4R8KA

Crystal structure of the guinea pig l-asparaginase 1 catalytic domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
355
structure length
355
Chain Sequence
SERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Identification and Structural Analysis of an l-Asparaginase Enzyme from Guinea Pig with Putative Tumor Cell Killing Properties.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Hydrolase
total genus 115
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r8kA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4r8kA01
5K3OA 2P2DA 5I48A 3ECAA 5DNCA 1WNFA 1O7JA 1HFJA 4NJEB 2OCDA 1WLSA 1JSLA 4PGAA 5F52A 4R8LA 1JJAA 1HO3A 4ECAA 4RA9B 4NJEA 5K4HA 2HIMA 5CBPB 1JAZA 2GVNA 5K45A 2P2NA 1WSAA 1ZQ1A 4RA9A 1HG0A 2JK0A 1AGXA 1JSRA 2WT4A 5DNDA 4R8KA 2D6FA 1ZCFA 1DJOA 3NXKA 5DNEA 3PGA1 5CBPA 1HG1A 4RA6B 3NTXA 1DJPA 5I4BA 1IHDA 1HFKA 1NNSA 5I3ZA 1HFWA 2HLNA 2WLTA 5HW0A 4RA6A 5K4GA 4Q0MA
chains in the Genus database with same CATH superfamily
1NVWQ 4G0WA 4MJ7A 4N8SA 1EBBA 2P1ZA 3E3LA 3QA9A 3UBMA 1IUKA 1LJLA 1N3YA 1NNUA 3AHDA 2GJSA 2X4DA 3KVNA 2EIXA 1D0IA 1KAQA 1Z17A 2EXXA 4MRAA 4QYIA 2IYFA 5LB4A 1OFUA 4JBGA 4ABYA 4KWEA 4IIHA 4QYTA 3PCRB 4EJ6A 1GCAA 1Y4ZA 1N6IA 2CD7A 2WVAA 2H2HA 4GZ3A 1T2DA 1A88A 1HKHA 1K97A 1PHRA 3B1VA 2XYRA 3OU6A 3OLQA 2L42A 4GPTA 3Q72A 4WNIA 3IO5A 1CIJA 1D1SA 1W94A 1UFOA 2OLJA 5F33A 4BB5A 1UBJS 3Q7EA 3HDHA 1J7JA 3SF0A 5I9IA 2GD0A 1PLKA 1K08A 3TAHA 4MQBA 3MLEA 3C8DA 1JIJA 3OSZA 4KDRA 4RELA 4MP3A 1U8CB 3TJZA 1GZ6A 1DZ3A 1I7PA 4L5CA 1Z33A 5IH3A 3TPCA 5FD8A 3WLEA 1W59A 4IW3B 4YUYA 1IJKA 1I5RA 2ZXEA 2FSGA 1NQ5A 3LXUX 3ZGYA 2I76A 3WHIA 3KQUA 2QMYA 2XE6A 4FEAA 2W2QA 4GKAA 4WCDA 1R0KA 5JT1A 3U0VA 1IN4A 1CS0B 1IN8A 3PQFA 3AV0B 3DDNA 3V7WA 3TLXA 5EMLA 2QN1A 2W6NA 1O08A 1H2HA 4LNHA 3S2UA 4PHTA 2NAPA 3MCZA 2ONKA 4TKUB 2HIGA 4EGJA 3BT7A 1ZIPA 1SKAA 1QTRA 2F48A 1SO8A 3FTCA 4ZAYA 3ON5A 4QUEA 3OKCA 4OI1A 4C1NA 1X7XB 3MWFA 2XKKA 1PJ3A 1GCOA 5LD2B 3OIVA 1JG1A 4GXTA 1QQTA 2GBPA 1SQ0A 3GT3A 3TDNA 2P6OA 1C0PA 4G6ZA 3CC8A 4EVSA 3QENA 3QVWA 4P6VF 3RIHA 1LX7A 1U3VA 1RMYA 2B5OA 2BEWA 4GYJA 3PX7A 2NUBA 3ST7A 3D8RA 1OLSB 3A2MA 3LK7A 2XV1A 3JX9A 2RJNA 3OF5A 4UD2A 2QI9C 3DMGA 3SKVA 3EG5A 2WD8A 4S1OA 2O3QA 3BN3A 4KAFA 3PYMA 4Q7JB 2HV9A 5D84A 1I94B 4D0LB 4URYR 2QAGB 1XZGA 4EJSB 2C97A 3LT4A 1NUHA 4QJBA 4ZI7B 2VNHA 1J00A 4CG1A 1KEVA 3I8OA 3MHTA 1LUAA 1EM6A 3GB9A 2OYCA 1CUDA 1ZD4A 3A8TA 4R41A 2R0QC 3U49A 3L8MA 2Q8NA 1SBYA 3RS8A 4KU4A 4MV5A 5FUQA 2HU5A 3NWPA 4HDQB 3HB7A 2H51A 3PLNA 5DTRA 2AZMA 3BD8A 1L1EA 5BN3A 4RPHA 1SG9A 3O8DA 4C78A 2GH1A 4PNPA 1PK9A 2IUFA 4PTLA 3RAPR 5AVOA 2IGBA 4P4GA 1T0UA 2PKRA 3QELB 2WV9A 3JYLA 5BWCA 4E32A 4OXNA 5HF6A 3A04A 2B1GA 3VZRA 4YDQA 3CEPB 1U0BB 3K94A 2IIBA 2RHCA 2ZS9A 4R8SA 1CS0A 2OPHA 3SS7X 2JA1A 4NDAA 5C8DA 4B6FA 1ICEA 1BVRA 4CI9A 2Y1DA 2QU7A 1YRHA 2BM1A 3FMFA 2OA0A 3UJDA 1AV7A 3D8HA 1PZMA 1AURA 4KW7A 1C7FA 2QMUA 4UDXX 4YAFA 1SM4A 4Q4HB 2JS7A 1YKGA 4AVYA 3JQPA 2F1KA 3MBKA 1JT9A 4JI4B 4MITA 2H5LA 5CLFA 1IRIA 1DDIA 2X15A 3NUQA 2PHZA 4AN0A 1Z18A 3OH8A 2WWYA 3JPWA 2F8LA 1N34B 4ENWA 1OLSA 3QY9A 1IM5A 2FQWA 4ZOAA 1L7OA 1CVRA 1HF3A 2NNLD 4LZZA 1D5CA 1NLFA 2GAAA 3CSSA 3TEFA 2LR0A 3CG0A 3G82C 4FOTA 4IJUA 1L5NA 5BV0A 5FBRB 5AW0A 4RVFA 2QAGA 3D7KA 4EJSA 1XJ5A 5KOHA 5GZ6A 2NZVG 4ZI7A 1BN6A 2ZUDA 4RMGA 4FFNA 4ENRA 2B98A 3CWZA 4DDUA 5BR4A 4Q19A 5FR1A 1ZC3A 5KUTA 1EBFA 3A25A 4XM0A 3T38A 4R6WA 1S2IA 4K03A 2R8OA 4QOFA 4C0XA 5KREA 4YJHA 3LHIA 3ZDFA 4MW6A 4TUYB 5CU7A 1NIJA 3CXRA 4XSGA 3AG6A 2VAXA 3IEXA 1EIWA 1Z0JA 1OASA 1S2NA 2GN2A 3GDFA 2PJDA 1GTVA 2VP9A 3HFRA 2QXYA 1DADA 3QXCA 2Q7DA 4JUBA 5KAMA 5HXAA 4BNJA 1ZGJA 4I4CA 3QYJA 1PWHA 3WLHA 4AN1A 4BU1A 1J23A 5BYAA 2J0UA 3DVLA 1I51A 1BHO1 1GKLA 3QELA 2OTCA 3C6KA 3E8MA 4PRZA 4LVUA 3AJ8A 3LT2A 5EI5A 5EJ5A 3WDKA 4QYXA 4EATA 1W47A 5FHRA 4BO0A 1H0RA 3EPPA 4J07A 1EVZA 4KWIA 4Q7EA 5EJIA 5K3BA 1YRQA 2XT9A 1SUIA 2V6GA 3DP7A 3N0XA 2YJZA 3WLPA 1EJBA 1OLXB 2Q0HA 1SGWA 2OKCA 1NASA 3SSNA 2C94A 1EFVA 1ZI6A 3OZXA 4KFRA 4UM8B 3ZNNA 2Y99A 5IUJC 2WJAA 1KEWA 3EVTA 1J0CA 2XVZA 4QXRA 1IDN1 1PT6A 4QQ8A 5G02A 4NFLA 5DNCA 1HTWA 5ALMA 4D8VA 3L8YA 4Q4HA 4IRUB 3CVOA 1A8HA 4HH3C 4IICA 1QHGA 4GYWA 3IKVA 3MPOA 5BWNA 1IOZA 2BMFA 1CERA 1MX3A 1S2OA 3F8SA 5HS6A 3W05A 3BL5A 3TJRA 2XMSA 1ZRSA 2IRWA 4QPDA 1L5LA 3NPMA 4M9RA 4JLSA 1D9ZA 2LVBA 2ERCA 4W99A 4PR0A 2PZFA 4MX8A 1DDOA 1A9PA 2R751 3IQFA 5J2TF 2CN1A 4U2GA 3A31A 1QJCA 5LQSA 3BWYA 5DU2A 1U7WA 2PO7A 3GGJA 5BRNA 4BFTA 3VR5A 4LOIA 4CRWB 5LLTA 4S3MA 1N9KA 3QU7A 4RFLA 1RABA 1LCIA 2LDXA 3KDAA 4I8XA 4YUWA 5CFZA 4KREA 4X7MA 2P0EA 2V7VA 3W0LB 4RZSA 3ZWBA 4YQYA 1ZK1A 1DIHA 4JQCA 4DLYA 2JASA 2YX1A 3UJBA 2ZB4A 3L7LA 5KWVA 3H19A 3BH0A 2Q29A 5CH8A 4D25A 4TUYA 5GIPE 5C8VA 1GPWB 1DKOA 4BC1A 3ZWVA 4EFNA 4K1XA 1SOWA 3TE7A 4DA6A 2J41A 3F47A 3RIGA 4RJJA 3V9PA 1YB6A 2VDRB 4J7UA 2F1JA 3EY9A 2ZJ8A 2ASVA 1AGRA 2PSSA 2G7MC 2HH9A 3IH5A 3LFTA 4TSFA 4AWXA 4Z4EA 4HGYA 2F4VB 2XVMA 3BQNB 3RRFA 5A02A 5JVDA 3M1AA 5HNKA 3OF3A 1UH5A 3FPJA 1KDZA 3S44A 1ZJ4A 2I54A 4Z5XA 1THTA 3GD5A 1GFSA 3W2EA 3I9FA 4ZD6A 1X9GA 4B0PA 4LV8B 5EWMA 4K05A 5JC8A 4TKLA 6CHYA 1OLXA 4G5RA 3ZVKA 3TQQA 1TMKA 3EWIA 4RANA 4Y2HA 5JWRA 1KETA 2P2GA 4OL0A 3AKEA 4F1JA 3IMGA 1AM4D 2XYGA 3BWVA 4BLVA 2OMEA 1GGJA 13PKA 1YQGA 3LSYA 2E1PA 4FGLA 4D96A 1XLUA 5DHUA 3RHZA 4PAWA 4WL0A 4FUQA 1BG6A 3BSSA 3IVGA 1Y63A 4O25A 4ZYVA 1F7VA 1XEAA 3PVCA 4M9XA 1ZSYA 1JBKA 2GK6A 3EXHC 5CW1A 3ACCA 3R7WA 3M9WA 4TV8F 3T7IA 1I10A 4ZQBA 3QPCA 2C5EA 3OWHA 2GK3A 2HXSA 3MJHA 4FHCA 5TMBA 3EEIA 1XYGA 1SWWA 4QDJA 3UZUA 3V3KA 5C7YA 1QIHA 3LT5A 5LN1A 1IL0A 3IQXA 3R9IA 3RBXA 3WA7A 1YCFA 4I9HA 5IDXA 3FNRA 1VKRA 4WNAB 4EKYA 3RRBA 1XXHB 4F3TA 3AKDA 3I6IA 3DOEA 3KZMA 5DWQA 5DGXA 5EQDA 3Q3VA 4PNEA 1XTRA 2GPWA 1RRVA 1G291 1WDWB 1ZPDA 4ZAZA 4B79A 4ASUD 1J7KA 1MUUA 1N5OX 2VAPA 1L4EA 3VDMA 4C3UA 4DGSA 3S68A 2JVIA 4XFJA 2WUDA 1ADYA 3DOUA 5JY1A 4QFBA 4ZV7A 3T3PB 2ZWPA 5HUHA 1AXEA 1GKKA 1Z6YA 3DZKA 1NQXA 1QDUA 1YQDA 4J90A 1U8FO 3PNPA 3TRHA 2WYHA 4B76A 1IG3A 3HUEA 5J4LA 3HY4A 1Z6XA 3AP3A 2PGNA 4TRJA 3IKJA 3R3HA 4C22A 3D0OA 4MV6A 4CV0A 3FYSA 5C18A 4ARAA 3THWB 4M8KA 1M0TA 4F3RA 5HF9A 5ITVA 1CY2A 2AX3A 2RAUA 5DEIA 3T7TA 5EXEA 1DQNA 1XZKA 2QAJA 2WIKA 1J2UA 3ABIA 1GSAA 3PVZA 4BYMA 2I0FA 4PLWA 1DINA 3OZRA 3U80A 3ILYA 2VSQA 4ZVQA 4I5GA 2NVUB 4BUZA 1XJWA 3K92A 1VMEA 4UDOA 5FYDA 2QJFA 3CPSA 1TE2A 1ZLXA 3GRCA 3OOEA 4K40A 4D9EA 2IXEA 3K09A 4CIYA 4ZYUA 3ZJVA 1BRMA 1CY6A 1DKMA 1Q0RA 1X1DA 2C9BA 1ZUD1 2PX4A 3ZCVA 2X22A 5CVCA 4HV4A 3ZI4A 5KNCH 3AXTA 4KN9S 1YACA 2VDMB 1UQUA 1XXHA 1D4ZA 2RHOA 4OOEA 1EQUA 3VYVA 2B4TO 3LDHA 4IDEA 4NICA 1N0WA 3COSA 2WK1A 4QBGB 5CIQA 4FSXA 1P2TA 1KH2A 4AB1A 1G59A 2GTIA 4KPEC 5DOZA 1IUOA 4M0LA 1D6SA 3C8UA 3KKOA 4L4UA 5H81A 1VI6A 4E08A 2WC1A 4TMXA 1B6TA 3NIBA 3ZV5A 1VHTA 2O07A 3EVEA 3M3HA 4R8RA 5CNJA 1OX5A 1SC1A 3SE7A 5BP7A 3UTDA 3UJNA 2AFIE 2PY6A 5J2TB 4OJQA 1KFJB 3DMDA 2XR1A 4KVZA 2WB2A 3COWA 1GV0A 5KU1A 3DFKA 3ZE8A 2LKCA 3E9YA 2QZPA 4L5AA 3P9QA 4ARVA 3ESYA 1CQJB 2ZOSA 2D3TA 3P8ZA 2PGDA 3DNMA 4LNAA 2IYPA 1YQXA 2GBFA 3AXSA 4V3CA 4G89A 3SU8A 4AG5A 3COZA 5FUBA 1EFUA 4QQRA 2J6HA 1FU7A 2CFCA 2V6IA 2QDXA 4LV6A 5JS6A 3VYRB 3THWA 2JFUA 4QELA 5G2OA 4PPYA 1OA1A 1KEPA 1TVEA 1Y9JA 2C0PA 2IIVA 4IDBA 5EIAA 5JSUA 4ZZIA 4BVKA 3EDMA 3V00A 1U7DA 1QIMA 4QXOA 1E2HA 5CLGA 1XPOA 2H1RA 4KR2A 4FBLA 4Q4JB 2G40A 5AXAA 5JG7A 4D4HA 4ZYWA 4ZZ0A 5C1OA 2RJOA 4P81A 4AF7A 2DMRA 2Z5FA 5DDIP 2BMAA 1F12A 3GK3A 3LYHA 2NVUA 3KJGA 1JEQB 2QM8A 4MUKA 3WRXA 3HB4X 2ZPUA 2ZJOA 4ND5A 4UUMA 4MUNA 1ZESA 3N53A 5DH9A 3T9CA 5IZ4A 2P2ZA 3IQZA 3L0YA 5CPBA 1Y9AA 1F7UA 4WKOA 3VO1A 1VPWA 2V65A 3PSHA 1IB6A 1XELA 4EHAA 3MIIA 1SC3A 4KXWA 1LTKA 2ZYVX 2R6R1 4EKEA 3O75A 3JD1A 4FWIB 1JFSA 4ACAA 4E03A 4NCBA 1QHXA 1RI2A 2HQOA 4D9BA 1JIVA 1GZ7A 1U4OA 1NZDA 4JL6A 4V0RA 1ZN7A 2YWHA 4JL5A 1S1MA 5SY4A 3H5VA 4W5QA 3ZVMA 2FMHA 2NU9B 3ABSB 3BTVA 4ZIRA 5B2FA 5CFMA 3NVDA 4MCAA 3KV3O 5DN9A 4IZHA 5F7JA 3ORQA 5J2TA 8ADHA 1W2GA 4OQQA 1HRKA 4HPXB 4DJTA 1Y1TA 4RJTA 4HD8A 1L7MA 5F3DA 5H4HA 3II6X 3MTBA 1F2UB 2Q21A 1LB1B 3TK1A 3F3KA 1CQJA 3KUXA 1K68A 1WXIA 2IEYA 2B4YA 2WUEA 3I6YA 3UK7A 4FGUA 3ZBPA 3A7EA 4IBOA 3Q15C 4KPYA 4HI0E 2ZTLA 2ZANA 3FDXA 2V97A 2R6CA 3BREA 5TX7A 4CIAA 4JHLA 1Q44A 4TLBA 3VX3A 3X1XA 2BKLA 4LCBA 3GPLA 2F67A 1OXKB 1OZAA 2J7PD 2JEOA 3DA8A 3IP3A 3QPBA 5ALEA 1RRFA 4XASA 3EMBA 3VC3A 1RLOA 1O95D 1XVTA 2BGTA 3CLSD 5FOTA 1I0ZA 1FYXA 4EF4A 3GCGA 4YV7A 3BDIA 4G4JA 3BGSA 1JG4A 1YA8A 2D13A 2F64A 1WNFA 3MM4A 2R48A 4HR7A 4P3KA 3R76A 3UQZA 3V7FA 2M2IA 2C9CA 2IZ1A 4JFRA 4ZFNA 4GP7A 4EI7A 3OMXA 1VPDA 4NHOA 1RQPA 2ZVJA 1K8XB 3T8YA 1JEQA 3TL6A 2A4MA 1VIVA 3E5RA 3KEQA 3L7OA 5AUOB 3NT5A 4TWRA 5C4GB 3N70A 1K2VN 2W6MA 1BMTA 3AFOA 2YXNA 2QRMA 1HETA 1SCBA 1WPQA 1C4WA 1XHFA 2LGJA 2VK1A 2WT4A 3W77A 3SVTA 4KIGA 3RANA 1Y8ZA 2P3LA 2RONA 3EASA 1O94C 3LQKA 3WKCA 4P98A 4XGQA 1ZH0A 2AZTA 4TS4A 1WZIA 4EYQA 2V0GA 3MMSA 4Z9XA 4A8JC 1A76A 3CG4A 1XTIA 2N42A 2O7RA 2RCNA 2RGWA 4BFUA 1UDXA 4PICA 2H1FA 3I42A 2NU9A 2VZ9A 1ZVQA 4QT0A 4TV8A 4EAQA 3OPMA 4JEHA 1W7AA 4C6HA 1JEOA 4IF4A 1R6AA 2BFDA 3ELUA 1X7YB 1G18A 1VB3A 2EBUA 3I01A 1TL7C 1F2UA 1CZOA 3O47A 5K99A 2O2EA 2G07A 4IMRA 2WF9A 3IJRA 4XYBA 1RWMA 2B20A 3LYLA 4OYHA 4RKFA 1KZHA 1N5IA 1R0XA 1ZGHA 2XWPA 1NPYA 2WZCA 3FTQA 3MFQA 3M0EA 4AT1A 4C3ZA 2ZW9A 4M38A 1B6GA 1TOAA 3MAJA 4OAOA 1OROA 4RVDA 4R54A 3PL1A 4QEDA 3CCBA 2RK4A 2Z3ZA 1EA7A 1A3CA 1SVSA 2P5SA 3HR4A 3QWIA 3WLFA 1NIPA 1VSUA 2VF8A 1Z82A 5IT5A 4I9GA 4AP6A 2X6RA 5BQPA 3OETA 4B6JA 2CVFA 1D3AA 4XWTA 5CURA 3OLYA 3VYSB 1VI5A 2X8LA 2GD2A 1V8BA 2J9GA 3IAXA 1O97D 3PC3A 4JBHA 4JC8A 3C4JA 3RSSA 4G24A 4KGVA 3SSOA 3FYUB 3H04A 3M6VA 4PIVA 4JI7B 2WU0A 4WX2B 1RACA 3CT6A 1E5DA 2GHIA 4GKVA 3LOUA 1KQ3A 4NYMQ 1E8DA 3NC0C 3PNBA 3C7AA 2L0XA 3JQ7B 3ETJA 1ZN8A 3NOOA 1JDJA 1TJ4A 4RY8A 4NBWA 2Q49A 3F46A 2J3LA 3O7MA 4UOEA 3DWGA 1G1MA 3GEPA 3DO5A 5ARBA 3TZEA 1R0LA 3MILA 3KXDA 4G8BA 1HGXA 3D8TA 3FMVA 4DUZB 3V8QA 1BWQA 1Z5UA 4DV7B 3PFWO 1IEXA 3MN1A 3BSYA 3T3GA 4C08A 3WB0A 3BGDA 4MINA 2RGYA 4PZAA 2PQ0A 2Q7XA 1FRZA 3VOBA 1CUVA 3PD1A 3QWHA 2CBGA 1N9ZA 1RLMA 1J0EA 2BWJA 2XQIA 3LCJA 3OHPA 1L5OA 2PLNA 2OD7A 4NU5A 4ZQHA 1CJSA 4TKMA 1X7YA 4PAQA 5A1TA 3HP7A 4UVGA 4ZDIA 1PJRA 5F76A 4INZA 3GWGA 3I53A 4FYPA 4LPSA 4YP9A 1R16A 4B9EA 1Q7EA 4DWJA 3ZJUA 1AHHA 2P91A 4D80A 2IPOA 4WXRA 4P3NA 3ULKA 1QH9A 3BEDA 4PRKA 2HPZA 3PR2B 4NMLA 1E4VA 3RRXA 1FW6A 1E3MA 3LPLA 4AURA 4CLEA 5JCOA 2VBCA 3RC3A 3SEZA 4BY9E 2VP5A 1U11A 4GT1A 3TO5A 4D6PA 2E4WA 1DBSA 2AMJA 3NHLA 4IV5A 3U3RA 3HCRA 4E4YA 1ZRMA 3KYCB 2JLCA 4L3VA 3G2HA 2FZLA 5AO9A 4JWTA 1J24A 2JBHA 2YV1A 4RHEA 1ILEA 2ZIFA 4RCZA 3DOHA 4TKZA 4BV2A 2H08A 4OATA 1N7GA 3RG8A 1DTEA 1P7WA 3VPHA 1WB6A 4DCNA 5BNWA 1AMNA 4JBIA 4W5HA 3K70B 1WJGA 3RU7A 4Y2RA 3UB4A 1CKEA 2MSWA 2WD7B 4ITRC 3JQBA 3GFBA 1IWBB 3NPAA 4E1VA 1EHYA 1ISPA 1QO7A 3RRMA 1G42A 3D3QA 4EZEA 1OH6A 1F2VA 4ZZ3A 3PG5A 4TL6A 3ZHZA 3H2IA 4M1WA 1K8ZB 2PSJA 3ZU2A 2H5EA 3IOYA 1E3LA 2C9MA 2VT6A 1I4WA 1NVKA 3GBPA 3OIDA 5FOUA 5JBIA 2PMKA 1U2DA 3ZS8A 2GBIA 1X7ZB 2Y3IA 4OJYA 2JI8A 3SQXA 4B3FX 2OZVA 3OZSA 1EJ2A 1IBRA 4NBKA 4QTXA 3K20A 2KBFA 4RTPA 3CZQA 2Y2UA 3AILA 4UFOA 4W1SA 3LZCA 3CE9A 3UYKA 5DZSA 4IXTA 4W7SA 5DXFA 4GSYA 3H9EO 2O2ZA 4K8OA 3E7PA 2JI6A 3UIEA 3SZMA 3F8WA 5FUMA 2X76A 4N0PA 3ZV6A 1X1SA 1HE4A 2JG3A 5BMVF 1X8JA 4ENTA 1FFDA 4CR8A 1XWFA 2JFOA 1HYHA 1STOA 5K7SA 4G36A 3B7WA 4RBNA 2G70A 1CS4C 2I4TA 2HSWA 5FOQA 1NC3A 2LW7A 1CQWA 3D2BA 2NZWA 4MV1A 4L0QA 2AWOA 3N59A 5KSZA 3H4MA 2GM9A 1RYDA 2AEMA 1QO0D 2BI7A 3DV2A 4PEVA 4GH5A 3AIMA 3NNSA 4Q9KA 3KYCA 4XLTA 2MYPA 4F5EA 4EYSA 2ZSDA 1WZEA 2AI1A 2L82A 2RIRA 1C7ZA 1SU4A 3DEKA 2ZWVA 4H7KA 4AJKA 3KB8A 4YNBA 2C3PA 5JSFA 3MMXA 1C3LA 3MJDA 3T3IA 4FFMA 2NV6A 4YIKA 2ZM6B 4L4YA 5JBNA 1CFJA 4I1PA 4BLQA 2WD7A 1PEKE 1J6UA 4BO3A 4Z3OA 1GSIA 2IS1A 3TLJA 5AESA 1HE3A 2CSUA 4M9CA 1SA0A 2DPGA 4X91A 2WPNA 1RPZA 1EK0A 4HDKB 1RQXA 3OEEA 5HZHA 1CR2A 3SQDA 3T6KA 4HB0A 2AC4A 3C2QA 3N2GB 4YP1A 4DMCA 2HFJA 3W2GA 1DBIA 3F2VA 3L7BA 3PGA1 2XXJA 1QMPA 1X7ZA 1NVEA 1O89A 2ZULA 2A3NA 3N9IA 1D2NA 4UZFA 4U6SA 2QLBA 1UMCA 2YHAA 2JGNA 2CNNA 5IK2D 1EGVB 1U5AA 4LRYA 1RYFA 3DLIA 3I34X 4Q1CA 1R5OA 3KAJA 4NJEB 2CLOB 3RTEA 4L8LA 1BHJA 1Z0DA 2CMFA 2GPJA 1Z75A 1EFKA 3KKKA 3LQYA 2VBGA 4B80A 3T3HA 5I3CA 1DTSA 1ORTA 4OHPA 4BKOA 5HUJA 3VU1A 2GILA 1BQ4A 5BVHB 1U80A 3HMKA 3U40A 4YLGA 5ALJA 2QTTA 2DWPA 4NNOA 2F1IA 4TXJA 5J2UF 3HU2A 4Q3LA 1F5NA 1RHJA 4GMKA 4B6GA 5F21A 1G8AA 4WFKA 4Y6QA 4DARA 3CLRD 2FW8A 1E89A 4WLUA 4YJ2F 4RGVA 1CTQA 3IUQA 3LF1A 3EVBA 3L6DA 4FYYA 3K0KA 1KMHB 3AF3A 3HJNA 3GRVA 3PGXA 1HZZC 4GO1A 3STUA 3WK8A 4EOGA 4YAKA 1OXUA 2ZYGA 1KXJA 4B87A 1FLAA 1XFDA 1ZMOA 2J31A 2QNRA 3D4BA 4NLLA 3AEKB 4NZMA 5TVKA 4HDKA 3PFFA 2SNIE 4F60A 3KU4A 4N7BA 3G0DA 3X1MA 1AQYA 5DM1A 1E9SA 1IEVA 4HADA 2Z8XA 3DMYA 4BGIA 1LPPA 1ORWA 1PZHA 3ESAA 3N2GA 3P4XA 5DWVA 4J0FA 4IXMA 1NR1A 4MQFB 5AHOA 3OJXA 1RXWA 2VDNB 3ESDA 3S2EA 1Y3DE 3ASZA 3RAGA 4AX4A 2JW5A 1Z0AA 1TLLA 5K05A 2OD9A 2CCKA 4H1VA 2BM8A 2B7LA 1EKXA 2V4ZA 3IMCA 4ZEVA 4JP5A 1JG3A 5ALQA 1KJJA 3GCXA 4NJEA 4DZTA 4UUBA 4MGHA 2BI8A 4PHHA 4ZI5A 2N1BA 1CJMA 2PXHA 2XDAA 2IU0A 1AF7A 1H2EA 3W2TA 3Q7TA 3SP1A 4HSEA 1QQAA 1H2WA 1QG2A 1QHEA 3RBVA 1GPDG 3O8RA 1A72A 1WPGA 4XWOA 4LFBB 1E66A 2IYTA 3JYQA 5CG2A 4UTXA 2CHVA 4R5MA 2PU7A 4PXYA 3LBNA 5BVHA 5JYCA 4J03A 3PFNA 3O4JA 1RJFA 1BDHA 3OJFA 4ZPJA 5LJIA 3JD0A 4Y6GB 5A05A 4DIMA 2H29A 1QPZA 2CSXA 3DTTA 1GV1A 4DIEA 2Z30A 1B0ZA 2FRVA 4Y30A 2V5AA 5EZSA 3U9LA 1FFHA 5ALFA 3RSFA 2FU5C 1KVRA 1W4RA 4F38A 4FZ5A 1ZG3A 5BMVB 4GI3A 1JDTA 4MJLA 3OT1B 4RVOA 5J4YA 4BL5A 2IHTA 2QUZA 2JZNA 3WQHA 1DQZA 5I45A 3OLXA 4H2DA 3PS9A 3TNLA 3FRIA 1GNPA 3HYCA 5DPMA 1HE8B 1XMVA 4QJ3A 1W52X 5KC8A 4M21A 4BNWA 1PV4A 3GW8A 1N7IA 4CKWA 3EPRA 4XD7D 4L73A 1XEFA 1QB8A 2VO1A 2FRXA 3VAZA 3KM0A 4MQFA 2A14A 2FZ4A 5HR5A 2R85A 3FBTA 3V6LA 4YT5A 1KP3A 3AL3A 3MJRA 5E3HA 3UJAA 3BAZA 4DA9A 4RKEA 4RMHA 1NX6A 4KHPB 4D0RA 2BELA 3NDRA 4J1QA 2VT7A 1MVLA 4WLEA 3H7AA 4OB6A 1O6GA 1SUAA 5PGMA 3VVMA 4YT4A 2ZG6A 5ALUA 2OFPA 4D98A 2DKNA 2X77A 3J7AC 1J0DA 5BUQA 3WFZA 3I9LA 4MKGA 4CDNA 2PSDA 4JVMA 4RMIA 4DNFA 5K0JA 3RV3A 5LMNB 1EVJA 3NB0A 4EG8A 5F64A 5A7FA 4HWKA 2J5XA 1L5RA 3OECA 1EQAA 1P0FA 4R5HA 1LK0A 1Z8FA 3N2EA 1X38A 3ZZUA 3WAGA 4I9NA 1MJNA 4CU5A 1TECE 1X3LA 3H5AA 2QAIA 4CG3A 3S6JA 4D9CA 1PQYA 4KK4A 2RE8A 2J4DA 2IOFA 2WINI 3IAHA 3UN1A 3AFGA 4AO7A 3ZYZA 4OLBA 4YJGB 3ILSA 1P9WA 1T35A 1OWOA 2WWHA 3QX3A 5K3SA 3R23A 1N2GA 1VCIA 3O2NA 1K4MA 1Y5LA 4IIGA 3RASA 5BMVA 1ZWKA 2CDRA 1ZXBA 3P9XA 5CCEA 3QHAA 5K8IA 3K0SA 1L8LA 5HE8A 3HG7A 1P1HA 3GGSA 1VBMA 3ZR4B 5AVXA 1G55A 3S99A 5JH7F 3FSRA 3FWYA 2GNPA 1UJBA 3EC2A 1YMUA 5BSMA 5CDYA 5AKGA 4KSBA 1Z38A 3NJRA 2C9YA 2I55A 4C6TB 5CXUA 3GRAA 2J0SA 3NV9A 4Y2SA 2Y6UA 3FMIA 3ONNA 4II7A 4OUDB 1OLOA 3I37X 4QUHA 1I5OA 1QGAA 4UFNA 5J2UB 5FUXA 2FWNA 1SVWA 2WVHA 3GH3A 3LGAA 2BDUA 3LL4A 3NJ8A 1GRRA 1QIKA 3I2KA 1QQ6A 5L7TA 2O1WA 821PA 5REQB 2WWVD 4ZOQI 2IXTA 3F3YA 4NI5A 4YJ2B 2R25B 3UY4A 1BA2A 1FFWA 4HFMA 3ZWAA 1EVKA 3AHJA 3FG9A 2DHRA 3FZYA 2P9GA 4RF5A 5EMJA 1HK7A 2B1QA 1VCNA 2I1QA 3UXHA 1KOLA 2Z2XA 5KTNA 2PS0A 1CRZA 1N6LA 5EJGA 1TZBA 1PJ4A 4KI7A 1GUFA 2H59A 4WINA 5TEWA 3DLHA 1C4OA 2GI4A 1DXYA 1QWOA 2AUTA 1K4YA 4WNCA 1D0VA 1NKVA 2UVDA 3EC1A 4ZTUB 2JLWA 2NO7A 5EMHA 4UMDA 4Q7QA 1N77A 2EQAA 2X8WA 4S2EA 5TF4A 4YMVA 1KJZA 2A58A 2FZ5A 5EKSA 1VXRA 3NNNA 4LSZA 4BBPA 2Q62A 1I6LA 3H87A 5DLQC 5HCUA 4CU2A 2Q27A 2B1IA 2BR3A 2CV0A 3EZFA 1W34A 1KAOA 1EWYA 2I3GA 5FOSA 1GUBA 2J67A 4I5DA 2EGGA 4M55A 7AT1A 1NVMB 1Z4MA 1H4VB 1XZLA 2VQ6A 4GWLA 4N9WA 2Y1OA 4YJGA 1T2EA 3OF2A 1DEKA 1MX9A 2IV3A 1U6IA 1OYOA 1UK9A 1BKSB 4XA8A 4DAOA 3SYMA 1UXHA 1L7BA 1C7QA 1Z5WA 2FLKA 2G1UA 2WU3A 4HS4A 4MJXA 5HKAA 4KR3A 4EO7A 1ZI9A 3DNFA 1M2JA 3WJAA 3JR3A 4IZIA 3GN1A 5CXXA 2BN4A 4J7XA 3MB8A 2B82A 2H5JA 2OB2A 2C8KA 2ZSJA 4HDOB 4LUCA 1ULZA 4B31A 2QUBA 3AC0A 4PAOA 2E82A 3WWCA 4AIIA 1DAEA 3UV7A 2ZI4A 4C6TA 2Y9MB 4HDMB 2G71A 4L22A 1VHQA 2JGRA 1DQYA 3HB1A 4J1SA 4R3WA 1VHJA 1P7PA 5CVUA 1JSCA 2Q2QA 1PGQA 2UZ1B 1A9SA 2AS0A 3UO8B 1YS4A 4KNVA 5J2UA 3ELBA 2D5LA 2D4AA 3L9WA 4CDGA 1KU0A 2QB5A 4AUKA 2W2KB 5I7RA 2UYCA 4XR4A 1NBAA 2QX8A 5REQA 7GPBA 2ZR0A 4RS3A 4YJ2A 3B3AA 1D09A 2DTXA 1LI4A 4INOA 4XJSA 4CETA 1XQWA 2VZEA 4DDVA 4TTIA 4F86A 5CNMA 3OD1A 2Q6IA 1OPXA 4ZGBA 4X7PA 4CIBA 4JGGA 5EJ2A 2F59A 4HY3A 3TR6A 3G9UA 2IS6A 2MR5A 2OCAA 1RU3A 4TLMB 3LQ1A 5JYBA 4G65A 3ZI7A 2X6QA 4OYRA 3VNVA 3MVEA 1O97C 2PGIA 3EODA 5KNDH 2JA2A 3UXYA 1ENOA 1XQVA 4PR3A 2H65A 2GVDC 2QLTA 5BMOA 1OTYA 2VP2A 4CM9D 1R8QA 2VYFA 2XITA 1LNZA 3U4HA 1S9DA 4CNQA 4PNHA 4AP9A 4E6EA 4QICA 3PHIA 2IA5A 3CNBA 3MJCA 4KXUA 3CN7A 5ALHA 1D2RA 1TZ2A 4MS4A 1PNOA 2I8CA 2A8YA 1E4YA 2REQB 3O1JC 1HM5A 2ILTA 1DEAA 2L2QA 1J56A 4XAQA 2EDCA 4RK1A 3ABOB 1C14A 1VLVA 3QOXA 3TW4A 4HXGA 1E6MA 2RK3A 4KWCA 2FN8A 4G23A 4C5CA 4UM7A 1XDSA 5AKXA 2CZQA 1RYEA 3F7MA 1SVNA 1PE0A 2AG6A 1ORDA 2CJWB 2IVFA 4IQ0A 3FDIA 5JAOA 2D8MA 3IQWA 5D3QA 4L0CA 4GI7A 3JWEA 3HLTA 2ATXA 3CEAA 3QUQA 1XO1A 3WICA 1B8NA 4QUDA 1KFKB 1KMNA 3G6KA 3HDQA 1R7RA 2WF6A 1KDOA 3Q8KA 2OESA 5EZ5A 3T1VA 4B4KA 1GDTA 5CUQA 2C4HA 2WHEA 5LBUA 3KXPA 1T6ZA 1NVVQ 1QM5A 3OQOA 4XDYA 3HDJA 3UAGA 2DJ5A 2UZ1A 1NKTA 5K0CA 4DYHA 4LRQA 3T7CA 2JGJA 2WAYA 5CT4A 1EH5A 1QWSA 2W2KA 5EXSA 2FMFA 2I6TA 5JZMA 3I28A 4IDDA 1KYWA 3QF7A 3FDJA 4EHDA 5CHEA 4DQLA 5EVJA 5H4GA 5IAOA 3VPSA 3QX9A 4Q1VA 3N8HA 2X13A 3QG1A 4U6QA 3M2TA 1FFEA 1P9RA 2AFRA 1DSSG 1BQ3A 4D57A 1RYZA 4HGRA 5KTRA 3T9DA 2ZEJA 3QLVA 4H9GA 4C7MA 2GZSA 4JKOA 1DB3A 5JH7B 1UDRA 3GR6A 1KEKA 5AVVA 3CLTC 1L2TA 2WHQA 1XZMA 3EFBA 1ZZEA 2IYOA 2J9YB 1RJWA 1MC5A 4Q16A 4L15A 5A4KA 2Y76A 3R7FA 3RUDA 4AP5A 1QLHA 2FNAA 1E59A 1G17A 1ZKMA 3NYIA 2OCGA 2CW5A 2EKLA 1KI9A 3PR3A 3WNZA 4D8TA 1EEXB 4EHNA 3FPFA 4IX1A 5LC1A 3KYIB 3PGJA 1UM8A 2PBRA 3IX7A 4JFAA 3A1VA 3MUFA 4TTTS 4GFDA 2AKEA 3G5AA 3OJOA 3OU2A 1JLKA 2D0OB 2REQA 5C81A 1VI2A 3KL2A 2CXOA 4UZSA 5D5PA 5CFRA 2YFHA 4ZU3A 1HORA 3WGGA 1MV8A 2W11A 1OAOC 5CVVA 1EWRA 1U3FA 4I1SA 4UBLA 3AOEA 4ZOCA 3ZTTA 4DPLA 1Y1PA 3QHPA 4QATA 5EZYF 2CJWA 3ND8A 5CB6A 3M5DA 4U2BA 3WP0A 2H4YA 3ONWA 4YXWD 2OAGA 2ALJA 4H4CA 2QJWA 5BW6B 2DT8A 3RW9A 4WERA 5ARDA 5K9ZA 4NWIA 4Z9FA 1J0AA 3RJ5A 1PQWA 3FGPA 1UANA 1XZQA 2A2ZA 5E1BA 1UC8A 5AKEA 3F1KA 2BDTA 1IBLB 2RC6A 3LQRA 2C7OA 3FVQA 1XX6A 2VDLB 1J9EA 3N8GA 3QJ5A 2ZPTX 1WCYA 5HF8A 1OX4B 4US1R 5CBKA 1YB7A 5GIOE 1E63A 1P7ZA 5IZCA 1MQ9A 3SYKA 1M6EX 3SC6A 1P62B 4W63A 1QQ7A 1G8FA 4P7BA 2HF9A 5A3SA 4FQ5A 3ZK8A 4AJ1A 2BYTA 1I13A 2HNBA 3N86A 1VLZA 3ZHQA 5JH7A 2QN3A 3IB3A 4GOLD 3AO0B 2WSSD 3K5PA 4TM8A 4WOPA 3I2HA 1VLLA 4X60A 2WRZA 5EWLA 5IRCD 1Z12A 3VHRA 3WRWA 2YMMA 3SMQA 4CFSA 4HX9A 2PSEA 1U2ZA 1YBVA 2F2TA 2H17A 3JATB 4I14A 1QVZA 1LBIA 4IOLA 4WN9B 4UU0A 4ZOEA 1TC2A 2FLVA 1T26A 1Q19A 1HNXB 4EPVA 1BQEA 3SHQA 4LJ8A 2HPVA 3WKBA 2QL6A 4PPGA 1Q1BA 3THXB 2W4IA 3FHLA 5HG0A 4F5WA 1WKBA 1KZ1A 2ABWA 3DBOB 4UTPA 2C95A 1A95A 1EX7A 2OV4A 4V03A 5BXQC 3U61B 1NNEA 3H9QA 1DLJA 3CRQA 3HR8A 2QMZA 4G63A 1K9VF 2YVQA 4KBGA 5AI4A 3UGJA 4IVQA 1D1PA 3C43A 2I3DA 2X5NA 2Z9DA 3NHJA 1WBDA 3KPVA 5FI5A 3ZBUA 1UEXC 1BW9B 3MWLA 1GZHB 3IEMA 2IH5A 2ZJZA 2GETA 3GF4A 4D56A 3A2KA 3OUUA 4U7PB 2AD1A 1MX1A 1O96A 1CYDA 3AR2A 3JSXA 1U0JA 1P4SA 1S3SA 5GJWC 4XWGA 1ZKDA 3WGHA 1F17A 2FOXA 4PBTA 3WLJA 1H9CA 4WOJA 2ONYA 5EZYA 3E8SA 3WYFA 1O4VA 2P40A 2P11A 4BWYA 4ESOA 2WQ6A 3OEHA 4YRSA 3U09A 3JQ8B 5FLYA 3D3NA 3LTEA 1Z22A 3UJ9A 3KQQA 1TMGE 3WBBA 3CB4A 2DHDA 2R11A 4XQ0A 1OX4A 2ETXA 3VSBA 3NWOA 4EQ6A 4EUSA 3A11A 4RM3A 3OZFA 2ZYWX 4A8HA 4MROA 3WKEA 1XLWA 3AHCA 3EA4A 4LRUA 4MQ5A 3GFPA 3T1OA 3S1SA 3V2GA 1E7SA 1NVVR 4JR0A 2HMYB 1VRVA 4MRMA 2C5LA 4DLKA 1G6KA 2XZOA 1TCBA 5BWBA 5FWDA 3LVRE 5EIOA 1T1JA 2HSGA 1A9ZA 2WJ3A 3B78A 3GZJA 4GXQA 1BAPA 4I1IA 4IJWA 4RO0A 2C54A 3PCTA 3QBDA 2VWHA 3JATA 4WZAE 3I4FA 4BX0A 4UOZA 4EJ0A 3AESB 4J8PA 3W3AD 4MV3A 4WUTA 4D4KA 5FPHA 3KRTA 4CF3A 2R65A 4DDTA 3THXA 1G2QA 2O7NA 4Y1FA 4UU7A 3T41A 1GEGA 5GONB 3FCAA 4HGNA 1AQNA 1A4XA 3QE0A 5ALGA 2SHKA 1U1FA 3W7BA 4LXXA 1AHNA 4LHYA 5DJ5A 3ZKAA 3RWMB 4LVOA 4W9MC 3P5SA 1QNFA 4YLYA 4M1OA 1G5HA 3DCYA 1Z0FA 3GVCA 5JHHB 3LGSA 4WPGA 2N46A 5IVKA 2AMYA 2WG1A 2Z0MA 3FXAA 3PL5A 3LU1A 1HEIA 1UJ4A 4TVBA 1ISJA 1E1RD 3WOHA 1SN7A 2VQ3A 5BRAA 2C4UA 3GPBA 2WAMA 1BXKA 4AECA 1IH8A 1JFRA 1F0NA 1Y9ZA 4C14A 5KVCA 5SYMA 1XTTA 1G5PA 2H1IA 1WMDA 4N18A 2QTFA 4A0SA 4L6AA 1YJQA 3PEVA 4EI2A 3JQ8A 3FYCA 3JALB 4GZ5A 4MV8A 1II0A 1IHXA 4R2LA 2OAQ1 2UAGA 1E1CB 1F38A 2EERA 1DT5A 1XCJA 1KK1A 3MT9A 4I0WB 3NC4A 4MPTA 5EZYB 3ZCPA 2WKPA 1VYUA 1L5ZA 4FFBB 3CRVA 4WVFA 4E33A 1NUPA 1Z73A 4JH0A 4OQDA 5KDOA 1T1SA 1YJCA 4KHZA 4FYHA 4OKSA 3W9SA 5TIIA 3PGMA 3QNMA 1KY2A 1P31A 1E8MA 1VKOA 1U8EA 1NNSA 1N5JA 3UFBA 2I4LA 2VH1A 3W1EA 3H84A 4JJGA 1NLZA 4BVFA 4QQKA 5LIPA 3QLUA 1TQ6A 2QRZA 1JBEA 2UYGA 1FNBA 2YZ7A 4QVIA 5IDQA 1NOKA 4DUGA 1WMAA 3RTDA 1A9TA 4I46A 4ZDWA 3PX2A 5DP1A 1WCIB 2QG4A 2XUAA 1G7SA 3NHUA 3COJA 1QHNA 5K20A 2NP7A 2FTKE 3QOYA 1M0EA 2O6LA 2MYNA 4L95C 4V0LA 3R8XA 3UJ6A 5KWSA 1E58A 2B5VA 2IU3A 2J8ZA 3C45A 3DULA 4BQPA 1N1EA 2II6A 3NCHA 3KLOA 3CEHA 3PFHA 2FSVC 1VPLA 1KYXA 1ZUIA 3L1HA 1PR2A 2IEIA 4FPXA 1U8YA 2JKZA 3BD6A 4MYUA 3RREA 4PG6A 4DR2B 2FDRA 1JJFA 3A6JA 5AM5A 2OV3A 3CNEA 2YY6A 3ENNA 3OM0A 5L9AA 1D2AA 5JR3A 2X1HA 4BNKA 1ZSNA 3KBBA 3FWZA 1M8JA 3BH6A 3JALA 4G4SO 4LVNA 4I99A 2O2HA 5KNBH 5A1JA 1D7AA 3SQNA 5LB2A 4QDZA 2R00C 1E1CA 1F0YA 1Y3HA 1N6NA 2TS1A 4WRRA 1U6JA 1SXHA 2BFBA 2HPHA 3MWGA 4QXMA 4TYPA 4QAQA 5AWFC 3RVNA 5JXJA 2H07A 2PNFA 4RYDA 4YI3A 2BVNA 4UNSA 1TM5E 3D6TB 4FFBA 1HDZA 2LUOA 4H1TA 1EPUA 3OTIA 4XE5A 2W6JD 3HK2A 3ITKA 4NULA 5HJ2A 3H2GA 1KWGA 1G5QA 2G17A 2VF7A 1VMDA 4NECA 4QGFA 4DCGA 4MEAA 2HTFA 3IQDB 3P2JA 1RQ2A 2O7QA 1JKMA 2A9RA 5KHAA 4MVJP 4QODA 1KVQA 2OE2A 5HE9A 1JXOA 4Q3KA 4EHLA 1WVIA 1MO5A 3B1KA 1XZFA 1M1NB 4Z7JA 2JFQA 1SOMA 3V4FA 3L4KA 2XRZA 3UJ8A 4ER7A 4YECA 3PPWA 4DM4A 5J5CA 3DMNA 5JVDB 3TLAA 4UHKA 5JMPA 4IQGA 4C20A 9ATCA 1WUKS 4N7MA 2P3SA 1UKAA 4ZOBA 4IJVA 3O9MA 3Q0TA 5BSWA 3M4NA 1ODJA 1YUNA 1W36C 5EERA 5T41A 3JQFC 1L5QA 3DZ8A 1XTUA 3Q0IA 1N2CB 1BO6A 1ZEMA 3KXLA 1LZKA 3K1ZA 2FFBA 2JFPA 1FNDA 3DG9A 1A82A 4HDCA 5A7HA 4Z0HO 2ZBEA 4NZ9A 3S5JA 3TLCA 4QTYA 3RWBA 3WB9A 2ZTVA 4FINA 4O0MA 4ERNA 1RBQA 2KQUA 1RXEA 4KX5A 1XTBA 4C89A 3MINB 4C76A 4EA9A 3AVYA 3LPDA 3SICE 1KORA 5JIBA 4C06A 1NN1A 1XTJA 1K2WA 2CLFB 3IIKA 4MRVA 1N2IA 5DVZA 4EO9A 2HIAA 2WIGA 2XDQB 4OXXA 5I7OA 5J5VA 2QNIA 3BRQA 1YI8A 3GLUA 4EHIA 1N2XA 1NN0A 1NTOA 1H1TA 4R1MA 2FQXA 2G9UA 3HE3A 4IEFB 1MAAA 4KDFA 2BMVA 4PZZA 4BZPA 5IKXA 4DYDA 4FHGA 3NP7A 3OQIB 3WGKA 4DKJA 1IN7A 1P1JA 2QE7D 3IAUA 2GM4A 3GFGA 2QP3A 1ZJYA 5KNLA 3DYVA 2V45A 3EC7A 2RAFA 4A03A 3R5HA 1GGVA 6PFKA 3I9JA 1T6XA 1UR5A 1QBKC 2YJNA 3IRUA 4UBOA 5A06A 4PX2A 4YRJA 4Y9SA 2IHBA 4Z99A 4RIEA 4KQCA 5DMHA 2COUA 1M1NA 2E1RA 4E1AA 1P2VA 1TNDA 3H17A 5FULA 1WCV1 3Q1LA 1PR4A 3QVSA 2P1RA 1SQGA 4ROTA 1E98A 1XZ8A 1P60A 2O2GA 3EVZA 3QVMA 2HM7A 1KPGA 1J0XO 1PFUA 1OOEA 2VTBB 1OJLA 3A06A 1WQ3A 2PRYA 3D3JA 3DDWA 5F77A 1UBTS 2OBYA 3PDCA 3CR8A 4FNOA 2FMKA 5JWHA 3TINA 5ALXA 3S4YA 3HM9A 1DCMA 1L7AA 1VL0A 1GLNA 2IU6A 1Z6PA 3NBQA 3IT1A 4HLDA 3CPEA 4XWYA 3VZCA 5T8KA 3RU2A 4UBNA 3DZCA 1FP1D 3QPVA 2PE5A 5GM2A 2BAGA 3UOAB 4MWBA 3ZWXA 2C82A 1CYEA 5JRZA 2GEDA 1RRCA 3T3OA 4CQJA 2OO3A 3W90A 4WK4B 3MINA 3RHFA 1Y7TA 4JNKA 3NHSA 4D26A 3AJDA 3BJZA 2QW0X 3TW8B 3VOTA 2CXPA 4IDOA 3HNPA 3KR0A 4TZKA 1PGOA 1VMAA 1DBVO 3CBQA 2P5YA 1RRGA 4NU6A 4U3JB 2A5FA 1Z28A 5MHTA 4NFYA 2XDQA 3JVDA 3PUIA 3FFBA 4JOBA 3KSUA 3ER9A 3PPYA 1F8XA 2I03A 3BB1A 4D9JA 1P19A 4LV5B 3LTNC 1KARA 1U2TA 4IWYA 4ME6A 3K35A 1NRXA 2P2DA 5K0EA 5EGNA 3GUYA 3HJTA 3NAZA 3OQIA 3A1FA 3L6RA 1A8QA 4NYIQ 3BXOA 3VGPA 2JJ8A 1J8DA 4HF7A 2VHUA 1L4GA 1RPAA 1XWWA 5AICA 2WMDA 2GXUA 4OLHA 2GR9A 5EMKA 4LHSA 3SBDA 4UFPA 9ABPA 4DQDA 3PXGA 2VHZA 2GLUA 4NYJQ 2BCJQ 3PVSA 3KQSA 4Y2QA 3GOHA 5GADl 1QPGA 5JAMA 4ZP1A 3TFOA 4XVQA 2C2ZA 4J4TA 3NG1A 4AUNA 4MKFA 4AW9A 2JDID 3RSZA 1NM5C 4B44A 3NRCA 1FPMA 1F8UA 3HBJA 1W49A 1DP4A 3VC1A 1KZ4A 2I9PA 4HXYA 3I92A 1KDRA 4RD0A 4MTCA 3GLFB 1AQ6A 1E92A 5FWXB 3HUUA 4ENQA 1HDXA 4RHUA 3I6ZA 3O8BA 3RVLA 4ANFA 5C37A 2G1PA 4B6QA 1C9DB 4OQFA 4BTEA 4KR7A 3Q7SA 4QTTB 2X5KO 2G5TA 4O4JF 1JJAA 3PQ7A 3AEUB 4DB2A 5AM3A 3SQWA 1KJYA 1NFRA 1XPRA 2WU8A 2YJ5A 1JALA 2G1KA 3SXUB 4LXIA 1PZXA 2RFLA 4TXHA 4TROA 1V1RB 5THXA 1RM0A 3QXGA 1LWOA 1HURA 3QUTA 4C0QC 1J70A 4RWEA 4PANA 4IEEA 1WW8A 3LYUA 3TG8A 4BMOB 3Q88A 4U3JA 1THGA 3VX4A 3URKA 1E2JA 3IKLA 3T5BA 1ZN9A 2VSNA 3KALA 1S3IA 1WW2A 2GEUA 4KB5A 3DC7A 3N2KA 4YP5A 3GAAA 4FW8A 3IR7A 4MB2A 1FTQA 1Z4QA 3K2IA 4QAJA 3VDXA 2BGJA 2ESRA 4HK4A 3ML1A 4X7BA 5EE1A 3AUJB 1G3IA 2GJ8A 1J21A 3GV0A 5HP4A 3RHSA 1WU8A 3EXFB 4MWGA 1AUOA 2FW6A 4JODA 2PPLA 2BJWA 4KIUA 1CJCA 5K03A 2D2VA 2Z2KA 3LRPA 3NXSA 1FSPA 1ARZA 1HG1A 4O3FA 5JFOA 1NI4B 2ZT8A 4R2WA 1N3BA 1Z7GA 3H83A 3OAAD 4G37A 1B42A 3HCPA 2FG5A 1IG0A 3C5EA 3OBIA 4ZU1X 3VZQA 1GTG1 1MN6A 1FP6A 3FZQA 4B34A 2F55A 3S7TA 5KI6A 2YRWA 2C00A 1MO3A 3FF1A 1XVVA 4IRXA 3WNQA 5L3SB 3ETGA 4A2CA 1O7JA 2X9LA 2PVPA 3KHUA 1SJ9A 1U94A 2MOKA 1IZ7A 3KZCA 3OOHA 5K8CA 1J49A 2B94A 5FWXA 1H5UA 2LNDA 3DAOA 4HGQA 4JVLA 2ZS8A 1FFAA 5LWQA 3D9QX 5K3CA 2W37A 5ARCA 3T06B 3ACBA 2OBLA 4P34A 4YYZA 3WV4A 1Z2EA 3AEUA 3BORA 4PX9A 1Q0PA 1OFTA 4LCEA 3RUIA 1AGXA 1OGJA 2GF0A 1NZJA 2PT7A 2OILA 3QEMB 3SXUA 3VFDA 4BX3A 2D2EA 3IVXA 2UUPA 1K7XB 2ZSAA 1V1RA 4JI1B 3DPUA 2A84A 2B0CA 1JAYA 3ADKA 1GPMA 1H22A 3P32A 1DPFA 3QEOA 4JAVC 4BUJA 1XHEA 1UEIA 1LF5A 5AUNB 2YDXA 2G09A 5BOVA 2Z43A 1U0TA 2O0KA 2BMJA 2WNHA 2NO9A 1P6QA 1KI6B 5DGDA 4NV1A 3N8KA 2DY1A 1O5IA 4ND3A 4R0MA 5CB4F 1RKVA 3PQEA 1QGYA 1DKUA 2IJGX 2I4RA 4FWTA 3THYB 2CLKB 2W58A 2QTLA 2CWWA 2EX0A 2SCUB 2RGNC 1JHRA 2XMDA 3C8ZA 3ZHOA 5JC1A 4LOLA 1IZ0A 3A3YA 3W4JA 3ZWOA 3KQKA 1E9AA 4XPIB 1GCIA 3IQHX 1Z4OA 4OHZA 3SBEA 3OY7A 4TMVA 2DFTA 1N8TA 3KZKA 4D43A 4W5NA 3R24A 3EXFA 2GZRA 4NIMA 3OVMA 1JX6A 3EQ7A 3JYNA 4K2AA 4EG3A 5EIEA 2ZZMA 2QL7A 3CM0A 4Y1EA 4KWHA 2W90A 1A2QA 3JD4A 1NI4A 2D5BA 1E2NA 3JQDA 1JFFA 4PPQA 3THOA 1YA4A 2GZMA 2QW1A 3MG9A 3PUVA 4YAGA 3H3XA 3M5PA 5JZ9A 1N5RA 1QTQA 4W4TA 1OFHA 4AY4A 3RAFC 1GNTA 1JIXA 1C0KA 3O6VA 4EBBA 3LM8A 1IQRA 1XG5A 3BRSA 5T67A 5L3SA 1MT0A 2ZAYA 1LDYA 1L5WA 3I3SR 3OCCA 5K3FA 1NFQA 3SAJA 4RPKA 5A4FS 4NYIR 2PGXA 3JWHA 3NO4A 3STYA 1IJBA 2R2AA 1XRSB 3LUCA 2YOFA 4Q39A 4KITB 1LBSA 3EOBI 4GBMA 4NYJR 3AEXA 4BVEA 1E2PA 1TM1E 2VHWA 3IODA 3LOPA 3GA5A 3B70A 3KZ1E 3QEMA 4B3GA 4WJLA 4D9MA 3G1UA 4AY2A 2CBXA 3VGJA 1ZH4A 4A91A 1Q16A 3REGA 1AKYA 3TJMA 3FNBA 3SVLA 2QT1A 1HC7A 1T2FA 3T61A 1VCHA 2B8TA 1DX6A 1WSDA 3WWZA 4A1FA 5JXHA 3GBSA 3IE1A 1WABA 2GARA 3ZVLA 1N25A 1VQ1A 2JNWA 2IYZA 4INPA 4BVHA 3TQOA 1L5GB 1FQOA 3HB0A 1KI6A 3NVAA 3GUCA 3PQ8A 4F4HA 3TW6A 1M6VB 1AKNA 1C29B 1TJYA 1IEWA 4EB3A 3V7NA 3THYA 4O4JB 3B8HA 16PKA 1YDGA 2UUBB 2PWYA 4AF8A 3B20A 4QOSA 5JROA 4D1YA 3AVVA 3MMNA 4XIFA 3RS5A 4RLQA 5B4VA 1UBOS 2YHUA 4XPIA 3T1YB 3DL7A 4X94A 2WNSA 1ODFA 3GT4A 1JDZA 1AV6A 5AI8A 3MWYW 4ALLA 3B52X 4JKYA 1QGUB 2G72A 2UZ0A 3AEYA 3GMDA 2WI8A 1SIWA 1ONNA 3O5AA 1UOOA 3F4LA 1QRUA 4V39A 3D0RA 3PX3A 5TGZA 3B13B 4OAQA 5TGDA 1NFFA 1YR6A 1HSZA 1XQ6A 4MI1A 3KQNA 2O59A 4HWRA 2QRLA 3B9QA 1YVRA 3E7XA 4I4NA 5AOCA 4BO5A 1IIBA 1ID8A 4Y6LA 4PAGA 1UZAA 2C31A 1UPTA 3MERA 1T2CA 1XXHE 2VUHB 3NFRA 1ZD8A 2RD2A 1YMVA 2A5GA 5FPPA 5SV2A 3VPAA 5AYVA 4CMCA 2G5PA 5FWAA 2C92A 4Q6BA 4C4AA 2ZRHA 3A9SA 4DT1B 3O3CA 4ER6A 3IHLA 5TC4A 1VB5A 1XKQA 1W30A 2ZT5A 4H7IA 4UHEA 5JAQA 2C2KA 2H63A 3O2QB 3AUXA 3W6UA 4OD0A 3RVMA 2JIBA 2FQYA 1E3EA 2KI5A 3D2CA 3HB9A 2Q6VA 4HKTA 4DLWA 1B0PA 4HNAB 1MB4A 3S70A 4L75A 1C4XA 1Y9DA 1G5FA 3ZHBA 1AKRA 5HYVA 3O95A 1H5NA 5FTKA 2XEXA 4MIYA 3UOGA 4FHDA 2NYRA 4OHCA 5GGYA 2DQSA 1X39A 5LDDC 3KL4A 3KT0A 1MD9A 4V0OA 4M7OA 1P2UA 1TYBE 2O2DA 4DG8A 4XJTA 3EXEB 3RUFA 1ISFA 4U2CA 5SY6A 3KSDO 1AIPA 5G4KB 3HPQA 4II2A 1M6VA 2Z5VA 4U9HS 4RZ3A 3L7DA 4O4JA 5KJ1A 2YJ6A 5ED0A 1W1WA 2EJTA 1NR5A 1YJAA 3Q87B 4IIJF 3PUJA 2BFPA 4MIOA 3RSLA 3BA1A 2WTNA 2C29D 1BS1A 2V7UA 4TGLA 4R6XA 2V7XA 4KXYA 4CF4A 2Z83A 4L8FA 2DECA 4HB2A 3RC7A 1PIWA 1INLA 2EYQA 3NLLA 5C35A 2BKAA 2W6CX 3LLVA 4UTZA 1MOQA 3EGXB 4BJ6A 4U63A 4CQMB 3NDBB 3G88A 1GG9A 5CB4B 5DLDA 4AZ3B 4BMPB 3WKDA 3ITEA 4BQEA 5CFNA 3JRNA 2A6PA 3ZWQA 2Q5CA 3WSWA 1Z4JA 3CZRA 4GOMD 4DT1A 2FWJA 3BKXA 2R1ZA 3G1TA 2ZI5A 1IUPA 3PF9A 2XDYA 4ZEXA 1CIVA 3EGOA 4LHEA 1JI0A 2AMFA 3GMTA 5DN6A 2FJ0A 1J8QA 4WXMA 2VRNA 4J0JA 5FWYA 9MHTA 4NS1A 4PHFA 4DCUA 5TMDA 3R4CA 1PL8A 4X6LA 2ZAMA 1VPTA 4JYAB 1PFWA 4HNAA 4F21A 4OSOA 4H27A 3WY9A 4L4SA 1VOTA 5JS1A 2QGFA 3KBOA 4H7EA 4EUKA 2QTAA 1DJNA 1EFAA 1JJ7A 1ZGCA 2ZSUA 4RSRA 3EXEA 4ZO9A 2D00A 1YGPA 4HFRA 1TM7E 5M2QA 3C7TA 1W6UA 5G4KA 4C0LA 2GFIA 1XRQA 5FL7A 2PT6A 2FHPA 4MO9A 1OR8A 1DJMA 1TKCA 5CNIA 1IVSA 3UB3A 4B35A 5A4JA 5KX5F 2PRKA 4GYKA 2PZ8A 5AQEA 2Q4BA 3FPAA 4XQ9A 2G83A 2QTGA 3RSGA 1J97A 1CJTC 3GY0A 5AM1A 4UARA 3WIUA 4D99A 5BUZA 1BS9A 4I6EA 2QTMA 4HFJA 2MU1A 2RIPA 4O4HB 5GJCA 3AUUA 3C1UA 3CR7A 3EGXA 3HP1A 3X1JA 4OLFA 3INGA 2QD3A 5IG2A 2O8CA 5CB4A 1SUCA 5EIHA 3C7CB 1I7NA 5TV2A 3RQSA 4AZ3A 4KBFA 2XE4A 3BXEA 3NKLA 3WDSA 3H5RA 1KO7A 2NUAA 1QGED 3WOVA 2Y9PB 4R2XA 1RBZA 1BC5A 2FAXA 2GAIA 5J3JA 3OQJA 4FYWA 2BE9A 3PPIA 2PLWA 2IV7A 3LUAA 2H3EA 4YAWA 5JSYA 4HQ6A 5DWDA 5DO9A 2Z4RA 2ZI9A 2MIIA 4G0ZA 3X1ZA 3KQMA 3U62A 1KE1A 2VQEB 5EIBC 3NHKA 1XMJA 1T5SA 4DM3A 1GNVA 2FDCA 3IMFA 3ASUA 4QPZA 1PJLA 1GTL1 2TMKA 1VJTA 2XJ9A 2DFDA 2YN2A 1KEUA 3ZDEA 1DOHA 1L7RA 1WXHA 3K8ZA 2CMDA 1BYIA 3DF9A 4WK2B 1RJ9B 4F2HA 1E3QA 3L7IA 1Y37A 2FR1A 1R5JA 1U2EA 3LO5A 4TYNA 3D5EA 1AO3A 1E7WA 4NZNA 2ID9A 4FYKA 3ZUPA 1I1QB 2D1TA 2QW8A 3CGGA 3GROA 4PO8A 4V0SA 2O3UA 3G0IA 3OX4A 3F67A 4EDHA 3UK2A 5BNTA 5IBCA 3IEPA 1PX0A 1JR2A 1GL7A 3JVIA 3O31A 1ZHOA 5TB5A 2NU7B 4NVRA 3MWDB 3P9NA 3FN4A 2XRFA 2Q3HA 4LF4B 3LD9A 4ENVA 4RULA 4NQRA 2Z4TA 1Z36A 2VJBA 3GLGB 1USKA 1CF2O 4ZYTA 1YDHA 4JYZA 3IHWA 2H9AA 3LUDA 4PGGA 3G2JA 3EARA 3HKBB 3NYQA 4MCJA 4BHTA 4EF6A 1UP7A 3SSAA 2GEKA 1X1BA 5CTJA 3NTLA 3KXIA 2VAWA 3EZ6A 2B99A 2ACEA 1JQ5A 2GZ1A 2VXOA 4CF5A 5LDHA 1CR4A 2AF4C 4HAZA 1H9AA 1KIAA 1YC2A 2PL1A 3E5HA 4RY9A 1PSWA 2LP4Y 4ZVOA 4K1LA 3WWOA 5JS7A 3I8XA 4IIJB 2WB4A 1RWWA 1CQPA 1GXSB 1BFKA 2EZUA 2FW7A 1EQ2A 5AXBA 1QOPB 5CITA 3H2JA 2J3HA 1Y7HA 3BL8A 3FOWA 1WD5A 4MR9B 4W82A 4H4EA 5BQOA 5KSOA 2MSKA 5C31A 3JARB 2I6UA 2CFIA 1FS5A 1DX4A 4RUKA 4D9HA 4BNXA 3DQZA 3NU1A 2IFTA 1TFUA 3OE1A 1G8YA 1RAAA 1C7RA 1NXVA 1GVNB 2AN5A 3DMTC 4KP7A 1Z08A 4RD1A 2Z4SA 5A9TA 5LU8A 3L02A 2V3CC 2BTOA 3F49S 4CL2A 1WUIS 3WRVA 1C1XB 3UANA 3VZPA 2NZUG 5HCNA 1TUGA 5AJHA 4CIVA 2ZIEA 3DZDA 2AYYA 2O0JA 1DPGA 1SUDA 2QRGA 3FYDA 3IERA 5HIAA 1RJ9A 2RHGB 3OT4A 3R20A 4B81A 1DIAA 1K7YA 3EXG2 3FSEA 5EPUA 1YULA 2HQSA 2ZUUA 2FR8A 2VQDA 3TYXA 3UT0A 121PA 3U3KA 5T57A 1TKBA 4GLFA 3KWFA 3PSAA 4KVFA 1E2LA 1ONBA 2XB9A 3WB2A 5LKAA 5LM3A 2LXNA 2CEAA 2LCQA 1LH0A 3DNPA 3V48A 3A26A 1I5EA 1XZEA 2QT9A 2XLBA 2R6GA 3E2PA 4LHZA 4X7RA 4UM9D 3MWDA 2HQRA 3I9V1 4M1EA 3WIVA 1XDBA 4WACA 4Y6PA 4JITA 5DW0A 2D62A 3GLGA 3PHCA 2P9JA 1ML3A 2X4IA 5E3JA 2CNWD 4YP6A 4IDPA 1K6EA 4QQNA 1SNYA 3HKBA 1I3OA 3HVIA 4B45A 5ALVA 3DE4X 5AOVA 4PQFA 3LXMA 5M7EA 1KR2A 4HYQA 3NUZA 4Z1OA 5DNWA 4BAZA 4AKEA 1OE0A 1X7GA 4GP6A 2Q9AA 1NMSA 2IBMA 4HWSA 2Q46A 3Q10A 1XP5A 4KCGA 5F9MA 4DWOA 4NH4A 2BLLA 2AEFA 2Z5LA 4IIJA 2O5EA 3H5TA 4UAUA 2XZDA 1GXSA 1NE7A 4DUPA 4E7PA 1ZDMA 4F7DA 1T4BA 2GDJA 5KX5B 4DEVA 4CN9A 3A10A 3KPYA 2QMHA 3ZNQA 1IONA 4C0BA 2PKQO 5AW4A 3ZWYA 4BQSA 3LT0A 4KGDA 5K6AC 4MGEA 1UBHS 4HQKA 2A9PA 1UJ5A 2PZEA 2IQIA 3TDKA 2VF2A 2JHAA 5JRJA 2HHLA 3MTAA 2ZQYA 2PSFA 1NXQA 2Y4OA 2G4LA 1C1XA 3MTDA 4F8EA 2WHPB 2GB4A 3HS3A 1PT5A 2J07A 3W8FA 2HEGA 1Z45A 5LVAA 4OKNA 5ICFA 5FRDA 3D1LA 3DO8A 4CCYB 3IS3A 4AWAA 2ZBRA 2ZB2A 3C70A 3EUFA 1DWQA 1JWAB 4NZYA 2P67A 3T5AA 1OKKD 3N2LA 3RFTA 1SCQA 4AJ4A 4B4VA 3DZJA 3L7AA 1UBUS 2IKSA 5AK4A 3QEAZ 5KYVA 1ECBA 1KBZA 1C9MA 4FW9A 3ZBTA 3TPFA 3U9TA 4ISBA 4L0MA 2PYIA 3F1LA 4CMGA 2HZBA 2QTWB 3L5OA 2ZI3A 3IJ5A 3I73A 1UL1X 3H3FA 4EY3A 4Z86A 3ZIAA 1GDHA 4QU9A 5EC8A 3E58A 4X6YA 2OMKA 4CMEA 1U8UA 1PR0A 5J63A 1QH0A 1RE0A 4RHXA 1V4VA 2V8OA 1CLEA 3WRYC 2A9OA 3HA2A 4YO8A 4ZV4A 1K86A 2WTXA 4CKBB 1G38A 3BXHA 4AY6A 2W6ZA 2UUOA 3L92A 5FL3A 1DFIA 5KX5A 2AQHA 3NVMB 4XB6B 5CM8B 1W1IA 4B7AA 1L6RA 1VE1A 3DBHB 1XDUA 1WMSA 1QRDA 2XRMA 3BHJA 3T52A 1NR7A 2FB9A 4Z4GA 3TSYA 3KVYA 3IULA 2VHQA 3WSVA 3H5WA 4D0GA 4O8CA 4GI5A 3SCZA 1Y82A 4OCZA 5ESXA 5C80A 3JYOA 1L5MA 5EESA 3PJDA 2JLBA 4PX3A 5EHIA 2PZJA 1N2EA 3EZ9A 3FM9A 3TQFA 1NYRA 3BWEA 3MCVA 4ZJUA 5AKIA 4Y0VA 4F4CA 4CCYA 3G85A 1OILA 4GBJA 1O6ZA 3WIBA 4F7WA 2LE0A 2PR2A 4IV8A 2ILVA 1ZQ1A 4TQGA 3IAFA 3UV3A 4BLTA 2HJHA 4BU0A 4DCSA 1FX0A 2VDVE 1SVKA 2ICAA 4RWZA 4UBKA 1ECJA 1FJHA 4P5PA 4CTKA 2EFHB 2XNCA 1FP2A 4PYKA 1L3IA 4ZANA 4A5OA 2FPIB 2P41A 1JR3E 3G2KA 2ECOA 3R3XA 2OHIA 3B1ZA 3HJAA 3FETA 4HQLA 4XIYA 2YOGA 2HSDA 3MQFA 3CJQA 7ADHA 2FP3A 3HWSA 1U04A 5HX7A 1NYLA 4RGYA 1GYQA 1BGVA 2CD9A 2AMLA 2NO4A 1WE2A 2IPMA 5CLQA 3S2YA 2NSDA 1VMKA 2BT4A 3DEJA 4XR9A 3KK0A 4E30A 3EF0A 2GHQA 4RHCA 4HVCA 1W5AA 3ZQJA 4NNPA 1GZ4A 3OG9A 5AVKA 1V0JA 1FVXA 2IV2X 1QNLA 1H8EA 1JB9A 2HMSA 2P9TA 3I6QA 4RVGA 1YRAA 2CE7A 5JPIA 1Z3IX 1EX6A 1F14A 1JSZA 5AJTA 5ICMA 2VCHA 1IHOA 4EYEA 1PGJA 5ANRB 2XPCA 1NUAA 5T3UA 4BKUA 1Q21A 4CKBA 5IANA 1XMXA 2DFVA 3VR1A 1FU8A 5CLHA 2Q4DA 1B73A 3H18A 4CWAA 1P1IA 3O1IC 5AI5A 3DBHA 4C4SA 4KXFB 1NN3A 2E55A 4NOJA 3R5JA 2JATA 4YRRA 3GG9A 4JV5B 1CUGA 2ZRCA 4KYUA 2YV5A 2I66A 5BR8B 3DF7A 3HY6A 5T3YA 3E9NA 1EFDN 2PN1A 2HRQA 1IC6A 5BW4A 1QKIA 3IP5A 3HXTA 3GYGA 1GYPA 4FZVA 2FUKA 1K0FA 4JP1A 1IXZA 1NUUA 2P78A 3UXMA 2JLAA 2JVKA 1GUDA 4K9NA 4UCFA 1P2GA 4NJMB 4QUKA 2C5GA 2ZR7A 3I72A 3KEOA 4XUCA 5JSKA 4B2IA 3PEUA 4RZ2A 4EI9A 4UBJA 2OR3A 5BSKA 2V1UA 2A57A 3MT8A 4QASA 2ONJA 4ED9A 2ZSEA 2R8ZA 1W8DA 3H7IA 3HYLA 2GM5A 1P2BA 2Q1SA 3Q5DA 2JCXA 5E6SB 2AOUB 3WO0A 4W1QA 3KCNA 5LLDA 3GEEA 1WS6A 2G88A 2FPIA 3NHWA 2TECE 1KQFA 2FW0A 5J40A 3GRYA 1P6UA 3DV9A 4I5EA 1T8RA 2BFOA 4URXR 3ANLA 3ILVA 4EUEA 3NM4A 4ICIA 1C3EA 2QSJA 4J7AA 3A6DA 3KQVA 2MSCB 5FLKA 3VUFA 3R3UA 2JJ1A 1OFVA 2GHRA 4M46A 3CKMA 4JB0A 2DR3A 1P0PA 2RH5A 3OQNA 2VA8A 3GLHB 2QQFA 3V8PA 5FDFA 3JZAA 5G53C 1GPYA 1ZM9A 4PLHA 4YAUA 5I5EA 3I5MA 1G5RA 1KAMA 4WOCA 1DC8A 5L3QB 4XVUA 2UYYA 2AOXA 3VR5H 4CNBA 1JTEA 4D5GA 2HLHA 1XCMA 2P4UA 3U16A 4KNWA 3C3JA 4S12A 1HLDA 3L0OA 4FOSA 2JIRA 1ZGGA 1ZMXA 3U7RA 3M2PA 1OH5A 4PLFA 2C7RA 4FGWA 5FOVA 1IBCA 2Y77A 3JYPA 2HNAA 3GLRA 4MWDA 4PG5A 4RH3A 1A4RA 2BTQB 3OCXA 5B3LA 3S2GA 3RUAA 5ALKA 1QZZA 2JZCA 3K0FB 3UA4A 4V2UA 1GRQA 2XYHA 3H97A 5A0FA 1UQRA 4LMPA 3GRRA 1UMKA 4IY1A 1LPSA 3IKMB 2G0NA 3R8CA 3N2YA 3W8EA 3ZU6A 1W1UA 2R84A 2VJAA 3I1YA 3QM1A 4BE4A 3DM5A 3FE2A 3F73A 4OTZA 1Z88A 1EUZA 3ODPA 1ZOOA 2GYYA 1JTFA 8ATCA 3D8NA 4GM1A 4NCNA 2X6TA 2Z04A 2YKGA 4FSDA 2XWSA 4EY4A 3HEAA 1NQOA 4EYGA 1AOXA 2QIPA 3O94A 3TIIA 5E6SA 1NURA 1PAUA 2AOUA 3HVRA 1T4CB 2GXQA 2J87A 3B51X 2VYNA 3CS3A 4FI3F 5KYWB 5LKRA 1BVYF 2FZGA 3NM5A 7ABPA 5CBPB 1YU9A 4II3A 2ACVA 1JKJB 4J4BA 1RRPA 4DIFA 4M83A 1RMTA 1MJ5A 3CKLA 1KGSA 3BJRA 1V3QE 3DZFA 2QXUA 1NG1A 3BFJA 2JIZD 3CF0A 3GLHA 1XA0A 3D6MA 1DJOA 3NDJA 3QE3A 1DUSA 4JLNA 5L3QA 4KMMA 3SLKA 3D8BA 5GV7A 4ZOLF 3ZD6A 5DP2A 3ZHUA 3LHSA 3WHKA 4WY2A 4DDMA 1TJPB 2W9XA 4FFRA 5C8XA 3H9BA 2FW9A 2NU6A 1R4NB 4JLBA 3DW1X 2XHEA 4M1MA 1OAAA 4QL3A 3JWJA 4REQB 3PKZA 4OHKA 4AK9A 4TSKA 1JYEA 2BTQA 1AHIA 4N41A 5A4DA 3K0FA 3R7AA 4JJFA 3A9CA 3EW9A 1CRWG 4IWNA 4OGLA 3HWX1 1GIAA 2B8JA 1XL0A 3PPXA 4CI0B 1ZMRA 5LD2C 5D51S 3RYHB 1LX6A 3WG9A 1Z0UA 3JQ6A 3IDZA 3L49A 1TIPA 3H1FA 4GMGA 4JOCA 4BV9A 3QFHA 4HYEA 3VAYA 1X14A 3NHZA 1U8XX 4G67A 1Z34A 5BSEA 5KOYA 3ZXUB 3QKUA 3EQ9A 3THRA 2HBQA 2OGUA 1T9ZA 1YONA 4ZVVA 2QBYB 1X7WB 3FSGA 5LP1A 5MGBA 2A5JA 4Z1MD 3PT9A 3W5JA 2IYSA 2QAGC 3HZRA 3FD8A 3O38A 4DZZA 4EJSC 4UMEA 1E2IA 3ADCA 1J0BA 5I5GA 3TZKA 1GD1O 2BLNA 5K3DA 2AR9A 5J4VA 3WIDA 1FTYA 1KO4A 1YZTA 2YS6A 5SYAA 4PRYA 1MVOA 4Q93A 1N3LA 1T4CA 1TAHA 3ZE2B 3FVVA 1RTKA 5KYWA 1EG2A 3M83A 2HLDD 3FSJX 1LTQA 3MAAC 2Q9BA 4KIWA 3SXJA 1YF3A 1BKYA 1WB5A 1JKJA 1DAFA 4C0SA 2VHXA 4OMFG 4GZMA 1Y42X 2YVLA 4LVCA 4J1NA 2QP4A 1H4TA 4TT3A 1XNQB 4EHKA 2BKUA 3P1JA 2NP6A 4CGZA 5HRCA 1O8BA 2IZOA 2V7QD 3GD7A 5MN4A 5DTIA 1K63A 3C3MA 3IE2A 3V9AA 3DKVA 1P1BA 3K53A 3OT5A 3RNLA 5DHFA 3EE6A 3VR4H 1YAHA 2RHDA 4RE6A 2XMQA 4B71A 3GEGA 1D04A 2R4UA 1RCTE 4LKRA 3AGPA 4WN3A 2DPHA 3L8FA 4QPCA 4REQA 4C7BA 1X0VA 4X6UA 4AXBA 1Q11A 2HDWA 4CHGA 4PC2A 5JSZA 1Q84A 1Z4IA 1HE5A 1HMPA 5J1TB 1QCZA 4XGNA 2HWYA 3D0QA 3B38A 1VLMA 1T2VA 3DHWC 5JCJA 4D5EA 3RYHA 3SDSA 2VP6A 1R6DA 5LIRA 1GLGA 1HFWA 2Y05A 5FIUA 1Q74A 1QZ3A 4U0JA 1LQTA 1QO9A 4Q3EA 1IZYA 4JJ6A 4H59A 2IHKA 5BV7A 4O6VA 2C42A 5EN4A 2QBYA 1QJ4A 1X7WA 1Z7EA 2ZJ2A 3PFGA 4HRXA 4X44A 4OX9Y 4JVNA 4I1OA 1A5TA 4NK4A 3QFSA 1P0IA 2I78A 2Y1KA 5F3WB 1SUBA 3AY3A 2OQ2A 4BLUA 1SB9A 3BUSA 4EW1A 4OMCA 1EXNA 1N9GB 5JW6A 4L07A 1QIIA 1RFGE 2G76A 3Q2KA 2WYWA 3R1IA 5FEMA 2P9EA 3K9BA 3VJMA 4DNOA 4H7JA 1OVGA 4PINA 3HJRA 1ZW6A 4A0QA 2V98A 3FDFA 1VE3A 3CZPA 4GX2A 4Q05A 3WBJA 1YZYA 2IELA 3K70D 4N3GA 1CQXA 4BNVA 3F6YA 1OH8A 3RAJA 2WWTA 3CIFA 2HL6A 2C9OA 1L9KA 3LIIA 5D3MA 3NGXA 2QLLA 4NZZA 1A7UA 1WP4A 3DXZA 1ORHA 5D01A 1JU9A 3OZEA 3PXDA 4R7ZA 3V2UA 3B6MA 4UOQA 2WT8A 3U3MA 1DOAA 3K15A 1CR0A 2OZKA 2QMQA 3DBLB 4Q9NA 1WZCA 1XC7A 1F6BA 1YS1X 2QN2A 4F93B 2B0JA 2ZCJA 1BEEA 3UMJA 1AF4A 3T7JA 1T9GR 3V55A 3AP2A 1D07A 5DULA 3DCIA 3QU5A 1PJSA 1P5HA 2ZRBA 3LX6A 4D3XA 1BWRA 1Q92A 5FPYA 3AVOA 4Y2UA 2IX9A 4JBNA 1TCUA 2WIBA 3O8NA 4KVAA 1Z6AA 1S0UA 2HUPA 2R7MA 4ZOLB 3BDAA 3KVRA 4FJ0A 2HJWA 4OGFA 3E3AA 3TEJA 1RZVA 2V1XA 4MNTA 3ADBA 2PO5A 2VCEA 3B1FA 3OPVA 4NESA 3U1TA 4BNMA 4O8ZA 3NNDA 4MKHA 2B7CA 5K4HA 2H1OA 1GT6A 3IMKA 1H2BA 3W7VA 2WJHA 2NADA 1ULHA 2WM8A 1TT5B 1SG0A 3NIWA 1YZGA 4OXIA 4DSAA 1OFGA 8ABPA 4DG9A 2V3WA 4X71A 3CN9A 2JGFA 3ESCA 1XKTA 4NH0A 4UD6A 2RGUA 3SZUA 1SIOA 2ZSIA 5ERYA 4QM6A 3K4QA 2ZKIA 4GAEA 1FYDA 5FT9A 1DO2A 1Q0ZA 5ITZB 4GC5A 4GEGA 1QPBA 2E85A 2JGEA 4R1QA 2ZSFA 2FGJA 3EHEA 1HTTA 1YKFA 2B61A 3GEDA 3IV6A 4UCQA 4AULA 5K01A 4O1HA 4K86A 1NW7A 1PV1A 4M98A 4GI2A 1ZM3A 2XMGA 4LC9A 3RDPA 3SX4A 3O4IA 5IJ0B 4W8OA 3SWWA 3UM9A 2D1FA 2B25A 2EJVA 4JBLA 5BSUA 2C99A 3OX3A 1SFRA 2BHTA 5D6OA 2GN6A 3EG9A 5LUBA 1H4QA 3VNUA 3DBIA 4U9IS 3BFVA 1MTZA 3V97A 2GYVA 3WL6A 1PL0A 2C2XA 2C2WA 3U1BA 1ZCAA 3BXGA 5HF5A 4RTMA 3FOAA 3OTWA 1R0YA 2GFHA 3PNSA 3TRDA 4ARCA 4W5JA 4WV3A 4YGXB 4P1ZA 4EPXA 2RBKA 2OO7A 4J7CA 5IUNC 4G85A 3RS3A 3NCTA 2N47A 2DGDA 4F4DA 4F4UA 5J23A 1BE1A 4RMNA 4Y98A 4KRGA 3SFTA 3SE0A 3LX5A 1SPXA 3HHPA 4FOOA 4GVLA 5G0WA 1FFXB 2Q6TA 3CKKA 4UEKA 2P9BA 5DBGA 1NBMD 4IOKA 1RXCA 1Z2AA 1K7CA 2J3DA 1U9IA 3RIEA 2Q1XA 4AKSA 2ZE5A 2CJPA 4HYTA 4UC0A 1XZPA 1NV8A 1ZD2P 3LX4A 5EJMA 1KMIY 4ZOLA 1YDMA 4DIKA 2OO5C 3IUEA 4YRDA 5EFZA 6GPBA 5KQSA 1G8KA 2YNMD 2H6EA 3F4KA 5G0SA 3BE5A 2CXQA 1K9SA 3FTDA 4LQCA 4QOJA 2AG5A 1F3LA 1OPRA 3OC0A 4Z4CA 3IRVA 4L4ZA 3ZQUA 2HR1A 1KA9H 3FAKA 2GPSA 4AJOA 10MHA 2AG0A 2ZYHA 3DTNA 3KT3A 4J16A 4RK7A 5M04A 3EN0A 3W5AA 1E6LA 1PZGA 5ECDA 2C2YA 4LYYA 5EP3A 2P2LA 3RR2A 3FHTA 3BA6A 5ITZA 1RWKA 1I0IA 1K88A 3AFHA 4LX0A 3KR1A 1IXRC 3ET5A 3L1JA 2CK3A 4QSMA 2AXQA 1AZWA 3CONA 4L0DA 5E8JA 4JR1A 4JT4A 2HU2A 3QI7A 5IJ0A 2E5LB 2V7WA 2YIDA 4KO1S 1HDIA 3AY6A 4FC7A 2WTUA 1XZJA 3OJCA 4TMYA 2HK8A 4RKQA 1N8KA 3HY3A 3Q4GA 2HA3A 4JXKA 4E2FA 2NUPB 2QUHA 3AR5A 4NCJA 5DNDA 4D42A 5CFPA 2W2OA 3AEQB 1QOQB 2DPYA 2ZRLA 3SEQA 4TTJA 4C4RA 5BO5A 4I08A 2FETA 5LOVF 5J59A 1R37A 3W7AA 2H1SA 2YASA 2YV2A 3CZ4A 3WGVA 3WBKA 4F9GA 3SKXA 5AW3A 4ZCIA 4HNHA 4JT9A 1T36B 2YFQA 1FFXA 3EVAA 4JJ4A 3TL2A 3V7UA 3W8NA 1Y80A 4D4JA 1G8SA 3BHIA 2XKBA 3JU3A 2F3UA 4AO8A 2YINC 4C29A 2QSZA 4DCTA 2NV0A 5IAGA 3QXXA 1IBMB 3QHQA 1NXSA 4CM4B 4RD3A 2WWRA 2IS2A 4JIGA 1PD1A 2R8YA 3PICA 3L3BA 5C51B 5EPOA 3WRXC 4CKEA 5CEJA 1AK9A 1OXBB 1M5UA 2PG3A 2QWXA 5CR9A 1NMXA 1LC0A 1QTNA 4G8DA 2WAXA 1V6SA 2BJHA 2XCQA 4WWHA 1GAXA 3W5HA 3ADOA 3IUNA 2R60A 1T8SA 5C5IA 2O2YA 4R3UC 1KOGA 2GN4A 2KW5A 2E5WA 4HH0A 2ZJBA 3U7IA 4BB6A 1EA5A 3HCFA 1J5PA 3DTVB 3IR5A 3I83A 3OCYA 4GQBA 3QVOA 3PTLA 2VJMB 3NBXX 2OKGA 1DNPA 4QGBA 4X1IB 4BNYA 1JDSA 4B8YA 3Q7PA 4WFJA 3WTBA 1MLDA 4A92A 1DAGA 3DDZX 3QV1A 5CLIA 4DS3A 3S7ZA 2AR0A 2WWFA 4GOND 1AKUA 4TTAA 4WBNF 5KWEA 4B75A 1ZUWA 3H1GA 5JYEA 3EEBA 3KETA 3NTOA 4MVWA 1CC1S 4RIIA 4EITA 1EK6A 1XROA 4MB6A 3RJTA 3BMOB 3FZGA 2NUPA 3WNCA 1OZFA 3L6OO 5I6DA 2BUBA 5I9BA 2JAXA 3OFKA 2DERA 3V4OA 3OM1A 3DDOA 5L45A 2EFJA 3CCCA 2I3AA 3CLUD 1M2VB 4J6EA 5T64A 1BE8A 2PMFA 1EAMA 4NCIA 4OQLA 4C0HA 3G17A 1B41A 3I05A 1G19A 4L5BA 4MLDA 4BN5A 4EZIA 2NVOA 4PFKA 4RTQA 1VFNA 2I6XA 2NU8A 4LHVA 1EFTA 3ZLBA 2G8LA 4A2PA 1JYSA 1UBKS 2IEAA 3IVCA 2GXAA 2WSIA 3VH3A 5CEEA 1IZZA 3H5OA 4R40A 1NKSA 1P81A 2O23A 2X19A 2GEBA 1XVLA 4LEIA