4R8KA

Crystal structure of the guinea pig l-asparaginase 1 catalytic domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
355
structure length
355
Chain Sequence
b'SERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Hydrolase
source organism Cavia porcellus
publication title Identification and Structural Analysis of an l-Asparaginase Enzyme from Guinea Pig with Putative Tumor Cell Killing Properties.
pubmed doi rcsb
total genus 115
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r8kA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4r8kA01
1JJAA 4Q0MA 2WLTA 1DJPA 2GVNA 1HFWA 1JSRA 1WLSA 3NTXA 5I48A 1HG0A 1O7JA 1HO3A 2WT4A 4NJEB 5F52A 1IHDA 1ZQ1A 4RA6B 4NJEA 5K3OA 2HIMA 1WSAA 4PGAA 2JK0A 1HFKA 4RA9B 5I4BA 3NXKA 5CBPB 1JSLA 2D6FA 1DJOA 2HLNA 1ZCFA 3PGA1 1HG1A 5K4HA 2P2DA 5DNEA 5K4GA 5DNDA 5K45A 4RA6A 1WNFA 1HFJA 4RA9A 4R8KA 5HW0A 4ECAA 1AGXA 1JAZA 4R8LA 5CBPA 5I3ZA 3ECAA 1NNSA 2P2NA 2OCDA 5DNCA
chains in the Genus database with same CATH superfamily
2QUZA 3KU1A 4N18A 4CCYB 7ABPA 5CU7A 4GKAA 3KQWA 5AM1A 3S55A 4OQZA 3WKDA 1KAEA 3BKXA 4M9XA 3AJRA 3IDFA 1KQPA 4YEDA 3TTWA 3VO1A 3W6UA 1GA1A 4RHCA 3RT7A 3N87A 3MTEA 2CDRA 2I6TA 4KXFB 3KHKA 1Z0SA 2GPWA 3D3NA 2FLKA 1V9CA 2R6R1 3VNQA 2QMEA 5IJXA 5ADHA 3MJFA 5A9SA 1NBMA 5MN6A 3A70A 3E61A 3OEHA 1O3YA 2QNIA 3OLQA 1K9VF 2CKMA 2FPXA 2P0EA 4GS5A 1AKQA 2KX7A 3MJ4A 5CX1B 3UHPA 4BFYA 1B2LA 2UYOA 1PEKE 1M76A 4GM4A 1LPPA 2QUHA 4G01B 4HDMA 3RYTC 3FYTA 4GE3A 5G4KB 5GPBA 2NYVA 1W88A 3IEUA 1Y3HA 2QUAA 3I4LA 4MQMA 2H11A 4QGGA 1YA4A 4A6XA 2CVOA 1A8UA 2J3DA 3AF3A 4PR0A 5IASA 2WUFA 5EIXA 3E22A 3JQPA 1AKNA 2DG2A 3KZKA 5ES3A 3GW8A 3AL2A 2EFGA 4NK4A 4ZQEA 1CETA 2OPBA 1IY8A 5D84A 1GYPA 3BWXA 4BLUA 1BAPA 4R8RA 5LU9A 1YO6A 3C14C 5TT1A 3RC3A 1JEDA 5JRDS 2FVYA 5ECGC 1LQTA 2J3EA 1KJQA 1KJYA 3L6EA 4Z49A 5HIAA 4G09A 1Q83A 4LG1A 5FR2A 3QJ5A 3HA3A 2WSLA 4JBWA 3BWBA 3CE6A 1H2FA 3DHWC 1NW6A 1WXHA 4HTFB 2RHGB 1O97C 1IPFA 1Z4MA 2RDMA 4HMOA 1MEOA 2YW2A 4HDKA 2IYAA 3QVTA 1VL5A 5IYZF 1EFRA 3EDRA 3O3MB 1YTUA 4LBVA 2ZSIA 4US1R 3SR0A 3EZGA 3I0MA 4CLRA 1FNNA 2NTJA 5BSKA 2X1HA 3AYZB 5DPMA 5EIBD 2ZROA 1T5OA 4MR8B 4Y9UA 2FW0A 4MW7A 1E1CB 1D1TA 4WN3A 1EFKA 5CA1A 5A5EA 4X94A 3JWGA 4E2YA 1R12A 2OO5C 4M7PA 4GMHA 1HG1A 5LWQA 5DO9A 2BGJA 4F4JA 1F7UA 2WWRA 3MPOA 3PNKA 5LQCA 3IHWA 2W6JA 3RC2A 1Y6JA 3PVZA 3R1IA 4KFRA 3HYTA 1NTOA 1U8TA 3PR2B 4RF3A 4FX5A 1M2FA 2QD2A 3C87A 4FHDA 3BB3A 3QMPA 3H65A 4GWKA 4BZZA 3QX7A 3U39A 4LRUA 2I7DA 1RI5A 4FW8A 1C7RA 3LHFA 4LPSA 1IOVA 1VFNA 3GLIB 5AP9A 2D2EA 2VA8A 1SXGA 2ERCA 2UYGA 1WPGA 1P18A 2I4OA 3M82A 1EA5A 3KB2A 3PTZA 4MP3A 3V8EA 2XMGA 4MK4A 2ZTHA 1MFPA 3HFSA 3T5BA 5E9WA 1UOPA 3LQ1A 1ZVVA 3HVJA 3RVQA 3OO0A 2PBRA 3ZBQA 3GVIA 4CKYA 3GLKA 5EMNA 5F3WB 3JAWA 4TXMA 1G16A 1F6WA 1T0IA 2HRRA 4O4JA 3T5MA 2IEDA 2P0YA 4F21A 3RF6A 4BNYA 4U8HA 3HDYA 4XX0B 3L4KA 3VJLA 4EHKA 5BSTA 1QGAA 3RSCA 3ILYA 1LTQA 5FUMA 2B7CA 2R25B 4G4JA 3OPNA 2F3SA 3QXGA 5HS6A 4I3HA 4Q9DA 1F2DA 2XAAA 4H08A 1HA3A 4KJZA 4Z8XA 4C4OA 5BXYA 1T6YA 1DO0A 2C2BA 3KQPA 4JR0A 2IKSA 2C5SA 2J07A 2JCYA 3KO8A 2C4VA 3PITA 4M8SA 1L1QA 4N5LA 4MVJG 4PHCA 2OL4A 5BSHA 1Q7CA 4DLNA 1ZL0A 1J97A 3OFNA 2FZLA 4DABA 4K9PA 2GJ4A 2O3SA 3QELA 2Q27A 4P1ZA 2A2ZA 4RIHA 4ZVKA 2MJLA 3NYWA 1CY6A 3RRJA 1D2GA 4KXVA 4DCVA 3D43A 1V8DA 3B5JA 1JAHA 3HB4X 4L1KA 4DWOA 5KREA 1SUIA 3BRWD 3GRPA 4GKJB 2GAOA 1U5AA 5ITWA 5LWHA 4BZPA 2VHYA 1GNPA 4QUBA 4EGSA 1IN8A 2HKIA 5I7FA 3CPJB 1KI1A 2FEKA 1G7SA 4WI1A 2XE7A 1N57A 2Q3LA 3AVWA 1M34A 3E35A 2P11A 5FL7D 2JRLA 3U81A 2R62A 1VLLA 2D13A 2XCTB 1JYSA 4CIVA 4YRIA 4GR4A 4EPVA 3HR4A 3HFRA 3ECAA 5TPWB 2OCDA 1SOUA 2H1VA 1LVHA 3KKZA 3KOYA 3NGXA 2J5RA 4QOIA 4LJSA 3CEPB 1XTRA 4HPWA 2J1LA 3V4SA 3VAZA 1VLVA 2B8WA 2QMOA 2F43A 4QX6A 3JYPA 3EGCA 5U4QA 4KN5A 4B4DA 3NXSA 4UJ3A 5M29A 3NP7A 13PKA 2V0GA 2ALJA 1VRCA 4RZ3A 3A1FA 3GLFA 2D1SA 3G2PA 2ZBRA 1LPSA 1AQ6A 2GZHA 2EWWA 3CMMA 4MJ3A 1S89A 1T3LA 3NKVA 3B38A 2BFDA 4HMPA 1H42A 1K6EA 4DVJA 2J3JA 4IW3B 1UZMA 2GYYA 5GGXA 1CEEA 3GFPA 4FDVA 2YJ5A 2EP8A 5JS8A 4OQLA 4PRKA 2XE8A 3ZOKA 3FUVA 5ARCA 1W5FA 5EJ5A 4S1NA 5IDWA 4KR6A 1RWQA 2OCIA 2G9ZA 3ME5A 4CKEB 1D0IA 3BWVA 3DMTC 4M0EA 5E1DA 2QVXX 2D0PB 4K6GA 1XTVA 1JHMA 4PLPA 2XOKD 1I80A 3P9SA 4AS2A 5BSGA 3BIOA 3RU7A 2I66A 3FW1A 2BKEA 5LA6F 4TLEA 4CUZA 5JJKA 2ZWAA 5DYIA 1M6EX 3W04A 3WFJA 1W5AA 5DFAA 5K09A 3D6HA 3LL7A 1Y1PA 3SE0A 3W2IA 5KQPA 1L4GA 5IAOA 1GSOA 3JZIA 2GPBA 4D9HA 1E0AA 4B84A 2YVAA 1Z88A 1NW4A 2XGOA 3L5KA 2JBHA 1PWYE 2LP4Y 3JVUA 2XWBF 4LS3A 4ZAVA 4EKGA 2R48A 2JAXA 5CXUA 5HZGA 3M6XA 5D1HA 2GYVA 1G5TA 2OGWA 4J1QA 2PT7A 3CZAA 4D3SA 4P0TA 4IQFA 2FWMX 1SIUA 4FN4A 1EVKA 1M2OB 2YY6A 4R5HA 3WIDA 2PLAA 3OLVA 4OB7A 3F98A 6GPBA 1PR3A 3W9YA 3HRHA 3BH7A 3LWBA 4Z7QB 4O02B 3HJNA 2DXIA 1P7WA 4Y6OA 1DO2A 1RM3A 1U9CA 4KXMA 1DKQA 4GYWA 3LWDA 4ALIA 1ZI8A 1I7PA 4R2HA 3IUNA 5EP3A 3G1UA 4RZUA 3UMYA 2LZ0A 1N9KA 4JAVC 4NPCA 2C3YA 4W6QA 4YAIA 4PYQA 3FOEC 4DFDA 5TGZA 1HDGO 1UWCA 2ZI7A 3FCYA 4XCVA 4RSHA 1YR3A 5HXAA 1TM3E 4PPGA 4G0MA 3S27A 4OHMA 4ZCMA 4DVGA 2W7TA 2DY0A 5EHNA 1XVAA 5HVNA 1LNSA 3NHLA 3CKLA 3EQZA 1EEXB 3T1OA 2YV2A 4I4IA 4D1YA 2HWYA 4ND8B 2AD5A 3RVNA 3ANTA 3PJGA 2J6BA 3IOBA 2V3CC 5DXJA 2IL1A 4Z9YA 1ZCZA 2D3WA 3LYUA 5AVQA 3I5UA 4MYUA 4ASUD 1MJGM 4I46A 1G5HA 3VDMA 5IVPA 1OUMA 2I2FA 3FPAA 3QQPA 2BLNA 4CR8A 3PNPA 1SKUA 1XOIA 3MAGA 4TROA 3I76A 4F5EA 5CFPA 1WXWA 3AKDA 4L5CA 2RAVA 2CZQA 2WFLB 4JJ4A 2F1IA 2R6GA 4QXPA 5CPBA 4D9NA 3G7UA 2PX5A 4A6EA 4EL5A 3EF3A 4U2DA 2MCFA 3G1WA 2C20A 1T8YA 2AOWA 4MVXA 3JWPA 2O0MA 3FF1A 3HWRA 3PL5A 3PVSA 4NICA 4TMKA 4TWIA 3CG4A 4K3VA 3FYUC 2L69A 2WIAA 1L5MA 1CUIA 5FWDA 2EW1A 4PFKA 1SU6A 2RSLA 2H59A 3ADDA 3B85A 3D59A 5EFOA 1DZIA 1PX2A 4YDRA 2BYTA 2ZOSA 3JWJA 4ALMA 1WXEA 3FDFA 3JD4A 1IVNA 1RPNA 3W5JA 1QCZA 4MGHA 1Z47A 1HGXA 3HCDA 3AQ4A 3IVMA 4YFYA 5FBKA 2B99A 1VMKA 1CV2A 4KMMA 2QLMA 2I22A 4KB5A 4NDNE 4QATA 4RE6A 3H6HA 3ZGNA 4C7KA 4BJ1A 1WDWB 1O1YA 5C1BA 4JBNA 3CX7A 1VLZA 3GVCA 4EPRA 2HLPA 1XDZA 4KXLA 1F7VA 1X92A 3SK0A 4MZXA 2ETXA 2NU9A 3K92A 3TKYA 4ND6A 3I45A 2MSWA 1ZEMA 3MJSA 5B7PA 2HNBA 3AUUA 4OX9B 3RV3A 5FLXA 3RYIA 4HLUC 2NV0A 3KP1A 4HKTA 3LSTA 4HG2A 1LDNA 5GJVC 5L3ZA 3TB4A 4K03A 5DNWA 4UREA 3NM4A 1YCGA 4V1CB 1NY5A 5TR9A 4NCBA 2CMFA 1YVEI 3FYDA 3Q3VA 5JCJA 1XA3A 1BGXT 4X44A 4NU8X 1O2DA 4LBYA 5IXYA 2B4RO 3WYNA 3R3WA 3AIMA 3GJQA 3IQDB 1Z63A 4AS3A 1T1EA 4N48A 1BROA 3EUFA 3I53A 1I2DA 1X1BA 4NZPA 3LLCA 3WJ1A 5LSAA 4KSCA 3OU6A 3Q0EA 5JJCA 1MW9X 2MWMA 1E3LA 1MN6A 2DKNA 3PRHA 1OLUA 3UB2A 4AJKA 2IYZA 4BATA 3EASA 3FI9A 4FUQA 4TWRA 2KW5A 1A96A 1S9DA 1U7TA 1W6RA 2K2WA 4OB6A 5BYAA 5I8PA 3ZK7A 3B36A 2Z1DA 4XSVA 1WUKS 3U5ZB 4MV0A 1XJWA 2J45A 2XV1A 221PA 2P9JA 4DLYA 3P2OA 1CE8B 2FOXA 1BH2A 2J0VA 4QFCA 5G2OA 3T41A 4R9VA 2IX9A 5FI0B 2PH3A 3V8RA 5JR3A 1IYZA 1Y8CA 5JQGB 1FUYB 4P08A 4ZAWA 1TD1A 3V32A 1TGYA 1G5FA 3R8CA 4MRVA 3FTDA 2HC9A 2IHUA 1SZPA 3QMWA 4MS3A 5HBGA 3DDOA 3UMRA 3SYNA 2HX1A 1XEAA 4URZR 3ZHVA 1A5AB 1PS9A 3BEDA 4LXTA 4XQGA 5DGIA 1CNEA 1ZX1A 2P0AA 4WACA 1WV0A 3Q10A 1P3DA 4DG8A 2WTNA 1Z0ZA 3ROQA 1XELA 5D8DA 5K3EA 2Z0MA 4KQMA 4M6WA 3HVHA 4AZ3A 2VYCA 3H4MA 1V8FA 3VNRA 2V4MA 3DMFA 4DPLA 4H7EA 4RIFA 5CDSA 3SVTA 1RI4A 2IXAA 1BHQ1 1BD4A 3WHLA 2VQEB 3G8YA 1YA6A 1RVV1 2JKVA 1US8A 3EVAA 3G9TA 3ZY4A 2ZSFA 4A0RA 3C6ZA 3IRUA 3MB5A 2BSAA 2UAGA 2ZJ2A 4HUQB 4F11A 5LB2A 4LX0A 3LP8A 1IRIA 1SURA 1BH6A 2VHCA 4YT5A 2EARA 2HA6A 4Y2GA 2F8LA 1XGKA 3I6MA 4YT2A 2BGNA 1B3RA 3KKEA 4JOSA 4X9XA 2FFAA 3B6JA 5D01A 2OD9A 2JZOA 2XCIA 1GL7A 1W8IA 1CC1S 3AOGA 1Z5UA 3MC1A 1XWIA 4YI3A 1EGHA 1R10A 1VSTA 1VMIA 3E9RA 1UBTS 1YB6A 3AR3A 4M53A 2QNRA 3DUFA 3QTTA 3DOFA 4RZQA 4A6PA 4GRDA 3ECCA 4MPTA 2XB2A 4EA8A 4ENRA 3O91A 2GD1O 3KSMA 5D7NA 4HATA 4F3KA 2REBA 2WEKA 2I1WA 1X2BA 2QRVA 4IDHA 4KNWA 1T4MA 4TYQA 4O4IB 5LBUA 4PCAA 4I55B 4JLDA 2O5EA 2XOKA 2Z09A 5BW5A 5DBEX 2TYSB 4P4UA 1U3WA 4QZVA 4DKXA 4IWYA 5K3AA 1SBYA 1LVGA 2J30A 1XP8A 3SJ7A 3QNUA 1KYYA 4YDHB 4JYAB 1YASA 2G36A 3H3XA 3L82B 4JBGA 4IH4A 4OLHA 1YHNA 4CEHB 4WEOA 4JWKA 3GDHA 1XQXA 3JYNA 4I1IA 2GAAA 4NEHB 4CEHA 3UZUA 2VCEA 2VRCA 2ZS9A 1I3MA 2EEPA 3PE6A 1LLCA 3V2GA 3VHLB 3ZI0A 4IXDA 1Z45A 3R9WA 1U8XX 1DQYA 3T3PB 3NDRA 3MZ0A 4EK9A 5J23A 1CZHA 1B16A 1H4TA 4FB4A 2HLDD 3DO6A 3D8NA 1I36A 3H9CA 3D2CA 4IBOA 4DWWA 2G5PA 2C54A 3KLBA 3VNAA 3IMEA 5H8WA 3MTQA 2VUHB 5ANRB 1KO8A 4ABTA 3U6KA 4QDUA 1WO8A 3HUTA 5FX2A 1R0WA 5AD1A 3L1VA 3AEXA 1EFTA 3O1JC 4C9BA 1GQYA 5TQJA 1EQ2A 4M76B 1II8A 3I4CA 1VJRA 1WCIA 4ETWA 1FS6A 2R4TA 5JARA 1Z5OA 4FYMA 4IQ0A 4V03A 2J0QA 2P9BA 1JZQA 1V8OA 4OFXA 1I51A 2FPIB 1JR2A 2AJCA 4OIMA 4QPJC 3ND5A 3EC1A 5JECA 2DETA 3O1HB 3ICCA 2Z4SA 5BOVA 3WGTA 1ZIOA 2CMKA 2WFAA 1TA0A 1ENOA 3JRWA 5B57C 1CU1A 4MV6A 1PUIA 3AR5A 4YMIA 2YIJA 5IBPA 4CTNA 2QLBA 2Y66A 4EGFA 4CKZA 1NVFA 2F9FA 4EVIA 2PT9A 2V54A 4CV3A 4MAMA 3TB6A 1J2YA 2IZ7A 3HI6A 3IKVA 1GG9A 5AK4A 1JLSA 3T4XA 3HJTA 4PPNA 3PGVA 3K1AB 5AK0A 4AY3A 5G4KA 1KK2A 4EY7A 1SQ6A 4F6LA 5ADWA 4UD2A 5F5LA 2FK8A 4Y9SA 3ETLA 3LNCA 3O9VA 4QO7A 4J03A 1U7HA 2OAQ1 5CNIA 5DKFA 3VISA 1AQUA 3GNQA 1NBMD 2C4KA 2ZRQA 1V47A 3R5KA 3DE2X 3DCYA 2FVXA 4F8EA 1G8AA 4M36A 3DE4X 1W44A 1R0YA 5HTOA 3PEWA 3FLAA 2VF7A 3TZ6A 2VLBA 1WV1A 4PCLA 1D7AA 1U2DC 1SZCA 3FDXA 4JUBA 1RLJA 5JQGF 3R7AA 1UP7A 4LYFA 4OX9Y 4EG6A 4CCWA 1SVWA 3DB2A 5B4TA 4FC6A 1XU4A 1E1QA 1QDUA 3AWIA 3DYIA 3H7AA 4XWTA 1AV6A 3FG9A 3PHGA 2QTBA 2A5YB 4KRGA 4JLJA 2DQZA 4Y2PA 4DSUA 1XNHA 3NIDB 1LWNA 2VSYA 3QVXA 3UIEA 1AUPA 2O2XA 1JJVA 3P26A 4C5BA 1N5LA 4DV1B 4DLRA 3PEVA 2J6IA 2O54A 1PKXA 4BWGA 3HKBA 4CF3A 4YUZA 2JLAA 3L0ZA 3WLSA 4OJQA 4ZGBA 4MITA 5JAHA 3ZHTA 1P3JA 4DUGD 3T15A 2VQFB 2CD7A 4QUEA 2VP3A 1PEDA 4QU5A 4TRNA 1OW3B 3KQSA 4BLWA 1T2NA 4ZAXA 3MILA 3RS2A 4RHTA 3I5XA 2RHMA 2OXEA 5KX5F 3LPNA 5HP4A 1O54A 1ZRSA 3V7YA 1N6LA 1UMBB 4ND1A 3U3RA 3SCZA 5JH7A 5BW6B 4LF9B 3PXUA 4NJOA 4XRRA 1P1FA 2ANCA 3VU1A 4AN0A 3ILHA 4H15A 1N75A 1DADA 5DX1A 1TZCA 4OMFG 4TKUA 2YJGA 2FR0A 3RNOA 2OV8A 2GO7A 1XZEA 1Z06A 4XYGA 4BFWA 2SICE 3ESRA 4LZOA 3ZWCA 3UC9A 5JMTA 5KTOA 2OHGA 4UVEA 3H1AA 4XARA 4BRZA 4KPUA 1BJTA 4ZFNA 5AVRA 2AWNA 1WVGA 3FPHA 3V7UA 3U7QA 4EJ0A 2YFHA 3QOYA 3A6PC 1NI5A 4QOHA 5TJHA 4C43A 4DNPA 2Q29A 4NONA 5D3MA 3R5XA 1VSVA 2FJ0A 1RI1A 3DTVB 5AJUA 4QXQA 2H00A 1SCBA 2QMYA 3DCJA 3BCSA 4RVSA 5E7QA 3H2ZA 3MLBA 4WZ6A 2XUFA 3CU5A 1B8PA 2UZAA 2P2DA 5KNCA 3UMBA 3MWFA 3UJAA 2PSJA 3GJTA 2F17A 3QUAA 1B6GA 2OD7A 3WHPA 4FWTA 2JVKA 1UUFA 1GPH1 4TL7A 2HU2A 4JLUA 4HRXA 2GZ1A 3I32A 4YJFB 2CE2X 1QYIA 4HT3B 1NKTA 1PS0A 3DE5X 2GN9A 1IH8A 1XTUA 1IQPA 4MUJA 4RCZA 5K8UA 1CS4C 1T5SA 3E9NA 4XR4A 4W5RA 2X0FA 1I7QB 1TZMA 1X8LA 2HA3A 3FPBA 1ELOA 2P9FA 1DZ3A 4IDEA 1OQAA 3KSRA 4JITA 4KPUB 4RFSB 3OE7D 4P36A 3TXAA 4F96A 1SUFA 5HOQA 1LSJA 2QTCA 3M6VA 1TUBB 3BZWA 3E3NA 4RELA 3KS9A 2C4NA 2YQZA 3ITNA 4MQUA 3V8PA 4MW2A 5ICSA 4KFSA 2ZUFA 2C9BA 4RTNA 1AC5A 2AE1A 2BFCB 1PL0A 1QR2A 3KJFA 1I1NA 4E1BA 4ESEA 2VCYA 4LQCA 4X6LA 4XRGA 1BNCA 2JGIA 2BIFA 3U1VA 4MZDA 5AVWA 4G5XA 1KPIA 2VYVA 5B4VA 5KQRA 1RXYA 4P9NA 3A9SA 2ZE7A 5IC6A 1JJAA 2RAPA 2WWIA 5KEIA 3EFHA 1KU0A 2CKDA 1C2YA 3H9EO 4O0LA 3UV6A 3TECE 3AEKB 4IKOA 2WLSA 2OMKA 3USCS 2BUAA 1FS5A 1VZ3A 2E3JA 2W2XA 3GEIA 4QJ3A 1TU0A 4NULA 4JNCA 5EKDA 3Q1LA 3OEHD 2FFHA 1LPNA 4BX9A 3G8DA 3C0KA 1VM6A 2QUJA 4ZYYA 3PUXA 1YZTA 1XZKA 4HNQA 3QZUA 4FN5A 3JD3A 4ZYXA 5KTKA 1NVBA 2JJ1D 3NRBA 2D7JA 4U7PB 3OZTA 4GFDA 1YRLA 1WXGA 1E6KA 2WD8A 2WV9A 4DDUA 1DPFA 7REQB 4Y0NA 1EH5A 2BCJQ 5DBFA 5E9JA 3V6LA 1N6IA 1GCAA 1E58A 1UFRA 1TECE 1TZKA 1SIWA 2DSNA 2Q2WA 4OBWA 4UDXX 2X0IA 2H5IA 2LTAA 3J7TA 3AB8A 4MXDA 4WEQA 2QR5A 4CIDA 4RK5A 4N6NA 2VTBA 3GOHA 1XX6A 3LRPA 1OBCA 1GPYA 3M0EA 2IHNA 3IP6A 4URUR 1CDOA 4UC0A 3QLJA 5TC4A 2C5AA 1XD9A 3CLTC 1OFUX 3HBNA 4XEHA 3EFEA 1SOWA 2RJNA 3A1CA 1HQCA 5IUJC 3FAKA 3JQGB 3NRJA 3BSWA 1Y8QB 1LWOA 1E2GA 2PGJA 4QJBA 1ISSA 1JE0A 2XTAA 1TF7A 3ENWA 3R6GA 2PZFA 3A36A 3ZBTA 3V1UA 3GJ4A 4MTLA 1FDUA 4EMBA 2QR2A 3BMNB 5ICGA 1M7HA 2XT6A 5D51S 3AVQA 1RCFA 2TS1A 1QH1B 5FUYA 2B92A 2HEGA 1KS2A 2B36A 2WFLA 4D57A 4K6KA 1Z6ZA 5AM0A 4MULA 4FOTA 3FJYA 3W8FA 1QTRA 4XYBA 1TU4A 2V98A 1L8XA 2R8XA 1N6NA 1CW2B 2CEAA 1IIRA 4XPIA 4DCUA 4E7PA 2Q8QA 3MNFA 2GJSA 1KH1A 2HPAA 1RM4A 3FMGA 2BTEA 4I19A 5IWAB 2C99A 3KSAC 3HC7A 3EF1A 2L82A 3R6DA 4UMFA 4GXTA 4KLRA 1UKCA 4FOLA 2YH2A 2UUCB 3NWBA 5CX1A 3A4VA 4FD3A 4YI5A 5AXDA 3QMMA 4XD2A 3ZJ4A 3E9QA 4PIVA 4NAHA 4OP3A 1PJLA 1JTFA 3VOSA 4YQFA 4MQBA 5JD5A 3E1KA 2P62A 2R2GA 3PPYA 3U5TA 2DU8A 4DV5B 1O0CA 4JJ6A 1Q0UA 1GDHA 1QCCA 2FEWB 2FW7A 1S6YA 4KX3A 4UNNA 1OTYA 3A6JA 5GGYA 4WBNA 3WLMA 3NO4A 8ATCA 4XE5A 5LBTA 4MYSA 1VGVA 2YWHA 2GNOA 1KFKB 4WFKA 1GLGA 2I2BA 1E2PA 1JKFA 2VT2A 4Q4AA 1QKIA 4IEIA 4JEIA 1U5BA 3JVEA 3GJ6A 1YBFA 3M1AA 5I4CA 4D9GA 5ITZA 1FTSA 4RIEA 1JG6A 2UVPA 4Q16A 2D1RA 4RANA 1ZIDA 2VQSA 3I3OA 2YWFA 3G7NA 5AJXA 1JT2A 5FV4A 1MUUA 2WHPA 4F4FA 2RH5A 3EIOA 3PGLA 3NEYA 4GXRA 4MLPA 4MUAA 3TSCA 4HN4B 4UD6A 1DIHA 1P44A 1UIRA 3RROA 2ERXA 4AZWA 4X20A 3MCTA 4Y98A 3GCZA 5DXFA 3GX1A 3TRFA 4F71A 1DHTA 3R9IA 3OX4A 2C04A 3H19A 2CVPA 5AM4A 5F12A 1IMJA 3JYHA 3FCOA 3NTXA 4R4JA 3K35A 2C2MA 2B2NA 2KYRA 1JXQA 1YQ9A 3U62A 3V2UA 3CMCO 4W5QA 4LCEA 3QSYA 1FZTA 1I10A 2J5KA 4BNZA 5HYVA 2Q5FA 1NJ5A 2QLFA 5FUXA 2E0IA 2UUAB 2WNIA 4AN1A 4OD0A 1QZUA 2HBYA 3IKJA 3JQ8B 3ZE0B 1XMQB 3OOHA 1UAYA 2JK1A 4E70A 1M0TA 4DBZA 3CJQA 1JHAA 3EDYA 1M6NA 4EO9A 5K6TA 1P5ZB 2N75A 3U37A 2CHUA 2FJUA 5FPPA 3W0LB 2BTQB 2BY4A 2OFOA 3W5HA 1M8PA 5FAXA 3K05A 4MGIR 2XEDA 4PIMA 3OUZA 3ZQ6A 3IIEA 1DTWB 3IOCA 2WHRA 4DR4B 1B8VA 1TUIA 2OC9A 3WIEA 4N3BA 2ADFA 3FZYA 1BS2A 4Q7JB 4PN7A 2I4MA 2RGXA 4AQ7A 1GG2A 2BWJA 1I5EA 1WB6A 2VI5A 3VU8A 1ZR2A 3QOWA 1OI7A 1ZMRA 3TUIC 2D2XA 2IZZA 1RTTA 5FJJA 1ND6A 3ZGZA 3NHBA 1HFJA 5KS2A 1KK1A 1AE1A 2JHAA 2XZLA 4Z9FA 5LKAA 2Q3BA 3FSRA 3QA9A 2I33A 5DB4A 5TQ2B 2E55A 2PYIA 3EMKA 2WU0A 1TA9A 3SP1A 2QX9A 3OQ6A 2WHYA 5KHAA 4V3CA 1RIFA 2AW3A 3FNHA 4RETA 3ZIUA 3ILXA 1H8ED 3MCUA 1SOAA 4UXJA 4X63A 4KK3A 5HHTA 2MR5A 2AW5A 2PH7A 3H4VA 2BTQA 4YCLA 3CLVA 3KD3A 3UHOA 1TT7A 2QU7A 2J5BA 4A27A 3CRZA 3E84A 2PMEA 1BGVA 4RL4A 5BMOA 2BFBA 1NX9A 4FYVA 1JDJA 5BWMA 4Q05A 4QYIB 5HJEA 4B48A 4MW0A 1YBVA 3I8SA 1HE8B 3KAKA 5CITA 2O8DA 2CHQA 1M9NA 3HU3A 1Q50A 3IYLW 3UJ6A 4D46A 1UJ6A 4Y2TA 3FI0A 4RVNA 4X45A 2UXBB 5FD8A 4CDRA 3L0YA 2VWQA 5CJ2A 4CLXA 3HKBB 4Q9LA 3BXPA 3RK4A 4WTOA 1ISJA 4HBZA 1E9SA 2ASEA 4HS4A 1T4GA 4I5EA 4UJ5A 4ZAGA 5K2MA 1BXRA 3CLTD 3VR0A 3L3BA 1OXKB 3FRIA 2CHGA 5BV8A 5BURA 5CNJA 1XZFA 3LIPA 1IJBA 3OQHA 4Y2JA 4OLJA 2OYCA 3ZKAA 3MJTA 3Q0TA 3X44A 1O57A 1X70A 2ZYWX 4MVJI 3SHFA 3O8LA 2ORVA 3A9TA 4E1VA 5D00A 1FSPA 1I4LD 4XUEA 3SBEA 2OZVA 5J1SB 3COJA 1I1HA 2BCEA 2GEFA 2RGAA 4L15A 1Z2EA 3FUCA 4CQMA 4DQ0A 1QYWA 2WJ3A 2ODNA 1C2TA 2PS3A 4AKTA 2ZSHA 5BXQC 1G1AA 3T3GA 3TS1A 5KWSA 1WKCA 1TF5A 1Q7BA 2VDNB 2W2LA 2EOAA 4J16C 4WUTA 4CQMB 3LYLA 4HB2A 3PQ3A 5JNWA 1A8HA 3H9BA 4QHTA 1AZLA 3TRIA 3H2GA 4WXHA 4LV5B 3U7QB 3B3GA 3GELA 1ZK1A 5KBYA 2J9YB 3BAZA 4NAUA 2HBZA 4B4VA 2DKOA 2OXRA 1MLDA 4POAA 2NUTA 3UO8B 4F86A 1H1LB 2A7XA 1ZCJA 2YFYA 3N3AC 4EI7A 3AI2A 2X0NA 1GZ7A 3DDNA 1U3GA 4G0YA 4QNNA 3R7SA 1VJCA 3DAGA 3EQ2A 4YXWA 421PA 3E3OA 5IC4A 2IS1A 3DLAA 1F0YA 2CUTA 5A3VA 2C4TA 3QU9A 2JGJA 2Z56A 2E4VA 1MAWA 2P67A 3ZWPA 3WADA 3ZU2A 1AUXA 2Z6VA 4AWAA 3CSDA 1BFKA 1I14A 3AM5A 4NNOA 4DV4B 4GKBA 4ROSA 1VRWA 1L3BA 3GPBA 3EOBI 2FP3A 2Q5JA 3H2JA 4FINA 4ISCA 3VKWA 2XDYA 2WINI 3THWA 1EHCA 2CSXA 4QULA 1YS6A 4HXYA 4YDSA 4C7JA 1ULBA 4LDQA 4K6FA 2AK2A 1O89A 2Q62A 3RIXA 5CEFA 3DMDA 2FMHA 3QPCA 4PLYA 2XYPA 3EVNA 4GXQA 5BYJA 2EATA 4I9UA 4TLBA 4WUVA 2AG0A 3M4XA 3FDJA 3ZZUA 4LC1A 1KIAA 2CFCA 4NWIA 1M6VA 2OPHA 2ZU6A 3I9MA 3OCZA 1ACLA 1KOLA 2XZPA 1QX3A 3RIYA 2VN8A 3S2FA 3B13B 4NFLA 1QVZA 2BFCA 3KJGA 3O9ZA 1DI0A 1F3OA 1L7AA 3M8KA 4FYYA 4J2OA 4WX2B 1JYFA 1N1DA 4IIGA 5TMDA 3FDIA 4HWSA 2WYUA 5EWLB 1CUAA 2BT4A 3LWNA 5I5EA 2RBEA 1F14A 2PZBA 2H48A 3SXPA 1TW2A 4ARIA 2VPYA 1H94A 1FJGB 3PG5A 5A2QA 1N8SA 4I08A 2PLWA 1Z22A 2WUWE 4FFNA 1FUKA 3L8FA 3QWAA 1F4VA 2A4KA 4DJEC 2MTBA 2DJ5A 3GPLA 3EZXA 3IMKA 1QFSA 2JI9A 1SU4A 1B8UA 3ABQB 3NDPA 3M3PA 3RC9A 1M5TA 2Q8NA 4MV7A 4WNIA 3TG2A 4W7IA 1ZMOA 1WHTA 1ZISA 5DTJA 1CJKC 4G8CA 4EY4A 5LJIA 2CNBA 1AU9A 5IUKC 4B3XA 9LDBA 1ZNWA 1KQ3A 1P4GA 2WR8A 3P9CA 2GEDA 4L85A 2O1XA 2CFOA 4QFMA 1LEHA 1AGXA 3IT1A 3N76A 3P2EA 1D04A 2MSCB 4YMWA 5DH9A 3OKFA 1ORHA 3G59A 3TCNA 3CH7A 4BO1A 3N70A 3F46A 3R0XA 3I34X 4X92A 4FPXA 3KG2A 4HQFA 5L3VA 1ZO8A 3AJAA 1D0VA 1P0CA 2O8CB 3LC2O 1NY6A 1I1OA 1CY8A 2FFRA 2Y1GA 5KTTA 2ONZA 4JT4A 4O4IF 5BNFA 5CFZA 4PAOA 1EXVA 4HXGA 4J90A 3ZKWA 5FPKA 5I4BA 2Y71A 2R1TA 5IDQA 1QUFA 1HEUA 4BIIA 1FOEB 1XZMA 1J25A 1I4TD 1QOQB 1Z73A 2H7VA 4E09A 4TT3A 3OWHA 5EQFA 2BMJA 4I4TB 4OA8A 4JUIA 2FPUA 2HJHA 2X22A 2NV6A 4CMBA 4I4TA 2YBDA 1RYDA 4AF7A 2HWWA 2GRUA 3K2BA 1KBZA 4U6NA 4XM1A 4YO7A 4YHBA 5EERA 2V7UA 1M2VB 4FMDF 1DIGA 4X60A 1FFXB 3OAAA 4H0CA 4MA5A 1II9A 1WX1A 4GSYA 5BWNA 1E92A 1UWKA 1USIA 3JY6A 4CFYA 1QV7A 5HF9A 4EF4A 4BNDA 1H85A 5A62A 1R2QA 4R9SA 3OOJA 4G9GA 2B8NA 4JVOA 1PU2A 2IXGA 5J5CA 4DDKA 4GMGA 2GCEA 2LCFA 2WHXA 2FE4A 3TCXB 1E7MA 1X9IA 2DWUA 2VK2A 1WOYA 1JQEA 1ZYUA 2LIVA 1BWQA 2CJYA 3R7NA 3VFDA 3NC4A 2XDAA 3DKVA 4N8EA 2WU8A 1A9ZA 3CWCA 3EARA 1MGOA 4HZUB 3D5EA 1YDWA 1MDFA 1T24A 3AUFA 4M0FA 4LDAA 2G1UA 1YUBA 3NM6B 2GZDA 5LQSA 2PFGA 5IN5A 2O2DA 1L5HB 1T3HA 2DHQA 2JATA 5DXAA 4JC4A 3A3PA 1QNFA 2PWBA 3IAM6 2FN8A 4G37A 2AXQA 2X1LA 4WA8A 4ZOCA 1W47A 3V1MA 4B3IA 2I7XA 5EJ7A 1YJQA 4GU5A 3WJAA 1CX9B 2B5OA 2O2CA 4K88A 1BO6A 1CY0A 2BP7A 1U0OC 1JDNA 2AUTA 3EH2A 2VTKA 4FFBA 2AOXA 2IHTA 3QWHA 1FUUA 2HJWA 4MIKA 4FGJA 1NJGA 3SYTA 5ALWA 1YA8A 3CN9A 4A23A 2JI4A 4IM7A 1IXSB 3Q3GE 2JF0A 2NSHA 4HPXB 1YZLA 1DUVG 3BIWA 3VJKA 4BMDA 3HKDB 2VSXA 4OOFA 1ZH6A 4UDYX 3PDIB 3W9UA 1G291 5EIEA 1Q7RA 3RUAA 2OILA 1RCTE 4DUGA 4RD3A 4QASA 4AZ3B 2AUNA 2EEZA 4BBZA 4EZIA 4I55F 1QTNA 4P98A 3URMA 1N8TA 5MN5A 3I6IA 2YYSA 4JDPA 1V1RB 5CBPB 1ZESA 5REQA 1UOOA 2PWZA 4BGUA 3OH8A 1G8SA 4L4SA 3ZE1B 1NTRA 2V6IA 4UTXA 1ZC4A 5CW1A 4E5VA 4YMTA 4G0VA 4CGYA 2NG1A 1U8ZA 1VIAA 1XTTA 2AVDA 4QJ5A 2QMUA 5JSUA 3OE1A 2O59A 7REQA 4ZCRA 2PKCA 3RO7A 5DX8A 2RGBA 5IAEA 4LHXA 5CXQA 5TVGA 4PX3A 2IUSA 4H9GA 5JSZA 1XFDA 4PO3X 1RLUA 4G6ZA 5DLDA 1UDCA 3AG5A 5EJ6A 2HJ9A 2YVKA 1VFPA 3QV2A 1DBQA 3BTSA 4RXTA 3D2AA 2W6IA 5C51B 3CUYA 4UUOA 2X8LA 2V0CA 1C7QA 3ONEA 1BC5A 3IAFA 2HBRA 2Z8XA 4OYYA 3CIOA 3WMXA 1XEWY 4D9MA 3W79A 1U9JA 621PA 3JAKB 4LRSB 3UXMA 1M2GA 3U09A 4QOGA 1A98A 4Q3KA 1SPBS 2YYAA 4LHSA 2DECA 3LBFA 5K8CA 1XT6A 3BTUA 1CF4A 4WKPA 2IYTA 4NFSA 3SNHA 3TE7A 4DAEA 1YR7A 4A82A 4YP6A 5B64A 1YDGA 1M34E 2FN4A 1XXHE 2AJ8A 4JUFA 5AVKA 1N2GA 3FBTA 1JIXA 1KJ8A 2GWHA 4RO0A 4DQDA 1QPZA 4YJKA 3RIHA 1JQ3A 2Q0QA 3WWPA 2FI1A 2QL5A 4BO8A 5J4YA 5AK5A 2I6FA 1QHHB 3G0IA 1OLXB 3KJQA 3BRSA 2W9XA 3ECSA 2VDRB 4KWTA 4OGWA 4Q66C 3TINA 3FYUA 4F4UA 5IU6A 4HY3A 1QCYA 1SBIA 4G8DA 4KREA 1L2TA 2G08A 4OOEA 5SYNA 1K0FA 1KMHB 1TE2A 2FWNA 2GFHA 4RVFA 4C7MA 1EK0A 4RD6A 2ZSBA 4P54A 1U7ZA 2IKQA 3GY0A 3OLWA 3N74A 3PI7A 3QEMA 2A67A 4U2KA 3REOA 2JHCA 4MKGA 3A0RB 2BE9A 5BQ5A 4FE7A 1CHNA 1VYTA 1RQPA 1SHJA 4PBRA 4BJ5A 2QY9A 2FPRA 3DZKA 3F4LA 3NTQA 1HM5A 1QZZA 1ESZA 3L0CA 3DUWA 2HUNA 3B7GA 4KPGA 1L7DA 4B3JA 3Q8KA 3RIGA 3DW3X 3IR7A 2PUWA 2AZ4A 1MCZA 4ZVPA 2W48A 4K9OA 1ONOA 3RHSA 4UKDA 1VL1A 3AEQB 2JH8A 4QYXA 3KEQA 1F5NA 1QCDA 1QFXA 2Z04A 3TG8A 4PQYA 4M8NE 4RTRA 1CEQA 3P94A 3PC4A 3KQNA 3VPAA 2VDOB 1NVVQ 3Q15C 1JPUA 3C41J 1O77A 5ALPA 1T8SA 3IO3A 3SZOA 3VNBA 1QYCA 1Z6AA 5FBHA 5IBQA 3HKDA 2ZTLA 4PANA 2NTYC 3NPAA 5HG0A 4F6CA 4FDUA 2HV9A 3I9V1 5A4DA 2H1LA 2C0QA 1QFYA 1YS7A 3ELYA 5K3SA 4S0XA 5FCDA 3NV7A 5JC1A 5F51A 3NBKA 4G9BA 4JI8B 3RBXA 4X90A 1GCOA 2QP4A 3A6GA 1MB2A 1DNPA 3G02A 4YO8A 2ZGVA 1UEIA 1TQHA 4FR2A 4TTJA 3ZTWA 1XHLA 2DFVA 2F3RA 1NPTO 2W2LD 3K0CC 3QE4A 4DMFA 1EK1A 2C4MA 3BGVA 2B6HA 2CLEB 3EW9A 4R01A 3SI7A 4KO4S 3JZMA 3UGQA 3PFGA 1IG0A 4ZKEA 2ORWA 3WNCA 3DQQA 4DN6A 3D3QA 1HH4A 1V11A 1RYMA 2H2DA 3E22B 3MUFA 4FDAA 1C9NA 4TMVA 4EY5A 2KB0A 4OJNA 4QT4A 1QP8A 3BG5A 1LDYA 3LW8A 3Q7EA 1TLLA 2B4TO 2YDXA 1WNFA 2C7PA 3NBAA 1GKLA 1YOVB 1HX7A 1WZEA 1RR6A 3Q3CA 4G0WA 2L2QA 3D5QA 1IIBA 4ZMBA 4RTJA 1J23A 5KWEA 3M89A 1SK9A 1SG9A 4NBWA 3S99A 1GYQA 1NVWQ 2PUTA 1KETA 2D00A 4EF5A 4EG5A 4PONA 2YNMC 2X4IA 5KJEA 1XNRB 5AKYA 1C7ZA 1KJJA 1YMVA 1OI2A 1IBRA 1XVLA 5EXXA 4GBMA 1MC4A 1KSGA 5DCYA 1T36B 1Z5NA 5K0JA 4FBLA 2AEJA 4D4IA 4DYHA 4GUDA 1D07A 1P2TA 1WMFA 3MOGA 3D8RA 3MS7A 3ANNA 4Y7CA 5BQOA 1L4HA 1PT6A 2DLDA 4RESA 4LSWA 2XHEA 3GRRA 1TFUA 2HMVA 2FFBA 3KCQA 5IS2A 1XDGA 1T0BA 3JU3A 4OGGA 4F85A 5HSGA 3O95A 3TSOA 4B5KA 5CD1A 2Q5QA 1L7PA 2QWXA 4ZCQA 5EWJA 4CUJA 4KSBA 4HYYA 1ADGA 5FADA 5J9FA 1PI3A 2XMBA 5FUWA 1DAEA 3ZZ1A 4GL2A 2XTNA 1DV1A 2BEJA 1KDZA 1ZVMA 1R0CA 4DIMA 4MVJF 2WYHA 1MVNA 1MTOA 1IXYA 2HBQA 4QEKA 2VJMA 3RAPR 2DHDA 4Q4JA 1MOSA 3B82A 2PWYA 5AKGA 4EYOA 4BXOB 4BRUA 5JNSA 1AZWA 3DMYA 1TJ5A 3U19A 3EQ7A 2YCBA 2FZ5A 1J0EA 4BVHA 4F9EA 1MOZA 2ZS7A 3I64A 1CUJA 4B33A 4E5NA 2GJ9A 4OMCA 5JAZA 2NO5A 4NFHA 4PYMA 1EG2A 2AFIB 1PQWA 4QVGA 4Z3DA 5FR1A 2FUG1 2NUAA 4LXQA 2BELA 3MK31 2IS4A 2JI7A 4YRBA 1M75A 4HAZA 1DUSA 1WHSB 3LPLA 1G8KA 1PHRA 4MRNA 3VH3A 4Z2AA 2V6JA 4G0UA 3RODA 2A35A 3GG2A 2ROQA 4HNHA 1N2IA 1Z9BA 2VBIA 3R41A 2WY2D 4YPFA 3T7JA 1VG0B 5A06A 3O92A 1PWXA 1S9HA 3IEPA 2VKTA 4TKVB 3OETA 4NOLA 2DKFA 1QS0A 4M21A 2ZWMA 1CUUA 1YZKA 2VXYA 1KE2A 3MWLA 4RK6A 1ACMA 3H8JA 4Q9AA 2BZSA 2CLIB 1M74A 3KYCB 2E89A 5JY6A 1CEXA 5B30A 4EA6A 4EDHA 4BBAA 4D4JA 5LMZA 2RG7A 3PXBA 3TIFA 2VT6A 3LBIA 2X77A 4OAQA 4KVAA 3QXHA 3WIUA 1FFSA 2XTZA 2NXEA 4N49A 1WCXA 1Y33E 5ES4B 4OXQA 4AF8A 3VGJA 3LFUA 3F6SA 3VKHA 2WICA 3T94A 5DIZA 3HS3A 4BNTA 4EHFA 4WQMA 1RMYA 3R5FA 2A94A 2AG1A 2HOQA 4FFOA 2CV1A 3UICA 5CUQA 4NU5A 1TCBA 2PZJA 4L6CA 4U2EA 5FNVA 3SHOA 3WRXC 4C0LA 4YCCA 5F9HA 3KJEA 4Y1GA 3V4ZA 4DWVA 4IDNA 4LXGA 1G3QA 4US2R 3IP8A 1JLMA 3GO4A 4YCAA 2B4YA 4EELA 4E33A 1G6OA 2FPWA 3PVCA 4OHFA 3V4RA 2O8DB 3PDCA 1N2HA 1SVOA 2J31A 3HGQA 5CK5A 4BASA 4I7EA 1TB4A 1W4ZA 2PGXA 4LXUA 5DMHA 1SVUA 3SHQA 4W82A 4U3JB 4OJMX 3FTPA 4N47A 2LIPA 4R51A 1E89A 1K2VN 2FN7A 5AO9A 1XZIA 3TTVA 4QFDA 3DF9A 3SJUA 1RLIA 4LZNA 1E61A 3FKQA 1F20A 2LCIA 1UJ5A 1JI0A 4MR9B 3X1MA 2WDPA 4B3CA 4NYIR 4REQA 1V0JA 2R0QC 2UU9B 4JLMA 1C7JA 2K87A 2QJRA 4DIOA 3R6LA 5DTMA 1JDBC 1TQ2A 5SV2A 4ZZ3A 1JEQB 5DLEA 3K96A 2GEBA 2IEZA 3NJRA 3QHQA 4HHEA 5AI5A 2V9CA 1DCFA 3ROXA 1ZD8A 4WKNA 1LX7A 3G2LA 2AN5A 5I6DA 2DUMA 4DC1A 4ERXA 1ISMA 4GZLA 4N7BA 4AG3A 4BO4A 2O2IA 5EKXA 5IT4A 4MUBA 4OXXA 4W5OA 3E8MA 2RH8A 2C95A 4J6FA 2H52A 3GLIA 3AR2A 3HSSA 2IHBA 2BEUA 3SSOA 3CWZA 3K1AA 4CNBA 3K9GA 5KPDA 3LBHA 3OPYA 1NM5A 5B2ZA 3GWGA 3PP8A 1OILA 1LY1A 2W6NA 2Q41A 3C48A 3GROA 4NATA 4U6QA 4G8BA 3DYBA 1NM5C 5EN4A 1E1DA 3HBLA 3L7MA 3Q5GA 1WDTA 1ZOPA 2OAGA 2VJQA 4N5IX 5HWSA 5L4LA 1JQ5A 2PHZA 3T1NA 4RYLA 1G8HA 3CRQA 3NDIA 1DT5A 3QVGA 2DHEA 2V1XA 1A2QA 1C9MA 1P6QA 4HB0A 2FSUA 4NNJA 3K73O 1I24A 1HMYA 2G06A 2V6MA 4PY2A 4RS4A 3K0KA 1LPOA 5IZCC 1YS2X 1EXDA 4RJIA 3GP3A 5EIFA 1QIHA 2XF2A 2WIDA 3M5CA 4Z9XA 1JAIA 1PD0A 4DA8A 5GZ1A 3QPUA 4DANA 4EG4A 1THGA 3OY7A 2OV6A 4PWZA 4W9NC 2X7XA 3ITDA 3W8EA 3VZSA 1NF9A 1XMIA 2ZQZA 2JG3A 1J22A 1EK5A 4FX2A 4MKHA 4AUKA 1GQ2A 2VJNA 1FFCA 1CUHA 3CLKA 4QODA 2XZOA 1KQNA 1XTJA 2JFQA 2P1DA 4AJLA 1AJEA 4LJ7A 3CA8A 5AW1A 4GG1A 3HLYA 3ZDCA 4XQCA 5E4JA 3WWCA 1X94A 1UP6A 1QQ7A 3ACBA 3WOVA 1DMRA 2Q50A 2VBGA 2Q8PA 1U5CA 3VJRA 4ZRNA 1MH1A 1QH1A 1MU0A 3N2ZB 1JQJC 4RK4A 2M2IA 3UA4A 4Q4AB 1S2LA 1UCFA 2GSDA 2PQ0A 4OXIA 5JS6A 3ZJYA 1KO5A 3ICEA 2PH1A 1HDIA 3OIYA 5TQ2A 3DFUA 1P9LA 3SR3A 4ZEVA 2NU9B 4O2BF 2VRBA 1NI4A 4BO7A 1UJMA 1USWA 2BJWA 3ULKA 2QAGC 3ESZA 4MJLA 4JCCA 1IL0A 1NMYA 4GPEA 3GFFA 4P3YA 4RY8A 3WIBA 5AW0A 3WQBA 1P31A 2G67A 2V5UA 4MV4A 4QEZA 1RP7A 1G8YA 4IS2A 4F3YA 4WOCA 4Q5IA 1UC5B 4KVFA 4TT8A 5J4LA 1MA3A 4L75A 1BXKA 1IZ7A 5L9AA 2BD0A 3LGXA 1R66A 1PQYA 4RMIA 1L7QA 3WDSA 1HYHA 2VJCA 3LXMA 2HREA 4KAFA 3MW8A 2PS9A 5HGXA 2BL4A 3IQZA 1RKXA 1CS0A 4FQ5A 2BUBA 3IJ5A 1E1RA 1RMQA 1ZD9A 1UK6A 2HM7A 3KJNA 3OPVA 4FONA 4FTWA 3WTBA 3ZLUA 5C18A 4F2GA 1N34B 4M0UA 1J8FA 3EVTA 3L0IB 4B8YA 5KNCD 3PFBA 5KYWB 2Y8EA 5B7GA 1Z6PA 2C1XA 2COKA 3ADOA 3C3PA 3RT1A 3RRFA 1QGZA 4R68A 3RWMB 3MUNA 1FVOA 1KI6A 1NW5A 1Y7HA 4WNYA 2PRSA 1OY1A 2C94A 2X3FA 2EBHX 3DMHA 2J6CA 2J48A 4TTVA 1FDRA 3TEJA 1OXXK 1EFVB 5C32A 5IK2D 3ZKWB 4ENUA 3EQ9A 3JR7A 1J09A 3TDMA 4RJTA 2C83A 5J2UA 3ROGA 1FVHA 1X0VA 1NULA 2VSOA 3RTCA 3HPRA 1H8HA 3BXXA 4MS3B 1DIRA 4M83A 2NYRA 2D0DA 1V3TA 4JP2A 3A28A 1QTIA 3H1FA 5HJ7A 1XLWA 3BD7A 4I6EA 5J59A 3QVMA 2YJTD 4INZA 3ELWA 4PVDA 4WCVA 3GLRA 1OXUA 4IV8A 2HTEA 1TYAE 1E9FA 4Y1RA 4DC0A 4TZ6A 1DBWA 3G0HA 2IVFA 3OPYI 2BN4A 1MT3A 4ADSG 4C01A 4QJIA 3F2VA 3U31A 1AB6A 4RTPA 2IRWA 3ONFA 3Q3IA 4IS3A 3P0RA 1NX6A 3GP5A 4Z1MA 2HFKA 4I9FA 4RORA 3ZW9A 1TO1E 3K4QA 2XKJE 1DIOB 3ICPA 3CNQS 4RY9A 3TLXA 1MX3A 4UTOA 3IQWA 4DRZA 1ZGHA 2QBYB 3SNKA 5LIPA 4MV1A 4F1WA 4M1KA 3AF0A 4PHHA 2IWRA 1PP4A 3TBFA 3GK3A 4B9AA 4I8DA 3FOZA 3IIJA 4B43A 2J67A 2FP4B 4Z53A 4OUDA 1N2EA 3GAZA 4QTUB 3EHEA 1O87A 3M3HA 2OBBA 4V1CI 2DWPA 2YOFA 3DEHA 4FNGA 4HH3C 4D0LB 3A4YA 4MW5A 2GK3A 2QENA 5AXCA 3LDHA 1PJ3A 2VXBA 1FU4A 2H1WA 2JJ1A 4IOMA 3N6VA 2AB0A 2AVNA 5HKLA 4EUNA 1HLDA 3N1UA 4H6PA 3UJCA 4IHAA 3ZZ0A 4YRRA 2ZYGA 4RFLA 1GYRA 4AXXA 1OXSC 1UODA 2GA9A 2PRKA 3DE7X 3LZ6A 3EXAA 4JVNA 2HK6A 1Z6XA 4PZLA 4O4JB 5FB3A 4B73A 1VPTA 4JUDX 3SX2A 2XD9A 1R0KA 4G85A 5GVSA 1BS9A 5M7EA 2YRWA 4HLQB 2VNSA 4Z4EA 4Q9NA 1GTJ1 4J0IA 4PCUA 4B81A 2JIMA 3E9CA 2QL7A 3BMCA 5BSUA 1BX0A 4N0MA 4KQXA 3W7BA 1N78A 1ZICA 2PV7A 5LZ7A 2R68A 3LDFA 4AIRA 2CC2A 1JBQA 1KHTA 1UEXC 3KE8A 4G4GA 4K0RA 4XM0A 5M04A 4D5EA 5MFZA 3FPFA 4TV9F 3STHA 2BM8A 1GSIA 3D6FA 1VJ1A 4F6RB 3GRFA 4HYQA 3GMSA 4LOJA 2H4HA 1Z2AA 3IQHX 1XUOA 3OIUA 3IXMA 3QFCA 5KNBA 3VO9A 3IALA 1PIWA 1PKEA 3ANMA 3KR1A 4IP0A 2W6MA 4WIAA 1GPLA 1T2VA 4TUYA 2HHLA 2JPDA 1PCXA 1U2ZA 3PWZA 4CUKA 5JSFA 3BWYA 5AI8A 2A9RA 2F62A 1ZXXA 4BNFA 2JH9A 4CQNA 5KOJA 4AWBA 1P7VA 2RK4A 3HACA 4JL8A 3ZJ5A 1E8DA 1TVKB 2OBXA 3M6LA 2QSJA 2C7VA 4D3XA 1VBFA 3GWZA 3MB8A 3PCTA 1EZZA 4DW8A 4Z1OA 4Z7NB 2HK7A 1NW9B 5A4MS 3FTFA 3F1KA 1FSSA 3W5AA 5EWJB 5AESA 2G1PA 1Z6TA 2VJKA 3GJSA 5FKJA 4P34A 3R3HA 2QSYA 2CL0X 2RAFA 3DZBA 3ERCA 4LE1A 3LPAA 5KQGA 2I9PA 4L5IA 4QTXA 1VLQA 3OPMA 4KOEC 5C5IA 2B2CA 2OCGA 1TMGE 5K5EA 3SX0A 4RWEA 4RVUA 3KYIB 1JWAB 3GZTB 4EKNB 3TAHA 1YL5A 4EABA 3RSZA 2JFNA 2Q1TA 3OSUA 4NU6A 4DR5B 3MELA 1P72A 5KNBD 3U9TA 2FUG6 2O2SA 2C7GA 3HZOA 4PGAA 4BBPA 3C8DA 2EKPA 4AULA 5CB4F 1Q6YA 2JFZA 3DDHA 3RRNA 1KFEB 4RTKA 3PGA1 1ZD5A 1VSUA 4MUNA 4UTNA 2CHVA 1GR0A 1HL7A 3RRXA 3KFVA 1ABEA 1YNSA 4HXEB 3RS8A 1Q12A 4UPDA 1P4RA 4Z4GA 5KDDA 4TZ0A 1WTCA 1DMSA 4O4LA 2IZ0A 3X1YA 4BMOB 3C3YA 3EVBA 1EE1A 1VPLA 5EA2A 3L06A 1LPAB 4KIFA 4EKIA 3FVTA 5J1TB 3UFXA 2OCKA 2HHJA 3CCBA 1VI6A 4L6AA 1WF3A 2GPNA 4CW7A 2JIBA 2ZIWB 5TPWA 2BF7A 4AJEA 2AJTA 3ANXA 4L7QA 1DFHA 4HXFB 5CVUA 1GQFA 3V9AA 5GMOA 2O8FA 1NV9A 4ZCSA 3U80A 3PUVA 2GAIA 2O5VA 2Z3ZA 5FT9A 3EMVA 1GA6A 1XQ6A 3OLXA 3QQ5A 3PDHA 4GMKA 1NJSA 2NQ8A 5JCXA 1XMPA 1PT7A 3G7SA 1U0RA 3N6XA 1BX1A 4O8CA 4FD2A 4IGAA 1WHSA 3L41A 4IRMA 4ZO6A 4CU5A 3IGFA 1E1QD 4BMZA 4LOAA 1BKSB 5JZ9A 4AO6A 3TIGA 2QIOA 3I1JA 5B3KA 3M2PA 2QRPA 2WZCA 5G3ZA 3KBBA 5P21A 4HEJA 4RU1A 3QP9A 3HZHA 3K20A 4I9NA 2PXAA 4BFXA 2GESA 1CR1A 3JQAB 2VPQA 3KDSE 2HYIC 2Y4NA 1GNTA 3AHIA 4CQLB 2AFHE 1I4WA 1KMMA 2QTZA 3PWSA 2PL5A 5JWOA 2QTLA 1QFZA 3L49A 2FPPA 5CNMA 1Z26A 4ALNA 4RTSA 4TTTS 2H2GA 1L5KA 1GFIA 5C8ZA 4J2TA 3MF4A 1QLWA 2HQOA 1B73A 1P19A 3L77A 4TKZA 4E07A 3EIHA 4IVPA 1SRRA 3G0DA 2QJFA 2XWQA 3NAZA 1UWLA 2Y1XA 4BNVA 4IUYA 4L76A 1F8FA 5L3QA 5HBRA 2QGNA 2O0HA 2XKBA 1I6KA 4P84A 4BX8A 4JX8A 2VQ6A 1VPWA 4W1SA 2H54A 2XRZA 2XGMA 5PNTA 1X74A 2QVBA 2ZJ4A 1F2UB 4LY3A 1MRNA 3P9RA 5EUCA 5TDHA 4E88A 4ZANA 2NPFA 3UJ7A 5SZHB 2R8EA 1Q0SA 5AUNB 5G4LA 3TX6A 5CB4B 1G55A 3D4IA 3N2GB 4LCBA 4OHCA 2BSXA 4MMXB 4XGQA 4P4NA 5K0LA 3T7DA 3UHFA 4JXJA 2Y2UA 3EVFA 3K5PA 1YE3A 1EP1B 4EY6A 2P41A 1YWGO 2AR0A 4KVGA 4QAJA 3BXFA 5E3IA 1GSHA 2GN6A 4DZZA 3LUDA 1VZ2A 6ADHA 2PRZA 3TLGA 4LFAB 4TX1A 3OT1A 4CF4A 3PS9A 4ZT3A 4NDAA 1IUOA 4QTYA 2I8LA 3FX2A 4YH1A 3SZLA 2F3PA 4IIBA 4N6OA 1KYXA 4D9FA 1L4EA 5CEJA 1H1TA 2FDRA 4V0OA 3DKKA 1W1WA 5CFRA 4J1TA 3B3JA 3B6EA 3K4HA 1O4WA 2QD1A 3L0BA 4MRMA 4NC9A 1BXZA 3KOXA 5FOQA 1R18A 1A4RA 3AUXA 3GFTA 3ENVA 1MIOA 1LF0A 4A03A 5H68A 4GH5A 1XQ1A 2PLRA 4DILA 1WXQA 3CJRA 5EQTA 3UK1A 4AK9A 4BWYA 1RT9A 3SQMA 4K9LA 1PLLA 4B2LA 3QVGB 4OHKA 5FA8A 4TM8A 3AJ8A 1GTL1 1B6SA 2CFTA 3RE1A 4EI2A 1DC6A 2DULA 4FI3F 2VRCD 3VMMA 3WDKA 2PGAA 1RFGE 3AESB 5E6UA 3EDCA 4YP7A 2W2PA 2M6KA 4DV7B 5BSVA 4CVNA 1FLNA 3OKCA 3ADBA 1UBOS 3EZ6A 5T7BA 1EFUA 2FUNB 3NJ4A 1M1NA 3OPYB 2OZLA 3OFJA 4HGPA 2VP9A 2VF4X 3TZBA 5ABPA 1NW3A 4HZGA 4OG2A 1Z4KA 2FAXA 2JFYA 1T91A 2M32A 3OOSA 5IULC 5JI3E 4IQ8A 4R98A 4D56A 4WHMA 1NG9A 1BMFD 3OM8A 4I2VA 4HP8A 4YMLA 2HV8A 4EFNA 3QYAA 2D62A 2Q6VA 1WHTB 1P2VA 3GRYA 4IDBA 2NYUA 2FR8C 1C81A 2RGCA 1PJSA 1VL2A 1W4BA 2WVHA 3LOUA 4R2WA 5IXSA 3CVJA 1AF7A 1CQWA 4CM7A 5J3JA 3AVVA 3SKYA 1M2EA 4RA6A 2DZDA 2EBWA 2HSEA 1E3DA 2XHZA 3PUHA 2X9NA 1ISIA 2PSSA 4IZ6A 3SXJA 2QHXA 5FTNA 3B3FA 4K9RA 1Z83A 3RBAA 4DM3A 1PR9A 3GMIA 4Q03A 1FDIA 2ZQYA 4H59A 2VBFA 1NJ2A 3IUJA 4LYAA 2IU0A 1S4QA 2B21A 3A06A 3W2HA 1CK4A 3HB5X 2ZBPA 4LXYA 2VRWA 1WWKA 1OV4A 3ANSA 3FOFC 3QKWA 1I0IA 3EXIA 4Q3NA 3WLJA 5B58C 4PQEA 1F38A 2QV7A 4JQCA 1PZNA 1EE9A 4JI7B 1L5YA 2PZAA 1INLA 3BDVA 4RZ2A 2LE0A 2LKDA 3RRZA 1XC7A 1IEQA 1IDOA 2PT6A 2Q6OA 3HY3A 4QA9A 1P45A 1FL9A 1VP9A 1QYRA 1RVDA 4LNAA 2OT3B 2PZKA 5KJ6A 1LV8A 1Q0LA 3FGNA 3QU2A 2YY5A 4MB2A 2ZI4A 4KYUA 4C6HA 4YMUA 5F7XA 2Q4TA 1AURA 1AB5A 1SC3A 2AF3C 2CJXA 4MNTA 4TN5A 5IABA 4WOJA 1JEEA 3A4IA 3WTCA 1EP3B 1NBME 1NQVA 1E9BA 4IZIA 1A9XA 3AFNA 4I8XA 1KFCB 4ABYA 2QU8A 3Q1KA 4JY7A 1R4MA 1Z29A 4UUAA 3PCXA 3CRW1 4U7FA 5AVSA 1PSWA 3DWFA 4Q00A 3IELA 4REOA 3G9XA 1HTTA 1TJYA 1K4YA 4CMEC 2W00A 4PRZA 5T41A 3G17A 1JF8A 3EDMA 3PLNA 4OGKA 3C85A 3GQBA 5KX5B 3OC6A 5K6AA 3H11A 3U7IA 4B6RA 3JQBC 3SHVA 2BSQA 3LCCA 2R85A 4ZVVA 1XF1A 1DINA 5AKZA 3AVUA 1Y7IA 1TTHA 4P82A 3AOEA 1HZZC 1RYNA 4LJKA 1FDWA 2Z57A 2CLCX 4K9SA 2NSYA 4EYSA 3S2YA 2X8AA 4X66B 1WMBA 4C3VA 3ZWMA 2YTZA 4LECA 4UHJA 1OH8A 1OBVA 1CR6A 1PNRA 3DGEC 3IXLA 1KI9A 3KPWA 5I7WA 1KPGA 1AN0A 3E48A 1F5SA 4RK7A 4TKMA 4WASA 4W4TA 3AH8A 2H1OA 5L8VA 3QPAA 2QE7D 1B0ZA 5DEIA 2RGWA 4KG7A 5MGNA 1A69A 5FOSA 1OMOA 3QHAA 3DLPX 4M0MA 1DBVO 2HSDA 2HT6A 4RIGA 4AQYB 5CGQB 3VTKA 4WSOA 1KRWA 3W1EA 2F9LA 3WMEA 2VEDA 3RYFA 1UWVA 4QNMA 3SSNA 2VT3A 1X80A 1CFZA 3A6LA 3ENKA 4MGZR 3UKOA 4A8HA 1M1XB 1TXGA 3K9WA 4DS3A 2CWDA 2TECE 3NEPX 4Q4LA 4NBRA 1VBNA 2J3KA 1QYXA 4QUJA 4UVHA 4WESA 3F3KA 3TAXA 3F6BX 4BLQA 1QHFA 4KRXA 4MDEA 3ZNNA 4DLXA 1RAFA 3LO8A 1N4DA 4FFPA 1W49A 3EFOA 2OXTA 1WRBA 3QPVA 3SS8A 4YAKA 4Q3OA 2V8OA 3KV3O 1K0UA 2QQ5A 2X5XA 4ZOEA 1ZZEA 1HFKA 1YZVA 2PJUA 1S2OA 2OWDA 3QI7A 1DJOA 1SKYB 5BN1A 5CA1B 4AY2A 2Y9PB 2HMSA 3BYZA 5TGDA 4E5YA 2Q2OA 5G02A 3C5WP 2WJHA 1VMEA 4Y6SA 4LFCB 4RVOA 4PPYA 2WMDA 3F6RA 3L4EA 4DADA 3S8EA 1C3JA 3QKSB 1T5TA 3EIQA 4JT9A 4OO3A 3P45A 4S05A 4HAOA 3AF5A 2XVZA 3L8ZA 2OO3A 3A6EA 5J2UB 1UQTA 1VLJA 4EG3A 1R1DA 4EEXA 2CSUA 1EFDN 1QONA 1YDMA 3L92A 4MYDA 2R7KA 4L3OA 4RACA 2OXIA 4UOEA 4D25A 3RCBA 2V59A 3OCWA 3ROKA 5EUQB 1ZGGA 1HQKA 2ZREA 4CM4B 4EY8A 2ZB2A 4ROTA 1A97A 1P60A 2ZE8A 4MKXA 3EZ9A 3S1AB 5KNBH 1PK9A 2PH5A 4JROA 3GGSA 1B7GO 1UKAA 1G41A 3OEEA 3UQYS 1ZINA 2PSEA 1UDBA 1SUSA 1ZUD1 1E62A 4WBNB 2RIPA 1VI5A 4A8JC 4CL8A 1WZ2A 1Z8DA 4UARA 2FMFA 1YR2A 3HA5A 4PG5A 2QQGA 1PGNA 4KXXA 1XALA 3OEYA 4M98A 2B4AA 4RHEA 2J3IA 2CXTA 3VOBA 2FF7A 2OQRA 1G9XA 2A9FA 4GI3A 3OECA 2NUPA 2WTUA 1X2EA 1JA1A 2CVHA 5DWDA 4E14A 1B93A 2W0SA 2HCTA 5D6OA 1YFZA 4IWNA 3DM5A 5GY7A 3RJTA 4Y2VA 1NONA 1JAYA 2P1ZA 3F4BA 3VR3A 2EWMA 3I58A 3WWDA 4BXOA 2B5WA 1GAJA 1ULSA 1Z2CA 1GUFA 4HFMA 3RSHA 4BUJA 2I9KA 1KDRA 3LUCA 4DHWA 1OHHA 2XCOA 1UMDB 1TZ2A 1JVNA 1N8NA 1Z6YA 1Y1KE 4LY9A 5LMNB 4MVYA 3W4IA 3EIXA 2DQ4A 2VHWA 4TVOA 3UMFA 3ZGVA 4Y18A 2ZBFA 2YHAA 3AETB 4YS6A 4KFUA 4S1PA 2HI0A 4H0FA 1QIMA 5KJ1A 3TRHA 3BGSA 1U2TA 4TS3A 3WNQA 3P2YA 2CYBA 3CYFA 3FMIA 2CUKA 3O8NA 1GRNA 3STWA 5F77A 4QSMA 1Q57A 2Z6QA 121PA 4GLOA 3ETNA 3GBPA 3L93A 4R8SA 4MB0A 2E21A 2P2CA 4RULA 1G59A 4NVRA 4R1UA 3BORA 4QG7A 1XQWA 2IT1A 1D6SA 3GDFA 4LOHA 3BDAA 4L78A 4RPHA 5E6SA 4YHHB 1QIDA 3DYVA 3CY6A 4M9CA 3ZHUA 3I9NA 1KE1A 3W2FA 4JYCA 3B89A 1K89A 2A78A 2WOOA 4UZSA 1GV1A 3U7FB 1L8LA 4PLGA 3AM1A 4HQNA 2X2FA 2Z2IA 4W8OA 3NYQA 5F7ZA 3EJ6A 2QE6A 5JSYA 3RFXA 1OBHA 3C6QA 5BN5A 2JVJA 1NU8A 2B94A 4HJRA 3L07A 3GARA 3OA0A 2DVMA 3D8SA 1YTLA 4MUKA 4MWBA 4O4LF 1PR2A 3VH1A 5K8IA 2HPHA 1P2GA 4FGWA 1A77A 1UXJA 1AA6A 3V4VB 2B1IA 3ZQUA 2DQYA 2FU5C 5HPYB 5ER9A 2G0AA 1J9EA 4O2BB 5GOTA 3RHZA 2C97A 2JH3A 2OCBA 2V65A 1L7RA 3BGWA 1ORDA 1Q2XA 3DWIA 4TV8B 2IYUA 4BNKA 5AKEA 4IINA 3DPSA 3WQHA 2JGEA 1JH9A 4OM8A 1ISFA 1IWBB 1E5LA 2Q2QA 9LDTA 1U0TA 1NYRA 2ZM5A 1JPJA 1JX6A 2ZJZA 1OWMA 3H1PA 3DO8A 4PG7A 1T9GS 3O3CA 2HHAA 3L6CA 4KWIA 5LYJA 3D3KA 3REFA 1ZI6A 1JLRA 2OYSA 1JFFA 3P27A 3FBWA 3N0TA 4ZRMA 3VYUB 1BW9A 4GVPA 3WE7A 2VZ9A 5AHKA 3W5CA 4M22A 3ABOB 4F3CA 2W98A 3ML1A 3A7DA 3QVKA 1VCIA 2QSUA 2XUOA 3M6WA 1T0JB 4MQ6A 3HCNA 4Q3CA 3VR1A 3H2YA 3AUKA 3QTBA 4LMPA 3D3WA 4W63A 2Y99A 2V7XA 1CUXA 5EJMA 4QNRA 3TSAA 3T4EA 1BFUA 2WKWA 5K20A 2RI1A 3CRMA 2H9IA 3CZMA 4J07A 4UMVA 4XGIA 4YXWD 5KC8A 3BT7A 2PQ2A 3R3VA 1MZVA 2O52A 4BGIA 2VQ3A 3OD5A 1T26A 1DQRA 1KXZA 1ECLA 1T13A 2GXUA 1GTZA 1E69A 2BBSA 2V7BA 2UVPB 4C0QC 2I6QA 5DBHX 3VA7A 5THXA 4F1JA 2UYQA 4RZXA 1KIFA 1U8FO 5JFOA 5ALOA 4KH0A 2WIBA 4OH1A 4TUYF 1IVYA 3RDPA 5F1YA 1G1MA 2VL7A 4CKEA 2GB4A 4GOOD 3I2HA 2BGTA 2IODA 4U2FA 3STVA 1Y1QA 4JLWA 1N9ZA 3RUDA 1G9TA 4JSTA 1MC8A 3IEXA 4RJLA 1RYEA 3MTGA 3GGOA 4J4BA 2Q0SA 3EGXB 4L7VA 1JHDA 3KJZA 1K66A 4M89A 1V5EA 1WP9A 5DIFA 5HJ2A 1QK3A 1H93A 1P91A 1PGQA 1XRJA 1C4KA 1JT9A 2PKQP 2GN1A 2X42A 4O29A 3TUJC 3UWKA 3WLEA 5LZ4A 5AJTA 3MIZA 4Q01A 4Z8YA 3KR0A 3G2IA 2IBSA 5H0IA 1Y98A 3TLYA 5JXGA 1XCLA 3AERA 4AVYA 1KZYC 4DQKA 5IUNC 4HFJA 2ZJ8A 1HNXB 2DPHA 3HB1A 1T0PA 4LK3A 1II8B 4NPAA 4Q3DA 4YRPA 2N42A 2PWPA 3CBGA 2VAMA 4XSGA 4BUZA 1A9TA 1W85B 3LO5A 4JJAA 5A9TA 4HLDA 1UPXA 5EWLA 4AJ2A 1O94C 1WW2A 3WSTA 4G97A 1W85A 4N7MA 3P4UA 3AMVA 2FW6A 5EOVA 5BWCA 1N5MA 3CGWA 3OLCX 3FNQA 4WBSA 4D9JA 1XTBA 3PDUA 1DU4A 3PQ7A 1SKYE 3A1TA 3DBVO 1DKUA 2WJAA 2D4AA 4Q12A 1RQLA 1XSEA 2ONYA 2UZ0A 1ZOLA 3AZOA 4FNMA 4UPVA 2G4CA 2H1FA 3MMZA 3WS7A 3A7EA 1I2AA 1P6XA 2WKPA 5DNEA 5ECDA 5FFFA 3UWOA 2I7VA 4WAUA 3BRQA 3NVAA 1O6FA 3WDMA 4CV0A 5CCBA 1PUXA 2R8RA 4NOKA 1NU6A 1PE0A 4IPTA 4QU9A 4ZZ1A 3D64A 3V4LA 1NRXA 3DFKA 2ZRMA 4K6CA 5A3QA 4PINA 2Q3JA 4CG2A 4DPMA 4P31A 5SY9A 4CEIA 1H22A 1TGVA 3UWDA 1XMVA 5I7UA 3KQHA 1JBKA 3G23A 4MWOA 3ILVA 2A1TR 3N5KA 2RARA 4JI3B 1XCMA 1HTWA 5ULLA 1RXVA 1YZGA 1QH9A 4YLGA 16PKA 1F0PA 3H9QA 4Z6KA 4OATA 3OJOA 3IP5A 3TJZA 4OEHA 4GPAA 3OZBA 4DB2A 3ZLVA 1I3OA 1PL8A 3VSDA 4B09A 4ETIA 4KNVA 1B1AA 1WY7A 2H2IA 2CLHB 3E9MA 3MT8A 4J3JA 4HDNB 1BVRA 2OV4A 3MCVA 2WTBA 4WCFA 5DN6A 3RSQA 1XO1A 3OOYA 1WR8A 4D6YA 5AKXA 1NYQA 3I9FA 3L79A 1I33A 2R96A 5D6NA 1QC5A 4AZSA 3MSXA 1KU6A 3F9RA 2H1CA 2IFTA 3S5UA 1J7JA 3TNDA 2FPSA 2HQSA 2JC3A 4F9TA 2H6EA 3C6MA 3FAZA 2XADA 3UQZA 2ODEA 2AKAB 4L4UA 1D3AA 4HRYA 2PX3A 3VO8A 1DDGA 1VXOA 1MTZA 2PKYX 2VP5A 5ECYA 5KKAA 1JKIA 1Y81A 1TJPB 1DQZA 2PPVA 3HRKA 2JFHA 3ETCA 1KK0A 2PS0A 2Z9DA 2Z30A 4Z0NA 1J20A 4ILEA 2GCOB 1JIIA 3MLAA 3LTNC 2FDCA 2ZITA 1RE1A 2XJ9A 2DCUA 4EZBA 2DT5A 4ZJYA 1GPUA 2R8PA 5I7SA 1YC5A 4PCVA 2CLFB 5KYVA 2YMLA 3T9EA 4AG5A 1L5HA 4TS4A 1VPDA 3VSEA 3QUCA 1PX0A 1XTSA 5ENVA 4YCDA 4UMEA 1AK9A 1M2HA 3GGPA 1X7WA 3LH5A 1KQOA 2CNWD 4HMQA 3NHMA 4PLVA 5HNKA 4FYHA 1Y4SA 4WA7A 3CCFA 4Q37A 3MM4A 3H5WA 4REQB 5H59A 2HADA 4B87A 2HIGA 3CISA 5E1BA 1TT5A 1YFKA 3WLOA 3N28A 2J0EA 3C3MA 1NXTA 3DMNA 4OKNA 1DC3A 1OTHA 1XN4A 3C3AA 3TRDA 1KMCA 1WTAA 3JXEA 4PZAA 3ZI4A 1AQJA 4U2BA 2DAPA 4RUKA 2WFMA 5HS4A 3B48A 4N8DA 2P6RA 1PR1A 1ZGZA 3D7KA 2B83A 3DWEX 1QV6A 3PFWO 2R6CA 3PFFA 1TVCA 4FU0A 2FSIA 4ND8A 3ZJTA 2YZ2A 4ZOQI 1XMJA 2GEKA 1L5GB 1EFVA 3IAS1 3DA8A 3OE5A 4UQPA 3V4OA 1G6HA 3Q8XB 2XSZA 3E2MA 3YASA 2ZYHA 1Y9EA 5JBQA 1UT5A 4C04A 1R6DA 2OG2A 3QPDA 3TNJA 5BRAA 3A4MA 1GAEO 3C6YA 4W7SA 1KARA 1M8GA 2DSTA 3MWKA 3UATA 4GBGA 4DSTA 4E0BA 1Z5GA 4OHUA 2EYQA 4RFSA 1GZSA 2RHDA 1L5RA 1S02A 4QPNA 1X3SA 3GZ4A 1FXSA 4UBLA 3CUEF 3VQTA 2FX2A 5SZIA 2OBLA 4CEIB 1PZHA 1ZR4A 3F5FA 1ISRA 2A30A 1LFDB 5MDHA 5LOVA 4Z0PA 4BVJA 1QG6A 1AD2A 5KU7A 2G7MC 2BE7A 2XVMA 2WD7B 1EJ6A 5C1IA 3TLKA 3KBOA 2DGDA 3LI2A 4DLAA 1JI3A 1TA4A 3EB9A 5DASA 3AT1A 3MGKA 1YRYE 4K26A 5IX8A 2C7QA 1A5BB 2PVPA 4HEA6 4RGQA 4BDSA 2EF0A 3PNQA 2YX1A 4GSKA 2BEWB 3QG5A 2H18A 2H17A 2VK4A 1YZHA 3C1OA 2DOKA 3LHSA 3PQFA 5DTQA 2GJ8A 4TQGA 4ZVOA 4L8GA 5G53C 4II3A 4TLMB 2Y2VA 3P9NA 3QJGA 4HFNA 4M1SA 4QBIA 1GD1O 3QEMB 1XZ8A 3LTEA 4GC5A 5EP1A 5GVRA 1NFQA 1C3OA 1EK6A 1XAJA 1OXTA 1NQAO 1ZOSA 1PJCA 2DRIA 4LRXA 4RDIA 4ZPJA 4JBXA 4N6GA 3SYMA 4C88A 4ETNA 4I9GA 3LLVA 4KFTA 5CA0A 1N6OA 4EJSA 3O90A 4J43A 4I81A 2JDID 4H7DA 3UEOA 2C7RA 4I6GA 2X9GA 3HJCA 4KQKA 4QYWA 5DBIA 3QFFA 3U4GA 4F12A 3W4KA 1N6KA 3BERA 3KRTA 5CXXA 3T7CA 4EPTA 2J3HA 1CWUA 1E4EB 3CJTA 2C4HA 1I6WA 5CB4A 2BM0A 3IA7A 3K9BA 1YRHA 2D1YA 4RSRA 1L4FA 3UBMA 4XVUA 2J08A 1OIWA 3OJWA 2P5UA 4AL4A 2BDEA 4YAWA 1IRXA 1PUJA 2DX7A 4QDZA 4C4XA 3F3MA 5EGSA 3WYFA 1T3SA 4UULA 5CYPA 3MGCA 5HRCA 4BFVA 4KR2A 5D5QA 2CUZA 1NVKA 4LCJA 4WDRA 5TQ0A 2BEWA 4PYOA 2ZIAA 5CT9A 1EU1A 1QLJA 1Q1EA 3BZBA 3FXAA 4HH1A 4AJNA 3QIVA 3ZHBA 1I2MA 1TK3A 3NBYC 2WUEA 4EFDA 4XXHA 2V4UA 4MGEA 1GZUA 3W3AH 4RH0A 1JKXA 3BQNB 4B0OA 1DFIA 1LBQA 2EL9A 3EWIA 3TQCA 1PFGA 4BX2A 3KM0A 3KXLA 4EW3A 4CNQA 3NM5A 2CJPA 4XCQA 1NMZA 2WK1A 1SU7A 2GN8A 3F71A 3FFWA 3T9AA 3WIOA 4RDXA 1W7AA 4L95C 3KTAA 3FPJA 2CT8A 3OZCA 3C15C 4LF5B 1HNNA 3WLPA 4D9EA 5C3UA 3ZCRA 5CFNA 1XZPA 4ZWNA 4BEJA 1OCEA 5I9LA 2C1EA 1QM5A 4D4MA 4KXQA 3WWEA 3EAFA 4NYMR 3GCDA 1WDKA 4H7PA 4DWJA 4YAJA 4G5OA 3C6XA 1FVFA 3BVPA 1OHHD 5JPIA 2VPZA 5DGCA 1R0LA 3D4OA 1K3TA 1M7GA 1OASA 1GADO 4ITUA 5AH0A 3RS9A 4D0RA 4EIWA 4RTQA 2Y6UA 3DCIA 4C0HA 5BP7A 1WLSA 4JP5A 3K0EA 5AHXA 3JARB 5I9MA 2V7GA 1IQRA 3M5PA 1V3VA 4EB6A 3IP1A 3V2IA 4IAOA 1KVQA 3SBXA 5LQDA 1XCBA 1HSZA 1ARZA 2EP7A 2AYXA 4J2HA 3W7AA 2AI1A 4OQYA 2QP9X 4JEUA 4KKXB 3OD1A 2PPLA 2QD4A 2E2WA 5CDFE 1PSDA 3ZHSA 2PIDA 4Q24A 1M54A 2DT8A 2X6QA 3KXKA 5L7WA 3GLUA 4MVJD 3FHTA 1HQDA 4UU1A 2Q4RA 3FPSA 4DGSA 2NWQA 2TMKA 1FYFA 1FLVA 1U81A 3C3BA 4G2TA 4N01A 5FEMA 4OXNA 2WWFA 5GV7A 4LZAA 3BICA 5T64A 4C2BA 3TF5A 2CFSA 2YNMA 3V8MA 4UBNA 5IKEA 4NKRA 1CT9A 1EUCA 1PFUA 2XGSA 4MWSA 5HF6A 1EWTA 5BN5B 3GJZA 1IG3A 1V26A 1LSOA 4RENA 1Z18A 1RIIA 2H0RA 4P3NA 1M1YA 2EFHB 3RS5A 5BV7A 3S2GA 4EG8A 4G63A 4IIDA 4V2IA 4C7OB 4KO1S 4MYTA 2BR3A 1MHPA 3UA3A 4E21A 1DKMA 2OK8A 2J0SA 3Q9UA 1GAQA 3R7WB 3WX0A 2P9ZA 4O6VA 3EGDA 5SZKB 1K6MA 4FSXA 4ZT2A 4QM7A 1E9RA 1NVAA 4IF4A 4LJAA 3IL2A 3R6WA 1YRAA 3M6UA 3KOOA 3KVYA 3WIVA 2FPOA 4TN1A 1SD1A 1CLEA 4FT2A 4EPXA 3NWOA 3C43A 4J1SA 1EWYA 4F3RA 1R4MB 2DR3A 3MJVA 4R9RA 3OMXA 8GPBA 4QPZA 1U0SY 3GUYA 3VAAA 3H0CA 4RW0A 4OHPA 1E4OA 3C3EA 3PGMA 4M1TA 2WM3A 4GXNA 1WD7A 5FA6A 4J1TC 3THWB 1OI4A 1CR4A 2FPGB 3DVRX 3LJKA 3ZY6A 1FZQA 2DWOA 2ZAYA 4ESOA 3A3NA 4JI4B 1V35A 4OI2A 3R77A 5BNIA 1NHGA 3FSGD 2VP2A 3S68A 3QPBA 1SBCA 4TLCA 2XBMA 2GTHA 4RHXA 2PG3A 2BBOA 4GPTA 4M9UA 2QT9A 5EXSA 4KDEA 3SPXA 5F76A 3COZA 5DOZA 2JIQA 2CBXA 3OZVA 4XD7D 4DLPA 1I94B 1CVRA 4LXIA 1LDEA 3QYJA 2ZLBA 3VH4A 2B98A 2ZI3A 4A36A 5H9WA 3O2JA 2D1TA 1MP0A 3KZCA 3ET4A 3ESBA 3L7DA 4MV8A 3O94A 3INRA 3ZDZB 1XXHB 3IBTA 2EX0A 4UCWA 5ERYA 1SPXA 1A9PA 3CRRA 5UKDA 4LA4A 1E2FA 5CB8A 1V48A 3E5HA 2Q1WA 1PJ8A 1UPUA 4KUEA 1MHTA 1LUAA 1WDMA 2CHFA 4D42A 2X7HA 3O47A 1X42A 4HEQA 4G1BA 1EA7A 4E6EA 1JHVA 5TMPA 3EQ6A 2HJVA 4U63A 1EX1A 4NEGA 4ECAA 4UUMA 4AMZA 2QRHA 1AK2A 1WM1A 4L27A 4OJKA 4OP1A 3PHHA 3REQA 4Z4FA 1GPWB 4L74A 1EDDA 3AUYA 4GICA 1VI2A 2W6ID 4D02A 1TKBA 2IHKA 4Y6RA 2VAPA 4LWPA 1MO3A 1M8FA 4DEXA 3VKGA 2QLLA 5I9BA 4GR9A 2IV7A 3X1ZA 2P1RA 2RI0A 2F59A 4QTTB 2F90A 3AGPA 2BHNA 5G0SA 1VL6A 2A9OA 2RHLA 1SB9A 2JIZD 2FEOA 4L8YA 3WMGA 4C4SA 3L43A 4IIXA 3K32A 4PICA 2PVSA 4MPRA 5HMLA 1JZTA 2IK8A 1DBPA 1WEHA 2I3DA 2QMHA 3OU2A 2NSJA 3AXSA 3ZX5A 4O4LB 5AVZA 4HEA1 4G0PA 3W8NA 3BCHA 4ZQIA 4MS4B 1EX6A 2Y1KA 4P35A 3HA7A 2WTXA 2XA2A 1YVPA 4PYRA 3MAJA 3VDNB 2DBYA 2WBLC 3BOSA 1X7ZA 4KQEA 5DI3B 4MS4A 5EWMB 3UTCA 1AS2A 4NCHA 3CVYA 1WLYA 5B1DA 3G2MA 5BT8A 2P69A 1JAXA 3T7RA 1G7CA 1LLFA 3CC8A 1AA9A 3JW8A 3QRWA 1UC9A 1ZLYA 1ECCA 1K8ZB 3IR5A 4B7UA 2G4LA 4WBNF 2FPPB 2QD5A 1RWWA 4GGPA 4KPEC 2B1QA 1EHIA 1TO6A 2E5WA 1GPBA 2Q6IA 3HCWA 4XQEA 1JFRA 3WLIA 3KQKA 1C0LA 2GHRA 4DV0B 5LP6C 2G6BA 3E7DA 1P5JA 1JMVA 1NRWA 2FYTA 3GHYA 2PUJA 3N75A 4UW9A 3KKOA 2MDTA 3L8EA 1BXGB