4EUNA

Crystal structure of a sugar kinase (target efi-502144 from janibacter sp. htcc2649), unliganded structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
PTRHVVVMGVSGSGKTTIAHGVADETGLEFAEADAFHSPENIATMQRGIPLTDEDRWPWLRSLAEWMDARADAGVSTIITCSALKRTYRDVLREGPPSVDFLHLDGPAEVIKGRMSKREGHFMPASLLQSQLATLEALEPDESGIVLDLRQPPEQLIERALTWLDIAPAVATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar kinase (Target EFI-502144 from Janibacter sp. HTCC2649), unliganded structure
rcsb
source organism Janibacter sp. htcc2649
molecule tags Transferase
molecule keywords thermoresistant glucokinase
total genus 64
structure length 173
sequence length 173
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eunA00
3THXB 3NWJA 2CL6X 4OJQA 2VP9A 5DN6D 4G5OA 1KDRA 3H86A 3VU9A 4Z1MD 5L3SB 1XBTA 2VHUA 4TLBA 3KKQA 4BFZA 4XD7A 4IVPA 2WJGA 4GZMA 1YZLA 4YMUA 3SR0A 2W0SA 1ZCBA 2CMKA 3W6PA 1M1YE 4ACAA 2A5YB 1T3HA 4HUQA 5EE1A 2GK7A 2ZJ2A 3RSLA 5JLJA 3OE7A 1G6HA 1Q20A 5FUYA 2EW1A 2V6JA 4OBEA 2L0XA 4OK5A 3RYTC 2C03A 4U7DA 5JWRA 4QGFA 2YC2C 1XMJA 3C41J 2E1RA 1YZUA 3ZD6A 3AP2A 4UQOA 2YKGA 4ZO4A 2Z4RA 5J5CA 3AF1A 1NVWQ 3RS4A 4UXJA 1MH1A 2RGAA 4BRUA 4EQ6B 3A58B 1XD2B 1MO5A 2ZM5A 2X2FA 1PUJA 5CK4A 2G3YA 2HLDD 2XB4A 2B7BA 2OAQ1 3QF4A 1U9IA 4KSBA 4MH0R 2QGZA 2HCBA 2O8DB 1EX6A 4IEIA 4YLGA 2PLRA 2VBCA 3TH5A 3H84A 2G1JA 2GBLC 1ZAKA 4LHWA 1GL9B 3CRVA 2BMDA 2V55B 1E2DA 3MFYA 5KSYA 1NKTA 2A2ZA 4S35A 4GDFA 1WDTA 1Z47A 5IHPA 4AG6A 3QQ5A 3WNDA 1U8ZA 4JLDA 2X1VA 2PZGA 4CW7A 5AJWA 1Z6GA 1GOTA 2H7VA 5KDDA 5JCPA 1RRPA 1I4LD 5FL7A 2OZEA 1T91A 1JEDA 4Q7JB 2WWIA 3IHWA 3TIFA 3T34A 4HYYA 4XIGS 1K5DA 5KSZA 3A1WA 1S8FA 1YR8A 1S1MA 1C1YA 2ZU0C 4M1YA 5P21A 3FFAA 3HR8A 2QAJA 2ZJ5A 1T3LA 4EUNA 4AY2A 1CR2A 3DVLA 3OHMA 4TMKA 4DCNA 1Q12A 2CBZA 3W3ZB 3THWA 4PZZA 2AKAB 1SXJE 2QENA 1G4UR 2Q9AA 3B85A 2DBYA 4A2WA 1G18A 3ADCA 4MRRA 1F2UB 1P60A 1TAGA 2OV2A 5CJ2A 3WBKA 1TTTA 1FL9A 1UBCA 1X8JA 1N3BA 4II7A 3C8UA 4KCGA 3WHLA 3H4MA 4B32A 2WPDD 3DEFA 2WPDA 1T3SA 4RD4A 1IY0A 1VMAA 2ZTSA 4RZ2A 4ZKDA 3OEHD 1ETUA 3FTQA 3X1ZA 1EFRD 3TNFA 3CONA 5HPYB 4TZ0A 2ZS8A 3LW8A 2C77A 4BZPA 5KPJA 1E2EA 3LFUA 5HE9A 3MCAA 2G0NA 2BHRA 2CL0X 4Q9JA 4PPGA 4RD1A 2CLDX 3FHTA 2BEKA 4ZDWA 2ANCA 4NYMQ 1COWA 3B6EA 1QHGA 1S0UA 4OQLA 2GNOA 2ZPTX 2ZUCA 1XTJA 4OK6A 5BN5A 4DEXA 4F92B 1RRGA 4D82A 4A15A 3VFDA 3THYA 5KUTA 3IIJA 4BFXA 2VEDA 4AKEA 4C2TA 4Q19A 4NL4H 2KSQA 1PLLA 2WOJA 4PHFA 5CLLA 2LKDA 4W5WA 1VG8A 2ZI9A 2ZXUA 4Q4HB 1OJLA 1ZUHA 1GZSA 2ZR0A 3AVOA 2CNWD 2D7CA 4GI7A 4WAUA 4DSOA 1IAQA 4ZIRA 3SJZA 2ODBA 3CRRA 4P32A 1NN3A 1RZ3A 4LHXA 3B82A 1T0JB 3GFPA 2QAGB 2YHSA 3KUDA 1QHHA 3PXGA 3TRFA 1Z83A 3WYGA 4B75A 4DLVA 2MSEB 4US1R 1JI0A 1ZC3A 1DAIA 3CR7A 4OHXA 5L3QA 3U3KA 1GKYA 4Y0VA 3QSYA 4DIDA 3MSXA 1N0VC 3D3QA 3AQ4A 1JNYA 3I3SR 1NBMD 1Z5ZA 1G8GA 5E7MA 3EA5A 1XMVA 2C96A 3PQCA 4TL8A 2JCSA 1IN6A 1E2FA 2FF7A 4TQAA 4L5BA 1HE1C 2I1VB 3AM1A 4PHHA 4A1FA 2IF0A 3RVBA 3DL0A 5BXQC 1KK0A 4URWR 4B76A 5EP1A 2GK6A 5SZHB 3VR3A 1R8QA 1QBKC 1GNRA 3GFTA 4NYIR 1JALA 1Y63A 2LKCA 3OESA 4AKHA 1ZC4A 2FJUA 2GF9A 1NJGA 3TW4A 5FTMA 2WV9A 1FUUA 3T61A 3CKLA 3EC1A 3WRXC 4A0HA 4DRZA 3FDIA 8OHMA 4EQ6A 3GJ7A 3KKMA 3LX8A 5GJBA 3THXA 1KI1A 5IDVA 1JPJA 2J7PD 4JJZA 2JJ1D 1Z63A 5KHOC 1AZTA 4FN5A 1W4BA 1E69A 1ZUIA 3EIEA 3KXIA 3F3YA 2R6GA 2F1HA 3LLMA 3LV8A 2DYKA 5IT5A 3GQBA 4M53A 2XGJA 2R6FA 2ZE5A 2JA1A 3QXJA 2WM9B 1BH2A 3RANA 1LY1A 3TMKA 1RC8A 4RZUA 3VX3A 1OF1A 1VYVA 3CPEA 1J8MF 2NPIA 1SULA 3HPQA 1BMFA 1GAJA 1UM8A 2D06A 4M1MA 2KWIA 5CB8A 2O8DA 3GLHE 5D3QA 4R71A 5KNBA 2PJRA 4WVFA 3X2SA 1NN1A 2VO1A 4B71A 2NO0A 4LYJA 4XVQA 4TQ9A 4BFVA 1EFHA 3GCGA 1HH4A 4KO8A 4M0LA 3BE4A 4ITRC 3QPWA 3GLGA 1NVXQ 4BE7B 2BMJA 4J0QA 3MG9A 5E4FA 3GLFA 2IXFA 2GF0A 1E2LA 3SHFA 2ZYVX 4HLCA 4TT3D 2CXXA 1XCPA 1O3YA 5GVSA 2FG5A 5GVRA 2IEZA 2GAAA 2GXQA 2JGNA 4TSFA 1KDPA 1R10A 5HCIA 5FR1A 1RKBA 2XTMA 1ZW6A 4M9QA 2ZRHA 2O8EA 3LY5A 4KBFA 4KITB 5EP4A 1T9HA 1XJ0A 4BECA 1ZM9A 4OHYA 1XF9A 4C0AC 3SHWA 1VG0B 3F8TA 4Q1AA 4B3FX 2UZ3A 1KI8A 3QKTA 4I1OA 4Q9IA 3FMOB 1TQ2A 4A6XA 1KZGB 4DC9A 1ZD8A 2QBYB 3HU1A 5TB5A 1W1WA 4G5SA 1S4QA 3RLFA 2K5UA 3IKJA 1NBMA 2WJYA 3GEHA 5IK2D 2FA9A 3K70B 4DWJA 4HAXA 3G0HA 1CXZA 1IM2A 1WE2A 1Z6XA 4O25A 5FR2A 4FCTA 2HF8A 1COWD 2PCJA 3CO5A 2BBSA 4KBGA 2IUUA 4NCHA 3DO6A 3AF4A 2C78A 1I4DD 4ON9A 3QEJA 2ZRLA 3SS8A 2RGGA 3AGPA 3DMDA 1E96A 1OV4A 2ODEA 1OXSC 3K53A 4HZUB 4X8HA 3AVWA 4LBYA 4DLYA 4FCVA 1QVAA 3U5ZB 1YZNA 4LJ5A 2IHYA 3FGNA 4PPQA 3EZ2A 3TW8B 4HUTA 5FOSA 2CNWA 1HEIA 4QL3A 1E4YA 4B47A 3ZD7A 2XZLA 2ZRAA 2UVQA 4DZZA 3L8YA 3C7KA 3SJBA 5F9HA 5JHHB 3GJ4A 3U61B 2J46A 4NP6A 3I5YA 3SJCA 4EFLA 1YRBA 2LCFA 4R98A 4JMPA 5EUMA 3NDBB 4L16A 1Q22A 1WXQA 2ATVA 2W00A 3CLVA 5H8WA 1KKLA 1TL7C 3U7FB 1M7GA 1P62B 2OXRA 3TAUA 2OG2A 3NBFA 1X86B 4DLUA 5FL3A 3U4QB 1P2VA 3U60B 2ZJZA 2ZR9A 1XD8A 4CEIB 5E7IA 2DFNA 2IX3A 4GOJA 4OQMA 4LJAA 4HB0A 4EKDA 1CU1A 1EX7A 3LO5A 1HQCA 1SVSA 2WWFA 1GNPA 2FSFA 1ZINA 3K9HA 4PQRA 3WY9A 2FSGA 3ND8A 3REGA 3AH8A 4RKEA 2X8AA 4BLPA 3IPXA 2O0KA 2A3RA 3T1VA 2R8RA 3H0KA 4Q5IA 3T06B 3LVQE 4EPWA 3OF5A 4U00A 1LVGA 2JJ2D 4V0MA 4RD6A 3QG5A 1VDZA 1Z0AA 1HE8B 3IBGA 4G5GA 1E1RA 3HPRA 2ZJ8A 1BIFA 2ORVA 2GJKA 3CPJB 4CT5A 2AFIE 2Z4SA 5KNCA 3TLXA 5C18A 4OHVA 2QEQA 4LV6A 2HF9A 3CNLA 5DH9A 2BM0A 2RB4A 4OQFA 5J40A 4C0LA 4M9SA 4DJTA 4CEJB 2A9KA 2H92A 2ECKA 3MJHA 4HLUC 1QZXA 4DLWA 2QRNA 4DSNA 4Q1FA 1JQLB 1IN5A 3PR1A 4R2IA 4F4IA 5IRCD 2I4IA 2ZANA 3IBYA 3BK7A 4E03A 1NMZA 2P5TB 5FTJA 3BB3A 1IONA 1E79D 1S96A 5EXTA 3D8BA 4B3BA 3ZZTA 5JS8A 4PO9A 5A5GA 1ZJ6A 3MWKA 5HR5A 2YJTD 3BXZA 3K0CA 5AUNB 1F48A 3EARA 4RZ3A 3RRNA 1ZU5A 3K8YA 1SKYB 4TLAA 1T8UA 1OPXA 2XX3A 1Z07A 1SVWA 4MYUA 2H18A 3FWYA 1UF9A 5TVKA 3VX4A 1U9IC 2G77B 4M2LA 1OFTA 2RHDA 3ZS9A 3ADDA 4P4SA 1WCV1 1KO5A 3WMFA 4A6PA 2D4HA 3GJXC 1XMIA 2F7SA 1XMSA 2QE7A 3ADKA 4WBSA 4BASA 5L3VA 5ANRB 1ZVQA 4A0RA 4B2IA 2AFHE 4BLOA 2QSZA 2CK3D 5B58C 4QBGB 1XEXA 3BJIC 3HYRA 1Z22A 2IT1A 3BH7A 4F4JA 3H2YA 3AEZA 3SFVA 3SBDA 5KNDA 4URZR 1E1RD 1N6RA 3U3OA 1OH8A 2VSXA 3CR8A 1XU4A 1Z2CA 4CZ2A 2WTUA 4R9UC 5JSZA 2OBLA 3DOFA 2P65A 2FSHA 4XD7D 2NO1A 4DUGA 4BLQA 2WWWA 3BIFA 3VQTA 2FH5B 4EJSC 4YMSA 2DWQA 1E6CA 3K70D 3CF0A 1ZU4A 1DTSA 1ZD9A 2DHRA 4JJKA 5LB2A 4K8OA 3SJAA 4B3XA 3L0SA 4XVUA 1NSTA 1JJVA 2F3TA 1IQPA 4TMVA 1GL6A 2W6JA 2NO7A 5FBWB 3KKOA 3NDPA 5E95A 1R6BX 2GEVA 1XXHB 4OL0A 4IFBA 3I61A 1HV8A 1Q21A 5C4GB 4IDHA 1VG1A 2P0EA 3KQNA 1GRQA 3EZ7A 1EK0A 2ORIA 3KX2A 5EXPA 5GJVC 1DAKA 3UXMA 3R9WA 4A2QA 1SZPA 1G3QA 1KJYA 3KZ1E 5SZKB 2EYQA 1P9NA 1MO4A 1W2GA 3K0FA 1KTVA 3RDPA 1MABB 2O8BB 2ASEA 3P20A 4YC7A 5DHFA 3R20A 3FVQA 5HCNA 4YMWA 4IEEA 4NPHA 3RAPR 1J90A 2NIPA 1N6PA 4Q02A 4B43A 3EAQA 4L9WA 3GFOA 5JI2E 5FPTA 4RSGA 4XTCS 3REFA 2GKSA 4JLJA 3G5UA 2CHVA 2ZJYA 4LJ9A 4GL2A 2NMVA 2OBNA 1CKEA 4AG5A 1H8HD 4G5QA 2IYSA 4IW3B 2FEMA 4RCZA 4ACBA 3FB4A 4XSGA 1Y3AA 2AD1A 4HAYA 1WB9A 2C04A 2W0MA 4A92A 4PHGA 4BPBA 3KJEA 2WWGA 3Q3JB 3Q5EA 2E87A 1LB1B 3NEJA 4OYHA 4PPFA 2J0UA 3UK6A 1E9CA 4HAZA 4Q4HA 4QXAA 3LBNA 1W0JD 3FYHA 3IEUA 3CWQA 1JXMA 3ICEA 2F6RA 3A37A 4Q9KA 3MUFA 2CVHA 2RGNA 4OHWA 1DE0A 5DIFA 1QDEA 2ZREA 1KSJA 2OAP1 1PJRA 3EC2A 3NVAA 3PUWA 4P33A 2I1QA 1DVRA 5JWHA 2QP9X 1RJ9A 4NH0A 3V9PA 1D2MA 4JLKA 4NMMA 1UKEA 4JBWA 4LYFA 1ZM7A 5DLQC 3T1QA 1G5PA 2QP4A 2QN6A 3X1XA 3UIEA 2J7PA 2CDNA 4HZUA 1AQUA 4MRPA 3B2EA 5CYOA 5LDDC 2XXAB 2EFCB 1SVOA 2X2EA 4RZXA 5FBRB 1TEXA 1K8RA 1VYTA 4DVGA 3WRYC 2ZYTX 3NXSA 4MGKR 2XAUA 4MYCA 2ORWA 4MA4A 1QHYA 1XFAA 2J87A 4IVRA 3LAWA 1OSNA 3EG5A 4GNKA 4GMDA 4LHYA 3EX7C 3GJ6A 5JBQA 2BCGY 2ZRDA 3P1JA 2IF2A 2ZSEA 4P3YA 2D7DA 1CTQA 2VIIA 1AK2A 4BFYA 5BYKA 2WSMA 3O47A 2KB0A 1ODFA 1UBGA 1Z2AA 3EZFA 1S1CA 3U2QA 2C95A 1LF5A 5CM8B 3U3MA 4O2RA 3VU9B 3JVVA 1E99A 4AWXA 3OAAA 4CEHB 1VCNA 2Q9CA 4RKFA 3BFVA 2RGXA 2ERYA 4MITA 5EE0A 2OLJA 3R8CA 2OCYC 1KYIA 4FMCB 2WZQA 3SU8A 3PITA 3Q5DA 2OCBA 1FQKA 4ESHA 3IIMA 1DADA 4Q1EA 3IGFA 5JEDA 3AF2A 2V1UA 2F55A 1W47A 2F1JA 2UKDA 3EWSA 3UANA 3K70C 1UBEA 4MRVA 2FEOA 3HP1A 4I1UA 4IOJA 3N2EA 4Q1CA 4LJ4A 4TYWA 1J8YF 1SVMA 4DDUA 4OI0A 3A1UA 1E2QA 1P3JA 2C98A 2VH5R 2XZPA 2BEJA 3I8SA 2B7CA 5LD2B 1TUEA 5B2ZA 2NGRA 2BCJQ 3LQQA 3KJIA 4C2UA 4ZDJA 4WIAA 3ASYA 4UKDA 4IJMA 2QT0A 1EG7A 1G3RA 3IO3A 4BWYA 1WA5A 1J2JA 3HU3A 1FX0B 1G8FA 3BB1A 2VQSA 4KV9A 5JCZA 2RGCA 2GJAA 2JDID 4A36A 1E9FA 3ETLA 4IDPA 4JBXA 2HT1A 3ZIAD 1C9KA 2B21A 5KSPA 3VTKA 4BFUA 5TY0A 1JR3A 4OI4A 2VHCA 4KXFB 1KSHA 5SZIA 2C9OA 2F1IA 2HUPA 2ZU6A 1W0KA 4GRAA 4URYR 4D4LA 1X3SA 2H5EA 3W6OA 4BLRA 1E9DA 1EFCA 4D81A 1FUKA 4HZIA 4LPSA 1G6OA 1FW6A 3OIVA 1NG1A 3L0PA 4DCUA 3K0EA 4V0NA 4A8JC 2W58A 4B34A 3B1VA 5DGXA 4TMTA 1NVVR 4C0SA 2QMUA 3PUXA 1YU9A 4B3DA 2VL7A 1H8ED 2AXPA 2WJHA 2GCOB 521PA 2NZ8A 4HAUA 5CM9C 3VMFA 2F9MA 4NYIQ 4LC0A 4Q7MB 1IY1A 4TTQA 2GDJA 1KI6A 2ZR7A 4XWAA 1GSIA 3ZVNA 4XVRA 5KYKA 1PUIA 4BLSA 1XXHE 5BQ5A 2DWOA 1F60A 2QSYA 1NMXA 1G17A 3QY0A 4NBSA 2J1LA 3O8DA 2F1RA 4JIMA 1IXRC 5G41A 4JS0A 1QHHB 4UJ5A 1P5ZB 3CZPA 1FTNA 1TQDA 2CLCX 3L0OA 4MQBA 1Q44A 1AS2A 3IQXA 3WMGA 2A5DA 2ZJBA 2CCKA 3C14C 4PZLA 5DN6A 1MRNA 2ZUBA 1OE0A 1P9RA 2FFHA 4UXHA 4LY6A 4NZYA 2H1LA 2FE4A 2VTKA 2ZI7A 1FNMA 1JR3E 4A0GA 1WBBA 1R5NA 1R4AA 4LHVA 221PA 4JL8A 1G16A 2E9SA 1G20E 4TMWA 3E1SA 1OFUX 4MGYR 3NC0C 2D2EA 4TTPA 1G7TA 1KDTA 1VECA 3CBQA 1G3UA 1ZNWA 1NI3A 3F5FA 5JHGB 4Q4LA 5DYGA 4BZXA 4ESVA 4PQFA 2ZRFA 4MYHA 1KAOA 1NF3A 2JLRA 2IHBA 4TLDA 5J47A 3TSZA 5K8LA 3T35A 4URVR 4LV5B 1EFTA 3MD0A 1PLKA 2JJ1A 4OQXA 1XD9A 3TBKA 4PAQA 4S2EA 1KNQA 1NN0A 3ZGXA 2XTNA 1W46A 1G41A 5DSZA 2FOLA 2RGBA 3CX8A 1EWRA 3RS5A 4A4DA 2O8FA 4QNMA 2DY1A 1IJEA 5FOWA 4C7OA 1R0XA 1Z28A 2EFEB 2QPTA 3P4XA 2NPFA 4Q4JB 1GNQA 2B6HA 1YR6A 2HDNB 3IEVA 5C46F 1E9AA 2WKRA 2CHQA 1MKYA 2FSIA 2J45A 1Q3HA 4I81A 1D9XA 1UDXA 4CEIA 3QBVA 2JLSA 3GLIE 3AB3A 2ZRNA 4DLRA 1H8HA 1WRBA 2N1BA 4ZDIA 2ZUDA 1W36B 3P32A 3LQRA 4JL5A 4JKIA 3RS2A 1CJMA 1LFDB 3C5CA 3PEUA 1L4UA 1D6JA 3IUYA 3MRSA 3TSOA 1NLFA 3L43A 5CYPA 3FFBA 3CRQA 1Q1QA 1TF2A 4TSFD 2EFDB 2ZI4A 4OI1A 2JLUA 4ZPXA 1U94A 2ZSAA 5L3RA 4I99A 4KU4A 3ZS8A 1L4YA 2NQ2C 1DO2A 3T5DA 1N6OA 1TU3A 3QF4B 4FMDB 4TQUS 1X8KA 1KGDA 2ZQ5A 2QTFA 4LUCA 5G40A 4DSTA 3KQKA 4R2HA 2V7QD 1T8TA 3WBJA 2EYUA 3MWJA 4JSYA 4QOSA 5EE9A 2BMEA 4KYIB 1AJEA 1LV7A 2AN9A 2CE7A 3AVVA 4NTZA 2GZAA 3IIKA 2IA5A 4PAOA 4UNQA 4AKGA 2DFKB 3A1TA 4OKSA 5FPYA 3RWMB 3VAAA 4QGGA 4EFMA 1G3IA 1VTKA 4A2PA 4D25A 4C0BA 3R9XA 3ZLJA 1GG2A 2V6IA 3NHBA 4B35A 4B74A 2QU8A 3MGCA 4MKHA 1OIXA 1OLOA 4GP6A 4F93B 4ASUD 1VG9B 4X8LA 2FN4A 3L0IB 3D7MA 1VIYA 1F3OA 1TEVA 4B3CA 2PLFA 4Q9HA 4C0KA 1U90A 1G21E 1SVKA 4TYNA 4C30A 5FOTA 2IYRA 2OESA 2WSSA 3M4YA 1CLUA 3RABA 4QJ4A 4Q48A 1R8SA 3PVSA 1QG4A 1GP2A 4NDZA 1GIAA 3SYNA 1YR7A 2IK8A 3B1ZA 1GUAA 2WICA 4LK2A 4DDWA 1P4SA 4UNRA 5JSZB 2V54A 3AP3A 4AYXA 1KKMA 3CRW1 2H17A 1HURA 5DI9A 3RRMA 4EDHA 2XB2A 4EJSB 1J70A 5F2EA 2ZRKA 2ZAMA 3BB4A 1E9RA 5EP3A 2QE7D 3B5JA 3QVVA 4JVLA 5EXXA 5FOXA 3SQWA 1RE0A 4KFTA 1QVRA 1U2RA 1YZQA 2XNDD 4QHYA 2FWRA 5AJZA 2X19A 3KKPA 4HB2A 2CEAA 1G7SA 4WZ6A 1XP8A 4V0OA 4LHZA 5HZHA 4Y0AA 3PG5A 1RPZA 3GLHB 2HV8A 2PT7A 2JLQA 3B7GA 4MGZR 1U8YA 1VIAA 2SHKA 3TUIC 2MSCB 5DI3A 1WP9A 3AKCA 4JLVA 2JDIA 2J0QA 1XRJA 2GEUA 1U99A 1KO4A 1NSFA 5FBLB 1JR3D 1Z6TA 2ZETA 1GTVA 2ONKA 1K6MA 2GCPA 1XJQA 4KI0A 1JB1A 3W9YA 1S9DA 4CIDA 1J99A 1P75A 3C16C 4C0HA 3TR0A 2YOFA 3AF0A 3CNOA 4B33A 2BKUA 1E0AA 3ECCA 4QGAA 3R9IA 2CK3A 4RFSB 4AC9A 1YE8A 5C1BA 1OHHD 2AL7A 1W2HA 1E79A 3A4NA 621PA 1CF4A 5HKKA 5BN4A 4PPNA 2Q3MA 1DAEA 2OCAA 3U7HB 4M9ZA 2NOAA 1S9HA 2V3CC 4AYTA 2BC9A 1IN7A 3I72A 3DKPA 3WP0A 3PUVA 4TZ6A 4DIEA 2RHMA 3VR2A 1KI6B 2DWPA 1JXOA 3QKRB 4LPKA 4L4UA 2Y8EA 5CIQA 1WBDA 4JLOA 4UNNA 1EWQA 3CNNA 1DG3A 5IK2A 2O8EB 2B92A 2QBYA 4IDOA 5E3HA 3EIQA 1II8B 1N5LA 3GMTA 1R5OA 3T12A 2WIAA 1LNZA 2XSZA 3ZIAA 4WW0A 4QNRA 5LBIA 2YINC 2QMEA 1A7JA 4PC3A 3LNCA 3NBZC 3CZQA 1HUQA 1T0HB 4V02A 2G88A 1AZSC 2CE2X 1D2EA 2YYZA 1TADA 2VP6A 1A2BA 3NIBA 1N2CE 3W8RA 3EZ9A 1G8YA 5H1YA 5AJXA 1E32A 2QY9A 2YWGA 3TK1A 4CEHA 2IS2A 2IXGA 1KNXA 4M1TA 3CRMA 3PCRB 3CH4B 3KB2A 1E4VA 1MV5A 1TX4B 1FQJA 2VLIA 4DT1A 1CRPA 1SXJC 2F9LA 3NH9A 4PAMA 1N5KA 3VKWA 4Q4JA 4BFWA 1OB2A 1YZKA 4OHZA 3KTAB 2ODWA 1OKKD 1QRAA 3PIRA 2W2XA 3A1SA 4CVNA 1AKEA 4YXWA 5CITA 1N25A 2ZVPX 4QRHA 2BBTA 3SC3A 4H9GA 1IN4A 1ZD1A 4CDGA 2BBWA 5D3MB 1MABA 4HUQB 1SVLA 3KL4A 4HDQB 2YC4C 1OT3A 5AUOB 3DZ8A 5TXGA 2FPLA 4IHQA 4LDJA 4O0MA 5KSOA 4M9XA 2FZLA 2P6UA 1ESMA 4M1OA 1DELA 1EXMA 4NCIA 4W9MC 4BEBA 3W6NA 5KDOA 4RY2A 2OFXA 3KUCA 4YMTA 1BOFA 2F3RA 1OHHA 1YQTA 4KFSA 2BOVA 1KMHB 2OBMA 2PMKA 1RRFA 3U3RA 3AV0B 2QRZA 1ZRHA 4GOXA 4I4LA 4AK9A 3O8RA 4A8JB 2R2AA 1SHKA 1OXXK 3OFND 4TL7A 4MUBA 3QG1A 3WMEA 4XWKA 1RRCA 3UG6A 2VA8A 1VCOA 4KYUA 3Q72A 5C2JB 1OH7A 3OEED 4V0ME 2J59A 3GJ0A 4PC7A 2OUKA 2HJGA 4R7ZA 1KY3A 3VR4A 1G8PA 421PA 1D5CA 1W4CA 3UG7A 2P6RA 2V4ZA 1GL7A 1ONBA 1Q1ZA 1A2KC 3F0TA 4DSUA 1FX0A 1N0UA 1DARA 3GLIA 3ZZ0A 3I32A 3ND9A 4HAVA 1AA9A 1CULC 1KO1A 2J5XA 3TAHA 5FBQB 3SZRA 3WNCA 3RRYA 4AIIA 5HKKD 2HXSA 3QXHA 1JBKA 4PC6A 1VPLA 4WXRA 1CIPA 4A0FA 4V03A 1ESNA 5CDFE 2ZJAA 3QI2A 4DDVA 2GVZC 4TLEA 1XEWX 3CX7A 4HSEA 2CCJA 2IEYA 2CJWA 4HAWA 5CK5A 4DCVA 3LH5A 1E94E 5FTNA 4E5UA 3HWSA 4LCBA 1V43A 2KJQA 1NL3A 4BEJA 1XTKA 4GPTA 1H8EA 3SN6A 3ZJYA 3CPHA 3UMFA 2ZI6A 5EUQB 2YV5A 4IOLA 4KODA 2EVWX 1AM4D 1VKJA 2ZSDA 1CEEA 2NO9A 4PO8A 5CLQA 4G01B 5GJWC 3TJZA 3NC1C 5FFMA 2GXSA 3LWNA 1A1VA 1DO0A 3KKNA 3U44B 1T4GA 3TUZC 2IYUA 4Q7KA 1M2OB 1Z06A 1BYUA 1NRJB 3C5HA 1KMHA 4M4SA 1KIMA 1KAGA 2MMCA 3QF7A 4HB4A 5JEEA 4NU0A 2OCPA 5EQTA 3SYLA 1II0A 1KMQA 4MRSA 1TQ6A 4UXIA 1OFHA 1UEJA 4X8OA 3VHXA 4CF7A 5FTLA 1E98A 1HT2E 4OK3A 2BIFA 1KK2A 3TKLA 3OIUA 4F4CA 1R7RA 4MGIR 3KQUA 1JAHA 2GXAA 3HR7A 1AKYA 1N5IA 3A36A 4LBWA 3R7WA 2XEXA 1KK3A 5CB6A 1XTSA 1OYWA 3AVQA 1N6KA 2J7KA 1I4TD 1NBME 3EW9A 3DPUA 121PA 4LV8B 1BS1A 2JJ2A 3FOZA 3K0AA 3B60A 2ONJA 1UDWA 4FMDF 1O87A 3L8ZA 4DHEA 3J81k 5F9FA 3K0AB 4PO1A 4ZCLA 1P61B 3S1AB 1XD2A 1J7KA 4ASUA 4FIDA 2WAXA 4D0GA 3BGWA 4EPRA 3FKSD 4NCKA 4JLMA 4KHZA 4EAQA 3A4LA 5J4LA 4F38A 1II9A 1YVDA 1ZMXA 3SI7A 4DXAA 1E0KA 2OSBA 3MMPA 2AK2A 3RS0A 3M0EA 4D26A 2UZIR 5AUPB 2GAOA 5KDLA 1YZTA 1XPRA 1L7VC 1E2JA 2FPKA 4D80A 6Q21A 4KLZA 1M34E 1NJFA 2AD5A 4MKIA 3OEEA 3LBHA 1Q0UA 1HA3A 2B8WA 3KDSE 5HE8A 3BS4A 3AVXA 2BJWA 3JZAA 3W34A 5A0FA 3HDTA 1BMFD 1U98A 3B1WA 4DEYA 1XCGB 5DISB 3Q85A 1G1MA 4KLNA 2AX4A 1CBUA 4L9SA 2C99A 3ASZA 4TMZA 2JASA 2IYYA 3KFXA 4H1VA 1Z6AA 4G0NA 4Z1MA 1AQYA 1FMLA 2ZSBA 1HY3A 3GEEA 3MAAC 5J4VA 4PTLA 5JI3E 5A4JA 2C9YA 2QROA 4D0NA 2ZYWX 1KK1A 4MKGA 4TWZA 4Z8YA 4N3NA 2G9NA 4D6PA 2WKPA 4P0TA 5JS7A 1FFHA 2ZS7A 4ZCMA 2VP0A 2O0JA 4WZAE 4PSVA 2VSOA 4LBZA 1NY5A 5FI0B 5FOVA 1F2TA 3BBPA 4IKEA 4AURA 2N46A 5JJKA 1XZQA 1KI9A 4JLBA 5IF9A 4GZLA 1UPTA 3K0CC 2OO7A 2YOHA 2PEZA 4YMVA 4DBLC 1SKQA 3K9GA 3MLEA 2XOKA 3VR6A 3ZVLA 4U5XA 2OM2A 4US2R 2WJVA 3NHAA 2H57A 3VR5A 2DB3A 2QQEA 1UFQA 1QHNA 5JFGA 1LTQA 1GFIA 4NYMR 5JJLA 5J4HA 4BGDA 2GHIA 1KI4A 3K0FB 2YWHA 4FI3C 2CCGA 5JECA 2NZJA 4KVGA 1G7RA 1U0HC 1ZCAA 2JLXA 1T5LA 5FBVB 1FZQA 2W6JD 5FTKA 4AYWA 5FH9A 3KQLA 1RIFA 1S3SA 4DCTA 4QM7A 1N0WA 1Z29A 2EU8A 3X1WA 1SKYE 2XTZA 3CX6A 3RRZA 5TMPA 2BWJA 1OH5A 4EPYA 2OXCA 4IXMA 2EQBA 1G5TA 1CJKC 3HYTA 5JJIA 1MR3F 1Z0KA 3T1OA 1LS6A 2WIBA 1FPMA 4WZBE 4AKIA 1KSGA 4XH9B 2R44A 2G83A 1GVNB 4HATA 2JLZA 1EFUA 3X1DA 3V4FA 1DAGA 1KI2A 2FU5C 3N5CA 1NN5A 1WMSA 2ZRBA 4FMBB 2FPMA 3L2OB 3TR5A 3GEIA 2IS4A 3BERA 4PC2A 1W4AA 1AGPA 3HU2A 1N6HA 4IRUB 3KFVA 2ZRIA 1U8AA 2IWRA 1XTQA 4O2LA 3BRWD 4QM6A 2QI9C 4P4SB 3NKVA 2QTVB 1KI3A 3WYFA 2HJVA 2XJ4A 5KTYA 2J0SA 4Q47A 1PVOA 1F5NA 3I5XA 3EASA 3GJ3A 1P6XA 3LRPA 4TYQA 2MMGA 2IYVA 3K09C 2P3SA 3O8BA 1W49A 5H68A 2VYFA 3WP1B 4E07A 3DM5A 1IXSB 2QP3A 2QORA 3IQWA 1OH6A 1IXZA 1KHTA 2O0HA 3DKVA 4LRWA 4C0QC 1EFRA 2V7QA 1RW4A 4M22A 1P7CA 2KBFA 4JT4A 4Q1DA 4PANA 1OXVA 2C9CA 5HZKA 4HLDA 2BKEA 1MT0A 2HYDA 4DT1B 2QT1A 3E2IA 3QNUA 1NVVQ 1W0JA 1W48A 3LD9A 3LDAA 1Q1EA 4B73A 4RD0A 3OIYA 3UPUA 3QKSA 5G53C 3M6AA 3I92A 4UJ3A 4BRWA 3QXXA 2XITA 2BV3A 2A5FA 3TE6A 3UWKA 4JLNA 1A82A 2JEOA 3FKSA 3EPHA 3T15A 1NP6A 3R7WB 5FPSA 4QBIA 4B6FA 1XXHA 2IXEA 4QBFA 1OW3B 1IBRA 2W2VA 2ODNA 2IYQA 1DS6A 3SYKA 3RNLA 3L82B 4IOKA 4L15A 1Z0FA 5J4YA 2O8CA 1H65A 1QHIA 5EE3A 3CW2A 2FGJA 2J9RA 2ZE7A 2W6ID 4I1VA 4DDTA 2W83A 4TN1A 1KOFA 2GZDA 4M1WA 2ERXA 4WA7A 1US8A 1L8QA 1SXJB 2VF8A 2RGNC 1QHXA 3BFXA 3QKUA 3UMSA 2QAGA 1DAHA 2YNMA 1E2IA 1RFLA 4LBVA 3BAFA 3K0SA 2C2HA 5TARA 3BWDD 4WOPA 1FOEB 2Q9BA 1G19A 3JVUA 1UBFA 4Q4AB 3GLGE 3VKHA 2BDTA 4FCWA 2GTPA 3RHFA 4RD3A 3U44A 1U0LA 5DNYB 2PX3A 1NLYA 3Q8XB 2O8FB 1R0WA 1FNNA 4Q9LA 3R8FA 4B3GA 3AVTA 4TTRA 2AWNA 3GLHA 4HDCA 3RSOA 3CM0A 2IYZA 4JVSB 4LWZA 1R2QA 4N0EA 1CS4C 1E2KA 3S1AA 3SDZA 3BOSA 4LJYA 4EPVA 4QHSA 3U6BA 2WMNB 3QE0A 1EGAA 1MOZA 3CF6R 1G64A 2C5LA 2WOOA 2IUTA 4PX9A 2ZE6A 1VCIA 1NVUQ 2JLYA 1UJ2A 3GLGB 3O8CA 2JLWA 4LC1A 3LA6A 1TMKA 4F7WA 1F2UA 4D2IA 1ZIOA 2VRWA 3W5JA 2H16A 3ZYCA 4YONB 3B78A 821PA 2AR7A 2QM8A 1YRAA 2D74A 4NHOA 3UATA 2NO6A 1Z08A 4HLQB 1DOAA 3ZQJA 1KSFX 4MDFA 2NG1A 2QM7A 2ZI3A 3I4LA 2JIZD 721PA 4LJ7A 2XZOA 5FI1B 4DB2A 5TV2A 2KI5A 3EZ6A 1JJ7A 5CJPA 4IVQA 2HEIA 5EJEA 2W6IA 2RKOA 2ZEJA 2QMHA 2J0UB 4FMCF 5KOYA 3I1FA 1R0YA 4P4TA 5EP2A 5JRJA 5C4MA 5KPDA 2YZ2A 3AKYA 3AKDA 5EZ5A 1NY6A 3TVTA 1XX6A 4Z51A 1GM5A 2J0VA 1Q3TA 2VHQA 1XTRA 4NCJA 4QKQA 1EESA 4ZCIA 1ZYUA 4BZQA 3IO5A 3PUZA 4W5JA 1IN8A 3CIOA 3THYB 3B9QA 4XOIA 1GKUB 2DFLA 1E3MA 2AKYA 4TL9A 4ZKEA 1QHSA 3C4JA 1E2NA 3KB1A 4GMXA 4GFDA 1AIPA 3SFZA 3OZXA 2CLSA 3ADBA 1F2TB 2OFWA 5AJYA 4EFNA 2WWYA 2HT6A 3VNVA 2ZRGA 4YDHB 3KJGA 3AP1A 4KFUA 5DHAA 5FL7D 3NEYA 3BH0A 3OAAD 3QENA 4ZIRB 2MSDB 3WXMA 4MDEA 1ZP6A 1HQYE 4U02A 1OYYA 5LPNA 3A8TA 2AWOA 2GCNA 1TQ4A 4ZI2A 1TU4A 1TPZA 2W2TA 4E22A 3WYAA 5JZVA 2FV8A 1X1RA 3D6TB 2HCJB 2WSSD 4NYJQ 1E2MA 5DO9A 4BUJA 1G3MA 1SGWA 2ANBA 3NBXX 2DPXA 4Q18A 2XSZD 1TUIA 1D9ZA 2Q3HA 2RH5A 2XXAA 1ZBDA 5K8UA 4G1UC 4BLTA 5BW8A 2GVDC 5UKDA 2ZITA 3CWZA 1W44A 1CP2A 4PSKA 1NIJA 4A8JA 3PEWA 3GLIB 4PHTA 4NYJR 4KAXA 2ZRCA 2ZYUX 1Q57A 3QPVA 2QMOA 4B48A 1FP6A 3E70C 2OLKA 1TF7A 3I8XA 3K9LA 4TMXA 1D8TA 1HT1E 4TLCA 3TGPA 1N6NA 1ZNZA 3NBYC 4BQSA 1X6VA 2BJVA 5ELXA 2IS1A 2I3BA 3IILA 3RC3A 2BVNA 5AUQA 3AVPA 2FNAA 2D62A 2ZJOA 4C0JA 3QVUA 3ZQ6A 5F3WB 2IS6A 1GRRA 4TL6A 5BWMA 1P2UA 1E2GA 4QJ3A 1XEFA 3RWOA 3UWOA 4M8NE 2PBRA 1M7BA 2FGKA 4KVAA 4D4KA 1CR4A 1E0SA 2P6NA 4RVCA 5H70A 3B1YA 1LS1A 4O3MA 1P2TA 5LD2C 4QBHA 3QBTA 5LB4A 4K46A 2ZRJA 5CDFA 2VPPA 2ZRPA 2N42A 3LW7A 1P72A 2REOA 3AUXA 1MO3A 1A5TA 5BYJA 2IW3A 4YDSA 4B2LA 1SXJD 5GJCA 1XJCA 5TDHA 1LF0A 3SNHA 3DHWC 4POAA 2F43A 3G82C 4ARZB 3B1XA 4Q01A 4UNPA 2FDCA 3LVRE 1R0ZA 1XEXB 3ZH9B 4DUGD 1C4OA 4LX0A 3N70A 1V5WA 3EA0A 4K81B 1GKIA 4CRWB 2JLVA 1BO6A 1W5SA 2EFGA 3W8NA 2RAPA 1QG2A 4XJXA 4A9AA 5G3YA 5AJVB 2QPAA 2VP2A 4KFRA 1Z0JA 4URUR 4ZI3A 1GILA 4Q21A 2GXUA 4P4UA 1GDDA 2BM1A 3NTUA 3RC8A 5CIWA 2QUZA 1UKVY 1ZIPA 3T5GA 1SQ5A 1X8LA 4JLPA 3A1VA 4D4MA 3DZDA 2PZEA 2WHXA 4LZZA 3QUSA 1MRSA 5J4KA 1IJFA 2GZHA 3U7GA 1XPOA 4JKYA 1LW7A 4B2PA 3ZZUA 4Q7LA 3QXCA 4GP7A 3E5HA 2RMKA 2YOGA 4IFEA 4KSCA 2ZE8A 3EXAA 5F98A 4HLUA 2O8CB 2NTYC 3I73A 2FFQA 2GBLA 1M7HA 2QGNA 2IC5A 2R6CA 3GD7A 4YXWD 3GP8A 3QEOA 3Q7QA 1PZNA 1B23P 2IYTA 3DOEA 4V0KA 5FUXA 3BH6A 5DYIA 2CHGA 1XEWY 3AVUA 3GLFB 3EPKA 2X77A 3DMNA 2GILA 2WJJA 2A5GA 3IDQA 4RD2A 4DKXA 1NG9A 2GCOA 2VHJA 4FD2A 1WQ1R 2QA5A 3QKRA 4CEJA 3HJNA 5FPKA 2ZI5A 2YWEA 3FMFA 1S2MA 3T1TA 1DEKA 4EIWA 1N6IA 4L8GA 1MO6A 4DLXA 4RJLA 1T5IA 2DR3A 4NONA 4Q03A 5DI3B 3PV0A 2Q21A 4V0LA 4Q4AA 4CT4B 4AI6A 2DCUA 2WBLC 2ZRMA 2Q3FA 1W0KD 1II8A 4W5HA 2Z5FA 2DFTA 3UMRA 1JAIA 2GJ8A 3RS7A 1KDOA 2AXNA 2IYLD 3FHCB 2RGEA 4GSYA 5L8VA 4FW9A 5L3SA 1G5RA 1Z0DA 1TF5A 2JIZA 1XDBA 4JYCA 4LJ6A 4NCNA 5FUWA 2R62A 4XWOA 1X1SA 3ZVMA 2G0TA 1JECA 4P31A 1ELOA 4EPTA 3A6PC 1T6NA 2QQ0A 2G1KA 1AGRA 4LGMA 2G6BA 4D4JA 1UADA 2PX0A 2VP4A 4RFVA 1KI7A 4G5RA 1Z0IA 3B9PA 1DBSA 1SVIA 2PMDA 3DDCA 1Z6YA 4IOMA 1CJTC 2OHFA 3BFKA 3IHLA 4OJKA 3AKEA 2R6DA 2KBEA 2GRJA 1AN0A 2C8VA 3TQFA 1BYIA 3VHLB 4EJSA 1PV4A 1KY2A 1XB2A 3PENA 3ICQB 4LYHA 1VYUA 1OB5A 1XPUA 1N6LA 3GJ8A 3AUYA 1KO8A 1M8PA 2A30A 1ZM2A 2XNDA 2YWFA 2JAQA 1AS3A 1IY2A 5GADl 1UEIA 1B0UA 4HDOB 2FX3A 4JSTA 1L2TA 1G4AE 1SHZA 4JZKA 2FFAA 3CUEF 4Z54A 1G8HA 1YJ5A 1E9BA 1R5BA 1XNJA 2Z83A 5K8IA 4XTRA 3NG1A 1DAMA 3BORA 5G3ZA 5M04A 3QXSA 4B6EA 4URXR 2Z43A 4QJ5A 3MJRA 3P4YA 1JEEA 1P73A 2FZ4A 2ZVQX 3AGQA 3FMIA 3OE7D 1NNEA 4M1SA 3K9NA 1W36D 1PLJA 4FINA 4A82A 2ZS9A 2JATA 2WVJA 1RJ9B 4JVNA 3TQCA 2IYWA 1ZUNB 2OFOA 4QHTA 3K1JA 1G7CA 4PR0A 3SBEA 1E9SA 3VR1A 2ATXA 2WAYA 4FWIB 1GITA 1N5JA 2PL3A 5B64A 4RFSA 1P2SA 5K8TA 1GWNA 1KZ7B 2PJZA 2H8KA 3LLUA 3QPUA 4QFMA 5AR1A 2CJWB 4F91B 2EFHB 3K09A 3ONWA 3AVYA 1JPNA 1E2PA 3ZDQA 3PFIA 2JJ8A 2CL7X 3DM9B 4MUAA 4RCYA 2ZROA 1G291 4DCSA 1IHUA 3WHKA 4CGZA 2HLDA 1RYFA 2TMKA 3LXXA 3VKGA 4HB3A 1KJZA 1W36C 1P9WA 1CRQA 2IBMA 4TT3A 3QIAA 3THWB 4MRNA 4EPXA 2VF7A 1DG1G 1OXUA 5E7JA 5L3QB 5AWFC 2RCNA 2HYIC 3PJRA 1ANKA 2PEYA 2WWHA 3QOFA 3LXRA 4PFSA 2A7QA 4DLSA 2ZIAA 3EPLA 3M1IA 4UNSA 3TUJC 1A4RA 5FUVA 1JQJC 2V8OA 2O52A 1FTSA 1BKDR 2QNRA 3EIHA 4FWTA 4C4PA 1UKZA 5FOUA 3KXKA 2GJ9A 4NE2A 3W5IA 1OKKA 1G9XA 2D3WA 3W3AA 4JT2A 2GJSA 1M74A 4DB4A 3KQHA 1JR6A 1VHLA 4I1SA 5KU1A 1QF9A 2Q0HA 4Q00A 3RS3A 3B8HA 4QC2A 3JZMA 2WMOB 2QG6A 4BFTA 5KO2A 2D2FA 4XSHA 5EZ6B 2BMFA 4ILEA 4M21A 1E9EA 1US8B 1NMYA 5EXSA 1E2HA 1S3GA 2QAGC 3BD9A 3SOPA 4DLZA 4HEJA 4LYAA 2V9PA 1Z8FA 1W7AA 3FKQA 3QJYA 2O5VA 3BC1A 2J41A 1NIPA 3FE2A 1F6BA 4Q1BA 4NKRA 2KE5A 2EWWA 2ZAOA 4TYYA 1K5GA 3SQXA 3VNUA 1D2NA 3CB4A 4PQYA 4JBYA 4ZV4A 1CJVC 1CR1A 4C3ZA 1YZGA 1HTWA 2XOKD 1SXJA 2ZSFA 4FXPA 4HI0E 3WNBA 4B44A 1XWIA 2Q6TA 1FMJA 1ZM4A 3AF3A 3P27A 5DE3A 2AK3A 2QL6A 3FHOA 4DLTA 3MWLA 2WKQA 4PZYA 2GEDA 3SEAA 2FMXA 2F43B 3ZVRA 4ARZA 3OFNA 2YVUA 2CVFA 3GLFE 2GWHA 2LWIA 3U3JA 4PXAA 1IOZA 1TNDA 1DAFA 1E0JA 4JL6A 3GPLA 2VSFA 3X1YA 3A4MA 4QGHA 5B30A 1YKSA 2OEPA 3U7EB 1CR0A 4GOKA 4C9BA 3QKSB 5HTKA 3GJ5A 4PSAA 3C15C 3H1TA 1GRNA 3THOA 3LX5A 3CH5A 1NLZA 4D0LB 1OFIA 3EWAA 4YQFA 1OIVA 5FPHA 2REXB 2A5JA 2QTHA 2O8BA 2GETA 1OXTA 5EE5B 4TYPA 2IYXA 1Z3IX 3EPJA 1U0JA 1ZNXA 2FFBA 2EWVA 3W90A 2GA8A 4M1KA 1OIWA 2OT3B 1KJWA 1KO7A 1YHNA 3LBIA 2GESA 4W7SA 5BN3A 2R9VA 3PEVA 4Q66C 1VCMA 2PT5A 2IUSA 1HYQA 4C7OB 1I2MA 3N2IA 5JMTA 4MYTA 2A78A 4N1AA 1ZM3A 2REBA 1UKYA 2VP5A 3TSWA 4H1UA 1FP7A 1M6NA 2HXYA 3OEHA 2P67A 4WXPA 4ABYA 3I62A 4MKFA 4ZDKA 3MWYW 1U81A 4ERNA 2WWXA 3PEYA 4IDNA 1CJUC 4GT1A 4IXNA 5AK0A 2XNSA 5D3MA 4IDQA 4G3XA 4OQNA 2P5SA 4BFSA 2VHTA 3FMPB 3V00A 3U6KA 1I2DA 1W5TA 3B13B 3Q9LA 1XZPA 1XCMA 3OIWA 1ZNYA 2IWHA 4LI0A 4US0R 1AS0A 3D31A 3UKDA 3KTAA 5SZJA 4JYBA 4OI2A 2J3EA 3TVDA 4E09A 4KJZA 3IPYA 2WJIA 2Z0MA 3CF2A 1NKSA 4LSGA 2V1XA 1RVDA 2PH1A 5JRZA 4N0DA 3P26A 2BBOA 2B8TA 5B57C 4CYMA 2AHOA 3Q7PA 4Z8XA 2Z6VA 4LOAA 4JVMA 2R6AA 1RYHA 2OILA 2QZ4A 3NH6A 1XTIA 4JLAA 2IL1A 3V4RA 1YR9A 4GBMA 2R65A 1VHTA 1E1QD 2QPOA 2P2LA 1E1QA 3KJHA 3KXLA 1W4RA 2XJ9A 4LJ8A 3U4QA 3PUYA 2PZFA 3SE0A 2RGDA 1UAAA 1DPFA 4QG7A 4X8MA 1Q1BA 3FPAA 4AD8A 5JWOA 2PCLA 4PC1A 1WF3A 2OE2A
chains in the Genus database with same CATH superfamily
3GLKA 2IH2A 3LU1A 4CLXA 1TA4A 2B6NA 2BN4A 2O7RA 3USES 2X42A 5A5EA 2PL5A 3AMVA 4ZOEA 1N34B 2ACKA 1ST2A 1KBOA 1WMAA 4YCAA 4P92A 5G02A 1GU0A 5EWLA 1E4OA 2CJYA 3RD5A 5KWEA 4FHZA 4I0WB 1QSGA 4W1RA 5JIBA 1YCDA 2D8AA 4H6XA 1KEEB 1XRRA 4S2UA 3G6WA 4R1TA 2O3TA 5CVVA 1JB9A 2Y1XA 4BX8A 5DP1A 4FYXA 4KPYA 3PD7A 4XD7A 3K31A 4IVPA 4GZMA 2LIVA 4UTXA 4LE1A 3WGZA 1E5DA 5ALLA 1LRKA 4ACAA 4B17A 4LRTB 4U0KA 4HUQA 4DIUA 1SQ0A 2ZJ2A 3RSLA 1Q20A 5FUYA 2J5RA 4OK5A 2FWIA 3UV3A 2WDPA 3HCFA 3P0FA 2YXPX 1AKVA 3AXTA 3VV3A 3WLRA 4DEVA 5SY6A 1Q7CA 3ZD6A 4WOBA 3UHJA 2QPLA 1W581 1SHLA 2VZLA 4UQOA 3BDAA 4LQ4A 1KZ6A 3LECA 4P7GA 3RS4A 3EGXA 2J6CA 2X6TA 2HMVA 3FWNA 3K8QA 4Z9FA 9LDTA 2H2WA 1B73A 2ZM5A 1PUJA 2XB4A 4AJ1A 4XLLA 3GH3A 1PGQA 1W34A 1FBNA 3D2LA 3VNSA 2O8DB 4MVJE 3DOIA 3TOCA 1FMCA 2M2IA 2PLRA 3C8ZA 3TH5A 1HDRA 2RI0A 3CCCA 1JBQA 1TZKA 4ENSA 1OAAA 2G1JA 1QRDA 3PKZA 1DXQA 3GAAA 4IEFB 4D44A 3T95A 2I33A 2TMDA 2O1XA 4NE9A 1NM5A 3A4TA 3ECAA 4RYDA 1CZKA 2FG6C 2HIHA 5K4HA 3JXEA 1RJGA 3O9VA 2VDJA 3RARA 3LBFA 2C2MA 2YIJA 4O4IF 5GAJA 5MN4A 1YDGA 2A2ZA 4HFJA 1WDTA 4MWZA 3PZBA 2PUTA 4AG6A 4D3YA 1U0GA 3QQ5A 4F45A 2PZGA 3PNVA 3LC7O 5AJWA 3GYGA 1Z6GA 4UCXA 5JCPA 4IX1A 4L5IA 2VF2A 3D1LA 1RI5A 1XZKA 2OZEA 3ACBA 2O07A 1E7RA 3O8QB 1IBSA 4WEOA 1ORWA 4EI9A 2I29A 1A7AA 3EH1A 1YTUA 3G8BA 2WWIA 2IOYA 3B9RA 1EHYA 3OSUA 3AERB 1IEWA 4KXLA 3ZE6A 1GPWB 1U04A 4XIGS 1K5DA 3OMLA 3WGYA 1YV9A 5EHQA 2VHWA 2E55A 3A1WA 4TWJA 1LI4A 2BY4A 5FWNA 3WLEA 4PAGA 1E7MA 2QAJA 3HR8A 2ZJ5A 3U48A 1WMEA 2PUFA 4AY2A 3OHMA 4C6RA 2C07A 3BICA 3H9BA 1Q12A 3L46A 1NXXA 1ZJ4A 4DCNA 2JHPA 2M98A 2W5UA 3U19A 2GX6A 1H0SA 4DW8A 4KQ2A 5JBIA 2NUPB 5KB3A 1OA0A 2PLAA 3AM5A 2X7JA 4KPUB 3JS5A 4MRRA 1E6UA 1E3SA 1F2UB 1P60A 1QGUA 5ICSA 1USGA 1LX6A 1FL9A 4KCGA 5IDWA 3C8UA 1QKKA 2FWNA 3WHLA 4KRXA 1ZVMA 4P34A 2VJNA 2WPDD 1M2VB 4RD4A 2FN7A 1GNVA 4AF8A 2B8JA 2QJWA 4DYHA 4EKIA 4B7XA 2XB6A 1ETUA 2G72A 4UAUA 1EFRD 3TNFA 3CONA 3X1ZA 4L51A 4CLEA 5K3EA 4TZ0A 3LW8A 1M2FA 1WVMA 3DMPA 4FGZA 1L7RA 4ND6A 2J32A 1ORHA 1UPUA 4HK4A 4LVUA 4BZPA 5HE9A 3MCAA 4QECA 2WIGA 1T2FA 3WDSA 3WYNA 3DVAB 4M0EA 1D1SA 3PHIA 2CLDX 4ZDWA 3JWHA 2IIQA 2C7QA 3AERA 1MZVA 1JHUA 1VZ2A 2R97A 1COWA 4OQLA 2HA3A 4O4LA 1J2TA 1IMOA 2WIFA 4DEXA 1LCIA 2FFRA 1TZJA 5LQMA 5ALEA 2MU1A 1U7PA 4A15A 5KUTA 1C0IA 4QJBA 1T3ZA 2RHRA 3D6VA 4BFXA 4M55A 4K03A 5SV2A 5KTMA 3JQ8A 1Z75A 4NL4H 1VIDA 2KSQA 3GB9A 1JFTA 1PLLA 2JIPA 3AYZB 3FJ1A 5CLLA 3BCUA 1EVKA 2LKDA 2QL5A 4W5WA 3S2FA 3G2QA 2WM3A 4M0MA 1X1EA 1OJLA 3RYFA 4BMVA 4RXTA 1A9ZA 3G79A 3WE7A 1FS6A 1ONNA 3CWCA 4J94A 3MCZA 1N5RA 3CZMA 3ABSB 3KOYA 1FU7A 4FFNA 3K20A 1E3LA 4XGNA 4UAGA 2ZIGA 2GD1O 1NN3A 4AP6A 2A3NA 3A1EA 2ZR8A 3FBWA 1E7WA 2HLHA 1DKNA 1YJAA 3DHEA 3I4FA 2VOEA 3IUQA 4YAWA 1NU8A 3G3EA 5DV9A 3VH3A 2VK4A 3PDUA 5HK9A 3DMTC 3OQPA 4X7PA 1ZUD1 4JBLA 1U6IA 1ZC3A 1SXIA 1DAIA 1T1IA 3KO8A 4KO4S 3IAS1 3I8OA 5CM2Z 3ZI7A 4B3TB 2PXAA 2IUEA 2PH7A 1Z4LA 3U3KA 3OM9A 2GFIA 2GRUA 3QSYA 3L1VA 5ES3A 5ECGC 1NNSA 3NJRA 3MSXA 4G0OA 4KPEC 5IEJA 3V3TA 3D3QA 2O57A 1QYDA 1JNYA 4FZ5A 6REQB 1Z5ZA 4MJ3A 1LDGA 3IIEA 2R1VB 2XWPA 1TQHA 4FGUA 3PPXA 2G1AA 3TOVA 2DQ4A 4TL8A 2JCSA 2WUFA 2YNMC 3UWOA 5KNCH 1TIBA 1X94A 2FF7A 1JWAB 4TQAA 3ANMA 3IAM1 3FNQA 3Q15C 3BMXA 1V11A 3A25A 4M8SA 2SBTA 4TS4A 3AM1A 4TOIA 3WGHA 4PHHA 2DQSA 2Y1KA 1NW5A 3AO0B 3DL0A 2GI4A 5C8YA 4LX8A 2CMHA 5BXQC 4EB6A 4IGFA 4U2KA 3ZWWA 4FFBA 1R9JA 1HBJA 1PKEA 5BPFA 4NYIR 3K5HA 3PGXA 3BJEA 4TKUA 1JFVA 1XDUA 3D1VA 1ZVKA 3SHTA 5BVHB 2DULA 1SC9A 4CPDA 2PGNA 3TW4A 4U9UA 3H5LA 3IE1A 3WRXC 5K6RA 3N7TA 1KU6A 2Q5IA 4JK3A 2AG1A 3N39C 4RA9B 4EQ6A 2X1MA 4JJZA 2JJ1D 2CLHB 1AZTA 1QYXA 3FM9A 2ONCA 3HCEA 4ZZ2A 2PK3A 3EIEA 3ETCA 4G56A 1PL8A 1OD6A 1D03A 2R6GA 3F9RA 5GZ1A 3QK7A 1QIDA 3LV8A 3NBMA 1U28C 4JOSA 4QTYA 3QHAA 1QNFA 4LK3A 1N9GA 1FFSA 1UP7A 3FVWA 4LZLA 3FR7A 3WRVA 2VYVA 2DKFA 1HRKA 1PI3A 3R24A 1BJRE 4GVPA 2ZE5A 3FNBA 3QXJA 2WM9B 1BH2A 5FJJA 1EQUA 4XIFA 1L5HB 2XE4A 3MB5A 4TKMA 4PLYA 3SZMA 4NXNB 1USVA 1J8MF 4YUYA 3HPQA 4O4HF 1GAJA 4FIZA 2C5AA 4PCAA 4WNCA 3AY0A 5D3QA 3ZKWB 2XMGA 2Q5EA 5JVDB 4OREX 2J9FB 4YMGA 5CA1B 4KV7A 4WVFA 1XZMA 5FNVB 1GAQA 4D8UA 3ZEIA 4O5AA 1UC5B 2VCHA 4LYJA 3V8MA 1NQTA 1XTPA 1QDLB 2AFIA 2HA2A 2A9VA 1HH4A 3A11A 3FTPA 4M0LA 3WGJA 4JQOA 4YP6A 3GLGA 1IB6A 4ZT3A 3K0BA 4J0QA 3MG9A 4DREA 3R5HA 2W6NA 1OX4B 4ADSG 5ARDA 5IZ4A 1OI2A 1W8IA 2QRQA 2UZ1A 2CXXA 2ZYVX 3I2GA 1T2DA 3KALA 3VTFA 4G0ZA 1JPUA 1QH1A 4IWYA 2CUNA 1ZGJA 3IXLA 1GZ3A 2ZK7A 1K9VF 4XR4A 2JH9A 4D9NA 5GVRA 4INAA 2IEZA 4OMUA 4EHFA 4IWNA 5A4DA 1ABBA 4TSFA 3RTGA 1KDPA 2NTNA 2QVLA 5HCIA 4JC0A 1RKBA 4WL0A 1ZW6A 1OFVA 2H9AA 4CMEC 3L0CA 4OA5A 1TDJA 3LY5A 2Q29A 5LU9A 1RWVA 1BE0A 1DQYA 3MS7A 4BECA 1ZM9A 3A3KA 4OHYA 4WQMA 1QMGA 3NB0A 1TRKA 3IUMA 5DHUA 2HPHA 1VG0B 2Z09A 4Q1AA 3WB0A 1P1IA 3INGA 4ND1A 5DX8A 5H9VA 4Q9IA 1M3SA 4OL9A 1KORA 3DTVD 3IERA 1TCAA 1TT5A 5B3JA 1GQSA 4FWBA 2P2NA 3FPLA 2WFAA 5TB5A 3RLFA 1S4QA 3RG2A 3IKJA 1KVQA 4ZRDA 1Q11A 2QQFA 5IK2D 2PZLA 2NAPA 1ONOA 3WFIA 4DWJA 1WMBA 3GDGA 3VZRA 4E6EA 1HDYA 1T2VA 1KVSA 1RJEA 4OM8A 5DFAA 4BTEA 1WE2A 4IZHA 3AB8A 4TZKA 5GPBA 4IGAA 2D5CA 1FK8A 1MA3A 2WVAA 5K51A 5DOZA 4KVZA 4MR9A 4C3VA 3AF4A 3Q0IA 3L40A 4MYDA 2KYRA 2G40A 5TGZA 2IPAB 2AFIB 1GPAA 1A8UA 3SS8A 2RGGA 3NHRA 1E96A 1OV4A 4GI1A 4HZUB 2ZTMA 3MT0A 3OJEA 1AKNA 1L5YA 1MP0A 2Q7DA 4DLYA 3F4BA 1L6RA 3LBAA 3M4JA 3W04A 5J1TB 3HZZA 1ORVA 2D5AA 4MVWA 1I6KA 4U2BA 4CFSA 3KVOA 1GG8A 3EZ2A 3TW8B 3NNSA 1Z4OA 5FOSA 1EAMA 4EMBA 1KE1A 1E4YA 1ORIA 4MI3A 2XZLA 1YKGA 2ZRAA 5BT9A 4DZZA 2JARA 2QKYA 3ACCA 4TRRA 3SJBA 3GY0A 1WPXA 2YXNA 2FCRA 3C3YA 1H1TA 2JCVA 1IVSA 3DYVA 4EFLA 3D02A 5LOVB 3GU3A 5EUMA 4HQLA 1SXPA 3LQ2A 2W00A 3V4PB 3B9BA 2PRSA 4NBWA 4M99A 4YRDA 4Q9NA 1RPTA 3IUBA 1SQGA 3WWZA 5FL3A 3BA6A 3UXHA 1I10A 5F5XA 1S7GA 4FX5A 3U60B 1XD8A 2Q2WA 4CEIB 3L4SO 2HX1A 2IX3A 3CVXA 4GOJA 3PTLA 4OQMA 4FKZA 4LF9B 4AQDA 1X2BA 2QUJA 2XMZA 1CU1A 4EKDA 2DXIA 1SVSA 1D3AA 3GVXA 2FSFA 2GBFA 3MWGA 3UPTA 1QQTA 3HBFA 1E3IA 3GT3A 3REGA 3AH8A 4RKEA 1WHTB 4EB6B 4LXQA 5L53A 3IPXA 2DUJA 3GRRA 3IP6A 4PSDA 3NASA 3TL6A 2R8RA 2UYHA 1KQFA 4ID3A 3R9XB 1XFDA 3LVQE 3P45A 4QDOA 1LVGA 4V0MA 4RD6A 5K4AA 1JLSA 3OVMA 3HFSA 3JQDA 3QVSA 4H27A 3E9CA 4HWOA 3NGMA 4I66A 2BJHA 4DFDA 4HMOA 4R51A 3CEAA 4NSNA 3VGPA 4CT5A 1M1UA 3G1WA 3WGIA 3TLXA 1VKZA 5K3CA 5C18A 4OHVA 4DYVA 2H1OA 1OAOA 2QEQA 3CNLA 3WG9A 3ASUA 3DTYA 2AT1A 1DQSA 4ES6A 4Y2XA 1N2GA 1C7JA 2QIPA 3NW9A 4MUGA 3RTEA 4Y6PA 1A96A 1T29A 3LQYA 4X24A 1JH9A 4M9SA 1G21B 1V8DA 4DJTA 2I34A 1ATIA 1QK5A 1Y9AA 1RWWA 3BQNB 3K92A 3A9SA 4QZVA 3WL3A 4ECEA 1QZXA 3ABOB 2IELA 3RF6A 3PQ3A 4GLBA 4MS1A 1M2JA 4N5LA 1BX3A 4DLWA 1IBMB 4PCUA 5A7FA 2P6OA 3FY4A 5JS1A 2DVMA 2QF7A 2XCUA 1IN5A 3WLJA 4PW0A 3G0BA 1MTOA 2JK1A 1YQQA 3K96A 5IRCD 2V7EA 2R96A 2ZANA 4JEHA 1NYTA 3BHJA 3BK7A 4LRUA 1GTSA 1NMZA 1AQJA 3ZI0A 3A0RB 1KEVA 4H35A 4INPA 1TD1A 1OXMA 2JGRA 2JVJA 2J3IA 5CW1A 3P9PA 3ZZTA 4B3BA 4PO9A 5A5GA 1ZJ6A 3H4VA 3MWKA 3Q7SA 2C9DA 2YJTD 4BVLA 2YRWA 2QS9A 3K0CA 5AUNB 1W25A 1IDOA 1OX5A 4LHSA 4RZ3A 2II6A 3RRNA 2P2SA 4GR9A 1P8JA 1P6QA 2YDYA 3FDJA 1JFSA 1YJ8A 4MDHA 4ZC8A 1MIHA 3O8LA 1NUAA 1X38A 2H18A 1UF9A 3FWYA 5DHPA 4HTAA 4CQLB 2Q5CA 2GK3A 5KQMA 4HEHA 2H5LA 2DUWA 1FFWA 1C1HA 1N57A 3HUTA 4JJ4A 5D86A 5BSMA 2VJBA 2FXVA 4NAHA 4WKOA 3WMFA 4A6PA 1JZQA 4FZRA 5ESDA 1K6XA 2A9PA 2D4HA 1OUMA 1T8WA 2F7SA 4V0RA 1C9EA 3AL3A 1U6JA 4P2BA 4EKEA 1MDFA 5L3VA 2XUIA 2FOIA 3WLTA 3DAPA 5ANRB 1WDMA 4A0RA 4BLOA 1UJCA 2JRLA 1JWLA 5F35A 3FNGA 4NPCA 4QBGB 5F3RA 2NUBA 1Z22A 2WD7A 5EXEA 1GFSA 3AJ9A 1P7WA 3KPJA 3O6VA 1ZN2A 3SFVA 3SY8A 3SLRA 1E1RD 2OWEA 5JCXA 3RSZA 2RG7A 3KZVA 1QP0A 3U3OA 1OH8A 3VSBA 4FGJA 4UDNA 4O3FA 3AIMA 5ICGA 1KJJA 4ROTA 4CZ2A 2QTWB 1TUBB 4PGGA 1Y42X 2ST1A 3OQIB 3T9EA 3VR6D 4R9UC 1IPFA 2R4QA 2V45A 2IKSA 5JR3A 4Z0NA 5AVQA 1D2GA 3T8YA 2X8JB 2QQ5A 2VN8A 3QW2A 2FPSA 1LJUA 2ZBDA 5JC1A 3N6VA 4UARA 4YMSA 2YWCA 4KQ9A 1SBZA 1E6MA 4JZYA 3DVQX 4UDYX 3CF0A 1BVHA 5DM0A 4KIJA 4ZYLA 2Q28A 3L0SA 2Y68A 1CEXA 3KEFA 2F3TA 3LGXA 4N8EA 4XLTA 4IMPA 1EFAA 3Q9SA 5KTTA 5EHNA 4LOLA 1YRLA 2NO7A 2VJYA 5FBWB 3RHTA 3WYCA 3PE3A 2VNIA 1GPMA 3HFRA 2XDQA 1RM3A 1WP4A 3B2NA 1LBSA 5AXDA 1QRTA 2ACVA 5KYUB 1R4ZA 5C4IA 3K73O 1H42A 1ZI6A 5BOSA 1M54A 1VG1A 3FSGD 3HXOA 1ZVVA 4M9UA 2MR6A 3B12A 4WSOA 1Y6QA 5HF9A 1XIVA 2EBWA 2Q62A 2Q6IA 3QMPA 2FX2A 1SZPA 4QVKA 1G3QA 3KZ1E 1QGOA 2B8EA 1DAOA 2GERA 2M9MA 1VJRA 2YVQA 3AEUB 2EYQA 1ZL0A 4KIGA 1QANA 3OJCA 4KUGA 4BNZA 4HR7A 1R00A 2O8BB 2Z9CA 4NV3A 3S28A 4UOEA 2OYSA 3P20A 4YC7A 5LR6A 1V45E 3FVQA 4MKXA 5HCNA 4TTAA 4YMWA 4G4SP 4IEEA 2ZIVB 3DFMA 3X43A 1DJPA 2FWBA 1ZKDA 1EXNA 2GZ2A 3ZN2A 4QPCA 2XVAA 3PWSA 5A9TA 3GFOA 3A6KA 4XTCS 1U0FA 2PL9A 2B1QA 2NO5A 2R2GA 4JJGA 3M49A 2NU8A 3REFA 3VNBA 5JT1A 4TWAA 1J0DA 1L4FA 4NQZA 4F4DA 4GL2A 2HTEA 4R3UC 2UV8A 4R8MA 1H8HD 1RS0A 1U0SY 2IYSA 2WNSA 4G5QA 3F47A 2Q8NA 4Q9AA 3E9ZA 2ZUWA 2WUEA 1OLUA 5CTAA 2BM8A 1WUYA 2WP8J 5IJAA 2GSWA 3ZHUA 2C04A 2W0MA 4NECA 2FRDC 1AB6A 4PYOA 4DABA 4EFKA 4QAJA 4JKOA 4F2PA 5KYXA 3C48A 3G7NA 2IE8A 5K3SA 3SDBA 2C3MA 3R5FA 3I2YX 5SYNA 3CINA 1JA1A 1J07A 3UK6A 4RJKA 2O23A 3B5EA 3O4JA 3LQFA 1L5QA 2ZSHA 3IEUA 4KNWA 1AUXA 5K7SA 5C80A 1NX9A 1PIWA 2E4VA 4YAEA 3A37A 1A71A 4OHWA 4EVRA 2VKQA 4ILKA 2R1VA 2V5AA 3IDSA 4FZVA 5AKGA 3H2ZA 3LWZA 1ZRSA 3HYNA 3WSTA 4EB0A 4TM7A 3PUWA 1V2HE 4P33A 5J63A 3U37A 3WHPA 5JWHA 1XDDA 2QP9X 1Z56C 1WD5A 3I9FA 4TSKA 3WC4A 5M29A 1BTOA 3I64A 5DLQC 4B4DA 3TEFA 4IV8A 3X1XA 5JSYA 2YMLA 3HDYA 2BGJA 1Z4NA 4MWEA 2O1SA 4E2YA 1PL6A 2VRBA 1HFKA 3LCCA 6AT1A 5LDDC 5CRIA 4S3MA 5CPFA 3GBPA 3OQBA 4K6OA 1VYTA 1K8RA 1A2QA 1TTHA 5FBRB 3WRYC 4RADA 2ZYTX 4MGKR 3EEYA 2I2WA 4MA4A 4I3FA 3QLTA 2PKXA 5DBOA 1OSNA 2FMFA 4FQ5A 1EX1A 2VTBB 3JVEA 3O4GA 2CBXA 3C6ZA 3GJ6A 5K8CA 3HFGA 4UHFA 3RVMA 2BCGY 2ZRDA 1PD0A 3HP7A 2FDXA 2P41A 2PYDA 1CTQA 2VIIA 4P5PA 1AK2A 4RHFA 4BFYA 5KVCA 2R1TA 3O47A 5HGXA 4G84A 2BAGA 5BN1A 3OLQA 2JFPA 2HLNA 2XXJA 4HEA6 2NU9A 1IHXA 1KBZA 3KSMA 2X1LA 1WUTA 3UZUA 4U0JA 1DCFA 4COKA 1SXHA 1HL7A 4I9NA 5CM8B 3BKWA 2WHPA 3D43A 2XNJA 3O8NA 1SC3A 1KRXA 4O2RA 1W30A 3L6BA 3CVJA 2FK7A 3ZY5A 2Q7XA 1AK9A 1EDEA 2OFFA 1NF8A 3OAAA 2VJCA 2WHPB 1E20A 4GLJA 5CX1A 4CCAA 5LXTF 2MDTA 3R8CA 5EE0A 4YQEA 2OLJA 4V3CA 1LSSA 3BMNB 1QZUA 4QIHA 2OCYC 4FDVA 4HD8A 4URFA 1AOXA 1KVRA 4FMCB 3SU8A 3WQBA 1UP4A 1SCUA 1D0IA 1N1GA 3MGGA 1BU5A 3B53X 3PDJA 4FT4A 1T0BA 3RYFB 4CM8B 3FAKA 2FUG6 3OQJA 4R2MA 1XRLA 4CETA 3FPEA 2ZIXA 3ROKA 2Z2KA 3AF2A 1ULUA 1XYGA 3CNBA 3JQ9A 2PAAA 4FJ1A 3EWSA 1T4CA 3UANA 4D4IA 1UBEA 1XRSB 2NYUA 2AHRA 2AV6A 3VOSA 1FXWA 2AMVA 1J8YF 3DOOA 3L6OO 2VHVA 4DDUA 1P3JA 4IIFA 2VH5R 3I8SA 4EK9A 1B41A 2B7CA 5FNVF 5KNCD 5LD2B 4JUIA 1K92A 3AHJA 5G0WA 1HQDA 4QELA 1SG0A 3TRJA 4CKCA 1XZCA 3RROA 4XX0B 2C5BA 2JZCA 3W4KA 2X14A 1SC4A 4WIAA 2YWBA 4EA7A 2X4LA 5AM3A 1P4RA 1P2BA 4PQEA 4QICA 1DJLA 1EG7A 3OT1B 5B1HA 3IEXA 4NY1A 1VLHA 5FQNA 5ULLA 4L4XA 3VYTB 5I7EA 3HU3A 1YA6A 4ZHQB 1FX0B 2XNCA 5EQDA 2VQSA 4EA8A 4E70A 2WTNA 4C05A 3QA9A 1Q50A 1D5WA 2OHOA 3KEGA 3QVGA 4G41A 4E4YA 4AQ7A 1X1TA 2B21A 3GEGA 1CETA 1C7QA 1HG1A 1U7TA 5ER6A 2Q4OA 4S0XA 5SZIA 1KSHA 1E3QA 2F1IA 2ZU6A 3B2QA 4MWOA 2JGDA 3CO0S 4NJOA 4URYR 1X3SA 3GV0A 1E9DA 3OX4A 3TZHA 1NF2A 4D41A 1FUKA 2IHKA 2WIKA 3FTNA 4HNAA 4LPSA 4TVBA 5DF1A 3KQOA 2EBHX 1CUEA 1O03A 1N3LA 1NG1A 2OTCA 4DCUA 3DT9A 3NKLA 3DTNA 2W58A 4B34A 2P9CA 3B1VA 5DGXA 1DTWB 4C0SA 2CWWA 3D8RA 4NG4A 3ND5A 5IKXA 2CB0A 4RF3A 2GCOB 3NUZA 4KXVA 3NIGB 3O4FA 4R5MA 1E5TA 3ZY3A 2NZ8A 4TRMA 5CM9C 1LDMA 4Y9UA 2IFTA 4D57A 1IY1A 2XXBA 4BGIA 2WUGA 3DE6X 4EW2A 2QJOA 4UM7A 1SUDA 1HGXA 2CF5A 3AL2A 3S81A 1Q1GA 4BMCA 1RMTA 2Y2VA 2E6KA 1JQDA 1XXHE 1YWGO 2FW0A 3BGIA 3F7OA 2DWOA 3LLCA 5BQ5A 4MWGA 3ZDYB 2QSYA 3AFNA 4C14A 4C89A 4CF4A 4YCNA 2VJQA 3X2FA 2I9PA 4EG3A 1SK8A 1AHHA 2J1LA 1XMPA 4OQQA 4CTNA 1TCUA 2H4HA 3BXGA 1QHHB 1P5ZB 2CLCX 1GGMA 3IQXA 4JUCA 1IQUA 3DZIA 2OCIA 1EVLA 4BO2A 3DNMA 2JGJA 5JNSA 3G8YA 4PZLA 4FB4A 4B4VA 1URPA 3H5RA 3ESDA 2I91A 1WSAA 3EVFA 1YOVA 3F5SA 4LY6A 4DLAA 4OTZA 1WMDA 3GWGA 3JYOA 4FHEA 4ZO8A 3VO8A 2FN8A 1RXEA 2C9BA 2VTKA 2ZI7A 3HZHA 1FNMA 2QY6A 4DQXA 2AN1A 3Q41A 3AY7A 3R6WA 2D5BA 1VE6A 4DUYB 3V7NA 221PA 3PLNA 2VUHB 1FMFA 1G16A 2E9SA 4YR7A 3Q3EA 2PN1A 3PI6A 4EATA 1G20E 2J08A 4CTJA 3IAFA 3EGEA 4WNAB 1OFUX 4BX2A 5B5SA 3FCAA 2WV7A 5L51A 2XLCA 3L9WA 4TTPA 2E89A 1RQGA 4WLFA 4CTKA 1NI3A 4BHTA 1RAGA 3R0JA 2PSHA 3QVXA 2VJPA 2JW5A 4MP6A 4O0LA 2E21A 3WYEA 4BZXA 4PQFA 1PV2A 4MYHA 1KAOA 1IIBA 2O2SA 1CY0A 3IBCA 1GV1A 4BQFA 2M1XA 1ZJJA 2PXCA 3R44A 3LUHA 3ABRB 5K8LA 1EVYA 1AO3A 4LV5B 1WB6A 3MD0A 1F4LA 3O8OA 3NHMA 2G5CA 5EJ4A 2E4XA 1PBTA 2X8LA 3JRNA 1E63A 3GELA 1YUBA 3DUFB 4ZN6A 3L1HA 1T0IA 1QF6A 1L5SA 3HO8A 2BLLA 2RGBA 4G0WA 3LF1A 4FTWA 3DO5A 4AUMA 3IRUA 4MB0A 4YAKA 1LDBA 4ZPJA 4ZVUA 2O8FA 2DY1A 1QGED 1IJEA 5FOWA 2W2MA 2BKAA 1R0XA 3REQA 3WWYA 2XCLA 2QPTA 4P0PB 5TIIA 1FNBA 3P4XA 2VJKA 4OEHA 4RTQA 5K01A 1J24A 1YR6A 2JFGA 3IEVA 1T9ZA 4MCHA 2D1SA 3ZNNA 1Y1QA 2R7AA 2WJWA 3NCTA 1MKYA 2FSIA 3QZUA 2PMWB 2NXWA 1OLXB 4Y6SA 5EG5A 3KKKA 2PS0A 5ILGA 4YT4A 1BWSA 2DUNA 3AB3A 2ZRNA 1H5QA 4CR6A 1EJ2A 2VQ6A 5A6SB 4HBGA 1WRBA 3EPRA 2HH9A 2HRRA 2ZUDA 4ZDIA 4G07A 3K35A 1BXRB 4H4CA 4UFOA 3W5HA 2W2NA 3KD3A 1HSZA 2BISA 1L8AA 1GUYA 2XT6A 3C5CA 2YHIA 4BCBA 3DHNA 3TSOA 2QJRA 3HABA 3W9BA 2WABA 4X61A 1NR7A 4JEUA 3FFBA 3FYUC 4L8YA 5CYPA 3ZXIA 5MF6A 3T9CA 2RK3A 3NFRA 1GQRA 3PNQA 5CAEA 1XRMA 3EVAA 4O4HB 4ODIA 2HLPA 4IH4A 1GZUA 4MW2A 1Y1LA 4ZZIA 3P2MA 2ON6A 5TT1A 5D5PA 1YFJA 1L4YA 1XQXA 1DO2A 4YBZA 5I3ZA 4KTVE 2W11A 3PHBE 4WKCA 4C7BA 2Y0CA 2R00C 1Y8ZA 4EMSA 2CXRA 2WA2A 3N74A 3A1NA 5G40A 1HE4A 2ADMA 1QE5A 1RTTA 3RAFC 1FRFS 2P30A 3WBJA 4JSYA 1RHJA 2H0AA 2O0LA 2CLOB 2BMEA 3DBLB 1Y3HA 2MYTA 3LZ6A 3ZWYA 3Q12A 1DQRA 1GV0A 4WGGA 2C5HA 2CD7A 5AIAA 2GZAA 2IA5A 2GLTA 4PAOA 5FUMA 1RPAA 4YRZA 4OKSA 3RWMB 1RSZA 3GZ4A 3MF4A 5A62A 4R8LA 2OORA 3W2HA 1C0PA 2F00A 3H1FA 1T13A 5GGYA 3VISA 1EK6A 1VTKA 5AI5A 1OI4A 1A9QA 3P0IA 3R9XA 1WX1A 1STOA 2V6IA 4JJ6A 1UK8A 4BE4A 3MGCA 1MJGA 3GC6A 1NDHA 3D2BA 4FBLA 4WESB 5AOAA 4ER5A 4DV7B 5EJ7A 1XQ9A 3D7MA 1VIYA 3CUUA 3TTYA 5KI6A 4GPBA 1XV5A 1H4VB 3ENZA 2DQZA 1SVKA 2VR1A 2YMQA 3K16A 3DDOA 2OBYA 3TIIA 4HN9A 1VKNA 2HC9A 1EZ1A 2C2XA 3UF0A 5CA1A 3KNZA 2RIRA 1W5FA 4RHUA 3ICWA 3OFVA 2DH5A 3FBGA 1GP2A 1VBFA 2P0AA 4MQEB 4NDZA 1JQ3A 2PQ6A 3AU8A 2WTEA 2BZGA 4I1YA 4LZWA 5DM2A 1GUAA 3TB6A 3WLPA 4ABTA 5IVKA 1MVOA 1F9AA 1Z37A 2H17A 2YV2A 4J4BA 1YAHA 2QLMA 4EUHA 5CGZA 1JDJA 5F2EA 1I4EB 1NOJA 4J0EA 5K3BA 4Z7OB 1PJTA 3RUCA 3AIKA 2P68A 3B5JA 1YRHA 5F73A 5ED4A 4NRDA 3NXKA 5EXXA 3GW8A 3HR4A 3OTWA 3ZY2A 5U9CA 3R3YA 1Y8QA 1QVRA 1U2RA 5D3KA 5AVOA 4OCZA 4BLUA 1PUXA 5AJZA 1GEEA 3G2IA 3KKPA 4N39A 3R40A 4HB2A 5B37A 5REQB 2EKPA 3AXSA 1G7SA 4ZANA 2QVZX 3C5VA 3DJFA 4V0OA 1RABA 1QGYA 2NP7A 4NCXA 2JLQA 1GG5A 1XYYA 1Y3DE 4MGZR 5IKPA 4I46A 4CKYA 4HVTA 5KCMA 3ROGA 2GYVA 5DI3A 4EF5A 1NSFA 5FBLB 4EG4A 4X97A 2P2GA 2ZETA 3E84A 1LI5A 3A4VA 5KQPA 1GKLA 1ULAA 1WUHS 1JB1A 4MUXA 3W9YA 1P75A 3C16C 3TR0A 1XQ1A 5DMHA 4X00A 3ROZA 1Y9JA 3W7AA 4AJNA 2B4KA 3KELA 3OTGA 1SHJA 4L6IA 4IQ8A 4PPNA 2Q3MA 4ZMBA 5JSHA 2ATCA 3ZGZA 2I99A 2NOAA 2YFQA 3V4OA 2BC9A 3REOA 3DKPA 1DX4A 4DIEA 2PUHA 4N5MA 4IIXA 1KI6B 3QKRB 1JXOA 3OOWA 4BRZA 3Q1KA 1WBDA 4B6PA 4UNNA 5DKFA 1JDBB 3WGUA 4X20A 2C83A 2X9GA 5EN4A 2CLIB 5EKDA 1JSCA 3OKCA 5E1MA 4K8RB 1OA1A 1SWVA 3IR5A 1UH5A 1WY5A 1AB5A 1Z12A 4H08A 1N5LA 1TOAA 3T12A 4F1WA 4H7JA 2XSZA 4LOHA 4QNRA 5EIXA 4YP7A 5LBIA 2YINC 5I45A 3AJAA 2I6QA 3WB2A 4CM9D 2JFOA 2W4QA 1S2GA 3NBZC 4R2LA 3EMBA 4V02A 2CE2X 1D2EA 1JHVA 1U63A 3I6YA 3ICOA 4MQ5A 3AEQB 1A2BA 3NIBA 3A2NA 1QZZA 1N2CE 1WM1A 3EZ9A 1MC1A 1UXOA 1KFBB 2VPYA 3IT3A 5H1YA 3WV5A 3AEKA 4F11A 4JI0B 3BVPA 4H0NA 3TK1A 1WZNA 4Z9XA 1HTTA 3L9XA 2IXGA 3CRMA 3KB2A 4XYGA 1E62A 4ZOBA 1MV5A 4RLHA 1DDIA 3FSEA 3K5PA 4ZICA 1ILEA 2VLIA 2FUNB 3KRTA 1T1SA 1MOQA 1YQWA 2B36A 4G97A 4PAMA 3KU1A 3VGJA 3O7WA 1PSDA 3EY4A 1KQNA 4C7KA 3N86A 5J2UF 1QRAA 2W2XA 1ZL2A 2R85A 4CVNA 1AKEA 3Q8LA 1VKOA 3SSOA 4QRHA 4OMFG 3ZE2B 3QPAA 5CHYA 3K71B 1GQOA 1JDUA 4X91A 1VL1A 1IN4A 4CDGA 5D3MB 2DR2A 1MABA 3TTTA 2GZ3A 4HDQB 2YC4C 3DUFA 3L5KA 1C30B 4U6NA 5AUOB 1E8MA 4I19A 2VWPA 4IHQA 3GFBA 2AE1A 4N6GA 4M9XA 4MI9A 4O0MA 4RLFA 4DUGD 4B3RB 1CFJA 3PT5A 1ESMA 3TDKA 1B8PA 1M1NB 5H16A 4P4NA 3INRA 4YB8A 5TQ2B 1QZ3A 2E2WA 1LRJA 5KX5A 4RY2A 2OFXA 1ZFNA 4FYMA 2MYUA 1BOFA 1YQTA 2BOVA 2BMWA 2H3EA 1VDMA 2I3AA 3R3XA 2VPZA 3FLMA 4A7PA 2WT8A 3KVVA 4EJFA 5THKA 2A92A 4ZVTA 4GOXA 3GYBA 3BSFA 2VQDA 1K6IA 2R2AA 4TL7A 3URMA 4Y2RA 1NXTA 3QG1A 4XWKA 1N2IA 2VA8A 2GBGA 3DD5A 4H6WA 4KYUA 5C2JB 3PUKA 2DLDA 4NC9A 5T67A 3DC2A 4D8TA 1HLFA 5DTMA 2J59A 5A6SA 1VXOA 4QVGA 3GBVA 4PC7A 1RWOA 4R7ZA 1O77A 1QORA 4QEKA 5AKHA 1Y33E 3FOWA 4OJMX 2F59A 1NASA 3F0TA 3PXXA 3ZNQA 2ZGVA 3I32A 3ND9A 4PFQA 4FFMA 1AA9A 2D2IA 1KO1A 2J5XA 5GP1A 4EI8A 3PVZA 1XRQA 2QV7A 3H11B 4G8DA 3LE8A 3WKEA 5I9IA 4HH1A 2V7XA 4A0FA 4V03A 3PX3A 3E5MA 4BJHB 2GVZC 1SZDA 3E9DA 4J0DA 5DTJA 2IEYA 5IJXA 4TS9A 1M1YA 1P19A 4CHTA 4Q24A 1Z2NX 3N0WA 5HIMA 4MA5A 1ZS9A 3JQAD 2D3TA 1PG0A 4MQEA 5U4QA 4FYJA 1ZIDA 4KWIA 4IQ0A 2PZAA 3CPHA 2YV5A 4PRZA 1NW8A 4KODA 5KEIA 4BP8A 1DGQA 5TR9A 2GB4A 2ZSDA 1CEEA 2NO9A 4EZEA 5B36A 3A14A 3LPCA 4I6JA 4YI3A 1V2GA 3D7NA 3NC1C 3E0QA 3A9CA 3JR7A 1J21A 1DO0A 1DEHA 4I5FA 5I7VA 1A1VA 1T4GA 1DZ3A 3K4PA 4K9DA 3ZD8A 5KYGA 1SUBA 1U3GA 2J9FA 4W99A 4AMYA 4HFNA 3L0ZA 3JQ6A 4HOYA 4GR5A 1U2PA 2AE2A 3UBMA 3IMEA 4XJVA 2MMCA 3RJZA 2KPOA 3CURA 2ZBUA 2X3FA 3WKAA 2P2YA 4I3GA 2HHCA 2CSUA 1VBMA 2HU8A 3ETNA 3QVTA 5HBGA 3R23A 4G2TA 1E2UA 4JN6B 2XYHA 4XB6B 1UEJA 4X8OA 3VHXA 2H65A 5FTLA 5CIYA 1HT2E 3ZX5A 2WWRA 3LO8A 4OK3A 4ZU6X 2Z8YM 4HH3C 2Q5LA 3PFGA 5F4ZA 4F4CA 4DDKA 3T3MB 1SU7A 1R37A 5LQSA 3HSKA 2GXAA 1N5IA 3R7WA 4YRIA 2ODTX 4GLLA 3C3EA 4LF8B 3HXLA 3MIIA 1YI1A 1N6KA 1FDVA 2PZKA 2WFZA 3EW9A 3EXHB 3N7UA 121PA 4G8CA 4I8DA 4LV8B 2YZGA 7REQA