3G9ZA

Crystal structure of este5, was soaked by p-nitrophenyl caprylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
b'MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Structural and biological characterization of EstE5
rcsb
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9zA00
4OD0A 1QIEA 4DNQA 2XMSA 3QITA 1LPNA 2OLEA 4Q82A 1EH5A 3DNMA 2QXUA 3D0KA 1HBJA 2V97A 2Z8ZA 4EY4A 4MYSA 3STUA 1CUBA 2GBFA 5JAUA 4G4GA 3AIKA 4J0HA 2WIJA 2ES4A 2OQIA 1FFBA 4GEGA 2HU5A 5HK8A 1QFSA 2VQ6A 3VJMA 4GWLA 4BCCA 2RONA 2BFNA 2XT0A 3ZLUA 5K3FA 4RPCA 1CUHA 5JAHA 1DWQA 5C8ZA 3QMMA 1R4ZA 3PUHA 2WU3A 4KJXA 3FYUB 3V1LA 1WHSA 1JT2A 2OGZA 3FVTA 1PV1A 1QTIA 1EDDA 4B7ZA 2IITA 3M3DA 2WJ3A 4RGYA 1Y37A 2CKMA 4JEIA 3I1IA 4X94A 3WIOA 1BCRA 3BWXA 3B5EA 5LYYA 1ZICA 5HFNA 3IA2A 2OCLA 3FNBA 3I2JA 4PSDA 2HA3A 1YS2X 3TRDA 4B0PA 1XROA 5LZ4A 3OURA 1IUPA 1VA4A 3O4IA 1RP1A 3FYUC 1GGVA 1O6FA 5K3EA 4BCBA 3HI4A 5H3HA 4B6GA 4DSZA 1JMKC 1UOPA 4OCZA 4TVKA 4BZWA 2ZSHA 4FKBA 1J07A 1C7JA 4OUKX 4EZIA 3AINA 1MPXA 3H2KA 5AKYA 4XIIA 3QMVA 1CUYA 1EK2A 1QIGA 1QO7A 3C8HA 4QWWA 5ALRA 3AJAA 4AMYA 2HA6A 2PU7A 4KE9A 5A62A 4MYDA 3OC0A 3R3UA 4G4IA 1TK3A 4W9RA 4E11A 5E2IA 3GELA 4F0JA 3HJUA 2QUBA 4H0CA 1UKCA 5I9IA 3A6ZA 4KRYA 3KD2A 5A7GA 1IUNA 3WA7A 5AIAA 4PW0A 5DNVA 1U2EA 3WKDA 4U2CA 1XZGA 3K6KA 4DMHA 1F0PA 1JU4A 3D7RA 4UBNA 4LXHA 5AIBA 4H18A 4UBJA 3LIPA 3RLIA 5AKKA 1AUOA 2WTMA 4BYMA 4HAIA 2V98A 1ZI6A 2DFPA 3MUOA 3OG9A 5ALSA 3STYA 3F8SA 5ESRA 2X8BA 5JYCA 4NS4A 3G02A 2J3DA 4U2GA 2H9YA 1Y7HA 1R9MA 3L1JA 1X70A 4BB0A 4Y2UA 1QO9A 1YASA 4KE8A 3AIOA 1XZMA 3C5WP 2PKYX 3H17A 3G0IA 4C6HA 4HRXA 1EA5A 5JADA 4DM7A 4XVCA 1LGYA 1XRMA 1MNQA 2ZJ6A 4QLOA 4U2EA 4MWSA 3VJKA 4KE6A 3HRHA 3HXKA 1XZAA 2HA2A 4LIPD 4OU4A 2JIDA 1C4XA 2QMQA 3OPMA 1SCIA 1OCEA 2XMCA 4TPKA 1THTA 2Y6VA 5K3FB 4JH0A 1MAHA 3ZI7A 3QPDA 3GFFA 4KACA 3WIBA 1CEXA 5C8XA 4HXFB 3WZLA 4AN1A 3C70A 5AM2A 4BC0A 5K3AA 4M0FA 1TKRA 4KYVA 3D4LA 2WILA 1AGYA 4X3CA 3M81A 2AJDA 5K3BA 4IQ4A 3JW8A 1ZGCA 4L3WA 2XMQA 3DKRA 5CXUA 3KOOA 1D07A 1T2NA 2DHCA 3R3YA 4X97A 4IO0A 1ZIYA 3VDXA 4IH4A 1WPRA 5AP9A 4H7DA 4LYDA 4BE4A 1IMJA 3U1TA 2WSLA 5AKZA 3FYUA 1CFJA 2XLCA 1CUAA 4KE7A 2ZVDA 1XZCA 3EQ9A 3EBLA 5AKJA 5JALA 5AM4A 1HQDA 3A2MA 4JYMA 4GW3A 1YR2A 1EK1A 1CUWA 2ZJ7A 5IVKA 4G8DA 5FOQA 1VLQA 2OQVA 2C58A 5ALLA 4UHHA 4XWGA 5JD5A 1N1MA 1UOQA 3UMJA 5JANA 1QIFA 4AO6A 4UFPA 3WWCA 2BAGA 1EI9A 5EI5A 1CLEA 4C4ZA 3WKEA 1JFRA 1CUZA 3ANTA 4K6KA 4L0CA 2E3JA 3CN9A 2J3QA 2WUFA 1F0NA 5J3JA 3RKSA 2YYSA 3WJ1A 3KXPA 4K6HA 3IBTA 3ZPXA 5D3KA 3F97A 1HLGA 4WFJA 2PL5A 2JGJA 1YSCA 3EQ7A 5SYMA 4ITVA 2WUGA 1B41A 5EIEA 3GBSA 4MQMA 1NU6A 4CI9A 1CUJA 1XZBA 3PI6A 3BF7A 3V1MA 3QYJA 1WM1A 1CIJA 3WL5A 2VAVA 4EY5A 2H7XA 4AQDA 4H7KA 1VKHA 5EHNA 4C4YA 4Z49A 2G4LA 2XMDA 1Y7IA 3FLAA 4G5XA 1VOTA 1W1IA 4S0XA 1ZJ5A 3JWEA 3GA7A 1GKKA 2O2GA 4BRSA 2R11A 2V9ZA 5DNWA 4X93A 1WHTA 2QM0A 4QDOA 3WKCA 1NX9A 4Y2PA 3H2GA 2XUDA 5K3CA 1UK6A 1IUOA 4KEAA 1QGED 4I19A 1K63A 3FLEA 2ONCA 1XFDA 1W4LA 2JGKA 3DS8A 2Q0XA 1L7QA 1AURA 4X6YA 4B81A 1ETHA 3S2ZA 3SC2A 3VJLA 4NMWA 2XUQA 5FUMA 1BROA 2XQFA 2AJLI 3HC7A 1XRPA 4CCYB 3AILA 4UFNA 4HS9A 4I3FA 1E5TA 2VT7A 3G0DA 5A7FA 5DYTA 4UFOA 4DTCA 3BDIA 3NOXA 4JYPA 1YB6A 3N2ZB 5HZGA 5T4HA 2XUHA 4JNCA 3A70A 2B9VA 5AICA 4Q1VA 3G0CA 2D0DA 3H2HA 3QPCA 3FYTA 5IVIA 1EX9A 2VJBA 2V96A 4WFIA 1CUXA 1DX4A 3I2FA 3LP5A 4CG2A 4EY6A 1BCSA 3WK4A 1P0IA 2JBWA 3O9MA 5FDFA 2OG1A 2Y2VA 1E89A 3FCXA 5LZ2A 2WHRA 5ALUA 1RWQA 2WFZA 1HPLA 4C01A 2GBCA 2VA9A 1UK7A 4FNMA 3BE8A 1W52X 3F98A 4HZGA 4PSUA 4N5HX 4PF1A 2HA5A 1LPAB 2ZJFA 2ECFA 2I3ZA 5AI4A 4P92A 3V1KA 4E15A 3A2LA 4P9NA 3HZOA 5C81A 3STWA 1XZKA 3AZQA 4BTLA 4F60A 3VKFA 2Y6UA 3R41A 1E3QA 5FP0A 4QWMA 4EY7A 1BRTA 2RI6A 1HKHA 4QA9A 1XRQA 1XLWA 3VVMA 5BV7A 4ZREA 1DT3A 1GKLA 4AX4A 1MU0A 2XUAA 1CR6A 1E8DA 1EB9A 1MX1A 4EUSA 1QIIA 3HSSA 2BJHA 3L1IA 4CIBA 2C4HA 5DTIA 3I1YA 2O7VA 3W06A 1MX5A 1ORVA 4KAAA 1XZEA 2QRUA 4FTWA 4QEKA 3ED1A 3HEAA 2H1IA 4O08A 4Q3OA 1PFQA 2FUKA 1NU8A 5KBYA 4J0CA 5CRIA 2H7YA 5AKEA 3D3NA 5LP1A 3PICA 2RAUA 1CUFA 4YASA 4MEAA 5T4BA 2QVBA 1BE0A 2WHQA 5JAPA 1L7RA 5ALQA 3Q0TA 3H1BA 3CN7A 4W1RA 5F4ZA 1H2YA 4Q34A 5FPQA 4DLNA 3W05A 5I7UA 1U65A 4DMCA 3AZOA 1DQZA 3C5VA 2JGMA 2DHEA 1MNAA 3G0GA 2QOEA 1K5PA 1B6GA 1CPYA 5DYYA 1XQXA 3A2NA 1VE6A 4ARAA 3T4UA 3KWJA 4B85A 2PSHA 2WQZA 5ALDA 4K5QA 1VXRA 2B4KA 5AOBA 4HXEB 1FFEA 3BJMA 4FLMA 3OTQA 2VJCA 1P0MA 4JUIA 2FJ0A 4B9EA 5AKGA 5A71A 5ALGA 1UWCA 4UBKA 1R88A 5EHZA 3D59A 2XI4A 2GZRA 4ZV7A 4M0MA 3FOBA 2CJPA 2Z3WA 2HM7A 1DX6A 5HKAA 5LKRA 1CUSA 1ODCA 1OXMA 2Z3ZA 1CRLA 3H2JA 3NGMA 5CT8A 2AJ8A 3GROA 3WMRA 1LPSA 5CW2A 1AC5A 2WFLB 3H04A 1CUGA 2BKLA 2QS9A 1A7UA 3AFIA 3STVA 5SYNA 3GZJA 3ESAA 1HL7A 2HA0A 1R9NA 4E14A 1L7AA 3IUQA 3C43A 2VEOA 1QTRA 5LZ9A 3O0DA 1DWOA 4BP8A 5JASA 3E1GA 3I2IA 3BIXA 3AZPA 4J0KA 2XUPA 4FNGA 4AB1A 4DIUA 4GECA 2PU5A 1XQWA 5K3DA 3IUNA 2G63A 3WKBA 3QMWA 2RHWA 4WY8A 1LPMA 2PSFA 1AKNA 4OB8A 2Y2UA 4G9EA 2GYVA 5A6VA 1UK9A 3VXKA 2JEZA 3QPAA 4PV7A 4CIAA 1ZD2P 1A8QA 2DHDA 4FOLA 3RK4A 1BS9A 3G9UA 2IIVA 1E8NA 4FFVA 2BCEA 2OAEA 4UBIA 2JEYA 5IVDA 2C0PA 3ZWQA 2ROQA 4Q3KA 5ALVA 4H77A 2JGIA 4H7IA 1TRHA 1GPNA 3G9XA 4QE3A 4QLAA 2GBIA 4B83A 2JGLA 5A2GA 1FSSA 5CXXA 2UZ0A 2WFMA 1GPLA 2ORYA 4HXGA 5IKXA 4X90A 1ZI9A 1LZLA 2WJ4A 3SK0A 4RNCA 3K9BA 1KEZA 4WCVA 5DTJA 1VE7A 1QJ4A 3S8YA 2PUHA 5AI6A 4DYHA 1R1DA 2WM2A 2VATA 4B84A 1WB6A 3CCBA 2WUEA 3WK6A 2XUGA 3FCYA 5D7BA 3IB3A 1ODSA 4GBGA 2DQYA 4DGQA 1H2XA 2XQIA 1ZD3A 4ETWA 1JI3A 1A8SA 3VISA 1S8OA 2ACKA 5ALYA 5C8VA 2XMBA 2WG2A 4OSEA 1QIMA 4YK7A 4N5IX 4J0IA 3DYIA 4H35A 5AM1A 5CBKA 1TCBA 2PBLA 1KU0A 4AO7A 5ALZA 4HTAA 5ALMA 5HQ3A 2WLSA 3WK7A 5IVHA 3C45A 2QJWA 3WA6A 2O7RA 3VVLA 3WZMA 3YASA 1R3DA 4I4CA 4FDMA 3DJYA 5EIAA 3WJ2A 1EXWA 4P08A 5I8PA 5HKBA 3GUUA 4ZWNA 3PFBA 3DQZA 4B82A 4BZZA 1CVLA 5JZSA 4DMFA 2W22A 1CUIA 3G0BA 2OGSA 3BJRA 1ZD5A 3ANSA 3H1AA 2CZQA 4LXGA 3W9UA 4FBMA 3L1HA 1BN7A 1UT6A 3I6MA 4ZGBA 1F6WA 2WFLA 2ZYIA 5LZ7A 3D2AA 1XRNA 2WHPA 5AM0A 5CURA 2XUJA 5ISMA 3W2TA 5ALTA 4FFWA 3W04A 1J2EA 2QTBA 1M33A 3DDUA 3X3HA 1G42A 5ALEA 3HABA 2ZYSA 2VSQA 4GLBA 1FJ2A 1MAAA 5LZ8A 2DR0A 1LNSA 5FLKA 3STXA 3WWPA 1AMNA 2XUIA 3OOSA 5BOVA 4QDZA 4U2BA 2WU4A 3PF9A 2DCMA 2YASA 3QH4A 1UZAA 1QLWA 4EHBA 5KWJA 2EEPA 5YASA 5IH7A 3SWWA 3RARA 1VZ3A 5AJHA 1WB5A 4DSAA 3D2CA 5DLPA 4J7AA 4BAZA 2G5PA 3W9BA 3E0XA 3ILSA 1VXOA 5CTAA 2AJBA 3JYHA 2XMZA 1BEEA 2WJ6A 3EQ8A 2YH2A 1E8MA 4G1FA 4BRZA 5KWIA 4ZRDA 4FMPA 3T52A 4F21A 2HADA 4Q3LA 2WHPB 1USWA 2XDWA 3C6YA 4G8BA 2D5LA 2RIPA 4DNOA 1ZOIA 4BAGA 1DT5A 5ALJA 2JGFA 2ACEA 2LIPA 3ZV7A 4CCWA 4A16A 1UOOA 2FJPA 2IX9A 2R8BA 4UBLA 4BE9A 4EBBA 3WK9A 5T4FA 3I6YA 1EHYA 1H2ZA 2O2IA 4FLEA 4BDSA 4H7FA 2G5TA 3QBJA 2QUAA 2I03A 3F96A 2VJDA 1TCAA 3WYDA 1Q84A 4IH9A 1ISPA 1UKAA 4BCDA 5D6OA 2HFJA 1BN6A 1DINA 3R3ZA 4QDXA 1JKMA 1IZ8A 1U8EA 2I78A 1TCCA 3TGLA 5JAOA 4Y9SA 1WOMA 1H22A 2DSNA 4WDRA 3WKAA 1W6RA 4Y2RA 5LIPA 2WG0A 3B3QA 1DTEA 3FLBA 2ZYHA 1MN6A 3QM1A 3G9TA 2PM8A 4IHAA 1W75A 3PFCA 2HRRA 5AO9A 5AKLA 2CBGA 3G8YA 3B12A 5K5EA 3WWEA 4XJVA 5JIBA 3CXUA 2B20A 4PO3X 1YB7A 1ODTC 4AZ0A 1CQWA 1ZI8A 1G4HA 3IVMA 1XZFA 1QONA 1LPOA 5HF8A 3N0TA 1XZLA 1K6EA 3O95A 1LPBB 4FWBA 2HIHA 2NW6A 3DCNA 2XLBA 3HLKA 2WTNA 1RYYA 1A8UA 4ARBA 1SOMA 4UHCA 4OYYA 1X2EA 4EY8A 1H2WA 3DL4A 5EIHA 4BAUA 3ESDA 1ACJA 5CT9A 2OPHA 4E46A 4A23A 2GZSA 3H19A 3DOIA 4N8EA 3LS2A 5ALKA 1G5FA 1X2BA 3M83A 2BUCA 2VTVA 4P93A 2HU8A 2QZPA 2WIFA 3BL8A 5AM3A 3DYVA 1MTZA 2BUBA 1QZ3A 2HU7A 3WK5A 5ALPA 1AZWA 1MJ5A 4LHEA 3IIIA 4GXNA 1OILA 4J0DA 5BWCA 5ALIA 2VAXA 4C87A 4UHFA 3WK8A 5FKJA 5AK5A 4UBOA 3V1NA 5JZBA 1DQYA 5ALNA 2EDCA 2JF0A 4AMZA 4BDTA 1FFCA 5AK4A 1FFDA 1Q0RA 1SFRA 2YXPX 1CUCA 4H7HA 3C6BA 4W1SA 3DOHA 1XRLA 3BF8A 3KWFA 2JGEA 4BVLA 2GBGA 4NVRA 5HK9A 3FVRA 4GDMA 5EGNA 1YAJA 1YS1X 1XZHA 3NUZA 4KR0A 3V48A 1EDBA 4FHZA 4WFKA 5AOAA 5C7YA 4LXIA 4XX1A 4MJ3A 2WIKA 1UFOA 4Y2XA 3C6XA 4UBMA 4X6XA 3OM8A 5CH8A 2CEKA 1GQRA 1VJ5A 3U0VA 2AXEA 1MO2A 4U2DA 3LIIA 4J0GA 5EHQA 1N5MA 3EF3A 2WG1A 2XQJA 3R40A 1IVYA 5JZ9A 2HL6A 3FSGA 1EINA 4LKOA 1ZJ4A 4K2AA 3KDAA 1CQZA 4BTVA 5HFAA 4PNZA 4L9AA 5ALXA 3DKKA 4WJLA 1CUUA 1SC9A 3C87A 3TEJA 1EDEA 1AX9A 4UHEA 4X95A 4WDQA 2PVSA 4BBZA 3MUNA 4MXDA 2WUDA 4OPMA 1MX9A 1QIKA 1EB8A 2XQKA 4G9GA 4INZA 3IULA 4LYEA 1K8QA 4IH1A 5HF6A 4ZI5A 5AH0A 1GT6A 1U4NA 4OU5A 3O4JA 5JD6A 1EVEA 5JD4A 3PF8A 5AI5A 2ZSIA 1VA5A 3E4DA 2OAGA 3LLCA 4W1PA 1XKTA 2HA7A 1THGA 2XUFA 3RM3A 3WYNA 1TAHA 1SCQA 3I6ZA 2WIGA 1PJAA 3UUFA 5AKXA 2PPLA 1Q83A 5ALFA 1GPKA 1E66A 3WWDA 2QT9A 1C7IA 1DU4A 1XLVA 4B9AA 1MT3A 4N8SA 1ZIXA 4X7BA 4X6UA 4HVTA 2OXEA 4MQLA 1SCKA 5FRDA 4ZXFA 5LZ5A 3AUKA 4C4XA 2QR5A 4FBLA 1QE3A 4X92A 3AIMA 2XQGA 1XQYA 3IUMA 1CUDA 1J1IA 5DWDA 4C89A 4F5ZA 2EDAA 4UHDA 3Q8WA 2C0QA 1G66A 3I2HA 2P8SA 3O4HA 1ZD4A 1YA8A 1QIDA 2O2HA 1JJBA 4V2IA 3DLTA 1XZIA 5ALHA 1TIBA 3IDAA 5E4JA 5ALWA 1EVQA 3NWOA 3G9ZA 2CUTA 3R0VA 5KREA 1GXSA 3E3AA 1KU6A 2XE4A 3HACA 2PX6A 1JMYA 2PSJA 3C8DA 1AQLA 2B61A 4Y7DA 1XZDA 3ESBA 4A5SA 4GHWA 5JATA 1Q0ZA 1R50A 4GI1A 3F9CA 1I6WA 1WCYA 4MWTA 1N8SA 3WQHA 4N8DA 1LLFA 1XRRA 4H7EA 4KAFA 7YASA 5HF9A 4Y2QA 4Y2YA 3WL7A 2PSDA 2RGUA 2BGNA 2Y1KA 1YCDA 4QNNA 4CG3A 5LKAA 3I2GA 5CH5A 4C88A 4PSCA 4J3JA 3ICWA 1UKBA 5FXMA 5T4EA 4UPDA 4B0OA 4L72A 3EIOA 4AZ3A 1UXOA 5D3ZA 1N5RA 3LCRA 5HCUA 2K2QB 4W63A 3ESCA 3TJMA 4EA6A 4WY5A 3ZLTA 2VF2A 2VJAA 4UHBA 4AO8A 2I3DA 1O6GA 4ZV9A 5HQ3B 5HF5A 2XUKA 3WL8A 4K6GA 3R3XA 5AK6A 4X85A 3DEAA 1A88A 1ORWA 2W6CX 2OCIA 1LBSA 3DL7A 2GYWA 2XB6A 3WL6A 1GQSA 1GZ7A 2RHTA 2HHAA 3ICVA 3MVEA 5DNUA 4CFSA 5FV4A 3DD5A 3PE6A 2AJCA 3K2IA 1XLUA 3D2BA 3M82A 1P0QA 5CT4A 4W1QA 5AM5A 4Y2TA 4X71A 4FLFA 2HFKA 1LPPA 3H18A 3R3VA 5BWBA 1YAHA 4YPVA 1XQVA 1ZGBA 4BP9A 1K4YA 5DJ5A 3D5EA 1JU3A 2Z8XA 4H7JA 4Y2SA 3MGAA 1CUEA 1QFMA 4QZVA 2PUJA 5CT5A 4NZZA 2C7BA 2CB9A 1FFAA 5AI8A 3R3WA 3QZUA 3H0CA 2ZYRA 2WKWA 3O9VA 3HYSA 4KAJA 1ACLA 2J4FA 3V9AA 1XKLA 1JJIA 1UK8A 4J03A 4PQEA 1QOZA 1W76A 4AN0A 1BU8A 1P0PA 4D9JA 2OGTA 4MEBA 2GYUA 4RE5A 3WLAA 3PUIA 2XUOA 1LBTA 2OCGA 5CMLA 5AK3A 4BVKA 4RE6A 3ZLVA 5AKHA 1BEZA 2WIDA 5A7HA 3I28A 1VZ2A 3BDVA 4Y2VA 4EB0A 3WI7A 4CCYA 5AOCA 5AI0A 4BC1A 5EHXA 1TQHA 2FX5A 5AI9A 4QDUA 1J06A 3O4GA 2C5GA 1H23A 2QKYA 4UUQA 2VT6A 1YA4A 2H7CA 2BUAA 1JJFA 2XMGA 4B80A 4M0EA 4QDTA 3C6ZA 2HDWA 4KRXA 1F8UA 4U2FA 3FAKA 4X00A 2DQZA 4G4JA 4Y2JA 4YX9A 1LZKA 2QJRA 3PDCA 3BXPA 5LLSA 5CH3A 5DYWA 2X76A 2BGRA 3IURA 4DMKA 1DWPA 4Q05A 3IUJA 3SX4A 2HA4A 3I2KA 3P2MA 4HRYA 4TGLA 5FPPA 3BIWA 3UUEA 3F67A 5AHXA 3FSGD 3WWOA 4DNFA 3KSRA 4BVJA 4ROTA 5CT6A 2C5FA 4G8CA 2J4CA 1WPXA 5E4TA 2XMRA 6YASA 2QXTA 3FBWA 1WB4A 5AKIA 4DNPA 5E4YA 2OCKA 1CV2A 3CCCA 4OYLA 5JARA 1QIJA 3H2IA 4CG1A 1HDEA 2CMFA 5ALOA 2Z5GA 4AXBA 5EFZA 2X5XA 4J0JA 2HRQA 3STTA 3FWHA 1T4MA 1XZJA 1QIHA 1IZ7A 4BATA 1Z68A 2PSEA 4OB6A 4X91A 4OB7A 3G7NA 3QVMA 1CUVA
chains in the Genus database with same CATH superfamily
3ENQA 3N59A 1XEXB 1HURA 1MVLA 4DQKA 2ZXEA 1LPNA 2SICE 3LLSA 3AXTA 3WB2A 4Q82A 4OXIA 1EH5A 2WB2A 4MYCA 3VRHA 1NN1A 2QXUA 3AJRA 5L9AA 2I4IA 3QVTA 3OOEA 2GTHA 2HBQA 5L3SA 1LRKA 4EY4A 3S8MA 3CGWA 4DLZA 1VPWA 2GBFA 3CH4B 3AIKA 4KGVA 1S89A 4FEEA 2OQIA 4C29A 3I9MA 1HK7A 3WADA 1FFBA 3BGIA 5HK8A 1QGOA 2NPOA 2VQ6A 4RDIA 4RK0A 2IZZA 2JI9A 3RT7A 2AVDA 2FWMX 4ZVOA 1GAJA 1J9GA 2W6MA 3JQ9A 1GGEA 4QXPA 1NRJB 2M6KA 9LDTA 3OICA 2W6QA 4MS3A 2GN2A 4LOAA 5K3FA 4GEKA 3U61B 4FT4A 1JR4A 4RPCA 1NFRA 1X74A 2BBWA 3VC2A 5JAHA 1ZH8A 1Y1RA 3KM0A 3MT9A 2OTCA 1YRBA 1KERA 2B4RO 1OFTA 4LYHA 2QV0A 1GNPA 2CGEA 2OVFA 3PNLA 4I99A 1T34A 1TE2A 4IIDA 4WZ6A 4AF8A 2GUGA 2WU3A 3PUHA 4IUBS 4KJXA 3ZWXA 3X1YA 2GCOA 1G59A 4N0MA 1Z73A 1P75A 1WHSA 4ZAYA 1QYVA 4YBZA 2OGZA 2ZRLA 3EVGA 3FVTA 3VH1A 3D4OA 4UEKA 1U2ZA 3M3DA 1KK3A 4YNBA 4DIBA 3UBTA 5IKEA 3BFXA 3OU7A 3AKYA 1UF9A 1Y37A 4UD6A 1PZGA 3L1KA 4D8UA 2C7OA 1FBNA 3KJEA 3X43A 5LLDA 4BWFB 1AMOA 4ZT3A 3BRSA 2CMHA 2QJOA 1XPRA 5BWMA 5E1MA 2QLJA 3B5EA 3INRA 3PLRA 2I1VB 4GMXA 4OJTA 4URYR 5KNDH 2G67A 3IPCA 2PBZA 4MWZA 1U1IA 2OCLA 4PFJA 4W6ZA 4B76A 4N18A 3I9NA 1WDWB 5JTUA 4DSOA 4GBJA 4A15A 4B0PA 3NKLA 3VZCA 3OD5A 3IL2A 5LZ4A 2BMVA 3MM4A 1PJ2A 4ICIA 5E3IA 3FDXA 3OURA 3RVJA 1VA4A 2WEKA 4D3DA 1E61A 2CLSA 4C43A 5CDHA 2EIXA 4H15A 1XJQA 2H65A 3DC7A 1OZGA 2IIPA 1JPNA 2PYDA 5CK5A 3RTDA 4WK2B 4CMGA 5J4HA 2G4CA 2ZPTX 5DMXA 2P11A 1MC5A 3N2GA 1NI5A 4P7KA 6ADHA 2NU7B 4ND1A 5HVNA 3EVEA 3R0QA 3VR0A 4P36A 3ZHBA 2DLDA 4AJ1A 5KC9A 5MF6A 3J81k 3OC6A 2GCNA 3BM5A 3RVLA 3SFZA 1JKFA 2AFIE 1QHYA 1TEVA 4OUKX 4I9UA 1RAFA 3M3HA 3B13B 4AG6A 1N2GA 2P9BA 3F5FA 3ACDA 1CUYA 7ABPA 4Q4HA 1IOWA 1CP2A 4UEQA 2XOKD 1JX6A 3HK2A 5BSMA 5DBFA 1NXQA 4WSOA 1ULSA 2JJMA 3QA9A 2VJYA 1SBQA 1NHWA 2M98A 2O7SA 2VIIA 1P2UA 3JYOA 4KE9A 4R7ZA 2GAAA 3T4PA 5J43A 5MGNA 1ID1A 2J5BA 3ORQA 2H4JA 3BSFA 3NPAA 4GL4A 3E35A 2C2WA 2JD2A 3R3UA 2ZXUA 3ABQB 1T2UA 4E11A 5E2IA 3P5BA 2BRUC 2IP2A 4F0JA 2VNSA 1Z82A 1E5DA 3DWGA 4MULA 4XSVA 4WOCA 2QUBA 2CXHA 3HJTA 5THXA 1NUTA 3VR6A 1WHSB 5I9IA 4I50B 5HEKA 4ER5A 1GUBA 2HBZA 1V2GA 4KRYA 1GCGA 3EFEA 1KGSA 3IOBA 1IUNA 1Z4OA 3G49A 3PG5A 2QRMA 4P7GA 2Q4DA 3Q6NA 5G1OA 2C54A 3URKA 4DV1B 4DV0B 1BE8A 2X42A 1KY4A 1AKEA 2H4WA 1V41E 3A6HA 1U2EA 1X0XA 3KTOA 5DNVA 2ZUEA 5FJIA 3TZBA 4CIDA 3OUTA 3CHYA 2IWRA 2OXFA 1S5PA 1F0PA 3HU5A 3KLMX 5EESA 4DMHA 1JU4A 3HB9A 1AK9A 1MR3F 2X5JO 1IRXA 1LWOA 2P2DA 3EC7A 4JLAA 4BO8A 1NDUA 2GLTA 4XWYA 1OW3B 5BV0A 4RF3A 2NSHA 4F12A 3RD5A 5JH7F 3TLCA 3D4NA 1SQ6A 4DZTA 2CNWD 3S1AA 1TFUA 1U7HA 3EE6A 1Z2PX 3NCTA 3WSWA 1AUOA 4H0NA 5EP2A 3UK7A 4XQ9A 3RIYA 4QO7A 2ZGVA 3CLVA 2YY7A 4CKXA 2G0NA 3DBVO 3JYPA 1XEXA 1MXHA 1Z4NA 2FZCA 4FIZA 3WGUA 4ZK2A 3QBEA 2C7PA 3DL2A 2V7BA 2ZS9A 4HUQB 4MP6A 4B8YA 3STYA 4NY1A 3BREA 2RGAA 4HADA 2C5HA 4JDUA 4S24A 2OVBA 3F8SA 4JBXA 2AOUA 4Y18A 1JIXA 3HRKA 4UOQA 2OFPA 1G3MA 1IM5A 3DJFA 4CMHA 1QS0B 1TAQA 5F3RA 1M6EX 2IBSA 3G02A 4U2GA 2YWDA 3FTQA 1QPZA 1ENZA 1GR0A 3GHHA 3V32A 2A7XA 2WF9A 3G82C 1G3UA 3ZW7A 3WXMA 4CUKA 3VSEA 1ZG3A 4I9HA 4KPEC 1BFDA 1K27A 2GZ2A 1GWNA 2PKQP 1YZLA 1QO9A 4Q3EA 5EWLB 2QUHA 2F43B 3H8SA 4KE8A 2LDBA 2VA8A 1Z0DA 1OXUA 1PS0A 4RZ3A 1J21A 2H4FA 4F4HA 2XKBA 3SC3A 3AIOA 3QWAA 2HY7A 4P98A 5AW9A 1D6SA 4ND8A 1KH2A 5EINA 5F1PA 1GGNA 3LXMA 3MT8A 2J67A 4MTLA 5KPJA 3P7MA 4XLLA 1P5RA 3UT5A 4FEGA 4HRXA 4YRCA 1EA5A 2ALJA 3MWLA 1JEQA 4NAVA 3QWFA 2OV2A 4D44A 4LHWA 3ZWBA 2ONYA 2QR3A 3LLUA 4XVCA 3GRCA 2NXNA 2OECA 5L3RA 2O8NA 2XQVA 4RA9A 1USUA 1G4UR 1XRMA 2O2YA 3T7TA 1BIFA 1MNQA 3I5AA 4U8HA 5EJ6A 2VPZA 3PHLA 4QLOA 4BO0A 1KYTA 1PD1A 1Z28A 2KJQA 3BX1A 3V7NA 4E2YA 1E2DA 4FT2A 1R0XA 4PXYA 4RK7A 1M2OB 1RBYA 1W9MA 1WZUA 1N7HA 1Z83A 1C9KA 2VHUA 3QWHA 4UE3S 5SY6A 5IF3A 1R0WA 4X7PA 3V1YA 4LBZA 4B33A 1G2OA 3HHEA 1AHIA 2CWDA 4J4HA 2O23A 3UAGA 4EG0A 1JBKA 1GQOA 2HA2A 3CKYA 5DK4A 3SDSA 2PIAA 4BRUA 4HB3A 4IPTA 3DHVA 2G80A 2YHIA 2QMQA 2VWHA 2JFWA 1SHKA 3E3MA 4WASA 3S55A 3MTQA 2QT0A 3CE9A 3U7EB 4D9IA 2GCOB 4K88A 4BOYA 3NHRA 3CLKA 1V7CA 4J7UA 4LJAA 3MTIA 1YUMA 2GM4A 2VP6A 3E70C 2FRDA 3FPBA 3JWPA 4W8GA 1NXTA 5EHIA 4YRJA 5JPIA 3V2HA 5BSHA 1OHHD 4HGOA 2VPQA 4JT8A 3AF5A 9GPBA 5K3FB 2AA3A 4PAWA 4R1TA 4JH0A 4IXWA 4M1SA 4UVHA 2A4KA 4MZDA 3ORSA 4BV8A 1N2CB 4KACA 1ZA2A 4MGKR 4EAAA 2ERCA 1CEXA 3OKCA 4HNSA 4ND7A 4PFQA 3AVWA 4HXFB 1RWNA 3N70A 2MJLA 4PCVA 4KR3A 5K2OA 3LFUA 4F11A 3ERCA 1R8XA 1GKUB 1TU0A 3BCRA 5K3DA 5LBTA 2MINA 3HP7A 4BC0A 2W6OA 5I7OA 1L5KA 2GAJA 4TTRA 1U9JA 2C57A 2WUWE 4KYVA 4H60A 3A36A 1GIAA 1M74A 2CVFA 4TVSA 5FUWA 1L2TA 4M0LA 2WWYA 1IXSB 1AGYA 3OZVA 4ETMA 2BKEA 5K8CA 1QX4A 3ROGA 3GRKA 1X1SA 2AJDA 1VBMA 2ADFA 4IQ4A 3TBHA 4KO2S 4LRWA 5SZIA 1XTVA 4E21A 2P9QA 4F91B 3PSHA 1ZGCA 3P27A 3CURA 3IAUA 3O2NA 4TX1A 2XMQA 1P1IA 4JHXA 3DKRA 3V8RA 3KKZA 4UTPA 3KOOA 1EUCB 5F51A 3RK0A 3QELA 2GSDA 1B2LA 2AK2A 2QNIA 2MSEB 5CVTA 3VSDA 4JYCA 2XIQA 4ZTUB 1MOSA 5HX7A 1ZXXA 4P3XA 5AXCA 1Z5VA 4IH4A 3VDXA 1E20A 2FEXA 3HB5X 3TMKA 2DUMA 1JU9A 4KXWA 1LI5A 3U1TA 4QBKA 5KX5F 1GAEO 5DOVA 1O3YA 3FYUA 2XLCA 3QIVA 4FS8A 2ZUTA 1MLDA 3QW2A 1H3FA 4KXUA 4JGBA 2ZYTX 3V42A 4F2WA 2C8JA 2HQRA 4MMZB 2F59A 3ZEAA 3E9NA 3DDZX 1PT9A 1ONNA 4CM9D 1URPA 4GMDA 3VUFA 1IHYA 5JQWA 2PXAA 2QR2A 2VQDA 3R8CA 4C7XA 1F38A 4QREA 3LC0A 4G8DA 3VMFA 5FOQA 4ZTBA 4C05A 3GQBA 1XMOB 3GZTB 4O33A 1R0CA 3ZR4B 2F1KA 1A9PA 1YO6A 2NSLA 3D6FA 4HDSB 1PJZA 3FWKA 2IYYA 4HNQA 3DHYA 5IC4A 3R5TA 2G82A 3KSDO 2HSWA 1IN6A 2JAXA 1WPGA 3GJ4A 1SKMA 1QIFA 2QVGA 5KOIA 4EITA 1S8NA 4AO6A 5TB5A 3SVLA 3F5SA 3GLUA 1EI9A 3FAZA 1FRVA 5CFQA 2RKWA 1M1YA 4IHJA 4XQCA 1I2BA 3GJTA 3ANTA 4OSPA 2PUTA 4L0CA 1QAOA 2E3JA 5K0BA 1AKRA 2CVQA 5FAXA 4BLSA 4R2KA 4EFMA 3ZDFA 1DAGA 4YRBA 1BAPA 1E77A 1XTIA 4XGNA 2BBTA 4KVAA 4RD4A 3WLKX 3EGDB 2E4UA 3TLEA 4Y6PA 5EL0A 1NQWA 5C0OE 5ENZA 5ECYA 3U3XA 3HP4A 1OH7A 1JDBC 3KXPA 3LPLA 3FSEA 4BVHA 2B3DA 5AW0A 1WB9A 3IBTA 2DRIA 3RB8A 3ZPXA 5D3KA 2PQ0A 3CF6R 3D7NA 4JT4A 2YZ2A 1MC4A 4UZFA 1UWLA 2C99A 4IDFA 2XT6A 1E64A 4R98A 3D3JA 2IEGA 4WFJA 2ATEA 2FRXA 1UMDB 5D8DA 2QTTA 2B1JA 1J42A 2PL5A 4L74A 1TXGA 4JBWA 4K6MA 4LXXA 1B8OA 1CHDA 1KPHA 4HGNA 2Q9CA 5SYMA 3CLUD 2QQ5A 2WUGA 4HS4A 1VJRA 4OKNA 3OA2A 4URXR 4YJGB 5TF4A 2E85A 3LOPA 4I4IA 4MR8A 1Y6ZA 4MUGA 1RKXA 1QAQA 3A4IA 1MO4A 1J5XA 1YR7A 2HMUA 4G1EB 4MW6A 1CUJA 4CI9A 4F9TA 1A3CA 4Q3AA 1PQYA 2IYWA 3RKUA 1HT0A 2Q3DA 1E4VA 4D5EA 4BLPA 1Q77A 3BF7A 3V1MA 5A6SA 5BVHA 2PT7A 3OF2A 1CIJA 2VPXA 5FV7A 2VAVA 2H7XA 1T6BY 3WBKA 4D9GA 4KHPB 3G2QA 4OA5A 4I2NA 3W77A 4AQDA 5CYGA 5JHHB 2CLDX 2JIQA 3ZQKA 5EXTA 1VKHA 1UM9A 3DMGA 4C4YA 1H94A 2AT1A 2O14A 2XNJA 3PQ6A 5D3MA 2VHXA 3A31A 2I2XB 3ORYA 3P4XA 2FR1A 2G4LA 1Y7IA 1ZCZA 2XMDA 4G5XA 1Y33E 2IKSA 1W36C 3KV1A 1W1IA 1W25A 1NXPA 3SLKA 4MV0A 1H93A 3RPEA 4E4TA 2J9FB 3NUQA 3N6RA 3EEYA 1ML4A 4E1AA 5AT1A 3OLWA 2AF4C 4G56A 5H16A 1VLHA 4JGIA 5GZ1A 3JWEA 4QTYA 1DRKA 1BWRA 5HW0A 1PO7A 3GGJA 4OP1A 4YCDA 1NBAA 4TN5A 5HSGA 4EHKA 2MYUA 2C3UA 4YJFA 5I7VA 1VSQA 1WHTA 2B5WA 3Q1LA 1M6VB 4PLWA 3KUDA 5H1YA 4MI3A 4DSTA 4XUDA 4Q9DA 2W4QA 4ZVSA 3AOEA 4WACA 4CLRB 2G06A 3O8RA 3HBLA 2HK9A 4EQ6B 3LT2A 1JXQA 1UBNA 1AXEA 4QDOA 4QOSA 2R1UA 1Q0HA 4HYEA 3UXEA 3WKCA 5LB4A 4TUYA 1RXWA 3IOYA 5FBQB 2ZAGA 1LX7A 1Z17A 4M1KA 4PSVA 3KQNA 3H2GA 3JR3A 1QRAA 1Y3HA 3D5TA 4IXTA 1SKAA 2R1VA 3R0XA 4XLZA 3ZTWA 5ARBA 5KYUB 1C4WA 1XYVA 2DHRA 2YIJA 3LH5A 4R2JA 1HYBA 3IR7A 1QVRA 1QGED 1PZNA 4I19A 5TMEA 2EF1A 2IHTA 1XFDA 2GPYA 2A94A 3H9CA 1TGVA 3QBVA 5D1NA 1H4TA 1W4LA 4B3GA 2OCPA 2QIPA 3MWDB 1WY5A 3SI7A 1NHGA 2GAIA 5DNYB 3KVVA 3H5LA 1E2MA 2RK6A 1DAOA 1U0LA 3IHLA 4N9WA 4B3TB 2QTNA 2FZGA 3WLPA 4ESOA 4N40A 2G1PA 1D2CA 1VIDA 1V71A 2QVZX 4WLFA 4B81A 3M5WA 4X20A 2PD3A 2QN2A 2I99A 2GR9A 1JS1X 5HRCA 1YB1A 3NJRA 2P69A 2WAYA 4HDCA 4I4TF 4NMWA 1YQXA 5FI0B 3RSFA 3VJLA 4COOA 1T9AA 4R6XA 5FUMA 4D8VA 4BUCA 1M75A 4BNKA 2ICAA 1X7XA 2UYQA 4BFXA 1V6CA 3DUFA 1BROA 2PMCA 3I58A 4UARA 1I4WA 4CCYB 4NCXA 2C96A 4UFNA 2FMIA 3C0KA 4HS9A 1A7AA 1R0SA 1K86A 2P41A 2VT7A 4I3FA 4OQXA 4WECA 5A7FA 2XXAB 4UFOA 5GV8A 3V2GA 1Q3HA 4DTCA 3NOXA 4BV2A 2NZWA 5AW4A 1U9YA 5A4MS 1ZKDA 2GESA 3A70A 1G3RA 3IKVA 3AR5A 5LOVF 3K0AA 1YR3A 3G0CA 2ZBQA 4IHKA 3CEMA 1D1QA 2YDXA 3QPCA 4RYDA 3FYTA 1Z0UA 3O94A 1JTVA 3DOJA 4E6EA 1X9GA 2SNIE 4OP2A 3AJ8A 1WV0A 2VJBA 3K0EA 1EIWA 2XOXA 1CETA 2P2GA 4ZOLF 2PT5A 4ZK6A 5IT4A 4JB8A 2WI8A 5EP3A 3WTCA 3ZBTA 5LFAA 4JVMA 1C2TA 5H3LA 4E5NA 4OFWA 3QEAZ 4MCHA 2A1IA 4WFIA 1S2OA 2ARKA 2NNWB 3QTLA 4RY2A 3WLTA 5IX8A 3E53A 2WVAA 2J0UB 4RTOA 3B8HA 4MVXA 1VKJA 5EHGA 3L7LA 4YJ3A 3PL1A 3LXRA 4HGYA 4O4IA 1O9GA 1YH3A 3WK4A 4FC6A 4YRIA 3PR1A 3QX3A 4TQ9A 2R8EA 1IU9A 2J09A 5I9TA 1IBRA 3G85A 3DO6A 3FBGA 2VP5A 2IU3A 2Y2VA 3N6XA 4OFBA 1D9ZA 2NQTA 1NQOA 5ADUS 3F7MA 1B43A 1UBKS 5ALUA 4W7IA 5ITVA 1RWQA 1SUBA 4L28A 4U7PB 5BMVA 4XRRA 3PLAE 1HPLA 2X8JA 3F2VA 3F6SA 3GBPA 1PJBA 4NLLA 2LZ0A 1UK7A 3I8SA 1S3SA 3LHIA 3TLYA 4H6PA 4L5CA 4B3SB 5TV2A 4HZGA 1H1DA 1KYVA 1MJGM 2Y0DA 4PSUA 2AX3A 3WQSB 1XPOA 3VR3D 2GRJA 3U81A 3LZDA 4UXIA 4EWLA 4JA2A 2B34A 1TZCA 3R4VA 2O3RA 2I3ZA 2JFYA 4TTSA 2ZJ1A 4P5PA 1C0IA 1GUFA 2J6IA 3OX4A 3HZHA 1MD9A 1KI6B 2QMZA 1EU1A 2EFHB 3O8OA 4QTZA 4RORA 5G0SA 1BJRE 3QVSA 1IZ9A 3HZOA 5C81A 1E98A 2R44A 1A5TA 3SCZA 2VSNA 3NCHA 4LE2A 2E4ZA 3TIGA 3VKFA 3WLJA 2R86A 1OSNA 3R41A 4KK3A 1E3QA 3TI9A 3TSCA 4EY7A 3U40A 4M1WA 3IUEA 1MOPA 4ENSA 1LK5A 2H18A 4QA9A 2F48A 1XRQA 3AUSA 2P9YA 2H1FA 2YJTD 2O0JA 3CX6A 3N3BC 3D7LA 4HK4A 4CDMA 1ESDA 3U9TA 4U0JA 4X66B 2L0XA 3PQEA 3S81A 3NIDB 3O31A 4CEIA 2A0KA 4L07A 2WT8A 5EUQB 1ZU4A 4N3AA 4QYIA 4U63A 3PC8A 2WW8A 3O82A 1CTQA 1Y82A 1TW2A 2H8KA 2ODWA 2XUAA 1CR6A 4C0HA 1R66A 1YZUA 2R5WA 5BQOA 4LVCA 2LCQA 4BNUA 1PD0A 4PVCA 3E9CA 1EB9A 4FUQA 4QFMA 4EO4A 1XWWA 3LUAA 5CB6A 5IDWA 1ATIA 2F8TA 3PXGA 2FU5C 3REQA 2Y99A 1F8GA 3HSSA 1Q17A 2BJHA 3O8DA 5FNVA 4WV3A 4B3DA 2ZYWX 1W2HA 4RESA 4MVJE 3RC2A 3U48A 3W8NA 3VZSA 3LY5A 1II0A 1CRWG 1PU2A 1ZRSA 2XB9A 2O7VA 3ASZA 3F8TA 3I1YA 3WQQA 4CCSA 4IP0A 1SY7A 1ZXLA 1P39A 2JIOA 2O07A 3D3QA 4F96A 1ECLA 1UAYA 1MOZA 4QTTB 1MB4A 3ZCVA 1NJSA 1VP9A 1POXA 2BHNA 4KXLA 1ULUA 2XNCA 2ZE8A 3E1KA 3KLNA 4FTWA 4ENRA 5BQ3A 4YWJA 3MCTA 3ABIA 4MGYR 3AHCA 3IEVA 2EJCA 1T6YA 5C8DA 1NU8A 4FILA 3HKCA 1ZW1A 3JVUA 2E55A 3KLOA 4J0CA 4WCFB 3TW8A 2JFVA 1WUHS 2IT1A 3AOEC 3C16C 4MWGA 5IBPA 4N76A 2H7YA 3OQJA 1H2FA 3M4XA 3D3NA 5HOQA 2OBLA 4QUHA 5BRAA 3IV9A 5INTA 1B7GO 1R5JA 3KX2A 3WWZA 2KPOA 2AMJA 4JA0A 1QCYA 2JI4A 3AL0C 1Z88A 5FF9A 1GZ4A 4HDAA 1PBNA 3SE7A 2BHRA 2CK3A 2JA1A 4V39A 3DEIA 1DKUA 2BFPA 2Q21A 3FIJA 1BE0A 1N7IA 3GCGA 4ENPA 3RC7A 3RUAA 3P20A 3GLIA 3QNWA 1FSZA 2A9VA 1YVRA 3B1JA 4V0QA 4DMMA 1WUIS 3FX2A 3UWPA 1F8YA 4PN7A 1Q16A 4LWOA 2A9KA 2ODNA 3VR4D 3U5TA 1C7EA 4M8IA 4E70A 3WO0A 5FPQA 3X1JA 4A0RA 4BNLA 1SXJE 3NAZA 3NHPA 4MWDA 1N2IA 1R0YA 1V3UA 4RHXA 1G6OA 1T5IA 4G97A 5WRFA 3A4MA 4DMCA 3TQCA 4FINA 2AFHA 1E2GA 2B25A 2LDXA 3OESA 4JLDA 4HVCA 2FFRA 3KEMA 4CL2A 1NMSA 1JBQA 4O02B 1BX1A 1LQTA 1U1FA 2HRCA 3KQOA 5F5NA 2YL2A 4IFTA 3LBFA 1NE2A 4BKOA 2JGMA 2X7JA 2BRUA 3ZK8A 5T8KA 1LSOA 3K6JA 3KYBA 4Y7CA 3RHSA 1SC3A 4NYMR 4AMVA 4ZTZB 4L4XA 1SA0B 1ZX1A 5G1NA 1N2SA 3MT7A 4BNDB 2QMHA 1XX6A 2OZKA 2IYTA 4WXMA 1AZSC 2A1TR 3EMDA 4BO7A 1HE4A 1UQUA 4QOIA 1KYIA 3ROKA 5A1JA 3TINA 5IN5A 2A57A 3WE7A 5HCIA 4B09A 5E3HA 2OHVA 1F17A 2I2WA 4G5SA 4MUHA 4ARAA 5T3YA 2OILA 4FZVA 3DWIA 2YMQA 2HF9A 3KWJA 4Q7LA 4RM3A 1KJ8A 4YAGA 2A3RA 3IVRA 1FX1A 3ZLBA 3LUHA 2WQZA 3RJTA 5ALDA 1NNSA 4K5QA 4W7SA 1Q5PA 2R6DA 1YZQA 2EJTA 5AOBA 2QAGA 1NI3A 2V4ZA 5K4AA 2X6TA 3BJMA 3O47A 3N2YA 2FPLA 5EZQA 5EJIA 2XHZA 5FORA 1C1YA 1OIVA 1DLIA 1P0MA 1N32B 3CZ9A 4QOFA 5IUKC 3VR2A 3ZV4A 4B9EA 4ZJYA 2YVLA 4P3YA 3EW9A 5ALGA 1Z5WA 1ZH2A 1YHZA 3DBRA 3MWEB 2JHPA 5BUSA 4B2PA 3IQGX 3ME5A 4WBNB 3A37A 4KBFA 2FVYA 1M1UA 1KQPA 1N5IA 1V8FA 2VDLB 3E7XA 1TOAA 2GZRA 1FRFS 1T5TA 2NWQA 4ZV7A 5TARA 4NG5A 5JDIC 1M8FA 2UZ3A 3KQPA 1CDOA 1CJTC 1U04A 3PXDA 3NC1C 5ERXA 5BUQA 2A9RA 5HKAA 1ODCA 4D4JA 5J4VA 4DLYA 1KFJB 4L75A 1UAGA 4XD7D 4DBLE 4GOND 4Q93A 4KITB 2D4HA 2VAPA 5E8JA 3KKNA 1XA3A 1N9ZA 3NGMA 3EOBI 4CF7A 4I66A 1LPSA 2WFLB 3TJZA 1CUGA 1L4LA 1GDHA 3ZLJA 4MICA 2XR1A 3KQYA 4BEJA 4RX1A 3OZ7A 4M7RA 2YZ7A 3AP3A 2NSDA 1Z6XA 1W88A 2H1WA 1XPUA 1UBCA 3WIEA 4GH5A 5IAGA 3OIFA 1HL7A 3KHKA 3WLIA 4CKEA 3TUJC 3JXEA 1L7AA 3IUQA 1QMPA 3K09C 2RSLA 3ZJUA 2ECQA 3M49A 1EXMA 4E5PA 3QRWA 2VEOA 5KVCA 1JQEA 1IK6A 1T4CB 1G18A 2WJWA 2MYTA 3PFNA 3AYXB 4RVSA 2XA2A 3K9LA 3O0DA 3K9WA 3PCRB 4HLUC 3RO7A 2DBZA 3E1GA 4GZ6A 1F51E 3RKRA 2D1RA 2ISSD 4CM4A 3JPYA 3AZPA 4J0KA 1ADYA 1JN0A 2HKIA 5ESXA 1AY0A 4ER3A 2BI8A 4D9BA 1N6RA 3JARA 1TT5B 4QFCA 1MC8A 3A27A 4EL0A 1E9RA 1JI0A 2RFLA 4FNGA 2N1MA 1C9EA 2Q4EA 2YXBA 2GN1A 3LUPA 5FL7A 5LQSA 4AB1A 2Q5OA 3LGSA 2QZJA 3PDWA 4KQWA 1EFVA 1TQ4A 1U2TA 4GOOD 4OL0A 2PU5A 1XQWA 3BK1A 4FCVA 4WMLA 3R23A 4PR3A 1SELA 1HE5A 3DT8A 3PC2A 3DBLA 1NQVA 3WKBA 3QMWA 2RHWA 2PUVA 4WY8A 3RG8A 4ZYWA 1R0KA 2QMUA 1LPMA 2WICA 1PWEA 1AKNA 2PSFA 3BFJA 1OWPA 3HH8A 3A1FA 3ESYA 2HUPA 1C30A 2AG8A 2HWWA 1ZKMA 2GYVA 2L82A 4JDPA 1ZL2A 4RLFA 5TX7A 5JXWA 1VJTA 4PV7A 3FDFA 5CFMA 1ZD2P 3L4BC 3EGEA 4FOLA 1EFDN 3IUYA 4YP0A 1BSVA 1E58A 1O94C 1X77A 2B92A 3SZGA 3WNCA 1EXDA 2EW8A 4ZODA 5FTWA 3K96A 4IDDA 2CHQA 3KKLA 1E9VA 1WS6A 4FMDB 4G09A 2ZUSA 1C30B 1M2KA 4UNRA 4KB5A 4C2UA 3MOSA 4Z9FA 4ZO6A 2IL1A 1Z12A 4W4TA 3O26A 2ROQA 2GASA 5B3KA 2DWCA 2ENWA 1NXWA 1TW3A 2XWBF 4DCJA 2XXAA 2XAUA 4AWBA 5JISA 4H7IA 3LG2A 1TRHA 2B0JA 1U8UA 4ZHQA 1GKIA 3MNFA 3KZNA 3G2KA 3CW8X 2HCRA 2Z6UA 4XPIA 4YT8A 3NM4A 3B85A 2W83A 3NUGA 2XNSA 4HDRA 4YMUA 4YWHA 1AA9A 2ECKA 5LJIA 3GLHE 5HG0A 1WF6A 3JARB 4Y6RA 3H6KA 1SZPA 1Z7BA 2JGLA 5G4LA 3S2GA 3ZDDA 4DGSA 3QE2A 3UW3A 4A1OA 5C7OO 1HWYA 2EBHX 5CXXA 1C1DB 4KN6A 2UZ0A 4CM4B 1ZIPA 1V1MB 3Q8KA 3DLBA 1CY2A 3CV3A 4QU9A 3BGOS 3PUZA 1YRHA 4YA6A 3SLGA 2A5GA 3HNOA 2NN3C 3D0QA 5KS2A 1PYGA 2WJ4A 1LVGA 1CJVC 1LC0A 4QODA 3D3WB 1L5LA 1P5JA 1WZIA 2WM9B 3K9BA 4RNCA 5K51A 1SBHA 4R1MA 4WRRA 1PEYA 2X0EA 4MJLA 2X0IA 3AEYA 5DTJA 3RYFB 1V35A 1VE7A 2XRMA 2NXJA 2W37A 1QVZA 1W88B 3JWJA 1A69A 1DKLA 2H3EA 3DAFA 3GAFA 1FQOA 3QFFA 1BOFA 4Z4QA 1TNDA 8ADHA 2X6RA 3QLTA 2X1VA 5AXAA 5ERYA 4L4YA 4DYHA 4PVDA 5HRAA 1SKYB 2WM2A 2A0YA 2WLTA 5LLTA 5IT9A 5CXSA 3I3OA 3CX3A 1XMVA 4MA4A 3HBNA 2NVOA 4IIEA 5FWDA 1VIMA 3S3TA 3DE7X 3V80A 1V1JA 1QZUA 2AKEA 4Q3NA 3ADBA 1XMJA 3GT4A 4QD3A 4NQRA 3DMHA 3OLVA 1XZ8A 4AUMA 4G0NA 4CEHA 1VMKA 4WL0A 5K8IA 2FFQA 3RJ5A 2EKBA 2P6RA 4MQ4A 4IHQA 1H2XA 3G8BA 3Q8XB 5I5EA 3CA8A 2YCBA 3SFTA 5EN4A 3EUAA 1VSTA 4E5DA 4MR7A 3K6RA 4GXRA 1CVRA 1TUIA 2AI1A 1I5EA 3MGBA 4EUFA 2FPPA 3DMTC 1W5EA 1ZD3A 4ETWA 3VX4A 4RS3A 1T29A 5LQDA 1ZXBA 3NEJA 3BQ9A 4BB9A 1AV7A 2D7JA 2O8FA 4L50A 1O95D 3R7LA 3GJQA 1FP1D 1XK6A 5JHGB 4BX8A 3CF2A 4AP5A 3K16A 1ZGGA 1FU4A 4NXMB 1X86B 3RHFA 1RD4A 4IGKA 1E7YA 1X7WA 4QUIA 4Z0PA 4XASA 4RVFA 4AJ4A 3DR5A 5CVUA 1WBDA 2CNKA 1NQXA 1VKRA 1W1UA 2FI1A 3O7MA 1P8JA 4WGFA 3VZPA 1U2GC 1KZYC 2OEPA 3HGTA 4OSEA 2H0QA 1QIMA 4PXSA 4J0IA 4YK7A 2DLCX 3KEFA 2B7LA 1KZ1A 1N6OA 1EUDB 1SZDA 5AM1A 5CBKA 2PBLA 4AO7A 3FZYA 5J58A 3B1WA 5ALZA 3DM9B 3U3ZA 1U6IA 2NTNA 2QTHA 3T54A 1GFSA 2WSSD 5GOZA 1AB6A 4F8JA 2V65A 2OMKA 1LRLA 4NFLA 3TFQA 5HQ3A 3BILA 3JQBA 3I73A 1L8XA 1MEOA 2B0CA 1GUYA 5E0OA 3GG9A 3QHAA 1AKWA 3H2BA 4AS2A 2MSDB 2Z1NA 1C3EA 1RPJA 3T7CA 6REQA 3C45A 1GQ2A 1A2QA 2QJWA 3ICCA 4GI2A 5IEJA 1ZHOA 4OHCA 3KR9A 4DMLA 1KJ9A 2Q0SA 4TYYA 4BFVA 3DP9A 1X7YB 4UAUA 3T3EA 4JFRA 3EUWA 1E5QA 3DJYA 4OJNA 1IMOA 5BR4A 3UG6A 2YWEA 1KBOA 3VV2A 3O6VA 3IELA 1XZNA 3HVJA 3WJ2A 4MYHA 4R9RA 4RXUA 4D9HA 3DVAA 4Z4FA 3GUUA 4ZWNA 2ZBRA 5BN4B 3C2QA 1UKYA 2MSWA 2GPSA 4MS1B 4C0QC 1AUXA 3IVXA 4B82A 4BZZA 4IEIA 2YR0A 2PWBA 3UOWA 2Q2VA 4UQOA 5E6SA 1FLNA 2ZB4A 4Y6GB 4ZDIA 2VKQA 3AF2A 4RADA 1J8MF 3G0BA 5BR8B 2BISA 1YS9A 1RWWA 2FPSA 5CVJA 4B4DA 3LCCA 4PTLA 5LYJF 3E9QA 4G86A 2CZQA 2CLKB 4LXGA 4S1NA 3VSCA 5IYZB 2A9FA 3BCSA 2H17A 4M7WA 1BHSA 2PZAA 1UT6A 3PE3A 3OX1A 4NBLA 2VP3A 1E7SA 1F6WA 2W11A 3IX7A 4CQMD 2GWHA 1QV6A 2RK4A 5LZ7A 2HDHA 2KS6A 2Q1WA 3UMSA 2QF7A 5FBHA 1QOQB 1R74A 3NC0C 4DDWA 4BNZA 4JBLA 1GSIA 4PYOA 1GP2A 4JL6A 1OFUX 1F2UA 2HD4A 2Z08A 3M5CA 1K4KA 3A9CA 4GBMA 3TDMA 5HS4A 5ISMA 4JOSA 1W29A 1G8GA 3MELA 5TNXA 3ECSA 1Y5IA 3AX6A 2OXIA 1KSHA 4FGUA 4IEEA 1N4AA 4RL4A 4BZPA 4KOEC 4TS1A 4FFWA 4QATA 1TK2A 1WP4A 4XVQA 4TMZA 2G71A 1EWYA 3GDFA 1NBWB 2O5RA 4IRXA 1L7EA 2QN9A 3TLMA 1WEHA 2PL1A 3X3HA 1C7RA 2QLFA 1SC6A 3H4MA 2JVKA 3GMIA 2Z2JA 4QGHA 5DTQA 4R0MA 3EDCA 2ZYSA 1F1JA 1CRQA 1HYHA 3TSZA 4DQLA 6Q21A 4DUZB 2FY8A 3NHAA 4HWPA 2CK3D 1ZITA 3PWTA 4WE3A 4DLWA 1MEJA 2P79A 3ZD6A 3U09A 3LDGA 2F9MA 1Z6GA 3AO0B 1MJHA 3BGVA 3L7JA 2RGXA 3SQNA 1Z8DA 2YQZA 1QP7A 1LU9A 4FHEA 1CJMA 1PZFA 2GPJA 1LNSA 1QSGA 1VYUA 2WK1A 3F78A 5AFSA 1QBGA 2OENG 1Y9AA 3TRIA 3WWPA 1EGAA 5EJ2A 5KMGB 4KI7A 1I51A 2EQ5A 5ARCA 2CLFB 4MW0A 4RJLA 5JQGF 2RKOA 2ZT6A 4TLEA 4Q15A 3FWYA 2DCMA 2ZUCA 2YYZA 3K8OE 4RIHA 2GLXA 1TFRA 1Z13A 1XTTA 4B34A 3F7OA 1D4FA 5KWJA 4ML3A 5YASA 2ID8A 5EJGA 3BTVA 4DLVA 1RJGA 1UL1X 3NX4A 4HQ0A 1GCUA 1WB5A 4IJKA 1XCJA 6ABPA 2QX4A 2ZYDA 3OCUA 3RQIA 4GGMX 4RF4A 4PAQA 2AQKA 5IBQA 3T3NA 3GA5A 3OKPA 3KPVA 2FEKA 1G2QA 3L0PA 4GKKB 4J7AA 4XYGA 4NBUA 4O2RA 4P80A 1V8ZA 1CY8A 4BAZA 1UKZA 3OE7A 4BUZA 4XWAA 1O95A 4GMFA 3V7WA 3W9BA 1X14A 1Z0ZA 3KQSA 4OMFG 2PZ8A 2YNMA 1OXXK 3E0XA 3EZ7A 4IEFB 4PHCA 3W8EA 1JXAA 5JSUA 3N58A 3PTAA 3KQTA 5CTAA 3MHPA 2V7TA 4M55A 1RZVA 3QFHA 2WJ6A 2X5OA 3UAWA 2EJBA 1YZTA 3ZUGA 1BDBA 4UVIA 1U2PA 4KQGA 4IOJA 2FPGA 4OBXA 2UXBB 3GQVA 4M0UA 4BRZA 4YDQA 3VPGA 2R6GA 5B12A 1SBYA 2YMPA 3EF1A 1OBVA 5FD8A 2XTZA 1LSSA 4IIJA 2ZB8A 4IKEA 1MORA 5HUQA 1WCV1 2CSUA 4F21A 3VMMA 1ZWKA 3H1GA 3OLYA 2HADA 3TBKA 2NYRA 4BKUA 4UM7A 2RHMA 4O4IF 4OHKA 2CN1A 5FA6A 4JU9A 1E9DA 3MPOA 2D5LA 2Y66A 3K4QA 4WXHA 1QHXA 3OOJA 1YZKA 2AMLA 3ENKA 2RIPA 4G1CA 5G40A 1FW6A 5IH3A 4LFBB 4Y98A 4DNOA 1PJTA 1ZOIA 1JEYB 1EMDA 3IAEA 5AW2A 5KOJA 2GM9A 3E61A 4UVDA 3ROPA 4JD5A 1CK4A 1QRTA 3HA3A 4Y0AA 4CM9A 4CGYA 5BRJA 1QHFA 3GFOA 2G09A 1AQYA 1DT5A 1IHPA 1LQ2A 4PCLA 2LUOA 1RZRD 1JSZA 3ESQA 3P8ZA 4IO1A 4QVGA 4NSNA 3UWKA 1VJGA 3OIWA 2LIPA 1WF3A 2BGKA 2RI1A 4IY1A 4W5NA 1I2CA 2YWJA 4WNAA 5BYJA 5C1PA 1W85B 4MV3A 3HJRA 2YJZA 5JECA 2OWDA 5J4KA 1IY9A 3KDPA 3M1YA 2R8BA 4UBLA 5LP6F 1D2MA 3ACCA 1PS9A 4V0RA 3JQ7A 4EBBA 3JZMA 1WSDA 4Q6WA 5T4FA 1S01A 3NTOA 3I6YA 1DC5A 1Z5PA 1H2ZA 2CE2X 4K9OA 3RYIB 1Z7EA 3PQCA 4DTIA 2O2IA 1YNOA 3SS9X 1S2DA 4HV4A 4YRRA 1M2GA 4D57A 2ZG6A 4IGEA 3JQCA 5T67A 2ACVA 2BMAA 2X0DA 2VJDA 1OT5A 3A3YA 1ISPA 1M34B 1E1KA 2A33A 2YWGA 4J94A 4BCDA 1HA3A 3JWIA 1D8AA 4QHTA 5LWHA 2OCAA 1JG1A 2XCLA 2X22A 3I4CA 4LAFA 3I30X 5CDFE 1D0SA 1Y9ZA 3W3AA 3ULKA 2BELA 1ST2A 2EHJA 3EIQA 2WV9A 2I7CA 1KAOA 1IZ8A 4GP7A 4N7BA 2G9ZA 2QDKA 4M6WB 3KJFA 2I78A 1LBHA 2I22A 2AE2A 1SCAA 2VKTA 2Y05A 4MQBA 1QB7A 5K6AA 4FX2A 1Z74A 1Y8ZA 5ITWA 2CUZA 2OBBA 1NW3A 1SXGA 4PLFA 5JAOA 3FTNA 3PUXA 3TEFA 2IH2A 2L17A 1NUAA 1OIXA 3AJ9A 1YL6A 1FUKA 4IVQA 3B38A 4WDRA 5LVAA 3FZGA 4FKZA 5DXAA 4ALJA 4KYTA 4Y2RA 5FOUA 1R16A 5DWQA 3VYVA 1SG6A 4EHDA 4WA7A 2YV1A 4YXWA 2JRCA 3VU9B 2W7TA 4B3XA 4UEJA 3VV3A 4FD2A 3MJVA 1SIOA 3NM6B 3VQTA 3TZQA 2WJAA 3HCFA 2PS9A 2FHSA 1DKOA 4IHAA 3S2UA 1B23P 4F2DA 3QFSA 3DDNA 1GDDA 3A6JA 4YEDA 3TCXB 1X19A 3P9KA 4X62B 5U9CA 2P9JA 4FCCA 3I9OA 1ETUA 3UT0A 2F4VB 3HSYA 2N46A 4NZ9A 1NXSA 4O2AF 5AKLA 1JR3D 3A1VA 2GCPA 2BFBA 5KYVA 4TXNA 2NV0A 5K5EA 1QHSA 1V8DA 3GJSA 4TV9B 1FMTA 2WOOA 3H99A 3L8GA 3NBMA 4XJSA 3WR5A 3MCZA 4HDKA 4L73A 8GPBA 4MJXA 3BMXA 1VBNA 1ZI8A 1FYVA 3HWX1 3P0HA 1BRMA 2QB5A 3NKFA 2VYQA 3PUJA 4R9SA 2VG8A 2YUTA 3BYZA 3IVMA 4JJ8A 5C4MA 1ECPA 3FG9A 4GSKA 5IAKA 1KKLA 1P2VA 3CEJA 4R1LA 5DN9A 3KHTA 5TJ9A 2HZBA 4Y6QA 1FVHA 3GLHB 3OX2A 3TM4A 2C5LA 2P2CA 3I72A 2QZSA 3SC4A 5FPYA 3AKCA 2W70A 3RIMA 4UD2A 2CD7A 1IWPB 3DD1A 1TM3E 3ZCTA 4MIYA 5BNZA 1X8KA 2RG1A 1UBHS 2JS7A 3AF1A 3BL5A 3G7SA 2H2HA 3K5IA 1IVSA 3L1VA 3DCNA 4FYXA 4Q7QA 2XLBA 4BJ1A 2WPDD 1DADA 3HLKA 3NYIA 4BPRA 1Y3AA 1XXHB 5K9ZA 3GRUA 2PAFA 4WXPA 1M1YE 4M22A 3RC9A 1HDGO 5EOVA 2ZULA 4PBTA 1CIVA 2AQ8A 1NT2A 2HLNA 3IT0A 3AW9A 1PQWA 1FK8A 2BBOA 1E92A 2CNWA 1J90A 1TO1E 1R27A 5GQSA 4O3MA 5LMNB 2O19A 1ISHA 4J1SA 1PZXA 4BMVA 3BC1A 3UGQA 2AD1A 2X6QA 2ZYAA 4NH4A 4MO9A 3NYWA 3OZSA 2IZ1A 3H5RA 3P96A 1BC5A 1YOVA 4MAFA 3PITA 2JB9A 1I1QB 3DL4A 3SYTA 1LB1B 5EIHA 2PD6A 4BAUA 4ERNA 3IAS6 1RKUA 3SXJA 4Y6SA 1P5FA 4C04A 3HE3A 4CKBA 3F4BA 5J2TF 5HGXA 4PO9A 4NXNB 2C8KA 3BE6A 2GM5A 1R6AA 1NNLA 2PS3A 2V7WA 1VYVA 3CNEA 2ZUDA 3PA6A 3MTAA 4PC3A 3U4MA 1XJ0A 1Q1AA 4YCCA 3E4CA 1SXIA 3GGOA 4KIJA 3BIFA 1IE3A 2AI2A 3ONDA 2DOKA 4UUMA 5A3JA 1SG9A 2O8DA 3LS2A 5DHAA 2W4MA 2NPIA 2E1PA 2ZUUA 4LA4A 3E5MA 4OXYA 1SXJD 1H6CA 2ZZKA 4JT2A 5EMNA 3AHIA 4URWR 3M0EA 1FRQA 1KOFA 4Q4AA 1K3UB 3IJPA 5J2UA 3AVXA 4Z53A 1EAYA 1GV1A 1OPXA 1C50A 2ZJZA 3RLFA 2Q3HA 4LVOA 3ZWWA 3PR2B 2FOIA 4LZOA 1MTZA 3VR6D 3BORA 3ZE6A 4CZ2A 5LU8A 4DPLA 2HU7A 1RZUA 4CR7A 1IXRC 1E1QD 3UANA 2GNPA 3ID6C 2WINI 2I65A 2VYVA 4V0MA 1I7DA 2ZIXA 3ELDA 1Q0LA 2VHZA 3TQRA 4AK9A 1YKFA 5U4XA 4WJZA 4GLOA 2UDPA 1CRPA 1V5FA 3IIIA 1MJNA 4ARUA 1T36A 3K1JA 4LJKA 5JO9A 3RAEC 2YOGA 1GM5A 3BB4A 5F78A 1X87A 4CEIB 3D5QA 3HYRA 3A1NA 5EEGA 4AWXA 2ODAA 3NS7A 1KMCA 4RIFA 4YRMA 3WK8A 3N05A 2PZLA 4JR1A 4DLLA 2VXYA 1JKJB 1V4BA 1GGHA 4QGBA 3CX4A 3V1NA 1CS4C 1X3SA 5ALNA 1TJ5A 2EDCA 1WZEA 1Q12A 1RLUA 2QRQA 4BN5A 4JMLA 4JZYA 1RLTA 4RZXA 3PR3A 5JWOA 1HZZC 1P0CA 4Y6LA 3PI7A 2Q07A 3H8VA 1L7BA 1B1AA 2YXPX 2D8MA 2M9MA 2PEYA 2QL5A 3ELBA 3FTDA 4H7HA 4OA8A 4QT0A 4W1SA 4UNIA 3TTVA 2EFJA 4A91A 1DTWB 1F5NA 1KK2A 5A4IS 9ATCA 5JNTA 1Z3IX 1P9NA 1XE3A 4BVLA 3AF3A 2Q7OE 2DPGA 4GPD1 6CHYA 5MN5A 1T9CA 1GZSA 1BMTA 1SWVA 3OKAA 4WXEA 1FP6A 1FP4A 3A4NA 2UYYA 3MYYA 4QUDA 3SYNA 4CLDA 1DL5A 3BXZA 2ERXA 3GRFA 4IDEA 5BRNA 4CFZA 4WOBA 4IILA 5LQRA 2YZMA 3F6BX 3A6GA 3GUYA 3CSSA 4MUNA 3ZXXA 3WICA 3DGFC 3IT2A 2HHJA 3L77A 4PAOA 3V48A 4C3UA 2E87A 1B26A 1P29A 3ZGLA 2PFGA 3EOAI 3WVNA 4BNHA 4L08A 5AOAA 2RD2A 1Q20A 1UFVA 4V38A 2F8MA 3U49A 2YQ4A 1YB4A 1WPQA 2NP6A 5IWAB 5MN6A 3TOXA 1D7AA 4NNJA 2D1TA 3MWKA 4RW0A 4XX1A 3WISA 1VJCA 4XIJA 2HV9A 2WIKA 5JSZB 2Q9BA 4LZZA 4AQYB 5LR6A 1UZUA 4MP8A 4XTCS 2I0FA 2OO5A 4L5BA 4X6XA 1JSCA 2O6LA 4TRNA 3VOTA 3A32A 5FADA 4YRSA 2JH3A 4WCFC 2OLJA 3K1AA 2CEKA 2XVMA 3OZGA 4MDEA 5SV2A 1CY1A 3U0VA 2EL7A 2GHRA 1PQ4A 1E9BA 1OFIA 3LIIA 4R1NA 5ILQA 3FCUB 3VR4A 1ZH0A 2P35A 1Z18A 5C4GB 1PHPA 4YR7A 1IXZA 4E7PA 4MYRA 2AYZA 4RNDB 5CA1A 4L8LA 5JZ9A 3FSGA 4DQ0A 3EN0A 1IPEA 3OFND 4ECAA 4K2AA 3KDAA 3G2NA 4YT4A 1I33A 3ZGYA 1J97A 5A4KA 1YHNA 2V6GA 2UU9B 4FEYA 3L0DA 1H2AS 2VTKA 1GYPA 2YS6A 4FDLA 4NBKA 4D82A 1VPEA 4I8IA 3I04M 1S7GA 3RRBA 3UGJA 4V1CI 1KYYA 3EZ2A 4JSRA 2IEAA 5GMOA 5ES4B 2VDWB 2PGJA 3QEMA 5ECGC 5GJWC 4ZHQF 1DFHA 3JQEA 1PBTA 1XU9A 1TECE 4ZEXA 1T36B 1BE6A 3FA2A 3L9XA 2D8AA 1L7DA 2Q2WA 1JHYA 5CIWA 1ZCBA 4Q0MA 4R7GA 3RS7A 1T0BA 4EA7A 4FMCF 3GRYA 3PCXA 1E18A 2P4QA 1J2TA 2Q28A 3ZZTA 3OTOB 4OHMA 2OK8A 4X95A 3ND6A 1Q19A 4JODA 4WDQA 2DFLA 2PVSA 2RE8A 3HUFA 3LHFA 4MNTA 1DGQA 1MX9A 3TLKA 1LF5A 1NF3A 3SICE 1PYDA 1Y3BE 4JHLA 4JL8A 4EF4A 3SFVA 1SWWA 3RUFA 4R51A 4TYPA 4AURA 4BX3A 4YIHA 4NAUA 3DMTA 4F84A 1K8QA 2J32A 5M7EA 2H6EA 4J0FA 3TM5A 3VTZA 2LXNA 2WE7A 4PPQA 3TE6A 2VNJA 5JAMA 4OU5A 3AR2A 4MV8A 5JD6A 2X4IA 2I7DA 5DXJA 3ZHZA 3D2LA 2P3OA 5AI5A 3SEFA 1XEWY 4L6IA 3HL0A 4NAHA 2OAGA 4C3ZA 4W1PA 1NWHA 4PPYA 1XKTA 2QP9X 3C14C 2Q3CA 1IG0A 2HWKA 2ZSKA 4R3WA 4Z2YA 1WNFA 1KFEB 1NR7A 1B0ZA 1SCQA 2X2FA 3ECAA 3U4HA 2C20A 3R5XA 4C7BA 2O54A 4L4UA 3LQ1A 3NNSA 5KUTA 2QDXA 1QUFA 3H5OA 4JP5A 4W6QA 3JQRA 3UUFA 4Z8XA 5K01A 4MO2A 5ALFA 3DA8A 3WWDA 4ARSA 2WKRA 2C9BA 1B15A 5EWJA 4RSMA 1U8AA 2C4WA 3PDUA 5FI1B 4AI6A 2VSXA 1MT3A 4ED9A 1ZIXA 3FPJA 3HFRA 4MZXA 3WXBA 4LJRA 1AM4D 1CNFA 1U81A 4AC9A 1VJDA 2I3GA 1CJUC 3WQRA 3B6IA 4U7WA 3DCYA 2IV2X 5L6MB 4ZXFA 1FW8A 3GH3A 2PS1A 2VUTA 4HL6A 3LTNC 1H4QA 2TMDA 3AUKA 1I5OA 4C4XA 1WAMA 3VYTB 3ROTA 5EERA 2BTOA 3CEAA 1XN4A 4P86A 1ENYA 4FBLA 5TQ0B 3RS4A 1QE3A 4G4SO 4X92A 2D0OB 4MLDA 3DE3X 5BN1A 3F6RA 1QTQA 3NBQA 2BEWA 5HIIA 1EA7A 4A92A 3Q3VA 3IUMA 3AIIA 3IV6A 3WGMA 3P0EA 4PWYA 1CP3A 5D00A 5DWDA 2NXEA 3RWMB 4R8LA 2FQWA 2ZR9A 1OA0A 5K6RA 1I7NA 2W98A 3GLGA 4FWIB 2JAUA 3PXCX 2DWQA 1ONSA 4KXYA 5B7GA 1XV5A 1DV1A 1AKQA 5E7MA 4I1IA 3C5EA 3ETLA 2JGRA 1CEQA 1LNQA 1RCFA 1FYFA 3C4JA 3NLLA 2IXGA 2HX1A 3VC7A 3ZS8A 4BVEA 5A9SA 3KUXA 5T6BA 4TKVA 3H1PA 4KMSA 4KO4S 2FFHA 2HSZA 3GMSA 4RZIA 5ADWA 4Z1MD 1ZIDA 4AG3A 1V9SA 1Z4KA 1ISMA 2PWPA 1UODA 4ZVVA 1TIBA 3SJUA 2OHGA 1W5AA 3C97A 2NUTA 3FOZA 2R48A 1JDUA 4EG1A 3EGCA 2A8YA 2IHBA 5HBRA 3EFBA 1KI8A 3I6BA 2J4DA 1V48A 4F6RA 3AG6A 3ROZA 1PSWA 1Y4SA 2J7PD 4II7A 2CUTA 2BT4A 1AKYA 4WKOA 5L7YA 3CVWA 3RYHA 2QVYX 4FFSA 3T38A 2RHDA 3IMEA 5DXFA 1DKMA 2IZ0A 4TS9A 2Z8YA 3HY4A 4AY6A 2IYRA 2WJJA 1JILA 3CUTA 3P1JA 4ZCIA 1NLZA 1KDPA 3OQPA 3UC9A 3R6LA 2PZGA 3DZCA 3ZXIA 3QKSA 4J6EA 3RUPA 4Y2GA 4EYQA 4WQMA 1CY7A 2B61A 2NO7A 1QO0D 4DKJA 3X1DA 4U6SA 5JSYA 3D6AA 3QKRB 5JATA 2IEIA 4HNGA 1D2NA 4OK5A 2XNHA 4Q18A 4ALNA 4OLHA 4Q4DA 1MVNA 4O4LF 1SVNA 4RIEA 3F9CA 3QNMA 3AI2A 4L78A 4K2HA 1GTMA 3WQHA 2XZLA 1MUUA 2J5XA 3HU2A 3LQYA 3TIIA 5KTOA 3HCOA 1LLFA 3NBYC 2W0MA 4L9RA 2FQYA 2JLAA 1LSUA 4XARA 4ZN6A 1D0VA 1Z0FA 4Y2QA 1UXGA 4HWSA 4U0KA 3TKYA 2FW7A 1JIKA 1ZNZA 2AR0A 2P9EA 4MS3B 4QICA 3RV3A 3QP9A 4EHJA 1OGIA 3E5HA 3WGGA 5BPHA 5KOHB 1X80A 5BV2P 3DTVA 2W2KB 4HZUB 3GH1A 4I9GA 4UOEA 4YAIA 3GEPA 1PIWA 1W49A 3N2NA 4MKHA 5JSQA 2IYXA 1JJAA 4PSKA 1A04A 1FQWA 5LKAA 3RSSA 4KW7A 3WYCA 5KDOA 2DUWA 4EYSA 1W5FA 2GN6A 3EFOB 1TCVA 3K53A 4HNAB 4CM6A 4D9NA 1L4GA 4I1YA 4REOA 1O96B 1WQ3A 3L4EA 1ZINA 2VR1A 4B0OA 3D0RA 3K1YA 3S1LA 4NL4H 2Z9DA 2XX3A 3GF4A 3DNFA 2D59A 4RK1A 4UCWA 3SF8B 3ZCXA 3DOFA 3JR7A 3ABRB 1J7KA 3GD7A 2BHTA 3BT7A 2J7PA 4GQAA 2A14A 3RAJA 1EWVA 3NAMA 4W63A 1GXSB 3DO5A 4HFNA 2ZSFA 4K0RA 1ZU5A 2OE2A 1KJZA 3ZLTA 2NT3A 5KU1A 4KFRA 3IAAA 3S7ZA 1ECJA 2PH1A 3CKKA 2VJAA 5J4LA 1RVDA 4PZPA 3C24A 2RGNA 5EVJA 3VTFA 2I3DA 2WFAA 1AN0A 1UPAA 1EFKA 3O03A 2X14A 3GCWA 1EJ0A 3OZCA 4L4ZA 5HF5A 1RAEA 2XUKA 2NO4A 3I42A 2RCNA 3PV0A 4LZLA 3WL8A 1G5HA 1M1XB 3ZV6A 1N3YA 1PFGA 1UQRA 4HN4B 4PONA 3EGWA 2F3TA 2YJ4A 2JLCA 4W99A 1Y5RA 3EXEA 3IIKA 3KT3A 4NU0A 2KLBA 4LCEA 5LXTB 721PA 1QH8B 3TXYA 2D0IA 3DEAA 4WZBB 3LVFO 3EW7A 3DBHA 1FU8A 4RANA 1YJXA 2AC7A 2B83A 2WD7B 5IEBA 4JQCA 5D2CA 3DL7A 1YZVA 4IX9A 3AOGA 2GYWA 2O2XA 3DKPA 4LHYA 3ZWNA 1IVNA 1ZWLA 2XB6A 1E3JA 3AEXA 3WL6A 1GJRA 2HCJB 2YHIB 1FMJA 1T13A 3E7DA 3LHKA 1F2VA 4IXMA 4OQPA 4U6NA 2JG3A 2CDAA 4W5RA 1P9OA 2VNKA 4JUBA 3C48A 3TEMA 1PFYA 2BWJA 2XBLA 1GAXA 5EUCA 4AUEA 5DYGA 1SXJA 1S0UA 5TQ2B 3I34X 3CF4G 3TQOA 3B20A 4GYWA 3CVYA 5FV4A 1ZYUA 2I4LA 2R7MA 1OYVA 3FWNA 1RIFA 1ZUNB 3PE6A 4HH4A 1A4RA 2DLNA 3D2BA 1D0IA 3W5CA 4R1SA 2Z6AA 3PYXA 2Y1XA 1VL5A 1YI0A 3IMGA 1DBIA 1R18A 1G8PA 3BSYA 2GJAA 2V6MA 4KQMA 4RA9B 3AG5A 3M70A 2CDRA 1YKGA 4KQ9A 4A9AA 3RS9A 4BLUA 1OC4A 4GR4A 2ZUFA 1BCSB 2HFKA 3EDOA 3LWNA 1NW7A 5TLSA 1LPPA 3H18A 3R3VA 5BWBA 4RY0A 1YAHA 3RVDA 2AC4A 2W2QA 1GKYA 2J5RA 3HGMA 2PZMA 1VYTA 1RSZA 3AHFA 4YQFA 2O8BA 4WXRA 5DX8A 1NBIA 4QPPA 3D6MA 3PNBA 3AFHA 4U7DA 4YCLA 4H7JA 3WHIA 3LPDA 4INOA 3LC2O 3I8OA 1QQ7A 2W93A 4RKQA 4A6PA 5BP7A 3H7AA 1EFRA 3VVCA 1JR6A 3PRKE 2H52A 2OM6A 3WRVA 1PG5A 1E4OA 1CUEA 4P5DA 2QX7A 3AY0A 3GT7A 2PUJA 5CT5A 4C0LA 2C7BA 3RBAA 4KXNA 1FX0A 1PRYA 1DJNA 2QP3A 1DHRA 1Z0IA 3UC5A 1G9TA 2PRKA 2Y1DA 3LD9A 2P1DA 2D00A 2A5YB 4GGOA 3UA4A 1U2SA 3VR3A 1N0UA 2FQQA 2FR8C 4WAUA 2ZWPA 4EVRA 3H0CA 4QAQA 3E27A 3W7VA 2VP9A 4WNCA 3EEQA 2PANA 2KMLA 3AL2A 1WXDA 2XCOA 1SU7A 3K9FC 2N75A 4C2AA 4PYJA 2WKWA 3L7AA 2EWVA 1XTQA 4YUYA 3TIFA 1DXYA 3WP0A 5KNBA 1H3EA 1LI4A 4KIUA 4R9VA 4YI3A 4US0R 4KAJA 3UHPA 4OXXA 4ALKA 2IX3A 4AS3A 3ZU6A 2J4FA 1ZGAA 3BD8A 4PTYA 3VI4B 2GHIA 3EFOA 3ZXUB 2Q3EA 1M72A 4YDSA 1O1YA 1BU8A 1N3BA 2IODA 2EERA 1Y6RA 2V03A 3R7FA 3ICPA 3RRJA 2QI9F 1EVJA 1LLUA 1HC7A 1QYWA 4LE1A 3MXOA 2W2KA 4HZUA 1ACMA 3M3PA 1WXHA 2J33A 2OGTA 3H4TA 4C2BA 5C3MA 1SBCA 2P67A 4M0KA 2MHCA 5CDSA 4IIJF 4JMPA 2CLEB 1LBTA 2XY4A 5JQGB 4KPGA 2GBLC 3CWQA 4JCCA 3U60B 5AKHA 2YXDA 4OM7A 1BEZA 1J0XO 2GMWA 3CU5A 3MILA 2VPIA 2O7NA 5A7HA 1JV2B 3I28A 4M76B 1H0SA 2DHQA 1YOVB 2G70A 2F3PA 1ORHA 3WGVA 4KI0A 4O5AA 1V9CA 3WI7A 1EQAA 2GYYA 2ZJ5A 5AOCA 5NULA 3DQPA 4YUAA 1DEKA 4LHVA 2V9CA 3FPFA 3RHZA 4C4OA 1G7RA 4FNAA 4CLHA 3TRHA 2O9JA 1LFDB 1FUYB 1IEQA 4G0VA 2UZIR 4G01B 2XEDA 1RJFA 2XODA 3CX8A 4IJMA 4EQZA 5DSZA 4EUKA 4PLYA 5GV7A 3D8RA 2I66A 2FR8A 3A3PA 3CRVA 3T1QA 1RKQA 1YNSA 2VJKA 3V4VB 1U7XA 4RTPA 4UHJA 3MPUA 2DPHA 5IWCA 2P5YA 4TMXA 3R7NA 1E7QA 3LFTA 1KORA 2PMFA 2OUKA 2QYOA 4DPMA 4EVIA 2OHJA 2ZDHA 4JJ4A 4BQNA 3ZI4A 3OJCA 1EFPB 5DRYA 1N5KA 2X5KO 2C5GA 3QVUA 4E1BA 3T7AA 2QKYA 3BAFA 5JNVA 4UUQA 5TMDA 3WLLA 2QGNA 4P7BA 5E95A 3GPCA 3RFVA 1TTQB 2Q29A 4CV0A 5KHLB 4NCBA 1JJFA 3DDSA 5JVDF 4P84A 3PJDA 2Q2NA 4K9SA 4C3OB 2FPWA 4QDTA 4HLDA 2HDWA 3ZQ6A 3BK7A 5CK4A 1N2HA 2H9AA 3MWFA 1K5GA 3RVOA 2VK8A 2DPLA 1GPH1 1F9AA 3F1LA 3PGMA 4JP1A 1GQFA 4Y2JA 3GLGE 1GZ6A 2VRNA 1ORRA 2QJRA 3PDCA 2BFBB 2GEDA 4BQOA 3BXPA 2QTAA 2AQHA 5CH3A 1HKUA 1BS2A 2CYBA 1W94A 4XDYA 5DYWA 1JVNA 2BEJA 4L7QA 2HNAA 3NV7A 1OLXA 1V95A 1XCGB 4OLBA 3B1FA 3FFAA 5GZ6A 3ZGVA 3A2KA 4OAQA 1VCIA 1Z6TA 1T4GA 5I8ZA 2V5UA 1W8DA 3UJ3X 4DSNA 1Q50A 2WR8A 1CJSA 3BRQA 3R2JA 2YC4C 4TSFA 3CRNA 4X0EA 5L53A 3UCFA 1JAYA 1TA4A 4HBGA 4KQFA 1AO0A 3OQOA 2FN3A 2HYDA 4HRYA 4TGLA 4KG7A 4ZYYA 5G0WA 4NC9A 4DB4A 5HYVA 3VU9A 3OZTA 2IU0A 3PEFA 3QV1A 1NPTO 3OEEA 5AHXA 1P7YA 4DE5A 3H2SA 1JDTA 5HMLA 1XMQB 2CNNA 1SPBS 2WAOA 4RIIA 1PJSA 2QV7A 1G5RA 3E2MA 4BLTA 1QV7A 3KSRA 2C29D 3NBXX 1G8HA 4ZCQA 3CZMA 5A0FA 4LRXA 4B3HA 3BA6A 2QY6A 4E7OA 4ZVNA 1IBMB 4K9NA 4RAQA 5HZKA 3OCYA 3W5DA 1WLYA 3MQ2A 4WJKB 4G8CA 3UYLA 4ZMRA 5HQJA 3HO1A 1H6DA 2TMKA 4BKM