4EUNA

Crystal structure of a sugar kinase (target efi-502144 from janibacter sp. htcc2649), unliganded structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
b'PTRHVVVMGVSGSGKTTIAHGVADETGLEFAEADAFHSPENIATMQRGIPLTDEDRWPWLRSLAEWMDARADAGVSTIITCSALKRTYRDVLREGPPSVDFLHLDGPAEVIKGRMSKREGHFMPASLLQSQLATLEALEPDESGIVLDLRQPPEQLIERALTWLDIAPAVATH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermoresistant glucokinase
publication title Crystal structure of a sugar kinase (Target EFI-502144 from Janibacter sp. HTCC2649), unliganded structure
rcsb
source organism Janibacter sp. htcc2649
molecule tags Transferase
total genus 64
structure length 173
sequence length 173
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eunA00
2JJ1D 2ZVQX 5FOWA 1VCMA 3FTQA 3BERA 4WOPA 2FE4A 2FPKA 2R44A 4PC1A 3VKGA 2RCNA 4N0DA 4V0NA 1XPUA 1NVVQ 4FN5A 1E9AA 2JDID 3HWSA 1E3MA 3EPHA 4DB2A 2IYTA 3ZS8A 3I92A 4NE2A 1KY2A 3QXJA 2CVFA 1Q1BA 4WBSA 1MH1A 3BORA 2PCJA 2W6JA 1E94E 1FTNA 3ZZUA 4BFSA 1A1VA 2YV5A 1IXSB 5FUXA 3ZVNA 1KI2A 3RHFA 4DSUA 4R7ZA 1MRSA 3P32A 2NQ2C 2QPAA 2GEVA 3LWNA 4B3FX 3BC1A 2JLUA 2RH5A 1ZM2A 1G17A 1FPMA 3H0KA 4HLCA 3UXMA 4NBSA 4DLVA 1G3RA 2PX0A 5DHAA 4PO1A 3QG5A 5AJXA 4ZDWA 4D0GA 1Z6GA 1J2JA 3KZ1E 1VKJA 2RKOA 3QPVA 4X8MA 3PCRB 4PPNA 2AD1A 2P6NA 2RGNA 4LJ6A 1WDTA 4LYJA 1IQPA 4LV8B 1NBME 2GBLC 3K9HA 1G8FA 2VH5R 3K0EA 4KO8A 3ZIAD 1ZD1A 2PCLA 3F3YA 5AJYA 3KJHA 3VU9A 2J0QA 3SYNA 3LH5A 4BWYA 1H8ED 1WQ1R 3HU3A 5FPHA 2O8DA 1OHHA 4P32A 3TSWA 1G5PA 4B43A 2P2LA 4FMCF 1N6KA 3Q72A 4RSGA 3DZ8A 1J7KA 1HTWA 3ONWA 2PH1A 3ZVLA 3W6OA 2DR3A 3LBNA 4Q7KA 3NBFA 2FFBA 4MRRA 1IN5A 3IIJA 4BFYA 2V6IA 1OKKA 1G291 3JVUA 3C5HA 4FI3C 4EFNA 1BO6A 4PANA 3PEVA 1LS6A 3NBXX 2VF7A 2IWRA 2BBSA 4LPKA 4ZDIA 4Q1EA 3WMGA 1GRQA 2FEMA 4O0MA 3PR1A 1JB1A 1MOZA 1KO1A 4UNPA 621PA 3VQTA 4ZKDA 2OLJA 5IT5A 1W0JD 3VAAA 1KMHB 1PUJA 1Z2CA 4QFMA 3LBHA 3EZ7A 3HJNA 4TYWA 3B1WA 5JS7A 2C9YA 2ZJ2A 3VTKA 3EIQA 4L8GA 3KUCA 4D81A 2PMKA 4FWTA 3CF6R 1D2NA 2GKSA 1KAGA 1RJ9A 2HXYA 4Q03A 3L82B 4R71A 2J87A 5FH9A 4P3YA 3P27A 1C1YA 3CNNA 4QHTA 4JVLA 3K8YA 1R6BX 4FCTA 1FOEB 3CB4A 4QJ3A 3IPXA 3SJBA 1NVXQ 2VHJA 3TQCA 4TN1A 3FMPB 1N25A 2QRZA 3TRFA 4JJZA 4HUQA 4TQ9A 1QHNA 2WWIA 4CEHA 3P1JA 3FMIA 1MT0A 2W2VA 3CR8A 1RRPA 3CH4B 1GDDA 2F7SA 2PLRA 4BEJA 3B1VA 5EUQB 1P2SA 3I3SR 3QE0A 3DPUA 4OI1A 1NKSA 3TUJC 4AC9A 4U7DA 1FNMA 3G0HA 2BM0A 4NPHA 2EFDB 1F2TA 3GLIA 2DY1A 4GFDA 4RZUA 1UM8A 1Q0UA 3SJCA 3T5DA 1SVIA 2QAJA 1NN3A 2QM7A 3WY9A 4B2PA 2XZOA 5TY0A 4AYWA 1K5DA 3E70C 2F1RA 4TT3D 3AF0A 4M9QA 1KJWA 2A5JA 1E9FA 4WIAA 1OYWA 3PEYA 2IEYA 4MGZR 1AS0A 2D62A 4PO8A 3BXZA 4MGYR 5AUPB 1NNEA 4B47A 2QRNA 2IBMA 2VRWA 3QF7A 3GFTA 1YZGA 1NY6A 3KJGA 4KCGA 3KXKA 2ZAOA 1Q57A 2ANBA 1COWD 2B6HA 1CBUA 4ZCIA 5C18A 3E2IA 4EFLA 2J0UB 3PIRA 1QHSA 4DCVA 1XEXB 4A8JB 1UJ2A 4QM7A 3OEEA 4TMWA 1ZCBA 4DSNA 3K0FA 5JFGA 4QBGB 3OFNA 4B74A 2X19A 1RRGA 3W6PA 2BCGY 2WSSD 1DAIA 4IVQA 3VNUA 1F2UA 1AKYA 3VNVA 2F6RA 5EJEA 2QAGA 2ZI6A 1DELA 2O52A 4G5QA 3NC0C 4JKYA 2PJRA 1ONBA 5JRZA 5HZKA 3UMFA 3FHTA 3Q7QA 1ZD9A 2ODWA 3H2YA 1LS1A 1W5TA 3TMKA 1E9DA 1CTQA 1QHXA 2EQBA 3NHBA 1TU3A 3L0OA 3B9QA 2CNWA 2P0EA 2QTFA 2IW3A 1AIPA 1GNRA 3LVRE 1T8UA 1OFIA 2IYXA 1KAOA 1ZUNB 4MDFA 3ADCA 3RSLA 5KPJA 4CF7A 4JSTA 4TZ0A 2H18A 4DDVA 1S4QA 3UG7A 4RD2A 2ZR7A 4UNQA 2W6JD 2XB4A 5B2ZA 5JWHA 3QF4A 1PUIA 3THXB 2GDJA 3NVAA 1VPLA 3F5FA 4US2R 2C98A 2YWGA 1Z6TA 1LF5A 4D4JA 3HU2A 1XZQA 3OIWA 1KSJA 3BJIC 2B21A 4M1MA 5DI3B 2KSQA 1PLJA 2IXGA 5JHHB 2ZE6A 2WOJA 5JJIA 3CW2A 4B35A 5HZHA 2QZ4A 1W46A 2QP3A 1IHUA 4HAYA 4ZI3A 2Q3FA 3B5JA 4DIEA 3B8HA 1UKZA 2QPOA 1W36D 1KO8A 3D7MA 1S2MA 1NJFA 4ILEA 3OEHD 3IIMA 4PAOA 2RGGA 2FZ4A 3FB4A 4TLCA 5A4JA 2YNMA 1Z22A 4D0NA 2RHMA 2CL6X 4MKGA 1MO3A 1T4GA 2F3TA 2VP0A 4IOLA 3MWKA 4JLNA 2PMDA 1PZNA 1US8A 3SQXA 4XTRA 1CJVC 2H1LA 4ESHA 4Z54A 2HUPA 3KKQA 3QBVA 3QEJA 3QI2A 2ZYTX 2LKDA 5FTLA 1OHHD 4RD4A 1XTIA 4FMCB 1XNJA 5FBWB 3T5GA 4PFSA 2QUZA 1VHLA 5FTNA 1KDRA 1HQYE 3BBPA 1AQUA 2BWJA 2DWPA 4XWAA 2FV8A 2A5GA 4HDCA 4MGKR 3SE0A 1EWRA 4BEBA 1GKYA 3EG5A 2QP9X 2GHIA 3UK6A 3CPJB 4KSBA 4QGAA 3SC3A 2F55A 2GWHA 5KSZA 1KK0A 1TEVA 3ZYCA 1VG0B 1W47A 1OKKD 3TBKA 2D2FA 2N42A 4FXPA 4XD7A 1R0YA 5KDDA 4BFWA 4LC1A 1P2TA 2X2FA 4B2LA 3KKOA 5B57C 2WICA 1U8AA 2XX3A 1FUUA 3AP3A 1QHYA 3WRXC 3VX4A 1WRBA 3QXSA 3K09A 4BFUA 4EPWA 3RS2A 4OHXA 2NOAA 3M4YA 1E0JA 1O87A 3UG6A 4BGDA 1OV4A 1XJ0A 3NDBB 1T6NA 1KSFX 3A4NA 1AM4D 2WM9B 1UKEA 3IEUA 4PPQA 3QVUA 2NO1A 1II9A 5FTMA 2GXQA 1XFAA 1R0WA 4DVGA 5D3QA 2WPDA 4QM6A 3ASZA 2KE5A 2AX4A 1Z5ZA 2B92A 2ZRLA 4NU0A 2ZS9A 2QGNA 5FL7A 1KYIA 3CRVA 3EZ6A 4ABYA 2ASEA 2QNRA 5ELXA 1EG7A 3EA0A 1KTVA 2F9LA 1U81A 2ZUDA 3TJZA 3W6NA 4I99A 3LX8A 3B85A 1HYQA 3CONA 2DCUA 2QY9A 2ZJ8A 4DB4A 4F4CA 3THWB 3CX8A 4TMXA 3C41J 1QHIA 4KXFB 1JAIA 5KUTA 2JGNA 1KHTA 3GLGE 2XAUA 1YJ5A 4TL8A 3C14C 4F93B 1TF5A 2I3BA 4G5OA 3NEYA 3CUEF 1DEKA 5FOSA 5EP1A 3SR0A 3QKRA 3GQBA 4G0NA 4OYHA 5EXPA 2BMFA 3T1OA 3W34A 2A30A 3TSZA 1E2IA 2DWOA 1UFQA 5CJPA 4QOSA 1UKYA 2H92A 2FWRA 3AGPA 4NYIR 1Z6XA 2DB3A 2A7QA 1XD2A 1M2OB 2KI5A 1SHZA 3L0PA 4OI2A 5AK0A 2HJGA 3LRPA 2ZSDA 1GITA 5D3MA 3C5CA 4IDOA 4BLPA 2WJJA 2FH5B 2FEOA 1OIWA 1YR7A 1VDZA 1WMSA 2BBWA 1QHGA 5C46F 3T06B 3D31A 4PXAA 3U4QB 3PENA 4AD8A 2A9KA 3VR3A 2V54A 2G88A 4QGGA 4L9WA 1R5OA 4D25A 2FNAA 1Y3AA 5K8IA 1VMAA 1KMQA 4CT4B 1R0ZA 2F43B 3K70B 5KNBA 1T91A 1ZM7A 4Q4LA 3DM9B 1KO7A 1R8QA 3B6EA 4CW7A 1E98A 1XEXA 5TMPA 2VP2A 3OEED 5HPYB 1Z8FA 2X2EA 3A1WA 1E2NA 3QXHA 1PV4A 1DAGA 2AK3A 2GK7A 2ZRFA 3F8TA 3EC2A 2GAAA 3DO6A 4E03A 4F7WA 4CIDA 3U44A 1FL9A 4A2QA 5C4MA 4EIWA 2G1JA 5FL3A 1NG1A 5H8WA 4B32A 1YR8A 2JLQA 1M7BA 5AJZA 2V8OA 1M6NA 4JLBA 5JSZB 1WF3A 1OJLA 4R2IA 4BLTA 2C9OA 3B82A 5G3YA 4LC0A 3LA6A 5TXGA 1YRBA 3R9WA 3K0AA 1LTQA 1W36C 4IDNA 4HLUC 2CNWD 3W5JA 2RGEA 4FD2A 2RGNC 3SQWA 3U7GA 4XVUA 1H65A 2ZEJA 1YKSA 3CNLA 2BIFA 2CJWA 4W7SA 5L3QB 4Q00A 4IFEA 5JMTA 3IQWA 3U3RA 4BZPA 2MMGA 3QXCA 4QKQA 4ARZB 1Z07A 2DFTA 3VKWA 1W2GA 4OHVA 5AJWA 3TLXA 4C0HA 4MKHA 4TMVA 1UEJA 3WXMA 3RS3A 3EX7C 2XNDA 5JHGB 2OM2A 3D8BA 4M1TA 2OCYC 1Q22A 3C15C 2L0XA 4F92B 5E4FA 3QKSA 3L0SA 1JXMA 1PJRA 2QEQA 4KBGA 3ZLJA 2KWIA 3CX6A 2J5XA 3H84A 3AVOA 1DAKA 5JECA 3SYLA 1E1RA 5IHPA 1MRNA 3HYRA 3TUZC 4GP6A 5AJVB 3LLMA 4LWZA 4DLYA 3LD9A 3B78A 1X6VA 4RCZA 2C9CA 1Z06A 4QNMA 4D4MA 2A5DA 5P21A 1P7CA 2WZQA 1E2JA 1QBKC 2F9MA 3EZ2A 4LYFA 2HYIC 4EPYA 1CEEA 1IOZA 1BMFA 2AK2A 1E2EA 1N5JA 2X77A 1UDXA 3A1UA 1CP2A 1KZGB 1R5BA 4M22A 4JVSB 3TSOA 1WB9A 3OIUA 4LBWA 1VYVA 2ZSAA 4U5XA 3EZ9A 1LW7A 1U94A 2ZRCA 4EPXA 2IS2A 5FOXA 1F3OA 1N5IA 2IT1A 4DLWA 4IVPA 3TQFA 3MCAA 1Z29A 4JLMA 2WHXA 1RRFA 3EW9A 1CRPA 4LHVA 3ADDA 4AY2A 2CCKA 3P4YA 5BN5A 2IS6A 2F1HA 2A2ZA 1E96A 1YR9A 3MSXA 5EQTA 4JLDA 1GNQA 1HA3A 2O8FA 4A1FA 4XD7D 1TTTA 1JALA 1ZW6A 1T5LA 4L4UA 1EFCA 2Q9AA 3V4FA 3WBKA 2BV3A 3KQUA 2XB2A 2JCSA 4LJ7A 1XTRA 5IF9A 1FX0A 5LD2C 2IUSA 1Z0KA 3QBTA 3LDAA 4TL7A 4C0LA 1YE8A 4DLXA 1TMKA 2OUKA 1KK1A 1OE0A 5KHOC 2CLDX 4D4LA 3AVWA 3PITA 3PG5A 5GJVC 1HQCA 2J9RA 2P6UA 4CT5A 2R9VA 4MH0R 3GLHA 3S1AA 4MYUA 1OH8A 4FMBB 4OJQA 4AIIA 1N3BA 2ZJ5A 3WYGA 3A1TA 3NXSA 4OJKA 1P2VA 3PUYA 1DADA 4I1UA 3FKSA 5F9HA 4MUBA 1D8TA 2BMEA 1UEIA 2FSIA 2ZTSA 3CR7A 4TYQA 5TDHA 1X1RA 3AVVA 3M0EA 1E2PA 3VKHA 1DG1G 4Q4AA 4C0BA 2J45A 4AI6A 2OILA 2QT1A 3UPUA 5BN3A 1KGDA 2J46A 1X8LA 2QU8A 4NH0A 5J47A 5JWRA 3KB1A 1XEWY 2DYKA 2BC9A 2LWIA 1OH6A 1YZNA 2EU8A 2O5VA 1R0XA 2FA9A 4IXNA 5K8UA 1KSGA 4XSGA 2JLXA 2R6CA 4KYIB 2C96A 4TLEA 1EFTA 2ODNA 3RC8A 1S3GA 3CM0A 1UDWA 1NP6A 5EXXA 1LY1A 4WXPA 5HE8A 2CHVA 2C77A 2KBEA 1AQYA 1IY1A 3JZMA 1RRCA 2XTNA 1J90A 4Q9LA 1VCNA 3MMPA 4NYJQ 1GWNA 1R2QA 2HXSA 1E1QA 2JIZA 2QAGC 3TIFA 1G21E 1G3IA 1E9CA 1IN4A 5DE3A 2V4ZA 2Q3MA 5CJ2A 3TR5A 4RFSA 1TUIA 1XJQA 1YR6A 3REGA 4NYMQ 5F9FA 3T1TA 4EPTA 3IEVA 2XSZA 4TZ6A 1DARA 3GLIE 3KDSE 4X8HA 3NWJA 3T12A 1E2LA 1XD9A 2DBYA 2ZSFA 1E79A 4HAWA 4M0LA 5HE9A 2C04A 4II7A 5DLQC 2P5SA 4YMWA 2HLDA 1KI8A 4LSGA 4N0EA 2PZFA 2EFEB 4JBXA 5CIQA 1FQJA 5J4VA 1TQ6A 1CJTC 4HLQB 4B3BA 5CITA 3LXXA 1Y63A 3EPLA 3OZXA 4N1AA 2OT3B 4JL5A 2F3RA 4KHZA 4WZ6A 5EZ5A 2XTMA 4M9SA 5GVRA 1GNPA 3BGWA 3M1IA 4PQRA 2WKQA 3CWZA 4W9MC 2QQ0A 3UANA 4ZIRA 3HU1A 1E99A 5KO2A 2J7PD 1P3JA 4IDPA 4L15A 4G5GA 4P4SA 2QN6A 4BUJA 5CYPA 1HEIA 4FMDF 3VMFA 3GFOA 1YZTA 1QG4A 3LQQA 2JAQA 4OBEA 1U99A 3PXGA 1GILA 1M8PA 4JVMA 3ZH9B 3HR7A 4QRHA 5JSZA 1EFRA 1G3QA 3DM5A 1XMVA 2CK3A 2HCBA 4TL9A 1XTJA 2FF7A 4P0TA 2AWOA 2DHRA 4ACAA 1X3SA 1U98A 2ODEA 4MYCA 1EX7A 2NIPA 4KYUA 1NIJA 2ZUBA 4M1OA 5DYIA 4JLJA 3SI7A 2NMVA 4RZXA 1V43A 5BYKA 4S2EA 4JT2A 2ORVA 1IN8A 3AP2A 3LNCA 3OF5A 3QKTA 4Q7JB 4DHEA 3EXAA 1G3MA 4EJSA 1FFHA 3KX2A 2KBFA 4D80A 3KFXA 3LVQE 2I4IA 1YZLA 3QQ5A 4URYR 2ZE7A 5JEEA 4PHFA 1MO5A 5CDFA 5TB5A 2GZHA 3CF0A 2XEXA 4JLAA 1XEFA 3CWQA 3CRQA 3Q9LA 4PSAA 2FFHA 3I8SA 5G40A 4BQSA 2XNDD 1W7AA 4E22A 5H68A 1NVVR 4EQ6B 2GVZC 1GUAA 2OBNA 1DO2A 3EARA 3BIFA 3B7GA 4RD6A 4C3ZA 4A4DA 1WBBA 4TMZA 1RYHA 3U6BA 1E2MA 4MQBA 1CR2A 2I1QA 4YXWD 1G16A 3A4MA 1II8B 2BDTA 1YVDA 4C0KA 3GJ3A 1TADA 5FOUA 4LV6A 1VG8A 4DCTA 3ASYA 5FI0B 3FKQA 4DT1A 1DPFA 2ZJAA 1RKBA 5CK5A 2CE2X 4G1UC 2QP4A 2Q9CA 3WNDA 2JLWA 1BMFD 1JBKA 1Z0IA 3D3QA 1UBEA 3EA5A 3NG1A 1IAQA 5SZKB 4ZV4A 4TYYA 4HB2A 2V55B 3K09C 1MO4A 2Z43A 2TMKA 2FGKA 4OL0A 2ZROA 1A5TA 1KJYA 1LVGA 2OFOA 2LCFA 2FSFA 4YC7A 3LLUA 3AVQA 1CR1A 1D9XA 4KI0A 4MITA 4QC2A 4PHGA 4BPBA 2IL1A 2J41A 3LW8A 2JJ2D 2ZYUX 4IKEA 4NL4H 4B44A 721PA 4OQXA 1KSHA 2BCJQ 3Q8XB 4Z1MA 4CEIB 1JI0A 1Z28A 2R8RA 5IDVA 2PZGA 1T3HA 3LBIA 1MABA 3QY0A 4RD1A 2ZE8A 3TW8B 1U8YA 1CXZA 4PC6A 2V7QA 1OT3A 3WMFA 1XF9A 2ZXUA 2AXNA 4GMDA 4OK3A 5CM9C 1SXJA 1XXHA 1TQ4A 5C2JB 3WHKA 2A3RA 2HV8A 2WWHA 4JMPA 1N5LA 3SYKA 3P26A 4ON9A 4YLGA 1NLYA 1TNDA 4DEYA 2R62A 3OAAA 1ZBDA 3KTAB 1ZYUA 1LFDB 1U90A 1S9HA 4UJ3A 2XNSA 4OI0A 1N6IA 2VP4A 2NZJA 1YQTA 3BB4A 5KU1A 2A5FA 3FKSD 3ADBA 4B73A 2P5TB 1IXZA 2E87A 4EKDA 3ZS9A 1QG2A 4IEIA 3FMOB 2CMKA 1G64A 4Q9HA 5AWFC 1DAFA 3JZAA 4UXIA 3AM1A 2JEOA 2JLYA 4CEJB 4C0QC 1KI1A 3PVSA 3SFVA 4E5UA 4F4JA 1CR0A 1CLUA 2W0MA 1FMJA 4LYAA 1JR6A 1WBDA 5CM8B 3OIYA 5J5CA 4Q48A 3VR6A 3EPJA 4HZUB 2JLSA 1RFLA 4Q1FA 3AVXA 2ZI5A 1E2DA 2CL7X 5CIWA 4DSOA 1NG9A 3WP1B 2Z5FA 2HCJB 1UPTA 2GK6A 5FUWA 4KITB 4NDZA 1CIPA 1ZM9A 5KNDA 2VEDA 4XVRA 1WE2A 5E95A 1CKEA 1B0UA 1L4YA 4DIDA 3ZJYA 1TL7C 4Q01A 4Q18A 3FHCB 3MG9A 4B76A 3MWYW 2ERYA 2JIZD 2ZE5A 1E1QD 4UKDA 2ZI4A 4Q4JB 3KJEA 3I32A 4H9GA 2HT1A 2OESA 3L43A 1NBMA 4A2WA 3GLFE 3SHFA 4HAXA 3GP8A 2WVJA 2IA5A 4B2IA 2GCOB 2ERXA 3MFYA 3ZD6A 2QE7A 3RS7A 1AJEA 2FG5A 3LW7A 4BLOA 1U0LA 1E79D 4Q5IA 1JEDA 1G19A 1AGRA 1N6HA 2VO1A 2QTVB 2ZUCA 2HLDD 4YQFA 4PTLA 4K81B 4C7OB 2AKAB 4QJ5A 3ECCA 2O0KA 3BRWD 3I62A 2J0SA 1I4DD 1PLLA 4YMVA 5AUOB 4HYYA 3MUFA 3CKLA 3TH5A 1P5ZB 2WJHA 4HB0A 1DS6A 3QPWA 4PC7A 1BYUA 1ZRHA 1QVRA 3RSOA 4A0HA 1NJGA 1S1CA 2Z4RA 4YDSA 4ZKEA 1YRAA 3AF3A 3R9IA 3RDPA 3AVUA 2R2AA 4O3MA 5HR5A 4FMDB 1G6OA 1G4UR 2PBRA 3GJ8A 4WA7A 3VHLB 4DCUA 2ZYWX 3R7WB 3WNBA 2P67A 4AK9A 1G6HA 1YZQA 4JS0A 2W2TA 4L5BA 4TSFA 5DHFA 1E9SA 1XJCA 3X1DA 3RVBA 1EFRD 1OXVA 2XZLA 5CK4A 3I73A 1EGAA 1IY2A 2H16A 1SVMA 1R10A 5L3SB 5EXTA 3SN6A 3TW4A 4QL3A 4PZYA 1VCOA 2C8VA 5M04A 3TGPA 1OYYA 3EAQA 1LF0A 4ESVA 1ZVQA 5BW8A 2V1XA 3WP0A 5FBVB 3GJ0A 2ZS7A 2IEZA 3IGFA 4DCNA 1NLZA 2IX3A 2IS4A 1E0KA 3PUWA 2GTPA 4M8NE 2XGJA 4ZDJA 521PA 2OO7A 3RS0A 2J7KA 2GCNA 4O25A 1GM5A 1AZSC 2Z4SA 3ZZTA 4MYTA 3SU8A 1G18A 2QENA 4EDHA 2GRJA 1XBTA 3X1YA 2VPPA 3AF4A 3BD9A 2ZRDA 2ZJYA 4XWKA 4P33A 3V9PA 1CU1A 2EWVA 4EAQA 4PZLA 3SJZA 3QEOA 4ZCLA 3GLGB 2OAQ1 4HB3A 4M1WA 5L3RA 1HH4A 3GEEA 3AVPA 1D2EA 4RFVA 2EYQA 1NIPA 3UMSA 4U00A 4GOJA 3RLFA 1TUEA 3AKYA 1IJEA 4IDHA 2GJ9A 2B8TA 3RWMB 4D4KA 5B58C 2XZPA 2EW1A 1YZUA 1GZSA 1KMHA 1ZJ6A 1TQ2A 2W83A 2WMNB 3T35A 2B7BA 2O8EB 3M6AA 4DWJA 3PUZA 2REBA 1JR3A 3UWKA 5JJKA 4LBZA 2H8KA 3BAFA 2BM1A 4PO9A 1F60A 1HT1E 1HE1C 1NL3A 4DLTA 4MDEA 1HV8A 3T61A 2VBCA 4X8OA 2BKEA 3DOFA 4QNRA 4XIGS 4NCHA 3RRMA 1N0WA 2OAP1 2D06A 1XWIA 3BH7A 2CEAA 1KDTA 1JNYA 3KXIA 1TQDA 4OKSA 2IYZA 2IF2A 5IK2A 1SVLA 1KY3A 1C9KA 3RC3A 1LB1B 1Z83A 3L2OB 4Z1MD 3BB3A 2YINC 1T9HA 4CEIA 2OE2A 1YHNA 2DFKB 4LX0A 2XXAB 1H8HA 2IYYA 4TL6A 2NG1A 3HDTA 5J4YA 2ZREA 2V7QD 2G0TA 4F91B 4PPGA 3EZFA 1SXJD 3NTUA 2HDNB 5FPSA 1JEEA 4KODA 2WKRA 3U60B 2QBYB 2NPIA 4PZZA 3OHMA 4H1UA 5DN6A 4B3CA 121PA 1SVSA 4MA4A 3ICQB 4H1VA 4QBIA 1P9WA 1P73A 3OAAD 2W6IA 4RZ2A 3LAWA 2P6RA 3KTAA 4XJXA 4AKEA 3O47A 3QG1A 3ND9A 4JVNA 4MGIR 4Q7MB 2VYFA 3ZQ6A 4DUGA 1RYFA 5A0FA 1BOFA 1QZXA 4Q02A 2YWEA 3G5UA 2MSDB 3PJRA 1YZKA 4AKHA 3FMFA 3BOSA 2IYRA 1XB2A 5L8VA 1W4AA 3AUXA 4DKXA 1OSNA 3GLHE 4GI7A 1P72A 1K5GA 4DDWA 1JJ7A 2FZLA 1D6JA 2UKDA 3PQCA 4GDFA 1SKYE 2EFGA 3Q85A 1DTSA 2H5EA 2W00A 3K0SA 2WJYA 1VYUA 4B34A 2JJ1A 2J0UA 3KJIA 2PT7A 1NSFA 4A8JA 2CXXA 2YJTD 3MWJA 3E5HA 4AKIA 3OFND 4A82A 4W5JA 1EFHA 4NTZA 4AG5A 2JDIA 2P65A 4QGFA 4PHTA 4RD3A 5EE5B 4C9BA 4OQMA 3PEUA 4BLRA 2C99A 3EIEA 1XDBA 2R6AA 1T0JB 1U9IA 2AN9A 1QHHB 2WWGA 3P20A 1M7HA 3RS4A 1F5NA 5JI2E 3O8BA 2Y8EA 2ZIAA 2W0SA 3LX5A 1OH5A 2NO7A 3QOFA 4NP6A 3KL4A 1RIFA 1F48A 4I4LA 1D2MA 3EWAA 1AK2A 1Z0AA 5B30A 1FNNA 5EUMA 4AYXA 3CPEA 4A6PA 3AUYA 4B71A 1G7TA 2QE7D 1G20E 3VR1A 5AR1A 1DVRA 4WW0A 1CRQA 2PJZA 1W36B 3C4JA 2R6GA 1QDEA 3DHWC 1ZNYA 4HB4A 1ANKA 3BE4A 4C7OA 4DDUA 4RJLA 1HY3A 3D6TB 4C4PA 2OV2A 2ZU0C 4LJAA 2XJ9A 1OPXA 4G5SA 4M21A 2QM8A 1KI4A 3AB3A 4A9AA 4C0AC 1NVUQ 2OLKA 3WYAA 1NRJB 3THXA 4URXR 3AF1A 1ZINA 4DC9A 2G6BA 2QMEA 2VSFA 3VU9B 4EJSC 1VIYA 3R8FA 3RS5A 5DI3A 4JLKA 1H8EA 5HTKA 4JLOA 4LRWA 1OXTA 3A58B 3KQKA 5JI3E 3B60A 1XEWX 2NO0A 4Q9KA 3TKLA 4TWZA 5F3WB 5E7JA 5LBIA 1LV7A 3K53A 1T0HB 3AEZA 2WKPA 3HR8A 3NDPA 2HF9A 4QJ4A 1I2DA 4OHYA 4BE7B 1Z6AA 1NKTA 2WJIA 5BXQC 5KSOA 4JYBA 1I4LD 1SGWA 2PLFA 4AG6A 4TLAA 5L3SA 1XX6A 2YC4C 2QMUA 1TPZA 3L0IB 2VSXA 4V0MA 4EUNA 4GOXA 3U3JA 4LJ4A 1ZUIA 1P9NA 4GSYA 3RABA 3KB2A 2GJKA 4DSTA 1ZM3A 2WOOA 2AXPA 3A36A 4Z51A 4EFMA 1SZPA 2QL6A 1HT2E 4IOMA 3BK7A 4Q1BA 3U2QA 3DDCA 2ZRIA 1HURA 1OLOA 2O0HA 2ORIA 5FI1B 1S1MA 1S96A 3N5CA 2ZRPA 3FPAA 3X1ZA 5TVKA 2IUTA 1KI6B 4Q19A 2OXCA 1CR4A 5H70A 4ZDKA 1F6BA 4B48A 4LY6A 3W8RA 3K9NA 4PQYA 4Q1AA 4KJZA 5GADl 1XRJA 4KAXA 2DFNA 2FFAA 1KI3A 1RJ9B 3KXLA 5KSPA 4MUAA 4OK5A 3RWOA 1ZC4A 1GKUB 2GETA 1FQKA 5DYGA 4LK2A 2CHQA 1Q21A 4LCBA 4JLPA 4NCIA 4RY2A 1BS1A 3T34A 3U6KA 2FN4A 4B33A 4IRUB 4D26A 4IJMA 4PR0A 1OXUA 1Q12A 4XH9B 2YWFA 1UF9A 3NIBA 4D0LB 4P4TA 2W58A 1EXMA 3UKDA 1U0HC 2O8EA 2KB0A 1SXJC 1G8HA 4HUQB 4DLRA 1JR3D 1E69A 3AP1A 1NMYA 2W2XA 2WJVA 3W3ZB 1N6LA 2WPDD 4BFZA 3PEWA 2YKGA 1Q3TA 3DOEA 4CEHB 4JBWA 3CPHA 3FFBA 3B1YA 3TE6A 1NVWQ 1Z08A 4XSHA 5FL7D 4Z8YA 5DI9A 3DKPA 4JLVA 3UMRA 3IIKA 1FP6A 2WSMA 1NI3A 2YOHA 3SDZA 3KQLA 1U2RA 4TYNA 3GJ7A 4V0OA 2YHSA 3CNOA 3DMDA 1F2TB 1KNXA 1M1YE 3IPYA 1AS2A 3WHLA 3GLIB 2FFQA 2F1IA 1UBCA 1KKMA 3BH6A 3JVVA 4FCWA 1I4TD 2B7CA 2FJUA 3QPUA 5IK2D 5E3HA 3FOZA 4LOAA 3ZDQA 3THWA 2ZRAA 1D9ZA 4BASA 2VHTA 4DLSA 4TQUS 5KYKA 3U5ZB 1AZTA 2VLIA 4UJ5A 1FMLA 4Q1DA 3REFA 1H8HD 2IXEA 3I4LA 2VP5A 4V0KA 2D7CA 1KJZA 4S35A 1HE8B 1OF1A 4LGMA 3QVVA 5JJLA 1Z0FA 3KUDA 1E2HA 3LFUA 1N0UA 4W5WA 3MLEA 1NN5A 4LHWA 2VP9A 3PV0A 5HCIA 3N70A 1EK0A 1ZD8A 3F0TA 4JBYA 5DN6D 2RMKA 2QBYA 1ZUHA 2VP6A 3EIHA 5CLQA 3VX3A 2BMDA 4AKGA 2W6ID 5FUVA 2ZRGA 1GTVA 3HPQA 4MRPA 2BVNA 4C2TA 1XTSA 5KNCA 1SVOA 1CJKC 4GZMA 4DUGD 3RANA 1TAGA 1NSTA 3K0FB 3K0CA 4ZCMA 1XXHE 2VQSA 2AFIE 3BWDD 4C0SA 1T8TA 1L4UA 5G41A 4LV5B 4DRZA 4OQFA 1F2UB 2VHCA 3BH0A 3I5XA 1ETUA 1WCV1 2QAGB 4ZPXA 3U4QA 4OHZA 2GXUA 4IFBA 2EYUA 2N1BA 4CDGA 2AR7A 3V4RA 1Q1QA 3KKMA 4ZI2A 2BKUA 1OW3B 1E9RA 4DZZA 1KDOA 3CZPA 2JASA 2F43A 2Z0MA 3J81k 1JXOA 5UKDA 1RPZA 4B6FA 1ZNZA 1N2CE 1W1WA 1W48A 3TAHA 1ZIPA 4DXAA 2JLZA 1G7SA 1ZM4A 3IHLA 3T1VA 2OHFA 4Y0VA 3GMTA 4OK6A 3NH6A 1UAAA 2WAYA 4I1OA 5ANRB 5EE3A 1GRRA 2PZEA 3IKJA 4BRWA 3E1SA 1Z3IX 2RGBA 2QSZA 3GEIA 1CS4C 3ZZ0A 4PC2A 1A4RA 2IYQA 3KKPA 4HDOB 3MWLA 3DZDA 4C0JA 1DAHA 2GF9A 4OQLA 3QF4B 1QHHA 1KO5A 3KQHA 1EX6A 2IF0A 3NC1C 4Q4HB 1GSIA 4M1KA 5HKKA 4BZQA 3SOPA 1OIVA 4YMTA 2V9PA 2DFLA 5L3VA 2ZPTX 3I1FA 1BIFA 2D74A 1CJUC 1ZIOA 3B13B 4R9UC 2ZVPX 5DIFA 4A0RA 5L3QA 2HJVA 3WRYC 3LV8A 4US1R 2IC5A 4KFSA 4HLUA 3TR0A 2ATXA 5J4LA 2JLVA 4M2LA 3P4XA 3OEHA 4NYJR 3QNUA 3G82C 5J40A 4ARZA 2YC2C 2PT5A 2YYZA 4A0FA 3FWYA 4AYTA 2GVDC 3AGQA 1US8B 3NBZC 4NCJA 4NYMR 2ANCA 3X1WA 4PQFA 5H1YA 1GAJA 3CF2A 2D7DA 2PL3A 1RVDA 1DO0A 4Q7LA 4D2IA 2IK8A 4A15A 2OSBA 5G53C 1A2BA 1DBSA 4PAQA 1B23P 3I61A 4GBMA 5CB6A 3PFIA 4Q9IA 3W5IA 1E1RD 2FGJA 3TNFA 1GKIA 1SKQA 2J3EA 5SZJA 1GL9B 4RZ3A 3U3KA 3V00A 1WA5A 2AD5A 1TX4B 4LJ8A 4MRSA 3TVTA 4NONA 3HYTA 4Q66C 1VG1A 2CLSA 3U7HB 3H86A 1ZC3A 2F1JA 1MKYA 2ZRHA 3A37A 2ORWA 1P62B 5JS8A 1RE0A 4HLDA 5KOYA 2QMOA 5CLLA 4RCYA 5G3ZA 1IN7A 1G5RA 4GMXA 5TARA 3DEFA 5JBQA 3DMNA 3QJYA 5GJBA 3EWSA 2VL7A 1S0UA 1P4SA 3AVYA 4URVR 1JPNA 1VG9B 2AL7A 2O8BB 3MJHA 2C78A 2HEIA 1VCIA 1KI6A 1N5KA 4QXAA 1V5WA 1NMZA 4O2LA 5JLJA 2Q9BA 4B6EA 2IYUA 4URUR 1XMJA 1X86B 2Q6TA 5JCPA 1UBGA 2ZRKA 1W49A 2OZEA 2H17A 4JIMA 2G1KA 2QTHA 1P61B 3I72A 5CB8A 4BLQA 1E0SA 2ECKA 1AS3A 2R6FA 1OFUX 5GJWC 3Q7PA 2NPFA 3ICEA 2BEJA 2VA8A 4AWXA 2BJWA 3GJ5A 4Q21A 2A78A 1G41A 1A7JA 1IY0A 3VR5A 5DGXA 4AURA 3ND8A 3W9YA 1VHTA 2OG2A 3CRW1 4BFVA 3QXXA 4TTRA 5LPNA 2BEKA 2CL0X 2ONJA 1XTKA 1X8JA 4IDQA 2GCPA 2NO6A 3GCGA 4JT4A 4M4SA 1RC8A 3SS8A 3GLFB 3QKRB 4R2HA 4HDQB 4NCKA 5GVSA 2RAPA 1S8FA 1XU4A 2O0JA 1CJMA 5JRJA 2AWNA 4HSEA 1KI7A 1MV5A 1N6NA 3DVLA 2UVQA 2IUUA 1GL7A 1JR3E 4X8LA 4IXMA 1XD2B 1W5SA 421PA 2ZYVX 2Z6VA 1EWQA 3LO5A 1BH2A 5D3MB 2WIAA 2QI9C 2VHUA 4HAZA 3AV0B 2JLRA 2G3YA 1NY5A 3BFVA 4KV9A 3AKDA 3EPKA 2ZJOA 4E09A 2NZ8A 1ZP6A 4TTPA 2ZM5A 1T3LA 1CF4A 2LKCA 4MRNA 4A8JC 2D3WA 4IHQA 2JA1A 1G5TA 4P31A 3OE7A 4L9SA 1OB2A 1OFHA 1JAHA 1JPJA 2WJGA 1IONA 4FIDA 1P9RA 2QG6A 4BRUA 4BZXA 1P60A 1R4AA 3A6PC 5FBQB 5K8TA 1NN0A 3SFZA 2GJAA 2FX3A 2GAOA 4JL6A 2CVHA 4KU4A 2Q3HA 3UATA 3WBJA 5KSYA 3U44B 1U8ZA 5JZVA 2GA8A 1U9IC 2XSZD 2ZI3A 2PX3A 3A1VA 3MAAC 1QF9A 2YVUA 2YWHA 4JSYA 4EPRA 4HUTA 1XMIA 5KDLA 3CIOA 1OXXK 2ODBA 4CYMA 2QGZA 4XVQA 1CULC 1T5IA 4UXJA 3K70D 4EPVA 1ZNXA 4TTQA 3DL0A 5EP3A 4I1SA 2J59A 4YONB 2ZAMA 2EFCB 5GJCA 2ZS8A 3K0AB 2I1VB 1M34E 4WXRA 3VR4A 1TF7A 221PA 2ZRMA 2A5YB 1L7VC 3N2EA 2WAXA 4URWR 5AUQA 2V3CC 2IHBA 1M7GA 1KNQA 1VECA 1XP8A 1XCPA 2CJWB 2EWWA 2FSGA 2RGDA 3B1XA 5DISB 5SZIA 3MGCA 4P4UA 1FW6A 1KDPA 2B8WA 1Q1EA 1JECA 2OBLA 2ZI7A 5KPDA 3I5YA 3LXRA 4LHYA 2OFXA 4LYHA 2ZJBA 3AQ4A 4GP7A 2AHOA 1XPOA 4G5RA 2CK3D 4KFUA 4KFTA 1FP7A 4Q4HA 5F2EA 5HKKD 1JJVA 1OIXA 1KZ7B 1W4BA 3W90A 4WAUA 3U7FB 8OHMA 3NBYC 4D82A 3QKSB 4NKRA 1N6PA 4A2PA 4B3XA 1K8RA 3H1TA 4KLZA 4A92A 3CX7A 3W3AA 3SZRA 1FTSA 2GBLA 3ZVMA 3GFPA 1NN1A 2RGXA 2VIIA 2BBTA 4KVGA 4TMKA 1XCGB 2OCAA 4LDJA 5EXSA 3SBDA 2ZRJA 4HATA 4CVNA 2ZANA 4LJ5A 3ZD7A 2QMHA 4YDHB 1XMSA 3MD0A 4PSVA 2MSCB 1AKEA 4GRAA 1J70A 2CE7A 4XWOA 4N3NA 2XTZA 4Q1CA 2OCPA 4EQ6A 2GXAA 3U3MA 2CCGA 1JQJC 4W5HA 2Q21A 4ASUA 4DEXA 4OQNA 2FPMA 4DLUA 2REOA 3VHXA 4RKEA 2VTKA 1KO4A 3A8TA 1II8A 5E7MA 3ETLA 1Q20A 1TEXA 1SQ5A 1GG2A 2IHYA 5FOTA 3THYB 1ESMA 1LNZA 2Q0HA 2ONKA 2RGAA 1Z63A 2C5LA 2RHDA 4IEEA 5JEDA 1W0KA 5DH9A 1KOFA 1Q1ZA 2CCJA 3Q5DA 4NCNA 2V6JA 3OIVA 4GL2A 4E07A 4PAMA 2O8FB 4XTCS 1ZCAA 5C4GB 4V0LA 1YU9A 4NYIQ 2G0NA 2O8CB 1WXQA 3U61B 4LPSA 4M9XA 3CLVA 1FX0B 1SVKA 1L2TA 1FUKA 4FCVA 3X1XA 1AA9A 1NF3A 4M9ZA 2E1RA 1GIAA 4MYHA 1GP2A 4BECA 2V1UA 1G8YA 1KI9A 4V0ME 2WTUA 1OFTA 4QGHA 4Q9JA 1WP9A 4QBFA 2IXFA 1KIMA 1Z47A 2ZR0A 1XPRA 3GLHB 3S1AB 2O8BA 3PUVA 2FOLA 2WMOB 3QENA 2WWXA 4MKFA 5SZHB 4C30A 5JCZA 1SKYB 2CHGA 3C8UA 1A2KC 4YMUA 1S9DA 4PHHA 4OI4A 2XOKA 3IO5A 4UNSA 1RW4A 4TMTA 1XZPA 5FTKA 1TU4A 4G3XA 3IO3A 5FR1A 5F98A 5J4HA 4IW3B 1XTQA 3KFVA 4Q4AB 4US0R 4WZAE 1Z0DA 2SHKA 2X8AA 3MJRA 5TV2A 2WWFA 1K6MA 3Q5EA 3QIAA 4UNNA 4XOIA 4PSKA 3C16C 4D6PA 2X1VA 5E7IA 1IJFA 4R98A 2C03A 2GZDA 4K46A 1BYIA 3AKEA 1R5NA 3CZQA 4JZKA 3R20A 2ZSBA 1W4CA 4UQOA 4URZR 2PEYA 3NHAA 2D4HA 2Z83A 5A5GA 4CGZA 2J1LA 5FTJA 4C2UA 4LJ9A 4QHYA 3GLFA 1U0JA 4JL8A 3K0CC 4CEJA 4QBHA 2CLCX 1J99A 2JJ8A 3K1JA 1UADA 3WYFA 1DE0A 2ZRBA 3RYTC 3VR2A 1L8QA 4BFTA 4DBLC 821PA 2DPXA 1N6OA 3R8CA 1G8GA 2JATA 1O3YA 2FU5C 2QT0A 4RFSB 5DSZA 2R65A 2YOGA 4HZUA 4Y0AA 1E6CA 4POAA 2QROA 2ZRNA 4LJYA 1I2MA 3K70C 4LUCA 4TQAA 5LB4A 1C4OA 4WVFA 2WWYA 4WZBE 1SVWA 2BHRA 3IILA 3OE7D 2ZITA 2E9SA 3IDQA 1OB5A 1E2GA 2N46A 2QPTA 5BN4A 2DWQA 5EE1A 4M1SA 4Q4JA 4HEJA 4NZYA 3RRYA 1ZU5A 2KJQA 2NO9A 5AUNB 5KDOA 4RKFA 3KQNA 1NBMD 4UNRA 2UZIR 4ZIRB 1NLFA 2AFHE 2J7PA 3CBQA 4P4SB 3AH8A 4LI0A 5B64A 2GCOA 3BFKA 1ESNA 1E2QA 3A1SA 1P2UA 2ZETA 3GD7A 4FINA 2QQEA 4HI0E 3FDIA 3Q3JB 3THOA 2ZU6A 4JKIA 5FOVA 1FZQA 4M1YA 2G9NA 3LQRA 4F38A 3GEHA 3EASA 2J0VA 1XD8A 1E32A 3QKUA 2FMXA 3SBEA 1VIAA 2YOFA 5EP4A 1N6RA 1UKVY 2YZ2A 3CRRA 2G77B 3CRMA 3R9XA 1S3SA 5EE9A 3FHOA 3AF2A 3BFXA 3FE2A 4KBFA 1DAEA 2GESA 3SNHA 3ZIAA 2H7VA 3ZQJA 5FPTA 3IBGA 3OESA 4GZLA 2QSYA 2O8DB 3K9LA 2ATVA 5J4KA 2HYDA 1OXSC 1GVNB 3RNLA 4EJSB 1G8PA 1PLKA 4G01B 4KSCA 1E4VA 2C2HA 3R7WA 1AGPA 1MR3F 4TSFD 1GL6A 4HZIA 4ACBA 3GJ4A 5FR2A 3ADKA 4Q47A 5FBRB 3W8NA 3FVQA 1W2HA 3BB1A 1JQLB 1ZMXA 4FWIB 3TVDA 2GXSA 3U3OA 4BLSA 4KLNA 3IHWA 3O8RA 2BJVA 1OH7A 1ZU4A 3CO5A 2R6DA 3EC1A 5IRCD 2IWHA 4RD0A 1X1SA 1E0AA 2WV9A 1DOAA 2IYSA 5HCNA 4A36A 4GPTA 3RAPR 1PVOA 2MSEB 3NH9A 4YXWA 4TLDA 1GRNA 2PEZA 2FDCA 2HT6A 4GOKA 1Z6YA 1N0VC 3KKNA 3SJAA 4UXHA 4DLZA 4A6XA 4L16A 1VTKA 2BMJA 2OCBA 4DT1B 3WMEA 2NTYC 2VHQA 3QUSA 3GPLA 4CZ2A 2VSOA 1W0JA 4QG7A 4TYPA 5EP2A 6Q21A 4KFRA 4A0GA 5EE0A 3MRSA 3ZGXA 1IXRC 1R7RA 2ZI9A 1E2KA 1E9EA 1TF2A 3CH5A 1ZNWA 2P3SA 4GNKA 3VFDA 4OHWA 4MRVA 4M53A 4ASUD 1Q3HA 3PUXA 1M74A 1W4RA 1DAMA 3A4LA 4JJKA 4LZZA 1ODFA 2XJ4A 1EFUA 5CDFE 3GLGA 4U02A 4K8OA 5DNYB 2VF8A 1MO6A 1RZ3A 5CYOA 5LDDC 5FPYA 2BOVA 1J8YF 3B2EA 4LBYA 5FBLB 1P75A 3THYA 1KK3A 2JJ2A 3GJ6A 5LD2B 1W0KD 3L8ZA 4IVRA 4LBVA 4V03A 4BFXA 2QORA 3TUIC 1T3SA 2IYVA 2GJSA 2GEUA 2GZAA 2AKYA 2CBZA 3I8XA 2O8CA 1Q44A 2ZR9A 3RRNA 1MABB 2WWWA 4I1VA 1AN0A 1E2FA 1BKDR 3B1ZA 4JYCA 5C1BA 4FW9A 1G7CA 2EFHB 1QRAA 1SXJB 4PX9A 1XXHB 2GILA 4CRWB 2ZQ5A 4NMMA 3UWOA 4RVCA 5EZ6B 3SEAA 3DKVA 2K5UA 1KK2A 4B3DA 3U7EB 2H57A 3L8YA 3LY5A 2G83A 1DG3A 1Z0JA 4HAUA 3BS4A 3RRZA 2FSHA 1A82A 1E9BA 1IN6A 1X8KA 2UZ3A 4KVAA 4B75A 2RGCA 5KTYA 3SHWA 2GNOA 1II0A 2GF0A 1SULA 2NGRA 5FFMA 2WIBA 2C95A 1ELOA 4TT3A 3HPRA 2GEDA 5FPKA 2XXAA 4TLBA 4YMSA 1VYTA 2XOKD 5BQ5A 4ITRC 3H4MA 1QVAA 1G7RA 2REXB 3IBYA 3FGNA 1GFIA 2OBMA 4LHXA 2IS1A 1E4YA 1D5CA 2IYLD 3IQXA 2BBOA 2FPLA 3NKVA 1Z2AA 1G3UA 4I81A 3T1QA 4LHZA 2MMCA 2EVWX 3NEJA 2OEPA 3WNCA 3O8DA 3AVTA 4DJTA 4V02A 5JWOA 4IOJA 5LB2A 3AKCA 4Z8XA 4PC3A 1J8MF 1IBRA 3FYHA 2HF8A 1XCMA 4NHOA 3ZVRA 5K8LA 1SHKA 1COWA 3HP1A 3O8CA 3QSYA 1NMXA 2WBLC 5BWMA 3TK1A 2ZSEA 1P6XA 3UIEA 2D2EA 3K9GA 3IUYA 4GT1A 1ZAKA 1EESA 1R8SA 2OXRA 1SXJE 3TAUA 2ZJZA 4MKIA 1IM2A 1HUQA 2GJ8A 4HAVA 2OFWA 4IOKA 4DCSA 3FFAA 2WSSA 3C7KA 3X2SA 3T15A 1GOTA 4PPFA 1W44A 5BYJA 4B3GA 4J0QA 1G4AE 3B9PA 4O2RA 4ERNA 2QA5A 4DDTA 2IYWA 1G1MA 4QHSA 2XITA 3N2IA 2RB4A 5DO9A 5FUYA 1UBFA 4ZO4A 1G9XA 1KKLA 4F4IA 2CDNA 3GJXC
chains in the Genus database with same CATH superfamily
1M54A 1P1RA 1BFKA 2H1CA 2JBWA 2PJDA 3MWFA 1VCMA 4DAEA 3T3OA 3JRWA 4KXWA 3WLLA 3HBFA 2JGEA 2XBMA 3IQGX 1L8OA 5KJ1A 4TTAA 2H52A 4P54A 1V25A 3K9QO 1E9AA 2JDID 3RC2A 3EPHA 4IMIB 1GYQA 2QJTA 2KLBA 3AUUA 2CLMB 3IOMA 4R05A 3ZS8A 3I92A 4H7IA 5B6IA 4N0PA 3QXJA 2QRPA 5C80A 3NRJA 7MHTA 2H1SA 3BORA 4RKQA 1FTNA 3H97A 4HP8A 1PZMA 1WZCA 2YV5A 3LG2A 4WNAA 4N3AA 4M87A 1EBFA 3RHFA 4Q7EA 4DSUA 1GYPA 1EHCA 3EQ2A 2D1QA 5FXMA 2QT9A 1ISIA 5T3UA 3UICA 5C8ZA 4B3FX 2JLUA 1RRMA 2RH5A 3UK7A 1DQNA 4HLCA 4IXTA 1VOTA 2PUVA 4RKWA 1OLUA 1ULHA 5DHAA 2OFFA 3ZCTA 1RHRA 5ERGB 4D0GA 3G2IA 2PQ2A 1JNXX 3TGWA 4PPNA 2AD1A 1CY8A 1HFKA 1H5NA 3K8QA 1EB9A 4RW0A 3HR4A 3JWHA 4HBZA 3UT5A 4L8LA 1OI3A 3CSDA 4GLOA 1YDFA 5D3KA 4ZU1X 7ABPA 1G8FA 3D6HA 3GT0A 4FW8A 4Q39A 1RXSA 2PCLA 1A0OA 3TIXB 2H7YA 3KJHA 4M0PA 3UC9A 3N28A 2G63A 2Z30A 5LJIA 1VFNA 3JPWA 3U19A 2H11A 3SYNA 2G9UA 1V48A 3ROGA 3NANA 3OKAA 1WQ1R 2QLBA 3VZDA 2XNKA 3DE1X 3TSWA 4Q16A 3AERA 1ZFNA 1R37A 3FYCA 1XWWA 1C1HA 1V16A 4EB8A 1HPLA 1NXQA 4RTJA 3GRKA 1A7KA 1W85A 3EIFA 4M7PA 4RSGA 4BVAA 3JSXA 4CR7A 3DZ8A 4EGSA 5CD9A 3LY7A 5LU9A 4LWOA 1CQJB 1ESZA 1OQAA 1QIGA 1Z6QA 2JAOA 1O9BA 2SCUB 5T6MA 3ZVLA 3LBNA 4TVOA 4Q7KA 4EKYA 3TWOA 1T5HX 4X94A 4O8CA 2HCTA 3K32A 2XRMA 2K6GA 2O3TA 3ITEA 4BFYA 2QLNA 2XGMA 2POCA 4OIFA 2PLWA 3HB9A 3KPWA 3PP8A 4HR7A 3WQQA 4F4DA 3SKXA 3V1TC 3R76A 4EFNA 2IWRA 5KU7A 3R3UA 4DV1B 2VF7A 1J0CA 4CKEB 4LPKA 3SXJA 2CL5A 3W2HA 4I2VA 2YFYA 1Y48E 3ESRA 2FEMA 1PD1A 2VT2A 3INGA 2M32A 3PR1A 4MLPA 5IM4A 3HSKA 5KTRA 1MOZA 4QWWA 2X8JB 4UARA 3KZOA 3O0TA 1KORA 4XM2A 5JAQA 2W2LD 1AKWA 1OWOA 3A6HA 5TQ2B 4EM6A 2D5AA 4LN1A 2RH8A 2OLJA 4ZKDA 1O03A 1KMHB 4ND2A 2HW8A 5CX1B 2CV0A 1Z2CA 3GPDG 2RI0A 4D9MA 4TYWA 1E60A 4PS1A 4PYMA 1JEAA 3ILSA 3QFTA 4YP0A 3BD7A 1TLLA 2I2AA 3T9AA 4L8GA 3VTKA 5CH8A 4RYLA 1V39A 1V8PA 2L17A 4P98A 2NQ8A 2PMKA 3KOYA 2A1UA 3KYBA 4MPRA 1E1KA 3EYWA 1TK2A 2GUGA 2Q6VA 3OQJA 1ZXBA 1QG6A 1KAGA 3BIWA 4KR0A 4UC0A 4R71A 3WADA 5L4LA 3LY9A 3R09A 2OHOA 3AFMA 3P5BA 3K5WA 1J25A 2C82A 3V3KA 3ZEAA 5CFQA 1KEVA 2PUGA 3ZHTA 1R6BX 3RVPA 2XF8A 1FOEB 1W73A 5FAXA 4BNVA 4QJ3A 1QDUA 3TQCA 4CUZA 1LLDA 1AF7A 3CC8A 3FMPB 2Q5EA 1N25A 2CNKA 3IESA 4LNAA 3L6CA 4HUQA 3RYFB 5CDSA 1SVUA 3G0DA 5K45A 3USCS 1QHNA 1NGSA 2FQXA 2DUMA 2XT0A 2XVMA 3L8CA 4S1VA 3V6LA 1MT0A 5T8KA 1LSUA 2GPWA 1T9GR 1YJQA 3FVRA 2F7SA 2AFIA 3BK2A 2PVPA 1A77A 1NTOA 5U1PA 4U7DA 5FDFA 1OASA 3W8DA 2EFDB 1F2TA 2VWPA 2XUAA 4GFDA 3GLIA 13PKA 3SJCA 1JIVA 3UPTA 2IELA 5B1SA 4PG5A 2YMMA 4P5PA 1NN3A 2QM7A 4B2PA 5BT9A 3S28A 3SCZA 2XZOA 1PN3A 5CNMA 5TY0A 4R3NA 5HBGA 2ZZKA 4U8HA 5IUKC 5C9ZA 3E70C 4TT3D 1GDHA 1Z38A 2J3JA 1KJWA 3K1TA 1CDOA 5DTMA 4L4ZA 2F2TA 3L7CA 5ARBA 5AVZA 2W6PA 1FP4B 3MGKA 5BOVA 3RIMA 4PO8A 4K9PA 4KXQA 5AKGA 2QRNA 2IBMA 3QF7A 1AGXA 1HI9A 1ES9A 4UM5A 5IKMA 1NDUA 1JTEA 2A6PA 3RG2A 1YZGA 2PAFA 3PXDA 5B53A 5ALGA 4MWCA 2ZAOA 2B6HA 3G5LA 4ZCIA 3KQQA 4X3OA 5IBRA 1TYAE 5BRNA 1IOWA 4D79A 4QXMA 1TKBA 2B82A 3SY8A 3TR6A 1QHSA 2FSVC 4A8JB 4IHJF 4UAGA 4BP3A 1DRWA 1T4MA 1ZN2A 1U1FA 4AC9A 4FKBA 2YJZA 4O4LB 1KS2A 1FS4A 2E49A 1ZKMA 4XLTA 3S27A 1RYBA 2X19A 4GDMA 2OPBA 3W6PA 4L3OA 1FDWA 4LOIA 4OJTA 4AY4A 1F8XA 1N2EA 4IVQA 3VNUA 1F2UA 1N4DA 1E20A 1YL5A 2AF3C 4AMVA 2CUNA 1DELA 2O52A 3K1AA 3K8OE 1SXQA 4B6JA 1QGED 5JRZA 4DCCA 1UJCA 3LZ6A 1MRZA 2WHPA 5HZKA 2RHTA 1FU7A 2BE9A 3DDNA 3R3ZA 3Q7QA 1QLJA 2IJGX 4M7RA 4OHFA 4EEKA 3ZGVA 4FOSA 1LS1A 1W5TA 1NJ6A 2IEIA 1ULAA 1JKFA 1V26A 3E2MA 3H9UA 3L41A 2HNAA 2OXFA 5EA2A 2P9BA 1QHXA 4DIBA 4HDKB 1SUFA 3NHBA 3L0OA 3HBAA 3M89A 1EP9A 2RJ3A 2P0EA 1QO0D 4DADA 4DUYB 2OKGA 1GNRA 1TK3A 3HUEA 3HMKA 3TLJA 4BVFA 1OFIA 4A23A 4F46A 1QO9A 1KP3A 1ZUNB 2EL7A 2J3LA 2X5OA 2FUKA 1QCZA 2B9EA 4YT4A 1OZGA 4MDFA 1EUZA 3IDFA 4CF7A 4XKJA 3UWPA 2H18A 4DDVA 1W0CA 4RD2A 1G2OA 2Q46A 1A88A 2W6JD 1XQWA 2XB4A 2ZR7A 1T2AA 3C3YA 1PUIA 3MFQA 3PGA1 3QF4A 4NV1A 4BO2A 5H16A 3THXB 1SVNA 3ZQKA 3NVAA 3EXHB 1DC5A 4WNIA 3E7PA 3RSQA 3RVLA 4E51A 2IH4A 2G72A 3OJLA 4H0NA 4D4JA 1XZQA 3OIWA 3BJIC 3DFUA 5DI3B 4I19A 5JHHB 1VE7A 4B35A 4AKTA 4FFNA 1W46A 2HMTA 2QP3A 2X3FA 4ZI3A 2PRIA 2Q3FA 4AJEA 4OFZA 4HNQA 2EKLA 3AR4A 3H5OA 1C9JA 1GGFA 3U1TA 1UKZA 2QPOA 4DIEA 1W36D 4HAIA 3QSGA 3NIFB 2FUCA 4CF5A 1SU8A 3OEHD 1W5BA 2CXNA 1EVIA 3IIMA 3KYJB 1FRVA 3QUQA 4FSDA 4JY7A 2RGGA 5EZSA 1TXGA 1EK6A 3LT4A 4MVXA 5FBKA 1Q0QA 3RAFC 2GT1A 2RHMA 4MKGA 5K03A 5ALPA 1WSAA 2QTBA 4JQCA 4JLNA 4G4SO 4OHCA 2NVWA 1SU7A 5IEJA 2XKKA 3LBYA 1I7SB 1FBTA 1HBJA 2NXEA 2H1LA 1MEJA 3MWGA 4QQKA 4GPAA 2PIDA 2BRUA 4X71A 3DONA 3U1VA 4ESHA 2BHSA 1CEYA 3KKQA 3ODGA 5EVJA 2ZYTX 1ATZA 2J5BA 2FUG6 3FW1A 1OD6A 4RD4A 2JD2A 2H1HA 2XNCA 1XNJA 5HIIA 4YJGB 2I8CA 2X0DA 1ZUWA 3JQFA 3TYXA 1O4VA 3B3JA 3DOOA 3MGAA 3K92A 1W5EA 2FV8A 2Q50A 4KDFA 4WY5A 3UF0A 4WACA 5BMVB 2XUQA 5JJCA 3QU5A 2UXBB 1T2DA 1GFSA 1H22A 1R0BA 2QP9X 3CSSA 2QN1A 3I2GA 3MF4A 4KSBA 2E85A 3L93A 4LMBA 4QGAA 5CA1B 5I9NA 4Z9YA 1LGYA 5LMNB 1VG0B 2VDJA 2G6TA 5LYYA 4DVJA 4KE9A 1RQRA 1ZGAA 3ILVA 1UODA 5JLAA 1E58A 3C3JA 5EG5A 3KKOA 3JQAD 2OP0A 1EQ2A 2QRGA 1U8AA 3HL4A 2XX3A 1UP4A 3EGWA 2HF2A 3GA7A 4KQ6A 3AP3A 4HSGA 3SQMA 5IFLA 1A7UA 1KYTA 1I0LA 1WRBA 2W4IA 1E7SA 1EZ4A 1VLQA 3R3YA 1SCDA 4BLUA 5AK5A 4BNUA 4RBNA 3I5MA 2UUPA 4H3SA 5AW5A 3V8VA 2C7GA 2NOAA 5TC4A 3UAYA 1O87A 3EUEA 2FE1A 4QELA 3UG6A 5BNWA 4BGDA 3E82A 1FUIA 1C1XA 4KX5A 1KSFX 4G56A 3A4NA 3E9YA 1QFZA 4XX1A 2WM9B 4KFCA 2O7RA 1I3NA 1O95A 2GXQA 4DVGA 3JQPA 4YT5A 3AM4A 4BRZA 1JRLA 4UUBA 3FBWA 5EQFA 2P75A 3TQRA 4HNVA 2JIBA 3AXSA 3L1IA 1JE0A 5E9WA 3TJRA 1MOQA 5B36A 2KE5A 2AX4A 5F2NA 3BBLA 2B92A 1DQZA 2O0MA 3EXEA 1KTIA 3K1ZA 3R6DA 2ASEA 3EISA 5ELXA 2ORYA 2QUKA 4UPEA 1KTVA 3CVUA 1E1NA 1EVQA 2GK3A 3BQ9A 1CZOA 4UUMA 2NLOA 1HYQA 2ZSJA 3B85A 1KS9A 3WZLA 4LF9B 5BV2P 3HB7A 4WZBB 4OV6B 4Y7CA 1EE9A 1ZMRA 1RNLA 3VZRA 3ZDXB 4QFDA 4S3MA 3BWBA 3OZRA 1AMNA 5CLHA 3C41J 4RIHA 4WVLA 2BGTA 2FZCA 4D9GA 1JAIA 4JB2A 4PYOA 3VPCA 5KUTA 3INNA 3ZHXA 3SS7X 2JFNA 3VOSA 4BMYA 2VPTA 1TF5A 2CC2A 3PFCA 2QE6A 2XOEA 5IHXA 1DEKA 5FOSA 1MAUA 3T7TA 2FVXA 1KQ3A 4NFSA 3IP5A 3WBBA 3AEUB 4BBJA 4OYHA 1T36A 1KETA 5EXPA 3ZC3A 3KKZA 4HBGA 3T1OA 2A30A 3TSZA 2H2AA 3DYBA 1XTPA 4CMAA 2GARA 1E2IA 3JQBA 1NZDA 4O4IF 4PVCA 1UFQA 2XCTB 2PT9A 1UKYA 4KIGA 4QOSA 1CY6A 4UATA 4HNSA 3NUQA 4EW3A 2FWRA 2LR0A 1RPJA 3PWSA 2FOXA 4QPJC 2YZNA 2Z4TA 4I08A 1GPNA 1Y82A 1PG2A 2Z1DA 3D1JA 4IKPA 2JHAA 4G1BA 2UUOA 4BV9A 3F5DA 5A2GA 5DCLA 3VPDA 4WGGA 3VMMA 4QTXA 4ZCPA 1RAGA 1UXHA 2FEOA 1VDZA 2IX9A 1PBTA 3RKSA 3T3NA 5AHKA 2ZUFA 1J9GA 3EGIA 4AD8A 3SZGA 4HWSA 5E1MA 1Q74A 4D43A 1BGXT 3H1FA 2C07A 5CB4B 1W19A 2RGUA 4L9WA 3SXUB 2ZB7A 3G8CA 5CDHA 1VMAA 4CLDA 4CT4B 1UK9A 3DHEA 5AHWA 5KTMA 3KT3A 1YIAA 1ZK4A 3DM9B 2YYAA 1QZTA 4JOSA 1UH5A 3RARA 1IMOA 3B6EA 3EOBI 4IY1A 4CW7A 1ULUA 1XHFA 5HPYB 1JYSA 1E2NA 4DUPA 5KWVA 2EG9A 1DAGA 2ZRFA 4DILA 1JZQA 2PNJA 1T15A 2JIDA 4KOAA 3DO6A 1XTUA 2G1PA 1C8LA 4ZAVA 4RL4A 2R68A 1LDMA 3LHKA 1B6TA 2IOFA 2BISA 4WPGA 3TZEA 4EIWA 2G1JA 5FL3A 1NG1A 1UJBA 4BNZA 4BNLA 2QLLA 3WMXA 2XCSB 1E9VA 4WCFC 1QSGA 3GH1A 2CLOB 4JI1B 3RROA 3TNDA 4HJRA 3N8HA 3CG0A 3TTWA 3H8VA 1PZFA 1RIIA 3DZBA 2Q7DA 5JDIC 4LE1A 3II6X 4YRQA 4JLBA 5JSZB 1K7YA 2Z2IA 1OJLA 3B82A 1K6IA 3KQSA 2F3SA 1XKLA 2P2CA 2H85A 4EOGA 4R68A 4MRAA 5TXGA 1WW2A 4YH1A 3R9WA 1W36C 3PJDA 2CNWD 4I14A 1VPDA 4FD2A 3UA4A 1NHGA 3IB3A 1P8JA 1H65A 2ZEJA 2IITA 3CNLA 5ELLA 4XYBA 2BZSA 3JYOA 1GPYA 1G5HA 2KYRA 2OY0A 4U2EA 3H3XA 4F96A 4C0XA 5DNCA 2GQ0A 3QXCA 4I5DA 1MF7A 1TKCA 3WHIA 3HYNA 4I3FA 3DDHA 1W2GA 1T9ZA 3I6IA 2DPMA 4C89A 4CUKA 3TLXA 1T2FA 4FQ7A 1WUIS 5E1BA 4MKHA 1KF0A 2MJLA 4F1WA 3DQZA 1T10A 1YKFA 1YOBA 3OCZA 4E2XA 3RS3A 1ZJ5A 1ENZA 1VE1A 5JHGB 3KSBC 3MMSA 4UVGA 3C15C 4ZC8A 3IPAA 3ZDCA 4F92B 4FE3A 4CPDA 1RKXA 3L40A 3L0SA 1JXMA 1PJRA 2QEQA 3H3FA 2C88A 4HY3A 3OQPA 1Q5PA 4IBOA 4KBGA 4EB3A 3ZBQA 2X4DA 2JF0A 2C3PA 2Q1TA 2Z2JA 3BGVA 3FCSB 3V6MA 4E46A 4GX1A 3O8OB 1MRNA 2BFFB 3JX9A 1NYTA 2W2NA 3F49S 4ZU6X 3TUZC 4BY9E 4OHKA 2PGOA 1J22A 4AZVA 4RCZA 1X6VA 3IQZA 4EHJA 4D4MA 4QNMA 3T7JA 2YNMD 3EVCA 4P4NA 3UYKA 2GN2A 3HN6A 2VEOA 4O33A 4R84A 1OA0A 1BJRE 2F9MA 3EZ2A 1T24A 2D5IA 1E8DA 3H99A 4IIJF 3LFHA 3K72B 2O4CA 5HG0A 3K6SB 1JSCA 2VPIA 1F3LA 3A1UA 4XQEA 5IC5A 4INZA 1VBKA 1KZGB 1VE9A 2IEGA 3ABOB 2EEPA 4ZHQB 3TSOA 4RVNA 2YXLA 4OP1A 1XPJA 3OIUA 3ZKAA 1VYVA 1B4DA 1J39A 1L5MA 2ZSAA 1LW7A 3OIFA 1LI4A 1EAMA 4GR5A 1U94A 4QXPA 2TMGA 3F4KA 4YJGA 3IODA 5C3UA 1N5IA 3SQNA 1Z29A 4ENPA 4CNQA 4FB4A 3EW9A 1MXFA 5FUMA 3D8RA 3DEZA 5CJJA 1I36A 2CZCA 2VHVA 3UWDA 1PYDA 3NWEA 2Q29A 5JAIA 1EU1A 2FMFA 4LJSA 4B6PA 5EKSA 4WJZA 4HD8A 3LYUA 5CA1A 3D0QA 5EQTA 2O8FA 1HA3A 4HX2A 4XYGA 1JALA 3V4FA 1NYQA 4F4HA 1EFCA 5B2EA 1AQIA 2A0XA 4G5XA 3BTSA 2R8XA 1C3LA 1V3TA 4OCZA 4LJ7A 1UBUS 4RY9A 1JI3A 1XTRA 4MRMB 3U7JA 5C8VA 5IC4A 2C8LA 4JC5A 1Z0KA 4FJ1A 5AVQA 1WMBA 3SPXA 3UWSA 3LDAA 4TL7A 5J2TA 1YE8A 1KWKA 3WDSA 3Q40A 2CLDX 3TTVA 2VR1A 1DEXA 1ZH6A 4D4LA 1ZA2A 3OA0A 1RC1A 5CXQA 3AVWA 3PITA 2YHAA 2XR1A 4EH1A 1HQCA 2J9RA 3RNOA 3U13A 3VR0A 3FDZA 1KJ9A 2ADOA 2OBXA 3EQZA 3GLHA 3I0NA 4LDPA 3S1AA 1VL2A 4B6GA 1RM3A 2YJ3A 2DHEA 2GBFA 2QYSA 1N3BA 3PF8A 1NVBA 1JMKC 4FM9A 1FSPA 3PUYA 4NABA 2QX4A 2WT8A 1JEYA 4EX7A 1Q84A 3HE3A 3ZIDA 1JL3A 2FSIA 1WVMA 4J1TC 5TDHA 2IDJA 2PZ8A 4BXOA 1X1RA 3B1FA 2BY4A 1KP9A 4YUVA 4PICA 3AVVA 2V0NA 4EA6A 3WYEA 3H9JA 5BSFA 3RV4A 1HC7A 4J43A 2X1LA 4Q4AA 1KE1A 3VKHA 4IUYA 1S2NA 3CKKA 4QUAA 1JFVA 3LUHA 4ZV7A 1X8LA 3ECSA 1N9ZA 1Z5UA 2EZ8A 5AVTA 1H5QA 4IUDS 5LP6A 2VNHA 1XEWY 2DYKA 4PW0A 1KOGA 4KW7A 4JGBA 3LK6A 2GF2A 2YVLA 4Y2YA 2OAEA 3ZY2A 3OX2A 3Q0TA 2PKQO 2JFFA 2BF7A 1YOVA 2P4UA 2VA9A 4JUAA 5LUBA 1D07A 2H2HA 3I2FA 4EGJA 3HVKA 1Y5LA 3DB1A 2ODNA 3CFYA 2G4VA 3UZUA 3CM0A 1EEHA 1SHJA 3GT3A 3MELA 2YJ5A 3CIFA 5CVEA 4FQ5A 4YAWA 5A9RA 4ILKA 2GLUA 1YZHA 5HE8A 3EFOA 2C77A 9LDBA 1Y1QA 1IY1A 2DHQA 3VO2A 3JZMA 3EC7A 5K0EA 5SY6A 4HPXB 4GQIA 3A27A 3DZKA 1U8FO 4JP8A 1R2QA 1RWKA 1E1QA 2QAGC 3TZHA 1LV8A 1TO6A 2HOQA 1IN4A 4R16A 4TV8B 3HCPA 4PFJA 3PQ5A 3UFBA 3I6BA 3DOUA 3PE3A 1XJQA 2AYYA 4RFSA 1QIEA 3PQ2A 4M36A 2A9JA 4P3XA 5AM1A 2OBYA 2BT4A 2VG8A 2ZSFA 2DBYA 3LHFA 2Z1NA 2IUYA 2IGBA 4M0LA 4TQGA 3FCXA 3QITA 2C04A 3ZHVA 4CF4A 5CB4A 1NWHA 5DLQC 2XYRA 5ICSA 4FKZA 1DL5A 4LSGA 1NBAA 3SXUA 3W4JA 1D1PA 1SIWA 3K9BA 3OZ7A 3DE7X 2CVPA 1JV2B 3QKWA 3V32A 4A8TA 2JCBA 5J4VA 3A3KA 4AZWA 3FI0A 3EPLA 3WLIA 3HRHA 4N1AA 5GV8A 1FCJA 4RF5A 4JL5A 1ONPA 4KHZA 4EUEA 2PVCA 1TRKA 2FY8A 4QYXA 3TPZA 1D6NA 3A6GA 2B2CA 3LIPA 3M1IA 4S1NA 1MNQA 5F1KA 1M6WA 1MJ5A 4PZEA 2HF7A 2FQWA 1E99A 2VDQB 5KO2A 4P4SA 2Z8ZA 1NQWA 3RTAA 4BUJA 4M0CA 2VLBA 3VMFA 2PWZA 1WKBA 4K9MA 1BS9A 4FGZA 1DI0A 1VXOA 3ACDA 3PXGA 1GILA 3URKA 4DANA 1M8PA 3IBSA 2H1VA 2XUOA 3D8TA 3OCWA 5JMWA 4EA8A 2HQRA 2ZVJA 4PFQA 4JHLA 5JSZA 1RADA 1G3QA 4TL9A 2CK3A 3AY3A 6PFKA 3MXOA 3EVAA 5D84A 5JFTA 1A9TA 4OSOA 3MOIA 1XTJA 4P0TA 3U4CA 3S55A 4H1HA 2DHRA 1IHYA 1IVYA 5COAA 2ODEA 3N1UA 4MYCA 1E0DA 2YYSA 3L6OO 3GLUA 5DYIA 2P7IA 3SI7A 4BRSA 2NMVA 1NONA 2A9QA 3CKYA 3F74A 4NJEA 4LGYA 2YNMC 1S5PA 4JT2A 3H18A 3NBKA 1VA5A 3QKTA 2W37A 4UPVA 5KVCA 2R87A 3S6JA 3CKMA 4QQFA 1PE0A 2KBFA 3F2VA 3OY7A 3EDQA 1CUVA 1MO5A 1ZCJA 2JCVA 3T7SA 3A28A 1HDGO 3CF0A 1GQFA 2XEXA 2WAMA 2WEKA 3V1NA 5F12A 1TIBA 3I8SA 2LNDA 1YQGA 5G40A 2ONZA 4RQBA 2DBQA 4TUYB 4EQ6B 2OBNA 2PU5A 1DQRA 1DO2A 1YB5A 4YRAA 2OD9A 3LUGA 3BIFA 3B7GA 2FP3A 2IE0A 4RD6A 4TZTA 4UM7A 1M8KA 4C3ZA 1WBBA 1QJ4A 4MQBA 3R7BA 5J58A 1U7XA 2VAMA 3O8OA 5J9FA 4DIUA 3L8EA 3UJDA 2BDTA 3LCVB 4C0KA 3GJ3A 2Q3CA 4AJ1A 3WLQA 3CUTA 4LV6A 3LU1A 4MV3A 2UXCB 1Y6ZA 3KM0A 1DPFA 3TECE 2BD0A 1JEQB 5CK5A 1HSZA 5AVSA 1AD2A 1GYRA 1UBEA 3NG1A 4DJJA 1JIJA 4TYYA 1DC7A 3CN7A 1XR3A 1XCBA 1BDMA 2E6KA 2V55B 3F8WA 3PRJA 5AKKA 2EJUA 5AMXA 4ZHQA 3R6LA 1MO4A 4D9NA 3ZCRA 1NJ2A 1K9VF 1P33A 2XCLA 4K9NA 3TAXA 4C7XA 4C7MA 5BSWA 2FWPA 1LVGA 2OFOA 4L7VA 2LCFA 4QQ8A 1PJCA 2FSFA 2Z2XA 4KQKA 4Z99A 1CR1A 1D9XA 5DMXA 4CL8A 4QC2A 4NAVA 4BPBA 2J41A 4GMGA 2XUKA 4ER0A 1X1QA 4DWWA 2PZKA 1XDGA 3KVNA 4DMLA 4IKEA 2HSGA 4FEYA 1QAQA 3OA2A 2BCJQ 4Q15A 1DC4A 3IAEA 3YASA 1B8UA 3F6EX 1I6WA 5EERA 4ZQHA 1RT9A 3H17A 3OPQA 1LJUA 2R8RA 5I47A 3IVMA 5JNSA 4EVIA 4RD1A 2ZE8A 3FFXA 1S02A 1CXZA 4MRMA 4MV6A 1I7PA 4PC6A 3UVEA 1XF9A 3WMFA 1T5DX 3LUPA 3DOHA 4L75A 2PT6A 3ETDA 4MQ4A 5CM9C 4ZV9A 1GQOA 2YIDA 3F4LA 4MJ3A 4QBTA 3ZR4B 3IP6A 4ND4A 2VUSA 5C2JB 3MJFA 2A3RA 2HV8A 4W7HA 4WKNA 4XWWA 3F1KA 4ZVMA 5LVAA 4OFWA 3ERCA 4M88A 1GSOA 4AY5A 3JD4A 1HSOA 2R62A 3ILHA 5K3EA 1DKMA 1CUBA 1ZBDA 1ZYUA 3KTAB 1U90A 1OGJA 3H9GA 3PC7A 4G85A 4MB6A 4PLFA 1S9HA 2CLIB 3UKJA 2YJ4A 2NZJA 4KLRA 1CS0A 4EEXA 4J4TA 1AZWA 1HYHA 4WD3A 3VYVA 1BDBA 3ZS9A 3CVJA 1RFGE 4FONA 4IEIA 2W8BA 2NXJA 1A8QA 1UBLS 4QG3A 3GMIA 3LWBA 1G64A 1DAFA 4ZHSA 4E2ZA 4AJOA 5JAOA 4R6XA 3MUOA 1BDIA 2PGNA 3PVSA 2I7TA 4IPTA 3QFCA 1Q11A 1LDBA 4LYAA 3W5UA 1EUCA 4KREA 3JD1A 2EBFX 3QWHA 2PBFA 3IEIA 1JG6A 3RS9A 1WXEA 2ZXEA 3ULKA 2ZUWA 4MS4A 1CP3A 1YIDA 1N0IA 2HU5A 2ZI5A 3I01A 2H2FA 1MVLA 2CL7X 3I1YA 5CIWA 1FNSA 5FLEX 4UQPA 5TS3A 4LXQA 1EZ1A 1RM5A 2Z5FA 4IZOA 1UPTA 4O1IA 1PL7A 3BIJA 4KITB 2V65A 4I8XA 1SZDA 1ZM9A 3W2FA 1WE2A 2XB6A 1Q16A 3UJPA 4QU8A 1P6UA 1QIHA 1ENOA 4IIEA 1U1GA 3K5HA 4P53A 2PUFA 1WCWA 1ZEJA 4MI6A 3RRJA 5JTTA 1UZMA 3EFBA 4XCVA 3EF1A 1IUOA 1RYYA 1NOKA 4YJ2F 3NFYA 3NRBA 4UKDA 4V0QA 2ZI4A 2J07A 2Q3EA 3KJEA 4TOIA 1CLEA 3JSAA 4F56A 3NAGA 2BL4A 3L0DA 5B55A 1YK0A 4A2WA 2I3DA 1YCGA 1ZVMA 4HAXA 3SHFA 4LVOA 5ITWA 4B2IA 2YICA 1DEHA 2ERXA 1G1AA 4DCMA 3I4CA 2AMJA 1AJEA 3C6YA 3K2QA 1E79D 4UZSA 1H05A 1N6HA 4Y1RB 4AS3A 1TVKA 4CM9D 4K0KB 2FHPA 2BKLA 4K81B 2EIHA 1VE6A 4QJ5A 3TO5A 1OI4A 2Q6KA 5H0IA 1L7QA 3LOPA 3FF4A 4TTTS 4I4TA 4F2WA 1L5LA 1U63A 3A4TA 4RV5A 3N8KA 2J0SA 3O1HB 3FMGA 1PLLA 1WLSA 4Y9UA 3S2EA 2PQMA 3R9XB 2PXAA 3MUFA 3HV0A 2WJHA 3RSOA 4OQEA 2FR0A 2P9TA 5GONB 4A0HA 1Y6RA 3BTUA 4YDSA 3ZJUA 2FRDC 1SWVA 1YRAA 3AF3A 1CE8B 4FOLA 4X24A 5IAKA 3RDPA 3ILXA 1FDIA 1Y1SA 2CBXA 2PO7A 2R7MA 3IBCA 3DO8A 4FMDB 1KYQA 3LUJA 5ALXA 1CY1A 2QX9A 4OM8A 4M54A 3VHLB 4B83A 5A7FA 4L5BA 5LYJF 3ANNA 5JQGB 3DTVD 4Z0HO 4CV0A 5IBCA 2HSEA 1Z0ZA 3K2EA 5F7XA 2ZDQA 1JFSA 1IY2A 1XEAA 2H16A 4IS2A 2QXUA 1M8FA 3LLVA 4FLEA 4KQGA 4HEHA 3GRVA 4W9NA 5M04A 3HEMA 5EWJB 3B6JA 4CM9A 5DTQA 1LF0A 2ZBPA 1QPGA 5LBUA 2VAVA 2P1DA 3T5TA 2OA0A 2E48A 5E1DA 1QC5B 1HYEA 1TM2A 4BQPA 5FBVB 2P69A 3LPLA 5I4BA 5BSEA 1E0KA 3PEEA 2GTPA 3F1LA 1P45A 2XMCA 3IYLW 4M8NE 2AUNA 4NATA 3UC5A 521PA 4CEHB 3UGJA 1EK1A 2OO7A 2W2KB 1FNBA 1I30A 1P7VA 2PS3A 2J7KA 3EODA 3GHHA 2O3JA 2X6RA 5AHOA 1GM5A 2WU3A 3TIVA 3T9FA 1Z39A 2QENA 3CVYA 2V96A 3ZOKA 4EDHA 3CU5A 1XBTA 3L1UA 3PCTA 1NA5A 4MW0A 3X1YA 4B17A 2FSPA 4DGQA 1YDWA 3JWIA 1MT3A 1JT2A 4HFRA 2ATEA 4TUYA 2HRCA 4WUTA 1KEZA 1JQDA 1SUAA 3DT6A 3L4SO 2WMDA 2Z98A 4G6ZA 3V9PA 1CU1A 2EWVA 4KMRA 1OPRA 2LGJA 1V3UA 1GPWB 4JUBA 3T7CA 4AP9A 4FGSA 5EKUA 4JN6B 4M1WA 5HKOA 3KE8A 3KPVA 4HPWA 1Q7BA 3HCCA 4MR7B 3UAXA 4BB9A 4RFVA 3SOZA 4CM4B 2EYQA 1NIPA 4QOGA 3UMSA 4TTJA 5AICA 3VGJA 4AFNA 2GEJA 3W1EA 4GOJA 3U4GA 3AKYA 1IJEA 3P0RA 4IDHA 3OZDA 4R1PA 2YJNA 1JEQA 1YZUA 3HNRA 1J1ZA 3WLKX 4O4HF 4MMYB 3RQSA 4IQFA 1YAJA 3EZNA 3NYWA 2GAFA 4GF5A 4L8FA 4N5DA 2B7BA 4WOKA 2VUHB 5LCXA 3T35A 3L77A 3WB1A 3M6AA 4DWJA 3PUZA 3SSAA 4XDYA 1RJDA 1UBSB 2A9VA 3R5FA 4TVSA 3PQ4A 2H8KA 2VAXA 5EI5A 2QVLA 2BM1A 5CCDA 4HAOA 3BL6A 3TDKA 1D2HA 1HE1C 3QVGB 1NL3A 1QIJA 2OHGA 1FE8A 1DIBA 2Q28A 1GUBA 3F5SA 1BAPA 4DLTA 2BKEA 3DOFA 4J16A 1CERA 5ECGC 4EL5A 3ZKWB 1EWTA 4ZVVA 2OAP1 1HDZA 2XBLA 3UTDA 3WDKA 4BNMA 1XWIA 3BH7A 5DASA 1IBLB 5JG7A 2G76A 1G4HA 1WAMA 5C4IA 2OXEA 3KXIA 3TD6A 2I87A 4EW6A 1C9KA 3RC3A 1HRKA 3WNQA 4GC5A 2JEZA 3GLQA 1Z4MA 1Z8HA 4AB1A 3PFKA 4Z1MD 1FZTA 3LWDA 2WIGA 4OIMA 1KPHA 5G2OA 2XXAB 1H8HA 1YI1A 4TL6A 1OAAA 4UCQA 3FOWA 3ZXSA 5J4YA 5CH3A 4MVJD 2D2XA 4F91B 2Q2QA 3HCEA 3O75A 1YK1A 3RREA 1QQ7A 1YMQA 1UQTA 1SXJD 4RF3A 3LIIA 3HRKA 4UD2A 5FPSA 2CSXA 4P5DA 1JEEA 4KODA 2WKRA 4I3HA 1N8SA 2QBYB 1JKXA 1UCFA 4RH1A 4YDRA 5ES4B 1SVSA 5CXUA 2ZIXA 4M1EA 5FD8A 3F6BX 5GY7A 3AI3A 3SVLA 4X6XA 1H93A 1RCUA 1Z5WA 2XADA 3IQEA 3M5DA 3OAAD 5AOCA 3SMVA 1GSHA 3KTAA 4CF3A 3IAM1 4GPBA 2QZZA 3O47A 3K31A 1QP0A 2OUIA 4HWRA 3ROEA 3NHUA 3GA5A 1RYFA 5K6RA 1QZXA 3MIIA 1PFWA 4Q02A 2B25A 3OZGA 2YWEA 3LBFA 4MQLA 3G1UA 4N0MA 4AJIA 4KOEC 3T99A 5DGHA 2GI4A 2PTHA 3NS7A 5IMSA 1DAPA 3RBXA 2IYRA 1W4AA 1OSNA 4P86A 1I5RA 4GI7A 4N5HX 2BW0A 3F6RA 5FWXA 3HVUA 1JR2A 2N47A 3RAJA 3TM5A 4RM2A 1ZJWA 1JKIA 1QPZA 4ZT5A 1R9NA 1U2ZA 3PQCA 1VKOA 1SUSA 3RVKA 3PDWA 4C4XA 2H5EA 1D8AA 2W00A 1Q15A 3D5EA 1VYUA 1WNTA 2JJ1A 2J0UA 3VR6D 3LDGA 1KHHA 2YJTD 4HDRA 2IZ7A 3MWJA 3HCRA 2HWKA 3F67A 3DBRA 5ALIA 4PN7A 1V8BA 2VJPA 4BGEA 4JENA 2XEDA 2ZDGA 3CH7A 3I9NA 4HGRA 3G8DA 2P65A 3ZWCA 3UBTA 5EE5B 2X3UA 1OXMA 4WSOA 3RK4A 3P2IA 4PR3A 3TB6A 4FKMA 4BLRA 1VPEA 2C99A 1W1UA 3QPBA 2FN7A 4WERA 3OMWA 1U9IA 5HF8A 1JHQA 1SIOA 3RS4A 1F5NA 1FSGA 2Y8EA 2ZIAA 3QE3A 1LNSA 2NO7A 2WK1A 5HOEA 4ZI7F 4ZQIA 3KLNA 3FD8A 3KL4A 1RIFA 3ENVA 4RESA 3NM6B 5AKLA 4ZRNA 3U4AA 4C88A 4WBNF 5IS2A 2EJTA 5E8RA 2ODTX 1O97D 3U40A 1MA3A 3IP3A 2QE7D 1N7JA 2OHHA 5B5SA 1DVRA 2BCEA 3E7FA 3E1GA 4WW0A 4NS1A 5FPQA 6ADHA 1A9QA 1V7QA 4UFPA 3DHWC 1QDEA 4I9HA 1ZNYA 1PEAA 2QN7A 4RDXA 3BK1A 1M5TA 4DDUA 2I4TA 1YS4A 1HY3A 3LOQA 4L85A 2YRFA 5BNIA 1NR7A 1VHQA 1X7XA 2X13A 3N8NA 3RSZA 3SVTA 4BTVA 4G5SA 4MW6A 4A9AA 4NCAA 1OT5A 2RHOA 4MAFA 4UW9A 3L7JA 4URXR 3HC7A 1CZKA 2QMZA 1ZINA 3EY4A 4H4CA 4CTNA 1PCXA 2VSFA 2XRFA 4FDTA 5AI0A 1F0KA 1VIYA 3VU9B 2PDAA 2PH3A 5GONA 2PS1A 3T0GA 1L5KA 1TZBA 2PX4A 1KEKA 1HQKA 1CE8A 1H8EA 3KV1A 2Q2OA 2VZ8A 4LOLA 4LRWA 4ONEA 5A7HA 4ENVA 3KQKA 1YBVA 3I6ZA 5A04A 5JI3E 2NO0A 5F52A 3VYWA 3KNZA 3V4PB 1Z56C 4O2AF 3OZUA 1L9XA 2H4HA 3AEZA 4QJ4A 5EAIA 1QQAA 1PGNA 2HF9A 2ZYSA 4GR9A 3TOXA 5JQGA 3SLGA 1W88A 4Y9RA 3SIPA 1B16A 1PDOA 2R6R1 2TS1A 2HJRA 4NENB 1UMCA 4KP7A 2ON6A 3QPAA 4L2IB 2ETVA 4LF5B 1N75A 2TRSB 4YP7A 1PVOA 5B7NA 4ESOA 4N5IX 2QMUA