4R8KA

Crystal structure of the guinea pig l-asparaginase 1 catalytic domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
355
structure length
355
Chain Sequence
SERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein
publication title Identification and Structural Analysis of an l-Asparaginase Enzyme from Guinea Pig with Putative Tumor Cell Killing Properties.
pubmed doi rcsb
source organism Cavia porcellus
total genus 115
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r8kA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4r8kA01
2WT4A 1JSLA 1WSAA 5DNEA 1HFJA 3ECAA 4Q0MA 5K4HA 2D6FA 1NNSA 1HFWA 1O7JA 3PGA1 4NJEB 5HW0A 1DJPA 1WLSA 2HLNA 4RA9A 1HFKA 2WLTA 1HO3A 1WNFA 2JK0A 5CBPA 2P2NA 1AGXA 5I3ZA 1DJOA 4PGAA 4RA6A 5F52A 5DNDA 1ZCFA 2OCDA 1JJAA 4R8LA 5I48A 5K3OA 2P2DA 5DNCA 4RA9B 5I4BA 1JSRA 4ECAA 1ZQ1A 2HIMA 1JAZA 5CBPB 1HG0A 3NTXA 5K45A 4NJEA 4R8KA 1HG1A 3NXKA 5K4GA 4RA6B 1IHDA 2GVNA
chains in the Genus database with same CATH superfamily
1DARA 1SUDA 3DAYA 3N59A 3VPHA 2VXYA 3K1ZA 1P8AA 2C4KA 3JZMA 3DP9A 4QNNA 3VHQA 1G2PA 3GGDA 1E1YA 4B85A 1XYVA 3TB6A 3QUTA 3QUSA 5JDIA 4AY6A 3A2NA 1EB8A 4WXMA 1QB8A 4V1CA 4DLSA 1NP3A 3PXCX 3KLNA 1SKMA 5JMPA 1GM5A 5ARDA 5BMVF 3G8CA 3D3QA 3CUWA 4NE9A 3KJXA 4P81A 4DILA 4CL8A 1OR8A 4Q9LA 4XE5A 4RA9B 5TGTA 3T9FA 1QE3A 4DE5A 2IEGA 5FIUA 1MFZA 4ZQFA 3GROA 2YIMA 2OSBA 1ZGCA 4N39A 4S1NA 3PC8C 5EE9A 5SYMA 3TJZA 3ZLTA 1DBQA 4UBMA 1D2AA 1IG3A 3BTSA 1F8XA 1IE3A 2WT8A 4Y1FA 3RTGA 2INGX 2P8SA 3MJVA 3RIYA 1KMHA 1PLKA 2N75A 3GL9A 2B1GA 3H87A 1URPA 5DEIA 1CUHA 1IWOA 2AN4A 3ICCA 3K1JA 2PH3A 2Q3BA 4FYJA 3NEYA 4PHFA 4BU1A 4LMPA 1CEQA 3LY5A 1R6VA 4QUGA 1F2DA 4LRUA 4Q4DA 4OBBA 3K6SB 3SJ7A 1G20E 3VDMA 3HKEA 2IHKA 3NOXA 1DAMA 4BRZA 4R2LA 2ID8A 1SZPA 4QPCA 4U9IS 3S2ZA 4LJAA 1V3UA 2HCBA 1MNQA 1VKOA 2DCMA 2ZIGA 3COZA 2EJUA 3HP1A 3KB2A 3KAKA 4B3IA 3F2VA 1RPJA 1QQAA 1DAHA 3K35A 1DTEA 1QP4A 1PJ2A 3CZCA 1Z7GA 3KVRA 1JR3D 4HQNA 1QHNA 5AKZA 1CUWA 1IONA 4DDMA 3I2HA 1QTQA 4DR1B 4L0CA 4BMNA 3VHRA 1U28C 3GQBB 4ARVA 3J81A 2HK9A 2HO5A 2QN7A 5K20A 3THYB 3NO4A 1FP1D 3IVGA 1EBUA 3MMNA 3KQLA 3U3JA 2FEWB 3QUBA 2X4DA 5AW4A 3GUYA 3I9MA 1X7HA 2LPMA 2Z5LA 3HB0A 3I04A 3JD4A 4P32A 5DM2A 3ZKWB 1SKUA 2PTGA 3B1VA 1ULSA 3C7KA 5FOVA 2NV6A 5DW0A 4B3HA 4FQ5A 4KH0A 3KEMA 1GCGA 2AQKA 5DYIA 4YAUA 1NR1A 2ZXEA 3I1YA 4W5RA 4MV6A 1SQ6A 3S44A 1EHYA 3A4NA 3EBOA 5EUMA 5G02A 3SHWA 2QIPA 1A5BB 1T1GA 4BE9A 1ZUD1 3LQ4A 3QNUA 2FY8A 3PKZA 4RLSA 5DT2A 4X91A 4I1PA 4K0RA 2BEUB 2P9ZA 1K7SN 1YNOA 1N2JA 2BGUA 2OV4A 3FTPA 2PX0A 3A1CA 3DTVA 3PFIA 3HEMA 4NVRA 2OFFA 2QR5A 2ZJ6A 3CB4A 4D4JA 1RYZA 1YONA 3I6YA 4KHPB 3D7KA 1J99A 1ZI6A 2WHEA 3HDHA 3MINB 4L27A 1DIAA 3IE0A 4EB6A 5CFMA 1RJ9B 4AKSA 3KCNA 1ZWKA 3EFOA 3LUDA 1ZIOA 2P7IA 2QVGA 4MI6A 5F1YA 3UB3A 1Q17A 3DZGA 4DBVO 1CR6A 3FLMA 4B4KA 1BOOA 4X45A 5DNCA 2HADA 5ILQA 1PG2A 1I6MA 1M74A 2OTCA 2YH2A 2YUTA 3NT2A 1ZUNB 3ZVMA 2JJQA 1CUFA 3GJYA 4LXGA 1Q7EA 4NQRA 4D45A 4X5OA 1JR3E 3AP1A 3RC9A 1ZUHA 2C4WA 2R00A 5TNXA 3P0EA 1MEEA 3DFZA 5JNWA 2P9QA 1FP6A 2QE7D 2YJGA 3RVSA 4E32A 2UXDB 2Z9BA 3VOSA 2UXBB 3T4XA 2XB4A 4FQ7A 4NCNA 1GTVA 1GPNA 4R7TA 5D7NA 2NTNA 3KAJA 1XMSA 2OB2A 2M1XA 2DC1A 3IKJA 2A0UA 4FFRA 4MQUA 3HBNA 4G84A 5IUKC 1KXZA 3HB5X 1L5HA 4R0NA 3KQNA 4BFSA 1XCOA 1U04A 2I3BA 3AEQB 4RQBA 4J9UE 5DZSA 3WAKA 1THGA 1H4QA 1UL1X 3CCBA 1LSUA 2OZPA 2VN8A 3EVGA 4IQ8A 1EFVB 2QN3A 3LT0A 4JJ4A 3PYXA 3VHXA 1DKMA 2IIQA 2ZUEA 3QE4A 3BL6A 3QFHA 4YMVA 1KI4A 3PEFA 4R51A 1LBIA 3LTEA 3C1UA 3KVYA 4U7HA 3WG9A 2QT9A 4WK6A 4XWOA 5JV5A 4IJ5A 1R4MB 3DVAB 4OKSA 5KIAA 1C3VA 2CB0A 3BSFA 4CFYA 4D97A 4DLNA 2ODBA 2JFPA 2X8JB 3GZTB 1CULC 4OHKA 4BUCA 1YOBA 1E3DA 3E5MA 5LD2C 1R8JA 3BHIA 1EQAA 4RA6A 1WXFA 4X1KA 4GH5A 4K3UA 4X8HA 4PR0A 4DUPA 3ID6C 4EITA 3HFJA 3KYDA 3F97A 3BPSA 2ZUDA 4PAOA 1D09A 3AFHA 4XM0A 1YR7A 2R8RA 3AFOA 2CLDX 4D7AA 2CJPA 5FBHA 3W7VA 3DDSA 1LQ2A 4I7EA 4DT1B 3V4FA 1OF1A 3FSEA 5FPSA 3QBVA 4EF4A 4FGSA 1IZ9A 1YULA 2EZUA 3NHZA 3T7AA 1KNXA 2YVLA 3PWSA 5ALTA 3W6PA 5HUHA 1BHQ1 3GT7A 1CYEA 2A9JA 2P41A 1Z3IX 3OQ1A 4MB0A 3W2FA 2CYAA 3DVRX 4EJ2A 1WA5A 2RD2A 3QEKA 3IJEB 3O3CA 3S3TA 5ARBA 4L0MA 4QE3A 3DUFB 3IMFA 3PI6A 2IGTA 3WLPA 4ERNA 2XT0A 2ZYRA 3G88A 5LLDA 1NY6A 2JK1A 2JIZA 2P9FA 2ZJYA 1IN7A 2ZWAA 4RV4A 2IW3A 2XMPA 1VBMA 1GQQA 3FM9A 3NH6A 2J67A 2RBEA 4N40A 1SRQA 4UCXA 5E9AA 4F12A 3DVSX 3FHOA 4RPIA 4A1FA 4UTXA 5L45A 1GSHA 5CFQA 4XYMA 1SCDA 4WMLA 1U2TA 3UG7A 3B9QA 2CHQA 3FUTA 1CRZA 3IAUA 4DUGA 2DXIA 2FWJA 5B6IA 1HOTA 3QYJA 4GPIB 4NAUA 5CVCA 4R2MA 1FYXA 3DTVD 2F43B 4HFMA 2BFFA 3O73A 3IQHX 1HM5A 3HVRA 2XIJA 1CUYA 1UEXC 4JYMA 3PXXA 2VEOA 1FXSA 3E9DA 4IWYA 4GM4A 1J8VA 3W6NA 4YV0A 1G4HA 3ZW8A 2I6TA 3NAZA 4L72A 4DEVA 3EMBA 5KCZA 2FPXA 3ELBA 4Q21A 2W42A 2VJPA 4ABTA 4IDCA 5LZ5A 2XMDA 3IODA 4GFDA 1IM2A 5C53B 1T8PA 1JH8A 4KVZA 4G6ZA 1BRTA 1I9GA 2E18A 1EA5A 2P5YA 4Q1EA 1BN7A 1SBCA 4AMZA 4BQOA 4IIYA 2O2DA 1DIGA 3QMWA 2X1HA 4M0DA 3VDNB 3GRZA 5C1DA 3GYGA 1KZHA 4WLVA 4D92A 2EW2A 3SIXA 1G6OA 1M10A 1UOOA 4DVGA 4GGMX 1PSZA 4X9XA 2ZJBA 4FYMA 4YR7A 4BX2A 1ZNQO 5EUCA 4LYGA 3ADCA 3FVWA 4A0QA 5JRZA 2IVFA 5U4QA 3DEAA 3RFVA 4N0DA 4EPRA 2YWEA 2J46A 4LAFA 3EOZA 4IQ0A 2H51A 2OV8A 4CIYA 1W0KD 3V97A 1VKHA 5IMSA 1VPDA 1YO6A 3OOYA 3PUYA 4D0RA 2H7VA 3WMEA 3MD9A 1CQJA 2UZ1A 1PEKE 2AKYA 1AUXA 2XMCA 4PE5B 1FVHA 3LYHA 1XMQB 1E2UA 4EGQA 1GXSB 2MSLA 2X0NA 1LV7A 3GFRA 3NHJA 2CLOB 2VP0A 4HDAA 4DJFC 1E61A 1XXHB 3AUSA 4B3MB 3I9V1 5HE8A 3MWLA 5BW4A 4PRLA 1Y8ZA 3QIVA 1E3IA 1KY4A 5KYTA 1U7OA 2O9JA 2NO5A 4DLWA 5AVRA 1U1FA 3MT9A 4JLDA 5AW1A 4JYPA 3C87A 3UWSA 4UBOA 1JHPA 5CDFA 3TLJA 2IZZA 3GAAA 4QL3A 4WLUA 3ZQUA 3ZV4A 2YMQA 3DULA 4YQFA 3TUZC 3PD0A 1CEXA 4HBZA 4U9HS 4NABA 2YDYA 3C3YA 3CMMA 4KV7A 4DN6A 1KI8A 4BGDA 3GJ0A 2X0DA 3OF2A 4LXHA 1EZ4A 3JZDA 1EWKA 1PHPA 2H1SA 3HMQA 4Z4IA 1LW7A 2QMOA 2LCFA 3EMKA 4G8BA 2XMSA 4II3A 5KYWB 3IAM1 4BNJA 4CMCA 1ZHOA 3WB1A 2PV0A 2JIZD 4PVCA 2B6HA 3OOSA 3KSMA 1JN0A 1KQOA 3QVVA 4K1LA 3EZ7A 1Z83A 4WLEA 3Q2OA 5GONA 4PPFA 3ABOB 4R8RA 5EIXA 4CG1A 1M9NA 3UK0A 1T0JB 1TJNA 3S55A 4I9HA 1AT1A 1G5FA 2KJQA 3HVIA 3S2SA 4KO3S 4MJLA 4C0KA 4DUGD 2C1XA 2I4MA 4Q9AA 3RSSA 4CUJA 3C5HA 4M1MA 2Q5OA 4BE4A 5DXAA 3WAGA 3OF3A 2YIJA 3BZWA 4HDSB 4YJHB 1U4SA 3HXPA 4L8YA 4LX0A 3UXEA 1T8SA 1U1GA 1U8XX 4FBGA 3VXKA 1M8JA 4ENRA 1L0BA 2CUTA 3QMMA 5JZVA 2PO7A 2HD4A 3R3YA 1EVIA 1OU0A 5C7OO 5ALPA 1ZVJA 3RVPA 4WACA 1XZFA 3SDZA 2XVYA 1E0KA 3F8TA 1GGNA 2XCLA 4HWKA 1BVYF 1H1LB 2I71A 2NU6A 2ZIUB 4H1UA 4INOA 1VOTA 1ZD9A 4L28A 4OO3A 5TMDA 2J0QA 3ETCA 4B09A 4CEIB 4UAUA 721PA 1SCBA 3OJ0A 3RFUA 3VJRA 4QBIA 3EUAA 3OY7A 3EVDA 5B1SA 3ZE1B 1J21A 2OZLB 3JR3A 4OREX 3D3JA 1C3OB 2JFHA 3QY0A 1M2KA 4GUAA 4TLLB 2EX1A 3K1TA 1NXTA 5JD5A 5K4GA 4V0QA 5ADVA 1EGHA 1Y1KE 1AZWA 2HUNA 2PMDA 2BMFA 1XFDA 1UBMS 4PQEA 4U7WA 5CM8B 3W3ZB 1LLUA 3H5OA 3WYCA 3A1UA 1OB5A 4QRDA 3ASZA 3GHHA 3G2JA 1Y34E 1FFWA 2PU7A 3A0RB 4N7JA 4ZHQA 4DV0B 2XNJA 3FPHA 4KPUB 1J8QA 5EKDA 4GWGA 1ZBDA 4FKBA 4IDBA 4KFCA 3P4YA 2D5CA 5KPJA 3NBUA 3D8BA 1ANKA 3IP6A 4GOMD 2JIBA 4NPHA 4UM9B 3L07A 3M6UA 3AHFA 1E5TA 3G5AA 4C1BA 2J3KA 2APJA 4IDOA 4NFSA 2JI4A 3FAKA 5A6VA 1SAYA 2RH4A 3WIEA 3FCEA 3IVCA 2I6SA 1Z47A 4CM4A 4E13A 3V4PB 1DWOA 2GXAA 1DL5A 1YNSA 2YVQA 4BGIA 4GBGA 1DBRA 1NY5A 2O1SA 3DQPA 3Q87B 3OZTA 2V59A 4WVFA 3EGXB 5IDQA 5KYGA 3FETA 3ITEA 1L8QA 1ODTC 1PGOA 3DH0A 3IXLA 4PX3A 4DAEA 1KPHA 1W52X 5H02A 1NI4B 3UKDA 4B0PA 4PSVA 1FYVA 4N12A 4YUWA 2BKLA 2Q9CA 4YK7A 3T1NA 4FFLA 4D3SA 4BFWA 2OCLA 4NI5A 5KQGA 2Z2XA 1RYMA 3UO8B 3B13B 4PICA 2BGJA 5HCNA 4XTCS 4HNHA 3U17A 1UJ5A 4LGMA 1LS6A 2NACA 4P0PB 4NU0A 5LP6C 3HADA 3ZLBA 2SHKA 4R8VA 4MCJA 1ODCA 2IYLD 1JKFA 2A59A 2QP9X 3M4NA 1ZG3A 4LJ7A 4DY6A 1SU6A 1IQRA 1TUBB 1Q7RA 1VXRA 2GUGA 2CLMB 3IVAA 4NNOA 5AP9A 3WHLA 1DZIA 4JYZA 2QE6A 1F14A 3ZDBA 1Q7TA 3E0XA 3D6MA 3H1AA 4C0SA 1A8QA 1WUIS 1GKKA 2X8BA 2NPOA 4RESA 3VYSB 2F8TA 2O6LA 1V48A 1MRZA 2TMGA 3CPEA 3HZHA 4Q34A 2J3MA 4JZYA 4QPNA 5DHAA 2HHCA 3D1VA 1DC7A 1L7BA 2HK6A 5JNRA 3FNFA 2QD1A 3EIWA 2RG1A 1UIMA 1B14A 5HQJA 4OMUA 2BZSA 2FLWA 4YAEA 4BEJA 4I19A 3ZV5A 3CF2A 4P3KA 1D6NA 1HDOA 3QWHA 4IYRA 1DG1G 1W5EA 1C7FA 3F0TA 5JH7A 3A7EA 1AGRA 3HBMA 4DPLA 1QP0A 3CKYA 2H1OA 1JFTA 4NG5A 4AWBA 5B1EA 3RH0A 1GAWA 2FXIA 1WWKA 2Q8QA 3Q10A 4OSEA 4PC7A 1CIVA 4DQKA 4QARA 5CB0A 5FOSA 5KYUB 4Q5IA 3E6AA 2IE8A 3IUMA 1NW9B 2LE0A 2G71A 3K15A 4DARA 3CCCA 4X1OA 1CERA 1AMUA 5CDFE 3UWOA 2WP8J 3OECA 2R84A 5EE3A 4RIGA 5B6PA 3FGOA 3HN2A 3AM1A 4C20A 4DANA 2F3UA 4GPEA 4H7HA 4CQMA 4MR8A 2IV2X 1NBWB 2J9FA 4I8IA 5EP2A 3ENKA 2Q2VA 3C1TA 3E70C 2NP7A 2BY4A 2MSEB 2QJFA 4PS1A 4F5EA 3W6ZA 1HDZA 2OP1A 1HE5A 1QVAA 3F7MA 3HWSA 4MYCA 4TLDA 2C0QA 2XOXA 1LY1A 4FI3F 4MV5A 1KEEB 2WWXA 1T5DX 3CF4A 1Z8HA 3FKSA 2G70A 1XZBA 4JEHA 3U7JA 3L0CA 3H3XA 3C3AA 2V6GA 3LP6A 4XYEA 1G0NA 2PUDA 3GB9A 3HN6A 421PA 2F59A 4DYDA 3M4YA 5CFRA 4LXIA 4ZVRA 1UFQA 4H27A 4B71A 1M2NA 3PKJA 2PIAA 1UMDA 1WCIB 4HEA1 4RM2A 2CHUA 2WIFA 1TCAA 5HM6A 2X8LA 4L8LA 1SUCA 2NUPA 2G1PA 2YZMA 4BLRA 3THWA 4KYTA 2JGMA 1TM4E 5C7YA 3K6JA 4HAVA 1PJTA 2CXRA 2Z1NA 3NDIA 3R23A 1CP3A 5AK3A 3FPCA 1GCIA 1PX2A 2ZPTX 2ZSUA 3GH1A 5KTSA 2RK4A 4XW2A 1H2AS 4ARZA 3GNSA 1C5KA 4YRDA 4BS9A 1ZOIA 4CLRB 2NZYA 5KYNA 3A06A 4GX2A 2HXYA 1DKQA 2X0FA 2XCUA 3SDBA 3S1AB 1E2HA 4MZDA 1J20A 2XWBF 2VBCA 3CRVA 3OSUA 4R54A 1EFPA 2AOUB 3ZCTA 1MAAA 2QLJA 4JLAA 3ORHA 4G1BA 1YK0A 5BN4A 1TKRA 1DDOA 5LMCA 1T4GA 2B61A 1CQXA 2WZCA 4MVXA 1BEEA 1JEDA 1FUKA 2WTUA 4HAOA 1C3EA 2RKBA 2NU8A 2VNSA 3F3MA 3OZRA 3IA2A 1KMMA 3IIJA 4LOKA 5HCUA 3R6GA 3NATA 4GW3A 1C4XA 2WM8A 3OTQA 4J1SA 3AXSA 4KPFC 3BK7A 2W93A 4JC4A 2V5VA 5C18A 2RI1A 3AOEA 8ADHA 3D8SA 5JJ5A 3UAWA 1CNFA 2IZ7A 2JI7A 3C4JA 3C3EA 1DKPA 2JD2A 3BRSA 3MWEA 2VWPA 3GLGA 1WLYA 3BQMB 3OWOA 1LTKA 4YRSA 3ZWVA 2O8EB 1EZZA 5HUJA 1OY1A 3DHEA 4WASA 2O2XA 3D6AA 2WFLA 1GKUB 3NP7A 3I9OA 3KSUA 4V3BA 3KUKA 4U4AA 4BP9A 4DC9A 3K2QA 3AESB 3IHTA 4TTJA 1JDJA 3BXPA 5K03A 3L0OA 1GY8A 4YPOA 4Z3OA 3FNRA 3MOGA 5D5HA 1D7OA 2BSAA 2F3QA 2RHBA 4YJGA 3U4CA 1S4MA 1ZOLA 5CDSA 5KSYA 3X1DA 1KRXA 3Q4GA 3T5GA 1Z2DA 5A9SB 5IN4A 1KO8A 1HG0A 3KZ1E 2QRHA 5GZ3A 2F3SA 1GZ6A 4P82A 2DTDA 5SY6A 5IW8A 1LDGA 2GLXA 2GZDA 3THOA 4Q9NA 4M9RA 5SZKB 4V0KA 7GPBA 3NCHA 1GLGA 4A6DA 5I9NA 3AL0C 3EGWA 4Q37A 2J08A 1A76A 4PLCA 4HLQB 5F9FA 1ZOSA 4JCCA 3D2LA 1ZK4A 3AIOA 4M2LA 5DBIA 5JCPA 1EEXB 2FP3A 4KR2A 2YV3A 1V3TA 1ZX1A 1TUIA 4CQMD 4S1VA 5JSHA 3B3AA 1V0JA 3E7PA 3SPXA 3QPWA 1DBWA 1O95A 1RKVA 5JWHA 3UYLA 5JD4A 4AG5A 4L15A 4BFTA 3IAS1 1M1NB 4IJUA 4BC0A 4D3FA 5EG5A 3ELUA 4FNMA 3URKA 3DR5A 1CTQA 2ZYIA 3FKSD 4NFHA 5ALFA 1F5SA 2EFYA 5JSZA 1QG6A 4UAGA 1VPLA 3CNHA 5ITWA 1C8VB 5CGQB 3O4VA 4A5SA 3NOQA 1O54A 4IO0A 4OXRA 4K6FA 1SFRA 5TEWA 2EFJA 4YQYA 2VL7A 3E48A 3KFLA 4HCJA 3N5CA 1J06A 4QG7A 3MT0A 2G36A 1PL8A 1W5FA 2ANBA 2QV7A 3G7SA 4FHFA 3H19A 2ZG6A 5AW6A 3IUPA 3T4PA 3GNQA 5D3QA 2IYVA 3R7BA 2A86A 4GSYA 1UDBA 1MC4A 3EUEA 3E3LA 4C4AA 7ABPA 1H3FA 1KOGA 1KWGA 4WNYA 2AKAB 2N46A 1OLXB 3RS4A 1II8B 1IJKA 1C30A 1B8UA 2X9GA 4D79A 3BH0A 1R4AA 1HRDA 4FEEA 1I4LD 2HNBA 4Z1MA 4EJSC 2O48X 4RBNA 3AUFA 1BS1A 5E0OA 1OI4A 2YJ6A 2XYRA 4QOFA 3ZWPA 1N7IA 1Q2XA 1GRQA 2OVBA 1JKJA 4DSOA 1F8YA 3TX2A 3IIIA 1T0HB 3U5ZB 3DW1X 3V7UA 3SYMA 4EL5A 5B6JA 2GK4A 5AYVA 3OQMA 3BJEA 1DGQA 4FYXA 4Q16A 5ULLA 5CA1F 3RJTA 5I7UA 5AW2A 3E1KA 4UARA 2FCRA 2VQDA 1VE9A 2C9BA 2YXPX 4REQA 1SIBE 5CDGA 3PUKA 4MWEA 2FEKA 4GI1A 1C0PA 3PNMA 1NQUA 3AJRA 3C5WP 4GBMA 1GKLA 4LZNA 4UZEA 4UUPA 4GX1A 4OXXA 2WD7A 5BT9A 4MMZB 1E8NA 1VG0B 3QXJA 1GFIA 3HRKA 3F3YA 5J40A 3OTOB 3STXA 1WUYA 1YFJA 3PUWA 4GSKA 4E1AA 2IZ0A 2VDLB 3WGUA 3FNHA 4OTZA 1CJBA 4LNHA 3M6XA 5HFJA 2O52A 4BLWA 2D0OB 2HPHA 1OPXA 3NYRA 2HF8A 4MVYA 3V1KA 1WXWA 1NJGA 2CF6A 3DAHA 5JWOA 6CHYA 4P08A 4CMEA 3SC3A 4DXDA 2PSDA 3NUZA 2Q99A 4U9UA 3RASA 2PT6A 5G4KB 5JVDF 3FVRA 2NV0A 3K72B 3VGPA 2PDAA 4HNQA 4KR9A 4A2QA 4RHFA 1AOXA 3KHTA 5C37A 3FAZA 4EQ6B 1QRUA 4WZBB 3ZJ4A 3CRNA 4N8DA 4KYVA 5FBQB 1BGWA 2AFRA 3DYVA 4N0QA 3GMIA 1KI1A 2XD9A 1O6ZA 2R6FA 3K8ZA 3KL4A 4RIIA 4YUZA 2ZIAA 4AVYA 1M76A 3MK31 9ATCA 1KYYA 1T43A 1BH2A 2GN2A 2O14A 3QZUA 2MDTA 3H5AA 4MUKA 3EQ2A 1C7EA 1UWKA 1HEIA 2P2ZA 3DZCA 3VAYA 4C14A 3PDUA 3RADC 4ZMSA 2NZXA 2BR4A 9MHTA 5M3BA 4QHSA 1HQCA 3JARA 2QZJA 3R6DA 4I2NA 4MDHA 4Q05A 1KRWA 4TSKA 5FV7A 4L74A 1I3KA 4KQKA 4G1FA 5IBQA 3BD7A 4ZALA 1O95D 5BY2A 2FJPA 2II6A 4Z53A 3P26A 2FMFA 3JAWA 5COBA 5F2EA 5L7WA 3T3OA 1C81A 1ZCBA 5A62A 2SCUA 4DKJA 3I8OA 4TVOA 4DCCA 1KQPA 2AX4A 3IIMA 3JPYA 4YRJA 3T1VA 4P22A 4Z8XA 1C41A 1A4XA 1TNDA 4Y8VA 4G9EA 4RFLA 1U9ZA 3IOYA 4KQCA 3A3NA 5AHRA 2F9FA 4FB4A 3GLGE 5KDLA 2DTXA 4Q19A 2Q8PA 3F90A 1QS0A 2WMDA 3HK2A 1KAMA 1SM4A 2R62A 3BJIC 3FYUB 3PFNA 1TEXA 1NSTA 1G0OA 1Y7IA 4BGVA 1UWCA 5TT0A 3OJXA 1B42A 2QW1A 1XU4A 1G21B 4UHCA 4EG1A 1T8UA 3IQGX 4GEGA 2J09A 3G8BA 5KTYA 4E5YA 1SU8A 4KQIA 4J1NA 4PC6A 4PVDA 5KTMA 4F56A 4JI3B 4NXNB 3ZZ0A 1IDOA 1F3OA 2BZ0A 3M2PA 2VHEA 4Q01A 4Z1MD 3U26A 4PPYA 4Y98A 3K9LA 5K8TA 1N25A 4CGYA 3MAAC 2OHXA 1Y63A 2WFAA 1NDQA 2YJZA 4BB5A 4RK1A 1NG1A 4TUYA 3KR0A 1GDDA 1Z5GA 1GV0A 2WM2A 3A4IA 3G0IA 2HJWA 4K6OA 5AUNB 4BFCA 4Y9RA 1X6VA 4QJBA 2F1HA 3FN4A 3EOBI 3BD8A 2XECA 1P0CA 3H5TA 4HBGA 4I99A 3QVJA 4OUDB 2C54A 1FFHA 3GUVA 5IK2A 5FEMA 5TDHA 3UV3A 5FJJA 4J2TA 1P73A 4DLTA 3THXA 1PLLA 1YTUA 4B2PA 2HDOA 1UZAA 3GRVA 3IURA 5JXJA 2ZSKA 5DHRA 3WJ1A 2JD0A 2OBYA 2YVKA 1JIKA 1XCJA 5E8RA 4TQ9A 4OXQA 4IDAA 3GLKA 5K3FB 4YMIA 2IYSA 4XRGA 2XGSA 1C80A 1X15A 1N1MA 5JHGB 3FTCA 2WTNA 1W9HA 3EXG1 3T5BA 4EHFA 2D8AA 3I83A 2A0XA 5TQ0A 1KP2A 5EERA 3TVYA 3B3JA 3QWIA 4N5MA 4BNHA 4J3NA 1FUEA 3KZKA 1V3VA 2A0YA 4QATA 2C7BA 2R66A 2OGUA 3OE7A 3CUTA 4JKOA 4ZJPA 3H0KA 5FO0A 1WPQA 5GM2A 2C83A 2VK4A 1DV1A 3PLRA 3JQGB 4G0XA 5KHLB 3O95A 1MVLA 4XB1A 2E4YA 4WN9A 4FW9A 1FS5A 3EA0A 1CZOA 4QHTA 3VJKA 3BGIA 1JNYA 1QDUA 3OQOA 4KFUA 1I5EA 2O0HA 4B47A 4G5QA 4ETNA 3TPZA 1LK7A 4W99A 4CFZA 4NL4H 5KVVA 4AYWA 1AQIA 1FNMA 2XAUA 1EUCB 2IE0A 2VHWA 5JCXA 4TYYA 2AD1A 1FX0B 1CDDA 3LT4A 3VV2A 2VATA 1V35A 1A2OA 4W1RA 4QXMA 2OV1A 3RIGA 2FEXA 3FCUB 4LS3A 5BQ5A 2DPXA 5A7GA 1T9ZA 2YIVX 1ITZA 4I9GA 3PC8A 4QODA 2J4CA 3X3HA 2GAAA 1BMQA 5ALEA 3E2PA 3Q11A 4PYRA 1O96B 1XLWA 2FKNA 4KHZA 4JWTA 1Q1BA 4PYQA 4QA9A 5DP1A 4GBED 5F5LA 2UUAB 1NMZA 4AD8A 1SD1A 3JXEA 1RXUA 3PRKE 2FG6C 3JWGA 3NFYA 5FBVB 2X14A 2NSHA 3I6MA 1ONBA 1JJ7A 1CB0A 4AAYA 1PWXA 1DC5A 2IBMA 3HCAA 3JPWA 3V55A 5K0CA 3RC8A 2HMUA 4I1IA 4BWYA 4NU5A 1ZIYA 1ECCA 3HL4A 2Z8YM 5IC5A 4A6XA 3O4RA 3PGLA 2JBAA 4WZ6A 3H2IA 5CT9A 1VCMA 1J9EA 3I5XA 3ED1A 4KIFA 4XKJA 2IUFA 4XWGA 2VDQB 2O5RA 4BRWA 1IPFA 4F0JA 3BXHA 2FW8A 1C7IA 2D4AA 2E87A 3OLZA 3VBEA 1V11A 4NBRA 1JQEA 1DC4A 1U28A 2HQBA 4HN2A 4MYTA 2QP4A 2YINC 3QTTA 5ITVA 1YL7A 1U6KA 4QTTB 1XU9A 1W4AA 3DWEX 3P2MA 4QU9A 3CWQA 1GTZA 1RAIA 3CNNA 3M83A 4FR0A 4IXDA 1IY2A 2X4GA 5GTDA 3PX7A 4S35A 2C4VA 2XUGA 4KGDA 1RXYA 4XPIA 5E1MA 5HK8A 3P2KA 3AINA 5JSKA 1SXJB 4I9FA 4J0EA 4BFLA 1JU9A 5CGZA 1XT6A 5BN3A 4RC9A 4Y7DA 4IX1A 3W5AA 3VMMA 4NZNA 1GEGA 1YH3A 3WLIA 2CW5A 4A0GA 3FPSA 5IK2D 2G9QA 2PGIA 4JXXA 1F0YA 1X1CA 2G83A 2DR3A 2FZLA 3PXBA 1K7EB 4M4SA 4U8HA 4XM2A 4XSHA 5KJ1A 1NBEA 2EBUA 1YS7A 3OZ7A 4HGOA 2GK3A 2B36A 4UTRA 3NHUA 1NUPA 5EFOA 4MW1A 1ZGZA 1ZIPA 4UVDA 2WAMA 2QUHA 3JQAA 2QRQA 5CLHA 5T4BA 4D41A 2IYPA 1EJBA 3FPAA 3L6RA 5IBPA 3IV7A 3RRXA 3PPWA 4GI3A 4I81A 5J5VA 3L84A 5EZSA 4G1MB 2ZUTA 3DCYA 2EU8A 2ILTA 4L1KA 3LC1O 5ESDA 3FB4A 1UKEA 4FQ8A 3OE7D 3VI4B 1ISPA 1JAHA 2GFIA 4KZPA 3AKCA 2GEBA 1RMQA 2VIIA 1J0XO 1YIOA 1L5SA 2H48A 2KYRA 2B34A 1MORA 1SKBA 5EQJB 2HBQA 2W6QA 5GZ1A 1YT5A 1GYQA 4A82A 1RLJA 4JQOA 1H0KA 3NHRA 1PT7A 1X80A 2B5VA 2Z5GA 1BWSA 3F6BX 3P9IA 5J2TF 2O3SA 4A4DA 3LX5A 1K66A 2FH5B 3MBOA 4XQGA 1RHJA 2EZ4A 5DTQA 3CW2A 5K2MA 5SYNA 4F1JA 2KHZA 4YRKA 1NTRA 2AYYA 3HV2A 3FD8A 3C7TA 3ML1A 1T8TA 5ALLA 4E46A 5IULC 1GR0A 4NECA 2XWPA 4ARCA 2PUHA 4JYAB 2XQIA 4Q1FA 5DGTA 1Z4LA 4IRMA 4W4TA 4RGBA 3OD5A 4MUEA 4EKDA 2WMYA 4OFXA 1PBTA 2C5FA 4NOLA 1FRVA 4BBPA 1UBLS 2Y4OA 3OPNA 4TT3A 3ZLJA 4XX1A 4Y0AA 4Z0PA 2ZIFA 3H86A 4NYMR 4MCIA 2I9PA 3JWHA 5HPYB 4FBMA 3R8XA 2W6JA 3BIXA 4K28A 4UMEA 4DMCA 2JGEA 4DQVA 1T2VA 2I54A 3RD5A 1SVIA 5IJ0B 1DMRA 1FJHA 3EHEA 3DJFA 4G3XA 1DPFA 4F46A 4IJVA 2QBYB 3VKHA 1PT6A 1KR5A 1V9CA 1T5SA 4QDTA 4EW1A 1FY2A 3PP8A 4WLOA 1FFYA 4R2HA 2ZRKA 1XWWA 4MO2A 4ZAFA 2CXQA 1KH1A 1TJYA 2FF7A 4C0XA 1YQDA 3NIBA 2ZDQA 3QPCA 1CEYA 1ZD1A 3LYUA 3H2SA 1T2EA 3U3KA 1PEYA 3SJAA 2X6RA 3A4YA 3B36A 2R9VA 2WTBA 1FP4B 3TW4A 3I2FA 2YZKA 3BYZA 1PW5A 3HA5A 1KQ3A 3R24A 4RDHA 5E6UB 3BH6A 4C0JA 1E3WA 2QJWA 5HIAA 5H68A 1YS6A 3N76A 1KTIA 4MW6A 1CUIA 3BDVA 3TVTA 3Q1KA 3GGCA 3DP7A 3GEPA 3N2GA 1QH0A 1YI8A 2AWOA 5CAEB 2NVWA 4RO0A 1TTQB 2X7JA 2L18A 5ALJA 2XUPA 1U2SA 3L7AA 5CBPB 2P1RA 2WJ6A 3R7SA 2X19A 2YHIB 2H1HA 2JFOA 3N0RA 4UKDA 1CBUA 1F2TA 1T24A 4IHJA 4ZCRA 2JFFA 1E59A 3BL5A 4BJ3A 4O33A 2F55A 1L8LA 2BMAA 1E66A 2A3RA 2JGLA 1XB2A 3DLCA 4KXMA 3FBWA 4Q12A 1JHZA 2X15A 4J4TA 4HQ0A 4G56A 2HBZA 2QRUA 4ZRMA 2WWVD 1U0FA 4JMPA 5G0TA 4F4CA 3G82C 1YRBA 3GF4A 2W2QA 1EG2A 2Y1DA 3JQAD 3M2TA 3NJ8A 2YFQA 1S8OA 2K2QB 3KZVA 3MTBA 4IR7A 2H9IA 4FWIB 2IU3A 4X00A 5IH7A 1N2GA 1Z38A 3F6YA 2PUEA 1JWBB 2HFKA 3TG2A 4E5SA 2AMJA 1U98A 1JI0A 4C29A 4F7DA 4L5CA 3RIMA 1RXWA 2VTEA 1PV2A 4DLXA 1YU9A 1NDHA 4J8PA 2B2XA 1L4BA 4YACA 5FFFA 1LI7A 2DHEA 3QM1A 4RPJA 3C3WA 3K2BA 3SYTA 4Q3CA 3T5MA 4EX6A 2BM1A 4Z2AA 3KOWA 3AJEA 4YRAA 3OFVA 1M83A 4IDHA 1TYEB 2VSXA 1KAQA 1B1AA 1T3SA 1RWMA 1JKXA 1X7WB 1YCFA 2J7PA 4MKZA 4XLZA 3WTBA 4LDRA 4WOJA 3EPPA 1K7XB 3HXQA 3H1BA 4ZO4A 3T8YA 4JI8B 2FF5A 3BT7A 2H17A 2RGAA 4A0FA 1WXHA 2NYUA 2PNFA 3MJFA 1E6KA 1RYEA 2QRVA 4TKZA 3EIXA 4E88A 4EABA 1LVUA 1PJQA 1G6KA 2E4WA 3A10A 3UGJA 3TXAA 2NQ2C 3JU3A 5FUVA 4N9WA 4QOGA 1PQUA 2JIOA 4GYYA 5AVTA 1FCJA 3DL0A 5EMMA 3OEYA 3KPYA 1D7AA 4Q6WA 3ZVLA 1JYEA 2WJZB 4B9EA 1ACLA 3OAAA 1G3MA 4R8KA 4ZYZA 2N3ZA 1HYGA 1CY6A 1XO1A 5DYGA 2CVOA 4A8PA 1U1DA 3PGXA 2HA2A 2V97A 4TT3D 3RSQA 4GP6A 3O5AA 1YVUA 1V8DA 2AOXA 2BMJA 4YC7A 2RGCA 3KZXA 3L1VA 2W6JD 4MS1B 2YC4C 5JG7A 1U9CA 5F1KA 3L8DA 4MJ7A 1P7ZA 3PZRA 3RWMB 1KVRA 2VHYA 5L4NA 3FLAA 3KT6A 2O1EA 4QRIA 1XVAA 4QQ8A 4PFQA 1C1XA 4PLVA 5DGDA 5BXQC 1XPOA 2I55A 3H99A 4P83A 5KKCA 2ECQA 2PRJA 3AF4A 7ADHA 2I2CA 4KIWA 4D9IA 5D6OA 2DUUA 4BB9A 1D4AA 1ZUIA 2I7DA 4QOIA 2CF5A 3IR5A 4E5MA 1ZGJA 1T8YA 4ON9A 1E1MA 5DN9A 4MYRA 4HLUC 4A8JB 4RCYA 2J9RA 2D6FA 4A73A 2VDOB 2ID4A 1K08A 2WR8A 2WTXA 4GSLA 3KM0A 4IIJA 3KC2A 2WW8A 3OP4A 3H05A 3TAXA 2FKAA 3GCGA 1QPGA 2QAGB 3UT6A 3WSTA 3O1HB 2WQ7A 4LNUA 3NIGB 1LS1A 2HRRA 3MLAA 3T0IA 5JAQA 3TLGB 4EA9A 3WA7A 1BWPA 4HZUA 4HV4A 4K8RB 3HM2A 3MVEA 1JHYA 1QORA 1E1QA 1NUAA 3CCFA 1GP2A 3FWNA 3QKTA 5HOQA 5JAPA 2FFJA 4DMLA 3GLHA 4TQUS 1KQFA 4DHWA 4YDSA 2EP5A 2J5QA 3HZOA 5FOWA 3HYRA 1G2QA 4A8TA 4K6CA 4NMMA 4MKIA 3C74A 2WFMA 3TLXA 4QO8A 5AUPB 1KDPA 2KLBA 5LNK6 3PNYA 5C8YF 4N5NA 3SQWA 1BC5A 5JECA 5SICE 3PD7A 1C4OA 1QDEA 1XJ0A 3NHKA 3I01M 2FN9A 4O4JA 3DO5A 4AP6A 1OB2A 2Q4EA 3I23A 1E2FA 3NWPA 2W8ZA 1U4NA 2VHCA 4MS3B 3PL5A 3JYOA 1TEHA 4PO9A 1JFFA 1NXXA 3UYKA 4EW6A 1E60A 4BQFA 4DLAA 4Q4CA 4CETA 5AK5A 3QV1A 1JDVA 1YHYA 2AVNA 4JBWA 4NJMB 1YQWA 2JGDA 2R6ZA 3ZE7A 4B48A 2GPTA 3RTDA 2A4MA 2F7SA 3LQRA 3OA0A 1FRQA 3LVQE 1XE3A 5DGHA 3STTA 4BN0A 3OOEA 1DV2A 1V7PC 5A2GA 1X42A 4BX3A 2J7PD 3GW8A 4UD2A 3SFZA 3HCWA 2CVFA 2HMVA 1TTTA 4PN7A 5BOSA 1AA9A 1LBQA 3FIUA 3N53A 1W5TA 1BJTA 1VB3A 1L4UA 1P39A 1E0SA 4JI4B 4MQ4A 1U0TA 3PQ4A 2JA2A 3MFYA 1JYFA 3R40A 4PNHA 1RZVA 3EQZA 1D1QA 2A9PA 2VJLA 4H7FA 3FGNA 4F9GA 2GRJA 5HVNA 4FDUA 4H6PA 4NEHB 5I9MA 3IV9A 3SZLA 3QLVC 5TF4A 4MICA 4QELA 1DC3A 4CXMA 5JROA 1S7GA 3RAEC 3H9GA 3T38A 1T2NA 2FPGB 1MNAA 3DT6A 2JI9A 5D8DA 3OAAD 1VLQA 4B45A 1KS9A 3GFTA 4DLRA 2W4QA 1FDUA 4JHXA 3IBFA 4KCGA 1CX9B 3KB1A 1KIAA 4JGGA 4HPXB 1LBTA 1I14A 2ODQA 2ZAGA 3TO5A 1YBVA 3ZGXA 4ETMA 2XUFA 4RAQA 4PM4A 2RCYA 4HRVA 1GU7A 1QK5A 4KBFA 2ZSJA 1FU8A 1HKHA 2Q5EA 4P7KA 3UJAA 4OLHA 4N01A 3QGMA 1NC1A 4MRSA 5DHPA 2XF2A 4JLWA 2C2XA 1MCZA 1GNPA 4CTNA 1V8FA 1W1IA 4YYZA 3FR8A 5HRUA 3T99A 4LJ8A 4CKWB 4TL6A 3U9LA 2PJZA 2FE4A 3VKFA 3RREA 1LB1B 3ZBTA 2W83A 5G0VA 5LU9A 4HS9A 3AHHA 2C5AA 4COKA 1RCUA 1X14A 4FS3A 3QOYA 2MSNA 1CLEA 2GYWA 4ONEA 2IYNA 5LP6A 5IYZA 3DQZA 2FQYA 2YIDA 5C1OA 4US2R 1QGDA 5AR1A 4G5RA 1LU9A 3LLSA 4IDDA 5CLJA 2PMFA 2YVUA 3LXXA 2HPAA 4TV9A 2D3TA 3HPRA 2VYQA 4KRYA 1GVHA 2BIFA 3SJCA 3V8QA 1GAJA 3FDFA 2R8OA 3GVHA 1PHRA 4KQGA 2NTVA 2PU5A 2QJOA 1XZAA 3NHYA 3ADDA 3W2HA 2J9XB 1ZAYA 3OWHA 3OPXA 1TD9A 3GRUA 2HLHA 1ZN9A 1E1QD 1EDBA 4L4XA 3ZUPA 1MC8A 1FTYA 2BM0A 3AB3A 1MJGM 2RAFA 3MRVA 5KYYB 1PTJC 4LGVA 3G1WA 1HQYE 2EL9A 1U2RA 3KVNA 4RSMA 3ZXUB 1A9RA 4LCEA 3EVAA 1DHTA 4UBJA 3SOZA 1G5QA 4YNBA 4QGFA 1S2LA 3EQ7A 3RO7A 1VSUA 4UAVA 4PZUA 3KQQA 4FEAA 3EFOB 4Q02A 1DXQA 1P9OA 1I7SB 2OXEA 4NS4A 1E94E 1XA3A 4GL2A 3BH7A 1TT7A 2CLHB 1M66A 2ZZKA 1ZNZA 1YQUA 2C3MA 5HF5A 5IXSA 1U6JA 2F67A 1SH7A 3DT9A 2V8BA 3E9NA 1K4MA 2PX5A 2R6AA 2VKQA 1JHAA 1X0VA 2PL1A 1OW3B 4B76A 5C3MA 1EX9A 1UEIA 2B7BA 4MQEA 1G7SA 1COWA 2V45A 3MM4A 1ADFA 3IMEA 1O0SA 1QAMA 2BV3A 4P36A 5A06A 1H42A 3GFOA 3DS8A 1SHLA 1XZGA 1M1ZA 5JSYA 4LOLA 1OXMA 8MHTA 5CNJA 1X7XA 4EI9A 5LCXA 1IHDA 3Q7SA 5EWMA 2GK6A 2Y1FA 3L6OO 5EZ6B 4NH4A 5D5QA 4IHQA 5EZ5A 3KG2A 5FL3A 3UIEA 1R64A 4CUZA 3UMVA 3RNOA 4JXKA 4EIWA 1R6DA 3JQBC 4CT4B 1C50A 5IANA 3AL3A 3UWPA 3KJQA 1ENZA 1FX1A 2JG3A 1XL1A 4IQFA 1TDJA 3U3DA 1SD5A 2MYTA 2O54A 1GN9A 2R6HA 1XTPA 3AUUA 3BD9A 5G41A 3RJ9A 4JLBA 4EFNA 1ENPA 3IAEA 3OX1A 4N9QA 2ZT8A 3S8EA 3DZDA 4MLCA 4FJ2A 1DJNA 4B3XA 2OILA 4S0XA 3V1YA 2Q07A 5AJXA 3BIOA 5JQGF 3I4CA 3IKVA 3SJUA 1GNLA 3DHYA 3UWMA 3OTWA 1H2WA 2EJCA 1INLA 4B6QA 3EFBA 5FP0A 4F92B 4FHDA 4QTUB 2Y2UA 1Y0BA 3P0FA 4X1KB 4FR5A 4M9UA 5I4CA 3C5EA 4RTOA 1TO6A 1MC5A 3X1XA 2ROQA 3KYDB 2J33A 2IEDA 3JASA 5JDCA 4AUEA 4HX5A 2ZAIA 2HX1A 3NUQA 3SNKA 1G2IA 3AF2A 5KMGB 4DOMA 2XCRB 1IYZA 2V4ZA 5T6MA 4I55F 1BOFA 4H31A 3W5HA 2BHSA 4PXYA 1B23P 3IIEA 1OFTA 4CM5A 3CH6A 2ERXA 4P4UA 2DPHA 3HCFA 3M89A 4JDPA 3GEDA 4KNYA 3HU5A 1DU4A 1IFXA 1YA4A 2BE9A 1E5VA 2PKQO 2IUUA 5IASA 4Y2PA 3KSAC 4KLCA 3T3NA 3L05A 1H2FA 2PS1A 3DEIA 3G7UA 4EY5A 5C8DA 1LWNA 1RWWA 1GPWB 1K8RA 4QGSA 5LDDC 3LPMA 3ETEA 4BVHA 1NNSA 1LPAB 4LF8B 4OLFA 1W73A 3F5FA 2ADFA 3JAKB 4MGEA 3AF6A 1JJIA 1U2DA 4TL8A 1Y3AA 1Z37A 3ZTTA 1O6FA 1PGNA 1AHHA 2C8KA 4GM1A 1JHVA 1RR6A 2YY6A 2DTEA 2QN1A 1ZN2A 4CL0A 5BORA 4FD3A 3BRCA 3L79A 4M7PA 1ZYUA 5AVSA 3RRBA 2YZGA 4ZYLA 2JCYA 2V9CA 4JKYA 4UDXX 5DIFA 1DSSG 1E2QA 2P68A 4J7AA 1EGMB 3T5AA 4HNTA 1RWPA 3ZE8A 4EKNB 4DQLA 2CHFA 3RK4A 2ZB3A 1YI0A 3EXEB 2C9MA 4JL6A 3K6RA 2WVJA 3NAQA 1JHRA 3A4TA 4H16A 2AFVA 4S1TA 4AJKA 1Z2EA 2EHJA 1S2MA 2CMHA 3GCWA 4O4IB 2F1RA 4R1SA 3ZCSA 4YCMA 2H2IA 3AERB 1TADA 4U2GA 2PUCA 4J0JA 3DNFA 1EFDN 2QL7A 4FYKA 2PXCA 3NT4A 3L2OB 4PGAA 2WQ6A 2OAEA 4M98A 3GRAA 4BO1A 2R7NA 2MINA 4G5OA 3PFGA 1YL6A 1AKWA 3R7WA 3V4OA 4ETIA 3NRBA 3A6ZA 3FA2A 1WSWA 1C9YA 4R1NA 1U8ZA 4BJ1A 4KXLA 2FZWA 1P4JA 1DKUA 3QKWA 1IY9A 1A9TA 1EGVB 2CVZA 2Y2VA 4R05A 3WGJA 1D1PA 2LXNA 4O2BA 1XCPA 3F1KA 5T3UA 2WJ4A 4AIIA 2OCBA 3MJRA 4Q4AB 1MVOA 3IAXA 1BQEA 5F7ZA 3FYHA 1T5LA 5H81A 4ZAXA 5LQSA 4QVIA 1VJ1A 3EG9B 3K0HA 3U09A 4DV1B 3L8EA 1MMFB 3FRJA 4C6TA 4L51A 3D3WB 2QMZA 4U63A 1IY1A 4HDKA 4JVSB 3PVCA 3BFVA 3RR2A 2QLMA 3UFBA 3QKSA 4K03A 3NEPX 2WJWA 1Z88A 1JJFA 3JTMA 3LUKA 4MR9B 2DSNA 2F1JA 2FQ1A 2GTPA 2HCJB 2RH8A 2W2XA 4S12A 3IUEA 3LIIA 4XDYA 1BE8A 3RHZA 4EJSA 1NRWA 2IUTA 5KWIA 1Y6QA 3CPSA 1J97A 4TYQA 2DT5A 2I3DA 1E3SA 4IVNA 4KQ9A 3DXZA 1PDVA 3WKCA 1I0ZA 3C3PA 4DMRA 3B7WA 4FX5A 3KO8A 1R0SA 2HHHB 3MS7A 5A4MS 1DAFA 4H1TA 5DCYA 3IHKA 4AURA 4UHDA 3LLUA 1GA4A 3PJEA 3PQ3A 2M1ZA 4PNZA 5DNVA 3TQFA 3HYSA 3V9AA 3JWJA 2I7VA 2OECA 1AUQA 2C9YA 2GAIA 4E51A 1RIFA 4R9RA 4WLNA 3KYCA 5JQWA 5KTNA 1QC5B 2JAWA 2IUEA 3CRMA 4TV8F 5DXJA 1Z74A 4WESA 2Y71A 4C7JA 1MGOA 1E9AA 3RABA 3KS9A 4FE3A 3TRKA 1ZAKA 2IYEA 4BVEA 4C4PA 4YMUA 4PO1A 1O87A 1B15A 1W34A 3BCRA 3F6EX 1N2EA 1GZ3A 4OBEA 1OX4B 3WKEA 2XUOA 1Q0HA 5HTOA 1W35A 4O3MA 1ESDA 4G4GA 4LJLA 2O2IA 3ZU3A 4CLHA 1K3TA 1R3DA 4R0MA 1C4WA 1TFRA 4CVNA 3OFJA 1QX3A 1U2GC 1I6KA 4JBLA 1C14A 1KEVA 1HYQA 1RQ2A 1Y9AA 4P2GA 3RAGA 4D5GA 5TIIA 1ZXLA 5C35A 1T4CA 3MJCA 4B3JA 1EVEA 1GV1A 4G86A 1UOPA 4D98A 3MELA 3SZUA 1O6GA 2Q5IA 1M2HA 1YZVA 2VVTA 4HTFB 3GRYA 2WY2D 3UK2A 3I32A 1B8OA 4GPAA 3KWMA 2H9YA 4N7MA 2HSZA 3H17A 2MSWA 2OHOA 1KDOA 1VIYA 1X7ZB 3IYLW 3NM6B 1HSZA 3MTQA 1TJPB 3IT2A 3OBBA 2P3QA 2X58A 4FXPA 5E6SA 2UXCB 1Y1QA 4IIEA 2ZI6A 1JG7A 2BGWA 1NMYA 3Q9SA 2QVZX 4AG6A 4ML3A 3GBPA 3L1KA 1CP2A 3ND8A 3CEMA 1Z63A 3RFFA 1C8LA 3T9CA 4NCBA 4F97A 3BIWA 4MUFA 3WICA 3IOEA 4K26A 4AT1A 4ZV4A 3NHMA 1WB4A 1QO9A 2EJBA 1CJVC 1MHPA 3NDPA 4MUMA 4RU1A 3DBRB 4Q7EA 3SM3A 3WWDA 3ZU5A 5KTOA 3MWYW 5FNVF 4YJKA 4AJHA 4FMPA 3A6JA 1AK2A 4XVRA 1OUMA 2GKGA 1WSBA 2Z2ZA 4KG7A 1HV8A 5FB3A 1OZHA 1E5QA 3BSWA 3KDPA 1PFYA 1YCDA 2HRZA 3HP4A 3HEAA 4B6JA 2O2YA 4UVHA 1LXCA 3RNLA 3U7GA 2V6MA 4PCUA 3NGXA 3SY8A 3G2IA 2G25A 5SYAA 3QF4B 4BMVA 3CLUC 1LTHR 2HNAA 5IAOA 2WWWA 4OMFG 2VH2A 3ULKA 3I04M 2WHQA 3BWXA 3WBJA 1EJ6A 2WSSD 5AQ1A 4ZCPA 4I4TB 3V7WA 2VJNA 3P9KA 2I7TA 1AUPA 2YQZA 2IPLA 2J9ZB 3OVMA 1CQIB 3E8SA 1LSJA 4NAVA 4UE6A 1OBHA 3DBOB 3EVNA 2V3CC 2ZB2A 1QHSA 1M75A 4TWIA 3VH2A 4QFCA 1PL0A 2LVBA 4MW7A 2TECE 1XAJA 3EARA 1QYIA 4JXJA 3WYEA 3IOCA 1Y4AE 3CJTA 3U6BA 2VAVA 3BB4A 1Z6AA 3SZOA 5T4HA 1NF9A 1FNNA 1C2YA 4K6GA 1DADA 2NSLA 1XCMA 1B93A 1E5LA 4DJJA 4RDXA 3RS8A 3FWZA 1GILA 2HK8A 5EZYB 2X9QA 4HVAA 1D9ZA 2QRPA 4H7KA 3UW1A 4HGPA 1FDSA 1JVSA 2KWIA 4Y6SA 4D1YA 3ZJVA 4D9HA 1F4LA 5HP4A 4IKPA 4DSZA 1ORVA 3HB1A 4LMRA 2XXBA 3H6GA 1C9KA 1P29A 2X0JA 1EWQA 3E61A 1GZSA 4UQPA 2ZROA 1SCUB 3EISA 4FEGA 5MGBA 1J5XA 5HNKA 3L02A 2ZSDA 2J1LA 2YJTD 1GNQA 2MMCA 1OE0A 5CA0F 4HN9A 2G9UA 3EWSA 3E9EA 2CJXA 5AJVB 3FY4A 4ASUA 2IV7A 5IKEA 3BZBA 5DDIP 4BVBA 3A26A 3BQ9A 4HMPA 3LK6A 1WDTA 3EXAA 5CDHA 4FOSA 1R4NB 2VZ0A 2WNIA 4XJXA 4CL2A 1NXWA 4PYMA 1P9LA 2ZRMA 3UHOA 5CB4B 1KAGA 2XB9A 5HM8A 2DHQA 5WRFA 1SVUA 2K87A 3AT1A 3WLLA 1TTHA 4JU8A 4RPGA 3UBTA 1W88B 2BEVB 3O38A 2FEPA 2NU9B 4NMXB 4EUHA 1PE0A 2AI2A 2QDXA 1HMYA 1NOKA 4OXYA 4EY6A 4Z4HA 4WKNA 3CUEF 1UIRA 1JZTA 3PPIA 4GUDA 1Z12A 3NETA 1R0CA 3LXUX 4PHGA 3HCBA 1RRPA 2OCIA 2C5HA 4DIMA 5U4XA 3U39A 5TVKA 3CZ4A 5CXXA 5D2CA 1NV8A 2GCIA 4MVJI 5JNLA 1WW2A 2HRQA 1PV1A 5C31A 3SQNA 4EUFA 4LF4B 3H1TA 3WNZA 3P9XA 2NZ8A 4EDFA 4PG8A 5JARA 3WRXC 4BLUA 5LQJA 3QRWA 4YECA 1E9VA 4EG5A 1LJUA 1QFZA 1RABA 2E21A 3ABQB 2PUWA 1GTG1 3GJ5A 4WDQA 5DO9A 4EUNA 4HT3B 2ZRJA 3PXEA 2ICAA 1KORA 1RM3A 3IE1A 5ESXA 3U4GA 4BX8A 1OOEA 2DWQA 2E89A 1CR4A 2OKCA 2KMLA 5GY7A 4OL9A 4BE7B 2H2HA 3FCOA 1C3JA 1DQYA 2C00A 5GIOE 2YWBA 2GBIA 1NX9A 4HYYA 2XXJA 4DMMA 1P4RA 4N7BA 3ZGZA 4ZC1A 3R7NA 3H42B 3KT3A 4IL5A 1EVQA 4W9NA 3PD1A 1UMDB 2VLBA 2E4XA 1N9GB 3UMBA 4M0LA 4BWVA 3G0OA 4GKKB 3E5HA 5BW6B 1T91A 1B0PA 3OETA 4YJDA 4YJ3F 3IP3A 3K30A 4E2YA 4QXQA 3ABRB 4RZQA 2ZRDA 4EI8A 3ELDA 5EXEA 4ROSA 1G3UA 1Z0JA 3HWRA 3BMOA 5IM5A 3SFTA 4O02B 3G8DA 3FHJA 1R0YA 2F00A 2I3ZA 4GZLA 4M3NA 4RZ3A 1PGPA 4AY2A 4XXHA 4WEQA 2LZ0A 2P2NA 3MTEA 2FRVA 1JP7A 2Q3DA 3E4CA 4XFKA 5E1BA 1YBHA 4OB8A 3SR3A 1B41A 3LX6A 4TMYA 3CGGA 1E9DA 3WR5A 4YEDA 3H9EO 5GIPE 1NPYA 2F48A 2IPNA 5BN4B 3AVYA 1ICIA 2WFZA 3VYUB 3F9CA 3KR1A 2PXHA 3NU1A 3DOHA 4M55A 1SO8A 5ANRB 1ZINA 2D13A 2YYAA 1XP5A 3DTYA 4RTMA 5J9FA 3IAFA 3A36A 4R2JA 3Q3IA 1AURA 4WZAB 3SBDA 4AQDA 3IR6A 1GPLA 3MILA 3VSBA 4ZZ2A 3MCTA 4U6QA 1CJCA 3UXHA 1UBJS 4D9BA 4H4EA 4JZKA 2SNIE 1RBQA 3NR2A 2FOLA 1MD9A 1QSGA 3ESRA 2V65A 1BGVA 1NVUQ 2AWNA 2WFLB 3F4KA 4JVLA 2YW9A 3EZXA 4EFLA 5JANA 4WNCA 1ORHA 3LOUA 5LQAA 3FVVA 3H5LA 3HUTA 3P2JA 3TLMA 3DEYX 3WDKA 1XQWA 1E9SA 3IPCA 2XXAA 3Q8MA 2V54A 4QUIA 3AHCA 2WOJA 2FPOA 3GRFA 3OX3A 1P6UA 1ZICA 5JR3A 1A3CA 1GUZA 4P7JA 4IS3A 3LTNC 3L6UA 3W9YA 3OZBA 4FSDA 3WRWA 1WF6A 4NU8X 1BROA 2P3OA 4EMBA 4ZYVA 1FZQA 3QFRA 1JDPA 2PIDA 2ZTSA 4LQ4A 3EIUA 1TVKA 2RHMA 3ZXXA 3OOWA 2O2EA 3DPSA 1CZKA 3DZFA 3IESA 4I50B 1J5PA 4LWQA 3RUPA 3C6YA 5CLIA 1C1DA 4PZYA 4Q82A 3H8SA 5AVYA 4L22A 3CVUA 4LF5B 3GGOA 3S68A 4Z4QA 4BWFB 2X7XA 1QHFA 2FOIA 2W6IA 2ZT5A 4ZYTA 1ID8A 1CFJA 3RUDA 1W9MA 1XDSA 3WKDA 4AY5A 1V43A 2LV8A 1D5WA 2P11A 4W1SA 1LPOA 1B0UA 3O2NA 4I6GA 4IHAA 5B1DA 3LFUA 1YR8A 3EULA 5D1HA 1BS2A 1OVMA 4PNEA 4Q39A 1PGQA 4MTLA 3TSZA 4F6RB 3DAOA 3N8KA 4QHYA 5DCWA 1WCV1 1XRJA 5E95A 4ZDIA 1KXJA 5C7LO 2AEJA 2QTVA 2W11A 4A2CA 4F2GA 1XD2A 4Y9TA 1E79A 1E2PA 1JKMA 2V5UA 3KV1A 3AFGA 2PNJA 4YV7A 2GYYA 4J3FA 1DT5A 4MB2A 3RTEA 4A23A 4BBJA 4Z9BA 1UDRA 1GCUA 2JFZA 2J6HA 1TJ4A 1F9AA 2DR0A 3QFSA 1BXGA 1JR2A 2WIKA 2P2DA 3PHJA 5DSTA 5FOTA 5G2OA 3SMVA 3DT8A 3HDTA 5JE8A 5KX5F 4FZVA 4H1VA 3GR6A 1QFXA 2QJRA 3GDWA 4RZXA 5F1OA 2WA1A 1VP3A 2IEIA 3DV0B 3ZHSA 4UUMA 3QVKA 1S8FA 2AQHA 1BNCA 1C30B 1MDBA 2RHOA 5AXDA 1XWIA 2QX9A 4MH0R 1CJKC 1C3XA 4G0ZA 4KRGA 3WV5A 4CKBA 2ATIA 4J16C 4EGSA 4K40A 4XCXA 2AJLI 4KE8A 1AQNA 4CKCA 1R8QA 1VHQA 1J2UA 1BYUA 5BQFA 3R0QA 4RETA 1TPYA 2G17A 2XHEA 3A3PA 1OXSC 2REQA 3L49A 4CRWB 2CJYA 5BR7A 1JDZA 3KHKA 3LLVA 1J49A 1PFGA 3UC9A 3E22A 1JXOA 2WHPB 4XGQA 2G09A 5JZMA 1JSCA 4UXIA 1TC1A 4BZXA 4DXAA 5AKHA 5TV2A 4PIPA 3SG0A 2Z0MA 1FFBA 1LDBA 1JZQA 1KYIA 2PA0A 3MWDB 2R4TA 3PIIA 2GASA 1UANA 4QQNA 5FR2A 4FDVA 3T3GA 3FPGA 1LW6E 3KWFA 4G1EB 3HUFA 3BQNB 1X38A 1PZNA 3IX7A 4E07A 2FWPA 1UPAA 2RGUA 1J2TA 1F06A 1M6VA 4KUHA 4WOCA 3DOFA 1P6XA 2UDPA 4OJQA 5HJ2A 4MW2A 1H8HA 3FX2A 4EYGA 3B6MA 3EYAA 8ATCA 1FXWF 4ZOBA 2E85A 1T3TA 1V16B 5BSRA 3TECE 3PHHA 2R6CA 2ZZNA 3QEBZ 2WYOA 4EUEA 2FG5A 2P79A 3LHIA 4R5MA 2GOYA 4JDUA 4RK0A 1U3TA 4Q4JA 2J85A 5BW8A 4R6XA 3EIOA 4INJA 1TVCA 1NI3A 1JIUA 4HGRA 5I5GA 4DV3B 5TARA 2GEJA 5JXIA 1JE1A 4U3JB 1GZDA 3RGWS 4MGHA 3PEYA 2H31A 2BGNA 1JLSA 4AJIA 1DVRA 1RBYA 3I5UA 3GI1A 1OJLA 1YZKA 4OYRA 5DI3A 2IUSA 3TZCA 1V71A 2H7CA 4EHIA 3SMQA 2UUBB 5D51S 2XT6A 3QOWA 4R9SA 3HA7A 3L3BA 2I9KA 4FCCA 5EHNA 3B2QA 2PFKA 1JLRA 3TR0A 4AZVA 3VJMA 1DBPA 3A3OA 3FDIA 3QEMA 3Q88A 2RHTA 1DOAA 3CV3A 5BNZA 1FTNA 1UP4A 3HO8A 4OK3A 4DDKA 1N36B 3EXIB 2B83A 5F77A 2VDWB 3MT7A 3JARB 3TDKA 5LDHA 4N76A 3L4EA 1I4EB 1YL5A 4FWBA 4I46A 1ADGA 2FWNA 4CU5A 1MOZA 3AJAA 3JAWB 2UKDA 1SQSA 2A2ZA 1T1EA 3RHTA 1PFQA 1U5AA 4J7UA 2JL1A 4HADA 4GMGA 4V0OA 4JOSA 2EBHX 2FUCA 4KUGA 2RMKA 4M88A 2ZTUA 5LC1A 2G28A 2PEZA 3ENZA 1AXEA 5ALRA 3UWKA 2LWIA 1US8A 4Y3UA 5GJCA 1E79D 4OHOA 1QS0B 1A4IA 2VAWA 3ZEAA 2OHJA 1D8TA 4YRIA 1Y5MA 1SNYA 2RARA 2Y1GA 2ZITA 4OHXA 1EYZA 1F17A 4AO7A 1RKBA 1RJDA 4TN1A 5JEEA 1Z6ZA 4QQFA 4YRLA 4ZQIA 2AC2A 2OYCA 2YN4A 4CTOA 3QUQA 4OP3A 3IUBA 4GQAA 1QRSA 4O4IF 1IH8A 1YC5A 1T4DA 2P75A 4QOSA 4B0OA 3LECA 3M7IA 1U7UA 1B2LA 2AGVA 2P3SA 2PFGA 3C6BA 2FPKA 3LP5A 3PGJA 3VHLB 3ZPXA 2JAUA 3TOVA 1EX1A 3I92A 1N4AA 1YS1X 4XSVA 2C3PA 4C04A 3OUZA 1S3SA 2GZAA 3WIOA 5K7SA 1U7TA 1I2AA 1GUAA 3BGWA 3K9CA 5B3AA 4XGRA 2YMPA 4MQFB 1NP7A 2VP2A 1LI5A 4YAIA 5BOVA 4XWAA 3GNTA 5HIMA 2GI4A 3VYTB 4XJTA 4YIKA 1NLZA 3DHWC 4JODA 3BFXA 2ZIVB 3ST7A 4DSUA 4YX9A 4JK3A 3VU9B 4K9QA 4BQSA 4CNQA 3TXXA 2QG6A 5FWAA 1WB5A 2GD2A 4TKUA 5LJLA 2YJ5A 3LP8A 1XHLA 3OIFA 1EX7A 4EY4A 2XUZA 3IKMB 4C5AA 2ZTMA 3AP2A 3KYJB 2O8BA 2EARA 1F7UA 3EOAI 1ESEA 2HN9A 4E7PA 2Z6QA 3AFMA 1H8HD 4J7CA 2Q1SA 5CEEA 1HFWA 1P1RA 4DDWA 3TZQA 3M6FA 3GA5A 1W5BA 1XFAA 2QMUA 1E2KA 1U3FA 2QTTA 3OLCX 1DFGA 4H0CA 3IT3A 2PUJA 4PLFA 1MIHA 2DFDA 3C8MA 3PXGA 4B5KA 2C99A 4D0GA 4Q7KA 1MX5A 4HVTA 4OQNA 4XAQA 1Z4PX 3GLRA 5BR8B 4WKBA 1WULS 2ACWA 2JCXA 5KHAA 2HLDA 2ZWOA 4QXAA 2BR3A 2GMWA 1XRPA 4RVOA 2LUOA 4BQPA 4EO7A 3HUDA 3E82A 3IQIX 2ADOA 1DCKA 5AM3A 1WHSA 1RYYA 4TXNA 3GPDG 3W2TA 3EUWA 4IEIA 4OUKX 1O9GA 3L8ZA 4L3OA 5EVCA 3FDZB 3BGOS 4UHBA 5DW3A 5HS6A 4W7SA 3W0LB 4TVKA 1V8ZA 3LXMA 3P5SA 4LJ6A 1RRKA 4AW9A 2IC5A 2VF8A 1QCCA 3R6WA 1J0EA 1GRRA 1W8IA 1EQ2A 2ZRQA 3K32A 4J1TC 4MK4A 1OU4A 3LCJA 1THZA 3QLVA 1K7YA 3QKRB 1U0GA 2P9GA 4JOCA 1EESA 3RVJA 5IJZA 4JITA 3WLAA 2BM9A 1Q7BA 2NZ2A 4GGPA 3UMSA 3UXYA 4B34A 5T8KC 4ZXPA 5SZIA 2ZJ7A 2QROA 1RXVA 1D2EA 3G0GA 3WIVA 3PFKA 1L7XA 4NBLA 3DCNA 2ATCA 4JP5A 2YYSA 4U2FA 1TMGE 1ZM4A 2JBAB 2VOJA 4X8MA 3FWKA 4ZOEA 1JF8A 4RSHA 3L6DA 4OJNA 4UZFA 2DY1A 4ZYYA 3ZDYB 4R01A 1CK4A 5ADWA 4IV8A 2PN1A 4LQLA 3C3CA 4GGOA 4NBSA 4DNOA 3DKKA 2YWXA 4PX2A 3F6SA 1UMBA 5AVXA 5EE0A 2FMTA 2ZRNA 1V5EA 2XDQA 2ZBPA 2J9GA 4BDTA 2IZ5A 1BG6A 3LLMA 1KYWA 2IDMA 1U80A 5HKAA 1YZLA 4JLSA 3U40A 3QHQA 1Z0IA 3BE4A 4G5SA 4AU1A 5K0ZA 1T9CA 1T36B 2HUPA 2PS3A 1PZEA 4D3YA 3TRIA 1UWLA 4XPIB 3QFCA 3ZZTA 3DDOA 2F2TA 5DTJA 2ZUFA 2PGOA 5CFZA 1TGYA 4I8XA 1PZHA 4IS2A 1HY3A 1Y1PA 3R8FA 3B8HA 1Y4ZA 4ZZIA 1GHTA 1UKAA 4FE4A 4Q3OA 4B8WA 1BEUB 1YRWA 3GUHA 4QVKA 4LIPD 1N2IA 1ZM3A 2HPZA 2C4TA 4RPHA 1GWNA 2EBFX 5KAPA 4EKYA 2BD0A 1D1TA 1P1HA 2PQMA 3Q8LA 1PTJA 5IEBA 2I78A 3QKIA 1NWHA 2A5GA 2V1UA 3R3VA 3JQAB 4RMJA 3X2FA 3FI0A 4DSTA 1A7UA 1MRSA 4K1XA 3WK7A 1RHRA 2Q6OA 2QTLA 2HWWA 2OGTA 5JU6A 1Z7BA 5KOIA 2EFCB 3EE6A 4I4TF 2I4RA 4M1EA 4MV7A 4CQNA 1YJCA 2HT6A 3F74A 4IILA 1KZ9A 4IIUA 4KR6A 2G0AA 3L18A 1WD7A 1G1MA 3WC4A 3HNOA 3PJDA 2DEUA 2QKYA 1CJMA 1RAGA 1DT3A 5BVHA 1EDEA 1XMXA 2ODAA 1SOWA 4Y9UA 3U4AA 4AROA 1SU7A 2ET6A 2WM9B 3O0TA 4G1UC 2K6GA 4JX8A 2AXQA 4DG8A 3FYUC 1F48A 2X8AA 3A4LA 2FHPA 2HLDD 3SEZA 1VLJA 2ZXFA 2JGKA 1RJGA 1WIWA 5EY5B 4ICIA 1GSAA 2LKCA 2VRBA 3D02A 4X61A 5DK6A 4BB6A 1IMOA 2OWEA 2ILVA 3PB3A 4RHEA 5LFAA 1IBLB 5JSQA 1UPUA 3SVLA 3W5DA 2Q6LA 3NPAA 1YZYA 1QKKA 5I45A 2CLEB 4XVCA 1MB4A 3CQ9A 1VZ3A 3INNA 3IV6A 3R09A 3TRHA 1VJTA 2B94A 1W4ZA 1E8DA 2PBRA 3OQIA 1E3LA 3UB4A 4EJ6A 5DYTA 3HO6A 3TSAA 4QGGA 2A67A 3WYAA 2OQ2A 1G3RA 1QUFA 3GYBA 3V8PA 5JASA 1NUUA 2X9NA 1F6DA 1J2YA 1E32A 1I2CA 1NVVQ 4I4NA 4F4FA 5SY9A 5T64A 3M1YA 1WZEA 1K7CA 3LDGA 1H66A 2EZ8A 2GPBA 3GT4A 4EQZA 3S81A 3EXFA 2ZTHA 4JGBA 3TE6A 1UAGA 4B6GA 2CD9A 4LSWA 3F1LA 1SOMA 2BE7A 3RKRA 1UPXA 1GUBA 4RPCA 1GAQA 1WV0A 2QRGA 1IY0A 2WYWA 3AKYA 1A9XA 3K71B 1EA7A 2XITA 1Y8RA 1KFKB 4LNAA 3HLYA 2PL9A 3GIDA 4KEAA 3LV8A 3D2CA 3C45A 5EKSA 2PMKA 3HA3A 3KQTA 4HDRA 3JQ7A 3CZQA 1MOSA 1JJBA 1N6OA 1QVZA 2QR2A 3PNVA 4U2DA 1MR3F 2C2WA 5CVDA 1ZJZA 5EMJA 1XEFA 4DM3A 5CPFA 3PHCA 4EGCB 2O1WA 4BRSA 4OLBA 3J81k 1NASA 1QH1A 1EAMA 2DETA 2VC2B 2I65A 4LN1A 5A1TA 2FZ5A 3HXMA 1BX0A 1ZJ6A 1PR2A 2YR0A 4PLWA 5B1YA 5BWBA 5C1BA 3DE1X 5DSZA 4IFEA 5IVPA 2RAPA 3ZDQA 1VG1A 2G5PA 3C97A 1O3YA 1RI2A 5H7XA 5L40A 3R9XB 4F3TA 3ESDA 1YZUA 2G0TA 3KKKA 4E12A 1SCNE 5SY4A 1JQ5A 4B31A 2DWUA 5ALXA 4X93A 2GBFA 2QZSA 2CXXA 2ODEA 1JRLA 3TDNA 3WIBA 5EHXA 4HLNA 5A0VA 4M9ZA 5IM4F 2ZBGA 2WC1A 2QD4A 4QUKA 3SJBA 1PL6A 1ZCJA 3L0YA 3U7QB 4RA9A 1L7RA 3WGHA 1IBRA 3L7KA 2RAUA 2EFEB 3ORQA 4AX8A 3C70A 2RKOA 1N7HA 3EZ9A 4MB6A 4X7RA 4C3UA 5HXAA 3F4BA 3GBSA 3PQ8A 3U4MA 1FB5A 3KALA 3IEPA 3DBVO 3ON5A 3UN1A 2BHTA 2XTJA 2EXXA 1DAPA 3O3OB 3UW3A 1GARA 2A14A 3VUEA 221PA 1OFGA 4KQWA 3WWOA 4DPKA 3LKBA 1VL1A 2Y6UA 2YCLA 1I24A 4G2TA 3CBQA 4Q1DA 2VCYA 3CRRA 4XARA 4RE6A 2XQKA 3FYTA 4E5KA 4XR4A 2ZWIA 3WFIA 2P90A 3V1NA 1W4CA 1TF2A 3RPEA 2ZYDA 3ES9A 3PYLA 3M5PA 3LT2A 2ZJ8A 4OL0A 1KRHA 3O1LA 4FNOA 3HPQA 3RS2A 1NXQA 1Y3DE 2P4EA 3IBSA 4FCVA 4BMSA 4CLOA 2JK0A 3K94A 1T9BA 2E9SA 2X2EA 5DTMA 1WXDA 2WMNB 1M2WA 1WPXA 1IN8A 4ND7A 2DUWA 3HSSA 2ZULA 3OURA 5ELLA 4E5UA 4GX0A 3BS4A 1KVQA 3F98A 3ZH2A 4IFTA 5LN1A 3Q7TA 3GQBA 4P2BA 5EIFA 3CUYA 2IY8A 5L7YA 2XVXA 3THYA 4Z3KA 1PK9A 3TDMA 3PE6A 1GNRA 1X1EA 2IEZA 3ZDRA 4CMIB 2XD4A 1T8WA 1THMA 3KJNA 3OHSX 3OX4A 3ESBA 4K9OA 1XEWX 4XWTA 4F6CA 3GUUA 3ZKWA 2J4DA 4MVWA 5AFSA 1JA9A 4JEMA 5HE9A 2Q1YA 2VUTA 1X9IA 4OGFA 3I37X 3E84A 1SXJC 1XAGA 3IVMA 1RZRD 3PQCA 1L5FA 3BRWD 4WAUA 5EIAA 4C0LA 3L93A 1B43A 4KDFA 4KR0A 1IHPA 2QT0A 4BJ5A 1OH8A 1Z9BA 2GEUA 2CCJA 5DPMA 1EWYA 1E9RA 1I7LA 2A5DA 1MIOB 4ZODA 1KI6A 2OCPA 1NRIA 4ECEA 1K5PA 2XQJA 2P4QA 3CS3A 4JD5A 4FT4A 2MSDB 4GXRA 1N3YA 1P31A 3DDCA 4G97A 3OHMA 3NH9A 5L95A 3QPVA 1E99A 3PDHA 3PXUA 1HRKA 3MINA 2C88A 3PQ7A 3H2YA 2D2VA 1RJ9A 4DDUA 1ZD4A 1RPAA 4JEIA 1KVSA 1L8AA 2WPDA 4HZIA 1ZOPA 3TTSA 1TT5B 3ZNQA 4Y6PA 5FWXB 4CT0A 4AULA 4JLVA 3WLQA 4HWPA 5CCEA 3LHFA 3LKVA 2D2FA 1B6GA 3TTVA 1AF7A 3ZG6A 1W44A 1L4EA 1Z4NA 3NVKI 1J7KA 1O6BA 1E7YA 2JEZA 1MB0A 1N6HA 5AESA 3K7EA 3MIZA 2O05A 5AI4A 2ZWVA 4LNUB 3DKPA 2GZ2A 2DFPA 4LI3X 5T3YA 1TD1A 3PPVA 3TCKA 1SPBS 3QA9A 2CNBA 1CR2A 4RF3A 1OHHA 2IPMA 5A9TA 1AS3A 1S6YA 2QZ4A 1ZK1A 2I2DA 1CF2O 2YQ4A 3GLHB 5IABA 2WE7A 4PG5A 2PT9A 1TQDA 8ABPA 3CT4A 1W36C 1DQPA 1R88A 3IO5A 1SZJG 1W7AA 4HI0E 4Y7CA 1DRWA 4PC2A 4OQMA 3UH1A 1UWVA 1M6NA 1U2GA 2PUTA 1CJUC 3I34X 5FTWA 3UUGA 1C1HA 3VDXA 3ZWOA 3U6KA 4WKCA 1HOXA 4HQ6A 4CKZA 1JR6A 2OCAA 1I7NA 4ZZ1A 3H4MA 1EFVA 3IA7A 3NASA 5A03A 4DC0A 5JFOA 1CS4C 1KZ4A 1KMIY 2ZCVA 1NAHA 2PG3A 3VR1A 3EK2A 2A7QA 3I1IA 1I6WA 2Z6AA 1RE0A 1XJWA 2A0FA 3K05A 4OQXA 4PHCA 4QVGA 1X1RA 3OQ6A 4K2HA 4OKNA 3SWWA 1R4MA 3DVAA 1N2XA 2DLCX 2C31A 2VA8A 1BMFA 4KW7A 4J0CA 4JV5B 2EW1A 2YWRA 3BL8A 1BTOA 4A2PA 4XOUA 4P8RA 3PWTA 1A2QA 5FCDA 4PYOA 5B7NA 5JVDA 2W00A 1TAGA 5BWMA 4H59A 1R8YA 3MUFA 4X6XA 1KHTA 3UGQA 3HVKA 1NBMA 2P2GA 1GZ4A 4DA8A 2JGJA 2QYSA 4KN5A 5BOSB 2FQWA 2P9EA 5MN5A 3HVJA 1CRLA 3WBFA 1O8CA 2ZBFA 4WXPA 1LCIA 3RK0A 4HXEB 4DT1A 1NQOA 3RUHA 1ZRHA 2Q0XA 3E3AA 3BHNA 2C2YA 3JD0A 2YZ7A 3N2IA 3SC2B 4H77A 1JAZA 2W70A 3UMRA 3IAHA 4ZGWA 1PK8A 2EHDA 4A27A 1NKSA 2OWDA 2EZ9A 2R2GA 3E0QA 1R16A 4LZWA 3RC7A 3RUEA 3WA6A 1RZ3A 3JD2A 2RGNC 1GKYA 3DE2X 2SICE 3E7WA 3ASVA 4XUDA 2I34A 5E3IA 3VU0A 2A9VA 3W5UA 1M2GA 1XTVA 3I42A 4GBJA 1Q50A 2E55A 2HWXA 2H06A 5JLAA 2B35A 3VPDA 1MABB 5CG1A 6ADHA 1HURA 4UOQA 1AGXA 2IJGX 2J48A 2X41A 3H7AA 1E77A 3KCQA 4G65A 4B44A 4QDZA 2ZSAA 1JAXA 2QLTA 4NDNE 3NHBA 1G8FA 2IT1A 2JS7A 3LCCA 4QJ4A 3WB2A 1BHO1 1X9GA 1LTQA 1SR8A 4LYAA 1ECPA 2XNHA 3OZFA 1NW7A 4YCNA 4MX8A 5AOCA 5AW9A 1RRMA 5BNIA 1Z8FA 1VYTA 1PWEA 2WYVA 2O8VA 1RAAA 1KK3A 1CIJA 2H65A 2CDCA 2I7CA 1OTYA 5KI6A 1P1JA 3LWZA 2CUKA 2WPDD 3UJNA 2N1MA 5AKKA 5TPWB 1I94B 4F4DA 1L9KA 1M6EX 1NJ1A 2J5KA 2ZPUA 3U5TA 4YLYA 2XX3A 2AL7A 1FMJA 1VKRA 4FMCF 3MERA 5CB8A 1PZFA 3WO1A 4KGZA 2WU0A 5I3ZA 3SQXA 3KOOA 2O3QA 2JAQA 3VC1A 2ADMA 2J3EA 4KQFA 3FF4A 3S5JA 1YSCA 2XOKA 3NNNA 1F5NA 3BHJA 3LZDA 3CUVA 1EDZA 1WZUA 1OHHD 1SC4A 3AR7A 1NNI1 1M7BA 1L4FA 1NR5A 1IVYA 1HLDA 4G5GA 2BZ1A 2WKSA 1ZXBA 4UU8A 3NXSA 3AV3A 3PITA 1UBCA 2BCGY 5HEKA 3ZHXA 1NW8A 3ONFA 5K0NA 1USVA 3T9EA 4TYMA 2ZYUX 3FUXA 4Q3EA 3R0JA 2B30A 5ECWA 2BGKA 2ZTLA 3CC8A 3LDFA 1NFRA 1GITA 3AI7A 4MCHA 2J3HA 4RK7A 3W4IA 1B6TA 2I03A 2WWHA 5AXAA 5J23A 1TA0A 3SYNA 4AJOA 1YDEA 2FMIA 3IB3A 2GPNA 3ZGLA 4ZMBA 3CLSC 3UCXA 2IS6A 2FZ4A 2O23A 3PR3A 3LO5A 4LMAA 3GFPA 1DEKA 4RGQA 4NCHA 5CK4A 1BMTA 1XXHA 4YGXB 3HSYA 3TW0A 1YHNA 1P1FA 3IMGA 2ZTVA 4C7OB 4AZTA 4ND5A 4M6WB 4AS3A 3FLEA 2FJ0A 2QUKA 4R9NA 2R8EA 3IUNA 2UV8A 4JROA 1HPLA 4HEQA 4EY7A 1HQKA 5CX1A 2JKYA 5TS2A 3WRXA 3BIJA 5LKRA 1VHJA 4RPKA 1NBMD 3C4QA 5BWLA 4NBUA 1MT3A 4ESHA 2I2BA 4MMYB 4TTIA 5EWMB 4BO2A 4F4HA 4X1IA 4HSEA 4NOKA 5B7QA 5JNSA 2QL6A 3BMXA 3FFWA 3SQOA 3QWAA 4OU5A 1K5HA 3T7KA 3L5KA 1W87A 4A8JC 4TQGA 4C4SA 4E70A 4FFPA 4H9GA 4CKEB 2ZBVA 3B82A 4O1IA 4WFKA 4UHHA 1NF8A 3O90A 5MFPA 4RY8A 4JOQA 1LI4A 1LSSA 4DZZA 2QAGC 4BKOA 5ECYA 3WSVA 2W6CX 1E1DA 1V1JA 3DVQX 1CLUA 1PNOA 4AWXA 4XGNA 1TZJA 3QNMA 1SBQA 1OI3A 4NMWA 2CC2A 5DGXA 5FLKA 4D57A 2DFLA 2HB6A 3HV0A 4HAXA 3C0KA 2B78A 3CLUD 1E8MA 5KO2A 2P27A 3BJZA 3FI9A 2G9VA 4A7PA 2Y1LA 2DLDA 1BDJA 3BERA 4YPVA 3LF2A 1QRRA 2OHGA 2JB9A 4X64B 4FWTA 1WQ4A 2BEKA 4HDSA 3TW8A 5HKOA 1WD5A 2FPMA 3X1MA 3HJGA 3ZD8A 4KRXA 2QSUA 1P17A 1CY1A 4UJ5A 4BAGA 1X1TA 4IIFA 4PSDA 3LUGA 4LZPA 2GJ4A 3NRCA 1ZMXA 1JVNA 1Q1AA 1K3UB 3H16A 2C2BA 3PJRA 3CIFA 3QXHA 4MW0A 1USUA 3UHAA 1H1LA 3LT1A 3PUIA 2YUIA 3NTUA 3W77A 1RLUA 5JDIC 3O8CA 2VK8A 5IAEA 5JS6A 4CEIA 2GQ0A 3KKZA 2C58A 2EEZA 3H04A 2CV2A 4EK9A 1U0HC 3DOUA 4KTVE 2OZLA 3ZN2A 1C3OA 2GO1A 3K8QA 3WGZA 3L7DA 4P53A 4IMJB 4E31A 2XOKD 5KWJA 4LVOA 2Q7DA 1UJCA 4YJFB 4BECA 4HH4A 3DM5A 1JDBB 3MD0A 2C9CA 1L8OA 2ZQYA 4PYIA 4ZVLA 4L57A 5H70A 3WBBA 3ZE0B 4AYXA 3EQ8A 3CNEA 3LT5A 3QITA 4DLZA 6YASA 4RANA 2I1LA 4KPUA 2B8WA 5D1NA 2ZYWX 3SP1A 1GTMA 5JJBA 5EXSA 3ETGA 2ZR7A 2VKTA 3LVBA 3VZDA 4H35A 5C5IA 3PGMA 1YJ8A 2TMKA 4PQYA 4AWAA 1IOVA 2XZTA 2C4HA 1Q84A 3OE5A 5IP5A 3RJMA 3T0GA 4PU0A 4F60A 3P32A 2AMVA 4NYMQ 2O2JA 2VZLA 3GH3A 3MBIA 4F3NA 4RVDA 4KXUA 5P8WA 2VXOA 2Q3JA 2LCQA 4W5NA 1KYXA 4AQ7A 2QQ5A 3CPHA 4TS3A 5HBRA 1GA1A 2VG8A 2R7KA 3PQ2A 1U7HA 2F90A 2HCRA 2Q5CA 1UFVA 3KJZA 1SQFA 3C16C 1Z28A 1RT9A 2CMKA 3N8NA 2ZJOA 2I1VB 3RYHB 2ZIXB 3LX8A 4C08A 3W4KA 2OXFA 2XRYA 3ZCXA 4ZT3A 1CSEE 2YHAA 1OGYA 2I80A 1QB7A 3ESXA 4JENA 2H7XA 3LG2A 2V7QA 4EFDA 2W0SA 3REQB 2UZAA 2MINB 4OHCA 4D6PA 1NI4A 3QV2A 5BWOA 1OH6A 1FQJA 1SULA 4R40A 5B4VA 2JFYA 4UXHA 4Y6RA 4X3PA 4AJEA 3V8NA 3COSA 4F91B 1U1EA 5L8VA 4H7EA 3TIGA 3AG6A 4G5YA 3RTBA 5ALVA 4IDGA 2XUHA 4PG7A 4OQPA 3LKDA 3S27A 3T95A 4HUTA 4NV3A 1A2KC 3OIWA 3I1FA 4P3XA 4Q3NA 5H3HA 2DG2A 2DKNA 1OYVA 2FSGA 5T6BA 3LPCA 1UODA 4XEHA 3IHWA 1KARA 2EGGA 2E1PA 2ZIZA 4L73A 3V4SA