3G9ZA

Crystal structure of este5, was soaked by p-nitrophenyl caprylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9zA00
4BP9A 2ZYSA 3F8SA 4J0DA 2WKWA 1IUOA 1R3DA 4FBMA 3BL8A 4M0MA 4GECA 5HF5A 3A2MA 3BDIA 4WY8A 4OD0A 4OSEA 2RAUA 4G9GA 4N8SA 4Q3OA 2VTVA 3IURA 2DSNA 2HL6A 3DNMA 3HYSA 5FDFA 4K5QA 1CVLA 3AIMA 3O4HA 3H2IA 3U0VA 3I6MA 4IO0A 2QKYA 2BFNA 4B84A 4GXNA 5ISMA 2CEKA 1EDEA 4FBLA 2YXPX 3F9CA 1QO7A 4OYYA 2OQVA 5JALA 1EI9A 5CT4A 1QIFA 1CUEA 1DX6A 2WLSA 3DOHA 4Q1VA 1BCSA 2PKYX 4H18A 2XE4A 5CXUA 2WUEA 4G4IA 5T4BA 1A88A 4X95A 4HVTA 2HM7A 5H3HA 4PV7A 4KE7A 4UHHA 1ODCA 5BWBA 3WL6A 2V96A 1SOMA 2EDAA 2VJAA 1LBSA 3GELA 2O2HA 1BE0A 3I28A 3GFFA 1TIBA 1MTZA 3STVA 1K6EA 4TGLA 1GKLA 1EXWA 1MAAA 2GZRA 3ZI7A 5AM0A 4E46A 2AXEA 4NMWA 1WPXA 3LIPA 5IVDA 3FYTA 3PI6A 2XQGA 1ODTC 5T4EA 2YH2A 5DWDA 2OCKA 3WWCA 3WWEA 4DMHA 4Y2YA 2WG0A 3PE6A 3WA7A 2HRRA 1TQHA 4UBOA 1YS1X 1HPLA 1U2EA 3C5WP 5CTAA 1F0PA 4Y2RA 1F6WA 3DL4A 1VA4A 1XRRA 3OPMA 4FLMA 2HADA 3C6ZA 1EVQA 4UHCA 3C6YA 3WJ2A 1QTIA 1XZHA 4AMZA 2H1IA 4EY7A 5D3ZA 3W04A 5FV4A 4DNPA 4WFIA 1KU6A 4DMCA 3VDXA 2HU5A 3R40A 4E14A 3V1MA 1YCDA 4UFOA 3M83A 3QPAA 5LKRA 2H7CA 2VJCA 1HLGA 5JYCA 2BKLA 1IVYA 1QIEA 5I9IA 2RHWA 3I6ZA 3OURA 3PUIA 3LIIA 1DWOA 5EIHA 1THGA 3DL7A 5EFZA 2WUFA 2HU7A 5A71A 4AO6A 3UUFA 1UFOA 4KAJA 4X00A 4BVKA 1CUGA 2QOEA 4Q3KA 4X92A 3ESCA 2C7BA 5LYYA 3WK5A 3BJMA 5JATA 1UWCA 5ALSA 1KEZA 2HA0A 4B80A 2IITA 4U2DA 1SCQA 2WUGA 1XRLA 3R3VA 4EY4A 3AZOA 1UK9A 4CI9A 1JT2A 3F98A 5CT8A 3L1HA 2DCMA 3N2ZB 2O2GA 3FVRA 1I6WA 2VF2A 3HLKA 5IVKA 3A2LA 4XWGA 2JGLA 2Z5GA 4X94A 2WIFA 4GEGA 4BATA 1CUBA 3G0CA 5LIPA 3D7RA 5AO9A 5A7GA 1VKHA 2VQ6A 1XZDA 5FKJA 3AZQA 1QJ4A 4KAAA 2XUHA 4WCVA 2HA6A 3YASA 2GYUA 1BEZA 1GPKA 4UBJA 3DEAA 5HZGA 4HAIA 3VVLA 3GZJA 5AI4A 4CG3A 1ZGCA 5AJHA 3BF8A 1C4XA 4MWTA 4KR0A 3H18A 3FAKA 5FLKA 4YPVA 1FJ2A 1Q84A 3FOBA 5DNUA 2ZYHA 1FFAA 4DTCA 4PQEA 1CUDA 1VXRA 3WZLA 5C7YA 5AOCA 2Q0XA 2OGZA 3HJUA 3IB3A 1VE7A 3I2JA 2XDWA 2QR5A 2WIGA 1EX9A 2DFPA 3WK4A 1FSSA 5AH0A 2PL5A 4BC1A 3G0BA 4E15A 4UPDA 2FJPA 1ORVA 2OLEA 5HCUA 2EEPA 4AN0A 5I7UA 1C7JA 4DLNA 4N8DA 4B82A 4O08A 1QIHA 3QM1A 5ALTA 1J1IA 3ED1A 1TCCA 3ZPXA 3VJMA 4BAUA 3GROA 2DHDA 2XUQA 5ALIA 4OB6A 4X71A 4Q05A 4V2IA 1JJBA 3KXPA 5ALRA 4BE9A 1BU8A 1VJ5A 5AKGA 3N0TA 3FYUB 2WU3A 3I1YA 4X3CA 2B9VA 1LLFA 2V9ZA 4XJVA 1HQDA 2ZJ6A 3SK0A 3EQ9A 2QJRA 5JAOA 3ZLVA 1ZD3A 3H04A 4RE6A 2DR0A 1HKHA 4G1FA 4IH4A 5ALYA 2YYSA 4HXEB 3E4DA 3UUEA 3WK9A 4X91A 5AIAA 2Y2VA 5LZ5A 2GYWA 4G4GA 3D3NA 2JEYA 3QH4A 3NOXA 1XLVA 3ESDA 5HK9A 2I3ZA 4ZI5A 1W76A 5DYYA 3W05A 4UBIA 1X70A 2LIPA 2WSLA 2QXTA 3H2KA 4EUSA 3T4UA 3VISA 4PSDA 3WI7A 1VZ3A 2HDWA 3OM8A 4F0JA 4BYMA 1WB5A 1ZD4A 4QWMA 4QDXA 1CIJA 4G8CA 4HXFB 2XI4A 5JAUA 1O6GA 4J0IA 1G42A 1L7RA 3G9XA 2C0PA 3W9UA 4YK7A 1UT6A 4ITVA 2XUGA 3STXA 1JI3A 4MQLA 4BBZA 1N1MA 5ESRA 4JH0A 3ANSA 1BN7A 5AKKA 4EY5A 2OQIA 3K6KA 1J06A 1LPBB 1PJAA 5LZ4A 2C4HA 4EB0A 4CCWA 3WL8A 5FRDA 1CUCA 3CN9A 3ESAA 1MN6A 1CEXA 1P0MA 4J0GA 1WHSA 5CH5A 4JUIA 4DMKA 3PUHA 1YB7A 4QE3A 3DDUA 1XZAA 1UKCA 1YA4A 2XLBA 3R0VA 3WKBA 4H7HA 1PV1A 3IULA 4OCZA 5ALEA 3O4JA 3CCBA 4X6UA 1GZ7A 1WB6A 4QWWA 4B83A 4YX9A 5CRIA 2QTBA 3GBSA 5LZ7A 4ZREA 1EK1A 2ZYIA 1GGVA 5ALKA 1MX1A 2XQIA 5JD5A 3H0CA 1QZ3A 3C8HA 5FOQA 4IH1A 3C87A 2ACKA 5A7FA 1BN6A 2XMCA 4AZ0A 3V1NA 3DKKA 4XIIA 3WWDA 1L7AA 3F67A 2PSEA 1CUHA 4W1QA 3D2BA 5ALQA 2WHPA 3RK4A 1W52X 1MNQA 4WY5A 1THTA 2Y6UA 4EY6A 2DHEA 3G0DA 5C81A 1MX5A 2WIDA 4IQ4A 3WK7A 2PX6A 4LHEA 2WTNA 5IH7A 3H1AA 3C6XA 4QDUA 4B0OA 2RI6A 2GZSA 2WIKA 1NX9A 2DQZA 5CBKA 3FLEA 3T52A 1AGYA 5ALLA 4WDQA 4E11A 3NWOA 1M33A 2HU8A 1GQRA 3P2MA 1DTEA 3D5EA 3FYUC 1QGED 2OXEA 3I6YA 5CT5A 5CMLA 2I3DA 1USWA 5EHQA 4GLBA 3FLAA 4NZZA 2PUJA 2EDCA 5CH3A 4X85A 2CMFA 4BZZA 4LYDA 5E2IA 3ESBA 1R9MA 5AM1A 1P0PA 4Y2UA 4J03A 5ALMA 3IDAA 4F21A 1AC5A 2IX9A 1IUNA 3ZLUA 4QLOA 5AK6A 1W75A 3X3HA 1UK8A 4G9EA 3HXKA 2AJBA 2HFKA 1XZKA 3AIOA 1EB8A 3B5EA 2VEOA 2OAGA 4CCYA 1EK2A 5BWCA 4C4XA 2OPHA 5LZ8A 2VT6A 4JEIA 4BTLA 2XUDA 3SX4A 3QBJA 2GBGA 1H2XA 5SYNA 3OTQA 4AMYA 3KOOA 1SCIA 2XMRA 3FSGD 2WFMA 1ZI8A 4C6HA 5JAPA 2WG2A 3AJAA 2PPLA 1MU0A 3MGAA 4JYPA 4CIAA 1EA5A 4AN1A 1E5TA 3G8YA 3JW8A 4H7FA 1TRHA 5AM5A 1MPXA 3H17A 4X97A 2WJ6A 2H9YA 1QONA 2WILA 4OU4A 4MJ3A 3V9AA 1FFDA 2ES4A 2WHQA 3IUNA 4MEAA 5ALZA 4EA6A 2DHCA 4W63A 4K2AA 3WMRA 2GBIA 1EINA 1G4HA 3BE8A 5EIEA 1CUZA 4U2CA 4L0CA 5AM4A 3HRHA 2V98A 4DMFA 3ZWQA 4BVLA 1FFCA 4G8DA 3WKEA 4U2GA 3FLBA 2XQFA 2XUAA 3E3AA 1IZ8A 2OG1A 4IHAA 1LPSA 2NW6A 5BV7A 3D2AA 2Y6VA 1P0QA 5FXMA 3HI4A 4OB8A 1EB9A 2I03A 1MNAA 3MUOA 1A8UA 1R1DA 1NU6A 5FP0A 1XKTA 3G7NA 3HACA 3PFCA 5E4TA 4Y9SA 3H19A 1B41A 2B20A 2ZJ7A 2OCLA 4BE4A 3WQHA 2JGFA 4BZWA 3AINA 3WWOA 5HKBA 1CUJA 1QIDA 3TEJA 1U8EA 2HA7A 4Z49A 2BUCA 1J07A 1QIJA 1UXOA 2FX5A 1JMKC 5K3FB 4UHDA 2O7VA 4Y2VA 1ZOIA 2D0DA 1RP1A 1R50A 4A23A 4RGYA 5JD6A 4BDTA 2XMSA 1LZKA 2WIJA 1T2NA 2G5PA 2QZPA 3IBTA 1DX4A 3R41A 3O9VA 5T4HA 4YASA 1VZ2A 1CUFA 3O4GA 2RGUA 5JZSA 1WPRA 4K6KA 4KACA 3W06A 2O7RA 1TK3A 1LPOA 2XT0A 1MAHA 2G63A 4N8EA 4FOLA 1QO9A 2XLCA 4PF1A 3BXPA 1YSCA 4KJXA 5DNVA 5A2GA 1N5RA 1OILA 4P93A 3IUQA 4FNMA 5D7BA 5HF6A 3STYA 2OGSA 3VVMA 1E8DA 3O95A 4G4JA 5F4ZA 1XROA 5SYMA 1A8SA 3LS2A 1UK6A 5EHNA 1QIMA 1CR6A 1DWPA 3DCNA 2QM0A 4WDRA 1Q0RA 5LKAA 2HA2A 2GBCA 4PNZA 3W2TA 4B81A 4JNCA 4CFSA 4Q3LA 5JIBA 5DTJA 5AKIA 3VXKA 3S8YA 4BAZA 1UOOA 2CUTA 2BJHA 4Y2PA 1Q83A 2VSQA 1LPPA 1YA8A 3OG9A 2PVSA 5AK4A 1UKAA 1H23A 3C8DA 1CUAA 4U2EA 3WLAA 5A7HA 5I8PA 2C0QA 3AFIA 2QRUA 4GW3A 2J3DA 2J3QA 2XQJA 3IUMA 2HIHA 2XUJA 1ZICA 1XQWA 1XZEA 2WU4A 3GA7A 5AKHA 1P0IA 5LZ2A 1VXOA 4J7AA 1YB6A 2IIVA 4I3FA 3WYDA 1XRPA 4B9EA 5AKLA 1GT6A 4XX1A 3EQ8A 7YASA 3VKFA 2FUKA 3D4LA 1K63A 3CN7A 4P92A 2W22A 4W9RA 1CPYA 2ECFA 1GQSA 1CQWA 1QIGA 2J4CA 2WG1A 1XQVA 2VJDA 4CIBA 2JGEA 3STUA 3IVMA 4OB7A 4CG1A 3QITA 2H7YA 2E3JA 1FFEA 3F96A 2V97A 5K5EA 1R4ZA 4INZA 4LIPD 3BJRA 4N5HX 4AQDA 4LXIA 5DTIA 3QYJA 1XZCA 4N5IX 2R11A 1AUOA 2X8BA 3EBLA 4BP8A 4H77A 4FLEA 3HZOA 4HS9A 4AXBA 2W6CX 4FKBA 5IKXA 4JYMA 1CUUA 1DT5A 3QPCA 1Q0ZA 3WK8A 4AX4A 4X93A 3STWA 3BIWA 1CFJA 4BTVA 2Y1KA 3KDAA 4EBBA 3DLTA 5FPPA 2VAVA 2XUPA 4ZV9A 2WFLA 5DLPA 1MX9A 2JGKA 3FVTA 2GYVA 2WQZA 2PSDA 4FFWA 1CQZA 5EGNA 4Y2SA 4PW0A 5ALOA 4EHBA 2DQYA 5JADA 5FUMA 4FTWA 4UHFA 2RHTA 4MXDA 1H22A 4XVCA 2AJ8A 5ALVA 4KAFA 5AI6A 4BAGA 4BC0A 1U65A 1EHYA 1W1IA 3UMJA 5K3CA 3H2GA 1UK7A 5HFNA 5HFAA 3V1LA 1N8SA 3BWXA 3AZPA 4W1RA 2B4KA 1ZJ4A 2OCIA 5CH8A 3RARA 4HTAA 4I4CA 4HZGA 2BCEA 4QDTA 3R3WA 3KWJA 3H1BA 4B0PA 3PICA 4FFVA 5K3BA 5HF9A 1XLUA 2QUAA 3LCRA 5AI5A 1WCYA 1X2EA 2Y2UA 4RE5A 5CXXA 1A8QA 1XFDA 4H35A 2WJ4A 1IUPA 1EDDA 3S2ZA 5AHXA 3BDVA 1C7IA 5AM2A 2RONA 4UHBA 4S0XA 4C4YA 5K3EA 1ZGBA 1EDBA 2HA4A 2XB6A 2CJPA 3L1JA 1JMYA 4FMPA 3WKCA 5AK5A 1LPNA 4MWSA 3D59A 1GKKA 2I78A 4PO3X 1CUXA 4BDSA 5AKYA 4F60A 1RYYA 3WA6A 3DS8A 5ALGA 1IZ7A 1E66A 2JEZA 3C45A 3WL5A 1ZIXA 4C88A 5AI8A 4LXHA 2AJDA 2WFZA 4TVKA 4HRYA 4OYLA 5A6VA 2HA3A 2ONCA 4PSUA 1EVEA 4QEKA 4B7ZA 3FSGA 5CT9A 4H7KA 5K3DA 1A7UA 5AOAA 3DKRA 1ZIYA 1ODSA 3TRDA 1HBJA 3DQZA 3MUNA 4J3JA 1UKBA 1AQLA 1UOQA 3C6BA 2J4FA 4BCCA 3KWFA 2X76A 3E0XA 2XMBA 4QZVA 4DIUA 1T4MA 1LBTA 3HSSA 4C4ZA 3FWHA 3WL7A 5ALNA 3WZMA 5AM3A 1MJ5A 5ALHA 3JWEA 4K6GA 1QFSA 1B6GA 4H7DA 1PFQA 1BS9A 3AILA 4LYEA 4ZWNA 2O2IA 4W1SA 2C58A 3DJYA 5HQ3B 1Z68A 1Y7IA 3Q0TA 4DM7A 2K2QB 4GI1A 4AO7A 4OUKX 3G02A 3VJLA 1MO2A 3H2JA 1XRQA 4X6XA 1LGYA 4FDMA 1XQXA 2CZQA 3WIOA 1JKMA 3R3ZA 1F8UA 3I1IA 5EIAA 3PDCA 1X2BA 3DD5A 1QOZA 4MQMA 2BUBA 4FWBA 4KEAA 1ZJ5A 3NUZA 4KRYA 5C8ZA 1LPAB 5C8XA 4J0CA 2QS9A 4BRSA 5JARA 1YAHA 1K5PA 4U2BA 4LXGA 1E8NA 1ZI9A 5ALUA 1AKNA 2ZJFA 3V48A 4D9JA 2WTMA 3ICVA 1DWQA 2WHPB 1BRTA 1XZMA 5T4FA 1ZD5A 1XQYA 4X90A 5KREA 3RKSA 2VJBA 1XZBA 2XMQA 3D2CA 1O6FA 5JANA 1E3QA 1OXMA 5CT6A 2ROQA 5AKEA 2ORYA 2X5XA 4WFKA 2AJCA 3FBWA 5AI9A 2ZSHA 1WOMA 3A2NA 4DNOA 5AICA 5K3FA 2HA5A 1CUYA 4M0EA 4IH9A 5ALXA 5ALJA 1K8QA 3D0KA 1XZIA 3NGMA 3PF8A 1R9NA 3AIKA 4U2FA 3BIXA 4J0KA 4M0FA 4Q34A 3I2HA 3G0GA 4HRXA 4AO8A 4DSAA 2VATA 3U1TA 5EHZA 2UZ0A 4ZGBA 4TPKA 1XRNA 2VAXA 4C01A 2PU7A 4L3WA 1J2EA 2PM8A 3B3QA 3CCCA 5HKAA 1JFRA 4P9NA 4H0CA 1L7QA 3O0DA 4C89A 3HABA 2GBFA 4CCYB 2C5GA 4BCBA 1XKLA 5CURA 3KSRA 5KWIA 2G5TA 3TGLA 3SWWA 5D3KA 5DJ5A 1W4LA 3I2IA 2CB9A 4QA9A 5HF8A 2HHAA 2QXUA 4NS4A 1ISPA 3SC2A 5AKJA 2BAGA 4BB0A 1QTRA 4AZ3A 2PUHA 1CUSA 3O9MA 2XMGA 2ZYRA 4QNNA 1ZD2P 1QFMA 3B12A 1LNSA 4KE9A 4ZRDA 2WUDA 1AZWA 2WM2A 1JJFA 5JZ9A 3R3UA 1ZI6A 5J3JA 1G66A 4OU5A 1VOTA 2CKMA 3A6ZA 3WKDA 4X6YA 4ARAA 2CBGA 3EQ7A 2RIPA 2PSHA 3W9BA 2HRQA 3EIOA 2WJ3A 3TJMA 1AX9A 5LP1A 3G9UA 3ICWA 3WYNA 1VLQA 4FHZA 4GHWA 4Y2TA 2QVBA 3ANTA 4H7EA 3IA2A 5CW2A 1QE3A 3E1GA 4KYVA 1QIKA 3I2KA 1VE6A 5AK3A 2QMQA 3EF3A 3HEAA 4UHEA 4QDOA 4MYSA 1WB4A 2B61A 4DNFA 4ROTA 2BGRA 3QPDA 1F0NA 2C5FA 2ZSIA 1LPMA 4C87A 4FNGA 4BCDA 5FPQA 1BCRA 3GUUA 1VA5A 2BGNA 3FYUA 3R3YA 5AP9A 1XLWA 1U4NA 3I2GA 4DYHA 2OGTA 1D07A 1XZJA 4H7IA 4L9AA 3G9ZA 3PF9A 3O4IA 3WKAA 1LZLA 3WIBA 1TCBA 4Y2XA 1JU3A 2PBLA 1YAJA 5K3AA 1YR2A 4GWLA 1E8MA 5JZBA 1CUWA 1GPNA 4EY8A 1HDEA 2XMZA 3PFBA 5IVIA 5E4YA 5C8VA 4QDZA 1Y37A 3QMWA 3LP5A 4B9AA 5E4JA 4BVJA 1WHTA 1HL7A 4G5XA 4GDMA 1CRLA 3V1KA 5DNWA 4MYDA 5ALFA 2Z3ZA 1IMJA 1TKRA 2JGJA 5JASA 2Z3WA 4ARBA 1XZFA 3OOSA 2OCGA 5ALPA 1KU0A 1YASA 4G8BA 5ALWA 4UBNA 3C5VA 5JAHA 4CG2A 3IIIA 1ETHA 4FLFA 2ACEA 2JF0A 1CUVA 3M3DA 1CUIA 5D6OA 4EZIA 3STTA 2ZVDA 2JIDA 1BEEA 1R88A 4B85A 1K4YA 3ZLTA 4Q82A 1H2ZA 4L72A 1WM1A 4I19A 4LKOA 2XQKA 5AI0A 1JJIA 1CLEA 1H2WA 2QT9A 2XUOA 5HK8A 3KD2A 1AMNA 3HC7A 4ETWA 1DT3A 1GPLA 3CXUA 3C70A 3QMVA 1NU8A 5LZ9A 4MEBA 5IVHA 3IUJA 4WFJA 1YS2X 1W6RA 5DYWA 4DSZA 3DYIA 4WJLA 5EHXA 1XRMA 4QLAA 2VA9A 4KE8A 3WJ1A 4W1PA 5LLSA 4NVRA 1OCEA 3G9TA 1N5MA 3G0IA 4A5SA 1ACLA 5A62A 1TCAA 4UBKA 4ZV7A 1FFBA 1H2YA 4AB1A 1RWQA 2XUFA 2Z8ZA 3M82A 1UOPA 5ALDA 4Y2QA 2OAEA 2PSFA 3OC0A 2XUIA 4DNQA 3ZV7A 4A16A 1MT3A 5AOBA 2JGIA 1SCKA 4GBGA 3JYHA 4H7JA 4UFPA 3F97A 1EH5A 4Y2JA 2G4LA 4Y7DA 3R3XA 4K6HA 2PU5A 4X7BA 5HQ3A 2AJLI 3H2HA 2Z8XA 3QZUA 1ORWA 3K2IA 1CV2A 2R8BA 5EI5A 1S8OA 2H7XA 3AUKA 1QIIA 1TAHA 1SFRA 3BF7A 4F5ZA 1ACJA 2P8SA 1QLWA 3WK6A 2JGMA 2WHRA 4KRXA 3K9BA 4UFNA 5KBYA 4KE6A 3VJKA 2WFLB 3C43A 1UZAA 1DQZA 3DOIA 2YASA 2JBWA 1JU4A 5DYTA 3L1IA 3MVEA 4HXGA 4RNCA 5KWJA 3DYVA 4J0HA 2VT7A 3FCYA 2QUBA 1Y7HA 4DGQA 2PSJA 3LLCA 3ILSA 1XZLA 1SC9A 6YASA 5AKXA 4ZXFA 1GXSA 2HFJA 5JD4A 4RPCA 5AKZA 1DINA 3FNBA 4P08A 2XMDA 3A70A 4B6GA 4BRZA 3QMMA 3RLIA 4UBMA 3RM3A 2D5LA 1AURA 1E89A 2BUAA 5YASA 2FJ0A 1BROA 4PSCA 3M81A 3WWPA 2XUKA 4UBLA 1DU4A 4J0JA 5BOVA 2QJWA 5AIBA 3QVMA 1G5FA 1XZGA 4OPMA 3I2FA 4UUQA 3Q8WA 3FCXA 1DQYA
chains in the Genus database with same CATH superfamily
2APJA 3EXEA 5BSRA 3F8SA 4B76A 4IIVA 1XALA 2EQAA 2WKWA 1UMDB 2NT4A 2W48A 4BHTA 2H18A 3ORRA 1KDTA 4OQLA 5C53B 1IUOA 5TGDA 3BCUA 3LC1O 5HF5A 4MDYA 2FWIA 2PUTA 3EZ9A 3VH2A 1SVOA 2H5LA 4NRDA 4R1PA 3WYEA 1Y6QA 1ND6A 1PR1A 2BEUA 1IY9A 2EBHX 4N8SA 3EZLA 4MHTA 2HWKA 1JEYB 2D5AA 2FQXA 3EVCA 3IURA 4V0NA 5BQOA 3OWHA 1L8QA 3KEQA 1FFWA 2E1RA 1VCMA 1LW7A 3HYSA 1GNQA 4R31A 1EIZA 1YBFA 2WICA 3WDKA 4NBTA 2IRWA 4TTPA 4IG4A 2YC4C 4BO7A 5LWHA 2B78A 1BWRA 1TM1E 1Y9AA 3ECCA 3FI9A 5E3JA 3UCEA 4L08A 3D64A 1XDZA 2PS9A 3D54D 5AJVB 5I48A 9ABPA 5BN3A 2Q3HA 4NS1A 4BEWA 5ABPA 4D3DA 5CFLA 2NVOA 4EKYA 1MTOA 2EFHB 3CRMA 1V96A 4GXNA 5ISMA 3BJEA 1RXVA 5IH3A 5F77A 1M6WA 2A3NA 2Q7XA 1L4MA 3CLVA 3BMXA 4HWRA 4WKOA 3ST7A 4M4SA 2YXPX 2HYIC 4NAVA 4OYYA 4NFSA 1NY5A 4ID9A 4ZT2A 5JALA 2QT0A 4LRQA 4GM0A 1PQ4A 1ZNXA 4PZPA 5TQ0A 2I9KA 2GZ1A 4LUCA 1DX6A 4G36A 1X7XA 3DOHA 3NTVA 4LHXA 4XFKA 1CF4A 2OO5A 2Q0SA 4JB2A 4B2YA 3TJZA 5CA1F 2PKYX 4C0HA 1W36C 1F6BA 3T9EA 2Y77A 3U3RA 1AZLA 2QMHA 4G4IA 5CXUA 4HQOA 1A88A 2ZRPA 1I0LA 4FFLA 3LW8A 2RGDA 2ZE6A 1DE0A 1QNLA 3M7IA 3RYFB 4BN4A 3S2YA 5L3QB 5BNFA 2P4QA 5D2CA 1M66A 3EIFA 1B43A 4ZRMA 1A4UA 3EFBA 4KV9A 4AKHA 4PLZA 5BWBA 4J49A 1Z5WA 2L2QA 3GFOA 3WL6A 2WWTA 4IL5A 2BMDA 4L07A 3USCS 3I28A 1PWHA 2P75A 3AF5A 5DXJA 1FQKA 1TIBA 2BP7A 2DY1A 2IYSA 4LJLA 3UWMA 3VBCA 1HE1C 3STVA 4AMBA 1WSAA 3VO8A 4HDSA 5KTPA 3TD9A 4TGLA 1HZZA 4L2IA 1E1LA 4BBPA 2XB4A 2ZB8A 1R4NA 2YMQA 3I34X 2GZRA 1BVHA 3C24A 4O4JB 1EKXA 2VR1A 3FWNA 2CNWD 2J9YB 1ZWLA 1CJTC 1I3KA 2VQSA 4TUYF 4E46A 4NCXA 1SCDA 2GNOA 3O6VA 3LUFA 3LIPA 3O2SB 3SI7A 2JGDB 2F3RA 2G04A 3GJ7A 1K3UB 2ZR9A 2RIRA 4YP9A 4LECA 1MC8A 1S9HA 2VHUA 3PI6A 4MW9A 1DKMA 4BRUA 5ADWA 4YRPA 3QVWA 3IEUA 1HMYA 4Q9HA 3DE6X 1TUBB 3EJWA 4RJJA 1OTYA 1P5FA 4DA0A 4ETNA 4ZU6X 1FU4A 1SCJA 4JQOA 4DLPA 1RQLA 4YCCA 3KKOA 3WWCA 4MB0A 2VHCA 1FCJA 1RI5A 3DHYA 1FLNA 4Y2YA 5C0OE 5E1BA 3VSEA 1PWXA 1IDOA 4XIJA 5THXA 3INRA 3RG2A 2QE7A 1J2RA 2B21A 1MJGA 1N2ZA 3DE4X 1OX4A 2H4HA 1JTFA 3L0ZA 1HPLA 4IVRA 4GYWA 5DN9A 2XMPA 4RPJA 4EFKA 2L18A 4ENVA 1F3LA 4KR2A 1TNDA 2MR6A 5DGIA 4R9RA 4NV0A 3QNMA 4EGCB 3KEMA 4XR4A 1LTQA 5IJ9B 4WHMA 4LK2A 4B79A 1VA4A 2F43A 3FFWA 1XRRA 4NC9A 4TT8A 3UJPA 1ZK0A 2VDRB 2CDRA 3BZBA 4RAOA 1US8B 5F9MA 3W2GA 3WLOA 1POXA 4PYIA 3TTWA 1F6DA 2ZSAA 1MAWA 4L5IA 2O1WA 5I7EA 1G7SA 3R9XA 1M34A 4UHCA 4F4CA 3K20A 3WJ2A 1FXSA 3IR5A 4GM1A 1C1YA 1ZINA 4AMZA 3PQ2A 3RGGA 1I4OA 3V4RA 4RVSA 2FPRA 3UG6A 4KI0A 4ON9A 5DHAA 2CEAA 3QLUA 4A36A 4ZANA 1JLSA 2CC2A 2FKAA 3JR7A 3VTZA 4DNPA 1CEYA 3A9SA 5EEGA 2GO1A 5TPWA 2ZZMA 3VDXA 4F9EA 1Z3IX 4KYUA 5AUNB 1XDUA 4GZ5A 4ZO9A 4E14A 4E33A 5LBUA 2YFKA 2QNBA 4M9ZA 2DT8A 4KBYA 2WF7A 3RUEA 5MDHA 3FZEA 3U6BA 3JTEA 2BM8A 5LKRA 3GQBA 1T9GS 1D2CA 2H7CA 2ZBFA 3GMIA 4DSTA 4WZZA 2OYSA 4JX8A 2GM3A 2EGGA 2PR7A 2QG4A 1IVYA 2WOOA 1Q5PA 1QIEA 2RHWA 3AW8A 2HCRA 2C2WA 4EHKA 1SKMA 1YRAA 3I6ZA 3K05A 2XXAA 4JBLA 1E1KA 1L5RA 1OWPA 4R9UC 1TMGE 3GJYA 2AFIE 1NVWQ 1Q7RA 1GPUA 5H70A 1J1ZA 2ZQYA 4FK8A 1I7QB 4YJ2F 2JIBA 3L49A 4I1OA 1SXPA 4OJKA 1C3OA 5ERXA 2AEMA 2P78A 4FYKA 5A71A 5FBLB 4DT1B 2B82A 3FB4A 3JVEA 3QNWA 2IWRA 2V5UA 1NVGA 2YN2A 3R9XB 1L5WA 1UFOA 1DTWA 3ISJA 3FMOB 4KAJA 2CXOA 4X00A 4BVKA 5KPJA 2QQFA 2EWVA 1WVIA 2ZBGA 5D5QA 1F8GA 4CLHA 4Q3KA 2GTIA 4ES6A 1BXGA 4X92A 2BFBA 1X8KA 3UW3A 4B3CA 3CE9A 5JY6A 4Z2AA 5JATA 2DEUA 5EXEA 3ZKWA 3CPEA 5IBCA 4AMVA 1KEZA 3UJBA 1CT9A 1RRMA 3P19A 1P80A 1L5SA 4RMNA 3RBVA 4WZ6A 1GD1O 4B80A 1EP2B 2Q1WA 3NQ41 2I4LA 4Q3DA 4U2DA 3ZWPA 1SCQA 3C7KA 3CRZA 4EHFA 1XMQB 3ZNOA 2J3IA 3IMGA 3EHDA 3A27A 1PIWA 5KKCA 1GCOA 1QGUA 2ZIXB 4BB6A 3TR6A 1BX0A 3ETNA 2PEYA 2AD5A 4K28A 3TJRA 5KHLB 3N7UA 1EP9A 2JLSA 2VPPA 2VTDA 3HXMA 2Y1CA 5CT8A 3U61B 3L1HA 2O2GA 2ADFA 1CVRA 2P67A 2HCFA 1BWSA 1I6WA 1XTIA 2P7HA 4DCCA 4ZTZB 5BYKA 3VC2A 3IAM6 1TW3A 1FW8A 4IQGA 1G17A 1N2OA 1XTVA 1JIXA 4NK4A 3S99A 1W88B 2Z5GA 1A9RA 2V7GA 4GBJA 1ORHA 2B92A 1CQIB 4B7UA 3VR1A 1XTUA 3BL6A 7ADHA 1KI2A 2Q5HA 2QYOA 4EJSC 4IZ6A 1I01A 2H11A 5BQ3A 3PUXA 4ALJA 4ZCQA 3MERA 3GVHA 1K06A 3F5MA 3HXTA 3RYHA 1L4NA 1PX2A 3EY9A 3BMQB 3BC1A 3IQHX 4L85A 3T5GA 1IJEA 1H6BA 1PEKE 1I51A 1RHUA 2FV8A 3C4VA 2PG3A 1PZGA 5LDDC 3HVUA 2PMCA 2C8VA 2H2GA 3M5WA 3F6YA 4LRWA 1NZJA 2GA8A 2A9PA 2W7TA 4YDRA 4H6VA 3DEAA 4DR5B 4BVEA 3OHMA 1ZJ6A 1JU9A 1Q2UA 3LHIA 4MINA 3WX0A 2C7QA 3N6XA 3W9SA 3R3JA 1XUOA 3R44A 2O7NA 3N70A 4LTMA 4MLZA 3CSUA 3GZJA 1AQNA 4X1KB 1RZRD 5AXCA 1MW8X 2CVHA 3SIXA 3G8AA 3H42B 4PQGA 5BRJA 1J4AA 1EQ2A 2H7VA 4YP5A 3PT5A 4XR9A 3V2IA 1JWBB 3QYFA 1XCPA 2VAWA 3DSRA 4KR0A 4BV3A 1FP1D 3FAKA 1LF5A 2ZJ0A 4OAQA 1Y80A 3T7JA 2VJPA 4QGHA 2AD1A 1VYTA 2JW5A 1PUIA 3ZZMA 2RGCA 3M89A 1ZIPA 2VPQA 4EL5A 2YN4A 3VZQA 1F51E 4PXAA 4BQQA 2WTUA 3CZPA 4WXEA 1KI6A 5ESRA 3E9DA 1NN5A 2ZBQA 1IM5A 1PF7E 1R9JA 3KG2A 1ZDMA 3JS5A 1E0SA 2X0KA 3CZ4A 1GPDG 1NQOA 2AR7A 3RE1A 3GLUA 4QGGA 3TQSA 1YZNA 4PQEA 4AMGA 2D8MA 1AN0A 3CEAA 3HB5X 3HLTA 1XWFA 1VXRA 1I6KA 4BO3A 2SHKA 3C6KA 4TTRA 3DZBA 2OZPA 3W5JA 1HMPA 2Q0XA 3HB0A 1ZJYA 4WINA 5TQJA 2QX9A 3VFDA 3W4IA 3K53A 3HJUA 5CVCA 1I0IA 4TT3A 1E1RA 1U8UA 5JI3E 1TU3A 1E1CB 2BI7A 4M3NA 4FYVA 2J3HA 1CJBA 1ZCZA 3AYXB 3GRVA 1O5IA 2WM8A 1ISGA 2EERA 4EELA 4ZIRA 4PYOA 2ET6A 1TC2A 1YACA 3LQ2A 3OZTA 4FNAA 1OLUA 1NBAA 3EYAA 4FQ5A 1M7HA 3PPVA 1YHYA 1XPUA 4GIBA 3N2YA 2ZRQA 1BWPA 2EVWX 4JLKA 4M98A 2ZUFA 3G0BA 4QDJA 1L8OA 3DE7X 3UTCA 2P0YA 2XVXA 2ESRA 1ECLA 3IEXA 4FYXA 3OLVA 4PZDA 3T0FA 4M88A 4OXNA 1FNDA 2AFIA 1Z35A 1AM4D 1H1TA 1RYHA 2PBZA 4LDQA 4UM7A 3SF0A 4KNVA 1N0VC 1Y8CA 3HV2A 4RADA 2GUGA 4AN0A 1I1QB 3IDOA 2C4NA 3B6EA 4R6WA 4P53A 4YREA 5I7UA 4HPWA 5IP5A 2YWEA 4O08A 1Q19A 1QIHA 2PZJA 4YY3B 3SZOA 1YOBA 3G3EA 5L4LA 2NXJA 2Q3FA 1RD4A 1J1IA 2YTZA 1TCCA 2OOSA 1CQJB 2VP0A 3CVJA 4RLHA 3L9XA 3GLVA 1O5OA 4F2GA 2QPOA 4TTVA 3VJMA 3ZPXA 2NTYC 4Q47A 3GEIA 2DHDA 3DOJA 2XUQA 5JU6A 2HMAA 2DTXA 2ZI6A 4YUVA 3VNVA 3LNTA 1KI7A 2ECOA 4J94A 3QKSA 16PKA 3DPUA 2ST1A 3R20A 3DA8A 4GUAA 4IDGA 4IHJF 2GO7A 4KAXA 4KSYA 4Q05A 5DW3A 5FADA 2FEAA 1JJBA 3BH0A 2YOHA 2VPYA 4Q7JB 1E3JA 1A0OA 2W0SA 3I92A 4XDHA 1I5RA 1WXEA 2C3MA 3T1OA 4PCUA 7ABPA 2LV8A 3U7JA 4RJTA 3FCOA 1W581 2UYHA 3ADDA 1M3SA 1ZP6A 1N9ZA 4H6PA 1BCRB 4REMA 4CIYA 2P40A 4H1UA 4RX1A 1VHLA 2LW7A 1KJQA 3LO8A 3WDMA 1E9BA 3H9GA 2PUEA 1QYRA 1UDBA 2CHVA 4QXAA 4YEDA 4DEXA 1I5EA 1EM8A 3IJRA 4UXIA 1EPUA 2X9NA 2ZFUA 1C2YA 1OREA 3A36A 4K0RA 4X3CA 1TB4A 1NG1A 4ZAXA 4PQRA 1KXZA 1TXGA 1NLYA 1WEKA 2FWJA 2XYQA 3NT4A 1HQDA 3PXUA 2BBOA 3R9WA 5JS2A 1R6XA 3FNRA 3IVGA 2FF7A 2JI8A 2RGYA 4TKVA 2BLLA 4PZCA 5DBFA 5BSWA 2DTDA 2G07A 3EEOA 1WMEA 3AVOA 4GLOA 5F98A 3ZXSA 1KFBB 3ESRA 2WF9A 3UMCA 4QPPA 1LCIA 1UAYA 2DR0A 4C2UA 3P9SA 1HDOA 4DCSA 5AXAA 2DTEA 5DF1A 3N75A 3JQBA 4NBUA 3VSCA 3ZOZA 5IFLA 1Z06A 4TMYA 1R4MB 3BCHA 2Q49A 3E4DA 1LF0A 3PQDA 3WK9A 4LPSA 4C22A 4YR9A 4FX2A 4MB2A 1P9NA 4WXYB 5AIAA 4GOXA 1PI3A 3FVVA 1X80B 4UUBA 1Z0KA 2IYPA 1PT6A 2JAWA 3UHJA 4EMTA 4D81A 1I30A 1T8WA 4QXPA 3D3NA 3X2SA 3QH4A 5FPTA 3IR7A 1HT3A 1U11A 3TN7A 5CVEA 2FN9A 1H69A 2W11A 3CKKA 3L6DA 2H5EA 4JI3B 4FFBA 1WBBA 1S2GA 4KR3A 2GSDA 3IP7A 4WD3A 4XPIB 1YKSA 2G0NA 3L0IB 5BVGA 1AA6A 3JAKB 2MYPA 2E6UX 5KQPA 1OOEA 4Q7EA 2A7QA 3IYLW 4IRMA 4UBIA 4YB8A 2HK8A 5HTOA 2QM7A 3RTAA 1HDXA 1OI7A 4N01A 3H2KA 1PJSA 1XL0A 4EUSA 3T4UA 3VISA 4D56A 3EWAA 4PSDA 4D6XA 1WA5A 2ZIAA 1VZ3A 2YWGA 3NC0C 5ARCA 4CF6A 3WNDA 4RD1A 2HDWA 2GERA 2IV7A 5KTKA 4BQEA 3D3JA 1DTSA 2R65A 3K9CA 3LUKA 3R5HA 4L7QA 4QWMA 4BYMA 3O8DA 1J8YF 4RD3A 1GQFA 3B51X 1QQAA 4NYMR 4KYIB 2KSQA 5GONF 4DA4A 4US0R 1QZUA 5GJVC 5I7VA 4G8CA 5JAUA 3B20A 3F1LA 3QG5A 3ASUA 4TRJA 2HLHA 4D6PA 1WXGA 2DKNA 2PR2A 5DXAA 1YGYA 1XNJA 2ANCA 2GCOA 3ND6A 3QW2A 2W2NA 4KIUA 4OA8A 3TH5A 3PWTA 1CDOA 1QP7A 1IUKA 3DEIA 2FAXA 5IK2A 2C0PA 4LHVA 3DLCA 3W9UA 4DL9A 4YK7A 3IMKA 1COWD 4OGWA 2POCA 3AY3A 1SKUA 4GPIB 4P36A 4BBZA 1V71A 2ZRLA 1XEAA 4R83A 1NXVA 1QVWA 3F3SA 4CT5A 4M76B 2H51A 1JMVA 1O9HA 1OI2A 1XCBA 2NPOA 1LRLA 3EIXA 3R1IA 4NH0A 2ZR0A 4WA7A 4PINA 4EY5A 3LDAA 4KX5A 3AVXA 1UKVY 4MKIA 1JXOA 2JD1A 5EPEA 1J06A 1PTJC 3EEIA 3ILHA 4F2PA 3OIYA 2HYDA 3BB3A 5EE3A 5KTMA 2QD4A 3E8XA 4CCWA 2BMVA 1VRWA 3PZBA 4CEJA 1TO6A 5G0TA 3ZH9B 1N6IA 1QAOA 4JR0A 1Q1GA 2G7MC 2JBAB 2WB4A 4GPZA 3T7EA 1XU9A 3RAFC 2FCRA 5CH5A 4MWOA 5FQNA 1EWTA 4YRBA 1U1IA 1E7YA 1JQEA 3KKPA 3CVWA 4NV1A 2VQDA 4G0NA 3SAJA 2CXQA 5M34A 2PGOA 3AL2A 4Q02A 1G8HA 3R0VA 1U9CA 3H2ZA 1PJ4A 4H7HA 4RIEA 3WKBA 1K6MA 4OEHA 4Q37A 1A5TA 3GJZA 3IULA 2I22A 4OCZA 4M1MA 4C0WA 4BE7B 1FRQA 2DPGA 3O4JA 3MUEA 1GNRA 4H16A 4Y6RA 2HPHA 5FJJA 4ZYUA 1GZ7A 2GF0A 3PDWA 1LTHR 3PGKA 2C5BA 1WB6A 1YQTA 2VVTA 1NBEA 3NXKA 3L5KA 1PO7A 3CPSA 4YX9A 2Q6TA 3FLMA 1F14A 5CRIA 1ESMA 1Z2EA 2NVWA 3G8DA 2A84A 3E9ZA 1OX6A 2GK4A 4CR7A 1JT9A 2FSUA 4D7AA 2WMNB 2X1MA 1I9CA 2R8RA 4MWEA 2DC1A 5ALKA 1OH8A 5JD5A 3W34A 1KS2A 4OVKA 2DLDA 1EUCB 2ZWAA 3NDIA 4IH1A 3UOAB 3VAZA 3D7SA 2GKOA 1JB9A 3WGMA 4HF7A 3LGSA 5I9LA 1BN6A 5TF4A 4P4SA 4CEHB 1E1QA 2F17A 3ASVA 2PKXA 1H42A 3HZZA 1KJIA 4DIOA 3AR9A 4AZ0A 2G06A 5B1SA 3DKKA 5FO1A 1TO1E 2XDYA 2HXSA 3WWDA 2ZXEA 1ZZEA 2DERA 3N0RA 5ALQA 4EAQA 3R5TA 3RK4A 2GCIA 3OCVA 2J09A 2RKWA 1B3BA 4JVSB 1T4CA 1Z0SA 5BSHA 4H17A 2GTPA 3LUAA 3QG1A 5LB4A 2XIQA 4N6GA 4KMOA 3ZYZA 4EY6A 1GG9A 1N8KA 2W2MA 2X14A 3KKZA 3NCTA 3SDBA 3WK7A 2OXCA 1JP7A 2Q1SA 2WTNA 4IJWA 4QDUA 3OKPA 1L1FA 2PZBA 1QP0A 2NU9B 2YCBA 3LMKA 1VE9A 2DVMA 3H5NA 3F90A 3IDZA 3QEMA 1LI5A 3E7WA 1M1YE 3DXZA 3G1UA 5CLHA 3AONB 2DQZA 5CBKA 1YZFA 3FLEA 3T52A 4ACAA 5ALLA 3TOZA 1C9JA 4HNGA 1XIVA 2W6NA 2J3JA 1PU2A 2AMJA 4MTCA 4QODA 2PZLA 4PX3A 4U63A 1DEAA 3UUWA 4QPNA 1WZIA 2Q8NA 3ONWA 3ABQB 4YTEA 1BE1A 2JCXA 3HRIA 2QL9A 4C06A 4HWGA 3UPUA 4OOEA 4AWAA 2K87A 1FE8A 1RLJA 1P31A 1XQ1A 2VXYA 3JV7A 4P4NA 4Y6GB 4JROA 3SBEA 5JS7A 1YZGA 2DCUA 3A06A 4LNHA 4BNMA 2Q5LA 4BLUA 4NZZA 4ASUA 1SXHA 1NSYA 3OPQA 3T3EA 3VDMA 3OQHA 3OZUA 3TFWA 2PUJA 2JDIA 2YIDA 2GD1O 4MI9A 5EKSA 2CMFA 1F5NA 2V4MA 2WKRA 4ZAWA 2ZM6B 3UMFA 1KJNA 5E2IA 2Z83A 1PT5A 3ESBA 3FUXA 3EVNA 3MT0A 2G9UA 5KMGB 1R9MA 4FJ1A 3DTVA 4J7XA 4UCWA 3FNGA 3EODA 5M7EA 1UC8A 1Y3BE 2WWRA 2WVHA 4GMKA 1GGMA 4D25A 1E1MA 2BHSA 3I9OA 1AC5A 3KIPA 3ZLUA 1BOOA 1GRNA 4JP3A 2WYOA 3L7CA 5JAQA 3X2FA 4YXWD 3MMXA 4G9EA 3BFVA 2AL7A 4I8XA 4BVFA 4S05A 5SZIA 1Z3CA 1XP5A 4NP6A 4UZSA 3K5IA 4LOIA 2WWIA 5DIZA 2HFKA 6REQA 5JCZA 3HXLA 3FOWA 3CTMA 2QQEA 3R8XA 1XZKA 1EX1A 3AG5A 1WJGA 5I3ZA 5FTJA 4DM4A 2QZ4A 3MWDB 3Q41A 3R9KA 1DI0A 4ENUA 4F96A 3EGDA 1DCTA 2VEOA 2OAGA 3QFSA 1K1EA 4B8WA 4CCYA 3TWOA 3NYQA 4IDNA 2VOEA 3ONFA 4D4LA 5BWCA 5C5CA 1XNQB 3V4ZA 5LZ8A 4NDAA 3CLSC 4QUHA 4ZZ1A 5ECGC 1F38A 2CDCA 3KB6A 3DH0A 4HSGA 1H9CA 4FM9A 2J0UB 1ZISA 2NXNA 1V9SA 2VFAA 4BTLA 4KWTA 3SX4A 3WLTA 4QVKA 1H2XA 3RRFA 4HBZA 5SYNA 1NF8A 3DHEA 4I1PA 1NX6A 2MYUA 2GPSA 5I9BA 2HEIA 5EVCA 4HGZA 4U5XA 2XMRA 3JZFA 3TLGB 2V65A 2C77A 3QVVA 2PN1A 3R7WA 2QMZA 2PBFA 2X8JA 2YHBA 2WTEA 1DXHA 2MSCB 2O4UX 2PPLA 3QVGA 1I14A 3WWZA 3FI0A 4YP0A 4JYPA 2B1IA 1T1IA 5JHGB 4AYWA 3H6HA 3NAZA 4DRXB 1W5BA 1YB2A 5E95A 3NPMA 1Y1QA 4H7FA 1Z28A 2ERYA 2PGAA 3MT7A 3WTCA 2Y1LA 1KMHB 4YXFA 5MFPA 3EXHC 1U6JA 3TVDA 3ZTWA 4NFLA 3MOSA 3GGGA 4E3ZA 1YR9A 3KSUA 4ZEXA 1GXSB 4BKOA 2H9YA 1AVTA 2JFHA 4PO1A 1GY8A 4I08A 1C8LA 3COJA 4FI3F 3R7DA 2WILA 3UWPA 1GDDA 5FOXA 3EGVA 4W6ZA 2DKFA 9LDBA 4V03A 2RH4A 1BDBA 4X45A 4IO1A 3BSYA 4DCOA 3KM0A 1L5MA 5BYBA 4LRUA 3QJYA 1JDSA 2XW6A 4KSCA 2FPLA 2PXAA 3CLUC 3M4NA 3FKSA 2BW0A 2QGZA 2YX1A 1DRVA 1Y89A 5SZHB 2D1FA 3U7IA 1GR0A 3E8SA 3QV2A 1W34A 4FUTA 4UTZA 5EIEA 1CP2A 1VMDA 1N8NA 2B5VA 2XE7A 3OICA 3EA5A 1KVTA 3EN0A 3GB9A 4KPUB 4CR6A 5LU8A 2NU8B 3M6VA 5FL7A 4LBVA 1G20E 2DKOA 3PHBE 4L0DA 2VQ3A 1A7AA 4LY3A 2B2XA 4CM7A 2O2CA 1BEUB 1CQXA 5BV2P 4J1NA 5IZ4A 4GM4A 3JQGA 4PN3A 4L3VA 1SBTA 1H4TA 5I8WA 4DMFA 3N5KA 5B55A 5HOEA 1DJOA 2EF1A 3EZYA 4YRDA 2YIMA 1I3MA 4MS4A 2FQYA 2J8ZA 2WYWA 1P19A 4PSVA 621PA 4G8DA 2KW5A 1IVNA 2RAFA 2X9LA 1EU1A 3JYPA 3C1TA 4XD2A 4V3CA 3ZE1B 2PUWA 4ALIA 4Z4EA 2IPMA 3EXEB 2HHHB 1JEOA 1A71A 1U7HA 2WMOB 1YFJA 2BSQA 1IHOA 2GA9A 4I4LA 5B12A 1N25A 3G2LA 1L7NA 1TM7E 2XUAA 4D9MA 2HR1A 3CRQA 2OD2A 4WI1A 5CLJA 3E3AA 2BEUB 1GVNB 3P0HA 4C7VA 4JBIA 1SQ6A 4RAQA 3JWHA 3NKLA 3D2AA 1I3LA 3GJ3A 4H4CA 3WV4A 4R0MA 3QEBZ 3ZGLA 4YRIA 5IT4A 3SBDA 2EKDA 4YP7A 2ZS9A 4JLPA 1NI3A 2BT4A 2VHWA 3S81A 4U1RA 4O2AF 4C20A 2B25A 3HBLA 3KNZA 1GTZA 1KAGA 2VWHA 1H5NA 4H15A 4G84A 4GLJA 1HUQA 3BM5A 4MQEA 2REXB 3LFUA 3O82A 3GEMA 5BN3B 5DASA 2FSVC 4EKEA 1OTHA 4IMPA 1YTUA 4BV9A 3OCZA 3TCXB 5ERYA 3DYBA 5J4LA 4J9VA 1FP4B 2BIFA 5EQDA 3ZY2A 4EDHA 1MP0A 5JCJA 2JAOA 4Y9SA 3N1UA 3BA1A 1YS7A 3NHUA 4JDUA 4V0LA 4JL6A 4XASA 5TMDA 4KN5A 5A9SB 1KORA 5IZCC 2OCLA 3R77A 1R16A 5L4NA 3FVQA 5LB2A 2JGFA 1SOUA 2I99A 2ZAMA 4ENPA 2F3TA 2H52A 3IUEA 3NAQA 2GHIA 3PQ8A 2J9RA 4J90A 4RF5A 4C2AA 5G2OA 3RWBA 1SB9A 4RKFA 3S2EA 5TQ0B 5A6SB 2H57A 1RW4A 3H75A 3RODA 1X7XB 4W5WA 3RB8A 4HNVA 2GRJA 1U8EA 2X23A 3HGMA 3PHIA 4PLFA 1G1MA 3BCSA 1MDFA 2ZJ5A 2FA9A 4N3NA 2DETA 5A5DA 3OQJA 1Z47A 1V39A 3K0CA 2VJMB 1E32A 2BKUA 4N1AA 5K3FB 2IGBA 3WB2A 5K9ZA 3AERA 1IB0A 2I4TA 3KQYA 1PJQA 3KYDA 4Y2VA 2D0DA 2A9KA 2DPXA 5G1PA 1HE3A 4XLLA 3WC4A 2ZT8A 4NAUA 2C03A 1RP1A 2TS1A 4GS5A 3X1WA 1S8NA 3QU9A 4RGYA 4QTYA 5JD6A 3WGHA 1MB3A 1TD9A 1VM6A 1P7ZA 2VK2A 2ZE7A 4BJ5A 3AFGA 4QUIA 1VKOA 5KNDH 3AVUA 3CJQA 1E9CA 2A5DA 4Q4AB 1Q17A 3DQQA 3DZ8A 1AS0A 1RBMA 3GT3A 2PMWB 1T2NA 3H5RA 4LX0A 3MS4A 2G5PA 4MAAA 4MUMA 2QZPA 2Z43A 1W96A 2D5CA 4ZHQF 4UEWA 2BP7B 3K9NA 1DX4A 2DF8A 4W5HA 4UE3S 3ZK8A 3MWJA 4Q24A 4I55F 4V0SA 4RVFA 1P7VA 5BQPA 1ZXXA 4L2IB 4D3YA 1M1NA 2WJAA 1QCYA 1FZQA 1ZUNA 1KRHA 4KFTA 2EC5A 2PX8A 3AVTA 4MR8B 5JW6A 2HC9A 4LJ4A 2LIVA 1ZGHA 5DGHA 1ISIA 1PL0A 2DUUA 3DZGA 3PNQA 3TNJA 3V8EA 4RVCA 2O59A 4U3JB 1YI8A 5DTMA 4CT4B 4N0MA 3DP7A 4K6KA 5GJWC 1YB5A 1BDHA 4TXNA 1NPDA 2O7RA 2PUVA 1TK3A 3IKJA 1LPOA 3KQOA 4PFJA 3C41J 3BRCA 3V7NA 1MAHA 1KEKA 2IDKA 3UBMA 1AQJA 4YHHB 4RTOA 1PFVA 2R00C 4PF1A 2E4AA 3SDZA 5TS2A 1DRJA 5KYUA 4Y30A 3PQ7A 3ETJA 3LWDA 1YMUA 2WP8J 2IEYA 1SR8A 3PNYA 4YRRA 2FEMA 1N5RA 3ZQJA 4DREA 5A2GA 4I9GA 3H84A 1U28C 4LGVA 4KO2S 3I8OA 2GEDA 3IV6A 4FNMA 1G8YA 4R05A 4CLXA 2Q1YA 2K7FA 1SUBA 2MYTA 3QVXA 3R0JA 4WCDA 4B1FA 2FPIB 4M1TA 1ZCJA 2O3RA 3OTWA 4RTJA 1E8DA 3PA6A 2F43B 4P38A 5I7AA 5F4ZA 2CY0A 3LH5A 3ZXIA 3DEKA 2CXHA 1A8SA 4A1FA 1YQWA 3C8MA 1OE0A 3LCMA 4JLJA 5DM4A 5EHNA 4HATA 3DLHA 1FU8A 3AM3A 2IEBA 3A3PA 2A3RA 3OIVA 2OQRA 3PQEA 1GGFA 2QM0A 1IIRA 1NJ5A 3EXG1 4HO1X 2B2NA 2B98A 2RK6A 2BPOA 1Q0RA 4GI7A 2YNMC 1W44A 4LQ4A 3TVYA 3GFQA 2GBCA 4UM8B 2JI9A 2YOGA 5AVWA 2Z08A 1PR0A 2FMHA 1ICEA 4M1OA 4D2IA 1PDWA 3FETA 3INYA 5F1OA 2QTCA 5TPWB 4B81A 3UWKA 2C4MA 2H1WA 2H1HA 2B6HA 3NEJA 1DJMA 4MV1A 3TZBA 5DTJA 4AJKA 3HDQA 5FFMA 3OTOB 1N3LA 1Q11A 5AKIA 2O8EB 2IXTA 3ZTYA 4BAZA 2IYQA 2ORVA 4IIBA 1Y81A 1ADGA 1N5OX 2B5OA 2PX2A 2VDMB 4AS1A 4OI0A 4M22A 5KYXA 4XCQA 3KQKA 1Q83A 2AOVA 1YDMA 3OJWA 4WZBE 3EVTA 1QYIA 2O23A 2O0HA 4XB2A 3PGJA 4MI1A 5AK4A 4EFNA 1K7EB 4PPNA 2WFAA 3TS1A 1Z8HA 3NGLA 4KWIA 3EHEA 5A9TA 5A7HA 3ZDEA 4JFRA 1YVUA 2C0QA 4FBGA 4ENWA 3AFIA 1FS6A 2EKQA 4ZT4A 2J3DA 1Z7YA 2J3QA 1BVYF 4YYZA 1DQNA 4UTXA 5AXDA 3TX6A 2HQRA 3UJ3X 3K09C 1BQEA 3IUMA 4RV9A 5ICEA 2FZGA 3BK7A 4EHHA 2IP4A 1XQWA 3K3PA 1XZEA 4HDKA 5CX4A 5AKHA 4XWWA 2HJVA 1DTWB 1FUEA 5EN4A 2R87A 1TIPA 1W29A 4R0NA 4LGMA 3VR4H 1BXGB 5CFRA 2BFBB 1H3NA 3HCOA 4G1VA 5LZ2A 4FD2A 4K81B 4C0XA 1NW4A 4P7BA 4L02A 1RLMA 2IIVA 4L4UA 3ZKWB 4LW8A 4G63A 1Z8DA 4O6VA 1RRFA 1MVLA 4V3BA 4FC6A 4DV7B 3BSSA 1T2DA 1BX1A 2VZ0A 3KPYA 3BAFA 4XX1A 3RFFA 5TDHA 3AHIA 1AGXA 3WADA 2FUKA 4O3FA 3M33A 4HVAA 3CE6A 5JNLA 3ZCVA 4PTLA 1FFSA 1DRKA 2VA8A 1Z2DA 2E5WA 1I2DA 4V0KA 4Q9KA 4KIFA 1KZYC 1JG1A 5JOQA 4HX9A 1RXWA 4U9IS 4W9RA 1T6ZA 3MOIA 1IJKA 1XCMA 5HJ5A 1RWPA 1DEHA 2CUZA 3B9BA 3BFKA 1F4VA 4LXUA 4WXRA 4QGFA 4E5VA 3F7TA 1GDHA 4R9SA 2GVNA 1XQVA 4XDYA 3O3CA 4TZTA 4UVHA 2VWGA 3RFUA 3MZ0A 4F7DA 4QHYA 4CM4A 1EVJA 2H7YA 1IN7A 5TPZD 1J8VA 1T3TA 2AF3C 5CIQA 1X1RA 1QQTA 1H0HA 4MIOA 1ARZA 1MO5A 4IGKA 4K8RB 2J5BA 3GCGA 2E3JA 4DDWA 4HC4A 3F96A 3TUIC 5K5EA 1R4ZA 4HJRA 2H4FA 4QYWA 2QM8A 4MAFA 2RKOA 3MRTA 3BJRA 1C3JA 3RHTA 2YQ5A 4JJAA 2WNSA 4P6VF 1K6XA 2IWHA 1L4FA 4S2EA 3RYHB 1RZUA 4H0FA 3SDSA 4KFCA 3ZWAA 1P60A 3UAOA 4BLWA 2PUFA 1VDZA 2QB5A 3JD2A 1XZCA 4QGSA 1G16A 3VSAA 4CV2A 4DLWA 1UKZA 3RVDA 2C7RA 1C1HA 1IQ0A 1QDEA 1GTVA 2X8BA 2WHYA 5DI9A 3J81k 1HNXB 2CL0X 1JPJA 1ECCA 4FLEA 4ZOEA 2JLAA 1QP4A 1NV8A 3A4NA 4U6NA 2H08A 3G5MA 1NIPA 3B48A 4BFZA 1PN3A 3U7GA 1GNSA 3LX6A 4JXKA 5FPKA 1EWYA 3QBEA 3O8CA 1MC1A 4QYSA 3RUCA 1LKZA 2ZSDA 3KZ1E 1DXYA 3X1ZA 5BW5A 4CLRA 2HREA 1DKLA 1I7PA 2QVLA 1NQWA 2VUHB 1CUUA 2A1UA 4TSFA 4ZCLA 2R7AA 2PK3A 4G5OA 4ZI7F 2AT1A 3HY6A 4G24A 4ZYLA 3L4KA 3LBIA 3WK8A 5F2OA 1WW8A 1UBEA 2NOAA 1E1DA 3WAJA 3PEWA 4DLTA 3STWA 2BFAA 3BIWA 5LMZA 2CFSA 1KI6B 2QI9C 3TXYA 3TOSA 3VMFA 1UANA 1GG2A 1D0SA 4DUGD 3RYCA 1VCHA 4KUHA 2AX4A 2CLOB 2HLDA 1ZY2A 4E4TA 3S4YA 3U40A 3KDAA 4NY1A 1P3JA 2VDLB 5AHKA 3VUFA 2X6RA 2C54A 2B1RA 4PZLA 4FYHA 5JDIC 4NXMB 1R74A 1NR5A 5KNDA 2BF7A 4ER7A 1E2FA 1XBTA 2EWMA 3FE2A 1R6UA 1PHRA 5H9WA 2FKNA 2HGZA 3G2JA 4JODA 1QX4A 2WQZA 3SLRA 3DWIA 1ZOLA 4HAVA 4ZCMA 4RMJA 2O3SA 4IIGA 1UZNA 4MWCA 2FFAA 3VR2A 4ZIRB 1RVV1 3OOEA 5I9TA 3SS8A 3HK2A 1OLUB 4YV2A 3K92A 4J2TA 1CZUA 1U2GA 4DDKA 5JADA 4LXQA 4PYJA 1PDVA 4KDCA 4MXDA 1KYZA 1GRRA 1PG5A 3E0QA 4L3OA 1QF9A 4WZBA 4AURA 4XVCA 2IXFA 2DP4E 3Q9UA 2AFIB 1YQDA 5ALVA 4KGXA 4AICA 1RYDA 3O4RA 2BRUA 1ACMA 1OASA 1BGXT 2W83A 4D4GA 4D8UA 5JY1A 3IH5A 4BS9A 3Q6MA 4K9NA 1W1IA 4EVIA 2B4AA 1MVNA 1R0SA 1P33A 1VYHA 4ESVA 1VJ1A 2WJZB 4RYDA 4B33A 1F2TB 2GLXA 3EA4A 1JFFA 4IJ6A 3ACBA 4WL0A 5HFNA 1ZRMA 4TQAA 5ESWA 2AUNA 2Q07A 1YE3A 2R47A 2B8JA 4XH9B 1B1CA 1X1AA 1ZM4A 1L6IA 2IXGA 5EJ7A 3A1WA 4FDUA 1GP2A 2OCIA 3OIUA 1YFKA 3C3KA 1PK9A 2CWWA 2ODQA 4EMUA 4HZGA 2BCEA 1U2RA 3VPBA 2VOJA 4EEZA 2AI1A 3A26A 3DBVO 4KP7A 2AN3A 1MB4A 3TR0A 1PR4A 1B8OA 4ZI3A 5JSQA 1OYOA 1A1VA 3R2JA 4FFVA 3H7AA 5HF9A 3HVHA 1Q1ZA 4DXDA 1J24A 4O2BA 5JCXA 2JEOA 3U26A 1YQEA 2IOHA 4JWKA 2HJGA 3PZRA 1X2EA 2AOWA 1K5DA 2C07A 4EI2A 4B4WA 2ZIUB 2HLNA 2WD9A 1EM8B 3C5HA 2YC2C 3PITA 3T1NA 1YO6A 5C31A 4B3TB 4ZTBA 3VPDA 2XNDD 2Z2IA 2ONJA 2WJ4A 3PKJA 2FRDA 3INTA 3ZN2A 2W6QA 1YJ5A 4TKVB 2QRQA 5T7BA 4Z3DA 4RD0A 3INNA 4EW2A 4CXMA 1P1RA 1D5WA 1U6IA 2Q6IA 3BDVA 1C7IA 4PFSA 5AHXA 5AM2A 3T9BA 4JENA 4U2KA 3PP8A 2O3UA 2V6IA 3FBGA 3K96A 3ZIAD 2AFHE 2YFYA 3VDQA 5BMVA 2BGWA 1E4VA 3HJNA 2EZ9A 2PWPA 3VO1A 4WJKB 3D7LA 1Q1EA 2ZAOA 4MKFA 1GU7A 1SC1A 3P9XA 4G41A 1Z0ZA 2HA4A 5E1MA 1UIMA 1GA6A 1JMYA 3QXJA 5MHTA 5K4GA 2Y92A 3GRFA 1WQ3A 5BMOA 2JH8A 4DWOA 1LPNA 1E6UA 1U7WA 3EEQA 4K9RA 2NUBA 1PJ2A 3I58A 2QTNA 3Q7QA 2Z09A 4IGEA 2O3QA 4LI3X 4DJTA 3I04M 1DFHA 4RPIA 4BEBA 5KTNA 2GJKA 8ABPA 1ZVMA 1CUXA 2AA3A 4FFBB 4OUDA 4PXYA 3VUEA 4CWAA 3SX0A 2R9VA 3JY6A 1DO2A 4Y6OA 1NUQA 2G5CA 3I72A 1L3BA 2BTEA 2IDMA 2QI9F 2ILTA 2F55A 1VQ1A 3EF1A 3ZVMA 2OVBA 1H8HD 2PX4A 4AJ1A 2R6AA 1XTSA 3PRYA 5IDWA 3PKZA 2X42A 4C88A 3IQEA 1D8TA 1YIAA 3NGXA 3PC2A 2HK9A 2H4XA 2JANA 3KZOA 4KUGA 1GTRA 1SHUX 1DWUA 2HMYB 2X0IA 4LXHA 1OX5A 3MTQA 3OX3A 3KOWA 4W7HA 3CIOA 3R6LA 3HEMA 1BKDR 1TK9A 4YJFB 3ISTA 3I39X 5CLLA 4KQWA 1X7DA 4G8JA 4QEKA 4FMCB 4WOBA 2NV0A 1YJ8A 4CFYA 1UQUA 4DIFA 1A7UA 1ZIYA 1OV4A 1AA9A 1NRIA 4E94A 4YQFA 3L6UA 4BUJA 1XKXA 3IAS1 4XVQA 2QM3A 4S24A 3SM3A 3ZIUA 1OY1A 4MQFA 4M8IA 4L73A 4QRHA 2WEKA 4DB2A 5U1PA 2H5IA 4BFLA 3CZMA 5TQ2A 3V1TC 3GLHA 4JLBA 3CRRA 2ZQ5A 3AWDA 1J70A 1LSSA 2QXYA 2RBEA 2X76A 3HPQA 4P4LA 4A73A 3OP4A 2RGAA 3VVCA 4UPEA 4FR5A 2XMBA 2ZYAA 3G88A 3A0RB 3OMWA 4OHRA 3NUQA 4P81A 1GZDA 2HMUA 3SQOA 1M76A 1NVFA 4DIUA 4GOKA 4Y1RA 1PHPA 4JYBA 3DXXA 4US2R 3FWHA 1K7XB 4IY1A 4TV9A 3KETA 5FB3A 2EL7A 2I65A 1FPMA 1W4CA 2R7NA 4K3UA 2AEJA 3KKLA 3WZMA 5AW3A 5IC4A 3JWEA 2CV0A 3JXEA 4X1IA 1QHFA 4M99A 2IUYA 4A92A 5MGBA 5JNUA 2CLEB 3CBQA 4H7DA 4CEJB 3FPJA 2AWOA 4RY9A 2FG6C 4YDHB 2FR8A 4ALKA 2JLQA 2O2IA 3DT9A 2WF5A 4W1SA 2C58A 2ZRBA 2IHVA 1TPYA 1NTRA 1V41E 3PNKA 4MO2A 4TYNA 1RJDA 1JSRA 1Y7IA 2AEEA 2FMKA 3Q0TA 3DMPA 4XSGA 4HB0A 1EFHA 2O4CA 3I5MA 3N2GA 5DX0A 4DM7A 1WETA 2EXXA 4GOJA 3HP7A 4OUKX 3TBFA 3OZEA 4C1BA 1C9KA 1A5BB 2XV1A 4P3KA 3H2JA 5L7YA 3IXQA 1HDCA 2W6ZA 3DCJA 3HUDA 3IV7A 1B8PA 2PRYA 3B8EA 2X4GA 1YJBA 1XQXA 2IZ5A 2CZQA 5EKTA 3WIOA 4DBVO 1E79A 4QYTA 4OQ4A 3O2NA 3HJCA 3IP5A 4M1KA 1F8UA 2UYYA 4QLBA 4NATA 5CNKA 5EIAA 1MVOA 3WMFA 4EPTA 1OVGA 2XQVA 4GSKA 4G5RA 4LZAA 2B3TA 5HVNA 3K2BA 2GDZA 2VAMA 3DDSA 4L8YA 1J0DA 4FPXA 5L45A 2NP6A 3KD3A 1M67A 3RQSA 2F00A 3GDGA 3C3PA 4KXMA 3TBHA 3GLFA 5L9AA 2RG1A 3SU8A 1DC4A 4OYHA 4JSRA 4C03A 2IYAA 1B74A 1OV6A 3AWIA 4KRYA 1XLTC 1N9GA 2VNIA 1WOYA 5TY0A 4J0CA 2OBNA 3FOAA 4LEIA 5L3VA 2X4LA 3SYLA 1YAHA 1UFVA 4CM5A 5ICMA 5JYBA 4P4SB 3L1UA 5F4BA 3SC4A 3RT7A 4AZ0B 4K8OA 4BGUA 2O07A 3F9RA 2R2GA 2ZJFA 5ALUA 4R41A 2V54A 5KSPA 3RS4A 2F9MA 3TX2A 3V48A 5EJ6A 1KEEA 3EXAA 5A9RA 3ICVA 2ARKA 4XVRA 4PG4A 1R6TA 2AFHA 3V7YA 1T4CB 1DZ3A 3HVIA 4ARVA 3I0ZA 1SH7A 2XWSA 4RMIA 1OU0A 2WU0A 1XMSA 1LC3A 1OTXA 2VJBA 2PA0A 2ZQZA 5KHAA 3D3WB 4GLFA 3W77A 3L0BA 2DHRA 3FH0A 4BQSA 5KTTA 1E3QA 2IW1A 3WE7A 3UEOA 4F11A 2YJZA 5LQKA 5B3KA 5FTMA 3P5BA 4EPWA 5CT6A 2ROQA 3FF4A 1J0XO 1T13A 5AKEA 4XB6B 3WIVA 1VCNA 4F1WA 1T2UA 2VKTA 4AF8A 5AI9A 4M46A 4KMMA 1UZLA 2WM3A 2J6BA 3KQWA 1ULTA 5G1OA 5F7OA 4F2DA 4DNOA 4A03A 1X1TA 2QENA 4KWHA 2CXXA 1ADJA 3BHNA 3SIWA 3PFFA 4F6RA 1NNUA 1Q91A 1RM3A 2DSTA 2PZKA 3CJRA 4WK4B 4DKJA 1NXSA 1CUYA 3PV0A 5LUBA 4RGQA 3CLHA 1X1DA 3P0EA 3CXRA 4I4TF 1NF9A 3KWLA 5TT1A 2J46A 2X5JO 3WLKX 1PJCA 2AK3A 3VH4A 4DY6A 2MMGA 1FLDA 4BLOA 5ALJA 5HMMA 4PIVA 3D0KA 4GT1A 4LWPA 1SVWA 3PF8A 1KNQA 1Y9EA 3EZ6A 1WUIS 1R9NA 1E2QA 3KZXA 1LS1A 1Y63A 4PC6A 1OGJA 2BHLA 2RK4A 3AIKA 4PYLA 1F4PA 4WFQA 4ZVPA 3VX3A 1D6SA 1UJNA 2C59A 3W3AH 4Q34A 2OO7A 1SIWA 1OLXB 2B8NA 2OHJA 2LD4A 1OT3A 1J23A 5DX8A 5EE5B 4D3SA 3IL2A 4OHFA 2V6GA 2Q6KA 2VP3A 4C4TA 3DDZX 5TR9A 4D5EA 1LV7A 5IM4F 1RTKA 5KTRA 4DR2B 2MSDB 3BICA 4RM3A 4B3HA 1VBNA 4TPKA 5K4AA 5AJXA 4ZVVA 3NEAA 3IAXA 4GXQA 3HJTA 1ONBA 2Y99A 3AUAA 4XJSA 5I3CA 1T5OA 1S89A 1XT6A 2EFGA 1Z6AA 3KE9A 2COKA 3P26A 4N5LA 5CGZA 3GFTA 1ESDA 4RTKA 4HEHA 5F33A 1J2EA 1OAOA 1NKSA 3H87A 4ZCSA 1OZ0A 2PT9A 3B3QA 3PNBA 6REQB 4P1ZA 4G01B 1ZVQA 1GCGA 2X8WA 1M8FA 2HZBA 2IUFA 2BFCA 3UHOA 3V2GA 4F71A 3AF3A 1G9SA 2NTJA 4PBTA 2Q5JA 4BFVA 4JAVC 3ZIDA 4ZZIA 3KQPA 3RC3A 2QAGB 3LCUA 1GZ3A 1ICIA 5JSZB 3EGDB 2QTVB 4MDEA 1TLFA 2AMVA 3O0DA 3HABA 2F9FA 4HLUC 1ZNQO 4CCYB 5G1NA 5C1DA 1XKLA 3G7SA 1NBHA 2RHBA 3AI3A 2GARA 3GU3A 1YT5A 3LLMA 5FWYA 2YRWA 1PL6A 4DA9A 3K15A 1EP1B 1RTTA 1S2OA 4JR1A 1I8TA 2HTEA 1RBZA 3TGLA 1Y9JA 3NASA 3JQEA 1CQPA 1M2EA 4XEHA 2YHIA 2MSLA 1E7MA 3IUBA 4EH1A 4Z6KA 4TYYA 4HB4A 2C04A 3A1CA 4Q19A 1ZXBA 4GZLA 3QOWA 3RSSA 2NYVA 1SXJC 1BYIA 4BNWA 1MXFA 2QSZA 4NS4A 1EWRA 2HDNB 4O8ZA 4BQFA 3RVSA 3NTQA 1ISPA 4WLEA 3OCYA 2BAGA 4CF5A 3RIMA 1OKKA 3R74A 3A4LA 3ER8A 3TRKA 2IU4A 2IZ7A 4MVCA 2FDXA 1MJHA 3OLZA 4X84A 1HLPA 4QBTA 3WXBA 5IEJA 2PUHA 1CUSA 1I36A 2II6A 4L4YA 4QNNA 1V4BA 5B3AA 1QFMA 1E6EA 3O3NB 1DV1A 1GUYA 4KE9A 3QIVA 1GTG1 4N0QA 4C3OB 3NVKI 3RJ9A 4E7OA 1G3MA 4PLPA 1AZWA 3K1YA 5A02A 2BONA 2V5AA 4RK7A 4FWIB 2NN3C 1P3Y1 2RHMA 3JRNA 1UXIA 5GOZA 4DC9A 5JZ9A 4OHPA 3B6MA 5D86A 4XVUA 4NBRA 2ZT7A 1PL7A 5L7WA 2WUVA 5KVCA 4EO4A 4KR6A 3SVLA 3HGTA 4UARA 1R0XA 1KL7A 2BHTA 2N75A 4FU0A 4NWIA 4EX6A 4LX8A 5JXWA 1MZVA 2OCDA 1NSTA 2ISCA 3CZQA 1RQXA 4KLNA 4BNDA 3K70C 2ZKIA 2PL9A 1ISHA 2WSSD 4KGVA 4L22A 3WIUA 4YFYA 1SRQA 2LVBA 4FYMA 4ECAA 1W73A 4X6YA 2CNLA 4X60A 1CLUA 3AGPA 5JFGA 2V3CC 1K8ZB 4YUYA 3EQ7A 3L1VA 2D1TA 5HNKA 1AKVA 3RH0A 5HUQA 1Y8RB 1XZPA 2HRQA 3EIOA 2WJ3A 3MIZA 2B35A 4U5QA 1FTNA 3PVZA 3N8HA 3ENKA 3RRBA 5LP1A 5FUYA 3RVLA 4C4PA 4OXKA 4CMEC 5CCEA 3AHEA 3DMDA 2UDPA 1O57A 1M1YB 3ZEAA 4F7WA 4P54A 3MCZA 4FHZA 4F5WA 2QE7D 3MWYW 4HDCA 4K40A 4NZPA 3V7UA 1PV4A 3ANTA 5KJ6A 2IHKA 1V4VA 2GUWA 2HQBA 2VPWA 1RAFA 3EDYA 3Q15C 4FOTA 4H7PA 4QL3A 3QPWA 1JXQA 2J3LA 1FTWA 3R6TA 1IPEA 5CNMA 5LP6C 3ZK7A 4BNJA 3EVFA 1NDUA 2QR3A 4MYCA 3EF3A 4K2HA 4GPAA 5AK3A 5FOWA 3MOGA 1SWWA 3UXHA 5FR1A 2AFVA 1SUFA 3H9EO 2ISQA 3AJEA 4H4EA 1PGPA 4HOYA 4MYSA 4Y1FA 5GY7A 2CL5A 1XAHA 2QLJA 1WB4A 1PZMA 1O94C 2I2BA 1CETA 1FYWA 2JCVA 5EMJA 4E1VA 4UTNA 2IU3A 1W2HA 5SZJA 1JUDA 1AKEA 3A3OA 3QPDA 5JLJA 1SBNE 3P71T 3EOZA 1F0NA 2JIZD 4MRSA 2REQB 4RF3A 5DBHX 3BTUA 1KEVA 1LPMA 5C1IA 1TF2A 1TECE 1VYVA 5FPQA 4BCDA 3GUUA 5C34B 1VE1A 3WBKA 3H3XA 4X54A 3MWFA 2BGNA 2GPTA 3UWDA 5ITZB 5EMKA 2BGTA 4D4HA 1KJZA 1V7QA 5AJZA 3Q4GA 5CK5A 1XLWA 3JASB 4GMGA 2ZUVA 3OO0A 4HDNA 2DWPA 2CLIB 3AUFA 3I5UA 4D26A 1IAQA 1JFTA 3DAFA 2OGTA 3KCNA 3P2OA 4YCDA 4YAEA 1XZJA 3NH9A 3KJGA 4HGPA 4HN9A 4CKXA 4H7IA 3SBXA 1L5FA 4B4VA 4AS3A 3Q2IA 4L9AA 5CNJA 3VHXA 4Q6WA 1BMFA 1SRRA 1YE5A 4OFBA 1H2AS 3A6LA 3OIWA 1UP7A 1S3FA 2LCIA 1AGNA 2JZCA 3PF9A 2C9YA 2HRCA 5L40A 2P6UA 5C52B 1YS4A 2ZBRA 3O4IA 1RLIA 4QOJA 1G4AE 1QGYA 3IOEA 4JLAA 3WKAA 3CNNA 1WZUA 4Y2XA 5CAEA 2CGEA 1EVIA 2B83A 2DH6A 2W6ID 4IYJA 3NTOA 4BQOA 5IJ0A 4Q1AA 4GWLA 4WJZA 5BO5A 4BFXA 2V0NA 1QQ5A 3ETCA 2ZIZA 3BIOA 4C3VA 1GPNA 3X1DA 4EEXA 5DSZA 2C4WA 3KAKA 3KYDB 1GIAA 2KX7A 3A9TA 5JVDB 4ZKEA 3I01M 4CMGA 4G97A 5E4YA 4NQZA 5C8VA 2CHUA 1EZ4A 3DBIA 4NHOA 5LA6B 4GYKA 1JPVA 1RFGE 1UFKA 1OBHA 5JJ5A 3TUZC 5H4HA 4TWAA 2C2KA 4B9AA 4G0UA 2R6FA 1WHTA 4CW7A 4F45A 1DMRA 3W2EA 1CRLA 4QJBA 5FFFA 4BZPA 4AG6A 2MR5A 3PXBA 2NO7A 3NAMA 3EMBA 2BEVA 2I3GA 4MYDA 3SD7A 3K31A 2IPAB 2Z3ZA 4N9WA 5ALFA 4DE5A 4EJ2A 1OFGA 2GN2A 1QK3A 2CZGA 4ARUA 1RXIA 2JGJA 2QMYA 3L7KA 4EJ6A 3HJAA 3KYIB 4RVDA 4Y8VA 3SSOA 1M1NB 3N8IA 1E77A 3ZWNA 1ZD8A 4R40A 1SUAA 3CG4A 4RK5A 2QW0X 3U7EB 1SZJG 3W3AA 4ARBA 1RCFA 4JS0A 1T2EA 1PZHA 3HO8A 1TT5A 3OOSA 2J59A 3M4JA 4K6OA 4LRYA 1WDKA 1BHQ1 2GMWA 3ANNA 3L6OO 4EY3A 1KU0A 4ZO4A 2RGGA 1XD9A 1YASA 4IZOA 5AFSA 2Y1WA 3PUWA 3NWBA 3RYIA 3T99A 2D2FA 1NUUA 1Y4ZA 1IZ0A 5JWOA 3KFLA 3M9XA 4LWQA 2GAFA 5FNVA 2H07A 3ZWXA 5T5QA 3SYRA 3ZCPA 3U0BA 5K0TA 4BV8A 1Q15A 4G81A 3MJHA 4XFDA 1QG2A 1I2AA 2R6JA 1I24A 4RA9A 2JCGA 2JVIA 2ZYGA 1CUVA 5KYUB 1DCFA 2ZANA 2Y0CA 3M3DA 3NBKA 1J56A 2O7QA 3LVBA 5D6OA 4X7PA 1DKRA 1L7PA 2CYCA 5AVRA 4CF7A 5H3LA 1UBTS 3STTA 4XGQA 5DCYA 5LP6F 1XVTA 2HNAA 2Y0BA 4I4IA 2GTHA 2QX4A 4XARA 3RU2A 1VJCA 2G6BA 2FH5B 1G20B 3OZIA 2JIDA 4N7BA 4QHTA 1R88A 3SZRA 4R9VA 5HGXA 4G2NA 3U44A 2B34A 4EG7A 2PGNA 2FWNA 5EA2A 1XCGB 4M8KA 1JR3A 3NTUA 4BVHA 3NYWA 1ORTA 4I19A 4CKBB 4WN3A 2FSSA 4YMHA 5CLGA 4KBGA 4TROA 4FE4A 4HDAA 4P2GA 5CCBA 1T9BA 2D1SA 2H59A 3IGFA 4LKOA 4NKRA 2ZPAA 3FIJA 1PS9A 3T5BA 4D0RA 1A76A 1IQRA 1K8YB 1UOEA 4L5AA 4XUCA 3UK6A 4DUYB 3UVEA 2CL7X 1JKJA 2HCBA 4MUNA 3ITKA 4HV4A 1NBMA 4QICA 2Y3IA 1ZW6A 1G0NA 2XUOA 4IDQA 3NHFA 3CYFA 3F4BA 1V3UA 4W99A 2ZPUA 4M36A 2IEZA 3KD2A 1CFZA 3C3XA 4IWXA 1SKQA 3PQ4A 2DWQA 4N6NA 4ETWA 1VLLA 1DT3A 2CLKB 4QYIA 5JH7A 5JJKA 4I5EA 4CLEA 1DV2A 3C70A 5KYXB 4OHWA 4DLRA 5KNBH 1KH1A 4WKPA 3NHYA 2NVUA 4EGQA 5K99A 4JLUA 4TT3D 4FX5A 5J43A 1HZZC 2JPDA 1RC1A 3S3TA 1D2EA 3UJAA 2EFYA 4MV0A 5KYVA 3QKIA 2WJJA 4F85A 2I54A 2Y1GA 1T4GA 3KB1A 4H2DA 4MEBA 2HDOA 2Q5EA 4O4LF 2IZZA 1H9AA 1RJGA 2DY0A 2J4DA 2VF7A 4WFJA 1W6RA 3PDIA 3B1VA 2BZ0A 2ODTX 1M8GA 1FF9A 1XKQA 4EYOA 1E63A 2O8DB 4W6QA 1DC6A 2IOQA 2EIHA 5EHXA 2PGIA 4HDKB 4IUYA 1UM9A 3DR3A 3WJ1A 3IEVA 1TTQB 3C7TA 4PR3A 1N6KA 4EKNB 1IFXA 1ZC4A 1JBQA 3TEFA 3C8ZA 2PKQO 1LBQA 3KB8A 4PC7A 4A0HA 4DLZA 1HEYA 1N78A 1IHUA 1EGMB 3VNRA 2IZ6A 1NN0A 3GV0A 2B2CA 1W47A 2WAOA 3F3YA 2OV3A 1N5MA 4HKTA 3EAFA 2Q2WA 2GZ2A 3SM9A 1P5JA 1W5EA 4A5SA 1TJ3A 1GAQA 5BNIA 1HF3A 5E6UA 1TCAA 3VYWA 2ZVJA 3LAWA 3VO9A 5DHQA 4QT0A 1FFBA 3B1KA 3Q0EA 4GMHA 4LVUA 2WINI 4NQRA 1LNZA 1V4NA 2NZ2A 2X15A 3CW9A 3PXCX 5GAJA 1LX6A 4BGVA 5BUSA 2XUFA 1QB8A 2GXUA 1RI4A 3D6TB 3G2HA 3DMYA 2AOUB 3KUKA 1D9XA 4JBHA 4KQEA 4W8HA 1SURA 1UOPA 5C4GB 3BBLA 2PUCA 1B3RA 4JI4B 4Y2QA 3UV6A 2OAEA 3NHMA 4HH0A 2XUIA 3IMEA 1D3AA 3LF1A 4QQKA 1DAHA 1J25A 1WUJS 1VJGA 3HDYA 4CM4B 1XPJA 6PFKA 2DJ5A 3GXBA 1XFAA 4TL9A 4BFTA 1SCKA 2EJTA 1DCMA 1EEHA 1UC4B 4RABA 3T4EA 3KVNA 3HUTA 3KO8A 3HFSA 4IKPA 3TD6A 1E20A 3IRUA 3JYHA 1RMTA 2AC2A 3NM4A 3W79A 4HDRA 4XWTA 3CMCO 2XZOA 1I7SB 1GN9A 3F7MA 4UVDA 1EIWA 4PZZA 2W6JD 4YAOA 2YS7A 3JQ9C 3TW0A 2QG6A 3KTAA 1Z63A 1EH5A 2IGTA 2YIVX 4RQUA 4YLYA 3IDFA 4JOSA 1QE5A 4RU1A 3W8DA 4P34A 3ELYA 1ESNA 2E89A 3W5UA 4FS8A 3FD8A 5FI3A 1FJHA 2CK3A 3K6JA 4C6TA 2EBUA 3QHPA 3NAGA 1PJRA 1TMKA 3H4MA 4UDXX 5KNCD 3LC7O 3M6UA 4MZDA 4X7BA 3SZGA 1OC4A 4QXQA 2AN4A 2OZKA 3QXCA 2FLWA 4FSDA 4QGAA 5CBPB 3EFHA 3QZUA 2AF4C 2ZJ2A 3THYB 4GD3Q 1QCCA 1Q95A 5BRAA 4TTTS 1OXXK 3M6AA 5K8VA 3HDGA 4TN5A 5KTYA 1XZNA 4HAOA 4QG7A 2IIQA 4JFAA 1MQSA 3K0AA 4L8VA 3UT6A 4ABYA 3U7FB 4GWKA 3LY7A 4BKUA 1NXWA 5HIIA 5JTTA 1S8OA 4JXZA 1QIIA 4HHEA 1FY2A 5A3JA 2BEJA 3D8NA 1SFRA 3GHYA 5ILOA 2DR3A 2HIGA 1GRVA 1QLWA 1GPWB 3P9NA 4BKRA 1Y42X 4WBNB 3RYCB 5FWXA 3WK6A 5EHIA 3T3DA 2JGMA 1R0YA 5B7NA 2QDXA 3QTBA 3DONA 4MV5A 2AI3A 4KVGA 4FC7A 4NZ9A 3RBXA 3TI9A 3UV3A 1KJJA 4DWWA 3CRVA 2B37A 4NZMA 3RASA 2Z2YA 4YUXA 2C3YA 5F1YA 3EULA 3JQDA 1WPQA 3RIYA 3A1SA 1CE8A 2X7JA 1R6DA 4KE6A 1WXHA 5TX7A 3JQ7A 3VJKA 4BJHB 4KC0A 4PANA 1UZAA 3T3MB 3EVEA 1YR6A 1TZ2A 4CQLA 1CYEA 3F2VA 3ZCSA 4K26A 3ZDZB 4TVSA 3BQ9A 1N77A 1X7WB 3GT7A 4EVQA 1MQ8B 4M7OA 1EUYA 3MVEA 4RNCA 3CNBA 1U3CA 3OPNA 1LS6A 4GPTA 4TS4A 2PJUA 1IHYA 1QZZA 3C3EA 1N57A 5D85A 5AXBA 1ZH2A 3V8BA 3C3DA 3BILA 4E31A 1FUIA 4LXYA 3II6X 4BPRA 2NO5A 3EIQA 4CV1A 3BREA 5HZMA 1KZHA 5IK2D 1REQA 2XRMA 3ILSA 3TQTA 1ZN7A 3R7BA 1K8RA 1U2QA 4WZBB 3LBHA 3H6GA 1AZTA 1J90A 1XA4A 5AKXA 2FWPA 3MLAA 4ZXFA 2LGJA 4P7GA 4GX0A 2Q6VA 3BYZA 2HFJA 2YS6A 4YO7A 3RAGA 3VTAA 3CUYA 2D59A 2YYAA 3A04A 4ZEMA 5C35A 3IT3A 4S1NA 3FCEA 3HYCA 1GG8A 1RSZA 2G08A 2R68A 1MOQA 3NBAA 1M6EX 1ONNA 3CTPA 1P2TA 3QUTA 4KK4A</