4EUNA

Crystal structure of a sugar kinase (target efi-502144 from janibacter sp. htcc2649), unliganded structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
PTRHVVVMGVSGSGKTTIAHGVADETGLEFAEADAFHSPENIATMQRGIPLTDEDRWPWLRSLAEWMDARADAGVSTIITCSALKRTYRDVLREGPPSVDFLHLDGPAEVIKGRMSKREGHFMPASLLQSQLATLEALEPDESGIVLDLRQPPEQLIERALTWLDIAPAVATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords thermoresistant glucokinase
publication title Crystal structure of a sugar kinase (Target EFI-502144 from Janibacter sp. HTCC2649), unliganded structure
rcsb
source organism Janibacter sp. htcc2649
total genus 64
structure length 173
sequence length 173
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eunA00
1VKJA 4URXR 3BC1A 1FTSA 4NP6A 4B33A 4BEBA 2HUPA 1IN4A 4F92B 2J0SA 4NCIA 4DWJA 4M22A 3B7GA 3THOA 2VP4A 2CLCX 4Q7LA 3I5XA 3PUYA 1KMHA 4MRVA 2QT1A 1ZRHA 5EP3A 5H68A 5F2EA 1Z06A 4ZKDA 1E4YA 1G7TA 5FOWA 1BMFD 4D0GA 2LCFA 3EWAA 1MO6A 4MRSA 1JNYA 4TT3D 5DN6D 3PUXA 1HEIA 3AVUA 4LRWA 1Q12A 2FN4A 1FOEB 3WHLA 2V1UA 4P4UA 3GLFE 1SVLA 3O8CA 2ZJAA 5CM9C 4NCKA 4Q4JA 2JJ2D 5CYPA 4URYR 4F38A 2ZAMA 3OE7A 1KSJA 1XD8A 1YR6A 1ZINA 4DKXA 1N0WA 2J7PD 4PPNA 2WZQA 2MSCB 4TMVA 1IN7A 3C7KA 2PZEA 1QHNA 3K9LA 2QMEA 4BEJA 2FGJA 4CEIA 2HXYA 2REBA 4NDZA 1OXTA 5E95A 1MABA 4OHZA 2ASEA 3REFA 1FX0A 3D6TB 1P62B 4GP6A 3AP1A 3EA5A 3HU2A 4DDTA 1E96A 4UJ3A 2C96A 4OL0A 2PEZA 2BDTA 4FINA 1XU4A 4RCYA 3HWSA 2QRNA 5B2ZA 1E1RD 5FPSA 1K5DA 4EPWA 4Z1MD 1NVVR 4CEJB 4KYUA 1QHHA 2R6DA 4ASUD 4OYHA 1NY5A 1RJ9B 1U98A 2VIIA 3KZ1E 1G8HA 1DOAA 1GRNA 2PT5A 1IQPA 4LK2A 1NBMD 3Q5DA 3QF4B 1COWA 2BEKA 4CVNA 1VG8A 3MD0A 5CDFA 1KKMA 3BH0A 3T1QA 1CR2A 1HV8A 4DCUA 1G6OA 2GBLC 2WM9B 3AGQA 2R9VA 3EXAA 2HYIC 3QY0A 2GZAA 2XSZD 3SN6A 3CR8A 1G3RA 4QBHA 2ZSAA 4DLZA 4A0HA 4B2IA 5JJKA 3VR2A 2JIZA 2W00A 3EWSA 2XNSA 1XMSA 5FBWB 3SYNA 4F7WA 1G16A 4BFUA 1E69A 1OT3A 2WTUA 4B75A 4PC2A 2WWXA 5DI3B 1XPUA 1TPZA 3E1SA 5JHHB 3H1TA 1ZU4A 2PJZA 2W6ID 2P0EA 3RLFA 1X1SA 2A5DA 2A3RA 2IK8A 4TQUS 1WE2A 3VU9B 2OV2A 2RGEA 4QC2A 5DSZA 1IHUA 1SVKA 2X8AA 1MV5A 2QORA 1OYYA 2ZAOA 3KXKA 2D7CA 4NU0A 3VX3A 5KSPA 1T3SA 1CRQA 3CWQA 4OQNA 1N5IA 1U8YA 4X8MA 1OXSC 1MT0A 3TSOA 1AGRA 4Q9LA 5A0FA 1VIAA 1CIPA 2ZS9A 1SVOA 2XTNA 4M9SA 3PCRB 3B9QA 1I4LD 1LNZA 2CBZA 3PXGA 1UPTA 2R62A 4A2PA 2AX4A 2QNRA 3THXB 4QHSA 2IF0A 2C03A 4LBYA 4QRHA 4N3NA 1XD2B 2BEJA 3SNHA 1HE1C 4KODA 1E2EA 2EW1A 5LBIA 2CMKA 3KKPA 2AD1A 2MMGA 3DZ8A 2R44A 4NCNA 5JWHA 2JLQA 2VEDA 4DLRA 1XF9A 2PH1A 1U2RA 2IYZA 1GWNA 2NOAA 2WV9A 3LV8A 4B3BA 3O47A 4QJ3A 2ZITA 3R9XA 1XX6A 4B2PA 1F60A 5KDLA 2ZRHA 4UXHA 2KWIA 4FW9A 2ANBA 4S35A 3RDPA 2BM0A 1DG1G 2W0MA 2BMEA 2E87A 3WYFA 4LJ4A 2HLDD 4IDPA 5J4LA 1IN6A 4IVQA 1XTRA 1HYQA 3BB3A 4CRWB 1GDDA 2QP9X 1LTQA 4NYIR 4I4LA 1OH5A 3TK1A 1IAQA 4KFTA 2GEVA 2FFAA 3TSWA 4CW7A 1TMKA 4PFSA 2CVHA 3LLMA 3WHKA 4GZMA 4BZXA 1E9DA 3FMPB 1OLOA 4EDHA 2JA1A 2ZI6A 1KAOA 2NZJA 4TZ6A 4B3DA 1KY2A 1E9AA 1QZXA 3BH7A 3CRMA 4U00A 4QNRA 2G1JA 1IONA 1GSIA 4NE2A 3U3JA 2OEPA 2ONKA 1S1CA 1Z0DA 2I1QA 1UDXA 4ZIRB 2R65A 3KTAA 1XFAA 5DNYB 4C3ZA 2IYSA 1U9IA 5H1YA 3AP3A 2ZSFA 3CNOA 2IWHA 2MSDB 1ZYUA 2OILA 2CL6X 3AVWA 1KI2A 4TYPA 4GZLA 1MRNA 1P2SA 5IK2A 1OFIA 3CH5A 3BJIC 4PPFA 3OE7D 1VYVA 4PHTA 1U8AA 3QIAA 4GL2A 4PC1A 4KLNA 5FUWA 4MRNA 4IFBA 3I73A 2BVNA 4LHZA 3S1AB 2R8RA 1ZP6A 3A1UA 5CM8B 3AKEA 1TADA 2WOOA 3FKSA 3QSYA 1G8YA 3ZZTA 2DHRA 4I1VA 4JLPA 2IUTA 1AS3A 1XXHA 4HAWA 5FBQB 3K70D 1H8EA 3GJ3A 1KK2A 3VKWA 2BC9A 1ZUHA 3BK7A 2WVJA 1KY3A 1NLZA 1P9WA 1FUUA 1Q3TA 4I1UA 4WAUA 2P2LA 2HXSA 3JVVA 3DM9B 4HAVA 1NN3A 3FFBA 2CL0X 1JECA 4OI1A 3AKYA 1TEXA 1E0KA 1S1MA 1D9XA 2BMDA 5CJPA 2RH5A 4QGGA 2GJKA 1J70A 3HPRA 1R2QA 4Z54A 1YQTA 5FL3A 3ZJYA 2IS4A 4KU4A 2CVFA 2WWIA 3TGPA 1W36C 2YV5A 2ZSBA 4OK3A 4Q4LA 4DXAA 2AD5A 2OBLA 5IT5A 3CW2A 3R9WA 4A2WA 4TZ0A 1R5OA 3WRXC 2EFEB 2IYYA 3F5FA 4LV8B 1Z08A 3MJHA 3ZLJA 2VP2A 3MCAA 3RSOA 3K0CA 4GMDA 3K0FA 1F2TB 4V0LA 2LKDA 5F9HA 4Q01A 1KSFX 2YC2C 2WWWA 3CIOA 2XGJA 1X1RA 4D25A 4HYYA 3P4YA 4MH0R 4OK5A 2BBWA 2ANCA 1NJGA 2FFBA 4UXIA 1RRPA 1W0KA 4A9AA 4B44A 2J0QA 3FE2A 3LAWA 2F1HA 3KXLA 3Q85A 2P6NA 1U0JA 2DBYA 3CNLA 4C7OB 4M4SA 3PENA 4GI7A 4Q03A 1BOFA 1TQ6A 2D7DA 3T15A 5TDHA 1YZTA 4FMDF 5KDOA 2RKOA 3MLEA 1Z6YA 4OI4A 5FOVA 4JLDA 4RFVA 1ZD1A 1KDRA 5JRZA 4Q4HB 3ZYCA 4G5SA 4EFNA 1UKEA 3U2QA 3B1WA 5DYIA 1NSFA 4EFLA 2KB0A 2XOKA 3C16C 4LHXA 2VH5R 1OF1A 3B1VA 4L9WA 3MAAC 3IIJA 3H2YA 2GWHA 3K09A 4US0R 5JZVA 2ERYA 2AL7A 4IDQA 4DEXA 5KYKA 5FUVA 4ACAA 2H18A 2VPPA 1XMVA 3QVVA 3VTKA 3N5CA 2IUUA 3K0AB 2N46A 2QSYA 2WWFA 3QXSA 4URUR 1Z28A 5DHFA 2F6RA 2NO1A 2NQ2C 1ZAKA 2FSIA 4HATA 4RJLA 1E2FA 3C4JA 2ONJA 3AH8A 2H8KA 1D8TA 4Q02A 3EZ7A 4HB2A 1CJKC 3QBTA 4PHFA 4EPVA 4IDOA 2AK2A 4A6PA 5GADl 4W5JA 3A1SA 1E0AA 3HP1A 1P73A 5EXSA 3U3RA 3KL4A 5TVKA 2R6FA 5EE9A 4B32A 4FN5A 3P26A 1YR7A 2J41A 1XJCA 2O0HA 3U44A 2F3TA 2H5EA 4M1OA 4PHGA 4JLVA 1W36B 1G7SA 1Z22A 2GF9A 3PR1A 1YRBA 4DCNA 2RGAA 221PA 3G5UA 3NKVA 1K8RA 1NI3A 1VHTA 2ZPTX 5EXPA 1BO6A 2C8VA 1G3UA 4OHVA 3HYTA 3V4FA 1CTQA 1XTQA 4GMXA 4NYJQ 2BBOA 2ZE7A 1J8MF 1ETUA 4LUCA 5B58C 2EFHB 4P0TA 2OG2A 4NYMR 1FTNA 4IJMA 4C0QC 3T1VA 2QMHA 1GG2A 2F9LA 3AVVA 2A5GA 3GCGA 4XTRA 4ZO4A 4HUTA 1C4OA 1CR4A 2V54A 4TL7A 1Z29A 2NO9A 4N0DA 1HQCA 1Z0FA 4JZKA 1E2KA 3NH6A 2A5YB 5AK0A 3SZRA 3B1ZA 3A4MA 2NPFA 1KK0A 2NMVA 1MR3F 1OHHA 3PITA 3TAHA 3C14C 5C18A 1SHKA 4IOMA 1YZGA 3LW8A 4NZYA 2V8OA 3QKSA 3DHWC 2GETA 3GJ8A 5C46F 4LYAA 3WBKA 4YMWA 4I1OA 5BN4A 1TF7A 4IFEA 3UG7A 5J40A 4B43A 2ZXUA 1GVNB 3ZS8A 2WIBA 1V5WA 3KUDA 3UATA 4Z51A 2YINC 3FKSD 3JVUA 4Q7MB 1R5NA 1G18A 4E03A 3LNCA 5BW8A 1H8ED 1E9SA 1KO4A 5LPNA 2JCSA 2VSOA 1P72A 2OZEA 2H92A 4JKYA 1F2UB 3A58B 2G77B 2PZGA 3D7MA 2YZ2A 4TMKA 1GNPA 3OIWA 1KDTA 2O5VA 4IRUB 3TMKA 3DEFA 2ORWA 4JVSB 1PVOA 4AKGA 1TNDA 2J87A 5D3MB 1KDOA 3BE4A 5FOSA 1FP6A 2BCJQ 3ZVRA 4RD2A 1KI6A 2OHFA 4BWYA 1E32A 1ZW6A 2C99A 4KFRA 1LFDB 2QRZA 1II0A 2HEIA 4EQ6A 3GLIB 4UNNA 3IBGA 1N6LA 3T5DA 2O8EB 4OK6A 3RS2A 4G0NA 1XCGB 2QI9C 4GFDA 5HZKA 2R6CA 1OSNA 1QVRA 3KB2A 5FTMA 1R0YA 5JEEA 1RRFA 4MKGA 1Z5ZA 1P75A 4LC1A 2ZJ2A 6Q21A 1W0JA 2KSQA 5JWOA 2OCBA 1YKSA 4B3FX 2HF8A 2CXXA 1ZNXA 1W0KD 1QHGA 1YZLA 2OAQ1 3SYLA 5L3RA 2JJ1D 1IJEA 2FMXA 1SXJE 2FSGA 4KFUA 1NMYA 4AWXA 4EAQA 1M2OB 2IYTA 3JZAA 4D82A 4GOKA 1X6VA 1NVVQ 2FF7A 4BFTA 1NN1A 3SE0A 1TEVA 4LBVA 3UANA 3B85A 3N2IA 4IEIA 2IBMA 1E2IA 4B6EA 2J46A 3U4QB 3QUSA 2OM2A 2XOKD 2FX3A 5FOTA 1BMFA 3OESA 5HKKD 3TUZC 1YZKA 1JBKA 2NIPA 3FGNA 3CWZA 1CJUC 1XEXA 1ZD9A 2Q21A 1ZJ6A 2YOHA 1CP2A 1JI0A 1TF5A 4ARZB 2QG6A 1AKEA 3NC0C 1TQ2A 5HR5A 1P7CA 1W47A 1F48A 3LO5A 1S3GA 2O0KA 4DIDA 3NH9A 1FL9A 1XD9A 3DMDA 4JVMA 3PEUA 4Q5IA 1VIYA 1U81A 2J7KA 3RC8A 2ZRDA 1T0JB 2IXEA 2D06A 4PSKA 3EZFA 4A0RA 2C95A 3CX8A 1Q1ZA 4BZQA 2DB3A 4UXJA 3B6EA 4Q1EA 4B76A 3P27A 2IF2A 2XAUA 4QJ5A 3SU8A 2CLDX 1T8TA 2ZE8A 3F0TA 3FMIA 1UKZA 1US8A 4GPTA 2OESA 1BYUA 2YOFA 1N2CE 1NBMA 1H8HA 3SHWA 4M1KA 1U8ZA 3TH5A 1D9ZA 3RS0A 5K8TA 1GM5A 1G64A 2C77A 2DFTA 2P5SA 4WZBE 5CB8A 2O8FB 4KCGA 3WMGA 5JSZB 1NRJB 2WKRA 4R98A 2QQEA 1TQDA 2WWGA 2ZRPA 4ILEA 1N6HA 1LV7A 2VF7A 3P4XA 4KSBA 2XXAB 1SXJC 2DWPA 1N6IA 1R8SA 1R0WA 3MSXA 3NBFA 1U94A 5L3SA 3GFOA 2A30A 2XSZA 3Q7PA 4KSCA 3R8FA 3AF4A 2G83A 1MO5A 2OUKA 1U90A 3SDZA 4MUAA 1JXMA 1IN5A 3AUXA 1L4UA 4WOPA 4Q9JA 4A4DA 4E09A 3QPVA 1OH8A 1VCIA 3CM0A 4IHQA 3I92A 4UNPA 2YOGA 3CPHA 1TF2A 2ZI5A 3AF1A 3ADBA 4ACBA 4TN1A 4ZDIA 1BKDR 4IW3B 4LGMA 4QM7A 2GNOA 1AJEA 3SR0A 2O8BB 1VYTA 4AC9A 4EJSA 5KSZA 5EJEA 3MWKA 1PUIA 3D3QA 3ZS9A 4V0KA 4CT4B 1ELOA 2ZE6A 2GBLA 3ZQ6A 5FBRB 1KI1A 1L2TA 4LI0A 1PLKA 1WA5A 4C0KA 4LPKA 1SHZA 1CF4A 1G8GA 2UZIR 4RD3A 2EYUA 3RS3A 3GLHA 1UBGA 4XVUA 2G0TA 1P2VA 4JS0A 4KHZA 2ZANA 1Z47A 3KB1A 5CJ2A 3X1DA 3QBVA 4MUBA 2ATXA 1D2NA 2F3RA 1N5JA 1YJ5A 5SZHB 4Q4AA 3TJZA 5DLQC 1G4UR 2J0UB 2B7CA 1JPJA 5FFMA 4BFWA 1VMAA 2IX3A 5LDDC 1KGDA 1RC8A 1NIJA 4ZPXA 3GLFA 5KU1A 1UBEA 3EG5A 2JATA 1E79D 4PC6A 4HAZA 1OIXA 3NBXX 4US2R 4WA7A 5J47A 2QA5A 2DYKA 1N6RA 1W0JD 1X8JA 3U3MA 4CZ2A 1HH4A 3VNVA 1E6CA 2CK3A 4GT1A 2BV3A 2P65A 1L8QA 1QHYA 1YVDA 3EPLA 3BAFA 3MG9A 1ZUNB 1QG2A 4MYHA 1SXJB 1UBFA 1IY1A 2W6JA 1R5BA 2Q3HA 1LF5A 2ZRIA 3AKDA 3QF7A 2IS6A 4HZUA 3PFIA 3RNLA 5FBVB 5JMTA 3THWB 3IQXA 4OQLA 4TYWA 2QM8A 3DL0A 5FTNA 4HDCA 4IOLA 2IW3A 1ZD8A 2GZHA 4QG7A 4B71A 1EESA 4XWOA 1LB1B 2ZS8A 3CBQA 2GVZC 4BFXA 1N25A 4EPTA 4CF7A 1EX6A 2JJ8A 4YMSA 1U0LA 3VHXA 2XZOA 3MWLA 4FCWA 1E2NA 4MGIR 2XJ9A 4OHWA 4F4CA 5KTYA 1OYWA 1DAKA 3CRRA 3K0EA 3FPAA 1A4RA 2BKEA 4LDJA 3FHTA 1GL9B 3A4NA 4WW0A 4PR0A 4K81B 1J90A 1GIAA 2H1LA 3GFTA 3W3ZB 1AQYA 4A8JB 5JJIA 4X8HA 2WJJA 2Y8EA 4IVPA 4GBMA 2QAGA 4WVFA 4H1UA 5H70A 4JVLA 2CJWB 2BJWA 2Z4SA 3AEZA 3B1XA 2XX3A 4DDUA 2SHKA 5J4HA 3QXHA 3RSLA 3L8YA 2QTHA 2ORIA 4M8NE 4RZ2A 4A1FA 1WF3A 1ZC4A 5G40A 1A2KC 2D2FA 1B23P 1IXRC 3BGWA 4MITA 4B6FA 5TMPA 3REGA 1II8B 2X1VA 5FTKA 1KI3A 1NNEA 4G3XA 3RABA 3ZVNA 1N6KA 4QGHA 1QHSA 4MA4A 3KJHA 1Z0KA 4U7DA 3Q3JB 4HAYA 3SHFA 2O8DB 2VSFA 2W0SA 2Z83A 4F4IA 4Q1DA 1GUAA 3GQBA 3AVXA 1IN8A 4BFVA 1H8HD 4FIDA 5IDVA 3PEWA 3PJRA 3G82C 1AQUA 1Z0JA 4LBZA 1A2BA 1DAMA 2GAOA 1RE0A 2EYQA 3CH4B 1ZM3A 4OQFA 2ZRKA 4FMCB 2WAXA 4DT1B 2DCUA 1ZIOA 3MMPA 1M7HA 3RRMA 4ZKEA 1XTSA 4IKEA 2YWFA 2A7QA 4D0LB 1FP7A 4RZXA 2ZJOA 4W9MC 3EIHA 1CR1A 1R0ZA 3ZZUA 3LX5A 4LWZA 2GILA 2ZROA 3GLGB 3UXMA 3U5ZB 2H17A 5K8IA 1E9FA 3QXJA 5L3QB 3AVTA 3LLUA 4MKHA 4P4SA 2ERXA 3VR6A 1F6BA 2WSSA 4RD4A 3I8XA 4EFMA 3U6KA 5K8LA 3EZ2A 2GXUA 2VP9A 3NXSA 4W7SA 1UF9A 4P4TA 2KBFA 1QRAA 4GSYA 3CUEF 3H0KA 5BN5A 1WB9A 4NYMQ 2VLIA 2ZJBA 2E9SA 1F5NA 5FPKA 2VHCA 2IYQA 3WP0A 5GVSA 4B48A 4LV5B 1MRSA 1M7BA 2O52A 1PZNA 2IHBA 4B34A 1MH1A 3DOEA 1O3YA 5FTJA 3EPJA 1GL6A 2V9PA 2V6JA 3EIQA 1AZSC 3NBZC 2RMKA 4XVQA 5JRJA 3R7WA 3X2SA 1BIFA 3L43A 4DVGA 2IS2A 1GL7A 1IJFA 1KO5A 1GKYA 1LS6A 3QQ5A 3TSZA 4D81A 4QBGB 1B0UA 4JYCA 1EFUA 2WPDA 2FOLA 3BBPA 4M53A 4PANA 3W8RA 3LXXA 2BOVA 2YHSA 3DVLA 3ZIAA 5C2JB 3R8CA 3MUFA 2VHTA 3BFKA 4V03A 4C9BA 4M0LA 1DEKA 1SVSA 4MQBA 2CK3D 3UIEA 5L3SB 1N3BA 1NVUQ 2PJRA 2VYFA 3K8YA 1Q20A 2TMKA 2HJVA 2V7QA 3W34A 3LH5A 4QBIA 4AY2A 4P3YA 1QHIA 4KJZA 4RZUA 2W6JD 4GNKA 1II9A 4HB3A 3ICEA 1XCMA 3CO5A 4XSGA 3PEYA 1PUJA 2ZI4A 1VG9B 1G7RA 4Q9HA 5EE1A 3VR4A 1P60A 1DO0A 3TR5A 1TUIA 4C0JA 4DDWA 1GOTA 1VDZA 1EFRA 2IL1A 1NF3A 3GJ0A 3VAAA 4HDQB 3NBYC 4DIEA 1D6JA 1KK3A 2YWHA 2ZRCA 1KI9A 3DKPA 2FZLA 2JGNA 5AJXA 2ZJZA 4ZCIA 4CEHA 4POAA 3AGPA 4TLDA 3X1WA 1CR0A 3UPUA 2QE7D 1EK0A 2Z5FA 4QHTA 3ZVLA 2D74A 3CF0A 1DBSA 3L82B 1G19A 1F3OA 5AR1A 4E07A 2WMNB 1ZBDA 4JL8A 4AYTA 1RPZA 2ZYWX 5CITA 1ZUIA 4WBSA 4GP7A 5KSYA 2GCNA 2FEOA 3CNNA 3RWOA 5FTLA 3ADCA 4JBWA 3RC3A 1I4DD 5FUXA 3BS4A 2IXGA 1AS2A 4Q21A 3NHAA 4PXAA 3TVDA 4BFZA 3Q9LA 3AVPA 4TL9A 5DHAA 1EG7A 3K70C 2V1XA 1OXVA 4LCBA 5DGXA 5A4JA 5FI1B 1IXSB 4IVRA 5C4MA 2V3CC 2W2TA 4EPXA 4V0ME 4KITB 2FG5A 4Q9IA 2H16A 4L16A 1UEIA 3A37A 1ODFA 2B8TA 2OAP1 4FCTA 1KAGA 3QE0A 5EZ6B 3T5GA 1ZC3A 1DARA 2JAQA 3WMEA 3WRYC 5J4YA 4BLSA 5KNDA 3BB4A 1JAHA 4TLAA 3RHFA 1RRCA 4D26A 1M6NA 1AS0A 3W6OA 1SULA 2I3BA 1SKYE 3QVUA 4NKRA 4DDVA 4QKQA 1UEJA 4LV6A 2PBRA 4B74A 4RFSA 2ZRMA 3GLIE 1HA3A 3SOPA 4M9QA 1Y63A 5FR1A 2B6HA 1G5TA 1KMHB 5A5GA 5KNBA 2QPAA 3P1JA 4QOSA 4YMTA 3CRVA 3ZH9B 2AWNA 1R8QA 1Z83A 1AN0A 1E9EA 1CJVC 1KNXA 2J5XA 4XH9B 3DM5A 4C0AC 1P6XA 3PUVA 5AUNB 2FEMA 3MJRA 2NO6A 1KKLA 4I99A 3THYA 2OFOA 2OSBA 4DCTA 4UNRA 2JJ1A 3B13B 5CIWA 2KE5A 5UKDA 2LKCA 3GJ4A 4Q4JB 3SJBA 2QM7A 4M9ZA 2WSSD 1P9RA 2ZU0C 1YR8A 2NZ8A 1NKSA 4UKDA 5D3QA 2XJ4A 3WYGA 1AM4D 2J1LA 2ODBA 3VNUA 1Q1QA 2RGXA 1Z0AA 4FI3C 1C9KA 4EUNA 4NTZA 2ZTSA 4MRRA 2WWHA 2X77A 1G291 4CEIB 2WJIA 4WXPA 2QUZA 4Y0AA 1MABB 3HU1A 1GRRA 3NEJA 1NVWQ 1FX0B 2QU8A 3LVRE 2GHIA 3K70B 1E2PA 5HKKA 3OEHD 2P3SA 3LY5A 1WQ1R 1CULC 4O0MA 2BBTA 4OI2A 3RYTC 2HT6A 3U7FB 4A15A 4YXWA 1JJVA 1G8PA 4DLWA 1DE0A 3IPYA 5EP4A 2G1KA 1T3HA 4TLBA 5E7IA 3U3KA 1QHHB 3EAQA 3HYRA 1NMXA 2GF0A 2IUSA 4DLYA 2QP3A 4JMPA 2GCOA 2IEZA 4ZDKA 3LBHA 5AUPB 3ND9A 1UKVY 4B47A 3SJZA 3WP1B 3UMRA 1XP8A 2K5UA 2WPDD 2H57A 3Q7QA 4YDSA 2WWYA 2OE2A 2VRWA 4HZIA 3TBKA 4BPBA 2ZUBA 3AF2A 1VPLA 3NDPA 2GA8A 3ZIAD 4TWZA 1XZPA 4URVR 2FPMA 2JLXA 2JEOA 1E0SA 4PHHA 5DIFA 4DRZA 1Q44A 2EU8A 3RS5A 1WBBA 4Q1CA 4M21A 2WJHA 2ZETA 5EXTA 3SFVA 2BWJA 5FI0B 1OH7A 2V7QD 3AV0B 3U7GA 3EPKA 1E9RA 4PPQA 4Q1BA 3O8BA 2XITA 3PVSA 2FSHA 1KI4A 2RHMA 4M1WA 2IXFA 521PA 2VO1A 4TQAA 2PMKA 2ECKA 1T6NA 2OCAA 3SS8A 4XD7A 1P61B 2VHUA 2ZE5A 5HE9A 1EFRD 1GAJA 3EASA 5FL7A 3EZ9A 2EQBA 3FMOB 1XRJA 3WNDA 4HUQA 2FWRA 1QF9A 2GVDC 5G41A 3VMFA 3WNCA 4IDHA 1NLFA 1W44A 1LS1A 1XBTA 2ZRNA 5HZHA 1S96A 1G17A 3X1YA 3LA6A 5IHPA 2EVWX 2ZYUX 4PO8A 1S9DA 2BIFA 1W48A 1BYIA 3EARA 3BFVA 3E5HA 3KX2A 3EW9A 3I5YA 2ODEA 3KDSE 3U7EB 4AKHA 1G1MA 4RD6A 2JDIA 1P4SA 1XEWX 1ESMA 2PLFA 4QFMA 3OEEA 3I4LA 2Z0MA 1KI8A 1XTKA 1ZM2A 1G6HA 721PA 3L0PA 2V55B 1UJ2A 5DE3A 2O8CA 4MGYR 3F3YA 2FH5B 5KO2A 1LF0A 2GJAA 2VTKA 2CE2X 2QP4A 1Z0IA 4HLDA 4DLVA 1X8KA 2PZFA 3BB1A 1JR3E 1OW3B 4OHYA 2ZI7A 2BJVA 2NGRA 2GEUA 4A0FA 1W5SA 2AKYA 1DAFA 2J45A 2QTVB 3PG5A 4BLRA 1JEDA 4JL6A 4AYWA 1CU1A 1N5LA 2IWRA 3W8NA 1ZNYA 5FBLB 1DTSA 1TU3A 3KKOA 4FMCF 3VR5A 2EFDB 1W4CA 2W83A 1GP2A 2FPLA 1A7JA 2GZDA 4EPRA 3K0CC 1SKYB 3K1JA 3HR8A 3AVQA 4MKIA 4JLOA 1NVXQ 4CGZA 1XZQA 4QBFA 3GEHA 3X1XA 2ZI3A 1BH2A 1E79A 2AKAB 2B7BA 4QHYA 3C8UA 1S2MA 4DZZA 1E4VA 5TB5A 3TLXA 3AVYA 1N6PA 5M04A 4B3XA 2ZR9A 1L4YA 3B60A 3LDAA 3KTAB 1A5TA 1E98A 4BLQA 2RAPA 4GOJA 3I32A 1M34E 4R9UC 2VQSA 3NIBA 4MYUA 1U99A 3A36A 3TE6A 2A9KA 3DKVA 3OF5A 2QN6A 5EE5B 2REOA 3T12A 2AFHE 4LJ5A 2VF8A 1DG3A 2XTZA 3FYHA 3V4RA 2VHJA 1KOFA 2FGKA 5ANRB 1QVAA 2FFQA 4HAUA 3GJ5A 3HPQA 3RS4A 1NG9A 3MFYA 5TV2A 3NWJA 4DEYA 1LVGA 1UKYA 4MYTA 4E22A 1C1YA 1J7KA 2QY9A 3E2IA 4HLUC 5P21A 4D4KA 2CDNA 3K53A 1XNJA 2C9OA 1YRAA 3T34A 2QTFA 3UKDA 4CEJA 2ZVPX 5EE3A 1LY1A 1XTIA 1R10A 1RJ9A 1XXHB 5B64A 4BLPA 2IYVA 1D5CA 3UK6A 3QF4A 5L3VA 3CX6A 3U7HB 1CXZA 4YXWD 3O8RA 3M4YA 3GJ7A 1XJ0A 2ZRLA 3OAAA 1J99A 4B2LA 5BXQC 4DLSA 4LJ6A 1GFIA 3VKHA 3UWKA 4TLCA 1GZSA 3B5JA 5SZJA 3IHLA 1FPMA 1WMSA 1W4BA 2EWWA 2WOJA 1S4QA 2W2XA 4M1SA 4V0NA 5HE8A 1E9CA 4F91B 2FA9A 4DJTA 3FHOA 5KUTA 4BGDA 3IPXA 5C1BA 5F3WB 4JSYA 1RRGA 4O2RA 1FFHA 2HDNB 4QXAA 2FFHA 3QOFA 4QNMA 4HI0E 5DO9A 5DI3A 3K0FB 5CK5A 3ZD6A 4OJQA 1AGPA 3HR7A 4ZCLA 1FNNA 1TTTA 3VU9A 5AJYA 1DAEA 2XEXA 3FMFA 3NC1C 4IXMA 4JLAA 4A82A 1GNRA 121PA 4F93B 3B1YA 1JB1A 2NPIA 2FJUA 4G01B 4MRPA 2HV8A 2GRJA 4XD7D 3A1VA 1TQ4A 4JLNA 4Q18A 3TVTA 4EIWA 3SJAA 2B8WA 3E70C 5FL7D 3FFAA 2Z43A 1R4AA 3EA0A 4F4JA 4J0QA 4L15A 3T35A 1QDEA 4ZI2A 5E4FA 2C5LA 5K8UA 5KNCA 2VP0A 3THXA 1D2EA 2QZ4A 1X3SA 1XD2A 2RCNA 2KJQA 1PV4A 4AD8A 3JZMA 1Z63A 1IY0A 4RVCA 2RGBA 3FHCB 2FZ4A 3HU3A 3TQFA 5FOUA 1EGAA 2OCYC 4A2QA 3GLGE 3ADDA 4PAQA 2WSMA 2MSEB 2JDID 4Q9KA 3VX4A 1GTVA 1PJRA 3OEED 421PA 1Z6AA 2X19A 4NYIQ 1EXMA 3AKCA 3GJ6A 4D4LA 3OHMA 4URZR 1JXOA 3HDTA 5FUYA 2GCOB 2W58A 4Q48A 4PX9A 2ORVA 3C15C 3WXMA 2RB4A 3QKRA 5GJWC 2NO7A 2Q9CA 4FCVA 2GTPA 3UMSA 3A8TA 2HCBA 2HF9A 3PQCA 2B92A 3ND8A 4A8JC 2PX3A 4M9XA 1SXJD 3FKQA 4TQ9A 4M1MA 3P20A 2C78A 1X8LA 1P9NA 3EC2A 3U44B 2G9NA 5FR2A 4HEJA 2KI5A 2GXSA 5CK4A 4PZYA 3SQXA 4GOXA 5AWFC 3CF2A 2YKGA 2YWGA 3P32A 1NN5A 4WZAE 4ZV4A 1KZGB 3CPEA 3RANA 3I3SR 4UJ5A 4KVAA 5B30A 2NO0A 3IDQA 3QI2A 1Z6TA 3KUCA 1W49A 4IEEA 4JYBA 4ZIRA 1NBME 2AXNA 4YDHB 1EFCA 4Q7KA 1G4AE 4ITRC 5H8WA 2RGDA 4DCSA 3DO6A 1WP9A 3ZQJA 3T1OA 4NYJR 4LJ8A 2QQ0A 3QG5A 1T0HB 1Q21A 1AZTA 1Q57A 1XEWY 3T06B 3B8HA 1ZNWA 2XTMA 1E2JA 3BORA 3C41J 5AUOB 5TY0A 1FUKA 1VCNA 3M0EA 3S1AA 1KZ7B 4Q66C 3QKSB 1Z2AA 1OIWA 2ZUDA 1T4GA 1G8FA 2REXB 4TYQA 1XTJA 1PLJA 1R0XA 1NJFA 4K46A 4HDOB 1K5GA 4DBLC 3AF0A 3DMNA 3OIYA 1S9HA 2ZRJA 4LPSA 5CLLA 4LJ7A 1TX4B 4JT2A 4MDEA 1BS1A 1OXUA 1NG1A 2BM1A 2GCPA 2V6IA 4RSGA 3WYAA 4A92A 2IYRA 2G6BA 4KFSA 4DSNA 2AFIE 2QE7A 3KFVA 4U02A 2QPTA 3I61A 3H86A 2XNDD 1JALA 2DR3A 1YU9A 2H7VA 2GEDA 1FW6A 4P31A 2I4IA 3LRPA 1CRPA 2F43A 1T5IA 3OAAD 2FU5C 5JLJA 2EWVA 3GLHE 3FOZA 4RD1A 1KK1A 3T1TA 1KI6B 2XB4A 3NG1A 3EPHA 5LB2A 4TL8A 3I8SA 5SZKB 1W46A 3R20A 4L8GA 4KXFB 5DI9A 2CHVA 2CEAA 3FTQA 1F2TA 4NHOA 5KSOA 3KKQA 2PL3A 4EQ6B 3VHLB 1ZIPA 4AKEA 3UMFA 3KJGA 2ZR0A 5JI2E 4MKFA 1MO4A 2AK3A 3H4MA 1X86B 1VCMA 4R7ZA 4V0OA 4C7OA 1YR9A 2GK7A 2ZYTX 3SQWA 1E2LA 4TMXA 3SBDA 2GXQA 4B3CA 4LX0A 3OIVA 5LD2C 3IHWA 5CLQA 2WJGA 1G3QA 5AUQA 2ZU6A 4HAXA 3W90A 3IEUA 1OKKA 2D3WA 3RWMB 4Q4HA 4PC7A 1I2DA 4YONB 3IKJA 5CB6A 2BMJA 3IEVA 4G5OA 4S2EA 1OB2A 4QGFA 1UFQA 4LSGA 3D31A 2JLUA 2W2VA 1FMLA 2XB2A 4PZLA 1ANKA 4OHXA 1YZUA 4JT4A 3F8TA 2AR7A 2YWEA 2NTYC 4Q1AA 4A0GA 2ZM5A 3TQCA 1HURA 2ZVQX 3WMFA 3KXIA 3K0AA 3GP8A 4X8LA 5KHOC 4XJXA 2YJTD 5FPYA 1VTKA 1M74A 1JPNA 2CLSA 1TUEA 4ABYA 5KOYA 1N6OA 3DZDA 1S8FA 1JQJC 4C0LA 4BUJA 1T5LA 1NKTA 3A1WA 1MKYA 1XEXB 1YE8A 4HB4A 4EJSC 3ETLA 1FMJA 2BMFA 4II7A 2BCGY 1HUQA 2JLZA 3EZ6A 3H84A 2WIAA 4CIDA 1E2HA 2CNWA 5HCIA 2CE7A 1ONBA 4LHWA 5G3ZA 3TNFA 3ZDQA 3J81k 2FE4A 2DFKB 1KIMA 1A1VA 2R6GA 4V02A 3QEOA 3HJNA 4B73A 1V43A 4E5UA 3A4LA 3L0OA 1VHLA 5EUQB 4DLXA 5C4GB 2ZYVX 4Q1FA 2J0VA 4KI0A 3NEYA 3OEHA 4LOAA 4RCZA 5EXXA 4TTQA 3CRQA 1ZNZA 2ATVA 4NCHA 2OFXA 3TUJC 2VP6A 4BFYA 4I81A 3KKNA 4NPHA 1WRBA 1FQJA 4L4UA 1XWIA 5IRCD 1GRQA 3L8ZA 4M1TA 3OFNA 4XWKA 1US8B 4JJZA 3CONA 1VG0B 1XCPA 2JLSA 3QENA 4DSUA 1CBUA 2WBLC 3B78A 4TTRA 5JI3E 3WNBA 5LD2B 3KQHA 4JLKA 4QM6A 3GMTA 1SKQA 4IOKA 4D80A 3PEVA 5CDFE 4IXNA 1G5RA 3QXXA 4B35A 2XZLA 1Z6XA 1J2JA 1FQKA 1KJZA 2QROA 2RGNC 4QL3A 3T61A 4YMVA 2QAJA 2N42A 3LVQE 1NN0A 2L0XA 4KAXA 4UQOA 3MRSA 1T8UA 3KQKA 4OJKA 3TIFA 1T9HA 1SGWA 4EKDA 1WXQA 3GEEA 4C4PA 2X2FA 2C98A 1XMJA 2PX0A 1S3SA 4PSAA 3WY9A 2FDCA 2F1IA 2DY1A 4KBGA 1MO3A 1ZM4A 2Z4RA 5JS7A 4C0BA 3IBYA 4OQXA 4V0MA 4N1AA 5DH9A 4DHEA 1GITA 3OZXA 3AVOA 1OFTA 2P5TB 3ICQB 1F2UA 1KMQA 2G0NA 1IXZA 1ZU5A 3GJXC 3LFUA 5EE0A 4EJSB 1ZCAA 3G0HA 3Q72A 3MWJA 1W1WA 3QKRB 4JKIA 5D3MA 4TSFA 1W4AA 2EFGA 1DADA 5E7MA 1TU4A 2HCJB 4D2IA 2FV8A 4TLEA 1LW7A 1EWRA 4NBSA 4QGAA 1KO1A 1S0UA 1E2DA 2QAGC 3BWDD 2F9MA 4OI0A 3SEAA 3UWOA 3GLIA 2OT3B 2F55A 4CYMA 3U61B 3GLHB 5AJWA 3W3AA 4ESVA 2O8EA 3KFXA 1UBCA 2JASA 2OXRA 4BLOA 4JL5A 5BYJA 3RRNA 1IOZA 1G21E 4Q47A 1Q0UA 2CCKA 2RHDA 3LX8A 4Q4AB 4Y0VA 1P2UA 3ADKA 2YC4C 2GDJA 2RGGA 3VR3A 4OQMA 2ZR7A 1UADA 1RFLA 2ZI9A 2UVQA 1KI7A 1HY3A 1G9XA 2IYXA 3GLFB 2QMOA 4WXRA 3MWYW 4AKIA 1NLYA 1XB2A 4FXPA 3SJCA 2GESA 4FWIB 1FZQA 3LD9A 3R9IA 3CB4A 1E2MA 4NMMA 4MYCA 1NIPA 3Q5EA 3FB4A 4KYIB 3ASZA 3TRFA 1OE0A 3QPUA 1OKKD 1XEFA 2AHOA 2BBSA 2WHXA 2WKPA 2VA8A 5E7JA 3KQNA 3U4QA 2HT1A 2JLWA 1M1YE 4EPYA 2UZ3A 1YZNA 1IY2A 4PQRA 5JCPA 4M1YA 3IILA 1OV4A 5LB4A 4HZUB 2OFWA 4IDNA 1VYUA 3BD9A 3C5CA 4TMTA 3TR0A 3QJYA 1SVIA 1TAGA 4XIGS 2P6RA 4ARZA 4BRUA 2ODNA 4KV9A 3AQ4A 2QSZA 3NHBA 1N0UA 1E94E 3CX7A 2ZEJA 5AJVB 2HJGA 1DO2A 1RYHA 2GJ8A 3I62A 1COWD 4HSEA 2GK6A 3ZGXA 4NL4H 3VFDA 4NONA 4YMUA 2F43B 1Q22A 1I2MA 3PV0A 3B2EA 821PA 2I1VB 3A1TA 3QPWA 3CPJB 2PMDA 5JS8A 1M8PA 4BECA 1GILA 1VCOA 3RAPR 4DUGA 2GJSA 2PCJA 4XOIA 1AA9A 2QAGB 5CYOA 4D6PA 2CNWD 1OH6A 4RD0A 4MGZR 4LBWA 4OKSA 5BWMA 5JCZA 1W36D 4KBFA 1CLUA 4LJAA 1UAAA 1QHXA 2OCPA 3L2OB 4PC3A 5JWRA 3KQUA 1E2QA 1HTWA 3TUIC 2JIZD 3KJEA 2CHGA 1XXHE 5GJCA 5J4VA 5JJLA 1NSTA 5HTKA 1OFHA 2IYLD 5GVRA 1KTVA 5EZ5A 1DAIA 1ZVQA 5HCNA 4Q19A 1CEEA 1OXXK 4AIIA 2ZRAA 2O8FA 4ON9A 1H65A 4BQSA 3QG1A 5JSZA 4LYFA 1KSGA 3TAUA 4GDFA 3OFND 4Q00A 2WJYA 4KLZA 1HT1E 4BZPA 1FNMA 2XXAA 3VKGA 2A78A 3GD7A 4RKFA 1NP6A 4BASA 3V9PA 3K9HA 4P32A 4NCJA 3I1FA 5JHGB 1SQ5A 1ZMXA 3QXCA 3KKMA 3TW8B 1JEEA 2GAAA 4RY2A 2QGZA 4HLUA 4D4MA 1KO7A 3WBJA 1HE8B 5B57C 2QL6A 1D2MA 1G3IA 3LBIA 2QGNA 4BLTA 1CJTC 2QT0A 2YVUA 4I1SA 5BQ5A 1JJ7A 2O0JA 3LBNA 2YYZA 1T3LA 3DDCA 2O8BA 3K9GA 4JSTA 3ZVMA 4LJ9A 1OB5A 4CDGA 3Q8XB 2D4HA 4JBXA 2XZPA 1CS4C 1WCV1 3CZQA 1W2GA 4YLGA 1OPXA 3IQWA 2ODWA 4R2HA 1XPOA 4LZZA 1JR3A 4P4SB 2DPXA 3LW7A 4FD2A 4PO9A 2OXCA 2A2ZA 4O3MA 2OO7A 4YQFA 5HPYB 2NG1A 1W5TA 1SVWA 1U9IC 4R2IA 2J9RA 4Z8YA 2Q6TA 4PPGA 2OBMA 3LWNA 4PQYA 4LYJA 4MGKR 4TSFD 4ZI3A 5J4KA 4JIMA 1E99A 2FSFA 1G7CA 5EP1A 2ZSEA 2QBYA 3N70A 2Q9AA 2OLKA 2C9CA 3OIUA 4WIAA 3W5JA 1R6BX 1QBKC 2YNMA 3QKUA 2JLRA 4O25A 4BE7B 4IOJA 1RZ3A 1ESNA 2J0UA 2UKDA 3N2EA 4G5QA 4TMWA 2PEYA 1JAIA 3IGFA 3K9NA 3W6PA 4JLJA 4WZ6A 2GJ9A 5EP2A 3R7WB 2F7SA 3B82A 3M1IA 1Z6GA 2Q3MA 1W2HA 4CT5A 1E0JA 3VR1A 1Q1BA 1VECA 2G88A 2P6UA 4PZZA 3GFPA 1WDTA 1A82A 1IM2A 2D62A 2ZRBA 4JBYA 4ZDJA 2HYDA 2V4ZA 1KDPA 1RVDA 3SYKA 5E3HA 4DB4A 3MGCA 1SXJA 2FPKA 3ASYA 3CZPA 4P33A 2RGCA 1HQYE 5IK2D 1KHTA 1N0VC 1DVRA 2C2HA 3TKLA 1N6NA 3THWA 4JLMA 4PSVA 4C0HA 3W6NA 3O8DA 1EFTA 4XWAA 3PUZA 4URWR 3NTUA 4XSHA 3DOFA 1XMIA 2VL7A 4FWTA 2ZJ8A 1UDWA 2ZRGA 3L0SA 3PUWA 4AK9A 1ZM9A 3A6PC 3RS7A 2AN9A 3NDBB 2EFCB 4C2UA 4DB2A 1GKIA 3AUYA 4C30A 4PO1A 1OIVA 1GNQA 1RYFA 2IT1A 4XTCS 1DPFA 2PT7A 3CKLA 2Q0HA 1E1QA 2C9YA 4CEHB 1P5ZB 1T91A 4A8JA 5DYGA 5SZIA 5JBQA 1L7VC 2AWOA 4G1UC 2WJVA 2FNAA 2IYUA 5TXGA 4TYYA 2CL7X 2PCLA 4DSOA 2N1BA 2CJWA 4D0NA 1E3MA 1GKUB 2Z6VA 2B21A 1G20E 5DISB 4AURA 3IIKA 4LHYA 3X1ZA 4LJYA 3QNUA 5ELXA 4DUGD 4HB0A 3U60B 4PQFA 3FVQA 1IBRA 1II8A 3TW4A 4PAMA 3K09C 3BOSA 4XVRA 2OBNA 1XDBA 2ZSDA 1CKEA 3NVAA 2IHYA 2WMOB 4TL6A 1R7RA 2MMCA 5KDDA 2O8DA 1Z3IX 2ZQ5A 5L8VA 2DWQA 5AJZA 4US1R 1Z2CA 3IO5A 5BN3A 4FMBB 5EQTA 5F98A 2XNDA 4AG5A 3AM1A 3BFXA 4TMZA 1RKBA 3EC1A 2VHQA 3PIRA 2DFNA 4YC7A 4DT1A 5JEDA 1XJQA 3CRW1 2AXPA 2ZIAA 4DCVA 4PTLA 1YHNA 4QJ4A 1E2GA 2IC5A 1P3JA 2Q9BA 2A5FA 2CCJA 1JQLB 5G53C 2GXAA 4X8OA 1KNQA 3BRWD 1P2TA 2J59A 2R6AA 3AB3A 4NH0A 4RFSB 4AYXA 1SZPA 4TT3A 4TTPA 5DN6A 1EWQA 4ESHA 5JFGA 1JR6A 3GLGA 3FWYA 1CJMA 3SC3A 3W5IA 1J8YF 1RW4A 3W9YA 2WAYA 2IEYA 2ZJYA 5L3QA 3BERA 4RZ3A 3GPLA 2GKSA 4GRAA 2JJ2A 4UNQA 3BIFA 3SI7A 4C2TA 2WICA 2DWOA 1WBDA 1U0HC 2J7PA 2D2EA 4H9GA 4AI6A 3THYB 5FH9A 4OBEA 2LWIA 1KYIA 4G5RA 2VBCA 2IYWA 4JJKA 3SBEA 1ZM7A 2C04A 4UNSA 2ZUCA 1JR3D 1DS6A 4K8OA 1AK2A 1Q3HA 4DLTA 2F1RA 1ZCBA 1PLLA 2JLVA 5CIQA 1OFUX 4C0SA 4R71A 1DELA 1NMZA 3DPUA 1M7GA 2OLJA 2WKQA 1E1RA 1G5PA 3V00A 1KO8A 1XPRA 1YZQA 2Q3FA 4Z1MA 1UM8A 4ASUA 1DAHA 2CHQA 3CF6R 3ZZ0A 1OJLA 4LYHA 4RKEA 1I4TD 3QKTA 4W5WA 3QEJA 5FOXA 621PA 4A6XA 4HLQB 2QENA 1HT2E 3U3OA 2ZS7A 2JLYA 1NY6A 1W7AA 4G5GA 8OHMA 2ZRFA 1DAGA 3AP2A 4KVGA 1AIPA 1KJYA 2VSXA 2PLRA 2IA5A 4M2LA 3EX7C 1OHHD 1KJWA 4Q7JB 4H1VA 3D8BA 4N0EA 4W5HA 4Z8XA 5JECA 2J3EA 4DLUA 3FDIA 4KO8A 3ONWA 1Q1EA 1NL3A 2VP5A 2W6IA 3L0IB 5GJVC 4DC9A 5F9FA 3LQQA 4L5BA 3EIEA 5BYKA 1Z8FA 2F1JA 2KBEA 1Z07A 5IF9A 1G3MA 3CR7A 4LHVA 3RRZA 1RIFA 2E1RA 1TL7C 2R2AA 3C5HA 5KPJA 5GJBA 1EX7A 4O2LA 4BFSA 4MDFA 3U6BA 4FMDB 1G41A 1EFHA 1SVMA 4LY6A 5FPTA 3RRYA 5EUMA 3M6AA 1W4RA 4HUQB 4JLBA 1E1QD 1MOZA 5G3YA 4U5XA 4PAOA 4DSTA 2QPOA 3IO3A 3KQLA 4A36A 2QBYB 4ZCMA 5J5CA 1QG4A 3BH6A 2G3YA 3ECCA 4ZDWA 3CLVA 3B9PA 1N5KA 2BKUA 2P67A 3K0SA 2ZREA 2CCGA 3LQRA 1Y3AA 1E9BA 3UG6A 4TYNA 4L9SA 3GEIA 5KPDA 1KSHA 2A5JA 4AG6A 4B3GA 3ZD7A 3AF3A 3LXRA 1K6MA 4BRWA 4ERNA 2IS1A 3SFZA 2QMUA 2O8CB 1VG1A 3VQTA 5TARA 3I72A 2HLDA 2QEQA 4LC0A 2DFLA 1AKYA 2X2EA 3IUYA 3KJIA 1O87A 3RVBA 4JVNA 3BXZA 4HLCA 2RGNA 2BHRA 2ZJ5A 5FPHA 4D4JA 3IIMA
chains in the Genus database with same CATH superfamily
5AVJA 3R3YA 1CF2O 2JCGA 1NU6A 1Z2OX 1JZSA 3RJZA 4AZ3A 5BRAA 1Z4PX 4RDCA 4C08A 1DDIA 1E4OA 1ZIXA 3NGMA 4EUKA 1AO0A 4C14A 5KSWB 4NCIA 3DR3A 4M22A 1TYDE 4NZOA 3THOA 3DE4X 3KYCA 3TEFA 4G0XA 2LP4Y 4F4HA 2EATA 3AFOA 3OZDA 3T0IA 1H2EA 2GB4A 2XMBA 3DO5A 2D5LA 3NBUA 2ILTA 3AI3A 3AIOA 3BREA 3BFJA 4WXEA 1Z06A 5H68A 4HT3B 2EBUA 4FCCA 4ZKDA 2IOFK 2AYXA 4EI9A 3FDXA 4O4JF 5EYPA 4KPYA 1LKZA 3EWAA 4O5OA 1MO6A 5DB4A 4M76B 1TXGA 2C54A 3SQDA 5A03A 5DN6D 1SUWA 2R8BA 3BXOA 3GMDA 4LRWA 1F3LA 3EFBA 4LVUA 1FOEB 1VM6A 1X1BA 3WHLA 3TM5A 3UPDA 2VI5A 5CM9C 2QSJA 3P9XA 1Y81A 1K5PA 4N18A 4NCKA 5CYPA 4ZO7A 3GGCA 4LHSA 1WBJB 3LVFO 1YR6A 3MMSA 4FMPA 2H4YA 1F0PA 1TC2A 5BSMA 4DKXA 1ZOIA 4PPNA 4Y9UA 2WZQA 5CA0F 2XVXA 4ZT2A 4TMVA 3C7KA 5BW6B 4BO0A 2PZEA 4WDRA 3BDAA 3S2EA 5F1OA 4BEJA 4CEIA 4CE6A 4NDZA 1DQSA 4B09A 2XQVA 1FP4A 3QE2A 4M86A 2CLMB 4NE9A 4PTYA 1P62B 4FFVA 5FFFA 4EA9A 5I7WA 1FS5A 4D02A 5J2UB 3CEAA 3IC5A 4R8VA 2I3ZA 3K8OE 5TGTA 1V1MB 4DV5B 1TQ8A 4OL0A 5BV0A 4FINA 1ADCA 1P7WA 1SCJA 2F4NA 2X5OA 4CIXA 5F64A 5BV1A 5B2ZA 1NW7A 1NVVR 5JALA 1GKKA 1QHHA 5F52A 2NAFA 5JFTA 3ZWNA 1NY5A 4E1AA 1I6KA 4MZXA 3S5UA 1LSJA 2YJZA 2W6ZA 1IQPA 3K92A 3Q5DA 5MF6A 2QTWB 1WB5A 3FUUA 1GUDA 4XVHA 1G42A 2FSVA 1VJTA 1FDWA 5C7LO 1CY6A 1D1SA 1QK5A 1YBMA 3VV2A 2ZB8A 2C5SA 3KD3A 2SCUB 4PG4A 1JAXA 1CR2A 5BYAA 4DCUA 1DRUA 3TTSA 1CZHA 1JQ3A 1GZ6A 4CM6A 2WHEA 2VJOA 3JQAA 4C07A 5TS3A 1M83A 1FDOA 2WM3A 3ESCA 4R3NA 2XSZD 2DECA 3HKDA 3NKLA 3CSUA 4Z6KA 1PGJA 3CR8A 4BKRA 5CD1A 1EJ6A 5A1TA 1P7YA 4GWKA 5BNTA 1CB7A 2BPOA 2ZSAA 4A0HA 5AVOA 4L0CA 3VR2A 1YE5A 1XFDA 2WF6A 1QR2A 4MV4A 2XNSA 4WKBA 1DBPA 2JFVA 3T9DA 4AJIA 4JB8A 1E69A 1NBEA 4WXHA 2DY0A 1YJAA 5DI3B 2WTUA 4V39A 5HILA 4FPXA 5IKXA 1ZD4A 2VQFB 1O57A 1YZYA 1XZGA 1JF8A 2PJZA 2AMYA 2W6ID 1NJSA 2P0EA 1U5BA 1I0ZA 4Y2SA 1WXEA 2IK8A 3RT7A 1CP3A 2VTEA 3EY9A 1BRTA 1L1FA 3VU9B 2X7JA 4DY6A 5JAUA 1PJBA 4F4FA 5IMSA 3MCTA 2QORA 3RVMA 4E2FA 3KXKA 1TAUA 1VBNA 3WL3A 1E5TA 5KSPA 1C8VB 3OIDA 3NWOA 1OXSC 4GE0A 1MT0A 2FHSA 4I9NA 1IFXA 1MUUA 2PZLA 2QDXA 4AY6A 1EUQA 5A0FA 4X64B 2Q3JA 1O5IA 5IDYA 1QX4A 2NU9A 5CT8A 3PCRB 3L4JA 3B9QA 5IC5A 3E9NA 2R6JA 2R62A 1ADBA 4A2PA 2JGLA 4QHSA 4QRHA 2HB6A 1JDJA 2OFFA 3SNHA 4BU0A 3M4ZA 1E2EA 2EW1A 1G21A 3FFWA 1UJBA 2JKZA 2AD1A 3DAHA 5F3RA 3A9WA 3SQLA 2ZVDA 2JLQA 1C3VA 1RBQA 1U7DA 4GDMA 2JL1A 4ZZ1A 2ID8A 3LV8A 1RDFA 2TSYB 1GWNA 1M2JA 5C5CA 1PAUA 1P5RA 4ER0A 1PDVA 4ZU6X 2BKLA 3BIWA 3KSMA 3I39X 2KWIA 4W7HA 3UWDA 1UOPA 1I7QB 3BDIA 3KOXA 4XGKA 4OFBA 4ETNA 2W0MA 4P98A 2BMEA 2I29A 1KDYA 3W78A 3WYFA 2HLDD 2QKYA 1QC5B 3JRXA 4IDPA 2C9BA 4R0NA 5J4LA 1A88A 1POWA 2QZSA 3W2HA 4F06A 4W9RA 4CRWB 3TJMA 5AVSA 1LTQA 2E7ZA 1CG6A 3PGKA 2LDXA 3TK1A 4KFTA 3RUFA 3EXFA 5BSUA 2AV6A 4B3TB 2OK7A 3G5LA 3OO1A 3ZXUB 4ENQA 5K01A 1ODJA 1TMKA 1ECBA 2W11A 2W2KA 3EZGA 2I1LA 3LGSA 3LLMA 3T9AA 4BQFA 4QZVA 2IDMA 1E9DA 2G5TA 3HI6A 4I55F 1OLOA 2PZKA 4Y3UA 3U40A 3VPGA 4O02B 3HV2A 2NU6A 2OGWA 1AK1A 1L5OA 3AR8A 4NAHA 3CWCA 1XPUA 3BH7A 1Q3KA 1Y3FE 4EHKA 1LJ8A 2G1JA 5KMGA 1TT5A 2EJUA 4AG3A 3P9ZA 4B31A 2ONKA 3CTMA 1S1CA 4LJRA 5G4KA 4UOZA 5LYJA 2I1QA 4YJFB 1UDXA 3TLJA 4MVJF 3TNLA 4FM9A 2PNJA 3VNBA 4FFNA 1ZJ4A 4PXYA 3C8ZA 3MPUA 4G4SO 1QP7A 3M5CA 2IWHA 2ZSFA 3Q41A 3RFTA 3VU0A 2OHJA 3QPBA 4LYDA 5SY9A 3AVWA 3U48A 2CL6X 1E3JA 4U8HA 3OZTA 1QGUB 5JT1A 3DDNA 1OGJA 1MRNA 4Q93A 5LZ9A 2PSFA 3H1EA 1AN9A 4PPFA 4MV6A 1ADJA 4RMJA 4BCBA 3A9UA 4KLNA 3GEGA 4PC1A 4IFBA 4D4IA 3MS4A 1H05A 2X42A 3PLRA 4LHZA 3CINA 1RHQA 2EZ8A 5FO1A 4M9CA 2R8RA 3GRPA 3GAZA 3OX1A 4UU7A 4NVRA 3EGVA 3PVCA 1Q83A 1TRHA 2AMFA 2R97A 4YP1A 2NU8A 2V7PA 1E3MA 3PX3A 3WDLA 2YJ5A 2IYAA 4FQ8A 2C88A 1L7DA 2VWHA 2XUIA 5CHYA 3K70D 3RGGA 3PDUA 2ZYSA 3VKWA 2BC9A 3W6PA 4I1UA 2IXTA 1KY3A 2WVJA 1OBFO 1FUUA 2Q0QA 4EKNB 3QX8A 4EUHA 2HXSA 1IB6A 3HVHA 2B94A 1V11A 1QIJA 2WTAA 4A8PA 1VRCA 2QRLA 3FFBA 3P71T 1EP9A 2CL0X 1W5EA 1A50B 4U6QA 2I6TA 3H7AA 1N8KA 3LHSA 1N9GA 4MGEA 5SY6A 2HCFA 4RF5A 4A27A 1E0KA 2XMDA 1D9XA 2BMDA 4LQDA 1PWYE 2BY4A 4QGGA 5HFJA 3V8EA 4CUZA 1J70A 1Y6ZA 3HPRA 3R0XA 3CLSD 4JBIA 1YUNA 3FOAA 3I9FA 5FL3A 5JCOA 3RYHA 3LC7O 2Z5GA 5DXFA 2WWIA 1RWBA 1MF7A 3D5TA 5CIYA 3HVIA 3V4SA 3EWNA 1DBRA 3R9WA 3Q0TA 4BY9E 4NOLA 4RQBA 1RU3A 3F5FA 1JHZA 3ZWVA 4EY3A 5JH7F 1MB0A 3ERCA 3JQAD 3MCAA 4HZGA 3K0CA 1PKEA 1R8XA 3K0FA 1U0BB 1MAHA 1ATIA 1NE7A 1WY5A 2R6ZA 5A4DA 1A9RA 1T4CB 2WFAA 5LQMA 2XGJA 5EWMB 1X1RA 4DIKA 4D25A 4HYYA 1YC5A 2J3IA 2Q5QA 1NJGA 3QLVC 5LUAA 5T8KC 4UXIA 4QSHA 4E32A 3UT6A 4A9AA 3VR2D 2J0QA 1KXZA 1GZUA 1X7XA 3FE2A 3Q1KA 3V2UA 1GG5A 1A69A 2P6NA 2DT8A 2DBYA 3CNLA 3PNYA 3QEKA 4CG3A 1TM1E 4GI7A 4Q03A 3D8SA 3EBOA 4TLLB 3HU5A 4QQRA 4N5LA 2D7DA 3DMFA 4CLDA 3L7YA 1UPXA 1WUKS 2O4UX 4JLDA 1ZD1A 3HA3A 2BFBB 5ALXA 1K8YB 1FEZA 3H65A 5JU6A 4YRDA 4M8KA 2QL7A 1E1DA 1JMVA 2HRCA 1VL8A 1D03A 3JQBC 3QWBA 4WEQA 4WCDA 5DYIA 3U2QA 4UPVA 5JRDS 3C16C 1J00A 2I7XA 1NNSA 1OF1A 3B1VA 3OCWA 4P34A 5BR4A 4MHTA 3MAAC 1X1CA 5AKKA 3H2YA 1VA4A 3K09A 1M2HA 3CX4A 4GZ5A 2Q5OA 1N2XA 4KACA 2ERYA 1JLHA 4IDQA 5JZVA 1E5LA 5FUVA 3H1FA 1Z45A 2H18A 1MX9A 2W6OA 1DQNA 2PXXA 3MWDA 4IIUA 5BWOA 2CN1A 1J21A 2XBLA 2D1RA 3K0AB 3MXTA 2IUUA 5BVGB 4CF4A 4URUR 2FQ1A 1GYRA 4GC9A 1QJCA 2PQ0A 3O1LA 4EHHA 4RJLA 2QJOA 4OEHA 1WS6A 1I01A 1Y3CE 4C78A 4KK4A 4OHRA 3DQPA 3EOBI 1A5ZA 3MHPA 4HX2A 1YVRA 4U2KA 5NLLA 3QBTA 5BWCA 1P74A 1D1PA 4HR7A 1J2UA 4IIJB 3ANLA 5GADl 2YCBA 4I50B 4EY4A 3M33A 2B3TA 1XZAA 5D5PA 3HCOA 3KL4A 3VYRB 3VH2A 4FHZA 4B32A 1BHJA 1U7XA 2PD4A 4MS3B 1YR7A 2Z2ZA 1OD6A 3LXUX 2A0FA 2H5EA 4M1OA 3O8QB 2HREA 3PRHA 1XVVA 3OOYA 1Z22A 5DM70 2GF9A 3BDVA 3H5NA 4E14A 1MHTA 2FMUA 221PA 3G5UA 3E9MA 3ZCRA 2OORC 5TRTA 2IYPA 4WKNA 3Q12A 5LQDA 1KE2A 2NW6A 4Y2VA 2QUAA 4HAIA 2JAWA 4NYJQ 3HYSA 4ETIA 2V0NA 3DG9A 2H3EA 4X91A 1JHMA 1FTNA 4NYMR 3RW9A 4CLOB 1PSZA 1USKA 2DKOA 2QMHA 3EB9A 3OZAA 3ISJA 5A7FA 5FUMA 3GCGA 1QMPA 3A2KA 1ITZA 4PLYA 5CEJA 1QKIA 1CR4A 3RQSA 1XIVA 2PY6A 4EKEA 3A4IA 3F3SA 1JBEA 3ORYA 1JEQA 5ER9A 5IJZA 1E2KA 2R1VB 2C8LA 1R15A 4W6ZA 5L3ZA 4HNTA 2OHXA 3PX7A 3FNBA 3KSRA 2NMVA 1Y1KE 3TAHA 3PITA 3VOSA 2FPPA 2V5AA 1XZIA 2EZTA 4H7HA 4ER7A 4Q9AA 1Q0RA 5EUBA 1HDRA 3LW8A 4NZYA 2DM6A 3W9SA 5K0BA 1E3WB 3M82A 2R85A 2V8OA 1WKVA 1MC1A 8ABPA 2GETA 3KQMA 3GJ8A 1QQ5A 1VE9A 4M0UA 2R751 3WIDA 5L4NA 4FJ2A 1TLTA 2BF4A 2J5RA 4OIMA 3T3MB 4I1OA 4FNAA 4JFRA 3UG7A 1QCZA 5CDYA 4ZEXA 1MU0A 4Y2GA 4KXXA 2FMHA 1CUXA 2HFKA 1KJ8A 5F4BA 2GLTA 4R2WA 3UATA 3OPXA 4DMLA 2WI8A 4Z51A 1ZJJA 2X23A 1R5NA 3HDHA 3LC0A 4JJEA 4MS1A 3NVMB 4U4AA 4DJFC 4RDXA 2W8ZA 1TJYA 3P0JA 3OZGA 3LNCA 3VPSA 4DVJA 3G2IA 4ND3A 4B6RA 3NOVA 3VVCA 5BW5A 5HW0A 1KO4A 1E9SA 2KW5A 3OEYA 2JCSA 3ENWA 4RGVA 4DLBA 4H0NA 4XYBA 3JWPA 3D7MA 2G77B 1EVEA 2P6OA 3P5BA 2O5VA 3TMKA 1D2GA 2ORWA 3DEFA 4JVSB 4GKBA 4FE7A 4Q39A 1Y4UA 3DOJA 3D3NA 5D3MB 3Q9UA 1TFUA 4C7JA 3BXGA 3KWMA 3STUA 2CXNA 2CEKA 1FP6A 2XLBA 4H16A 4I1RA 5A62A 3OM9A 1RYEA 3BQMB 2IEBA 2OHFA 4BB0A 3EXFB 3FUWA 4BWYA 4KFRA 2I2WA 3D6FA 3CE6A 5HTOA 5J5VA 1IEVA 5HKBA 4MMYB 3RVKA 1K63A 4BAZA 5EJ9A 1QRTA 4DWVA 1XZMA 3GLIB 4DGSA 4UNNA 2A4MA 3IBGA 3J80A 1MAAA 2GRUA 4BO7A 2O8EB 4OK6A 3O83A 4JV5B 5JOQA 4N7BA 1XCGB 3VZDA 4CF6A 3E1GA 1WUTA 4B83A 1OSNA 5ALKA 1BDIA 1H23A 1EG2A 5WRFA 5JEEA 1J5XA 4QUDA 4BNZA 1UM9B 3DBRB 4LC1A 2QX4A 3DDHA 1CUVA 2B2XA 2ZJ2A 5EHGA 1BXRA 4U9IS 3D8RA 5IC6A 5JWOA 3L06A 3L40A 2HF8A 2CXXA 5D01A 4BS9A 1C3LA 1ZNXA 4MR8A 3F3MA 3UWMA 2O2SA 2Z6UA 1QHGA 4KXYA 3RTGA 1Y0BA 3ENQA 2IGBA 3QUCA 1Y98A 1SA0A 4F2PA 4TLMB 2A1UA 2AG6A 4OA5A 3MVEA 5IT0A 1SXJE 2FSGA 3D8UA 4BEVA 3BMQB 2EEPA 2BSAA 1V6SA 1T24A 1M2OB 2IYTA 3JZAA 1MC5A 2PK3A 1HE2A 3V80A 4GOKA 4BLUA 3K0SA 2P3OA 4KIWA 5CDTA 5CH3A 4C7VA 1T0PA 5A9RA 2YJ6A 3N2IA 3UJ7A 4D8YA 4ZK6A 2IBMA 1Z73A 3JARA 3WOVA 4B6EA 3DYIA 2GHQA 1J39A 1CZNA 4YYEA 1XNRB 3OTIA 1J25A 5TSDA 3OPYA 2PIAA 1JSCA 4UC0A 3IBFA 3EFHA 2YL2A 5CNMA 5BUSA 5F21A 2FX3A 4DA7A 5FOTA 1BMFA 3KIPA 5HOEA 4DIUA 1V9SA 1ICIA 1P4HA 1J1IA 3TUZC 4FDLA 4KIFA 3WBBA 2C4WA 2NIPA 1EFDN 2QUHA 3GLRA 3CWZA 1CJUC 1T4DA 3HEMA 3G2HA 2DKNA 5BPHA 3ITKA 1DSSG 2V6MA 1TF5A 3I1IA 4ARZB 5ALZA 3ZE0B 4PLWA 1J1ZA 5FPQA 4EO7A 5ILGA 1ISIA 4IF4A 4J76A 1G63A 2OBFA 5ES3A 2IEIA 4LWOA 2JNWA 3GLUA 1TKCA 5A6SB 4DA6A 3S55A 2O0KA 4DIDA 4RABA 2XNHA 4GBJA 4JVMA 1IY9A 2J7KA 4IIBA 5B3AA 2XA1A 3QSGA 4IDDA 5E3JA 3L7KA 1SCKA 1ONSA 1L5SA 4C01A 1W19A 3SYTA 2WE7A 3QKIA 1UAYA 2DTEA 1K6JA 1GQRA 2MOKA 3VMMA 1Q1ZA 1N2OA 3I9JA 4QQNA 1DJMA 3PL5A 1E5XA 2YNMC 2WIDA 4J1QA 3HY4A 3DSRA 3E3MA 3S99A 1XRNA 4JP3A 4PLVA 2XAUA 3FPSA 1K7CA 1XOIA 3E9YA 3KBBA 3VA7A 1ULSA 3L7IA 1CT9A 1ZQ1A 1US8A 5E9WA 1K2WA 1K97A 5DXAA 2PGNA 1BYUA 1UPAA 1ECCA 2GPNA 2PQ2A 2YOFA 1DXYA 3H7IA 3LBFA 4PCLA 1NBMA 1O6GA 1OXKB 3CH7A 3JQGA 4IIEA 3TH5A 4MI9A 4OPMA 3IULA 4ZAVA 4YJGA 4ZYLA 2YQ5A 3SR4A 4Z7NB 3EDQA 5ENVA 2D2XA 3QVGB 1NRJB 2E1PA 2HIMA 3WMGA 4ENTA 1GL3A 3HKCA 3QBJA 1UJ6A 2ZR8A 2XRZA 2NZ2A 1SQ0A 4WY8A 3DEKA 2B4YA 3NGXA 1GPAA 3WDMA 2DWPA 1R8SA 3GEDA 1R0WA 3SXJA 4V0RA 4F45A 5LOVB 5A0TA 1H2XA 1UK9A 2A30A 3FUCA 4I1IA 1VBFA 2Y1GA 1ML3A 3HV0A 3R8FA 3AF4A 2H00A 2JEYA 1JU3A 1JXMA 1IN5A 4J0GA 4ER3A 1S3FA 4E6PA 1WDMA 5AW4A 1W6RA 1U2GC 3HCAA 3KNZA 3BGDA 3QPVA 3MWDB 2GAIA 1VCIA 2D1FA 2IEGA 2YJ4A 4YAEA 4DTCA 2YOGA 2OTCA 3I2IA 4P7BA 4U0KA 1P9OA 4TN1A 4FR5A 3RJMA 5ADHA 4MB0A 5KJEA 3VVBA 2WYUA 1HMPA 2CYCA 3GUZA 1FTYA 3NOQA 2C3YA 4GOND 4WFKA 3WDKA 1AJEA 4OX9B 1P1BA 2HMTA 4AC9A 1Z4LA 3MWKA 3TOSA 1PUIA 2FDXA 3BUSA 4K0RA 4TPKA 1L7PA 3KZKA 1R9NA 1YCHA 5I9BA 1KFEB 3FWZA 3WLSA 5C51B 3ZQ6A 5IKMA 3NUGA 4BBPA 2HWKA 3HM9A 4LI0A 1PLKA 2WTEA 1KZ1A 3OQNA 1QIGA 1R37A 1SHZA 2WIGA 4D3XA 1DUSA 4P81A 5DBHX 3VH4A 5CYGA 3A32A 3TNDA 1F4VA 1UBGA 2H54A 5LC1A 1OROA 5ITWA 3L49A 4JS0A 2D6FA 4XYLA 4FOLA 2O5RA 2IQ5A 3DLPX 3QY9A 5CYFA 1LI7A 4I5GA 4DNPA 1D6NA 3QBVA 1D2NA 3SG0A 2Q28A 3KWJA 2FPUA 5SZHB 1Q17A 3B5EA 4I4TB 4MPRA 1NQVA 2XVYA 1G4UR 3Q6MA 4HF7A 4B9EA 4EGAA 3N8KA 1KIFA 1VMAA 3SHOA 1RC8A 1YE3A 4QTXA 5H5JA 4GF5A 4DR6B 3LQ2A 4R9NA 1X38A 1ZUD1 4LXIA 5DYYA 2H0RA 3GLFA 1UBEA 1T2UA 3EG5A 3ANYB 2QTCA 4H4EA 5C8YA 5DGCA 4CPDA 4HAZA 3E03A 2CSXA 3NBXX 4RC9A 4WA7A 4US2R 5JJCA 2G25A 2QN8A 2QA5A 3NAGA 4YJ3A 1T29A 3FUVA 1E6CA 4GT1A 1I30A 1IQUA 1P91A 1UMBA 1WY7A 3DKKA 3KE8A 4IRMA 5HCUA 3WGGA 2FPPB 2ZIEA 1C50A 2D1TA 1PR2A 3BILA 3OJWA 3MB8A 3T5PA 3IE2A 1JX6A 3TQHA 5JNWA 1QG2A 3R4VA 4MYHA 1SXJB 1UBFA 3FM9A 4UHBA 3VPBA 1GFWA 4Y6SA 8MHTA 1EE2A 1XROA 1JV2B 3BMNA 3T3PB 5FBVB 3A7EA 5EHNA 4OUDB 5GZ1A 3DL0A 5FTNA 4TYWA 4ZVTA 3NTQA 2Y3IA 4GPAA 5F1KA 4C0XA 4RNCA 1JSLA 3FIJA 4JP8A 3W5AA 4UTRA 3AZQA 3JW8A 4DV1B 1LB1B 2G9QA 2ZS8A 3CBQA 2GVZC 2OK8A 3OJXA 4S2UA 4F3KA 1I7DA 2V98A 4XFJA 5B4VA 3AEQB 1F0YA 1SIOA 4CF7A 2JJ8A 3L01A 2P30A 2PXAA 4MULA 3CUYA 3EJWA 4MGIR 3T7CA 1OOEA 2XJ9A 3UQYS 3K71B 1T13A 1OYWA 5CA1F 4WDQA 2R8EA 4KLRA 4LDJA 5F7ZA 4AL4A 3ZDBA 3FHTA 1GL9B 4YP7A 4IV5A 1WOYA 2ZRQA 4WW0A 4E51A 2R48A 3WSWA 5HM8A 3HXPA 4K81B 1J90A 3ZWDA 3GFTA 1AQYA 1NBAA 1PFVA 1U04A 1RYZA 3EUWA 5FA8A 1UQRA 1NVFA 2XWJI 4G09A 4GGOA 4IG4A 3W5HA 4UTXA 4JVLA 4DQKA 4YV2A 3AEZA 2Z4SA 1USWA 3C2QA 4YUZA 4G8BA 1C0IA 2OHIA 2SHKA 1INLA 5HIAA 1N1GA 3V55A 3AOEC 4F71A 3BRQA 3H4IA 3L8YA 2QE6A 4PG8A 2LUOA 4DBZA 5G40A 2IEDA 1A2KC 1MJGM 3TD2A 3WGHA 1G9SA 4X63A 1RAAA 4R2MA 5B36A 2EZ4A 1II8B 3REGA 2QQFA 4C4YA 3P0RA 3MYRA 4OLAA 1N6KA 1ZY2A 1LD3A 2CHFA 3JAKA 3KJHA 2HX1A 5AI0A 3M2PA 3MJEA 4CGYA 1ODTC 3SM9A 4UTNA 4KAFA 1MJHA 3U0BA 4CV2A 2DUWA 1U3TA 4DV3B 3AI2A 3ROPA 1IN8A 2Q0XA 3AESA 1J22A 1TJ3A 4HTFB 4LDZA 1H69A 4FIDA 3PEWA 5EJAA 1RLMA 2VUUA 3PJRA 1VB3A 4TM7A 1AHPA 3ZLUA 4R16A 1A2BA 4RGYA 2P68A 1DAMA 2XNKA 4QSMA 4M1QA 4FI3F 2VK8A 5C1DA 5KU7A 2WABA 3JARB 1D2AA 4NPCA 4DT1B 3FNHA 3DOCA 1A7KA 5ESDA 4QLBA 3MMPA 1WUYA 1Z15A 5EKTA 1XTSA 4FLFA 3EGIA 1VLLA 1YULA 1OA1A 1TVKB 3K30A 4KN5A 1WCYA 1FP7A 4GYWA 3ACCA 2GBCA 4MIYA 4O4JA 2ZJOA 2W7TA 3U0VA 4U9HS 3E1KA 1MRZA 1T15A 3GRAA 2BGJA 4LWZA 3HZZA 4CMCA 4F2HA 2ZROA 3ON5A 3GLGB 3UXMA 4JYMA 2ZATA 4BZWA 1GGKA 4KPUA 4CETA 1B6SA 2H1CA 2YFQA 4UQLA 2FEXA 2EGGA 3PUHA 1ABBA 3AVTA 3MJDA 1FMTA 3DZJA 2C42A 2JFUA 4MKHA 4CCYB 1F6BA 2WSSA 3K16A 3I8XA 5KTTA 3V7NA 2MT9A 2R8XA 4P54A 2BFDB 4XB2A 4W7SA 4MQ5A 2GN9A 5CA0A 2AW3A 3SS7X 3DUFB 2Y1EA 1W85B 2G5PA 3H0KA 3M70A 5BN5A 5HJ5A 2FP4A 2XW6A 4PFKA 1P7PA 2ZJBA 4OM8A 1KAQA 5FPKA 1C0EA 3WP0A 5E1DA 3NMUF 1NBIA 2DGDA 4B48A 4GVLA 3Q8WA 3WA7A 3VZQA 3T95A 1LWOA 1PZNA 3RAFC 1XTPA 1MH1A 4WESA 1WDKA 1UEXC 2UXDB 3GUUA 3JQCA 3KS9A 1GL6A 2V9PA 3EIQA 4MLDA 3O75A 1AZSC 3NBZC 3BT7A 1ECLA 2RMKA 1Y8ZA 1GUYA 4LMAA 1R74A 5KNLA 5BSWA 4G24A 3AWDA 1IJFA 3V4OA 3GAFA 2BMAA 1RHRA 1YH3A 3I2FA 3QQ5A 1S02A 3TSZA 1EBBA 2VPXA 4G0MA 4RX1A 3EQ9A 5DBFA 4CU5A 2WAMA 4XYGA 4CKEA 2O7RA 3EVTA 2Q0SA 1RQXA 2WU3A 3ZIAA 4F2GA 3UAVA 3C7TA 4MQBA 3TLZA 2NNWB 5FWYA 3CBGA 2V4MA 3ETEA 1N3BA 1ND6A 1QIEA 3PZBA 5DULA 3RSCA 3UIEA 3RC7A 1Z8DA 3WLFA 3L7BA 2VYFA 1E89A 5I7SA 5IS2A 3DLHA 1CUWA 1Q20A 2TMKA 2ZAGA 4MI6A 2CBXA 3JZIA 3LLSA 3W34A 4AY2A 1QHIA 3E0XA 4G37A 4G8CA 4RZUA 2H1RA 4A6EA 4B82A 3VH1A 3ICEA 1XCMA 3E61A 4RQAA 1XZCA 4XUDA 2J32A 1F06A 3BKWA 4Q9HA 5FUQA 3TR5A 1TUIA 2HRBA 1STOA 1H5NA 1D04A 3OLWA 4TUYF 1KPGA 1VDZA 3UMMA 3BCSA 1WUJS 1Y8QA 5LXTB 3GJ0A 5AW6A 1MX1A 1U4NA 1JFSA 4HDQB 4DIEA 1AHHA 10MHA 4CEHA 1KI9A 1P6UA 1ND5A 3LG2A 3D7RA 1WU7A 3H9UA 4POAA 4HWKA 4TLDA 3KM0A 1EK0A 2A9JA 2Z5FA 1Y5RA 4NF2A 4QHTA 3ICPA 2A0UA 4IIGA 4NE7A 1P17A 1TCUA 1U7OA 2OVFA 2YRWA 4PBSA 4I1YA 4OCZA 4XE5A 1F3OA 4JR0A 5F5XA 4A26A 4B7CA 3V9AA 4EO4A 4JL8A 1W5FA 3L6RA 4LGYA 4ANFA 4EZBA 5A02A 2P2YA 2PE5A 4WBSA 3BHIA 2C83A 3EVZA 4EI8A 2GCNA 3RGWS 1CUCA 2OORA 2UVPA 5FTLA 3ORSA 1I1QB 1I4DD 2PT9A 4MINA 5FUXA 3BS4A 4Q21A 4E15A 1IZYA 3MT9A 4MI1A 4QUAA 2VNJA 4O4LB 5TPWB 3TVDA 5AIBA 2V1XA 4BO2A 4JI4B 4REOA 1OXVA 1XZLA 3H0CA 4LCBA 5DGXA 3I01A 4BO3A 4UVGA 3EXG2 3C39A 2VNKA 3E18A 2V3CC 4X1KA 1SBQA 4EPXA 2PN1A 3DQQA 3E5RA 4MYDA 1T3TA 4KITB 4NZNA 3FDJA 4Q9IA 2QTRA 3K15A 3IAEA 3KUKA 3LLVA 5AKIA 3U09A 3GRUA 2HJSA 3M5DA 3OQBA 3O82A 1KAGA 2GX6A 3QE0A 4MVWA 2P4EA 5IM5A 4DNXA 4EQZA 1MZPA 1ESZA 2AYZA 1JFRA 1UMBB 5CH5A 5J4YA 1NXWA 1L5ZA 3FIUA 2ONZA 4BX0A 4F86A 4JY7A 1I2ZA 2PLAA 4RHEA 1E1NA 2O06A 4E0BA 5FIUA 2FK8A 2OHVA 3SY8A 3P2OA 4PSUA 5TQ2B 3TL3A 1Z4KA 3D0QA 1CERA 1LBEA 2WJAA 1WETA 1AS0A 3AF6A 1F8XA 5C34B 4RQUA 1SHUX 4I55A 2I3BA 3VXKA 1UEJA 3TXAA 5AK6A 4BP9A 3T3IA 1HA3A 1GNLA 2ZBDA 3SOPA 2WUFA 1QQ6A 2B6HA 2DWUA 3WAGA 5IVHA 4ZRNA 1DTWA 4GPD1 4Z5XA 4J7UA 4QOSA 3RVQA 4IZIA 3HKEA 3OIGA 1T8WA 1R8QA 1Z83A 3ZH9B 3G3EA 1KNXA 1OT5A 2XYGA 4C0AC 2I34A 2GRAA 4QGSA 3MJRA 2GAFA 1Y6JA 4E13A 2FFJA 1QS0B 3ANTA 3I6ZA 2JAXA 3WLNA 1B1CA 5K5EA 4UVDA 4E1BA 4TXHA 5JC8A 2QM7A 4M9ZA 4ZPJA 4F2WA 2WSSD 1B41A 1WXGA 1SKAA 3QNWA 3MTGA 2NZ8A 2XJ4A 5C52B 4AJEA 4OHFA 1C7IA 2HI0A 1ZRMA 3PQ3A 2ODBA 3QFTA 1Q1QA 3WNVA 2W5UA 4FI3C 1F0NA 3I9MA 1M66A 2X77A 2I7TA 2X0RA 2YXDA 3H1BA 4RV5A 3AY7A 4B4UA 2QUZA 2JARA 3U31A 1MABB 3HU1A 3BHNA 5FO0A 1NVWQ 1FX0B 4J4TA 3E9CA 1E2PA 5IJ9A 3DQZA 3D6HA 1WQ1R 3CVXA 3CZAA 1ECGA 3HYNA 1LVUA 4JUDX 4XPZA 3DE7X 4KXVA 1BE0A 4TKVA 1JJVA 1CCWA 1T4MA 1NDUA 3UICA 4DLWA 4NEHB 1SY7A 1B6RA 1T3HA 2G1KA 1VFNA 2YWJA 2WHQA 3GGJA 2GF0A 2IUSA 1H2AS 3KCNA 2M1XA 2QP3A 2H52A 2YXLA 3KTOA 4JB3A 5HMLA 2NUAB 2IEZA 3LKBA 4YO8A 3LBHA 4IQFA 3KKKA 1PYOA 3Q0IA 1O89A 4AN4A 1I32A 1THMA 3N39C 1UDAA 4HWPA 4B47A 3SJZA 2ZBVA 1UOOA 3HKBB 3D1JA 4FT2A 2H57A 4YDSA 3WIBA 2RD2A 1QYCA 3ST7A 1OLUA 4HZIA 4BPBA 3ZIAD 1HDCA 4MKRA 5ECWA 5JH7A 2YCLA 4YRPA 1GPYA 4GAEA 2JLXA 2XF8A 1DBVO 4MV0A 5GQSA 3RS5A 1WBBA 2R5NA 5BQFA 5FAKA 1SBHA 2WJHA 4L50A 5IFKA 1KWGA 3VJRA 1X13A 1T0IA 5FI0B 2JCVA 3HCBA 4YR7A 2AI3A 2AJBA 1JWAB 2WFLA 4XB1A 3BD7A 3PVSA 3ZHSA 4L6IA 1EVJA 1IHPA 4KPUB 3L8HA 4BNDA 3D0KA 3MBOA 4QD3A 2P9TA 1OMOA 2HHLA 2XMCA 4PR3A 3WKEA 4KQ1A 1T6NA 4EARA 3G9ZA 3PYMA 3JWHA 3KSBC 2MHCA 2I2AA 3W2FA 3WNDA 1Y3DE 5B6PA 4XWYA 4WNAA 4HUQA 2GVDC 5G41A 3IHTA 3U49A 4OV6B 1Z82A 1NLFA 1I1NA 1UZNA 1W44A 1XBTA 5HZHA 3X1YA 4PFJA 4CM3A 2EZ9A 2PVPA 2PX6A 3F7OA 3OOWA 1SB9A 4I0WB 4YAOA 4G4JA 4JQYA 4ZMSA 5KQLA 3IDZA 2H1HA 1OQAA 2O54A 1W48A 1U8CB 1ESCA 1H4TA 4UFNA 1G20A 3WKAA 2AZTA 2BH9A 2ODEA 3DE6X 2CUNA 3DULA 3W5UA 4AJ4A 2JIPA 4AKHA 4EA8A 3OT1A 2JDIA 3JD3A 5HRAA 1XEWX 3ESBA 4ETMA 3H87A 2FPIB 4YT8A 2Z0MA 5DW0A 1KC3A 4L4ZA 1XTKA 2HHHB 5KBYA 4HWGA 2V55B 1H9BA 4QVIA 1GGVA 2IQIA 3FTCA 1L7AA 4ZJPA 3F3YA 3G8CA 3NYQA 4Z0HO 1LF0A 2GJAA 1WPXA 2VTKA 3AEKA 1TKRA 1YA4A 2HH9A 3D64A 2NN3C 1WZUA 1Z0IA 1CZKA 4HLDA 1G55A 3ZWQA 2AFVA 4DLVA 4RZHA 3FA2A 3LU1A 3R9XB 2VZ9A 2Q2VA 2C1ZA 2L2QA 2Y2UA 3F74A 2Q5JA 2VPQA 4C4SA 5J3JA 4MUFA 1I7NA 2C7BA 3ZKWA 3TFOA 3NZEA 3K05A 1W5SA 5DMHA 2J45A 4HPJB 3JAMA 1VCHA 3LKDA 5T6MA 3AQIA 4AF6A 4IYJA 4IWNA 4X1YB 3C5WP 4GKVA 4KIGA 1J33A 1ZNYA 4OLHA 5FBLB 4Z2YA 1JILA 1TU3A 4EYOA 1C3XA 3MAJA 2C5AA 1F9AA 1ONOA 2EFDB 3NP9A 4CU2A 1QUFA 1TZMA 1ZD3A 2YH2A 4NARA 2GPYA 4E5MA 4UHHA 1N57A 1SBNE 2OXEA 3NFYA 1JA9A 4YA6A 3AVQA 2H08A 4MRMB 4U7FA 2Q2NA 4KZKA 4LXUA 4CDMA 1AUOA 4QBFA 3GEHA 3IBCA 3X1XA 2IBSA 2I62A 5K8JB 1BH2A 2AKAB 1DTEA 4O1MA 4ZAZA 3C8UA 5DYWA 1PGQA 1CVIA 3ZY4A 4DZZA 3TX6A 4DAOA 3AVYA 2EAUA 4G86A 3ZHCA 1TDJA 2ZR9A 3B60A 2BTEA 4KE6A 4PZDA 2VZ0A 4J1NA 4YRTA 2RAPA 2RI6A 2XUKA 3LCRA 3ZHQA 3I32A 3W9UA 3UC5A 4R84A 1H0HA 1OY1A 1NUTA 2QN6A 3OF5A 3P9PA 2REOA 4G2TA 1YQDA 2YYSA 2YIVX 4QXMA 3T12A 3WJ2A 5U9CA 5COAA 4D9JA 3LI2A 1DG3A 1BRMA 2O2EA 2VHJA 5ANRB 3KYJB 3GJ5A 2C5GA 3GJTA 5IAKA 4E5PA 1V39A 3W5SA 4OFXA 3W1EA 1UKYA 2XA9A 1ZZEA 1BDJA 4MJ7A 3WJ7A 1A98A 1O95A 1J7KA 1R9GA 4CMIB 2RBEA 5AM4A 3EMDA 4BGIA 2IX9A 2YY5A 2JAPA 5FXMA 2CDNA 1XNJA 3R7AA 1YRAA 2QTFA 4O2AF 2ZVPX 4UHCA 4QUKA 4FUQA 4S1WA 1J0BA 2RAVA 1K9SA 1ZK1A 2L82A 3KEMA 4HNSA 1GQSA 1N2CA 4X3CA 4X7BA 1KFCB 5FEMA 4CM5A 1TQHA 1R4MB 2AQHA 3NBAA 3N7UA 2H6EA 3PXBA 1A3CA 1CXZA 1VBMA 3O8RA 4RF3A 2ZSHA 3GXOA 3GDOA 3M4YA 4C1NA 4OM7A 5JNTA 3ED5A 3HTXA 4YLEA 1I14A 2J6HA 2ZXEA 2ZTMA 4RE5A 3HJHA 3T7AA 4PYNA