A 3CRQA 1HPLA 5K05A 3IDSA 4GBGA 2FK8A 3ZUPA 4FC6A 4R8LA 2DM6A 3MWDB 1GZ7A 4I1UA 4GDFA 1JSRA 2IOFA 4JLPA 2H85A 3GG9A 4MUYA 2HTEA 1Y3HA 2GA8A 2PL9A 3WSVA 1XMQB 2H5LA 5KHLB 1ID1A 4AMYA 1Q0LA 1KR5A 3OZIA 4BQIA 4EY5A 2NQ8A 3H5VA 5I7AA 2J6HA 3BRCA 3GJRA 4KL8S 1TYCA 2NZUG 2D13A 1X8LA 2FPLA 2O5VA 4MVYA 4A3FB 1BHQ1 4RPJA 1YT5A 2VDJA 5BW5A 4TUYA 5CGQB 3UMSA 3U7QB 5AW3A 2XYVA 1S1MA 2BF7A 1GPJA 1AV7A 2UUOA 3EVEA 2X6TA 3KDSE 1JAXA 4X1OA 3T4EA 4PC6A 3V2HA 3JY6A 3BF7A 4IAOA 2GPSA 4XB2A 1OZGA 3CH7A 3S6JA 4TVSA 1QIHA 5K0TA 4MCIA 2GZDA 3GHHA 4OQEA 3ER6A 1E32A 4YRDA 1ZAYA 1I3QB 2HU2A 4H7DA 1QDEA 3ESYA 1T9CA 3M9WA 3PPXA 1SOAA 2GWHA 2X4IA 4JD5A 3IELA 5DYGA 5KQPA 1E2BA 3ZXUB 2R8YA 3JAKA 2ZJZA 4H7PA 4QPZA 2Q46A 3ANMA 4W63A 4MVJI 1D8TA 1T4CA 5CGZA 5C32A 1DBSA 2I5PO 3EIWA 1UPBA 4G8JA 1QBKC 3GPLA 3RVOA 1SVNA 1GLVA 4BB5A 2FR1A 2KMLA 3IQIX 1N2CA 3UA4A 3VM6A 3WYNA 1KI1A 2GYWA 3GRPA 5HFJA 4D98A 4ZN6A 2GYYA 2CJXA 3PUWA 3NIGB 5EKDA 4C22A 1RI3A 4HDQB 1JHOA 1NN5A 1S8FA 1S8OA 4HLUA 5AKKA 1Z28A 5EIEA 2A2ZA 1ZJYA 1F8FA 1WS6A 2VNSA 4WZ6A 4H3SA 4Z8XA 4DXHA 4GPTA 3GEPA 3UXEA 3NJRA 4MQBA 1RR6A 2PGIA 2VBCA 4C87A 3VR5D 1WCWA 1O5IA 3GTKB 2O8BA 2ZIAA 1P8AA 5FUVA 2JBAA 3DZ8A 4P7GA 1E6UA 5FX2A 4J6EA 2FR8C 3PVSA 5DNWA 1RC1A 2R00A 1RMQA 4CMIA 3AH8A 1FRVA 4NX2A 1KVQA 4C5AA 5FUBA 2YWHA 3EFBA 4F38A 2PLRA 2LW7A 4IEFB 4K8RB 3AZOA 3UOAB 1OXVA 2BBOA 4H08A 3RS2A 4D26A 4BNJA 4KX3A 3HVUA 2V7UA 3OZUA 4N9WA 1NN0A 4MKGA 3PR1A 4TQAA 1KQGA 1WHSA 2JZNA 1XDDA 2ZRNA 1HI9A 2WWGA 3C5WP 3PK0A 5EXSA 4EHKA 5ADUS 1R8QA 2ET6A 2IHUA 4RF2A 4L6CA 3ZWCA 1AKNA 4KXQA 4L57A 1GFSA 1YOVB 1Z4LA 3HOVB 4YMSA 4GX0A 2BL4A 1Z2EA 5TARA 4OI1A 2A5YB 2B92A 4MPTA 2JC3A 3BA6A 3TGLA 2H1RA 1GO2A 2C78A 1NJSA 2NYAA 5HKOA 1TWGB 3DMFA 4GX2A 4F3RA 3H04A 3WQRA 5K8LA 5ECYA 1EQ2A 2F3QA 5JAZA 3B7GA 2OQVA 1CS4C 2VTVA 4ND8B 4AJJA 5KVSA 5DYNA 1DQPA 3R5FA 4QO8A 2PXAA 2G0TA 1GFIA 1XEWX 5H82A 4KQ2A 1PTKA 3MAAC 3PFKA 1OYVA 3DFKA 4EQ6A 3RUAA 3SC2A 4QXQA 1NY6A 3MVEA 4GYWA 1POWA 2R3SA 1JV2B 4MVJG 4PAQA 5BPFA 4CL2A 1NY5A 4GUDA 3N75A 1DC4A 1D5WA 3DCNA 4K0RA 1ECLA 4RMHA 4WECA 5AKYA 3TSYA 1VE1A 2H16A 5L4LA 4DV5B 3IXQA 2RHGB 3E4DA 1EVQA 1Q6ZA 1XLTC 4FE7A 3MYRA 3VSDA 1NM5A 3FUXA 4E0BA 1M72A 1XYVA 1SKQA 5A9SA 3C7TA 3TMYA 3LG2A 3K9FC 4MUHA 2B99A 3F4BA 2X7JA 4UNIA 2EBUA 2R92B 3L82B 4GZ3A 4DGSA 4WFKA 1HRDA 2H11A 1EHYA 5KDDA 4K6HA 3ADDA 1W2GA 3K9BA 4LZWA 1YFJA 1MAWA 4J29A 3V8NA 4HMPA 4JCOA 1ESZA 1EPUA 4Q9AA 2R4UA 4UU1A 2SCUB 2J4CA 4UTVA 1IZ7A 3U7HB 1D0VA 1E2PA 2BFMA 2DT8A 5KINB 2WILA 3OCJA 3WXMA 3I4MB 2ONZA 3HKEA 2FUG1 3I2KA 1GG9A 4DAOA 2RJOA 1VMDA 4NYJR 4OD0A 2C99A 3AEQA 4A2CA 3PA8A 2B1QA 2ZJAA 4PW0A 2VUIB 5AHXA 3W9YA 4AO7A 1RQPA 3P4YA 3ZZ0A 4DANA 1LS6A 3K8QA 2ZBRA 5AW4A 1AMNA 4F1WA 1E1DA 3GLSA 4EH1A 2D6FA 3V8BA 1SHTX 1QVVA 2VUTA 2R6R1 3NTUA 2G04A 4XIFA 1YRAA 1A7UA 4Z1OA 1PNTA 2HXSA 3IRVA 3P26A 1U3FA 4I08A 2GSWA 3S99A 3A36A 3RI3A 3D6AA 2DJ5A 1IM5A 4JC0A 4I4CA 5H3HA 4ZMSA 1IBRA 3DR3A 3TZEA 3M6WA 2FV8A 1LJUA 1H8HA 2G06A 2MMCA 3QF4A 4GG1A 3OLWA 3K4HA 4G9BA 1W36C 2Z98A 4AJNA 4PXYA 1R9MA 1X8KA 4FW9A 1U5BA 3WK9A 5B6PA 2G3YA 1C9NA 5A6SB 3W8DA 5KB3A 5L51A 4CKEB 4LF6B 5A1TA 1NVDA 1JG1A 4A2QA 1RWKA 4R8VA 5AKZA 4GVPA 2GF0A 1OXSC 1UM8A 2K5UA 2MT9A 3K5WA 2AX3A 4LDPA 4MQFA 3W5IA 4AG3A 5JVDB 3RE1A 4NCBA 1CUSA 4TV9A 1E9CA 3VDRA 1X74A 4CODB 3KTFA 3UVEA 2EHDA 4ER0A 2RGGA 2O0LA 3KB2A 5JXGA 5JBNA 4B85A 1J70A 3VR6D 1LQTA 1FSPA 2JGEA 3GLHA 4WH0A 4M8KA 2VHVA 1QFMA 2XMSA 4AURA 2DF8A 3UG7A 3VHRA 3VYUB 1ZIPA 4ZHQB 3TJMA 5E3HA 1A72A 1ZCAA 2H1IA 4YGYA 2JGDA 1UMDB 2RGBA 3FDZA 1U3VA 1XMPA 5CM2Z 5EIAA 4YAEA 1TM3E 3SG0A 1Z06A 2P62A 3L0SA 3GY0A 3EE6A 2QRHA 4JBXA 3TOZA 1GL3A 1FS5A 3NHJA 2AF4C 1NW5A 3RPEA 4KQFA 4RIEA 4EG6A 1EI9A 1Y3CE 3QMVA 2HEIA 2WSMA 5JSYA 5F76A 1MB3A 2Z8ZA 2PA0A 3C3XA 3HADA 4RHXA 4ZXFA 2ADOA 3VYTB 3NXSA 1E98A 2EBWA 3AESB 5TPZD 5CR9A 2O7VA 2OHGA 3DMYA 1EXDA 2VDVE 2JARA 3PXCX 3UPDA 4A36A 3RVLA 4IWXA 4X20A 1D09A 4F9EA 3NT4A 4L15A 1JMVA 1G8SA 3D6JA 4G5QA 5FQNA 4TTAA 3WYEA 4E4RA 2C3PA 4ZA2A 4FMPA 4GWKA 3K71B 5DGTA 1UK7A 1Y7TA 2OZEA 4UE3S 4WVLA 2XCTB 2O3JA 4PZEA 4AMBA 2ZSUA 4H6VA 4B71A 1N5IA 3KT8A 4LF4B 1JG2A 3R6DA 3JQ8A 1FJGB 1CJCA 2BGTA 3LUPA 1KTVA 2H2FA 1OJ7A 2JK0A 1GCIA 3D59A 2J6IA 4DA4A 6NULA 1R0BA 1O94C 4WCVA 4XR9A 1JHPA 3DTYA 1RRFA 3QMMA 2NGRA 5F3RA 1IIRA 3VTAA 4AJKA 5CB4B 4OQFA 3ECCA 2W2QA 4CF3A 1GNPA 2PKXA 2WJVA 2YQ4A 3E5MA 4D4IA 1F5NA 1I13A 5LXTF 4ETIA 3IPAA 3RS5A 1BCSA 4XI9A 2D1YA 1ZNQO 4R2WA 3EC1A 1KSHA 4K88A 1TU4A 3AEUA 1Y3DE 3VHXB 1L7EA 2XMGA 3UBTA 1U3CA 3LP5A 4DL9A 3EB9A 5DCWA 4E08A 1DZ3A 3HFSA 3I1IA 3DFZA 1CR1A 3EF0A 4EX6A 1N0HA 4IV8A 2WUGA 4Y9SA 2VG8A 4ZVOA 3PUHA 4HCJA 3WWZA 5EZ6B 4JQZA 3DVSX 1G41A 1PWXA 1XCGB 3D8NA 1GSIA 1QJ4A 1Y80A 3IMKA 4JMPA 3EEQA 3N7AA 1EE2A 5IYZF 3EY4A 1NBMA 4CG2A 2JFVA 3LQQA 2Q5EA 3B1JA 1W5BA 4KR2A 1OTYA 5EHXA 3R5KA 3TW6A 1QXSA 4H3VA 3SN6A 3ZE0B 2NU6B 1T5SA 2ATCA 4LDAA 1YKFA 1CXZA 1DWQA 5EKUA 1NVXQ 2ICAA 3CLKA 3HVJA 1FYDA 4HFRA 3K5PA 4B7UA 2PSEA 4C6RA 1XN1A 1TZJA 3HUEA 3E84A 4JJ6A 4H59A 4P36A 1BWQA 3ISJA 1PJSA 3GLGA 2H9IA 3RJ9A 2RHLA 2FFHA 5LQAA 2GUWA 1LNZA 1V6SA 3X3HA 1TEHA 2ZIXA 4M0CA 1QWSA 3TFQA 3STYA 5C3UA 4QUAA 1GYQA 3FGPA 1Z29A 1XP5A 4NU8X 4PWZA 1JQDA 2H9YA 4KQEA 1H69A 3LQ1A 5AM0A 5HCUA 3CEHA 1KGDA 1Q1QA 2CMHA 3U56A 1L7QA 3KXPA 5K6RA 3CB4A 1NW4A 3JRWA 1Q1GA 5C8ZA 1EXVA 2E9SA 3S27A 2IBSA 4OHPA 2EW2A 2I2AA 1VBKA 4NP6A 5HGXA 4W5RA 1T36A 3E03A 1JB1A 4DMGA 1UXGA 3LLMA 1YVRA 3FNFA 2FPIB 5HG0A 3P9IA 4EGFA 1YA6A 3LXXA 4KNVA 1NDUA 1YZGA 5JJCA 4JGGA 3RHFA 3GLIA 3LI2A 3RWOA 4RAQA 4N12A 1HLDA 4URYR 2W6NA 3OJCA 4HDRA 4ZQGA 5A2GA 1PVOA 4C0WA 1UKYA 2P5SA 1GRVA 1CW2B 2XTJA 1UWKA 1SCUA 1DAGA 3PCTA 3TLEA 4EJ2A 3STHA 3GT0A 4XJSA 4OK5A 3SJBA 4ZEOA 3OPQA 2X77A 1F60A 2A58A 5KZMB 4W6ZA 4N48A 3QW4B 1KSJA 4G0MA 4CXMA 4WDQA 2B61A 1H85A 5ELLA 3H3FA 3VNSA 1BQ3A 3FWNA 3HHEA 3LA8A 5FWAA 1EHCA 3C85A 3HY6A 4M8SA 3LA6A 4D0SA 3ELUA 2B4QA 4MUGA 1FLVA 2VF2A 3IERA 3N76A 3V1MA 3HQ4O 3KVYA 3EWSA 5BOVA 4DNXA 3AHHA 4X1YB 1UCFA 3W8RA 4KFUA 4JC8A 1ACJA 1D2CA 4B6EA 4G63A 1D3AA 1GRNA 3VZQA 1RVV1 3WV5A 2DUMA 1ISMA 1EK6A 3BJRA 3DLIA 2XR1A 2E49A 1P45A 3IIKA 3LXRA 4II2A 2JI6A 1EGVB 4OXXA 4NATA 3U3XA 4DPKA 3AQ4A 1TMGE 2Q2NA 4LZOA 1T1GA 4M9XA 4FCWA 2VAXA 3TBHA 3L43A 4UEWA 1M34E 3G9ZA 1JDNA 2PNJA 2FETA 3IHTA 2PV0A 3IVRA 2OD2A 1BXKA 3UW1A 3UQYS 1NVKA 3KSBC 1IULA 3C6ZA 2PQ0A 2JRCA 1ISFA 5MN5A 2IEZA 3R8CA 2AH5A 2Q6OA 2WIJA 2XD4A 2XZDA 4O63O 3DJFA 4KO2S 1VL6A 3B1XA 4M60A 4F0JA 4JYMA 2QZPA 5ALHA 4EX7A 5IG2A 3ENZA 2Y1LA 1JF8A 4CM5A 3TD9A 2COUA 2PSHA 1ZI9A 4G67A 1D8AA 1ZQ9A 3B52X 4JLVA 4W5TA 2BWJA 3P9RA 2CHUA 3EGXA 1R9JA 2CCJA 3JYHA 3ASVA 2OCAA 4EPWA 3E9EA 3PU6A 4ZV7A 1P91A 5JNWA 1OFHA 2P4UA 2DAPA 1Z0FA 3L1HA 3QENA 3U1BA 2BMDA 3W8EA 2EXXA 3BD7A 3GEIA 5H8WA 1G4HA 3UAWA 1AF7A 2H0QA 7YASA 1E8MA 1KZGB 1XA4A 3G0GA 4MPJA 3SM3A 2YMLA 2ZBQA 3IIEA 5KYWA 5HTOA 3H13A 3AEYA 3GNTA 3OX4A 5DYIA 2HMWA 3WFJA 4P34A 1HLPA 4QDUA 4J90A 3W5JA 4YCDA 3EUFA 1SVWA 3HJUA 2RBKA 4G24A 4MAFA 5CB0A 2PBLA 3R6TA 1D4AA 4JQOA 1R12A 1VKNA 2Y27A 4QECA 4QRDA 4XYBA 5D5HA 1A4XA 2O8VA 3LP8A 3NT2A 3O0TA 4KQWA 5ALGA 2AOUA 5H80A 4E4TA 1WZEA 2HA2A 3ZVKA 1MGOA 3M82A 1VL5A 4PANA 3WBFA 1WB4A 4EPTA 3O4VA 3R3ZA 3KQNA 1D1QA 4KB5A 2OOKA 3L8MA 1VTKA 4YHBA 5JY6A 1UBCA 4JXZA 2QGNA 2EIXA 4YC7A 1Z63A 3UUGA 4MR9B 3ZHUA 1XJQA 1C9EA 1VL2A 1Q1AA 2DLNA 3DF7A 4EW6A 3TAXA 5K8IA 1RWPA 2X0RA 5DNEA 5BN4B 3HEBA 5KI6A 1VIMA 2HNBA 1IWOA 1BXGA 5ALJA 3AF4A 4F2DA 2DBQA 1MHTA 4EUKA 3BTOA 4NTZA 2AR0A 5KWSA 4P84A 4I8IA 4QYTA 2VBIA 3P9KA 2VP9A 3RGGA 4G1FA 4BFTA 2Z30A 3EVNA 4CFZA 3FZYA 3FXAA 2X3YA 3U7QA 2UZ3A 1NXVA 5EQTA 1A8QA 1EXWA 1ZK2A 1R16A 2OECA 3W4IA 4AJLA 2V7PA 2FFQA 2HY7A 4NZYA 3AG6A 3A6DA 4XX1A 2Q3CA 4EJ6A 5C35A 1G5QA 4DDUA 1HFKA 3IAS6 4PLVA 1I2BA 3E5NA 3R6LA 2AE1A 2JKYA 3HN2A 2G28A 2A9PA 1U5AA 3OT1B 5AM5A 2XEDA 5A4DA 5AQ1A 3HVRA 2BT4A 5DNCA 1JECA 2YVUA 4CDGA 4L5YA 3TQHA 2EOAA 3MWFA 1C1XB 2VRNA 4C3IB 3MBKA 3PC8A 1T13A 2JJQA 4J4TA 2O5CA 1T2FA 3WWOA 1A9RA 1ONOA 5IBQA 1RKBA 1KS2A 1TJPB 3B6JA 1T6XA 1IHYA 1UFVA 5H70A 4DV4B 3R24A 2A0KA 1XO1A 1KMQA 2P69A 4K9SA 1BOFA 3HWWA 3AGPA 1Q83A 1U6KA 2XGSA 3P0IA 4L7VA 3TNFA 4D5EA 4IWYA 1HDCA 1PR1A 1QH1A 3GG2A 3CR3C 3HCNA 3P4XA 3DOOA 3TQSA 3R0JA 1QQBA 4FK8A 1C9KA 3X1KA 5JMOA 2FUKA 3Q12A 1PG2A 2VJDA 2X2PA 4HZIA 4J2HA 2FG7C 3GPBA 4Y3UA 4CMBA 1GZ5A 4RTLA 1G8KA 2A0YA 4N5HX 5LOVA 5EUMA 1BIFA 4H6PA 1JJVA 4DMCA 3ESBA 1Y1VB 3QNMA 1WSWA 4HF7A 4Z1MA 5AVTA 1SN7A 1GQFA 4LISA 1NOKA 2Y0BA 2YBDA 4RHTA 2ZUUA 3HGMA 5IZ4A 2HHJA 1X39A 4HNTA 4DJFC 1OVMA 3L8CA 1S8AA 4E2ZA 4IXDA 4KR0A 1NP6A 2PSDA 3Q3GE 3GLTA 2ORIA 3SVZA 4N03A 1U8UA 4O33A 4NZZA 4NESA 3D5EA 2FX5A 5L95A 1PWHA 2OHIA 2HQ1A 1Z8DA 3JYLA 4CLRB 3A70A 1XLTA 4DSUA 5HSGA 1F2TB 1JZTA 3FH0A 3BD8A 1EVKA 2HQBA 2W2LA 4RYDA 3STWA 2O48X 4F3NA 1YJAA 1T9HA 3ORFA 4HXEB 3VPSA 1VDZA 1PIWA 4PBTA 3V1YA 3KLPX 1KJ8A 3WLJA 4EO9A 1TL7C 3DA8A 2FFRA 2H06A 2HO5A 3F97A 3I32A 3MCUA 1ADGA 1Y9AA 2HU8A 4YQFA 1H23A 1YOVA 3G0IA 1ZMBA 3GFBA 4JXXA 3D02A 3GAZA 3DE6X 3NOXA 3EVGA 1SC9A 5AI5A 3GYBA 4TYMA 3L6BA 3WIEA 1PZHA 3PTZA 1M5UA 3UPUA 5L6MB 3GLFE 5DGHA 2GN2A 3SYTA 1G6HA 2E4XA 1U0JA 1A1SA 3DG9A 5DHPA 4MS3A 4NECA 3M6VA 5HIJA 3WB1A 3WHIA 1EX7A 2NO9A 3X2FA 4ND1A 3OC0A 4Q9DA 1N8NA 1KOLA 3T9FA 1Z0IA 2E2WA 4BTEA 2YYZA 1IDN1 4FLFA 1Z25A 3WB0A 3FCSB 3S55A 4S3MA 3FNBA 4MYSA 4MRNA 5A3VA 3HJRA 1N0IA 1EQUA 4TYQA 2B1JA 2WT8A 3DR5A 5JHGB 5C51B 2YJGA 3GUYA 3QXCA 4E2XA 2I03A 1DUVG 4I1VA 1V3QE 2NO5A 3QEKA 3OETA 5DH9A 2R1UA 3PYLA 1YQTA 2CL0X 1E2QA 1G1MA 1OI3A 4EARA 1WBBA 3L6CA 3HPQA 4OI2A 4CFYA 4Y1RB 1E2GA 3E48A 2ZT7A 4IWNA 1EFTA 1E1CB 1II8A 3CX4A 3E9RA 1JAHA 1QHXA 3ROPA 1R2QA 2BY4A 4EAQA 2CDBA 5K3AA 3UPTA 1M6WA 1KEEA 1DS6A 5B64A 2IIVA 4N01A 1IY9A 2J32A 4WADA 2SCUA 1ZN2A 2MYUA 2O0JA 4KQHA 1SBNE 2H7YA 4LSMA 2ORWA 3RM3A 4BVGA 4F4DA 3OOJA 2FPPA 3E9CA 2O8CB 2GZ3A 4NPAA 2CLHB 2HSWA 3IEKA 3E70C 4E46A 1E0JA 5CYPA 2ZJ2A 2QYTA 3OJWA 2G5PA 3PQ6A 4BPRA 1JLKA 3RUIA 2CJWB 3M8KA 4P4TA 4RKQA 2WWYA 5B2ZA 5AH0A 4ZI7F 2WAAA 4OPMA 1AGPA 3EXEB 5CT9A 2YZ7A 4XGNA 1P2DA 3ND8A 4QBFA 1CBUA 1OXTA 4GMKA 2DUJA 3BB1A 2J46A 2IOFK 3CWQA 3EWIA 2OBNA 3O8BA 3IVGA 4QDTA 5ALOA 4ZANA 4ZEXA 2MYTA 2O50A 3Q3VA 4KQIA 4EECA 4K6FA 1E7MA 4WNCA 4BS9A 2OB2A 1A2BA 3KFVA 2O7RA 3Q3JB 4RK0A 3JAMA 2P2NA 3FDXA 1V25A 4MINA 5EC8A 1OA0A 5CA0B 3K0SA 1NOIA 2V6JA 3AP3A 5A6SA 2PVPA 5IC6A 2WTBA 1BS1A 3IFSA 5P21A 5EE3A 4IHAA 1MA3A 2FMFA 1GKUB 2R48A 4XX0A 2I3BA 3PD0A 4R1PA 4Y6LA 3V1TC 4G56A 2P9GA 5JVDA 1PUJA 1EJBA 2ZDHA 5HGJA 4JUCA 3OE7A 1ZVQA 2WWIA 4CDMA 2R8BA 2GPAA 3CW9A 2J9XB 1FQOA 1C41A 2PSSA 2Q0XA 4LOIA 2BKXA 2W5UA 1P81A 1GWNA 1Z5WA 3EDMA 2IE8A 2OO5C 2ZR7A 4MJ3A 2VP0A 2VQ6A 1J8YF 1H94A 2QU8A 1U0BB 2ODTX 4B5KA 5DW3A 1SZCA 3ENVA 1APBA 3MCTA 3H86A 4OBEA 2GS9A 3RUHA 2A14A 1UMDA 1CY6A 1XTJA 4A0HA 2HV9A 4Z0NA 3MXTA 5K0LA 1FUEA 1TM5E 5KSYA 4P54A 3CMMA 1KJQA 3E1KA 4B6QA 4E11A 3BF8A 3CBQA 1E4EB 3ELDA 5M7EA 4C9BA 3N7TA 2QUKA 4FXOA 3ONNA 4QU9A 4R54A 4D9JA 3LUFA 3AESA 1YE5A 2OZPA 3K8YA 4LRQA 4R1UA 4UUOA 2JD2A 5DHFA 4ZK2A 2FF5A 2P9EA 2K2WA 4G26A 4YAOA 3HOWB 2ZYIA 1EUDB 4R9RA 4IDEA 4V2IA 3BHNA 1S96A 4N0PA 1N7JA 1HNZB 2HCTA 3MQ2A 4AZ3B 2O0MA 1KO1A 4GLJA 4TXMA 1EK1A 3AFIA 5LZ5A 5L6LB 2WU8A 1AO3A 1K4MA 3IUMA 1A5TA 2NSDA 1NZJA 5DX1A 4YAWA 5HXAA 2IZOA 5C46F 3LPLA 3QHPA 4ZCMA 1U7DA 3NGLA 1AQJA 4FNOA 2RAFA 1IBCA 4U7HA 4B80A 9LDBA 1U2RA 3U1VA 2PRKA 3JQ9C 3I9LA 3C7CB 4H16A 3SSNA 4KRGA 2XMBA 3ICEA 5BUZA 4QU0A 4J0CA 4QSHA 1LLFA 1DOZA 5CCXA 4MIYA 1OLSB 2X8BA 1K7SN 2TS1A 2OVFA 3GJ5A 3KR9A 4UEJA 5FRDA 3UO8B 2K6GA 2PKQO 2RB5A 4DSZA 3RFFA 3T5MA 3HOYB 5JMTA 3ZX4A 4WUTA 2ZRHA 2NADA 2V6IA 4E5SA 1IJBA 4PIVA 4YRCA 5FL3A 4CE6A 2VSYA 4KPGA 4GW3A 1A5SB 1Y98A 1E2KA 3CR7A 4ABYA 4BJ6A 4CVNA 4UD6A 1MQAA 2PMCA 1MGPA 3BK7A 1E18A 1GUYA 3R3WA 3QEJA 3WQBA 5AW2A 5LYJA 4MKRA 1HSZA 4KZPA 4L75A 5KNBD 4X24A 3FMFA 4KP7A 1UL1X 4QG7A 1JB9A 2I8CA 4I6JA 4X54A 2ZR8A 1OY1A 1JXAA 2FFBA 2X41A 2ZB3A 3AW9A 3E0QA 2DFVA 2XNDA 2XB8A 3GPDG 1A5AB 2FW8A 2HPAA 2J30A 4JAVC 4NMXB 2Q4OA 1VCHA 1YB5A 2OBBA 2WC1A 3N05A 4Y8VA 4Y9RA 1MRZA 2NPFA 2GPYA 5TSDA 3G8YA 1HGXA 1JFSA 4HL6A 3QWIA 4Y9TA 2B82A 4MVJF 1GPH1 2OCBA 1M75A 1DT3A 2W22A 4NFSA 4PVDA 3SEFA 3ZYZA 5A4MS 4KMRA 1L5WA 3THWB 1CY1A 3LQ4A 4RU1A 5DIFA 3BFJA 3ZIUA 3P71T 5A9RA 4KZKA 4ASUA 2DT5A 2BHRA 3O8RA 1JEYB 5AVVA 4MKIA 2HMYB 1SPXA 4DRXB 2OVBA 3IKJA 5IXSA 1DEHA 2QP3A 3NHRA 3H16A 5EQDA 4PGAA 3RS3A 2WE8A 3I73A 1V8DA 1AMOA 1QTIA 2WLSA 3EIQA 5CPFA 2EP7A 1CR4A 3H1TA 1XXHB 2GBCA 3B7WA 2MSKA 4D6YA 1K89A 3PJGA 4ZZIA 4MVJE 2D5IA 1E3WB 1N2ZA 1VOTA 3JQAD 4E3ZA 1OROA 1TCVA 2AA3A 3BK1A 4AMVA 3K0AA 4YR9A 3MJHA 2KE5A 2G7ZA 4DYDA 3ZCSA 3FPHA 4E2FA 2BZ1A 1C9YA 2NZJA 1RZ3A 2B98A 3HACA 4PCUA 4EELA 3O83A 2FKAA 2DFTA 1WF6A 1Z5PA 3CVYA 2FE1A 3O8OA 2ZS8A 1ZBQA 8OHMA 4RUKA 2QLTA 2ZBFA 4WINA 2EYUA 2VNAA 3HKDB 3LZ6A 3DEIA 3Q3CA 4HYTA 1H5QA 1W5SA 3KELA 3PIIA 5F23A 3EEFA 4UHKA 1E5VA 3W9BA 4MGHA 4U9UA 1MXHA 1KAOA 4XIYA 5BNWA 1MOZA 4XVUA 1TUBB 2GCGA 1CE8B 4KAFA 4S0XA 2GOYA 4YGXB 4RK4A 3GUZA 2PVCA 2VDOB 2XGGA 5D8DA 2I6FA 5DSZA 3A1VA 2XYPA 2QT1A 5CA1B 3F9RA 3U37A 4JYCA 2J4DA 2WK1A 3AXTA 4CT5A 2PUBA 1YUMA 2VRWA 3N2LA 3SZGA 5M04A 3NIBA 4L5BA 2Y1XA 4P2BA 2JA6B 2J9ZB 7MDHA 2GEFA 1ECCA 1R0YA 2Q4EA 2R11A 3T7CA 1LX7A 5F4BA 3TQRA 4B9EA 3U49A 5I47A 2UYGA 5A3SA 4QVKA 3V9PA 1Z4MA 2QPLA 2HA3A 1JI3A 2FPGB 2Q5OA 2QRLA 3PGXA 4RLFA 4BJ3A 1ORWA 1TZMA 2FR0A 2F6RA 2IDMA 2Y9PB 3D4PA 3H17A 2CXPA 3IP9A 1RYDA 2MINB 4S12A 5ESDA 4IIVA 1JHAA 2O1XA 4NPHA 4Z0TA 3AHEA 3TZ6A 3G79A 1TZCA 3I92A 4UTXA 2UVQA 2GK7A 3DZIA 1SKBA 2LR0A 2OPBA 3KS9A 2HHAA 4MDHA 4J0QA 1ZAKA 5KOJB 3SEQA 3DZJA 1OASA 5A5GA 1SCKA 1T4BA 2VZLA 3LYLA 3IAM6 2FG5A 2H2WA 1A7AA 4ND5A 1DIGA 1UFQA 2QI9C 1SBIA 4AY3A 4FD3A 1QDUA 5CH3A 4ZVUA 3S68A 2QSJA 2WTMA 4BNDB 1K06A 2WYOA 5ALUA 2IL1A 1IBKB 2RHDA 3E9MA 4IFEA 1LX6A 2Q1SA 3DAFA 3AFGA 3GDFA 4G85A 4X60A 2I1VB 2Q5LA 2R1VB 2C3OA 2HMSA 1XDSA 2ODAA 4YXFA 1V1RB 2R47A 2GWRA 4GMXA 1G20E 1U31A 4AICA 4EM6A 2F55A 2W2MA 2XV1A 4JP5A 5EEHA 2CNWA 4BB6A 3JD3A 2RHWA 2VN8A 4YRFA 5H83A 1O4VA 3G17A 1R4NB 3M5DA 4ZGGA 5FIUA 1PVDA 1SVOA 2XBLA 4C6TA 1W4CA 3CF2A 4FW8A 3LVFO 4E4YA 4YRZA 1XRMA 2BI7A 4GM0A 3BGIA 3HXKA 4RK1A 4ZD6A 5LIPA 1QGZA 2XQKA 3I23A 5C31A 2DQYA 2QN3A 2NX2A 3H65A 3MJTA 2QOEA 3U39A 2C1ZA 4D56A 2PEZA 1UJ5A 1Z9BA 1KWKA 1Z5OA 1DAMA 2ZRBA 1NVWQ 2E4AA 5DI9A 1N5DA 1R8SA 2BKVA 2YQ5A 1Z2AA 2VDMB 4K86A 3H6HA 1RYZA 3OFND 4R2HA 3B6EA 3OEYA 4HB3A 2M6RA 4K46A 4K9KA 4EAAA 3HXQA 2IZ0A 3ESRA 4UOEA 2WM2A 1XZNA 5EEGA 5IM4A 4GM1A 4IQFA 2NYRA 2KI5A 1TMYA 1EFLA 2VNHA 5KMGB 1Q7EA 1W94A 1JXOA 2POQX 2WIGA 5JYEA 4Z3OA 1HZJA 2F9MA 4MR9A 2ECFA 2GBGA 4E30A 2E89A 3TDNA 2IYOA 5BN4A 1ZGCA 2X1VA 4BEVA 5EMNA 1QE5A 4J0IA 2H17A 3N8IA 1ZXLA 3CXRA 1RYEA 4DV1B 1GPLA 3MTBA 3LUCA 3AUFA 1KYIA 2EF0A 3GQVA 4X84A 5FV7A 4CKYA 1YCGA 4JELA 5ESWA 1Y6QA 3E9ZA 4KAAA 3FSGD 1F6BA 4WLFA 4BKRA 4KMSA 5E1DA 1JJFA 4TSFD 2NZWA 4GQAA 4ZODA 1QIFA 2DPXA 6PFKA 5K7SA 4O4JF 3QSGA 2ZSJA 2XF8A 2EFEB 5E7QA 1MFPA 2FDCA 2G8LA 3BREA 1JX6A 1YKGA 1FDIA 1TT5B 3CY6A 2YXEA 2BGIA 2VFAA 4TQ9A 1JSLA 3SMVA 3VR5H 3J81A 3AETA 1XN4A 1GU0A 3RRMA 3LC0A 1W88A 3II6X 4MPDA 2GCOB 1N57A 5I48A 1OFIA 4AJPA 2ONCA 2IY8A 3B3AA 1CZRA 2JAPA 1O95C 2BGUA 3B8EA 3Q2OA 4RV4A 3UHJA 5MN6A 3L3BA 1D7AA 1C1XA 1DJPA 2Q9BA 4JJ8A 2XNHA 1HETA 3M3PA 4K9PA 4MMYB 1Y9EA 2JHAA 2AMJA 2Y1FA 1NF3A 1BJTA 1XCPA 4FWIB 4PWYA 5B4TA 4KXYA 1E3MA 1X7GA 4R81A 2GTPA 2HCFA 1NRIA 4E32A 3KR0A 3JTEA 2HHHB 3FHTA 1ZSYA 2GO7A 3HRKA 3QVOA 2MYNA 3UMGA 3VR3D 1OBHA 3AR7A 3EC2A 2NUAB 4KR3A 1I33A 5IAJA 1D2NA 1C30B 2HF9A 5M29A 5GIOE 3JQFC 3CSUA 1FMTA 1U80A 1U9CA 1L4UA 2QW8A 3WTCA 4EFKA 1QZUA 3P0FA 1SOUA 3AI1A 4EJSC 3FOFC 3LU1A 5C5EA 1WNTA 1F48A 2QTAA 2ZUBA 2BDTA 1X14A 2QW0X 2C5FA 4OL9A 1QVZA 3FCCA 2WVGA 5AW0A 2XKKA 1CJUC 3KUCA 3FI0A 5B7QA 1CYEA 1UBGA 3N8HA 5ALWA 5IDQA 2ZYDA 1VE6A 3MS4A 2ZAYA 1E2UA 2OZKA 1JKJB 1NIJA 3NGXA 5EZYB 1Z4QA 4Z51A 1U7OA 1ADYA 3WNDA 4ZTZB 3GDHA 3TB4A 3U44B 2J85A 1P2VA 4QYXA 3BXHA 4CLRA 3CVOA 2YN2A 3PJEA 3LPNA 4AXXA 2GEKA 3F5FA 1VMKA 3D0KA 1J0CA 1F2TA 1KP2A 2HSEA 4N1AA 4OAOA 1TYZA 3NLLA 3WOVA 5BV7A 4OXIA 4UHFA 3NAZA 1KARA 3COVA 2IS6A 1O7JA 3V4OA 4C01A 1J09A 1CNFA 2DKOA 5EWLB 2J48A 4D9BA 1LRJA 3DHWC 2CUNA 5ULLA 2JJYA 3UFXB 5KSWB 2G6TA 2WW8A 2J9YB 1P0FA 2WJGA 3NFYA 3OC6A 4HSEA 4URHA 3VFDA 1PLJA 1VJTA 3CJTA 3WIBA 4DTIA 2MR6A 3FOCA 3RBAA 4EPXA 3FTEA 1B93A 4NH4A 1RE0A 4A6PA 3RC1A 2QLFA 1XZIA 2ZT8A 1ADFA 5JYDA 2JJ1A 3I5AA 1KFKB 2WAOA 3Q1KA 3ZGOA 1WBJB 1GTJ1 3HN6A 4B6SA 2W71A 4LEIA 5JC8A 2ERCA 4GAEA 3GTLB 4G0PA 5CLGA 5DWVA 1HA3A 4Y1FA 1GY8A 4II3A 1M2OA 3D4LA 1DO2A 4DS3A 4RIFA 1CEEA 5I9BA 3ZOZA 4CMEA 4NCKA 4TV8F 4PYKA 1QRTA 1JFVA 4Y2SA 1B8NA 2FMTA 4BRWA 3MK31 2NAPA 5HFNA 1M1NB 4MI1A 4UBOA 5KWIA 2IXGA 1TVKA 1UZMA 4RM3A 2DHRA 2EU8A 4I81A 3KQSA 5L3RA 2J5BA 3BVPA 3CN7A 3TW4A 1H5NA 2WU4A 4WXYB 1IDOA 2QK4A 1W4BA 4YH1A 3HWRA 5DHUA 3U3OA 5CFRA 1AKUA 4J4BA 2QDXA 4H7JA 4LXYA 4M7OA 4NZ9A 4ZVRA 2DERA 2C8KA 2ZU0C 2VF7A 1SEPA 4A16A 3MBIA 1R18A 5ENZA 2IV2X 1HO3A 2R8ZA 3WJAA 1E59A 2AOTB 4N5LA 2P9ZA 5ITZA 1O77A 2JA2A 2ZXFA 3VA7A 5BUSA 4TTPA 2V98A 4BOYA 2I1QA 3EGDB 3AEZA 4GR9A 4U0JA 1SEVA 4HNHA 2XE7A 3O95A 2AUNA 3VR2D 1IFXA 2FE4A 4Q4HB 4IH1A 4PX5A 3PNLA 1NQWA 3PZBA 3P4UA 3VR6H 4JV5B 1TO2E 5K4HA 2L18A 5COAA 4GWGA 4OUDB 2GPTA 3ZD7A 2C7BA 2Z95A 3R20A 1XZEA 2FWAA 2CCGA 1VGQA 2RONA 4IKPA 4KLCA 2D62A 1DBPA 1BO6A 1ZMTA 1SU6A 3DOEA 1SUSA 4WKOA 1YS2X 2YXPX 4MA4A 3NEJA 3BBPA 3GNQA 4LQLA 1PBNA 1FFGA 3L7MA 2ZW9A 2NM0A 4PC1A 4ZYVA 2JGFA 4MJLA 4EPVA 4ALLA 4CIWA 1X3LA 4OFZA 4Q1EA 3C1OA 4M22A 4GOND 2HI0A 4UUAA 3RHSA 4ESVA 3QKRA 4RJKA 4CDNA 5HHTA 2RGRA 3ZR4B 1AIPA 3IPXA 1T5DX 1Y7HA 4L07A 3TRDA 1PD1A 5IW8A 1X42A 2P9YA 3BQMB 1K5HA 4L73A 3WSWA 2V3CC 5FEUA 3GLKA 4TKUB 4EA6A 2BPOA 2BH9A 4KLNA 3N8GA 4MW7A 4L8LA 2HHCA 3ZKWB 4BGUA 4C14A 3HEAA 3RBXA 4G0ZA 4M1EA 1BVYF 2JFXA 3WYAA 3IR7A 2NO7A 4MV8A 1UINA 2ZDGA 4RKFA 5CNJA 2H92A 3OZDA 1YOBA 4RZ3A 1KH2A 1UBMS 2GK4A 1N75A 2P67A 4OQDA 5FWYA 4TMYA 3JQ9A 3BHMA 3OH8A 4JGBA 4XIGS 5DN9A 2WB1B 4O2AB 4HVLA 2C7QA 2N42A 2WWFA 4ODIA 4RH3A 1KIAA 1DSSG 5IH7A 4YUZA 1ZPDA 1MXFA 4HH0A 2KYRA 2PH5A 4NU0A 4WT7A 1QNFA 4XB6B 3ZI0A 1PQPA 2J5XA 3VJRA 3E23A 1ECPA 5BSKA 3C8DA 1KKUA 2YNMA 4NXMB 1ZX1A 2NNLD 3PDWA 5JUWA 5JNRA 4KDEA 3RYHA 1GP2A 3A9RA 3NETA 3RTDA 1E9SA 1ZP6A 3PWSA 4HQ0A 4AKIA 1P6UA 2ZIVB 1V5IA 1P9LA 1YZKA 5ALNA 3K1ZA 1PL6A 1CUEA 1J2EA 1AGXA 1CF9A 2ALJA 1Z2CA 1ZN8A 2RGCA 4DR7B 1EUDA 3D3WB 2BI4A 4U6QA 1ZRNA 4WL0A 1JG4A 1QH9A 4GI2A 3RIXA 1ZHOA 3DAGA 3LH5A 4AZ3A 2O5RA 4PHGA 2H31A 3OTWA 2PZMA 3OQIB 1N8SA 1GNTA 5HKKA 1Z12A 2TMDA 1EFAA 1R6UA 1XU9A 4R1LA 4ME6A 1TKBA 4JA2A 3EPKA 1VKHA 1KFBB 5DX8A 2X5JO 2C59A 3R77A 1U2PA 4LUCA 1UC5B 2A35A 3N87A 3NO4A 4NHEA 3FWHA 1WUYA 3IUEA 5UKDA 4EG3A 4K87A 1WVGA 3C6QA 3UAVA 5FFMA 3ED5A 4TTRA 3G7NA 4BLQA 2Y8EA 4C4YA 3QFSA 4K3VA 1RYBA 4C1BA 4WK6A 3W8NA 2UUAB 3RUCA 1VMAA 3WISA 1XQWA 1E5XA 3SYNA 1W5TA 3JYOA 1KAMA 4FI3C 1SXJE 4H1WA 3HN7A 2ZRCA 3LRTA 1IK6A 3DC2A 3JATB 4V02A 5FOUA 4QXPA 2H1FA 2NYUA 5HQ3B 1CDZA 3KAQA 4TL8A 2ISSD 1M6VB 1WMEA 1FZTA 3C98A 1JEQA 2Y2UA 5FWXA 2HTFA 3WLPA 1JRLA 4Z4EA 5JSKA 2JFFA 1HDZA 4BO8A 4XARA 3JQDA 5LB4A 1X7YB 3M49A 3GWZA 4RKWA 5TDHA 3SYKA 3WTBA 4ENTA 5F2NA 2C4UA 1ZH2A 4X61A 1IBMB 3OECA 1Q91A 1JG6A 2DRIA 4Q05A 1XD2A 4BX2A 1JG7A 4WFQA 4WBNF 1EP3B 3IRUA 2ZSAA 4MUBA 1W0JD 1P2UA 2VRCA 2Q3FA 2I6GA 2YN4A 3GRUA 3K0EA 3ZH9B 1W48A 1ODCA 5JSHA 1G3RA 5JSZB 4X7PA 1X1CA 5AVSA 2HDOA 3CGGA 2NVQB 3C3BA 2PRZA 4QNRA 4BNGA 3N39C 4YMLA 3ZQKA 2VXCA 3L79A 4DUYB 1G4UR 4L16A 4U7GA 4BMOB 3THWA 3WBJA 3CWZA 2VQSA 3WO0A 2P6PA 1EVLA 3FVWA 4G37A 1P1HA 3GUCA 4RY8A 2WKWA 1LF0A 3TECE 1WXWA 1JEYA 1MN6A 1JR3E 4HR7A 1I5RA 4ZYUA 3AF2A 1TW3A 3EFHA 5B5SA 1O6BA 2JAHA 1TFUA 3QU4A 5E0KB 1P44A 1NKVA 3FZNA 1UXKA 2I22A 4PO9A 4AROA 2Z4RA 2P40A 2W6MA 3LF2A 4RZUA 4G2TA 2JIZA 1CY0A 2WLTA 1B6SA 1F4LA 5KIAA 3CX6A 1KXJA 2QUIA 2EZ4A 3E22A 1E3WA 3L7LA 4DIOA 1KI4A 2KHZA 2GCEA 4D3YA 4D9KA 4CJXA 3UCEA 5BNZA 5KEIA 4BY7B 1SWWA 3OA0A 5MF6A 2ABWA 3F3SA 4RCZA 4DSOA 5C37A 2G9VA 4IY1A 1YZTA 2GDJA 4I55F 1B0UA 2AW5A 4LV8B 5IVKA 4XYMA 2ZJ0A 1XQXA 2OKGA 2CJYA 2I4TA 2AI3A 2F1JA 1CJBA 3NBYC 4URWR 3ZY6A 1ISSA 1I32A 2E4VA 1FNCA 1CJVC 1EFCA 1G5TA 1K5DA 1K2VN 1ZM3A 3ISTA 3P7MA 3HKDA 4BLRA 4MA0A 3EQ8A 3MUNA 5FR2A 3TR6A 3U4GA 2JGJA 2QSUA 1ILWA 2EKDA 3JASB 3RKSA 3NKLA 2OBYA 3G82C 1L5LA 4DNPA 1U1GA 4EB6B 3DOCA 1N77A 4B32A 2ILVA 2PGDA 1KZ1A 4D9HA 1WEKA 2RSLA 2O8DA 4OLAA 1TJ5A 1QHFA 1GAEO 1TUBA 3OLVA 2B2CA 4IZIA 1O87A 4Q9HA 3V8QA 1SUIA 3ZY2A 4GVLA 1ATIA 1D0SA 1IWPB 2FNAA 2FVXA 3CEJA 3I2HA 4QBHA 4FEEA 1I1OA 1PJCA 3K96A 3PT5A 4GRDA 5CA1A 1YONA 1PT7A 2AQIA 3BK2A 4JLAA 4FM9A 1OCEA 4M8NE 1R0WA 3R0IA 1PF7E 1T3LA 3HBAA 4IZOA 1IOLA 1UKVY 3EH2A 3HO6A 4N5IX 4YP9A 5L3VA 4I66A 3ZNOA 1YDEA 2MDTA 4U02A 1ZOSA 3RIYA 1W1IA 4F7DA 4Y1EA 4CEHB 3ETDA 2FPGA 4NBLA 5KDLA 3TNJA 5BNTA 5JQGF 4TVBA 5JLAA 1C3EA 2PWPA 2IYEA 2MINA 2W9XA 3PF9A 4GL4A 4M83A 1HE8B 1JQ5A 3M1IA 3A04A 1D04A 4FS3A 5IHPA 2ZANA 4QAJA 4OLBA 2PLAA 2GPWA 1U9IC 2HJHA 2NZVG 3BIOA 5K3SA 5ADVA 3IP6A 4NV0A 5B1YA 2QN7A 1PV4A 4ZDWA 4UAUA 3CLRD 1SCAA 3GNSA 3OMLA 4PLTA 4R6XA 1T5HX 4BP8A 1YKSA 5ECDA 4EYOA 3CZMA 1ZL2A 2CXQA 1AGNA 2YV1A 2C4NA 1VJ5A 4MI9A 4F1KA 5IASA 2OGUA 2Q5FA 2QVYX 2OK8A 4QHYA 1LWOA 4YCAA 1RYYA 1Y6RA 4Y2VA 1KFEB 621PA 1USUA 2YWDA 4CL3A 4B6JA 4KODA 2C7VA 2R1VA 3KE9A 3AWIA 3I2FA 4M0PA 4YLGA 5LDGA 5SZHB 1V1RA 3VTKA 4C07A 1EWQA 2HZ7A 1PQ4A 1SC4A 1A8UA 1B4DA 2VP6A 4LDRA 1R66A 2VLBA 1X1BA 2NZ8A 5FTLA 1WPGA 3F0TA 1R4NA 3UMVA 1V5WA 1UPFA 4IXTA 1DQSA 3WWDA 1TMKA 2J6BA 4ZYZA 3F78A 4RAOA 2IEGA 2VTEA 4XUDA 1ZMRA 5AVZA 6CHYA 4DCGA 3WP0A 2X5OA 2Q8NA 3VR1A 2OHOA 2RHBA 4J76A 3NHUA 3CISA 4YDQA 4DMRA 3GFQA 4JB2A 4UE6A 2VLIA 1NOJA 1LPNA 1LSUA 2AR9A 2RDMA 2JCVA 5JAIA 3IBSA 4OGWA 1VKOA 3R7DA 4YMTA 5EI5A 5ICFA 2NP6A 1ZCFA 3PKIA 3R0ZA 2IIBA 2WNIA 2JJMA 1H2BA 2Q27A 5AKGA 1LBSA 4O4IF 5FTWA 2X9NA 2CNBA 5CM9C 3NDBB 3KYIB 3VPHA 4Z3KA 1DJOA 1I7PA 1N5RA 1RLUA 1Z6QA 5BV8A 1CUDA 5KMGA 2WJ3A 1RDFA 3C3YA 2IELA 4JHLA 4R41A 4YROA 1FNBA 1MBZA 1MO4A 1QFYA 3RKUA 2AKYA 3OLXA 5AJUA 3W8FA 4FFVA 4BBPA 4I3FA 5BUQA 1NN1A 2JDIA 2CBZA 1KPGA 2WPNA 4MAAA 4INJA 5DM2A 4BYMA 4MQUA 4A6XA 2JCYA 3BX1A 3SJCA 1NUAA 1HG1A 2BAGA 1JBKA 2PCJA 2JA8B 3UMFA 1EG7A 2R2GA 5PGMA 2JI8A 5BMOA 5AKJA 2O9JA 3DBIA 3BN3A 4AUNA 3G3EA 2Z09A 3I62A 3ZZMA 5BURA 3PXEA 1UC4B 5LQNA 5HVNA 3M5CA 2Q3MA 2EFYA 2ZI6A 3WJ7A 1AY0A 3EVBA 2NXEA 1MTOA 3MJSA 4ARBA 5ER9A 5IFKA 1OH5A 2ZZMA 1TOAA 3SJZA 4B79A 1WB5A 3LLSA 1KEVA 2JGMA 2GI4A 5ETJA 1TYEB 1N6RA 2DBZA 2RG7A 3IT0A 1ECBA 1EVJA 1TT5A 4UREA 4XQGA 5E7JA 2QPTA 1X9IA 2DOKA 3F5QA 4R51A 3F7NA 1JE1A 5EY5B 4BLPA 1JPNA 1QHHB 4JFRA 4NYMQ 1P1IA 4Y0NA 3VU8A 1VA4A 2GCOA 3I76A 3CRNA 2PUHA 2YXDA 3L84A 1QCDA 3T9CA 3TLJA 9ATCA 1XTVA 1WXFA 2H1CA 3F3MA 4PQFA 4DV2B 2FWJA 4GIBA 1FQJA 4Z9FA 4YRAA 1NUUA 1DXHA 1FYWA 4GZLA 2EFCB 3GJXC 3MQ4A 4KH0A 2PS9A 1L5SA 2PPVA 3AKZA 1QIKA 2GVZC 1CQXA 4YY3B 4WLUA 5KAPA 2VYQA 5IP5A 1PNRA 4R5HA 4P4UA 4ER6A 2Y67A 2FH5B 1XOIA 4J3FA 4S24A 2ERXA 2YXNA 5H59A 4CM1A 5KTPA 1E5LA 4BQEA 4LZNA 3R7AA 2ODWA 4D1YA 2OBFA 3TLGA 2NUAA 3RIEA 5I4BA 3WDMA 4FFBB 2Y1WA 4JSTA 2XY4A 5CBPA 1X1DA 3SU8A 4KREA 3P2JA 4B31A 5AKXA 1BGVA 2JH3A 5IBRA 4AIIA 2IUUA 2BUAA 2C0QA 3NRJA 4Z2YA 1C0EA 1M8PA 1JDJA 4F97A 3C3MA 1RZRD 1IY2A 3MINA 3OQPA 5BMVA 2H57A 3ZKAA 3LBFA 4Z7QB 3GDOA 1BGXT 3NM4A 3HGTA 4HXFB 1SPBS 4UBJA 1L0BA 2FJPA 2G72A 4BGEA 1JKJA 4B6FA 2FPMA 4DYHA 1QQAA 1E0AA 3O9VA 3GLRA 4HNRA 5KVAA 1N6IA 4Y6RA 2XCOA 3K72B 1IQPA 2G76A 3B2EA 5IDYA 4LWZA 4I4LA 2O05A 3C14C 3PNPA 4CM9A 5CVTA 7GPBA 4F8JA 1DUIA 3EXIA 4G9EA 5E6RA 3W0LB 5I51A 5AK5A 2G1PA 4XH9B 2B8WA 1TYBE 2EGGA 1AG9A 3VR5A 3ILXA 3JVDA 2O1EA 5EMKA 3U3KA 2DHEA 3QFFA 1DG9A 3LGXA 3DM9B 2ACEA 2AN3A 5BYJA 2JL1A 2B9VA 5HUHA 2WU1A 3G6KA 5EWLA 4BCCA 4NK5A 3TG8A 1XC7A 3BXOA 1NXPA 2WV7A 3D3EA 1U2SA 4HGOA 5IU6A 3D54D 1Y48E 1TDJA 3UFXA 3FOZA 1MX1A 1E96A 2HRBA 3LLUA 1X15A 4OHWA 1VPVA 1XZMA 4M86A 4EUHA 5HJ7A 1E5TA 1Y7LA 3TSOA 1D7OA 5F35A 4PBSA 4OM7A 1C4WA 1ABEA 4BNNA 3QUTA 1E1RD 1ZUWA 1HURA 4QGBA 2FZGA 1X86B 2C9BA 3DDCA 3U26A 2OV1A 4FYVA 1RHUA 2WF6A 3NDPA 4POOA 4MIOA 4YCCA 5H16A 1QIDA 4AF6A 1IXSB 4FZRA 1U8EA 3FFBA 5FNZA 1UMBA 4IIUA 4LHSA 3WRYC 1H65A 1NXWA 1RNLA 4I50F 1VPDA 2CLCX 1QR6A 2HKIA 1EBUA 2TMKA 3KKQA 4GDMA 4BGVA 3DBLB 4HPWA 1QTNA 1N3YA 3FGOA 4JJAA 3NS7A 1EWKA 3L1IA 3JQRA 1UH5A 4DLYA 1YJXA 1UIRA 3KQTA 5C4GB 1RI2A 3EUAA 4JU8A 1YF3A 5SYNA 1Q7BA 2QVBA 3KOYA 3SAJA 5LMUB 4ZEVA 2D1SA 3DWIA 5E2IA 2P9QA 2NMVA 3BRWD 4NQZA 1U0EA 2R44A 2BGWA 1L4HA 1AJEA 2QG4A 4I9GA 4OJQA 2Y05A 3UK0A 4QU8A 4C5BA 3H5RA 3QE9Y 4NYIR 3V33A 3OFSA 2V55B 3QXSA 3GA7A 2AOTA 2OLKA 3NOOA 3VSBA 2ZCUA 5I5GA 2CMGA 4DADA 2V58A 1I6HB 3GEBA 2CHFA 3K09C 3EGDA 5H0IA 4DBVO 4DV3B 4FSHA 2G9RA 2JHGA 4Q4HA 4B0PA 1HT2E 1OXXK 4EG7A 1RJDA 3C4JA 3FPGA 1YRYE 1T0PA 4DNOA 2XCLA 4OUDA 4AIRA 5EJ8A 1GGKA 1FP1D 2NUPB 1N0VC 4G4SP 5DTJA 1E61A 5JRJA 1CZHA 5J4YA 3KC2A 3URKA 1G9TA 1PT8A 2V5VA 3VKGA 4XRGA 1L5YA 5EE9A 2FUEA 2RH4A 1TIKA 1UJBA 1M1YB 2YX1A 4CIDA 2AG6A 1NN3A 4YMWA 4J1TC 4MHSA 5FWDA 2XMZA 4XD7D 1DQNA 2ZRKA 5CFOA 4BBJA 5IS2A 2ZCJA 4XWWA 3EG9A 2IFTA 2C83A 2Z2JA 3AF6A 4BJHB 2OP1A 3O5AA 3WLQA 4TKUA 5BYAA 4A8JA 3JPWA 3IJPA 3L8FA 3IVAA 3T7JA 3WGHA 4U00A 1I6KA 4OI4A 4RFSB 1ZSVA 5F3DA 2BE9A 1X1SA 4OYRA 3HU5A 4LHXA 4YS6A 1KRHA 5D86A 5HF5A 5EUCA 1GV1A 3AJAA 1TM4E 4O2AA 2C2YA 1Z82A 2NUTB 4MV9A 2XT6A 3V42A 1YR7A 1DIOB 1U2GC 2IUTA 3BWBA 1H8EA 1Z5VA 4QIHA 1DC8A 3EZNA 1ZK4A 2CZCA 1IG3A 2VHUA 3JD0A 3V4LA 4NWIA 1M8KA 3BDIA 1H0RA 1XZGA 1Z4JA 4P4LA 4W7IA 1UOQA 4KNWA 1Z39A 2OO3A 5I7HA 1PJLA 4A0SA 1MH9A 4PRKA 1SOVA 1FUIA 1AKTA 1TKRA 5C4IA 1JGTA 2XECA 3G0OA 2OK7A 1QMGA 3VDQA 2XXBA 3OQ6A 3LGAA 1EHIA 1XK7A 3KEGA 2EZ8A 2J7PD 2R7AA 2ZIGA 3QKTA 4ZT7A 5JD5A 2O19A 1A97A 3MIZA 1QHYA 1MPTA 3VR6A 4BX0A 2BMAA 4MVWA 2GJAA 4AULA 3ZGZA 3D3WA 2XKAA 1ND6A 3ICOA 4LYDA 3E6AA 4PYNA 5BR7A 5JS2A 3CONA 2W2NA 4YDSA 1AK1A 4YJ2F 4XLZA 1GSHA 3OQIA 5KU7A 2B63B 4YYEA 4HOYA 5BRAA 3FYSA 5EGSA 3K8OE 1KDZA 4TLDA 4PBRA 2A88A 2VEOA 4DBLE 1WAMA 2RGUA 2W58A 3PTAA 5AWFC 4JI2B 4FN5A 1MB9A 4JLNA 1L9XA 4EVQA 1ECFA 4Q66C 5B1HA 3RTAA 4ALIA 1AKEA 4EYKA 2AIRA 3GTMB 2UZ0A 3M4YA 1TK9A 4E12A 4D4KA 1GR0A 5ALYA 4EEZA 3IQFA 4MS4B 5TPZA 4OL0A 4FEAA 4CI0B 4FN4A 1AXGA 3UJ9A 4B4UA 4KXUA 1RLMA 5C8XA 4GOMD 2EW8A 4CLEA 3DJYA 4ZGWA 1D6MA 1B76A 2Q9AA 1CY8A 2Z2ZA 4D0GA 5JSFA 1P3Y1 3JATA 3OKCA 1YTUA 1XCBA 5HQ3A 3FPLA 3CNEA 3NTQA 4QPDA 5AP9A 2VIIA 1M6VA 2FEPA 4TWAA 4CHGA 1D2EA 2PS3A 4J0DA 2CXHA 1Z4IA 5A71A 5I4CA 1JHMA 2YJZA 5L7WA 2XRZA 2PK3A 4RXMA 5EVCA 4UUPA 2AMFA 4LC1A 3WK4A 4NCXA 1QUFA 2P2CA 5K3EA 2W8ZA 4CKCB 3OJOA 4UEQA 3BSFA 1EG2A 1VYTA 1N2IA 3FBWA 5TEVA 1NJ2A 5KDOA 1ZJJA 1K3TA 2P4SA 3FVTA 4HH3C 1GR1A 2CVQA 2O3RA 3DCIA 1VJ0A 4QQFA 4DJTA 2PJZA 3IAS1 4F5WA 3TL2A 1RVDA 1KNXA 3NTXA 1OFTA 4B3BA 1AVTA 3L8ZA 5JSZA 4A3JB 3SNKA 3FFWA 2WSYB 5IANA 1CG6A 3BCUA 4MROA 2JRLA 2C7RA 1NPYA 4WERA 1SUCA 3CUSA 1LDYA 1ULBA 2AYYA 4G4IA 4II7A 4B2IA 3N0RA 5J58A 1J90A 1O9BA 4TTSA 4XOUA 2GASA 3CLVA 5CFMA 3ANXA 2YN0A 4EHFA 2J33A 5JJKA 1PR9A 2P2ZA 2J9RA 2JJ8A 2CL6X 1A1VA 3NUGA 3V7YA 4B7CA 2VDNB 4R1SA 3VOBA 2C2KA 3X1DA 1L5VA 5FULA 4KTTE 1DXYA 2BDUA 3S2YA 4AUKA 3RADC 5DO9A 5AR1A 5KYYB 3H8JA 2I67A 2QF7A 3V46A 5D2CA 4E1BA 1WQ3A 2XADA 3OOHA 1NVUQ 4RLHA 2HB6A 3JAWA 5JDIC 1LPMA 4AJ4A 1JLLA 1N6KA 4BBRB 1L6RA 1QV6A 2DPMA 1SIOA 3KTAB 4OJMX 1K63A 3CX7A 4P3YA 4HVAA 2EBHX 4IH4A 3S8EA 2OP0A 2P3SA 3KIPA 4WOPA 1YV9A 2TECE 3ZZTA 2IZ5A 2WG2A 3LUHA 5EHZA 1W75A 1QVRA 1TCAA 4YJHA 2QSZA 3WMGA 4QOGA 3FMOB 1RAFA 1T9AA 4QXRA 3HM9A 2IZZA 2HNAA 1IE3A 1U9IA 4CQJA 3INTA 1WCIA 1KXZA 4TSKA 3ICVA 4L28A 3H0EA 1YFLA 5CP8A 4QFBA 1M10A 1RPJA 1E2JA 4YUWA 1CLUA 3NATA 4C0JA 1E2IA 3OSUA 2QHXA 5AHRA 2LP4Y 3HU3A 4KWHA 3WIVA 1NFQA 3VHQA 2YYYA 2YC4C 3F46A 3E3AA 2JGAA 3ND6A 4ZCLA 4RDXA 5JMWA 4ZRMA 5JAQA 5JPIA 1TTTA 4PRZA 2BZ0A 3CH6A 1GQQA 1ZUIA 1L7OA 1JPVA 2OC9A 4MDYA 4ZYLA 5AW8A 4HEA6 3RYCB 3L4SO 3GX1A 2WA1A 3TE7A 1WU7A 1BS2A 1PFWA 4OXRA 5JO0A 3R5XA 5THXA 1EXMA 2QRZA 4IDBA 3U2QA 1G8AA 5DTEA 5J5AA 3ZH2A 3QEMB 3ENKA 4RGQA 1VXOA 4CCSA 4QQNA 4CCAA 1YE3A 4R68A 4KG7A 3PL5A 1RQLA 3HV0A 4KC0A 4V1CA 4REQB 1TQ2A 2GJ4A 3GAAA 3LC7O 4CEHA 4RZHA 1U7WA 2QAGB 4H0CA 2WPDD 3UUEA 3DEKA 1Z0SA 4UVIA 4QQRA 3INNA 5LU8A 3LBHA 4IJ6A 3MTDA 3PDIA 5G0TA 3CRZA 1D6SA 4FOSA 2Y0PA 1W87A 4L85A 4KGZA 4MUXA 2WJ6A 1BMDA 5B2FA 2R25B 4Q7EA 1Z16A 4C0XA 2BGGA 4UTRA 3UUWA 2YWEA 2CLKB 3HP4A 4LWQA 3V8EA 2IHTA 4G0OA 3JYNA 4C0KA 3MBOA 5DVZA 4KV7A 4Q5IA 1W4LA 1Z17A 3K35A 1KK3A 1ESNA 4F5YA 2BTQB 1KVRA 5IULC 1IH8A 5E9JA 4BMVA 4G0VA 3RWMB 3EMVA 2WJ4A 3FUVA 1G9SA 4KXLA 4KFSA 2NPOA 4RELA 3VNAA 3FTDA 4CM4B 2F8TA 2QTHA 4KI7A 1TQ8A 4J9VA 4B3IA 1Q0ZA 4URFA 5I9TA 2CJFA 5KTOA 2G1UA 4MDEA 4TZ0A 3M6XA 2DP4E 4AJ2A 1CEXA 1D2HA 4GP9A 4D9GA 5BN1A 5BT8A 2X6RA 1EAYA 3EODA 3B1ZA 1M0TA 3DB2A 2BSAA 4KSYA 3WGMA 1AHIA 5IKXA 3D31A 4KYVA 5CFNA 5HZHA 2Q62A 3PGJA 3Q6NA 5F2EA 2JAUA 2G8NA 1JYSA 2LBPA 5T67A 5C7IO 4YUVA 1I4TD 3ZGLA 1RI4A 1M0WA 4OAQA 2QAGC 5D85A 4A27A 1L3BA 2YICA 3CE9A 2EL9A 1CVRA 1N2CE 2YHSA 1TQHA 2X22A 4PQYA 2WINI 3ELBA 4R2LA 3WGVA 4M53A 1KVUA 4FBMA 2J41A 4O4HA 4TLAA 2BFEB 1P9OA 1Z08A 2OFOA 1X13A 3E9DA 4RQTA 4WI1A 1Y4DE 5K3FB 1X3SA 3O38A 4WV3A 1YVEI 3EGOA 3TTYA 3D1JA 1J22A 3O1LA 4RWEA 4IQ8A 3GBVA 4EUEA 5ADWA 2IYSA 1JAZA 3H87A 2WFMA 1C7RA 2KW5A 1Q0PA 3H42B 4X6UA 4YR7A 3DKRA 1DTEA 4CKZA 1WKVA 2ZAMA 1U1FA 4WEOA 4FFWA 1PHRA 4JVMA 1S3GA 5KQSA 1XA0A 2LV8A 3S15B 5AUQA 3EPRA 1XCOA 3A0RB 3SKXA 3OX3A 3ADKA 2G40A 5K0GA 5LQCA 1CRPA 2QUJA 5ALIA 2PUVA 3AL0C 1EK2A 3EWNA 4MW6A 4EEKA 1QQ6A 4DKJA 3KLMX 5C53B 3CH5A 5K0JA 2WAMA 3DTVD 4PR3A 3U19A 1NW7A 2YMQA 1RXIA 5JXWA 5AJHA 3L6UA 2R6HA 1JVBA 2KLHA 3QRWA 3OCZA 4O2BF 2VDPB 4IILA 4XSGA 4EGQA 4NDZA 1NW8A 3DKVA 5KYVA 4ETNA 1SXQA 2ANBA 4WAUA 3HJCA 2YHIB 3BSWA 3F5SA 1FNDA 3BQ9A 1V8PA 3N8DA 3Q2KA 2XWSA 4PAMA 3VPBA 4BMCA 3MLBA 4E5VA 5BXQC 2GRAA 1JL3A 1XZHA 3EGVA 3KWFA 4HADA 5CB6A 3IURA 3JVEA 2HT6A 4LTDA 2R751 4BO5A 1BH6A 5EJ6A 1BHSA 4MV6A 4HRYA 4Q1CA 1FQKA 4OOFA 2JGLA 1BMQA 1MOSA 2WHYA 4CGZA 1QZTA 3VGPA 2AK2A 2I34A 1J25A 1GKYA 3ZEAA 2MOKA 2AMVA 2B1GA 2JVIA 2WKRA 5G0WA 3P2EA 3U31A 5EHNA 3S28A 1PT5A 2G6BA 4RSGA 4P0QB 1T10A 4FHGA 1RAGA 3NU1A 5AJTA 1LTQA 1GEGA 4GOJA 4XJTA 4LHZA 4E5UA 1FP2A 1KAQA 5EXDA 4UXHA 1D6JA 4IOJA 2GERA 4YXWD 3P97A 4NJEB 4FMDF 1T43A 4DHWA 3RAFC 4LXIA 1N2OA 1UJMA 2NU8B 5DN6D 3SIWA 4G0NA 1ZM2A 5A0TA 2D4HA 3UT5A 1NQAO 2W37A 1UC8A 1ESEA 4HVTA 1IYZA 1XX6A 1TYDE 3EVZA 2G4LA 4HN9A 4PLYA 3U61B 1OKKD 3U17A 4UCXA 4M55A 3ZE6A 4OJYA 1HY3A 1ONPA 1E3EA 5ANRB 3OWOA 3EPPA 1U9YA 4IG9A 1LPSA 3EDOA 1S0UA 3HKBA 2I65A 1G3IA 3EA5A 5DYYA 4XGRA 2CLDX 4CZ2A 4IFIA 3H9BA 4MV3A 4X00A 3MIIA 5HILA 4HDMB 1L5FA 3TPFA 1W5FA 1A8IA 3BFKA 1EE9A 3KRTA 1I1QB 3WRXC 2N0SA 3ONFA 5JFTA 3KKNA 4NJOA 3MA0A 2VJQA 3U80A 2Q49A 3JU3A 4F9FA 4P81A 1U0OC 3LHFA 4RY2A 4YYZA 1SVIA 4GPD1 4U2KA 2FUNB 2BUBA 3D4IA 4WZZA 5GQSA 2JAXA 5EJ7A 5JLJA 2OBXA 1WB9A 1Y8CA 2QTNA 4JJKA 4L4ZA 2WDZA 3RV3A 1XF1A 1U8YA 4RIGA 1NVTA 3UY4A 2D1TA 1CQIA 2IXDA 3MJRA 4U6SA 2ZYUX 4MCJA 3DZHA 2PS0A 3FVRA 4KR9A 3KXLA 3RC9A 1KS9A 1LBTA 2GXAA 3LX8A 2IJGX 2QT0A 2ZJ1A 1MC4A 5CT4A 4NULA 7REQA 3T35A 1UEXC 3BIJA 4NMMA 5JI3E 2V7TA 2E87A 1YVUA 2AYXA 4ZEWA 3DF9A 3HS3A 3QVTA 4ZRDA 5FA6A 1CS0A 1VMIA 5CBKA 4RCVA 3U7IA 3W3AH 1TAGA 2AFIA 1UK9A 3GJ6A 3PS9A 4I1IA 4IF4A 4IMJB 2FOXA 4C2BA 4NBRA 1NRWA 1FEZA 1QAOA 4OV6B 1MEOA 1RHKA 1ZISA 3IGFA 5KTNA 4UNRA 3C1UA 2DWOA 4RKEA 3VX4A 3DOJA 3OQOA 2CVFA 1TF7A 4JJFA 5CDGA 2A5LA 1WULS 2IH2A 2BGMA 3KWJA 3K31A 3OBIA 2WSIA 2ZJ6A 3PX2A 4DUZB 4MS1B 2HWWA 4EL5A 3ZW8A 3IXMA 2ZG6A 1N7IA 4WKNA 1UBEA 2A6PA 2JJ2D 5IT5A 4GKKB 3GLHE 4CMGA 1X6VA 4TMKA 4PYLA 2FSPA 4X6LA 3VJKA 5T8KC 4WLVA 2ZFUA 1IUNA 4MB2A 1ISIA 3CUEF 4U7FA 2GD0A 2VXOA 1JMYA 1ZD9A 2GK6A 1YJBA 2WJHA 1AB6A 1IG0A 3HCAA 4MRPA 4PG5A 5FLEX 3PWTA 3SZMA 4D8YA 4Z4QA 1GKLA 4RIHA 3FTQA 1IPEA 3F2VA 3O7WA 2XWBF 5TJHA 4EL0A 3X2EA 4AJ1A 5I7EA 1IJEA 3EX7C 2ZSBA 2MSCB 3BH0A 2HD4A 4ZCPA 1R4MA 3GTOB 3Q41A 4QXAA 2QQEA 4FEYA 4GPAA 2QJWA 3L77A 4LX8A 2HIAA 2TSYB 4QDKA 3G49A 1Q50A 5CVJA 1UBSB 2V0NA 2VHEA 2CD9A 3AV3A 4LY3A 3WNQA 2IXEA 4WCDA 1XLVA 4P53A 5DCUA 1MQSA 2IBTA 2NUPA 3QOXA 4X92A 1UFKA 3ZVMA 4P35A 1GLNA 1ZVVA 2BP7A 1YZQA 3OT5A 3PRJA 3I3OA 5GZ1A 4OHKA 4PVCA 5A0VA 1M1YA 1NXTA 1DIHA 2ADMA 5JPCA 1QORA 3SBOA 1MO6A 1EE1A 3WGUA 1W85A 4C4ZA 2Q0HA 2H59A 3DDOA 2R6GA 4KQJA 4PLGA 3SCZA 4ZIRB 3GU3A 3MPOA 3V80A 4YMHA 3UXYA 2Q1UA 3B13B 5HJ2A 2IGTA 4INAA 3WHPA 4X5OA 3WYCA 5JCXA 4NG5A 3DVQX 1V6CA 2R8PA 3DD5A 1QS0B 4F4IA 3VH4A 1RQXA 5D51S 5JALA 3LYAA 1YZUA 4RFSA 5LMZA 3BAFA 1DC7A 2IBMA 5AXAA 2W6ZA 1H4TA 2QAJA 3HYLA 3NBZC 1LU9A 3ZI7A 2I2DA 3ZWXA 4M89A 1DDGA 1Q0RA 3GN1A 3PXAA 4WXPA 1AQNA 4C4TA 2JNWA 1JNYA 3GJ3A 2QWXA 2YJ3A 3A7EA 2NUTA 1ONSA 3DEHA 4A5SA 4AQDA 3OQJA 2PQ6A 1Y8RA 4JVOA 5FLKA 2GFHA 5K3BA 1RLOA 1WA5A 4AKTA 1XZ8A 3QTBA 1SB9A 1DKQA 4GEKA 1K7CA 4KN9S 2N47A 3LYUA 2VVTA 1P5FA 3AF0A 4IUCS 3PEYA 1USVA 4F2PA 4NZMA 1JH9A 3AV0B 4FYPA 4GMDA 3EF3A 3K9HA 4FHCA 2OFPA 4JLDA 4PC3A 1KOFA 4RMJA 4RPHA 2QROA 4BBAA 1M8FA 4ND4A 3ESDA 4M1OA 1H2HA 1KOJA 3R3XA 2RAVA 4RY9A 4XWYA 1R3UA 1S4QA 1SG9A 3PYMA 1M5TA 1OW3B 1T0IA 3GRZA 4HMOA 4ONEA 4WQMA 3ZDQA 2OTCA 4L3OA 4F92B 4UPEA 1H4SA 1LBEA 2DGDA 2WU3A 1KYZA 4JLKA 1Z7WA 1WDTA 3HXLA 3IUJA 1D2MA 4EVIA 3JX9A 2EARA 4BNMA 1UDRA 3OP4A 2GZ1A 4D9EA 4AU1A 3EOBI 4MYRA 1VG0B 4M76B 4TTQA 2BCEA 3F1LA 4F2WA 3IP1A 3O2JA 1M2VB 1TRKA 2YMMA 1PE0A 3M1YA 4BL5A 5JNSA 4DQDA 1F51E 521PA 4B6OA 3O3CA 2YYAA 3G5LA 1ZDMA 3IALA 3KVRA 4REMA 3EJWA 1WP9A 2QD1A 3STXA 2FVYA 1KBQA 3ZTTA 2Q9CA 4NCHA 1RJGA 3U4AA 3DXZA 3UYKA 1BCRB 1BD4A 2FW9A 1QU2A 3RREA 1I51A 4MS4A 3GLIE 4Q34A 1LV8A 3E15A 3LBIA 2RIPA 2YWFA 3OIDA 4N7MA 1JHYA 4EW2A 1G2OA 5BWCA 2A9QA 4TS1A 2HUNA 3WAKA 5C8YB 3T1QA 3JQPA 2POCA 7ADHA 3BGOS 4A3EB 5T4HA 5BYBA 4YAUA 1P4HA 2EZUA 2IYYA 4M49A 5LD2B 3RZOB 1E20A 3H97A 3MMNA 4Z9XA 2NU9B 3Q87B 1QE0A 1ZD2P 5IZCA 4M4SA 1NNSA 3RS7A 1A27A 4PPNA 5BOSA 2G9QA 4E5YA 2BONA 1IL0A 3NTRA 4Z54A 2X8JB 1C5KA 4RPGA 4GZMA 2WTUA 2OD7A 2G71A 1I4DD 3PBKA 4MTLA 3PUKA 3ZWVA 5LNK6 1OC4A 2OXFA 4RZXA 1Z56C 2IIQA 3PGMA 4RA9B 4BZWA 5BVGA 5EHQA 3N2EA 5I7VA 2IDZA 2VNIA 5IC5A 1D6NA 2B8NA 3AEKB 4ZQFA 1J1UA 3KD2A 2C7OA 2HSJA 4MMXB 4N5NA 2P0EA 3PB3A 3VDXA 1DKNA 1SFRA 4P0PB 5BN3A 5LSAA 4OJNA 3A6GA 3FPEA 3HKZB 2BEKA 1XVAA 2X2FA 4XYGA 5B1SA 1ZITA 2P9HA 2XAAA 5LZ4A 2AFHB 3B2NA 2BEVB 3UKOA 3FHCB 4M8LA 1RYFA 5TVGA 1MDFA 5GTDA 3RFUA 1LJ8A 2QUAA 4I5GA 3U7FB 4MQEB 4CW7A 1UOEA 4OQZA 1PR0A 2XTMA 4D8TA 4J8PA 5KYYA 3A9SA 1XEXB 2FCAA 1LWNA 2UYHA 4UE2A 1GFZA 2CXRA 1AHNA 5LD2C 5ITWA 3MT9A 3KE8A 2LIVA 3CIFA 4DCSA 1D9ZA 1EVEA 2F1KA 1A9TA 4GYYA 4PGFA 4U0KA 5IKMA 4DC9A 3AI2A 1CKEA 1T25A 4P22A 3M5PA 1MRSA 4AI6A 1VBMA 1PJQA 1Q0TA 3FNHA 1OYWA 1RQGA 3GCDA 4FB5A 2EW1A 5CXUA 1B14A 2Q29A 2EKQA 2W8BB 1UBJS 4UZFA 1YXMA 1PGNA 5AUOB 2ACWA 2H1VA 4TTIA 1A8SA 4HDCA 2W2KB 5LUAA 1I5OA 2QM8A 5U4XA 4PLHA 4YDHB 4F4FA 4GS5A 1N7GA 3GP8A 1I3LA 2A4MA 1JALA 2X8AA 3C8MA 3AHDA 3CUKA 3RCBA 3DPUA 2ZBPA 4KE8A 1OTHA 3T0IA 2QVZX 4BLVA 3D7MA 4UATA 1ODIA 3UH0A 3KDAA 1P19A 1YIDA 3JQAA 4HN2A 2X2OA 2WT4A 1RQRA 3V1LA 3AR5A 4BZQA 3RYCA 2D74A 3P96A 3S2DB 1DWUA 1EB8A 2YV2A 1AKYA 1YBAA 1MX3A 3WG9A 3MD0A 3GRFA 4V0OA 3NHKA 3RFXA 4DJEC 3NGMA 3QEMA 5I7FA 5JY1A 2GBPA 5JPDA 3FSRA 2N9UA 3JD1A 2XDAA 1D9XA 1R00A 4WK0B 1DELA 5DULA 5B58C 4ZT5A 2CSUA 2QRNA 3TOSA 4AS1A 1YUBA 1HV8A 4N41A 2OV4A 1JIQA 2DPHA 3TTXA 3A2KA 5TY0A 3TOXA 2Q6TA 1EKXA 2JLRA 2QAGA 3E7FA 4M1QA 3TL3A 3W2GA 4AMGA 4JX8A 3GEMA 1