4R8KA

Crystal structure of the guinea pig l-asparaginase 1 catalytic domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
355
structure length
355
Chain Sequence
SERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Identification and Structural Analysis of an l-Asparaginase Enzyme from Guinea Pig with Putative Tumor Cell Killing Properties.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Hydrolase
total genus 115
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r8kA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4r8kA01
2P2DA 4PGAA 5DNCA 1O7JA 1AGXA 2WLTA 2D6FA 2GVNA 4RA9A 1DJOA 2WT4A 5CBPB 5K45A 1HG1A 1DJPA 4ECAA 5HW0A 4NJEA 5K4GA 4RA6B 4R8KA 2HIMA 3NXKA 5F52A 1JAZA 2OCDA 4Q0MA 1JSRA 1HFKA 1IHDA 4R8LA 5DNDA 5I48A 5CBPA 5I4BA 1HFJA 3NTXA 4RA6A 1JSLA 4RA9B 1HG0A 2P2NA 1WLSA 1HO3A 5DNEA 3PGA1 2JK0A 2HLNA 3ECAA 5I3ZA 1ZCFA 5K3OA 4NJEB 1ZQ1A 5K4HA 1JJAA 1NNSA 1WSAA 1WNFA 1HFWA
chains in the Genus database with same CATH superfamily
1FTNA 1N2OA 1DTWA 4Y9UA 3U2QA 1X1AA 3T95A 3HP1A 1F0YA 2QZZA 3PX3A 3C7KA 3PNPA 4RSMA 1C8BA 3NYQA 1Z0UA 3DV2A 1R9MA 1VE7A 1U1CA 1IQ0A 1Z13A 3GA5A 3L40A 3NT5A 3IT1A 4GZLA 4LOLA 4BEJA 1YI1A 4QYWA 5F33A 2IVFA 2YFHA 3TD2A 3CLKA 2DWQA 2Z09A 3TW6A 1XZQA 3X2EA 4YV2A 3WGMA 4LNUA 2PBZA 4XB1A 3B8HA 4D45A 5K0JA 1IXKA 1ADBA 1C9YA 5JCJD 5K0GA 3LCJA 5FBRB 4JR0A 1CUVA 3UWSA 2O2IA 2PZAA 4KSYA 1P9WA 1RLOA 5CVUA 5MHTA 3ZDEA 1KZ9A 2YRWA 2RHJA 2ACVA 2ZTUA 2GCOA 3F3YA 3LD9A 1DWOA 3FA2A 1K3UB 4RZSA 3PL1A 3IR7A 2DBYA 4NP6A 3SBDA 1YUBA 3DH0A 1C9MA 2H2IA 4LYGA 1R0ZA 2R4QA 3KCNA 3T5MA 3TB6A 4WOCA 3RTGA 3UJ6A 3KZVA 4KX3A 5BSTA 3GDWA 2IL1A 1KJIA 1OTYA 1Q6YA 3O91A 5GWXA 3CUWA 3BCRA 4DT1A 1U0TA 1MQSA 4FFVA 3RWBA 1YFKA 2X2EA 4PPGA 4P83A 1NDUA 2VUUA 3PD0A 5H59A 3VA7A 2OE2A 3IQZA 1I9GA 2Z0MA 4NXMB 3Q7RA 2C5AA 2R96A 4ZA2A 3H86A 1IHXA 3JYOA 2IDJA 2UUOA 4Z5XA 4JJ6A 2IS6A 2JFZA 1YJ8A 1IBSA 3EFOB 4J0IA 4RHCA 1RHJA 2BI8A 4GRIA 4AY4A 3FNBA 3K2EA 3HJBA 1OBCA 1SIUA 1S2IA 3KOUA 4PQYA 1V37A 2XKBA 3ED1A 5I7HA 5JROA 1XCPA 4FGWA 3DDHA 2Q1XA 1E9RA 1SU8A 2ZJYA 1RC8A 3SIXA 4AS1A 2Z4RA 3GA7A 2FE4A 4KQEA 4EENA 2AMJA 4JYPA 1G21A 4WXPA 4AZ0A 1NOKA 4C76A 1LPOA 1AKNA 2XUAA 2QROA 2G1AA 4F2WA 1B15A 1R0WA 2GN1A 5C18A 4P0QB 4RAQA 221PA 1E0SA 1UWVA 2QTGA 2C9YA 1PF7E 2XEDA 1D6SA 2CJYA 3WBFA 3PRHA 5F9MA 3U4HA 1VPWA 1ZL2A 1Q50A 2BMDA 2SKCA 3WKBA 1KI4A 3MJVA 3PJFA 2A3RA 4DIBA 4BMSA 4DQDA 2I6GA 2QNRA 2LDBA 4OHKA 4JU8A 4E2XA 3SNKA 3EIOA 4X90A 2FQYA 2X2FA 5ECDA 1QVVA 2PGAA 1EXWA 1L4NA 2ID8A 1BCSB 3ASVA 4I4LA 1G63A 2AA3A 3PFHA 4P38A 4WA7A 4B32A 1L1QA 1ZGCA 3GOHA 5BT8A 1U6IA 5A06A 1G8PA 4NNOA 1K92A 5IH7A 3H4VA 5BN1A 5HF9A 3ZWWA 5HZKA 3IVXA 4CFZA 1T26A 2JH3A 2QVZX 5YASA 2R5WA 1N6KA 4RK0A 1VRCA 3H7IA 4KCGA 5K3BA 3VZCA 4B2LA 4TVKA 1IZ7A 1Z2AA 3A37A 4JI1B 1FUUA 4H3VA 3CLTC 3QLTA 3AC0A 3DE1X 1NRIA 3A6PC 4EJ0A 1FDTA 4AX8A 2AFHB 1AF7A 1T3TA 4GYWA 3E23A 2B1JA 4H17A 5HW0A 1F7VA 4GVLA 2J5XA 2PBFA 5KVVA 2EJTA 1NMSA 5B53A 2FUG6 1EGHA 3BDVA 5DT2A 4PO9A 4DLZA 3A0UA 4CL8A 1JKMA 3NTUA 4B4OA 3L0ZA 2C42A 3PRYA 3B85A 1BYUA 4Q4LA 1BS1A 4Q4JA 2X0DA 1O95A 4P4LA 3BD9A 4KAAA 3BF7A 2NAPA 2OXFA 4HEHA 5LBIA 3PQ5A 3ROTA 1UBNA 2K7FA 4WXEA 4KXLA 2Y77A 2YNMC 4G89A 4S1PA 4OL9A 4EHHA 3PQ8A 4HXFB 3I8SA 2GLXA 4KQ1A 4DV6B 1VL6A 4EMTA 1JECA 3MWLA 4MGIR 4WI1A 3N6VA 4HPWA 2GN9A 3G9QA 4LJ8A 1R74A 4OJMX 3K30A 3HCPA 1OBOA 1XMXA 3QIAA 2ATVA 4FB5A 1FFBA 1AKWA 4MS3B 1O94C 3VAYA 1A2KC 3ZN2A 3OUZA 3N8NA 2N0SA 4DWJA 2WZDA 1FFEA 3FF1A 4FNOA 5T57A 2CJPA 1INLA 1QX3A 2O5VA 3A6EA 3E7PA 1OLOA 1CX9B 1DCFA 2NQTA 3EY4A 4WFIA 2DQYA 1U0OC 5K8IA 4JASB 4C7XA 3ZG6A 4WKNA 2ETVA 2AR7A 2CDNA 2ZI3A 3FZGA 1QO7A 3E9NA 1CY7A 5IKXA 1CUIA 3JXEA 1T5DX 4FT4A 4ZC1A 3TMAA 1Q3KA 2YWRA 4MP3A 3UUEA 1AB6A 1QH8B 4D44A 4C87A 1MQ8B 1XF9A 2D1RA 5TARA 4C4TA 1F6BA 1Q0QA 3IS3A 5LYYA 2FZVA 3QVSA 4ZIRB 5FH9A 4FJ1A 2B99A 4QDTA 3RKRA 2A1TR 1M72A 5D87A 1KFEB 1SCNE 2WW8A 1SK9A 3G2KA 2JNWA 4N3AA 2MT9A 4AIIA 3JWGA 4RY8A 1BMTA 2AK2A 4K87A 1DHTA 3H4TA 3C5WP 3BQNB 1IIRA 4TWJA 1Z08A 1F9AA 3RBVA 4HMPA 1A5TA 5DP1A 4C4RA 2HYDA 4ZC8A 1CVRA 3ZJUA 3IXLA 4Y18A 1OI2A 2PZGA 4J0FA 3C6QA 3N8HA 4RSHA 3RHZA 1NBWB 5KREA 4TV8A 1UIRA 3KWFA 4U0JA 4HEJA 1J2EA 4KLCA 2FDRA 4QBHA 2IZ6A 4G97A 3MWDA 3HJFA 1VBFA 2AG8A 3S4YA 3VU3A 2IRWA 2PCLA 1VG9B 2Y2UA 4M83A 2EL7A 1ND5A 1V35A 2W6QA 2IIPA 1U04A 2OMEA 1AV6A 3TG2A 3GB9A 5HSGA 1PI3A 2R6JA 1IXSB 1W4BA 3NWBA 4IZOA 1F3OA 1HORA 4F2DA 5BSRA 5DNDA 4YTEA 4PSVA 4BIMA 4C03A 3A1SA 1SBHA 4P58A 1U5AA 1A88A 3DUFB 1V96A 2ZJ7A 1XVIA 3WGQA 1YQXA 3CUUA 3WYGA 1VKJA 3CEJA 2EZTA 2I3GA 4UNPA 1VSQA 3RASA 1ZWKA 5DTMA 5ES4B 3CUKA 1T4MA 1JYSA 1P4JA 3Q7IA 2XE8A 5EJMA 3DOEA 3HACA 2LD4A 2AKYA 4LC0A 1UBOS 1A95A 2KB0A 1CJMA 1I2ZA 3ECSA 4TL8A 1HNWB 2RGUA 5EQJB 2KM1A 1OFUA 2XDAA 3D5EA 3AEUB 1YDGA 1ZA2A 2C4NA 5K0ZA 3H1EA 2CBZA 4ZTZB 2XCTB 3FUTA 3D64A 4YJHA 3OQJA 2W93A 2XVXA 3NGMA 4ZVPA 2Z9CA 5BRJA 3ZWBA 4Y1RA 1KDRA 2BEUA 1MABA 1NXQA 2C9DA 3R5SA 2AV6A 4KOAA 4QYIB 3TE7A 1QIHA 1STOA 2GKSA 1DBSA 2HLNA 2MYPA 2NU8B 3EGEA 5TX7A 4M86A 3TRHA 5KWIA 4XASA 2IWHA 2PWZA 1O6CA 1DC4A 1L4MA 2XGSA 3PFNA 4I3GA 5GY7A 1DDGA 5JY1A 1TU4A 2NOAA 2Q5OA 3IQWA 3RVPA 4QXQA 2P6OA 3DDUA 5JSFA 1NWHA 4URWR 4EB3A 4DMMA 1MH1A 2Y1LA 4FDTA 5HTOA 1ZN2A 2JAOA 2C5EA 3GOQA 2H5LA 2HM7A 1E2MA 3KNZA 4RAOA 4UC0A 2ECPA 2OCBA 4HTFB 4O0LA 2Q7OE 4GWKA 3W8RA 5F23A 1G19A 1M76A 2ZANA 3I58A 3OE7D 4FLMA 4TV8F 2FLKA 4QECA 3WLTA 3PL5A 1ZSYA 1OROA 2F43A 4Y1GA 5LZ2A 1N75A 4MHTA 1SWWA 4UNNA 1GSOA 1HYEA 2G08A 4KQIA 4FINA 3KEOA 1VJ5A 4JQCA 4FZ5A 4KLZA 3X2SA 1BXKA 5AK4A 5LP6A 2HW8A 3OEEA 3TXXA 2V9ZA 5DK6A 1LW7A 3JW8A 3OZXA 3HABA 4RMGA 2CXOA 4WADA 3F90A 3VJKA 3VSDA 1IRIA 2OLJA 3W5UA 1JDSA 4M49A 4JI2B 4P4SA 1Q1BA 1X13A 4FNGA 4AYWA 2RAVA 1VSTA 3UMGA 4DCVA 4B3TB 3E3AA 1NW9B 1RSZA 1EU1A 3DDNA 5IJZA 3IP3A 4GR9A 1VJTA 2DOKA 4I9FA 4KRGA 1KS9A 4KSCA 1E3JA 3HRHA 1USVA 1HRKA 4FYWA 4AULA 5KO2A 2E5LB 1RD4A 1J5EB 1MKYA 2GH1A 5IAAA 3A1WA 4X71A 5JH7A 3PFKA 3VPCA 3Q72A 1EP1B 4F6LA 4UTVA 1AVTA 2P68A 1KP2A 3QUSA 1BX3A 1TUEA 2BGUA 2JJ8A 2OY0A 3QPAA 5EP2A 5KDLA 5K4HA 3CVYA 1K4KA 1A0OA 1BJRE 3TFOA 4YP1A 3A3YA 3O7WA 2CCKA 2G63A 2PVPA 1SCUB 3GJTA 4JBYA 4FNMA 3M49A 1UBEA 3EULA 3CC8A 3PI7A 3OSUA 1R4AA 3U4QB 3ACCA 3SHWA 3ERCA 1WXHA 5C9ZA 4BO8A 5J3JA 1KP3A 2HQBA 2PH5A 3U5ZB 4WK0B 2J3JA 1RAHA 3C1UA 5LFAA 1E7WA 3IMKA 4M22A 2C5FA 1T15A 3DZFA 4BLWA 3KKOA 4QQ8A 4CIDA 5FWNA 4U3JB 1ZGBA 1E20A 3UBMA 3IR5A 1SVIA 1CZOA 4HDKA 1Q7GA 1SVLA 2A3NA 3TNJA 3KLOA 4RIGA 2HF9A 2BZSA 2ETXA 3IHTA 3MTGA 5E8RA 1IFXA 4W4TA 4V0LA 1GNQA 3GHHA 3JD2A 2BFOA 1IHUA 1L8XA 1YMUA 5DZSA 4NOJA 4F5ZA 1IVSA 1TIBA 1GKIA 3LVRE 5I7VA 1Z6QA 3H9UA 5F7JA 3Q9NA 2FZGA 4E2ZA 1TAHA 4O4LB 2V58A 2WOJA 3T6KA 3A4LA 3IAAA 5EJ7A 2OYSA 1L0BA 1DINA 2E6UX 2NIPA 4CIYA 4YFVA 2M2IA 3CO5A 2C9CA 3K4QA 3GLQA 4JA2A 3WNDA 4DAEA 3QVLA 2ZQZA 3CUTA 4LWZA 4J7XA 4Q4CA 1BE8A 2H7YA 3PC2A 4GUAA 1SC3A 2I4IA 1KO1A 1VLZA 1HK7A 2DTEA 3QQPA 3R0JA 4YJFB 1DO0A 2HJWA 2HSJA 2QR3A 4OK6A 4ZAGA 2Z3ZA 3T3EA 4E88A 4AROA 4OQMA 3CRQA 1FX0B 2X0FA 1SZDA 4FYKA 2JI8A 4HDRB 4V0KA 2YQ5A 3B3GA 5CFMA 1O6GA 1CY2A 2IYZA 1W8IA 3HBNA 3GZJA 3KKZA 3NCTA 1D8TA 1OR8A 1Z3CA 1ZVQA 2HIGA 3PNSA 2AJLI 2WRZA 4UZFA 2CFRA 3BMNA 2PYIA 4RYDA 3AJEA 3ZZNA 1Z16A 1C9DB 2R6R1 4Z9AA 5JH7F 1X1QA 1L5HB 4LHZA 2HBYA 4RADA 1L8QA 2ZT8A 1QYCA 5HKOA 1JDVA 4JC0A 4BASA 1RMQA 2P30A 4EHKA 2WHRA 5LIPA 3K6SB 1MNQA 2W2LD 3IVGA 3SN6A 4Y2XA 2BFEA 5ALDA 2B4RO 5DX8A 3DL4A 3FH0A 3AVVA 3SFTA 5A02A 2EV9A 5B7QA 1ISMA 1T8SA 2ZLBA 3COPA 4QYTA 1QP4A 1KU6A 3EC2A 5IAOA 1RKQA 1RQPA 1R9JA 1XE3A 3KYJB 1TXGA 3J81A 4UUBA 2QLTA 4FR2A 5AI8A 1HMPA 1TKRA 4TSKA 5FOUA 1KI6A 3DZDA 1XVLA 2Q4BA 4HATA 4D9KA 5HNKA 4ZRDA 3U40A 3PXUA 4I8DA 4CNBA 4RZQA 1WWKA 1KZ4A 2CVPA 3ASYA 4EG5A 4Z51A 2GHRA 2BH2A 4KE6A 3LOQA 4ID9A 4P3NA 1Z7BA 4YJDA 1UWLA 2OBLA 3DD5A 1XNJA 3R6TA 1JRLA 4PO8A 5EJ2A 1XNGA 6AT1A 3LHSA 5BQ5A 4XR9A 1QAMA 3VSAA 2EKBA 3BMXA 1ENZA 4MWTA 1SC6A 5CA0B 3O6VA 1RZUA 2QTHA 3V33A 2Q3LA 2QRPA 4OQDA 3GHYA 4B09A 5ISMA 2JGRA 4GPEA 4M1ZA 2WDZA 4A8JA 4EY8A 1DG3A 4YRKA 3R3VA 3BDAA 4PPQA 3H6GA 3MD9A 1ORWA 4PHFA 3ZZMA 3QA9A 4AMVA 1M7GA 5ECWA 3BJZA 4ETIA 4MJ3A 1E3WA 3C6ZA 1XYGA 3GV0A 3DDZX 3LCMA 1NNEA 4RTJA 2JGNA 2JIZA 2Q9CA 2FK7A 4F4HA 1U8FO 2JEYA 3G23A 2Q49A 3DA8A 4JZKA 1P17A 3AKDA 5TQVA 3MFYA 1I5RA 3JQ9C 4CM4A 3KUDA 3K92A 1QZTA 4ZQFA 3T7KA 4EATA 4F56A 2BMVA 5IJ0B 3RV3A 2RE8A 1ZVVA 1MAVA 4L28A 1EVEA 4OLHA 4WK4B 3UYLA 4GOMD 5JSQA 5IN4A 1GSIA 1H85A 2W9XA 2FN8A 2FP4B 4ODIA 1YKFA 4KRYA 1CBUA 1AQYA 1SO8A 1RI5A 3V55A 2HWXA 3CRW1 1GPLA 2IC5A 2ZBUA 4MKFA 4EUSA 3DV0B 4Q3DA 3LC2O 5JJCA 1JMKC 2PD4A 4V1CA 2ZJZA 1NFFA 2I2WA 2H4FA 2J9RA 4OHXA 4KI0A 4PC7A 2GCPA 2HNKA 2ORIA 5JTTA 4RMIA 4M1WA 4NAUA 4WNAB 2BGTA 3TVYA 2FMKA 4B8ZA 5E7JA 4BLVA 5ESRA 5AYVA 4XX0A 2BW0A 1EK5A 4AY5A 5T6MA 4LF9B 4EAAA 3ZY2A 3GZNA 4NYJQ 3X1WA 2OLEA 1T8PA 2CLMB 1X14A 1TO2E 4QOHA 2Q3HA 3NYIA 5CVEA 2WFLA 4EPTA 5EIXA 4ETWA 2GETA 1CLEA 2ZJ3A 3GK3A 1O97C 3TK1A 1P8AA 1YE5A 2WJHA 3C41J 3TEMA 2KMLA 4PANA 1J7JA 1XO1A 1G9TA 4M2LA 5HKBA 5FL3A 3NFRA 1JQEA 3IC5A 1A9QA 1S89A 1QO9A 2DUWA 5C8VA 1T2FA 3PRKE 4GNKA 4M1SA 1KO8A 1E3IA 3WWYA 3VYSB 4YUAA 5C53B 1EI9A 3EBLA 4U8HA 2QK4A 5C8YB 4V0SA 1SCJA 5KQGA 4OLJA 2VAWA 5TC4A 3OWOA 2G17A 4IOKA 1IY9A 1A8SA 4RTMA 2Z4TA 3GH1A 3L04A 1ZNZA 5FBHA 3AV3A 8ABPA 4J3JA 4F96A 1ZGGA 2QXYA 3L18A 4RMNA 5DB4A 4MYUA 4C2AA 4ISCA 3PDWA 2V7QD 2QD3A 3V8MA 3DE2X 1C1DB 1XZMA 4L4XA 4WLUA 4YEDA 1PSDA 2R8RA 5E3JA 4ZHSA 1XWIA 3BXPA 1JIUA 2QE6A 4IAOA 4LMBA 4Q18A 3X1ZA 3EZ6A 3VNSA 1PBTA 1DT3A 1E7SA 1KVRA 4IQ8A 4MQ5A 5MGBA 2Y8EA 7REQB 4GLJA 1MG0A 2AJCA 3BAFA 2Y1CA 3EJWA 2OFPA 3JD0A 5BWMA 1YK1A 1VKOA 2O8DB 1LDNA 4UM5A 2JBAA 3WLOA 4WSOA 2VF5X 5KOJB 1GUBA 2GFHA 1KFJB 2I2FA 3STUA 1F06A 5A1JA 1XNQB 1BHQ1 1Z0SA 1RLUA 4LE1A 3ZNOA 1W5FA 4ZI7F 2WUVA 4O5OA 2X9GA 3KP1A 3LTEA 4YP5A 3CH6A 2P7HA 3AR5A 4WDRA 1AZTA 1PR4A 1QO0D 4ZOAA 3H42B 3RDPA 4XJSA 2B4TO 4Y6PA 5EVJA 5T64A 3BM5A 3TUIC 2A9VA 4YJGA 3BIJA 1NE2A 2DUJA 4BTEA 1Q92A 2XPCA 2OAGA 2ZUWA 4CEIB 1YJ5A 1E1YA 3MD0A 1SVNA 5IMSA 2OG1A 2PO7A 2RI0A 3ILXA 3PD1A 2W7TA 3B36A 3S29A 3IAEA 4MQEA 1JDPA 1CE8B 3IAS1 1PJCA 3IOMA 1JEAA 4FZRA 6GPBA 3AL2A 3G1UA 3M6LA 3N53A 4G5YA 3W4JA 1ZM2A 2A59A 1XDUA 1E3DA 2Z08A 1X8KA 3O74A 1GSHA 1EJ2A 1ZD1A 2FP4A 1GAJA 3AXTA 3BGSA 3ABQB 3ELUA 1P73A 3JVIA 1OMOA 3PNQA 5FO0A 2ICAA 1PP4A 3KB6A 2P1DA 1Z75A 1FJGB 2E3JA 1Y5MA 1KMMA 5KOYA 5I7UA 5JNWA 1RYFA 3PR1A 4DUGA 1YDMA 3T7TA 5BN3A 2HPHA 1RI3A 3MOGA 3Q5EA 1Z2EA 4MUMA 4J3NA 4Q48A 1YOBA 5LWQA 4MRPA 2PIDA 4YIKA 1JWBB 5E1OA 5F1PA 3SX4A 1ZVJA 1QFMA 1QYVA 1FXSA 2XAAA 3JVVA 4G9GA 4FKZA 3S5UA 1CYEA 2GTPA 5IPFA 3RT1A 3B1ZA 2PVCA 5KSYA 3AVQA 1CHDA 1UP6A 1F9EA 2QX7A 2D5IA 4IEEA 3K15A 4U9IS 5THXA 4L1KA 2ZRLA 1CUFA 1Q6ZA 2NVUA 3MA0A 1SA0A 2FZEA 1RWMA 3KSAC 2O2CA 1WOYA 1X7HA 3AR4A 4I55B 4KVFA 1NP6A 2X7JA 1NJGA 1M2OB 1EUCA 3LXMA 2IOFK 1ULZA 3G17A 2BKVA 3HN6A 3OE5A 2R3SA 5DK4A 3H17A 4CEHB 5H3CA 3NAZA 1HE5A 1T9HA 1NG1A 1KPGA 4CMAA 5KTNA 1AKUA 4R98A 2GM3A 4CE6A 2DR2A 1W87A 1TU0A 3UAGA 3NXSA 2V7VA 2YYAA 3JWPA 5SV2A 3KDAA 4G8BA 4WE3A 3FPLA 3B1YA 2ILVA 4ZPXA 4D8XA 2MWMA 1IOVA 2GSDA 2V0GA 5KNDA 1MIOA 4ZEXA 5C8YA 3R8FA 1E7RA 4ITVA 4L50A 4BVJA 2EF0A 2I2AA 4ZAWA 3N0XA 2BFNA 4FFDA 1IBKB 4U4AA 1IN6A 2VEOA 3L43A 3OHMA 4GRAA 3K31A 1FA9A 4H1VA 4LJYA 2IHZA 1GILA 1CUEA 3T4UA 2JI6A 1U7OA 1C3JA 1XRPA 3QA3E 4NDNE 1GPUA 1Q1AA 3IB3A 3DW3X 2CHFA 4MYTA 1ZI6A 4RJIA 3RBZA 3IIKA 2A2ZA 2PV7A 3SKVA 2WQ7A 1XTSA 1CUZA 3A26A 2L17A 2V1XA 3HDJA 4IICA 5ENZA 1RQ7A 2CJWB 2VF2A 3D59A 4UVDA 4AX4A 1CZRA 1TA0A 2BM1A 3WRXC 5KINB 3AKZA 1YRLA 1M0WA 2ERCA 3QXGA 4R54A 4BWFB 2X22A 1PNVA 4L4ZA 3A25A 2B7CA 2OWDA 3G5UA 1PKXA 1FUIA 2I2XB 2I9PA 3RFUA 3JD4A 2VJBA 4HPXB 3RABA 3UXHA 3VR6H 1JHQA 1X8JA 3M0EA 1G291 1QHFA 5CA1A 5TMDA 1E1QA 3D5TA 5AKEA 3LKVA 2VLBA 1ANKA 1CQPA 2WTBA 1I3KA 4HLNA 4PZDA 4XSGA 4IXTA 1FLDA 1QM5A 4D4KA 1P18A 5SY4A 4X3CA 4MV0A 3GDGA 4KQMA 1IPFA 4R3UC 4KWEA 3RT7A 3V4SA 4AUMA 1FXUA 4II3A 2JJ1A 3AV0B 1TMOA 1EFPA 1EFUA 2XBMA 3KO8A 4JC5A 4E32A 2BF4A 3B1VA 2M98A 4P4UA 1TZ2A 1QG2A 4UM9D 4YCNA 1IG0A 2E0IA 3SJAA 3I01M 5B4TA 4X8LA 3LO5A 4LSMA 3GRZA 2BI4A 4BVLA 1KGSA 1EFLA 2UAGA 3RRYA 2A78A 2P2CA 4WCFA 3DQZA 5LUBA 4DCGA 3SQXA 2R65A 4WOKA 4V0NA 4PPFA 4PGHA 1XFAA 3JSXA 3PUZA 2PKQP 3R7BA 3OT5A 3VH3A 5IVHA 4L78A 1JFFA 4MVJD 1JLKA 1ZNXA 4UOQA 3I2JA 3COZA 2NTYC 2Y92A 2H48A 1WMAA 2R6DA 2PUJA 5A05A 4MS1B 3WMRA 2RH4A 4LXHA 1W36D 1PNOA 3QP9A 2I8AA 2QHXA 3BWMA 1E2BA 1E77A 1M34E 1QG6A 2ZS7A 1OAKA 2ORED 3E3OA 4WX2B 1OE0A 3EC7A 5EUBA 4BP1A 3I28A 1RAAA 1UBLS 4CIXA 1BS9A 1CVLA 2CL5A 2HF8A 3OP1A 4IX1A 5A7GA 4GOND 5C8XA 5ITZA 1KOJA 2MINA 5REQB 2LCQA 4BO1A 4D92A 2XZOA 4L74A 4YUVA 4TXJA 3JATA 4MHSA 3TH5A 5IXYA 4QE3A 5EMLA 2L82A 3A06A 3QUBA 4UD6A 2Z6AA 5KX5F 4BWGA 4DOMA 4XDGA 1CKEA 4E1AA 1T5HX 1Y1KE 3C87A 3ZPXA 4EDHA 1CUYA 3FHJA 3RRNA 1A9ZA 1XZIA 2J6CA 1F8GA 3AIOA 1REQB 3JZFA 1VJRA 4UUPA 5DLYA 5FFFA 1JR3D 2VYCA 2Z5VA 4KN8A 1JU9A 4X61A 4C29A 2X7XA 1C3XA 4QXOA 2C29D 1P39A 3RYIB 1AS0A 5DTJA 1DKOA 2OZPA 5DXAA 5FXMA 1ZXXA 3C6YA 2OYCA 1TVMA 4FLFA 2FSUA 2MR5A 3I9V6 3O95A 3CJQA 3ITEA 3MLAA 4RA9A 4YUYA 4HGOA 2PBLA 5JMTA 2VPTA 3SQDA 4XGKA 1W5EA 2EGGA 1ZNQO 2XVAA 5AKYA 1OV4A 4NZ9A 3OT4A 4X41A 3R0XA 1Y6RA 3IMGA 1FL9A 5CNJA 3G7NA 3E82A 5DU2A 3UKOA 4RWZA 2FVXA 3WYCA 2YDYA 4AWBA 2BBSA 5JMOA 2K7ZA 4WWHA 3VPDA 1D2MA 1RE1A 3E8SA 4EFNA 2W90A 2AJBA 1ORIA 1WO8A 2DFTA 3DCIA 4QEKA 3P4YA 4Y2JA 1I6MA 4HN2A 1BN6A 1GT91 1NF2A 3HRKA 4DV4B 2EQBA 3ZV3A 3KV1A 4GKAA 2X0IA 3HJAA 1DWPA 3N6XA 3CZMA 1EWTA 2AJ8A 1LI4A 1MC1A 4YJ2F 4D57A 1V3VA 3O21A 1R18A 1U3CA 2YJZA 1PD1A 1RYNA 1L5GB 2CB0A 3GFPA 4F4JA 3GLKA 1FP4B 3HUFA 3WXMA 3KVYA 1MAAA 1PL0A 3O8LA 1ACMA 2GXQA 4N39A 4A6EA 3B52X 4B40A 2PHZA 5HIMA 1JJFA 3DW1X 5ECYA 4GQIA 5EA2A 3IJEB 1IMJA 1KYTA 1FMJA 3T8YA 1E18A 1PYDA 4WECA 1L5ZA 4G85A 3WRYA 4GVPA 4DMCA 4ARAA 3DZCA 1GRQA 3CNLA 1FJXA 5G2OA 2CSUA 2D59A 1P0FA 3QE3A 3V1YA 3W2IA 4LRXA 3QE4A 4FGZA 1V1MB 4DKXA 1KDYA 1YR8A 2NZYA 2J4DA 4BMDA 3A6ZA 2Q1TA 3C39A 1UM8A 3O8BA 2ZULA 3OQHA 1M2EA 3ZJ4A 1E64A 3DT9A 4OF4A 1BDJA 5M3BA 4AP6A 2D2XA 2FPSA 1ZOIA 4YT2A 1RIFA 4MW6A 1MN6A 2CDBA 1TTPB 1BMQA 1JZSA 1PGQA 4IDEA 3S1AA 4EJ2A 1DC6A 3LHIA 1IC6A 1IHPA 2FWBA 1F2UB 3I23A 3N7UA 1CZKA 1RM0A 1FK8A 1Z47A 2WMNB 2WUGA 4IIJB 3ZXUB 2AZTA 4JT9A 3SSAA 1P77A 1EWRA 2Q1WA 3P2YA 1ZNWA 3K0FA 1U80A 5BQFA 2JAHA 4HWSA 1SU6A 5DNEA 5FCDA 5KB3A 1FC0A 2VYVA 2ZUSA 3JAMA 4KWCA 4HR7A 5H81A 2H4HA 4K9MA 5CG2A 5MDHA 4OGWA 1S1CA 4ND1A 1WDWB 3VBEA 5GV8A 3QV1A 1X70A 2VNSA 4PF1A 1T5IA 4N48A 4M0LA 4MS1A 2PZKA 1ZGZA 2BLLA 4PZPA 3T9CA 3PNBA 1GOTA 2G5PA 4NARA 3H75A 3VOAA 2SKEA 3D4LA 1YV9A 4L73A 3TRJA 2PWPA 5JDIA 1PFQA 4EI7A 4B74A 1J00A 1G21E 1RAEA 5EWLB 1B0UA 1JHDA 2IEAA 1DWQA 2REQA 3AL3A 5F35A 3KX2A 4U2CA 2CF5A 3BK1A 3K0AB 2WHYA 3OQMA 4BXOA 3IUBA 2XNJA 2NZXA 4KQXA 4XX1A 2C2HA 1GYQA 4B6PA 5AXAA 4DQ0A 3OX1A 1W35A 2Z95A 4JSTA 4KO4S 3ZWVA 3UWPA 2X1HA 3W2FA 3Q8MA 2FPPA 2IUTA 3R1IA 2ZVJA 1C0EA 4FW8A 2VVTA 4O4IA 4QAQA 1FFYA 3QEBZ 1HFWA 3QOYA 4I3HA 1C3EA 1R6TA 2HH9A 2OECA 4XOIA 5DTQA 1GTSA 2A9OA 3QPBA 2QPTA 1Z6ZA 3AF5A 4FFWA 1N92A 1GAWA 3ZCUA 3AG5A 5G40A 3NXKA 4B3MB 4AP9A 5CB6A 4JJKA 3VJRA 1JLHA 1H8HA 1RWQA 2F00A 2LV8A 2R7LA 4J1TA 4WOJA 4S1WA 5CB0A 2BR4A 2I8LA 3L84A 3USES 4KQCA 1P9NA 1DZIA 4BNDA 1BJKA 3C8UA 1AKYA 5K3FA 1MJHA 1EJ0A 2PZMA 3JVEA 3NHWA 2Q1YA 1UBSB 2MSEB 3H9QA 3ONVA 3P96A 4IIXA 2VPYA 4DCTA 4Y2YA 2RGWA 3CSUA 2VN8A 1ZQ1A 2AG0A 3FUXA 3T0GA 3B1KA 2ZJ8A 3AHHA 1TCCA 2GUWA 4B5KA 1N0VC 3WGZA 4AAYA 2B83A 1DDOA 5JAZA 2EJUA 2FMFA 3QBJA 4COKA 5J47A 1WLYA 2W6CX 2DFKB 2IZ0A 2EYQA 2VHXA 3DS8A 4Y30A 4BO9A 2PUGA 2O8EA 1ESMA 1JLLB 3F6RA 3GRRA 3JU3A 4ON9A 5DWQA 1DJQA 3ZE8A 3LX4A 4M1TA 3TS1A 4PNHA 3DDSA 4Q6BA 2XUDA 3VYVA 3NP7A 2YY6A 4WFQA 1X94A 2E87A 2YWXA 1QS0B 3FNGA 3MJHA 3O8QA 5CNIA 3WGKA 3F3KA 5IM4F 2JK1A 2XTMA 4WK2B 3TLBA 5LJLA 3PD7A 2UYYA 1PWHA 2XUIA 2ZVDA 2OA0A 5DGHA 3P9XA 3SLKA 5DP2A 3HGMA 2WZBA 3CSDA 4C7MA 5IASA 2TSYB 3IMEA 2YOHA 3P9QA 1N8KA 4YACA 1WW2A 1Y4DE 1SXQA 3VR5D 4ZYTA 1T3GA 1TZKA 1XVAA 1DRUA 1L7MA 3TSYA 5EIBC 5BSEA 2HSGA 3L7AA 3PEYA 2ID7A 2R8OA 3K1JA 5C5EA 3PNOA 3GLSA 5LP6C 1YUNA 1XVTA 4EX6A 1CP3A 4EYEA 4O8ZA 5IVIA 3AOGA 3D6VA 4FFLA 1S2OA 1B3RA 1UDCA 4DMFA 2NO0A 1LI7A 2RI6A 3FI0A 2O7QA 5EIOA 5EKSA 4I1IA 4L27A 2P5TB 4ICIA 4EPXA 4KP7A 5T6BA 3VSEA 1X7GA 1UL1X 1SHJA 1OXKB 1YDHA 1N4DA 1P4AA 2XA2A 3O3OB 3K9BA 4LE2A 3RANA 1F2UA 3WNQA 1ISRA 3VJLA 3FZYA 4WNCA 5DISB 4BX8A 4F2GA 2IEGA 3IDAA 5DX0A 4MQBA 1HC7A 1ZIYA 1P6UA 3QU9A 3BWDD 1U65A 3OECA 4ZQBA 2V3CC 1U0NA 3CPSA 3ORSA 4L0MA 1A27A 2PSFA 2QYSA 4IWXA 3FDXA 2CFTA 3QK7A 5D5PA 4IMRA 1CEQA 3I9MA 3ND7A 3Q10A 5G53C 1YIDA 3LVQE 5IAKA 3HDYA 3VI4B 1BEEA 4RJTA 3LPNA 4TRMA 5I45A 1PFKA 4AUKA 3SHFA 4YV0A 2AFVA 3L7MA 3UJ9A 1P7VA 1LRKA 3GUYA 4CEJA 1SBIA 1ZIOA 2W6MA 1F8UA 3UICA 1FDWA 1B8PA 1KSJA 1W85A 4W1RA 2XRZA 1V6AA 4FBLA 4QG3A 3EEOA 2QY9A 3GG2A 1ZAYA 4P8RA 1NDQA 1V8ZA 3BHIA 1UKZA 3ZTTA 3DVRX 1Z5UA 3H5OA 5AESA 1OZGA 4JQYA 2H54A 5D00A 5KKNB 2QRJA 1O0CA 4PGAA 4RZXA 1RKBA 1U31A 1J0DA 1UCFA 2OK8A 1X1BA 2WUFA 4I4CA 1QCYA 4EKDA 2QQ0A 3EA5A 3ICWA 3MFQA 4XE5A 1M8JA 2VZLA 3IDOA 4KH1A 5L45A 1IMOA 1Q16A 2Q5EA 3C3DA 4IH1A 4GVXA 3VU0A 1XXHA 1KJ9A 3G02A 3PS9A 2FMIA 4II7A 4JJGA 3TF5A 3OPYA 1IYZA 1YIOA 2RHGB 3U9SA 1RE0A 2P6MA 2ZJ6A 3PICA 3ZZUA 4X1YB 4N0EA 3GPLA 2YUIA 3ONFA 3UATA 3BKWA 2GZ2A 5SZJA 1EUYA 3SJUA 2IZ7A 4N7MA 3LY7A 4QUIA 4N0MA 4D8UA 2JFYA 4EPYA 5EHGA 1UJ4A 2FRDC 5HOEA 4C22A 4TKUB 1QMGA 3G2MA 3WYAA 2D0PB 4YMTA 2VZ8A 1S2MA 2FN4A 2H29A 2NZ8A 3BWCA 2NUBA 1R9GA 3EB9A 1XQYA 4KQFA 1BMFD 5IG2A 5EQTA 3AFGA 4II2A 5KYTA 2WPDD 4PR0A 3T15A 5DDIP 1QG0A 1XCBA 1YRHA 1C3OB 3OPMA 4GOOD 4MIYA 5E8JA 3ZD7A 3H8JA 1ADFA 1TKBA 3MUNA 3NHLA 4OXRA 1NP7A 2FPLA 2WJIA 1C4OA 3DAGA 4R2WA 2AFHE 3V1NA 1LFDB 1M1YB 2ZB2A 1EWVA 1E5DA 1PJAA 4KJXA 1T35A 4GNRA 4RPGA 2ILTA 3D43A 1XTBA 4YECA 4ZO6A 1ZRSA 1EP2B 3E4DA 4JLSA 4MVXA 5EXTA 1Z17A 4CQMB 4ZCPA 1A8QA 3U13A 4A0RA 3C1TA 2YC4C 1XP8A 2Q45A 3QWFA 4W7HA 1M8KA 1NRJB 3HCCA 2ZM6B 4OM8A 4N5DA 5U1PA 2TMDA 1WSAA 4YT5A 3W0LB 2JVJA 3FB4A 5AM3A 1GEGA 3SDZA 1RI4A 3L5KA 4QGAA 2NYUA 3V7NA 2PGOA 4AK9A 4WESB 3THWB 4C4PA 4MGEA 4EA9A 2P27A 1CP2A 3LLUA 1AY0A 3MAAC 4IVRA 5I9BA 5E6SA 2RKWA 4CL2A 3BJEA 4G5OA 1EM8B 5J4YA 3WGIA 2AWNA 2ZIAA 4WCDA 2P0YA 5LMCA 4ZKEA 4KO8A 4CIWA 2CXQA 1TQ6A 3OH8A 1QE5A 1QV7A 3ETHA 1EWKA 3HYCA 4HN4B 4GSYA 1VMIA 3DFMA 3DLTA 1XPOA 3I0NA 1Y8QB 1NY6A 4LJAA 1QP0A 1MA0A 2FCRA 4G5RA 4PC2A 1QGOA 3VC2A 4OXQA 2A1UA 1SC9A 1H4VB 2JCVA 1FB5A 2BSAA 1K6IA 2WF5A 5SZIA 3RYFB 1AQUA 1UQRA 4AYXA 4DA9A 2ESRA 3SEFA 1FJHA 3T3PB 4LBVA 5BVHA 3KJFA 4WCVA 3QUCA 2GXUA 1HG1A 1L7QA 2R8BA 3ISJA 4RD2A 4R01A 2P9FA 4PW0A 1N6OA 5LQAA 4CTMA 1R12A 2ZPAA 4UAVA 2JKZA 1PNRA 1C8VB 2F1KA 3QMWA 3IXMA 1PYGA 1NLUA 2Z3WA 5CXSA 1EUDA 3I73A 3QJ5A 1NVGA 4N41A 3GEDA 1C80A 3R3ZA 2DX7A 5JCZA 1W6RA 2IV7A 1GCGA 2WKSA 3FPFA 5ELLA 2HDHA 4F92B 3E8XA 2F1IA 4CW7A 4DIEA 4C21A 4LGMA 5JECA 4O8CA 1L4UA 3MMXA 1YVEI 1K0UA 5EJ4A 2BHSA 5B6PA 1BGXT 1TYBE 3FM9A 3DHWC 1VA5A 2YMPA 3P71T 1LVGA 2CE7A 2P3OA 2WMOB 3GR6A 4K86A 4KLRA 5JC8A 4RTOA 3Q1KA 4F86A 1Q15A 1FYXA 1T8RA 2PWAA 2C20A 2RH9B 4MUHA 2Q5LA 1CPYA 5K8JB 2AUTA 1UPUA 1DI0A 2POQX 1LFAA 2ZTSA 2GEUA 1A04A 3CBQA 1WW8A 3TZ6A 2L0XA 1QVRA 2H3HA 4LRYA 1M3SA 3NOVA 1V7CA 1WL8A 2IIVA 1L5VA 3FB1A 1T4CB 4NEQA 3RS2A 4AJIA 4E1VA 2R2AA 1JGTA 3WTBA 4BRWA 3TBKA 3I45A 1NLFA 1ZMRA 1OJ7A 5JVDB 5KQLA 4HL6A 4LHSA 2V45A 1I1NA 4OPMA 3FKSA 5ESDA 4X1YA 1ID8A 4E4TA 2XCOA 3IV9A 1JB1A 2IYFA 3NM5A 3ROMA 2VJMB 4R83A 2ASVA 4GI1A 4ENPA 3LQQA 2EIHA 3RJTA 3TVDA 3V8VA 2HPAA 1N78A 4WVLA 2OCYC 1NVUQ 3NBFA 3EWIA 3GDOA 4QTUB 4GOKA 1RBYA 2PVSA 3E5NA 4N6NA 3PGXA 4ZO8A 1KXZA 4HGQA 4XWAA 3SAJA 5AM5A 3W6ZA 3O93A 2G88A 2HEGA 2X3FA 3HFGA 4RV5A 3RV4A 3RUHA 4A8HA 3ZCPA 4BNWA 5JXJA 1C3OA 3QKRB 3K3PA 1KE1A 2O9JA 3V9AA 2RBKA 4HCJA 4TN5A 2B1IA 3RQSA 4E31A 3LY8A 3V7FA 1KZ6A 2Q1UA 3H6HA 5G1NA 1AA9A 3GJ7A 3FVRA 1DP4A 1PS9A 3H2IA 2JIOA 3LC7O 3GJXC 1PHRA 3DZGA 4OQ4A 1O5OA 3AZPA 1G5IA 2GF9A 4LJLA 1RQLA 4DNPA 1D03A 1XZLA 5A9SA 4K9DA 3CZ4A 3D3EA 3N9IA 4IFIA 2A4KA 4ZCTA 1PW7A 1Z8DA 3R7SA 3WLIA 3M3PA 3UMVA 5JNVA 1NZFA 1UXGA 3VTZA 4KU4A 4Z3DA 2J9ZB 4J2HA 2ZSHA 2D2IA 3N8IA 1ECLA 2O52A 2WZCA 4KV7A 1C7IA 1KZYC 3HKBA 1G5RA 4OM7A 3IX7A 1MMFB 3REQB 4W9MC 5JE8A 2I2CA 4RK7A 3HCRA 2W83A 3E3LA 3AR2A 4MEJA 2EBHX 3CTPA 4QYMA 5EUQB 3V2IA 2XVZA 3LUBA 4S35A 5BWBA 3AM5A 5EXDA 2PS3A 5AHWA 1YKSA 4WA8A 3FYSA 4H4CA 3IT2A 3CX4A 1CY6A 4LCJA 4OU4A 1PTJA 2AH5A 3KG2A 3MC1A 1E9CA 1CG6A 1PR6A 4M8KA 5T3UA 5IVPA 1LVHA 4TTAA 3ZHZA 3A4VA 3IPRA 4WKGA 4A8TA 2HHHB 4MWEA 3TWOA 1RRPA 4Q4AB 3EXHA 4WLNA 1BHSA 2DFVA 2AOUB 1W59A 3GGOA 3AR8A 1O58A 4K3UA 4HYQA 4QOJA 3PXGA 1XZDA 2LBPA 3TM4A 5EUMA 1U7UA 1Z29A 2QN8A 3MGAA 4RSGA 1E89A 1UXIA 3VR2A 3WS7A 1RLMA 3K5WA 1NNLA 4IDQA 3X44A 5C32A 2ZYDA 2J9FA 3GIWA 2ZG6A 3LVFO 3SXUA 4D7AA 4E4RA 1V1RB 5FL7D 1U1GA 2J8ZA 3ABOB 3VH1A 4Z0NA 4TVSA 4BJ3A 2RHBA 1ZOPA 3I04A 3MIZA 4QNNA 4LPSA 3OI7A 1Z18A 1SUSA 4TS9A 1IJKA 2AJTA 3ABRB 2YW9A 1TW3A 4IG4A 3WKCA 1SQSA 5FLKA 3G9XA 3PKJA 4GAEA 3RVKA 1UADA 1II8B 1L3IA 1AQ6A 3F74A 3M5DA 4JJ7A 3TL2A 2VDVE 1TQDA 1R5JA 4AXBA 4BFTA 5M34A 1UANA 3O4FA 2Y71A 3VX4A 4PYJA 2WJPA 5JNUA 4R16A 4A91A 1ZK0A 2YH2A 2VRNA 4XLLA 3QENA 1F48A 1K88A 1JKIA 3F98A 2BWJA 4B0PA 5K0CA 3ACBA 4D4IA 1ZZEA 3GDHA 3O8NA 5I8ZA 3HZZA 4F97A 3TGPA 1U3FA 1YB5A 3BB1A 3HY6A 4WY5A 2E2WA 4XCVA 5JCPA 4TLBA 3L7LA 3N2GB 5ILQA 2DFNA 3UQZA 2HU5A 2XOKD 1ELOA 1H05A 1U0LA 1QGUB 1UDXA 1N9ZA 1V5IA 2EW2A 3CEAA 4RHXA 1IEQA 5C8ZA 3P2JA 3C14C 4IX9A 4DCNA 2BEVA 1G0OA 2CMDA 3KTOA 1HNZB 3SPXA 2XODA 3JY6A 1XD2B 3PEFA 4F3TA 4H08A 2CEKA 2I62A 4HDQB 3AR9A 2CZCA 3T1VA 4MKGA 2GJSA 5KTOA 1R8JA 4WERA 1EXDA 3PFIA 4BKRA 2Q3CA 2QE7A 4ILKA 1DIOB 1TYDE 4E12A 3SDSA 3VKHA 2HPZA 4Y0NA 2ATXA 3I4CA 3PXDA 3KT0A 4LCBA 3RU2A 2JEOA 3HRIA 4HNRA 3LIPA 4RF4A 4B3XA 2XYVA 4BB6A 1PLJA 3Q12A 2PPVA 3JWIA 4K2HA 4XB6B 4Z9FA 4X7PA 2D1SA 4OMDA 3MJSA 2HQ1A 2ENUA 4WMLA 2WIJA 4QICA 1PK9A 1QCCA 4G6ZA 3F8WA 3CM0A 2HOQA 4MVJM 4RANA 4S05A 1JAHA 1FS4A 4IWNA 5BRNA 3D8UA 3L02A 3FDZB 3NUGA 2XLCA 2HF7A 2ZI9A 4LKRA 3KJHA 5TSDA 5A5GA 4ZO7A 3KQNA 5FPQA 5HPYB 1DRJA 4ZKDA 2BY4A 3OZ7A 4ZOEA 2Y3IA 2V7EA 4BX0A 3O7MA 5TXGA 3UJ7A 3D0KA 4JKYA 4R6WA 5B2FA 3C70A 3CONA 3V4ZA 3E8MA 3DOJA 1O5TA 1Y0BA 2HV8A 2X77A 4JLJA 3LQYA 2CXPA 2PMDA 1P1IA 4AMUA 1CEYA 4JVSB 3AFIA 1Z38A 1CQWA 1WMEA 2G3YA 4RA6B 1BGWA 4I6JA 1T1JA 2M6RA 4UHCA 1FF9A 2LPMA 3BXHA 3CNOA 3B5EA 1WMSA 2D0OB 3A7EA 4NCKA 5ADWA 2J30A 3DPSA 4HVCA 1DGQA 2JHPA 2XBUA 5HIKA 3TEFA 3DD1A 4OK5A 4UPDA 3Q3VA 3WLEA 1VRWA 1G6HA 5AXBA 1P1RA 4Z2AA 3NZEA 6YASA 2B8JA 1TE2A 3MM4A 4GI5A 3DJYA 5ALWA 4RDHA 3PGVA 2OYRA 2E1PA 5DE3A 3COVA 3G8YA 2FR1A 1U8AA 3RSGA 1S9DA 3BF8A 4FHCA 1N0IA 5K3CA 3LQ1A 4HNGA 4RETA 3RAGA 2VSNA 3TNDA 2IDZA 3M8KA 1DJMA 3F1LA 1KZ7B 1BKDR 2NACA 3ABZA 3T7DA 4DIDA 4HWRA 3C4QA 2BGNA 1JZQA 2DHDA 2W2NA 1CR1A 5AI4A 4QZVA 3F7TA 4RW0A 3UB4A 1HTWA 3QVWA 4BN4A 2Q4TA 1B1AA 2YW2A 2UYGA 3K1TA 3KDPA 5GONA 4B3IA 3RGWS 2OC9A 3IQEA 2QV0A 4BVBA 3ZDAA 2ZRKA 3AHFA 1HNXB 3G0CA 1RXVA 3O1IC 2H52A 3UPTA 4PC6A 1HH4A 1AQIA 2NT3A 3GLHA 1ZW1A 2PJRA 3NUQA 1HX7A 3NP9A 3DZJA 4Q1AA 1AGNA 2WU4A 3DO8A 4DDTA 4UVEA 2VT3A 2E1RA 3RYHA 3VUFA 1PGNA 3KRTA 3LT5A 1B2LA 2CXNA 2VNHA 1NPDA 2EEZA 2QD5A 2R8PA 4NTZA 1K5GA 1I1QB 1G4UR 2BKEA 2JJMA 1ZSNA 3BWBA 3I6YA 5AW4A 5AI5A 2IUUA 5CFLA 5KVAA 4UDOA 1DEAA 2H8KA 3MTAA 5K6TA 4EI2A 4UAUA 1FMTA 1R5OA 4Z3KA 1KZ1A 5FBZA 4JOSA 3RUEA 4QTZA 3AJ8A 4B3CA 3COYA 2HT6A 3KZ1E 3Q0EA 4W9NC 1QYWA 3L7DA 4C5CA 4XVCA 4UAGA 1XD2A 2OILA 2JRLA 2G0TA 5FR2A 1KI9A 4B0OA 4DEYA 1M5TA 3M9WA 4E11A 3JYQA 5DM0A 5FBWB 2Q0QA 1DZ3A 3DC7A 4C5BA 2V8BA 1E2GA 1TZMA 3OQIA 4U2GA 3GEHA 4ZODA 1QUEA 2IHJA 3SP1A 2G9ZA 2CHGA 2ERXA 2P8SA 4FHGA 4RFSB 2EJWA 5FIUA 3WLJA 3O8CA 1J25A 3CO0S 3Q2IA 5K3AA 3FSJX 4U7HA 4J0CA 5L4LA 3AHGA 5ALOA 3QFHA 3UJCA 2GEDA 4LK2A 1BA3A 4D3XA 4MTCA 3VNRA 1O4VA 1GG8A 2RGRA 2C31A 1G3MA 2A5GA 2R4UA 3OU2A 4JBIA 4HFJA 1TVEA 2WVAA 4PPYA 4EDFA 4RTKA 5JDCA 4OUDB 1XEXB 1GJRA 2CUKA 1JEJA 5B37A 3WDMA 3S8MA 1IJEA 3JQBC 2NWQA 4JKOA 3O84A 1U3WA 4W1QA 2I2BA 4ZYXA 5C8DA 1KDPA 1RJGA 4G5SA 4DNQA 3I72A 4L2IB 5KHOC 2IA5A 4MQ6A 1IJBA 1BXZA 3G2QA 4GZMA 5FWYB 4JUIA 2HDWA 5CJJA 3TAXA 3TIXB 3ZE9A 1J0EA 4C6SA 3PQ2A 2ZYIA 2BGIA 4ZN6A 2IW1A 5DKFA 4DMKA 4I9HA 3W2TA 1MGOA 2ZIVB 3H3JA 4ZOBA 1GVHA 5FLEX 5AQ1A 4N47A 2YIJA 2VZEA 1FBNA 2JCBA 1E1RD 5C80A 3TTWA 1M6VA 1S8FA 1TUBA 1A2OA 4OA5A 4QL3A 1LKZA 1WVIA 3F6EX 4LOKA 1MPTA 2P11A 4X1KA 2HC9A 4H6VA 3LK7A 1FNDA 2IYRA 3W2EA 4B44A 3LNTA 2J9YB 3DBHA 3WMGA 2HCTA 3RF6A 3EZXA 2HA3A 4LECA 5GQSA 1NBIA 2HJHA 4I4TF 4AZVA 2Q6OA 3A2LA 4OI4A 5I9MA 1EM6A 2EP5A 2J0EA 3KKPA 3L8DA 4BMXA 2YCBA 1ZHOA 5SYMA 3DVSX 4GP9A 1G41A 1PE0A 2FG6C 1GGVA 2OBMA 3LF2A 5EHIA 4QTYA 2PGNA 2ZYVX 4IUCS 1X80A 3H9GA 2ZIXB 3AUKA 5EJGA 4CCWA 2EIXA 5DYYA 3WNZA 5CDHA 2GKGA 2HBQA 2F1OA 1E4EA 4MROA 3KR0A 4J16C 3SGLA 4DQLA 3NH9A 2DJIA 2HWUA 4KR6A 4CF6A 4FUQA 1UJBA 3EDYA 2O8BA 4RF3A 4MHOA 3IRVA 3FYUB 1DO2A 1UXJA 2EU8A 4EG6A 4ECAA 1P7YA 3EMKA 1JDBB 3KPWA 3RK0A 3KWLA 2JH8A 1U1DA 4UPVA 3NVDA 2FSVC 1LGYA 5JLJA 3ENVA 1GZDA 3B1JA 5FUVA 2XCIA 4KI7A 1P9OA 3RD5A 4E15A 1FP7A 3AM4A 2VDRB 2PA0A 3WLKX 1KL7A 2FCAA 1GXSA 2HKIA 2WM8A 1S2DA 4NQZA 3WLFA 1W2WB 5LB4A 3IKVA 5A1TA 3B38A 1E2PA 3LPMA 4BTLA 4LJ4A 4CPDA 2P6UA 1FSFA 3V8EA 3DEYX 2Q5HA 4CODB 2C00A 2XH8A 1ABBA 5K6AA 2CCJA 2X6TA 2GBFA 4QTXA 4P3XA 2GPNA 2AXQA 2HRBA 2VC2B 4TQAA 3PEEA 2H11A 2QEQA 3NEPX 4R31A 1FBTA 2AX3A 1U63A 1UPAA 3ZX4A 4FNAA 3WNBA 1C5KA 2B4YA 5CT8A 5CTJA 3BT7A 3KLBA 4BZWA 1UMBB 4UULA 3T38A 1E1DA 3A10A 3FDJA 1T1RA 3HDTA 4NC9A 5IFKA 4MI6A 3KJZA 4NNJA 3NTLA 4G1FA 1C4XA 3JQ9A 3TTVA 4CWAA 4DEVA 1QCZA 2Q50A 2IX3A 3O8DA 5GVRA 4D5GA 5F98A 4AKTA 4AO7A 1QQBA 1YR1A 3EQ7A 2XQVA 1FNBA 2I3DA 2D62A 1USIA 2VJOA 4TYPA 4WXMA 2O7RA 5ERXA 2EG9A 4Z4GA 1XZBA 2EERA 1CY4A 3R5HA 5LD2B 1XX6A 4YP6A 2GNAA 4XVHA 4DLLA 5B7NA 4R1UA 1V25A 1QVAA 2NO9A 1F6DA 1JPVA 2O50A 3QTLA 4U7TB 3D7SA 2DBZA 1MB0A 1VFNA 1Z34A 2Z9BA 2FR0A 3OM0A 5EWMB 5FOSA 3WC4A 1EDEA 1O03A 2HJRA 4BNFA 2QTTA 3NAGA 2XE7A 4C4OA 1BVRA 2SCUB 2EJBA 1ONOA 3QF7A 1PNTA 1XD8A 2QUHA 4KGDA 2WWFA 4TMYA 2QLNA 1B73A 4Y67A 4Y9TA 4BKMA 4ES6A 2R0QC 2H2WA 3RVQA 3K70B 3IIJA 4IJWA 1VMKA 1ULHA 3ZLJA 5BSFA 1X19A 1P1BA 5FWXB 3MT7A 3R7AA 4HNAB 1JN0A 1W581 2VK1A 3FPCA 3A3KA 2VP2A 3CA8A 1OKKD 4K6OA 4KKVA 3VVBA 1RDFA 2FPWA 3Q3JB 4Y2TA 4NQRA 4QM7A 2HSEA 4P3OA 3J81k 3S2ZA 5JQWA 3V1UA 1BXRA 3O4HA 3QVOA 1Q57A 4UMVA 5CPFA 4RPIA 2CBXA 4EY6A 1HT1E 2H0RA 2IQIA 4ZI7B 3BORA 7ABPA 1XUOA 1LF5A 1OIVA 5A9TA 1RJ9A 2AMLA 2PUWA 2XITA 3BIWA 4JP5A 4RTNA 4JYAB 1HEYA 1PV2A 1ZK1A 5DULA 5FEUA 3K9FC 4D0LB 3ZE2B 2CXXA 1QYIA 4BQRA 4ALKA 3IBGA 4CM5A 4GBJA 3AESB 4GDFA 5L3VA 4JXZA 1YD7A 4LZAA 1J2RA 1WHTB 3I6BA 1XRRA 2GF2A 2PXXA 2VSXA 3Q8WA 1T9AA 4WLEA 1OXTA 3UT0A 9LDBA 1LTKA 3RVNA 4LA4A 3U7JA 1JX6A 1QAQA 2RHOA 4NU0A 1U0BB 2NG1A 4EQ6B 4M0FA 2BP7B 2VDPB 1BXGB 1K4MA 1W34A 2ZIXA 2ACKA 2R2GA 4RFVA 1AX9A 1H9AA 3EEFA 4XJVA 3KEQA 3JAWB 5TRTA 2HQOA 3KK0A 4DVJA 3WL3A 3K0KA 1H9BA 3AIKA 1SOMA 5BRAA 4M60A 1TJNA 2UVDA 2VT7A 4OHWA 5FHRA 4PHHA 5MFPA 4QGBA 5K0FA 1TFUA 2YYYA 1JF8A 1U9ZA 4MV6A 1V9CA 1E63A 3JS5A 2XUQA 4M0CA 5EJ8A 5JBNA 2OD9A 3STXA 1V2GA 3TL3A 1IUPA 1PV4A 3U4MA 1MT3A 4Y9SA 1D2AA 2REBA 1O0SA 3BCSA 4G37A 4Q21A 10MHA 1EFAA 4ENWA 2PUFA 2ZCJA 4RJ2A 5AM1A 1PJTA 2OENG 1S96A 4D9GA 4KR7A 1KJ8A 1XHEA 2J0UA 3NHUA 4NL4H 5TVKA 1NVEA 4GR5A 1Y8RA 5DNAA 3AQIA 3OF2A 4REQA 1COWD 4HX2A 2RC6A 3MJDA 4DCOA 1MF7A 4K2AA 4YIHA 4W8HA 2BFDB 2IHUA 1NI3A 4MMYB 3TXYA 5L7YA 1R9NA 4R1LA 3HCNA 2DTDA 4PHCA 2WHPA 2R1TB 4R2XA 3CG4A 3ZWCA 3FD8A 4JB3A 4A2QA 4YS6A 1OH5A 1ATZA 1MJFA 2RI1A 4RABA 2CLOB 5HDQA 2CVFA 4V0RA 1V39A 2BKXA 3DULA 1E2HA 3KLPX 3UAVA 4DR3B 1PL7A 3ZVMA 3BL6A 2C1ZA 2H0QA 4BX9A 3D4PA 4RULA 2JGLA 4QUHA 3UWOA 3LGXA 4EKYA 4A03A 4RFLA 3NBYC 3JQEA 1K97A 2VDKB 5FLXA 5DHFA 621PA 3WWOA 1BOOA 2Q7XA 3VZDA 1GWNA 3I9OA 3RUDA 3LUKA 3ZIDA 1OA0A 3O9MA 1AZLA 2KSQA 1EVJA 5BXQC 4V39A 2IYSA 3HNOA 3P9IA 4TLCA 3O0DA 4KNYA 5EQDA 2Z6VA 2CGEA 1KOLA 3DMHA 1PG0A 4TXLA 4QXRA 4FYXA 2FFBA 1VB3A 1P45A 3E2PA 4K40A 2EKQA 1TJ3A 4KBGA 5GMOA 1LQTA 2E5FA 3L1IA 4LF7B 2Z6QA 4W5NA 2WIAA 1IY2A 3F96A 4HDCA 1FDSA 4H0NA 4MPRA 5AW7A 1FRFS 2FE1A 3UCEA 3JQGA 3BMOB 4J0JA 2X0RA 1X7WB 4C7OA 1NHGA 1DBIA 3CCFA 4QDJA 1HKUA 2PUAA 3O38A 1KMIY 3UHJA 2GN4A 4F4UA 5IK2D 4KFRA 3GGCA 3KKNA 2BRUA 2H2FA 4FQ8A 4BBJA 5H4HA 4DC0A 2COKA 4YDHB 2CV2A 1XRQA 4LQLA 2VJDA 2AKAB 3U4IA 3L8EA 4LS3A 3R75A 3EF1A 3H2BA 4ZVUA 2X4LA 2MYNA 3VNBA 2VWQA 2Q6VA 5JSZA 4NNPA 1QRDA 4U7PB 1N2XA 5CHYA 3R44A 5KHLB 1KK1A 4UMFA 4PCUA 3A2KA 3QLUA 2HHJA 5FUMA 2IK8A 2X4DA 3DTVD 5KWJA 2X40A 1GTMA 4DV1B 2O8NA 3FJ1A 3OVMA 1X9GA 4ENRA 5KVCA 8MHTA 4CV1A 2RDMA 1GNPA 1WULS 1SXIA 3WDSA 4F21A 3TPCA 1G8AA 4XDYA 1O87A 1NVVQ 1SY7A 2J9GA 1TM2A 2DMRA 4MI1A 3ZBTA 2PDAA 3MS2A 1IN4A 2J0VA 1FDVA 2FWMX 2QVBA 2R6HA 3IDSA 3R7WB 3DXYA 3WL8A 4B8WA 4F71A 1BE1A 3B2EA 1A7AA 1S1MA 5TEWA 1ZUIA 4YXWD 2OV6A 1X2BA 3GROA 5FPHA 3IL2A 1U4OA 3K09C 3WRXA 4CCYA 2GK7A 3L92A 4HDMA 4U2KA 1E3SA 3HUTA 3SNHA 5H8WA 4YK7A 2BAGA 2Y27A 2GAJA 4JJAA 4EARA 5D1NA 3T7EA 2A4MA 4H15A 5DI3B 2Q27A 2AYYA 3W3ZB 2ZSFA 1ESZA 3O8OB 5ILGA 2CZGA 4BLQA 4CF3A 4BFZA 3G8BA 2FSSA 3ZV4A 3GRCA 4PLYA 3SSOA 4ENSA 1PJSA 5J1TB 5JWHA 1YQUA 4J1SA 4DLAA 4KZPA 4DS3A 4F9FA 2GPYA 1V95A 1U1EA 1T6YA 1RPJA 2IXBA 1WB5A 4HJRA 4FS3A 3ZUGA 4EHIA 3K7EA 1OASA 3T9FA 3GX1A 1UMDA 1OZAA 2DBQA 5C34B 4EY5A 4XTRA 5L3QA 2Y0CA 3C24A 4TQGA 5F2OA 3ESCA 3OY7A 5HBRA 3SHOA 4DIKA 1HYQA 3I6MA 1NJ6A 5K3EA 1G2OA 5AW6A 4BQFA 4MGZR 1GPKA 3HZOA 4UM9B 5IT0A 3OIWA 4ASUA 2OQIA 2CNNA 4PZLA 4UUQA 3BZUA 4HVLA 3KSRA 3UUGA 3DBLA 3WSWA 1SCKA 1YMVA 4R7ZA 4CYMA 4TPKA 5I7RA 4O4HF 1AMOA 1I01A 4BU0A 2A94A 4TQ9A 4C78A 4KR3A 1YS2X 3EIQA 2OP0A 5TPZA 2WD7B 4PXAA 3SC6A 3N8KA 1HR0B 1NZJA 2CDAA 2D8MA 2IEDA 2F1RA 4CMKA 2VDUE 1ZMTA 2H2GA 3E7DA 2BFBA 3O1HB 4B79A 3FMFA 5ELXA 3OZRA 5HTKA 4TWBA 1VTKA 2FWIA 2QM8A 2MU1A 2UZ1B 5TPWA 1AB5A 2Z2YA 3A9UA 3GMDA 3H4IA 4ZI5A 3TQHA 1W36B 3W5VA 1DV1A 4QODA 3PIRA 1UKCA 3JWJA 3C5EA 2BTOA 1NLYA 5I7EA 4QPDA 1NT2A 4HQFA 2MR6A 4TX1A 4YJ2B 5TY0A 3U31A 1QF6A 3C8DA 2ZTHA 8ATCA 3HI6A 3N2LA 2XMPA 1OYOA 1A5SB 2QX8A 5JHHB 3ZY4A 2I6SA 2WTMA 3KU4A 4A0GA 5HRUA 3I04M 4DPLA 1BE0A 1XTPA 1GG9A 2V7TA 2ZK7A 2ZSEA 2DT8A 3EF3A 3HSYA 3NT4A 4QJ4A 4ZAXA 1W1UA 3M5CA 5CVVA 1NOIA 2ZKLA 1QORA 1UOEA 2R00A 3E9CA 1H2EA 2BPOA 3HBMA 1PLLA 1R8YA 1CS0B 3UT5A 3EIFA 1KS2A 3F6CA 4UZSA 2GUGA 1FSPA 1ZVMA 4V24A 4TLAA 4CLEA 2DHEA 3AIIA 4G84A 4FFBB 5ALFA 3VQTA 2HI0A 3HJGA 4P4TA 3EODA 3E5RA 2Q8QA 2ZFUA 5D3QA 3M9XA 2RC5A 4ZAFA 3TLEA 1EK1A 5B58T 2OWEA 3WHLA 2HHAA 1VE9A 3V34A 4EVIA 3EPPA 1AG9A 1K9SA 3LUPA 3U09A 1JEQA 4R0VA 1OJLA 2XY4A 3I2IA 3M1AA 1ADYA 3IT0A 1OBFO 2H4JA 4JCCA 4B46A 4B7UA 2IU4A 2MCFA 1FFSA 4KAXA 1ZBDA 3NIWA 1JALA 5DW3A 3H3XA 1HTBA 2FPMA 1ECGA 3H13A 3MEQA 1NKTA 2PTGA 4E5VA 1TGVA 4RQUA 1A8UA 4X24A 4BO4A 3JQ7A 1L8LA 4FP9A 4JEUA 2ZTMA 2YASA 3EJ6A 1A1VA 1NV8A 2ST1A 1VJ0A 2KPOA 2O6LA 3AF0A 1IHOA 3CCBA 3MCTA 4P4GA 4W1PA 3M6IA 4EA8A 4ZGGA 3U44B 4EEXA 1SD1A 1IK4A 5IHPA 3T7CA 2OV1A 4NV1A 4ZVOA 1KY3A 4D9BA 1XZAA 1KEEA 4NCXA 2BFFB 4UDYX 2IP1A 2XKJE 3KFXA 4NCIA 4RTRA 1SUFA 4LDAA 4QDOA 1EB9A 3ZK8A 5F9HA 4IGAA 3QU2A 2PLNA 2R751 3IOYA 2VI5A 3GARA 3SLRA 5ICSA 4M7OA 3H4MA 4LWOA 5FA6A 3TRKA 1AGXA 2A35A 4ALJA 2QMZA 3QELA 2V3WA 1B6SA 2JAXA 3DF7A 3M4NA 5COBA 5C46F 3L0IB 2ONKA 4JYCA 1M1NB 4BO5A 2W00A 1GQOA 1TYCA 2ISQA 4OHBA 4OQFA 2ES4A 4EK9A 5HQTA 5CCBA 1EG2A 1EX6A 3GY0A 3UYKA 2FDCA 1OFVA 3P2KA 1CLUA 1Q77A 3QBTA 3E03A 4HUTA 3MHTA 4CTNA 3C4VA 4KPUA 1H6AA 5AVJA 1QIEA 4U2EA 3VHXA 1GU0A 1L5QA 5F7OA 2CK3D 1Q7BA 3NKLA 2WUEA 3QV2A 2C2OA 1I51A 1LCIA 3GJQA 3P0FA 4D8TA 3K8YA 1VBMA 2X3UA 1U6JA 3A1TA 1RW4A 3DMDA 2YXNA 3OTQA 1MVNA 4V0OA 5TMEA 1HE4A 3GMIA 1KWGA 3UPDA 2MTBA 2CDCA 3FHTA 2JGEA 3KQYA 4IO0A 5FUYA 1CD5A 4UJ5A 4LWQA 5TDHA 3BL5A 5LIRA 2PMFA 5AMXA 1NBOA 2V96A 4FX5A 3TSWA 3V2HA 5GIPE 3WRVA 2EEPA 1X8XA 5KAMA 1VYTA 4LTDA 1E32A 3NDIA 4D02A 2PFSA 2FMHA 3X2FA 2HGZA 1UK6A 2I7XA 2UDPA 4CKBA 4KPYA 4CM3A 2P9HA 4N0DA 5KPJA 1TVKB 3VR3A 2C2GA 1QHXA 3DAYA 1DAIA 2Y1FA 2P9EA 3GQBB 1Z45A 1BWQA 4UBKA 2Z8YM 1GCAA 3OIGA 4BBPA 2BGWA 1C29B 1DRVA 5CRIA 2I9KA 4ZU6X 2RHDA 1NQXA 1Z5GA 1J33A 1NVTA 2VBGA 1P5ZB 4PVDA 1KMHB 2PQMA 1MX5A 4F4CA 6ABPA 3VU9B 2JLZA 3D6TB 3RVMA 3MBKA 5CVCA 5DTEA 1ZN8A 4BFYA 4HD8A 1K66A 1JIXA 1U28A 3SC2B 3IAM1 2Z98A 3M3DA 3IE2A 2HQRA 4MGYR 4WINA 2EFEB 1OLUB 1PBNA 5IVKA 1QIJA 1K2WA 1JR3A 2PGJA 1B42A 2QM0A 2AK3A 4OLAA 4KXFB 3QLVC 4KTVE 2ZS8A 1YAJA 3D5QA 3LOPA 4R0NA 5IAGA 4EG7A 3DLPX 2EKPA 5DPMA 1ENYA 4WKCA 3ETJA 2H1VA 1WUKS 4UM8B 5ESXA 4EP1A 4F5WA 3FTEA 2CWWA 4IIHA 1NQWA 1TW2A 2A9KA 2AB0A 2Y2VA 1V7ZA 1OGIA 2Q28A 2OB1A 4HXEB 5JASA 1GRCA 2FWRA 1MZPA 7ADHA 2WKPA 1XMPA 3CFYA 3GPCA 3VFDA 1XIVA 1RCFA 3STWA 4QQFA 3AEQA 2QAGC 2UXDB 1JVBA 1O6BA 4B3BA 2C4UA 3PC4A 4WJZA 4BNXA 2DY0A 4Q1CA 4MQMA 4Z2YA 2A0UA 2EARA 1XJQA 4QUJA 2D1TA 5ALTA 3IVRA 5ES3A 5EKXA 1YRYE 2D74A 5CK5A 3AY0A 1SQ6A 4U5XA 1XTIA 2P78A 3ANNA 1ZJ4A 2GOYA 2YJNA 2ZYHA 4OD0A 3PCXA 2PU5A 4OQPA 4F5YA 5JAPA 1C50A 4YWJA 2WJ6A 2BFCA 1SB9A 2ZIEA 4TRNA 3IPAA 4GC5A 3EVFA 2R97A 3TDNA 2GZ3A 4CGYA 4Y9RA 3NOQA 1D6JA 1P0CA 4MCAA 1UPFA 1IVNA 4Q6WA 3AVOA 4KTTE 3SEQA 3TOXA 5IKEA 2WJJA 3HY4A 3AEZA 4HEQA 4TS3A 4YP0A 2J67A 3IAHA 5EMHA 1JMVA 4JP3A 4KIFA 5A4FS 3VR0A 3EPRA 3RLFA 1ZK3A 3UIEA 5J40A 1VIAA 3N58A 4JUCA 1MEJA 4PR3A 3SC3A 4EMUA 3QHPA 1QFYA 4A5OA 5A6VA 3ZHUA 4XWWA 3THOA 4U6SA 3MWEB 4JODA 1TCBA 1YWGO 5IEBA 1Z4PX 4RLHA 4DYHA 4J4TA 2VTBA 2ZZKA 1G8KA 3AQ4A 3P0JA 1YFZA 6LDHA 2AOTA 1H2WA 4YO8A 3RREA 4QDZA 3UEOA 1B16A 3GJ4A 1HFEL 3C6KA 3H11A 2GHQA 2VYQA 3QVKA 4LMRA 4WACA 5DHQA 3WV5A 4AJOA 1ENPA 2DRIA 1KGDA 1V8FA 4RZ3A 3VVLA 1X7YA 3FFWA 4M9UA 3I9JA 4LSGA 3NKVA 3RVOA 3U3OA 1QP7A 5G02A 4GGMX 1RJEA 5EAIA 2YJ5A 5BNWA 1D2GA 1G4HA 2WBLC 2B5WA 1MX9A 1R5NA 1TC1A 4UJ3A 3VR4D 3O9ZA 2FHSA 3GFQA 4MVJI 3EXIA 1KYIA 3QITA 1SBCA 1XZFA 1YBMA 1T3HA 4W6QA 5E1BA 2ZETA 5DN6D 4E5NA 1BKSB 2XCQA 2EBWA 4IDHA 3W5CA 4NR0A 3VC7A 4DA0A 1MJNA 3EGDB 1OYWA 5L4NA 2BC9A 4O2AA 1TVKA 2X0NA 3A04A 2G1JA 3IVCA 4KAJA 2DAPA 1GDHA 4GF5A 4UCXA 3ASZA 2JCSA 3U39A 3UXEA 3U5TA 1MB4A 2WWRA 4XDHA 4X6UA 5EZYA 2BGRA 1HDXA 3OHPA 4RM2A 1UMKA 1ZIPA 3OZVA 4IUBS 4P34A 4C0XA 2W2KB 2C84A 4GR4A 3QUQA 1V11A 4C7VA 4RGBA 1TTHA 3MZ0A 1Z33A 5LU8A 4UAJA 4OA8A 1OA1A 2KI5A 3VU9A 4BJHB 2JAQA 2VSYA 3NVKI 1MX3A 1U2RA 4WJLA 1H0KA 1E69A 5BV0A 3AVTA 3H1AA 1ZD8A 1HETA 2ZZNA 1UQUA 2GCEA 3LJKA 3FYCA 3W5HA 1OLUA 1OXXK 1EAMA 1X1DA 2HDNB 1XYVA 2KE5A 1IZYA 3GXBA 4FXPA 3HM2A 3ZDRA 4DIOA 5LP6F 4YRCA 2LTAA 3VZPA 4BWYA 3JALB 2WAOA 3NRCA 5CAEB 2A9JA 3GJ6A 3FHLA 4E07A 3UJNA 1T25A 4CL3A 3DZIA 1CUGA 4L0DA 3CH4B 1Z4LA 3QMMA 1BKYA 4ZEOA 1WOMA 1V3QE 1C9NA 3AW8A 3IHWA 2ID4A 3KJQA 4KN9S 4NCHA 1U2PA 5HE8A 3KKMA 5UKDA 1UODA 2EZ8A 3EN0A 1ODKA 1HF3A 1Q12A 2ZITA 1ZP6A 3EWNA 1VCOA 3P52A 2PUTA 1BVHA 4LGCA 1WJGA 5LLDA 2WT8A 2AZXA 4PX9A 1CW2B 4P7KA 3VO2A 2WSSD 1EXNA 4UM7A 1P0QA 3VPBA 4MQ4A 3RS9A 1L7BA 4BBZA 1PFWA 3ZJYA 3GLIA 4PN3A 1N2HA 1A82A 2XF2A 2DGDA 2QGNA 2CHVA 4KQJA 2J5BA 1QIDA 2HB6A 4YONB 2XWSA 5E9QA 3WLAA 4LF8B 3LKDA 2E48A 4M99A 2PRZA 3HLTA 5DVZA 2FPIA 1PVDA 3HK2A 3IIMA 4JWKA 1VFPA 1R6DA 3SBOA 3K94A 3WGOA 1USGA 2IX9A 3SQLA 6CHYA 1JNXX 4ZJUA 4O2AF 4X6YA 3VR5A 2JZCA 1GLNA 1QIMA 1NW8A 1RPTA 2PRJA 2QN1A 2VRCA 4GP6A 4K5QA 3ZYCA 5IUNC 3OG9A 3QMVA 1NMEA 1KI3A 5EZYF 4RCYA 2ZAGA 3DNPA 3W8DA 1NQUA 4QUDA 2YHIB 3JZIA 4M88A 1MV5A 2BCEA 3MS4A 5FAXA 1DL5A 2DJ5A 2YINC 3R6WA 1MENA 1P4SA 3D8NA 4MVWA 1Z4IA 2H57A 2HBRA 2KHZA 4H4EA 4IIDA 4TSRA 4YRLA 5HR5A 1E92A 2WLTA 2AN9A 3USCS 1J06A 3GGSA 3Q87B 1P75A 1VXRA 1E9SA 4L75A 3KJGA 4CKCB 1VYHA 4BZPA 4D4MA 1ST3A 3RC9A 4QOEA 1SXJD 3FDIA 4U2FA 1M2KA 2LCIA 3NB0A 3U3JA 4DARA 2PL5A 3FZNA 1R0CA 5ITWA 4Q01A 4GX5A 3ML1A 3RCBA 1WY7A 1O95C 5EVCA 4X0EA 3MCUA 4PX3A 1YHYA 5LZ5A 3ELBA 4KV9A 4E70A 2Z57A 3CW2A 3EEQA 1MXFA 3JQFC 2EKZA 5FOXA 3EIXA 3MB5A 2DQKA 4X8MA 4J0QA 3SIPA 3L79A 4ZGWA 3M5WA 4K88A 3ZWPA 1JR4A 2GBPA 1WCIB 3OUUA 1SHUX 1KKMA 3LC1O 5CH5A 5K6RA 3AP3A 1WM1A 4UTZA 3D1VA 2EL9A 2Q3EA 4O25A 5E7MA 4C3UA 4D6PA 2GHTA 2KQUA 2GD1O 2QX4A 3NM6B 4IQFA 3SD7A 2O23A 5LDDC 2C9BA 4BKOA 4DA6A 2FGKA 2I8CA 1IG3A 5FUWA 3TQOA 2XWJI 1WVGA 5T3YA 5AW9A 1T1EA 4LY0A 4E1BA 4Q47A 1EFDN 1CB0A 3PE4A 5EJ6A 3F3SA 5AUNB 4IZ6A 1ESNA 4UNRA 2VG8A 4BB0A 3CMMA 4PCVA 1ZGJA 3TPFA 4G67A 5I7OA 1OC2A 1USUA 1KO7A 4IW3B 1EMDA 3HJCA 2W58A 3IMFA 2WM2A 3IXQA 3PHJA 4HLQB 3PCRB 1W5SA 3P9ZA 1YQDA 2OOSA 4J07A 1SMKA 3QX8A 2IP2A 1B14A 2J59A 4ENVA 1NUUA 4FEAA 3V32A 2ZBQA 4F9GA 4GLOA 5FOQA 2VSOA 3A70A 3OSZA 3UJDA 3FFXA 3BRQA 1HURA 3FSEA 4B3JA 2QG6A 3R9KA 4TLLB 5ENVA 2CMGA 3GLFA 3K71B 5A3JA 5JQGA 2E21A 2XCLA 4A27A 1NZDA 3MHPA 3PC8A 3PHIA 1R7RA 4X7MA 1U3DA 2VNIA 1BCRB 1U2TA 3KU1A 1LS1A 4GOLD 4QHYA 5ALSA 4B81A 5TS3A 4BQSA 4QJ5A 3HMQA 1FCJA 1M6HA 1Y80A 3QUAA 4ACAA 4FYIA 2E55A 4DXDA 4QVIA 1KI2A 3FTFA 3PSHA 5SZKB 1VJ1A 4X84A 4TMWA 3J7AC 2NSLA 4R2HA 1BMFA 1Y9ZA 1P31A 2WPDA 3P5SA 13PKA 3PUHA 4TMXA 2G9RA 1KH1A 5SYNA 5FPKA 1EAYA 1V71A 3G0IA 3N0RA 3MRXA 3A31A 1Z8FA 3SXPA 4I8XA 3EGXB 5F4BA 3AUTA 1VPDA 4IHJA 5IH3A 2YC2C 3AEYA 3FWPA 2NU9B 1T8UA 4I5FA 3QMPA 4AZWA 4JI0B 4CLOB 3R23A 2H1OA 2X2OA 1PG5A 3IBTA 3K96A 4OY3A 1G38A 3BOSA 1V1JA 1VBNA 1PSWA 2Y68A 4GMDA 2B69A 2AE2A 2QMQA 3F9RA 2O2XA 4WZBB 1ZMXA 3MG9A 3C0KA 2L69A 5GAJA 3Q2KA 5ALXA 1A5AB 2R25B 1TT7A 1VL1A 2WP8J 4HMQA 2C82A 3LRXA 5DX1A 4ZXPA 2ZSAA 4CMBA 3I6IA 1VJDA 2BONA 3ORRA 2BTQB 4H7FA 2IPAB 1YR2A 2IYEA 7YASA 4BNKA 4YPFA 4TV9F 1JA0A 2ZCVA 1CJKC 4J6EA 4MP8A 2O7SA 3HR4A 4UBLA 3TQQA 3BWXA 4V03A 1JAYA 8OHMA 3H5LA 3ZBQA 5E4FA 2WVGA 4ND8B 2NT4A 1QGED 2XCSB 2OGUA 3K1AB 4BEWA 3M4JA 4FZVA 2P90A 2P91A 4W7SA 4KQ6A 3CMCO 3TX6A 4BFLA 3TUZC 1XXLA 3MXTA 3E22B 1UMCA 1D1TA 2Z83A 1UAYA 3NGXA 4D4LA 3NJ8A 1RFLA 1KY2A 2PUCA 2HA5A 4DAOA 5JQGF 1C3VA 3E1SA 3U7IA 1O9GA 7GPBA 4LYYA 3P5BA 4B85A 5JPIA 1LPPA 2OKGA 3X1YA 1D1PA 4D82A 4DG5A 2OSVA 2V9CA 3HGTA 2DE0X 1E6WA 1QAOA 3DEAA 4ZHQA 2QN9A 3VYUB 4AN1A 3WMXA 2AFIA 1JSZA 2WIGA 2CXHA 3FPEA 4B6EA 2PX4A 1TRKA 2PNFA 3ORFA 5T4HA 2RJOA 4XD7D 3SYRA 3VU8A 4CFYA 5JO0A 1XJ5A 3F5FA 5CUQA 2C9ZA 3C3YA 3E3NA 5K01A 1E1NA 3EE6A 3MTEA 3N1UA 4L3VA 4EI9A 1VLHA 5JADA 4JXXA 3CRRA 16PKA 1DAPA 4NJMA 4XCXA 5BMVA 5HKAA 1BRMA 1QIFA 2HK6A 2WOOA 3RFFA 2RIPA 4S24A 1AHHA 3HJTA 1MH9A 4H27A 5E6RA 5HFJA 1AE1A 3AJ9A 2QU8A 3IQFA 1MO4A 3B6KA 1WQ4A 2VJPA 3L7IA 2QPLA 4URFA 8LDHA 4AZ3B 3EPHA 2REOA 2A7QA 3BFPA 2HMYB 3MT0A 3PGLA 1YFJA 3GH3A 2GQ0A 1T0HB 4C5AA 5BN5A 2C94A 2XNSA 2YJ4A 3RH0A 2EATA 4EW1A 4X63A 1NG9A 4NHOA 1DEXA 2D5AA 5C4IA 2RB4A 4J2OA 2Z43A 3HU3A 3OAAD 1B0AA 2BUBA 3SKXA 4EVQA 1W4AA 1FRNA 2VJYA 2VWHA 3S6JA 3PVSA 4DYVA 1M1XB 1Y89A 3EVDA 5GZ6A 1TJPB 1DJNA 2I33A 121PA 3O92A 2A88A 3D2AA 3DHNA 1KDVA 1HKHA 2Q3FA 4TKVA 1AOXA 2CXUA 2WHQA 4GLBA 4YRIA 3WIEA 5JISA 2FX5A 1P0MA 4FM9A 1Q3TA 4I6EA 1GRVA 4QBKA 4D9MA 1KEKA 3DYVA 1WPQA 4KQGA 2QTLA 1IUKA 3K6RA 4H3SA 1T8TA 3RTAA 4UHKA 3UWDA 4CF4A 4EBBA 2H7VA 2ECKA 1UPTA 3H9BA 4JI6B 4C08A 1KEPA 1GQ2A 4AMYA 5CLJA 2EX0A 5WRFA 4AIRA 4Q37A 3PUJA 2AW3A 5EFZA 5LZ8A 1PL8A 1DAHA 3FBTA 3QEOA 3R3YA 1DAEA 4YI3A 1DCKA 2DFLA 2UVQA 4ZV7A 4K0KB 4AKHA 5H9VA 5HRAA 1PZXA 1VXOA 1G5TA 3ETGA 3GUCA 3MPOA 2FB9A 4G1BA 5IAEA 1NXSA 2QTVB 1I1HA 3OCWA 2IXTA 3RVBA 4ZHQF 4CLOA 3EIHA 4H0CA 1W30A 3L1KA 4Y2VA 3LZ6A 3BGVA 2IITA 3S1SA 2AEEA 4FDLA 4TUYF 5J2UA 2GERA 3PQDA 4ZYLA 2WSYB 2PYZA 3PIDA 1G5QA 2CYAA 1FXWF 2V65A 4KIJA 3PKIA 1KXJA 4LPKA 4KMMA 2XV1A 2NSDA 4MIEA 4XR4A 1Q2UA 1S3GA 2D6FA 1ENOA 2WJYA 2WYHA 3OKAA 5I5GA 4FI3C 5SY9A 1HT2E 3LBFA 1SCQA 2ZUBA 3G6KA 2C4TA 3BEDA 3HKEB 3KZMA 1DWUA 4OYHA 3GFRA 4WIAA 4GU5A 1YZ3A 3L0CA 3PYLA 5BWOA 5KNCA 2GDZA 4PWZA 4ZRNA 5ALPA 4E3WA 4MWCA 1ZQ9A 3KLNA 1A98A 3KS9A 2ZAYA 2O8VA 3F6YA 4Q82A 5CX1A 3THXB 3QF4B 2D4AA 3UXYA 5ICCA 3AKEA 2YX1A 4LK3A 3DHYA 1WPXA 2AI1A 3F67A 3S1LA 4GSLA 2HT1A 2C2YA 5A7FA 2WSMA 1IUNA 3WIBA 1N6LA 2YXLA 1J4AA 1I4EB 1T6BY 3RIHA 5L8VA 2QQGA 4O2BB 1YL6A 3WGTA 421PA 2WAYA 3CLSD 4X1IB 5ALRA 3T5CA 1IN1A 4BDSA 1N0WA 9LDTA 2H7CA 1NHWA 2NPOA 4HMOA 5F9FA 4H35A 4XAQA 3BL8A 3DOFA 3H1TA 3H5VA 3G89A 2CNOA 3ADKA 3UM9A 4AWAA 5MN6A 3AF1A 4Z9BA 2AOWA 2XRFA 4RDIA 1A4UA 4B4WA 1KOGA 4BU1A 5FL7A 4BQNA 1PX0A 3DBIA 4U7FA 3AETB 3A6HA 2NTVA 3PJGA 5CW2A 4X00A 1YS7A 4E4YA 4Z4FA 1B3BA 1SIBE 4NE9A 4YRDA 1L5MA 1YGYA 2AQHA 3B3FA 4RL6A 1AHPA 3PHBE 2JA2A 3CEMA 4CN8A 3RRBA 5EHZA 3L8YA 3CNHA 4PQFA 3K9QO 1IJFA 1VIVA 3RRFA 4ABYA 3CT4A 1Z5NA 1N7JA 4ID3A 1ISJA 3CLRD 1SELA 1ZK4A 4HFRA 3PNVA 4JBGA 4YROA 4A2CA 3LI2A 4Q66C 3IUSA 1GUYA 3M4YA 1F3LA 1OLSA 3TQSA 1MORA 1SM4A 1N2CA 2H92A 2E4ZA 3OMLA 2AEMA 4XZ3A 1C0KA 1P2TA 1WTCA 3R5TA 1QYRA 5A3QA 2FQXA 3UJ8A 1W6UA 4R1TA 4LC9A 1ZN9A 2QZ9A 5ENDA 2N47A 3W77A