3G9ZA

Crystal structure of este5, was soaked by p-nitrophenyl caprylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9zA00
2OGZA 2ZVDA 1DQYA 1JMYA 4H7IA 3STXA 3VISA 2PU5A 2XQJA 3O9MA 1XRPA 3ED1A 1THGA 3ZI7A 2WIFA 3TJMA 5LZ2A 1XZBA 2XB6A 4X3CA 1E8MA 3WKAA 4LXGA 1ZD4A 3PDCA 2WJ6A 2WHPA 1UKCA 3EBLA 4EUSA 3DDUA 3UMJA 2BFNA 2ZJ7A 4CG2A 4ZV7A 5EIHA 4KJXA 6YASA 4ZWNA 2WFLA 4DNQA 4DMHA 1N8SA 3D2CA 1WPRA 2RHTA 4G4JA 2ORYA 5FP0A 4UFOA 3ESBA 3SC2A 5ALRA 3I6YA 1VA4A 1FFAA 2ROQA 1QO9A 4CG1A 2OPHA 5DWDA 2ACEA 5DLPA 3V48A 1HPLA 3O95A 2VJAA 3FVRA 3W9BA 2Z3WA 3CN9A 4U2CA 1GZ7A 2QUBA 4UHCA 3F97A 5EGNA 5ALKA 1XRNA 1Y7HA 3H18A 1Q83A 4CFSA 4BZWA 2G5PA 4ZV9A 2XI4A 4BC0A 1G42A 1UFOA 2B4KA 5AK4A 1DQZA 4UHDA 3KOOA 5F4ZA 3QPCA 4EB0A 4K6GA 4J0JA 3ZWQA 1TCCA 3WJ2A 5BWCA 5AI9A 1FFDA 1XFDA 5I9IA 1W6RA 1U65A 3W2TA 5EHZA 1UKBA 2BUAA 1ODTC 1JKMA 3I1YA 5IVIA 5HF6A 3RLIA 2XMGA 2DHDA 4L9AA 1LNSA 3FYUB 5A7GA 4G4IA 4HZGA 2EEPA 2YH2A 1M33A 3IUNA 2VEOA 1ISPA 4N5IX 5EHXA 1XZHA 3ESDA 5A71A 3C43A 1J1IA 4H7JA 3G0GA 4CG3A 5CXUA 5H3HA 4UPDA 4Q3KA 4FLMA 5LKRA 2XQGA 2QJWA 4DYHA 2G5TA 1PFQA 2CMFA 5AKIA 1R1DA 2OXEA 1G4HA 3KWFA 1ZI6A 4TVKA 4AN0A 2ZYRA 3HACA 3U0VA 3O4IA 2DSNA 3C6ZA 4JUIA 1KU0A 3CCBA 5CT6A 1ODCA 1BEEA 1AGYA 5HF8A 4B0PA 5LZ7A 4H18A 3STWA 2XUHA 3G9XA 5CRIA 1J07A 4FFWA 4KAFA 1DT5A 5I7UA 4ARBA 2XUAA 4XX1A 3A6ZA 3E3AA 1MJ5A 5FPQA 5ALXA 2BUCA 2JIDA 2HIHA 2PUHA 4P92A 2XUOA 4YK7A 5KWIA 5DYTA 2CBGA 1YB7A 2QR5A 1J06A 1QIDA 2WQZA 3R3XA 3OTQA 4RE5A 4X93A 1TKRA 1YSCA 4BCBA 5ALQA 3IA2A 1ZICA 3BL8A 1EH5A 2QM0A 1XZIA 2VAVA 4X6YA 1BU8A 4BDSA 4DTCA 2PVSA 1TAHA 3H1BA 4CIAA 5KBYA 4OB6A 1TIBA 2EDCA 1ZD2P 4X95A 5A2GA 2VJBA 4GDMA 4WFKA 4Q3LA 3WKBA 4XJVA 1ORVA 2C5FA 1R88A 4N8EA 3IBTA 1ZGCA 2Y6VA 2WSLA 1OILA 5JD5A 5CBKA 3CN7A 4DMCA 1ETHA 2WU4A 1UWCA 3M82A 1GT6A 3WK6A 3FYUC 2JEZA 4FKBA 3OM8A 5AKYA 4JH0A 3B12A 4I3FA 5ALYA 1F0PA 4G1FA 4Y2QA 2YYSA 3C6BA 5HQ3B 2XMRA 4BB0A 1MNQA 5HFAA 2CJPA 1Q0ZA 2HA4A 5AM1A 3DLTA 5C8VA 4J0IA 4AQDA 4BP9A 5EFZA 5ALIA 3HJUA 4Q05A 1CVLA 4L0CA 3S2ZA 2WUEA 3P2MA 2OLEA 2XQKA 1LGYA 4HTAA 4B7ZA 4F5ZA 2VF2A 2H9YA 2WU3A 3WKDA 1XQYA 3IUJA 4U2FA 2FUKA 1XZDA 4X6XA 1VE6A 2HADA 4QDZA 5ALNA 3K2IA 1ZD3A 1T2NA 2K2QB 3I2JA 5ALMA 1A8SA 2XE4A 4DSZA 3CXUA 1EK1A 2QXTA 4Y2SA 5JAPA 3NGMA 4JEIA 4I19A 1LPAB 4ZI5A 5LP1A 1O6FA 3NUZA 2C7BA 2C0QA 1QFMA 2B61A 4MQMA 3ZPXA 4B83A 2WFZA 1ZGBA 2VA9A 2PSDA 1IVYA 2X8BA 4H0CA 3B5EA 1EDDA 1MNAA 2WG1A 3U1TA 4B9AA 4FOLA 1EINA 1ACLA 4OU4A 4HRXA 3LLCA 1DWQA 5A62A 4QLAA 2CEKA 3A2NA 1IZ7A 2O2GA 1BN7A 3GUUA 2XLCA 2H1IA 5A6VA 4G9EA 1WB6A 4MWSA 3TRDA 3JWEA 3G7NA 1I6WA 5KWJA 5AM4A 3BF8A 5ALTA 1XQWA 5ALOA 5CT5A 4S0XA 4C88A 4J3JA 4MEAA 4K2AA 5HF5A 4NVRA 3TEJA 1DX6A 5JD6A 3T4UA 3PICA 1LBSA 4X92A 4AB1A 1JU4A 1H2WA 1SCIA 2OAEA 1B41A 4J7AA 5I8PA 1K4YA 3STUA 2HA2A 5LLSA 3BDIA 2DQZA 1CUFA 3W05A 3W04A 4A23A 5AKGA 3L1JA 4WFIA 5IH7A 3FAKA 1G66A 3ZLVA 2O7VA 5AOCA 4RE6A 2WKWA 1U8EA 3R41A 4BTVA 4FDMA 2YASA 1GGVA 4W1PA 2J4CA 5CTAA 1YA8A 3VJMA 5T4HA 1CV2A 2JGJA 5JIBA 1EX9A 1P0PA 2I03A 1L7RA 5JYCA 3QYJA 4Y2YA 1QIGA 3WJ1A 1EB9A 4L3WA 3IDAA 3H17A 1T4MA 2FX5A 4Q82A 2FJ0A 2XUGA 3KD2A 3I6ZA 4WY8A 4KE7A 1Q0RA 4W1SA 4AXBA 2WIDA 3FYUA 1DWOA 2W6CX 3KXPA 1SOMA 3MVEA 4K6KA 2WJ3A 1W52X 2O2IA 1XRQA 3K9BA 3QM1A 1B6GA 4X91A 1O6GA 4WDRA 5LZ8A 1WM1A 4UBLA 4E46A 5AM5A 1EK2A 4DM7A 1VE7A 1XQVA 2HL6A 3WA7A 1CUJA 3FNBA 1CLEA 3IULA 3A2LA 2JGLA 2J3DA 1FFCA 1YS2X 3BJRA 1N5MA 3G0CA 3DKRA 1CUXA 5AJHA 3PF9A 1VOTA 3FYTA 1XKLA 3JW8A 3PE6A 1VA5A 1MX9A 1USWA 1P0QA 4QWWA 4BAUA 1QTIA 3ZV7A 4BC1A 1BCRA 4KE6A 5AI8A 2H7YA 3FCYA 5HZGA 4MWTA 2H7XA 5E4TA 3FCXA 4AO8A 4BTLA 2Z3ZA 3IVMA 4X00A 2AJBA 3HZOA 4IQ4A 4B84A 3Q8WA 4B80A 2Z8ZA 1QJ4A 3O0DA 4NMWA 1BRTA 4UBNA 1DT3A 1Y7IA 3HC7A 3W9UA 4J0DA 4FHZA 4A5SA 5IVDA 1CQZA 4NZZA 4BBZA 2V97A 1TCAA 4HVTA 2WIJA 4Z49A 1EVQA 4X97A 2CKMA 2GBGA 2WG0A 1ZOIA 1NU6A 3EF3A 7YASA 1LPMA 3MGAA 4Y2JA 4WY5A 2QZPA 4KRYA 5CXXA 5DYWA 4UHFA 3VVLA 5FV4A 3QPDA 4KAJA 2WLSA 3WKCA 4QDUA 2Q0XA 3H19A 3IUMA 3VJKA 4C4YA 3C6XA 4OCZA 3AIOA 4AMYA 4WJLA 2VSQA 3QZUA 5JANA 5A7HA 2QUAA 3D5EA 4ZGBA 4GECA 3WIBA 4XVCA 2IIVA 5YASA 2X5XA 2B9VA 4QDTA 4UBIA 4UHEA 1IMJA 1GKKA 2DQYA 3MUNA 4AMZA 1TRHA 4FTWA 1JJFA 3G0DA 2I3ZA 5LKAA 2J3QA 1AX9A 4JYPA 4WDQA 3KWJA 4DNOA 2ZSHA 3AILA 4H7EA 5C8ZA 3F9CA 1UOPA 2HA6A 2ZYHA 3OOSA 4X90A 3WIOA 1LPOA 1CPYA 3HI4A 2QXUA 1C4XA 1TCBA 4PO3X 3AIKA 4UBKA 1LBTA 5K3FB 2PPLA 2QTBA 2W22A 1MX5A 5HQ3A 4RNCA 2XMQA 4HXFB 5AKEA 5JAHA 2HU7A 3I2HA 4G8CA 1CUVA 1NX9A 2AJLI 3G9ZA 1JJBA 4H7HA 4HS9A 2J4FA 5ALSA 2WTNA 4W1RA 2QJRA 2C5GA 1CUSA 4Q34A 2D0DA 4M0FA 3WWOA 4TGLA 2WJ4A 1GPKA 1ODSA 1DINA 1VXOA 4B6GA 3NOXA 3WK9A 5FUMA 2Y6UA 1CUZA 1U2EA 2Z8XA 2Z5GA 2HHAA 3PF8A 3WQHA 5K3BA 3H2IA 2JEYA 1W75A 3PFCA 2AJDA 2IX9A 1XLWA 4J0GA 5AOAA 5AH0A 3KSRA 4YASA 4OUKX 3WL8A 5K3CA 3N2ZB 3GBSA 3IB3A 4ETWA 5LZ9A 1DX4A 1AMNA 1XRLA 1Z68A 4HXEB 2DHCA 5JATA 1W1IA 4FWBA 4MXDA 1R3DA 2HDWA 3AZQA 4M0EA 4LXIA 3WK5A 4UFNA 4KYVA 1S8OA 1JU3A 1HKHA 1NU8A 4OD0A 5AICA 4PQEA 3E4DA 5ALJA 1RWQA 1Q84A 4Y2RA 4EY5A 2CZQA 2PM8A 3ICWA 1YS1X 1IUOA 2OCLA 3I6MA 1IUNA 3BJMA 4Y2VA 5JARA 3WYDA 3LIIA 1AQLA 3L1HA 4UUQA 1D07A 3QH4A 1XZCA 3L1IA 1ORWA 3B3QA 3QVMA 1GKLA 2OGSA 2JGKA 3C5WP 1WOMA 5J3JA 2ZJ6A 5K5EA 3DL7A 3WZLA 2HRQA 3D7RA 4G5XA 4DNPA 4QDOA 2BAGA 4Y2PA 4U2DA 3MUOA 2WG2A 1CUBA 5IVHA 1DU4A 4K5QA 3LIPA 1MT3A 1CUUA 4CCYB 2JGIA 1PV1A 1QOZA 4E11A 2XQIA 1H2ZA 3HYSA 5AKZA 2DHEA 5AKJA 4Y2UA 2O2HA 3I2KA 1E66A 3FBWA 1CUIA 5EIAA 5E4JA 1EDBA 3HXKA 1KU6A 2E3JA 2G4LA 2X76A 5FDFA 5C7YA 4CCWA 2QMQA 3FSGD 4F0JA 1VZ2A 3I2FA 2QKYA 1QZ3A 2HU5A 3T52A 1JFRA 4C4XA 3ZLTA 4BRSA 2BGRA 5A7FA 1ZD5A 3QBJA 3BXPA 2OQIA 4BCCA 4X85A 4Q1VA 5T4EA 3QPAA 4RPCA 1CUEA 2ES4A 5D7BA 1SCQA 2P8SA 4ZREA 3STYA 5EI5A 3YASA 1ZI8A 1HLGA 2OCIA 4E14A 4F60A 4LYEA 1VZ3A 5DTIA 4G8BA 4H35A 3H1AA 1F0NA 2XMSA 4CI9A 1C7JA 5AK6A 3C70A 3VKFA 5AM3A 5ALEA 3D3NA 4G4GA 4OB7A 3BE8A 3DS8A 1MTZA 1YAHA 1EXWA 5DNUA 1CUDA 5CT8A 5JZSA 1L7QA 1ZJ4A 5ESRA 3STTA 3QMWA 1WPXA 3C45A 3WWPA 2O7RA 5AK3A 1J2EA 3ANTA 4FBLA 5K3DA 4ROTA 1AKNA 4ITVA 4RGYA 4P9NA 4DIUA 3F98A 4BYMA 4X94A 2V98A 1P0IA 1QIFA 2VT7A 4QA9A 1OCEA 1K63A 4UFPA 1R9NA 4BCDA 1XLVA 4LXHA 1QGED 3DOHA 2PUJA 3S8YA 2RHWA 1JJIA 2QS9A 4KR0A 3AZPA 1AURA 1CUHA 4UBMA 3G02A 5BWBA 4BE4A 1BN6A 1SFRA 3D2BA 4I4CA 4QNNA 1ZI9A 3SX4A 1EHYA 5CT9A 1LPNA 3AUKA 5JZBA 3WL5A 4N8DA 3RARA 1WB4A 3V1LA 1GPLA 3KDAA 3NWOA 2OCGA 4FLEA 1UKAA 5DNWA 2GZRA 1QE3A 2VT6A 1DWPA 1BE0A 2C58A 4B81A 4G8DA 5FKJA 2BKLA 4B9EA 1LPPA 3QMVA 3I1IA 1CUAA 3A2MA 2XMDA 3Q0TA 3D4LA 3LP5A 4EY4A 3WK8A 5AP9A 3EQ7A 3G0IA 2HA0A 3DYVA 3DKKA 1FJ2A 3DOIA 4JNCA 4X7BA 5AKLA 2HA5A 4DNFA 1IUPA 3PUIA 5AIBA 3VXKA 1CUYA 4BP8A 4W1QA 3SWWA 1CFJA 1QFSA 4LHEA 1UOOA 4W63A 4J0KA 5AKHA 4M0MA 1LPSA 1W76A 1JI3A 1H23A 5AI4A 4A16A 3WWEA 4PNZA 5BV7A 3WWDA 5K3FA 4GHWA 5JAOA 2Y2UA 3HEAA 4INZA 4C87A 2QRUA 3WYNA 5JADA 5AI5A 2RGUA 2CB9A 5EIEA 1R9MA 5HFNA 1EI9A 2GBFA 1YASA 1SC9A 2BCEA 1XKTA 3OPMA 4BRZA 3RK4A 4BVKA 3TGLA 4LYDA 5ALPA 5AKXA 1TQHA 2WM2A 3EQ9A 3R3UA 2AJCA 4O08A 3E1GA 4MYSA 2D5LA 3QMMA 4KAAA 1F8UA 3WI7A 4Q3OA 1MN6A 4GBGA 2OG1A 5HK9A 4KACA 4U2GA 2JGMA 3IURA 4IH9A 4X6UA 5IKXA 3UUFA 5KREA 5K3EA 5ALWA 3DQZA 2PSJA 4OB8A 2VAXA 3HRHA 2WHQA 4DLNA 2OAGA 1ZIXA 5AHXA 4XWGA 4GW3A 5CURA 5C81A 2VTVA 1EB8A 2AXEA 3R0VA 5ALZA 3PFBA 5AO9A 4GI1A 4P08A 5FLKA 1R50A 4Y7DA 2HA3A 1XZGA 3FLAA 5JALA 2LIPA 2PBLA 1UK8A 3H0CA 3WA6A 1XRRA 4N8SA 3EQ8A 3WK7A 4EA6A 3WL7A 2FJPA 1E8DA 4FMPA 2GBCA 2HFKA 1PJAA 1XZAA 2PX6A 3IIIA 1UXOA 3HABA 4L72A 4WCVA 1AUOA 3N0TA 3WWCA 4U2EA 4F21A 4QZVA 1EA5A 1XZMA 5JD4A 2Y1KA 5T4FA 2V9ZA 1ZJ5A 2JGEA 3V1KA 5DTJA 1MO2A 5DNVA 5ALLA 5CH5A 4CIBA 4HRYA 4H7FA 4WFJA 2WHRA 1HL7A 4KRXA 3R3VA 4LIPD 5SYNA 3AIMA 4UHHA 3BWXA 2GYVA 4D9JA 3F67A 1H22A 4GLBA 3BDVA 3D0KA 1X70A 2ACKA 3O9VA 1IZ8A 2G63A 2EDAA 1UT6A 4H77A 2VJDA 3DD5A 1VJ5A 4CCYA 3PI6A 1CR6A 1G5FA 3H2HA 4C6HA 3AINA 1LLFA 3GA7A 2OGTA 3GROA 3D2AA 5ALDA 3I2IA 2JBWA 1MPXA 2WFMA 5EHQA 3X3HA 3LS2A 1LPBB 4PW0A 1XZFA 4QEKA 2ZJFA 3AZOA 5HK8A 1F6WA 1XRMA 2VQ6A 2IITA 5HCUA 2RONA 1WHTA 1XZLA 2XUFA 4BVJA 4BZZA 4BE9A 1YAJA 2XMZA 1WHSA 2JF0A 4LKOA 4IO0A 1VLQA 3OC0A 1YCDA 1JT2A 1ZIYA 5AM0A 2PKYX 4C89A 1QIJA 3ESCA 4IHAA 3H2GA 5LYYA 3M81A 5D3ZA 5BOVA 5IVKA 5FOQA 2AJ8A 1CUWA 1EDEA 3JYHA 1AZWA 2QOEA 3V1MA 5AKKA 4X71A 2YXPX 1CIJA 5CW2A 4AX4A 4MQLA 4J0HA 1GQRA 2HA7A 1BROA 3O4GA 4B0OA 4FLFA 5ALGA 1A7UA 3WK4A 4OYLA 3K6KA 5JZ9A 1N1MA 2WHPB 2GZSA 2GYWA 4JYMA 1A88A 3FLEA 4J03A 3RM3A 1QIHA 5ISMA 4FBMA 1LZKA 5E4YA 3M3DA 1EVEA 1HDEA 2WFLB 1E89A 5AOBA 1N5RA 4K6HA 3GFFA 4PF1A 1TK3A 3ANSA 5CH3A 5EHNA 5DJ5A 2XT0A 4KEAA 4ARAA 4C4ZA 1GPNA 5D3KA 2R11A 1R4ZA 2RAUA 3DJYA 3H2KA 4AZ3A 2OQVA 2PL5A 5CMLA 2XUJA 3DEAA 4BDTA 4KE8A 1YA4A 1HQDA 3I2GA 5C8XA 2PSEA 3DL4A 4EBBA 5AI0A 5HKAA 1X2BA 4U2BA 5AIAA 3AFIA 3WKEA 3F8SA 2WUGA 1E3QA 1QIIA 4MJ3A 3F96A 4EY6A 3DNMA 5D6OA 1K5PA 1OXMA 1A8UA 2ZYSA 3O4HA 3WLAA 3DYIA 3C5VA 2GYUA 2XUKA 2RI6A 4FNMA 1MU0A 1MAHA 4MEBA 4ZXFA 5ALVA 3BIWA 1MX1A 2VATA 2WUFA 4G9GA 4YX9A 1BS9A 2BJHA 3HLKA 1E5TA 1XZEA 1QONA 3FWHA 3D59A 3H2JA 3RKSA 5FRDA 3VVMA 1KEZA 3ZLUA 1RYYA 1RP1A 4EY8A 4Y9SA 2V96A 4IH4A 1FFBA 5CH8A 2NW6A 5K3AA 1UK7A 4MYDA 2VJCA 1WB5A 1THTA 4B85A 1E8NA 4QE3A 3VJLA 1H2YA 1X2EA 3EIOA 4AN1A 4TPKA 4OPMA 1WCYA 1UOQA 4DGQA 3WZMA 3ICVA 2WIKA 2I3DA 2I78A 5JAUA 2WIGA 4YPVA 3DCNA 4QDXA 3ILSA 2XUPA 2PSHA 1FFEA 3M83A 5FPPA 1K8QA 2CUTA 2GBIA 2B20A 2XMCA 4UBJA 2C4HA 1ACJA 2PSFA 1SCKA 1UZAA 1QO7A 4OYYA 3O4JA 4UBOA 1XROA 1FSSA 5LZ4A 2QT9A 5ALHA 5AK5A 5ALFA 1CUGA 3G0BA 1YB6A 1W4LA 5JASA 3C87A 1XQXA 1VXRA 4N5HX 1LZLA 5CT4A 4DMFA 3IUQA 3FOBA 1QIKA 1UK9A 3PUHA 3GELA 2WTMA 1C7IA 3HSSA 2ONCA 1A8QA 4J0CA 4PSDA 4Y2TA 3CCCA 3BIXA 4KE9A 1QIEA 4FFVA 2ECFA 4ZRDA 4QLOA 2RIPA 1XZJA 1DTEA 1QTRA 3R3ZA 3VDXA 3WL6A 1YR2A 3E0XA 2UZ0A 2BGNA 1GXSA 2C0PA 3WMRA 1MAAA 4PSCA 2XUDA 2XQFA 2OCKA 2QVBA 5E2IA 3W06A 4BVLA 4B82A 4NS4A 4P93A 5DYYA 4EZIA 1VKHA 2WILA 4DMKA 1JMKC 2XMBA 5T4BA 2JGFA 2XDWA 1K6EA 3I28A 5LZ5A 4AO7A 2XLBA 3R3YA 3H04A 1UK6A 1CEXA 1CUCA 3FSGA 3R3WA 3G8YA 4V2IA 1GQSA 1QIMA 4AZ0A 2WUDA 3V9AA 1CQWA 4BATA 1XLUA 2ZSIA 4EHBA 1L7AA 4H7KA 1BCSA 4H7DA 2HU8A 4HXGA 3QITA 4C01A 3BF7A 3G9TA 4Y2XA 4EY7A 4HAIA 4OU5A 3AJAA 2DR0A 5FXMA 2H7CA 4E15A 3R40A 3OG9A 4GEGA 3G9UA 4UHBA 1QLWA 3LCRA 1Y37A 5HF9A 4IH1A 1P0MA 5AM2A 2HRRA 3C6YA 2ZYIA 4GXNA 3C8DA 1XZKA 3UUEA 2DCMA 4PSUA 2HFJA 4XIIA 3SK0A 4BAGA 4AO6A 4FNGA 1H2XA 4QWMA 5HKBA 3OURA 4OSEA 2XUIA 2XUQA 2R8BA 5ALUA 3A70A 1BEZA 2PU7A 3FLBA 1AC5A 3V1NA 2BUBA 3C8HA 5LIPA 1CRLA 5AI6A 4GWLA 5SYMA 4BAZA 3ESAA 2Y2VA 4W9RA 1U4NA 3STVA 4PV7A 3FVTA 4DSAA 1HBJA 2DFPA 3GZJA 2HM7A
chains in the Genus database with same CATH superfamily
2XD9A 5IKEA 3LQ2A 5A5VA 1R0SA 1ZD8A 3WTCA 3PWSA 3B1KA 3IODA 5KVSA 5CD1A 3E03A 5JNWA 3WC4A 2XGJA 5BNTA 1XTZA 4GM4A 2P65A 3VISA 5KCMA 2NNWB 2W2OA 2XQJA 1J8FA 3FPCA 1VSQA 3O9MA 4GQAA 4IPTA 3NHFA 4ZAZA 4HDKA 2QQGA 3ED1A 1THGA 4UTRA 3SIRA 3ZCQA 1KFKB 1OFGA 3M0EA 1EUCA 5LYJF 4HFJA 4LVOA 3SVLA 3IERA 4LWPA 1KI8A 1XZBA 2DECA 4ROSA 5IUKC 1FDTA 1A72A 2FETA 4X3CA 4D0LB 4ZKEA 3WKAA 1TM5E 4BGIA 4A26A 2ZQYA 1KRHA 1O94A 1CERA 1H5UA 2AR0A 3PDCA 2CUKA 4UUAA 2AHOA 2PX0A 2WJ6A 1M54A 2X9VA 4V0RA 3QQ5A 4Q9IA 2CLCX 3PEUA 4EUSA 3LHSA 4P3OA 4LJLA 3DDUA 5AHOA 5ED0A 2ZWPA 2YWJA 4UMDA 3AI1A 2GX6A 3UMJA 1LJUA 1NP7A 2GPYA 1DAEA 3I09A 3LQKA 3C3MA 3PFGA 3GDWA 4O1HA 2O8FB 1GGFA 2RGGA 4HYYA 1YGYA 3CUWA 2FPGA 1GEGA 1P2UA 2YV2A 2EKQA 1AKEA 1SQ5A 3F9RA 3PJGA 4B47A 1AS0A 1C7FA 4KI0A 4YREA 1Q0TA 5A6SA 4ZVUA 1NBME 4S1VA 2XYQA 4FGZA 4X44A 3EXHB 3UPTA 3JQAD 3H5RA 3JQ8A 1W59A 4ZOLF 3HU2A 1XWFA 1HT3A 3E23A 1DC4A 1WPRA 1N57A 2RHTA 3I9V1 4J94A 3THRA 4XWWA 2ORYA 1YJAA 3LXMA 1EVKA 1OOEA 2C9BA 3I12A 1JAXA 3PYLA 4I4TB 3Q8LA 3PCRB 1OYYA 1QMGA 3MYRA 5JCZA 1VA4A 1WMDA 1FFAA 4AJ9A 2IXTA 4MHTA 1G7SA 3TM4A 2KLBA 2O5RA 4GQIA 1D3AA 3T61A 2OV3A 2WK1A 3MWLA 3QI2A 3MTIA 4HB2A 4V39A 4N0PA 4RA9B 5DWDA 3CVWA 4NYJR 3EAQA 4C7OB 3LPCA 2WAAA 3CC8A 3O95A 4DARA 2QV0A 3HMQA 4MRMA 4OI1A 1VM6A 4BFZA 3PHJA 4XLZA 4P4NA 1TT5B 2AZ4A 1G21A 1T43A 3GMDA 3D3WA 1NWHA 3H97A 3FVRA 3N0VA 3IS3A 4GNRA 1JHOA 4NP6A 3MYYA 3MJTA 4LCBA 1GJRA 4GKBA 3B89A 1XT6A 3TZ6A 2IRWA 4QM7A 1W7AA 2GXAA 4HB4A 5A3VA 1QVWA 1V8FA 3HCOA 3OCUA 1YS6A 3CJTA 3CX3A 4L0MA 5D2CA 4O02B 3ZJUA 3IPYA 4CIYA 4U2CA 3IPLA 4P8RA 4N76A 4Q6WA 5GIOE 1QR2A 3L7CA 1XVAA 4KO4S 3IJPA 2IH2A 4ZZ0A 3RU3A 3UH1A 1MH9A 2NQ8A 2XWBF 3C8UA 3I01M 4RA6A 1GVHA 3HM2A 5D3QA 4Z0NA 3H18A 4IJ5A 1G20B 2HJHA 4BB6A 4MO9A 4F56A 4CFSA 1H85A 3MGKA 4TTVA 2ZT8A 4Y6OA 2V3WA 3WGOA 2G5PA 4FFBB 4RTKA 2OMKA 2XI4A 5EZ6B 1VG8A 1Q1GA 3V8RA 1H5QA 4H17A 4FFNA 1E0SA 2IE8A 2J0VA 4JC8A 2B4KA 1LSOA 1N6NA 4PGAA 5CA0F 1Z62A 2HQBA 3AEKB 2OT3B 4F93B 1J9GA 1E2EA 1PR4A 2GASA 3ESRA 1Y81A 1D03A 3RWBA 4MRVA 5FAKA 1GPH1 1MXHA 4GPEA 1TA9A 2PCLA 3FRHA 1NN3A 3NWJA 4KQCA 1FDVA 3OLVA 3PXXA 2AXPA 3LFTA 3HKEA 3QVKA 5FO0A 1I2AA 2LPMA 3WJ2A 2IXDA 3QUAA 4WCDA 1IN7A 1BVYF 5AI9A 2EIXA 1FFDA 1PR1A 2ERCA 3B6IA 4XZ3A 3LT0A 2DWPA 2HJWA 3LYHA 2A6PA 1Y3DE 3U61B 4M0DA 4DLSA 3CVXA 1TVKB 3D7MA 3KKEA 3A6HA 5EHZA 2H3HA 1UKBA 1Y4SA 4EEKA 1HSOA 3ES9A 3GH1A 3KTFA 1U3DA 3BMXA 3EMBA 3ICPA 3I76A 1C14A 4LMPA 1JIKA 5DP1A 1BAPA 1LXCA 4K7JA 5IVIA 1SCBA 4HZIA 3OEHD 2ECKA 2VOJA 3S28A 2I2WA 3N0WA 3T7SA 4C6TB 4XE5A 3BKXA 4J07A 4MS1B 1VBFA 3RLIA 1VI2A 4HEQA 1R64A 3ZWKA 2P5TB 5KX5F 4K9RA 1SM4A 2C96A 2ZITA 1VYTA 2GD0A 2AG8A 2ZKIA 3QSGA 2I6SA 1GNSA 4JI7B 1AUPA 3FYUB 4O4JF 4QICA 3QUBA 4HDAA 1FLAA 4WQMA 2Q9CA 5DYNA 4ZK6A 5FPKA 2XIJA 1HORA 3VO1A 3G8DA 5AVRA 4HZGA 1IM2A 5I01A 4KLNA 2FWMX 1EGQA 5FQNA 1KJNA 4QJ3A 1N1GA 2VDPB 2VEOA 3H2YA 3K31A 1A77A 5DT9A 2X3UA 1YZVA 1GPYA 3ZVRA 4F4CA 3L8ZA 3KZNA 1JALA 2FFHA 1QDUA 4MQFB 3H9JA 3GGOA 5JZOA 3C43A 3RRYA 2AF3C 5KMGA 4M1WA 4NZOA 1WQ3A 1PLKA 3TM5A 1N6LA 5A05A 4CG3A 2PZKA 3C3EA 1J00A 1NPYA 5DHUA 5JBQA 4I6EA 1B8OA 4FLMA 1AHIA 2RC5A 2Y92A 4XD7A 3K53A 3PG5A 4GMKA 1YR3A 4QUEA 5KYXB 4GVLA 3T5CA 5K8JB 1QF7A 1Z26A 5D87A 3FMVA 1VE3A 1PFQA 2O06A 2CMFA 1AF4A 4MW2A 5AKIA 3GPIA 3WYEA 5F1OA 4F1JA 2O50A 4FBGA 1XELA 1G2QA 1PR2A 2W2LA 1T1EA 1Z45A 5D51S 3PX3A 3RFCA 5JNVA 4YMTA 1RWNA 1RPZA 4OX9B 3NHRA 3KWFA 4M0KA 1ZI6A 2Q49A 4NF2A 4YI3A 2ZAMA 2AN3A 4ND8A 4PGGA 4COKA 5BP7A 4LWOA 4B4VA 5L95A 1BG6A 1XU7A 5CEJA 2ETVA 4RZ2A 1JR3D 3AM1A 4I1RA 3D6HA 2DSNA 1XC7A 2ID9A 2JFQA 3E05A 1NNUA 1KMNA 1UJNA 5FOTA 4AI6A 3OJEA 4DABA 4PWYA 5MGNA 2ZLBA 2X0KA 3QU4A 3LBFA 4US1R 1BEEA 2IPNA 1DIRA 2PTGA 4NRDA 1V9SA 2VSYA 1UM9B 1VHTA 3PFNA 3W5VA 2B1IA 2NUPB 4ZXPA 1FUEA 2D00A 2XUHA 1NHGA 2QGNA 1L3BA 4Q1AA 4CLRA 4W4TA 3GEPA 2CLDX 5H3CA 1TAUA 5A9RA 3LSTA 1KHHA 4UATA 4TXLA 2BFWA 5CRIA 2FYTA 3ZZ0A 3D3EA 4FFWA 6Q21A 5DHRA 4UW9A 1GQYA 2W5UA 1ZPDA 1J2TA 1DT5A 2FCRA 3HDTA 4ARBA 4XTRA 3AHJA 1CQIB 1SUBA 2QTMA 3AK4A 3AUJB 4NBLA 2Z83A 3KQWA 4P7FA 1SXGA 3UICA 2HCJB 2XUAA 3EVCA 2FUNB 1T4CB 3D6VA 4XX1A 1FS5A 3SI7A 1P2SA 2GPNA 3GEBA 5DCYA 5E8RA 3T5GA 4D74A 1MJ5A 1Z13A 1N32B 1BHQ1 5FPQA 3W8RA 1WP4A 4I9UA 1QH8A 1V4NA 1Z08A 2FEPA 2JIDA 1Y89A 1UJBA 3TZHA 3MMSA 2CV2A 1Y6ZA 5L3SB 1NFRA 3QFRA 5HIIA 2PKEA 3AR4A 3SEQA 4YK7A 1SVSA 5EUCA 4BE7B 1X7YB 3KTAB 1Z74A 5KWIA 3VU3A 5FH9A 5DYTA 2HPZA 4V0NA 2QR5A 1QIDA 4UU7A 4O2AF 4F4DA 3WBBA 1TKRA 3OQ6A 4MW1A 3I5UA 2DXIA 2HCFA 5CK5A 1XA0A 2B36A 2NZWA 1ZICA 2HT6A 3BL8A 4EHHA 2OZKA 3COSA 1EH5A 4TKVB 2QUZA 5AD1A 5FWYA 3NT5A 4J29A 1E7WA 3DH0A 5CLQA 1THZA 2AR7A 4NBNA 4XLTA 4BP1A 5JCXA 3AF2A 4RFSA 1XUOA 1Q0SA 2D3TA 3BTUA 3E7XA 4CDNA 4DTCA 4QT4A 1JMVA 4QYTA 3VUFA 1RSZA 1ZISA 2PVSA 1YV9A 1CHNA 5B55A 1NBHA 1TAHA 1MJGA 3GAFA 5GJCA 4Z4EA 3MCWA 4HNAB 2C82A 2J3HA 4LY9A 5TV2A 4NE2A 3CLSC 2PH5A 1XU9A 1M8PA 2FX3A 2LR0A 4JX9A 2I87A 1NJ5A 4KNWA 3IKTA 1UT8A 3L7KA 4JROA 5EIBC 1BGWA 2NO0A 2VJBA 4GDMA 1J8MF 4IIJA 4WFKA 3WTBA 4TV8B 3WXBA 3ISVA 3ZE0B 1NR5A 1DAOA 2B30A 2P9QA 1VI5A 3AJDA 2C1XA 3D0OA 4XJVA 2PS0A 3TW8A 1B8NA 2OKCA 4JI2B 1P1JA 1ZJZA 4Z54A 2JS7A 4WOJA 3WJAA 4BMNA 1E9EA 1N7HA 1RI3A 1UJMA 3MT9A 4DCSA 1PFVA 1OTYA 1ZUNB 3ORHA 2OPBA 1KBZA 4GYKA 1T8UA 3RAEC 1IHUA 2QD1A 1A9RA 1AB6A 3IBTA 5DHSA 1ZGCA 2JBAA 3ROMA 2PZBA 1M66A 4ZI3A 1TTPB 4AURA 3QMPA 3ORQA 1VL2A 1L5FA 4BQOA 2Y6VA 3LP6A 1Z2AA 4FCTA 5LMNB 4KR6A 3EA0A 4UZFA 5HG0A 1YBMA 1LI5A 2XF2A 4LOLA 5IFKA 3UENA 2RG7A 1J1ZA 3IQXA 4EJSC 3CN7A 3UK0A 4V24A 3RS3A 4D8WA 4Q9JA 2NU8B 1GVNB 3KPJA 2O3TA 4CKCB 1R4AA 2YJGA 2Q4OA 3RVPA 1XL1A 4HB3A 2EL7A 1FRFS 4DIFA 4RPJA 4D4GA 2ZRLA 1G64A 4BV8A 3HP1A 3ZX5A 3K1ZA 3JQCA 3O8OB 4FKBA 1AE1A 5KOHA 3U4MA 4EQ6B 1L4BA 3DJFA 3KKOA 4TS4A 1D2CA 1C29B 2QPOA 2RB5A 3MMPA 2FB9A 2RGDA 3OZFA 4QULA 2W6JA 5LP6B 1G7TA 4CMAA 4IS3A 5ALYA 5FULA 2H00A 1C8BA 5I9LA 4G1FA 4HUQA 1CRZA 4YJKA 1ZGAA 2YYSA 1KY4A 4LS3A 2IT1A 3ZD8A 2EZ4A 2GLTA 3EC7A 3HFJA 4TQAA 4KYIB 4WKNA 3HO6A 4HAZA 4HNHA 2I1QA 2QG9A 4C06A 1YRWA 4DZRA 1QG0A 2BFCB 4I8XA 3KD3A 4R51A 3VHXA 4YHHB 4A03A 1Q0ZA 5KVAA 1I6LA 2ZTSA 2HA4A 3LGSA 1KDVA 1Z2OX 5DPMA 1XKXA 2W2MA 4A1OA 1TUIA 4PLCA 3KVYA 3WLEA 4BMVA 3NIBA 1JHYA 2ANBA 1EFHA 5EC8A 4AQDA 2QYHA 2YYYA 4QYIA 1OTXA 2QTHA 2G9UA 5EFZA 3N8IA 5KSZA 2XHZA 4MA5A 5HOEA 1AKTA 6REQA 1NQUA 3EFHA 3CKLA 2WT9A 4L0CA 4ZZIA 5FI3A 1X39A 1DRWA 2J85A 3RIGA 3ASUA 3TVTA 2XQKA 5GVSA 5JS8A 4HTAA 1MB0A 3ZD9A 5JG7A 3T1YB 2G17A 4BECA 2H9YA 2VUIB 3RVMA 2X2FA 1Z82A 3WKDA 1C30A 1LSJA 1XQYA 5AT1A 1ZH2A 2EL9A 3GRUA 4N3CA 4TQ9A 2NZYA 1FUIA 1F38A 3ZE1B 3WKBA 1SXJC 5TIIA 5CITA 1L5QA 5ILGA 4BX0A 2AZXA 4QDZA 4I55A 3UXMA 4WZAB 1E7MA 1L4KA 1ZD3A 4G24A 2Q29A 2LRHA 4LUCA 4CF5A 1BHO1 3ETDA 3HDGA 4QXPA 4WZ6A 2X4DA 1A8SA 2WSMA 2YDYA 3K4PA 3LUCA 1ZGHA 4OAQA 2PVCA 4OHOA 4C0QC 2PGIA 1QP7A 2IS1A 4FMDF 4L3OA 5LB4A 5HILA 2IV2X 4KLAA 4HGRA 4AD8A 4HF7A 1G16A 2Q27A 2GZDA 1UBKS 3M6IA 4F85A 1UBCA 4R9SA 4P81A 2RH8A 2VBGA 4A0RA 4I19A 3KQSA 1LPAB 1T91A 3TFWA 4WXYB 4NU5A 5A0FA 1ZXBA 2WT4A 5EJ5A 2O3QA 2O05A 1OLUA 2HMAA 2QW0X 4UULA 2A92A 3I9MA 4A73A 2XCQA 3WGLA 2FQYA 1C81A 5EIWA 1QFMA 4E3ZA 2OD9A 4Q4LA 1RBQA 3H5IA 4M76B 1OGYA 4GZ6A 4LF9B 3U4DA 2ZTUA 4IXMA 1GTRA 5IX8A 5EJ8A 3KKMA 4IDPA 4XCVA 5KSPA 2H5JA 3U62A 4DMRA 5LR6A 1IVYA 4H0CA 4YCAA 2A9PA 3E18A 3MT7A 2X0NA 1E5XA 2P2GA 1Z0SA 1ZL0A 2WG1A 3OBIA 4RCVA 3KB6A 5EMMA 1IBSA 4JSTA 3H9GA 3OOWA 4M9UA 2QTZA 3TAHA 1TF5A 4EA7A 3LQQA 1GGKA 1F8XA 3DFZA 3G82C 3SIXA 2V7TA 2ZB7A 5P8WA 3KT0A 2I4TA 1OYVA 1M0TA 3HDJA 3DKVA 1O6BA 1ZBQA 3D8TA 5LBIA 2C2OA 4WGGA 3GUUA 4Z9BA 4JSRA 4ZVLA 2XLCA 7REQB 5EKUA 1KP9A 5JFGA 1FFYA 1KQFA 3ZY2A 1N33B 1OREA 2H1IA 3AXTA 3PQ2A 4ADSG 2Q1TA 1XTQA 5GV8A 4Q1DA 1CXZA 2JJ2D 1WXEA 4FOSA 3EDYA 1WB6A 4MZDA 3UWPA 4EGAA 5FBWB 4F9TA 3WG9A 1AQIA 5K6AA 2R4TA 2QN2A 2VP2A 4IG4A 3JWEA 1CK4A 1SK8A 5LQMA 3A7DA 2IHUA 1UBHS 3KB8A 2Q4TA 2DT8A 2VP3A 5AM4A 1F20A 3ORYA 3T95A 3B6ZA 3WLHA 3BF8A 3EXHA 1NUUA 5I7AA 4E94A 4Q1CA 2G28A 1XQWA 2ZWMA 4NNPA 4M83A 5ALOA 1PWZA 4C88A 3FOWA 3C8ZA 5HQTA 1P9NA 3HUUA 4K2AA 4MEAA 1GUZA 1SVKA 2OFOA 2VAWA 4Q21A 1O4VA 2B9EA 5A4AA 4I4TA 2OZVA 2CHUA 3MF4A 4YS6A 1IXRC 1PT6A 2RK3A 3DHWC 5JD6A 3NIDB 1NF8A 2DPYA 3A31A 4GBJA 4KPEC 1EK5A 2GNPA 2XCOA 3DDNA 4EGQA 7AT1A 5SZJA 2FPKA 2NTVA 4HHEA 1S1CA 1GZ5A 2E4ZA 4RA9A 4C7OA 2IXBA 4CNBA 3NCHA 1SCIA 4KYTA 4XKJA 4P2GA 4RVGA 4U7FA 4AROA 3SLRA 7REQA 3EEOA 1DS6A 5I8PA 2VIIA 1XTSA 4HD8A 1TT5A 5B30A 2UVDA 1SBHA 3K3PA 1EZ1A 4HPXB 1VGVA 4FJ0A 2DQZA 3DAPA 3PGKA 1PFKA 4HDQB 3W05A 3WDLA 4KSYA 5G1PA 5G1OA 1LBHA 4ZOAA 5AKGA 3L1JA 4TSFA 3AVUA 3WMXA 2JW5A 4TKUB 2HBZA 3DMGA 2PRYA 4WFIA 4TTRA 3OFSA 2IDMA 3OU2A 3R3HA 3FDJA 3OZBA 1A69A 4UM5A 1F2DA 2VDVE 3L0ZA 3PL5A 1G66A 5IWAB 1R18A 2R8XA 3A7EA 4IS2A 5EJFA 2O7VA 3TOCA 4QBIA 1NV9A 3DF9A 1W5TA 1G20A 4JVNA 4I3HA 4BX9A 3T4EA 4F3CA 4I1PA 2PSSA 2C5EA 4X6LA 4N3AA 3GC6A 4FFBA 5SYAA 5KTTA 2UUCB 5P21A 5THKA 2HK6A 3DTVD 4IJUA 1YFJA 2HSGA 1RNLA 1XU4A 2DULA 2PS9A 1T9HA 2W83A 3KLOA 4P4SB 1DI0A 1R6AA 4W1PA 2J4CA 1M6EX 3AEKA 5CTAA 1CB7A 5T5QA 4DQLA 5L7WA 1V47A 5B1EA 1QDEA 3K35A 3IQWA 4Q4CA 2A88A 1YA6A 3DHNA 1WUIS 3E2PA 4EO7A 1KJ9A 5JIBA 1EX9A 4IUYA 1P0PA 3FROA 4YLYA 1RADA 1L7RA 4S1WA 2YHBA 4KLRA 3ER9A 3KKZA 3G2LA 1XXHE 3AW8A 2X5OA 3E4CA 2EJBA 3SM3A 1IOWA 3QOYA 5IBRA 4A6EA 4CCAA 4FZRA 3ZE2B 4EFNA 5CR9A 1CF4A 1BXZA 1WEKA 3F5FA 1TVKA 1T3TA 3JAWB 1QH1B 4GO1A 5C1DA 4JLDA 3WYAA 2YXNA 5EWMB 4WECA 2OMEA 1ZN7A 3ENWA 2AG5A 2X40A 3R24A 4C6TA 2PFSA 3A0RB 4Q82A 1KEVA 2FJ0A 4MS1A 1NVBA 3L4SO 2CGEA 4ZPJA 1YF3A 2YJTD 4KE7A 1VLJA 3I5AA 4JYBA 4F45A 4IDQA 1YR7A 4AXBA 4IGAA 1RBMA 4X65B 4RC9A 3KOMA 3FYUA 1S3SA 1DWOA 3KXPA 4Z8YA 2CKDA 4K6KA 1HE3A 1TCUA 1CIPA 2ZM5A 3SX2A 3N2KB 3GEDA 3EDRA 4X84A 1NI3A 2AWOA 3I37X 821PA 1SD1A 4HQLA 3VA7A 4UUPA 2WWXA 4CM9D 3KAKA 2FUG1 4LSZA 3K30A 2F43B 3WGJA 2FA9A 4R0MA 3ZD6A 3M2PA 4MQFA 1ODIA 2VZ9A 1P75A 2BDEA 2V65A 2QQFA 4Q3DA 4WDRA 2VG8A 4J1NA 1L8OA 4W8HA 5LZ8A 4BLTA 4KB5A 4D4JA 4UTNA 4CBVA 3LBIA 4V2UA 1MC5A 2PN1A 3L7BA 1EK2A 1TMKA 3DQQA 4ICIA 2H31A 5FYQA 4DM7A 1XMPA 4FSHA 1Y1KE 3T1OA 5LNK6 5DXJA 3TCNA 3DGFC 5KYXA 5DGXA 5C7OO 4JLAA 3S99A 3U7JA 4N40A 5MF6A 2J3DA 3U2QA 1FFCA 2QT1A 1QKKA 3DDZX 1X7DA 3VPBA 1G38A 2GAJA 3AETB 1CUXA 2IQ5A 2PKRA 1OXUA 5ITZB 4IDEA 1TU3A 1YZQA 3PF9A 1VOTA 3MUEA 5ERXA 3U56A 2DFVA 1A7JA 2X15A 3SHQA 1J0XO 2A14A 2X0EA 3HA7A 2NSYA 4BAUA 4CV3A 1W96A 4Z9YA 4PSVA 1NAHA 3GRKA 4MJXA 2AK2A 4QIHA 3ZV7A 2O2DA 2ORED 1ILWA 2FSVA 4XOUA 2H7YA 5AUOB 1TECE 3P9ZA 3L18A 1IY0A 3UAWA 3KV3O 2IU6A 4AP9A 4QM6A 4PZ9A 5IAKA 3RC9A 1C7RA 1D7OA 4KTVE 1NMZA 1TC1A 3NBAA 1JEJA 4BNHA 1IAVA 4QXAA 5T8KA 5HIAA 2C4UA 2F55A 1CIVA 1K6MA 1UM9A 2OILA 3ADOA 2TMYA 3DTTA 4K26A 5HBRA 1T3HA 4TRNA 2H4HA 5CA1F 5CNKA 2NV2B 3IP5A 4JZKA 1GNTA 4TMTA 1W581 1GPDG 4MIKA 4L8YA 1BDJA 4B80A 4EGSA 1QJ4A 3O0DA 4M38A 1BRTA 3FA2A 5C3MA 1PDOA 2ZI6A 3W7AA 3PX7A 2ZR7A 1TIPA 3GHYA 5I7OA 2XJ4A 1CQIA 1T10A 4TV9B 4L2IB 4DLKA 1KEPA 3GPDG 1ZGGA 4M55A 3P0HA 5EJMA 1QHNA 3UGTA 4LDZA 4CPDA 5B4VA 2Q5CA 1T4CA 4XSGA 1EFLA 3WNBA 3VAYA 4A5SA 2C9OA 2V6GA 1Z75A 4NYMQ 1CQZA 1GQOA 1L4HA 1Y7TA 3MNFA 1W36B 4JJ7A 4HJRA 3BILA 2VUTA 4X5OA 4BWGA 4Z49A 3BTOA 5L3SA 1WKVA 2PUEA 4RYDA 1CJSA 3KTAA 1IN8A 2NPIA 3AB7A 4EL5A 3QTTA 4A92A 3IVRA 7YASA 4KIUA 1C7QA 1C8KA 1ZK2A 5EZYB 2WNHA 2R7NA 3S8EA 2LTAA 4MQ6A 4BUCA 3KUXA 4WY5A 2QZPA 4J3NA 2X5NA 5H3LA 3KZ1E 4OXYA 3WDMA 4A0HA 3UPDA 3L4BC 1RLIA 4KBGA 2AXNA 1N5IA 3L92A 1DAFA 4NEHB 1CYEA 1NY6A 3RV3A 5KTPA 4TKVA 2O2SA 3QX7A 1CDDA 2WD9A 3SC4A 3QPDA 5TY0A 4CMCA 2XE8A 2VHVA 4LMAA 4OJQA 4QDUA 1YR1A 1VLMA 1E6WA 1DQPA 2D1RA 3TZEA 5AUQA 4LFCB 4BO0A 2BGIA 3ANLA 3IUMA 4TZKA 2NVOA 3ZGVA 4C4YA 3MT0A 5HSGA 4OCZA 3GCGA 1RAHA 1UXHA 2ZRFA 3F5SA 2VKTA 3O1LA 3QVWA 1ZLYA 3AIOA 4C1NA 1Q6ZA 4QSMA 1ENZA 4HNAA 2G04A 2V6MA 3PEEA 4FW8A 2ZBQA 3KCNA 3LT2A 1G98A 4UVIA 3VKWA 3A6GA 5A7HA 2J3EA 3D5EA 3RAJA 2C9ZA 2HRBA 4UD6A 3AEXA 4ZGBA 2VNKA 2VF8A 3E70C 4UVDA 3A1VA 3QPWA 1EP9A 3TKYA 2XZOA 3AJRA 2A2ZA 4M1QA 2QYSA 4MKZA 4RELA 1E4YA 2IYFA 2BHTA 2E37A 3G5TA 4UM9D 2X5XA 1OFVA 2B9VA 2OAQ1 2Y9MB 4QDTA 4COOA 4K81B 9GPBA 1NSFA 1ZUNA 3X1DA 3HSKA 3W78A 4G5HA 1AV7A 5CLHA 4KFSA 1GKKA 4EHNA 5J2TB 1FNCA 3IQIX 4G1BA 3G3EA 4Q03A 1QKJA 2W2KB 2A5FA 3LDAA 4B40A 5M34A 1Q0HA 1Y80A 1I4EB 2CYCA 1CCWA 1G8HA 4R7ZA 521PA 1QO0A 2I3ZA 1MO5A 1O89A 5LKAA 2Y1WA 4ER6A 1P2TA 5B2ZA 5GPBA 5EJ7A 1A4XA 3BS4A 2LNDA 3I5MA 4IX9A 3HPRA 5EUBA 2P75A 4OOFA 2RE8A 1M34B 2GO1A 4N9WA 3DEJA 3FTQA 3PD7A 1TJPB 2AF4C 4IJVA 1U3WA 3FCCA 3KWJA 3P9PA 2UU9B 5FPYA 3DW3X 1PK9A 2WF7A 4AKEA 2MWMA 1O9GA 4B3HA 3HY3A 2NU8A 4CKCA 3TZBA 4Z4GA 3GT7A 4CLEA 2QRPA 4DJTA 4YCCA 1GZ3A 1UAYA 1I7LA 1RS0A 4FGLA 4K6CA 1KZ7B 3OOSA 4DCPA 3BMCB 2HHCA 5I4KA 3IE2A 3PQ5A 1Q16A 3NTUA 1U0TA 2FZ4A 4EQ6A 4CZ2A 2QXUA 4HNQA 2FE1A 1U7TA 3GRFA 1X87A 2OV4A 1OX5A 4LJKA 5ECWA 3AWDA 4TMXA 4IDGA 1HNNA 5LP6A 2QPLA 4NHOA 3OEED 1CZKA 3RSGA 5K3FB 2XV1A 2VLIA 1Z5WA 1I0IA 1MX5A 2W22A 3CX7A 3Q72A 2JATA 4HYQA 4QASA 2D62A 4TX1A 1H2AS 1IIRA 2IVZA 2M32A 3R5JA 2BFCA 2VJPA 4RENA 3ZLBA 4HXFB 2HH9A 4RLQA 4PX3A 3ZQJA 5CHEA 5C32A 5JAHA 1DQNA 4O4HF 5EPEA 3K70B 2HU7A 3DHEA 2XKJE 5KTOA 1YQ9A 3MTAA 3QWFA 1KVSA 3L0PA 4QATA 3AR8A 1Y9JA 4N9QA 3RE1A 3IHKA 3QVLA 4XGKA 4X1YB 3VR5H 3ZE6A 5E6UB 3T7EA 4AZVA 3DEHA 2VQDA 2R8YA 3DZGA 2JL1A 2F3SA 4LHXA 4H31A 2EHJA 4O6VA 3K7EA 2R8PA 4FD3A 3WFIA 4GP7A 4CV1A 2WTNA 1CNMA 4L5IA 3G23A 1SBNE 5KNDA 1D2MA 3A9TA 5I7FA 4DA9A 4KWHA 1UBEA 1GCOA 1VKZA 2B8WA 4M0FA 4N3NA 4WKBA 4N0EA 4JJIA 3BJEA 1GTG1 2VBFA 2AEFA 2DBRA 2YOFA 4TGLA 4EQZA 1MC1A 1BDIA 2WJ4A 2CMKA 2X7JA 1DINA 4YRKA 2AMYA 3IEKA 4DKXA 1YHZA 3B2NA 3MWFA 4F2HA 4TWBA 3JALA 4DFDA 3OQVA 1VXOA 4WZAA 4JVSB 1MV8A 3HWSA 3NOXA 1KYTA 3L0BA 5AR1A 1ANKA 1TO2E 1X9GA 1DBRA 4UUNA 5K6AC 3MIIA 1T2DA 3FVWA 4RJLA 5G53C 5JS7A 2FVYA 4HUJA 4ESEA 2O1XA 4IGFA 5KNCA 3KQOA 4U7TB 2GXSA 3P97A 1EWTA 1Y6JA 3DNFA 3PSHA 2PT5A 2M6LA 5J2UB 2IIPA 1TJYA 3SZUA 1FJGB 3H2IA 1SVUA 3R44A 3OWOA 4FB4A 5DBIA 3ZW7A 2ZR9A 3PFCA 8ABPA 2YVQA 3CZ5A 4DCTA 1FUYB 1XLWA 1LC3A 1WO8A 2B7CA 1XSEA 1FNBA 1ZG3A 3KFXA 4MDFA 3D8NA 1IL0A 3L07A 2BV3A 3L7NA 4WESA 3DXZA 4URYR 5SY9A 5C18A 4KQ1A 1K2WA 1Z68A 2BCJQ 3DMTC 2DHCA 3JVIA 3HNRA 3IIEA 5LQCA 1YZUA 3SYRA 4EUNA 4RY0A 1Y8CA 4Y1GA 1ONSA 4RIGA 3SAJA 4CKZA 4P80A 4QFDA 1P62B 4KQFA 1J0EA 2WZDA 3CQ9A 1RYHA 3UMMA 1QYIA 1SC4A 3DMDA 4MPDA 2CL0X 4F91B 1LWNA 1GA6A 4WK6A 2OXRA 3WK5A 3I8OA 4KYVA 1JG1A 1VG9B 4WK0B 1JU3A 4LX0A 1W5AA 2TYSB 1K27A 4P3NA 1NMXA 4QPPA 1ZD9A 2ONKA 3EC2A 5D86A 2CN1A 3ZU3A 2ISQA 5AICA 4YV0A 2LE0A 1KZ9A 4Y0AA 3R6GA 4JUBA 5GJVC 4PLYA 1YZGA 5PNTA 2CZQA 1FYDA 3BAFA 4Q15A 3SK0A 4B3BA 4YCNA 3GFVA 1RWXA 1E5VA 1Q3KA 1Y3FE 2IFTA 3GCWA 4K1XA 4LE1A 1U7XA 5JSZB 2HR1A 1LSSA 1O97C 3IE0A 2NUAB 2GNAA 1NV8A 2ABWA 3I6MA 1WNFA 2IU3A 3USES 5JARA 1OZ0A 4XQGA 3WYDA 4WH0A 1D07A 3L1IA 4K9SA 3EIQA 2FSUA 1N2JA 1G21E 2FNAA 3NOOA 1NOJA 4CVNA 1DEKA 1GKLA 4BZXA 2BELA 3NBZC 5HS6A 2EBHX 4YAEA 1EFDN 3KUCA 1T0HB 2IU4A 2B25A 1CY6A 2AIRA 4MUGA 4OBWA 3UB3A 3M4XA 2C7PA 3QVVA 3JD1A 2I9KA 1JSZA 1ZITA 5HPYB 4FKZA 2C98A 3C5CA 3WZLA 3THOA 3CZRA 3QXHA 3D7RA 3NC0C 1W4RA 1DGQA 4DNPA 4G36A 4QDOA 3VR3A 3DC2A 4HDCA 1VDZA 4Y2PA 3KPUA 1ZN8A 5IK2D 2EJUA 3CR7A 3IBFA 4ARSA 3HXLA 3KTDA 3MUOA 4EVQA 3AEUB 1SIWA 1X77A 1TD1A 3LVFO 3TFQA 4AMVA 1XZ8A 1L6IA 4IIUA 5IVHA 4GPAA 3RFTA 1DU4A 4QL3A 1SH7A 4IINA 3V7WA 3FNRA 3NHJA 2MSWA 4Z5XA 3P9KA 2BMWA 3C3BA 1CUUA 1YZKA 5GP1A 2WSBA 3MW8A 3I73A 4DDUA 1NG9A 1DKNA 1L3CA 4HWPA 3VU1A 5AYVA 3TKAA 4MRAA 4NE7A 2X4GA 1RU3A 3OQIB 4GMDA 2DHEA 4XCXA 3HB5X 4TKUA 2PR2A 3TLYA 3UWSA 5A4IS 3A1DA 2VJYA 2B2XA 3MG9A 5IFLA 3AFOA 1CQJA 2H65A 3FUCA 2LV8A 3BK1A 2FP4B 2CL6X 4TTJA 4BRUA 4DR7B 1STOA 3PPYA 3LZDA 2XNKA 1M2GA 2F3UA 4UCXA 1YQWA 2QL7A 5AVJA 1K6IA 1CUIA 2BRUA 2NNLD 4X8OA 4HZUB 4EA8A 4A8JB 1A1VA 2B1RA 4P4SA 3OCWA 3QU7A 2G7MC 3PSAA 4I5FA 2GEVA 3ZUGA 1G2IA 5IKOA 4AZSA 2X22A 2R6HA 2I3BA 1Y9EA 3PGXA 2GKOA 1KZHA 3TUIC 5LM3A 3GDOA 1PV4A 2BGGA 3K6JA 2XZLA 2F3RA 2PZ8A 3P2KA 5GQSA 1KR2A 3N8HA 2G4LA 4RTQA 2X76A 2YCBA 2C7RA 1DKRA 1T5OA 1WHSB 4EELA 4PLPA 1GTJ1 1T4BA 3EQZA 4CF3A 2WDPA 3GGSA 3IAAA 3S6JA 3TIGA 2QPAA 4KITB 3G17A 4F0JA 1VZ2A 4Z1MD 3W5AA 3UT0A 3ZNPA 4D45A 3B20A 2EFGA 1OXTA 1ZNZA 3JAWA 1QZ3A 4EGCB 1AKWA 1M8KA 4C4XA 5EWMA 3W2GA 4BJ3A 5FUXA 2PX4A 4PHFA 1M2NA 1YNOA 2FSVC 2ZRCA 3L7JA 3ZWCA 1NVEA 4BN5A 3L4JA 1MZPA 3HCBA 1DCMA 3D4IA 4J90A 5IWCA 1EUZA 1M2EA 1Q91A 4MVJA 4LFBB 2OP0A 1ZGZA 1RKBA 2YTZA 3KL2A 3V7FA 5CG1A 1E1LA 2WP0A 3JQGB 1ZONA 3TCXB 2QZ9A 1ETUA 5T8KC 3M5WA 1DB3A 2P9YA 4XARA 2D8MA 4RPCA 3JWHA 3T5DA 4PS1A 1M75A 1E32A 2NSDA 3CRMA 3N2KA 3WGZA 4CJXA 1O2DA 1YOVB 1YZYA 2HJSA 1VMEA 2IUEA 3YASA 4AFNA 1QB8A 1ZI8A 2F43A 2NV0A 3OESA 4EG5A 4ESVA 2BFFB 2J09A 2YWXA 3T7RA 3P5SA 3GLHB 1TUEA 1MVOA 1NGSA 1G3RA 1VZ3A 3OKAA 2ZRNA 1M8GA 1PQUA 4XYEA 3VDMA 4OQZA 2XW6A 2IZ0A 3GV0A 1DG1G 1Y4DE 3H75A 3DR3A 2F3TA 4OV6B 1IY8A 5DTMA 3IQHX 5LBTA 2KYRA 1KDPA 1Q44A 2W90A 3PIDA 3OOJA 4KQJA 5ERGB 4CI9A 1RLJA 4OQ4A 1RIIA 2HMUA 4ER3A 3OHSX 1S5PA 2Y1FA 3VKFA 2DJ5A 2XGMA 4HMPA 4NMHA 4MR7B 5AM3A 3MAGA 1ECLA 4FIZA 5GONF 2IEGA 2QX4A 4NEQA 4DSUA 3UMGA 5LQAA 2ZIXB 3UJ8A 1IQUA 1H3FA 1V3TA 2X19A 2QR2A 3AETA 3H0EA 3BE8A 2C77A 1K0UA 1ZNXA 5ITZA 3K16A 4NK5A 2FFBA 4PG7A 4EARA 1EXWA 3RFVA 1JS1X 4L4UA 4M88A 4TLAA 5BSRA 3W7BA 1QX4A 4ER0A 5DNUA 3RSOA 1FCJA 4NXMB 5JZSA 1XK6A 1JSXA 3NMUF 1X1DA 1UPTA 1L7QA 3STTA 2I3GA 1YCHA 3M5DA 1QOPB 2BGUA 2I55A 2PZMA 2YIVX 3AB8A 3GJTA 2OYSA 3MCTA 2L19A 3NBMA 3OZSA 4PVDA 4TLEA 5F1PA 3T94A 3IELA 1JQJC 3KJQA 2CW5A 3QMWA 3C45A 4IO1A 4QBTA 4F2PA 4XFJA 1E9DA 2JVIA 2AW3A 2VDOB 3RBXA 1OXVA 4LOIA 2YIDA 5CYPA 2RHBA 2VEDA 5DBOA 5G0SA 5IJXA 4BQFA 1IZZA 4WOKA 3MMXA 4EUEA 1U2DA 3BHJA 1NT2A 3H11B 4E4RA 2BE9A 5AVTA 4MJ7A 2PCJA 2DKOA 4KQIA 3UMRA 1AKUA 4J6EA 2PRKA 4ROTA 4I0WB 5JPIA 1QAMA 2J3KA 4RGYA 2YZGA 1P1IA 1X14A 4BYMA 2EJTA 4TV9A 1UDRA 5DRTA 4L2IA 1MKYA 4AY3A 4ZODA 4DF3A 4FDTA 2A9OA 4XQCA 4EPTA 2AYXA 5JSUA 3GFTA 1YQXA 1WKBA 3Q9UA 4XGIA 2VT7A 5JCJA 3IQDB 4R1MA 3WFJA 1OCEA 3RSFA 4DA4A 3E9CA 5BRJA 3K09A 2MSKA 1R9NA 4C7VA 4LXHA 2YN4A 5KSWB 1ZSVA 1E1QD 4MW5A 1ZEJA 1KFEB 2N3ZA 2P6RA 4GI2A 3DCJA 3H87A 3MEQA 1EEXB 2RHWA 3DMPA 5BWMA 4NY1A 3JYPA 1A4IA 5CVVA 1P5RA 4NE9A 2HD4A 1FBNA 2QP3A 3A1TA 2R84A 3CIOA 1NRXA 3I42A 5EZYA 1KRWA 1V1MB 1QYWA 1UKEA 3SR4A 3B85A 4DA6A 1AURA 2OCDA 2RKOA 4LV5B 1CUHA 1EFRD 1GFZA 1QOQB 1SY7A 2H1HA 2QAGB 2Y4OA 2YNMA 3C15C 2B34A 3DB1A 3HN2A 3HU3A 3C3CA 3Q3HA 5BWBA 2P9GA 1DC8A 3D8BA 2OBXA 1UPUA 3ZEAA 2I6QA 1YT5A 2BHRA 1YQTA 3AYZB 3PUXA 4DUGD 1TKBA 2EFDB 2MYUA 4HUTA 3V34A 2FHPA 5ELMA 3BIFA 3PXEA 3B38A 3VR6A 1Z5PA 4KSCA 1OR8A 2UDPA 4MVJI 4RK1A 2WSSD 1WZEA 4FZ5A 1NVUQ 3QG1A 1BWPA 3FHLA 5BR1A 2X2PA 1DXOA 2VZEA 3I9NA 1UR5A 2DHRA 4BJ6A 4F86A 1DAGA 1QMPA 4UJ3A 3V1LA 3FR8A 2DY1A 3IT2A 2XZTA 4RVDA 1TM7E 2GEFA 3ESZA 1KF0A 3KDAA 4PQFA 3AU8A 4W8OA 1MX3A 1G9XA 1UKAA 3F8WA 4I1YA 4IZIA 5DNWA 1YMVA 3DEZA 4L9SA 1DWPA 1SD2A 4JLNA 1NN0A 4MKHA 4GR4A 4UNNA 3NJ4A 1MVNA 2PX2A 2VCHA 4B81A 4BNXA 2XB4A 3Q8KA 1V4VA 2H5IA 2BKLA 4GYJA 4C3ZA 1EHCA 2A5GA 2HUNA 3FWYA 4RSGA 1XNJA 3L0OA 1YVRA 2ZRIA 3LK7A 3RUCA 5J2TA 5KU1A 2FHSA 2W2KA 3W79A 3SHFA 3KJNA 4YAUA 3D4LA 1X7WB 4ZQGA 4CM1A 1TD9A 4NQZA 3ABOB 5AXDA 4B6OA 3BL5A 3ECSA 2UUBB 4TL7A 3IILA 4BRWA 3DYVA 5DFAA 1R0LA 4QYSA 3RK1A 1Z6PA 1M34A 2KLHA 2OBBA 2WV9A 4JNCA 5FL3A 2YWHA 1PO7A 3HCDA 4RHUA 1RQNA 2HA5A 4C78A 1E3LA 4DNFA 4QUDA 1UXJA 2BH9A 4REOA 2PT6A 2ZXUA 5DKFA 4IWNA 3ACCA 3BFJA 1YJXA 2H4FA 4WN3A 2PX8A 1VSUA 1E59A 1MGOA 3LF2A 1UOOA 4RTNA 4NDZA 1PAUA 4Z4IA 3NIFB 3BMCA 4B6JA 1IQRA 1Z07A 5JBIA 4RKRA 2B1GA 1YOBA 2OBNA 2IPXA 4MITA 3FHJA 4M0MA 4OFZA 1JI3A 4A16A 4TSRA 2H9IA 1IU9A 2NYUA 1JXMA 4N7MA 2VPYA 3GUHA 3SGLA 3WWDA 1UCFA 3UJ7A 2XODA 5K3FA 2AG0A 3O31A 8ATCA 1C8VB 3I30X 4QTZA 4L78A 3CZQA 1R00A 1G17A 2OUKA 2OCAA 1J0CA 2W2XA 3HEAA 4L8VA 3TGWA 4C87A 2QTTA 4JT2A 2QRUA 5TX7A 1NNEA 3L8YA 4DWOA 4ZYWA 1EI9A 2CLFB 3QJYA 2IOFK 4FEGA 3LOUA 3UCEA 1YXMA 3P2EA 3QVJA 2B4AA 2BCEA 2IHVA 4X1YA 5FA8A 3L0YA 4G5FA 3H7IA 1W8IA 5E6UA 1TVMA 2XSZD 4BRZA 3RK4A 1CBUA 3GT4A 2EATA 3H5AA 2E4VA 2P0YA 1EVZA 1ZWKA 1SUPA 2WHYA 5AKXA 2AZTA 1SUDA 1JFFA 1LS6A 5I9BA 3SZOA 3A4TA 4CKYA 5JXGA 3SZLA 3FOEC 3K1JA 1Z6ZA 3FNFA 1SKQA 3G9QA 5EJ6A 4OX9Y 3CZ4A 2WR8A 4KJZA 5BT9A 3E3OA 2VQ3A 1REQB 2D5LA 1J6UA 1YL5A 2ZWVA 3QMMA 4RZXA 5FUVA 3GW8A 2PRJA 3OZVA 4XGRA 4YDSA 3VVCA 3ZCXA 1IM5A 3UJDA 1X3LA 1ZZGA 2KQUA 3ENVA 4H6WA 3LX6A 3P0JA 4WLEA 5ECYA 4M99A 4GBGA 2OG1A 4OGGA 1NDQA 3S2EA 1PZGA 3Q9LA 1LNQA 4IH9A 1XWWA 4FKMA 1E7QA 2FUG6 4FR2A 1FQOA 1Y1SA 2A94A 5DOZA 4I1VA 3IC5A 1K7EB 1Z33A 2G5CA 3DQZA 5DI3A 4TMZA 4RK4A 3MCUA 3TLMA 4V03A 3F2IA 1EJ0A 2P0AA 4JMLA 2VA8A 4EB8A 4OIFA 5J2UA 1Y4ZA 2O52A 2RC6A 4D9FA 2HCRA 3VC2A 1U2TA 5AHXA 3WMGA 1L7BA 2GESA 4C6SA 2GUGA 5TNXA 2Q6TA 4GW3A 4P86A 1PJ2A 3UOWA 2F00A 2AXEA 2PLWA 1ZNWA 1NVTA 1YK1A 1J42A 2BIFA 4RF4A 4A10A 1UBLS 1UKYA 4Y8VA 5JSQA 3WGTA 1HC7A 3GFSA 2MU1A 4WXRA 4XWYA 3E15A 2OFPA 3A6DA 4GI1A 4A2QA 2H48A 2R8OA 3RVKA 3DAOA 3O2QB 4HDOB 4IOKA 2LP4Y 4CI0B 1JPUA 4HQFA 4JITA 4OGWA 2HEGA 4Y30A 4UAJA 4Q5IA 1EUYA 4GOKA 1G8SA 2HA3A 3I58A 1XZGA 1YTLA 3L1VA 4RSHA 4WOPA 1QQTA 3II6X 5TPZA 1NJ2A 3B1ZA 3FUXA 1BNCA 3JQFA 3ZY3A 2XB2A 1ZLXA 1K3FA 3ZTTA 2C5LA 4MA4A 2ASVA 2ZSEA 2AZMA 2CDNA 2ZJAA 1QRRA 3H42B 1ONOA 2IBSA 1EZZA 1FMTA 2JJ1A 4N8SA 1IJBA 3INRA 3OWHA 1W44A 5CCXA 4FMPA 5CDYA 1M6HA 1UDCA 3IP6A 3RJTA 2GBCA 4Z1OA 3J81k 4JQCA 5LU8A 2F48A 5LD2C 2C4VA 2RARA 2P2LA 4B43A 1G59A 3Q3VA 2C4TA 1Q5PA 1XZAA 2PV7A 1ISFA 2PX6A 3RYIB 1U7WA 2OO3A 3HABA 3FPGA 4WCVA 3ZHVA 5K0BA 4LGVA 4LQDA 5JSZA 3FOFC 4PAGA 1P4RA 2Q3EA 4MW7A 3FWPA 4RD3A 3LY9A 4EPYA 4KH0A 2ZUBA 3AKZA 1NVXQ 2QTWB 1ZL2A 5BN4A 3R6WA 2YFYA 2QTAA 1F8GA 1SKMA 1RW4A 2P3SA 1I7NA 1C9DB 2XBLA 1B6SA 1QFZA 1SWWA 2PUWA 1W1WA 3NZEA 4FGJA 4PGHA 4BGVA 5T4FA 3B7GA 2JIZD 3R0JA 1O08A 3SBDA 1T9GS 2POQX 5CP8A 1U0HC 3LM8A 4H16A 4B6EA 3MT8A 4N6NA 5CH5A 2J6IA 1TK2A 4EABA 4CIBA 3FVQA 4WXHA 2XDAA 3BJZA 3CT4A 4WFJA 3MELA 5DHFA 5CCDA 2WC1A 4DIDA 2IDKA 5E1OA 2FSGA 4WN9B 3ZCRA 4Q3AA 1GP2A 3IE1A 1GZSA 5TT1A 3SYKA 1CETA 2WKRA 4A27A 4HNTA 2B92A 1E79A 2DBZA 2MYPA 2OCYC 1SBQA 2V7GA 5EE5B 4CU2A 1YR6A 4GLBA 4CWAA 3AEUA 4TYYA 3IBYA 2HLNA 1FTGA 1D09A 2BI7A 2X0FA 5DWVA 2OFWA 3E61A 3LC7O 1P8JA 2Y0DA 2EC5A 2UKDA 1V16B 3Q7SA 2RJOA 4Z9AA 5L40A 3PP8A 3C5EA 3E9EA 3VYUB 1Q11A 3PI6A 4JXJA 1G5FA 4C6HA 2H5LA 3HY6A 1ENYA 4RDHA 3VH4A 1WIWA 2OGTA 3OQIA 5ALDA 2WTXA 5I7RA 1X94A 1FTNA 1TO6A 3UHOA 2G8NA 4TTPA 3ADPA 2WFMA 2V5VA 4EG3A 2CNOA 3R8CA 4YRCA 1LPBB 3OCJA 3RT1A 1QGOA 3QA9A 3OZDA 3BH7A 3WSWA 2FP4A 1IEXA 2XVXA 1Z6YA 4ILKA 5HK8A 1G0NA 1RKUA 3EDMA 2ERYA 3RH0A 1F6WA 3V7UA 1E3MA 3VKHA 2P8JA 2W6QA 4CU5A 1L5WA 1X8LA 2IITA 1JKFA 3AT1A 5EPUA 3Q1KA 2V9CA 4MXDA 2R97A 5B6JA 4A8JA 4XWAA 3F73A 4ZDKA 5FAXA 2V6IA 1XEAA 1XZLA 2C4MA 1W9HA 4UDNA 3U48A 1OWOA 5K03A 1U1CA 4G2TA 4ZEWA 4B74A 5EJ9A 5T7BA 4ITRC 3BCRA 4DV0B 5K8CA 2XTAA 3F3YA 1YRLA 1J9EA 3ETJA 1WHSA 9MHTA 3HVKA 3AKDA 4H9GA 2VWPA 4K05A 4PYRA 4UUBA 3ISTA 4LKOA 4PNPA 4IO0A 3JR3A 5CDGA 1ID8A 3JCZA 2NYRA 3DWEX 3RJZA 1VJCA 2NSLA 5H68A 5IT0A 1ZIYA 3OZAA 2P2ZA 5BR8B 3EGEA 5AM0A 2C4KA 1DDOA 4IF6A 3P9SA 3GVCA 1QIJA 3VUEA 2MSLA 1JDBB 2Q3CA 3IIJA 3SU8A 4G8JA 1T0UA 1V5IA 1IEVA 1X8XA 2HK9A 4IHAA 4NATA 3WR5A 3NHUA 2I2AA 1JDJA 1Z4LA 4LDJA 4DCCA 5JMTA 4X62B 1RJDA 1GL3A 4WASA 4QPCA 2A5LA 1RYMA 1WXGA 5EUMA 3QYFA 1RXIA 1NRJB 3JYHA 4RD2A 3R7FA 4TKMA 3TO5A 4CM8B 1KJIA 3JQGA 3KQLA 1Y8QB 1K68A 1W5EA 2H4JA 3DDHA 3IVCA 2A58A 3TSZA 5CFZA 1Z5ZA 2YWBA 1LF0A 5AKKA 1XRSB 2H2GA 1IWOA 2SKEA 4D8VA 4RV4A 3OPQA 3DL0A 2QTNA 4KMSA 1ZVVA 1CIJA 3LHFA 4GWGA 4ACBA 5K45A 2VHYA 1LDGA 4YI5A 1ZNYA 3X2SA 4L27A 2NT4A 4W9NA 2HA7A 4WD3A 5AVZA 5K8IA 1BROA 1NUQA 1ODLA 4V3BA 2AH5A 5JXIA 2XZPA 1K8YB 2BFFA 3GLHA 3E35A 3IALA 1HLDA 5NULA 3N3BC 3O1IC 3WK4A 1L5KA 5I7HA 1N0UA 1R5OA 2YS7A 1TXGA 1W48A 3EVFA 5AJTA 1H9CA 1Z8DA 4LNAA 2VO1A 1BMFD 4KQ9A 4JYMA 3U44B 2C9CA 5GVRA 4MR7A 4JQZA 4OH1A 1M5RA 2BDUA 4P54A 4E88A 2ZIXA 3ILVA 1QIHA 3KEOA 3U7HB 2F1RA 2DKNA 4OVKA 1JSLA 1KH2A 1Z4IA 1HFWA 4RH3A 3ZOZA 1LZKA 2FW0A 2WU8A 4FR0A 4LXXA 5JEEA 2AX3A 4MOWA 4XDZA 3M3DA 3IJ5A 1E2QA 1OD6A 1PLLA 3Q6IA 3TINA 3ASZA 2GS9A 1NASA 4WLFA 1VRVA 1N5RA 1BMQA 2LKDA 3C1TA 2RCNA 3SFVA 3UWMA 3FNQA 2FEXA 2IELA 2QP9X 2D06A 1FQKA 4MYRA 3MOSA 4BTEA 3PNKA 3HHPA 3WNCA 3KLBA 5DJ5A 5E7QA 4HY3A 2J9RA 3G59A 1LH0A 4KEAA 3SC2B 3QVGB 3RANA 2YMQA 5GIPE 3NO4A 2B35A 3H9CA 4KXVA 4Q1EA 4URWR 5E6RB 1IWBB 4ESHA 2XWQA 2O07A 1GPNA 4P58A 4DCNA 1SOWA 2FZGA 3H11A 5D3KA 1T6XA 2PNFA 3EB9A 4WLOA 3OE7A 5BQPA 4YRMA 4OGFA 2G4CA 1OU4A 4ZQCB 1DKPA 2CHFA 5KTKA 5KKAA 2J46A 3EA4A 5A9SB 4JYCA 1M73E 1QV6A 3VTFA 2V4UA 4BNJA 2R66A 3LUHA 4N1AA 1A4RA 1YA4A 1V41E 5J63A 1KP2A 4D82A 5D3MB 5LJLA 3K9LA 1WMAA 1HQDA 3I2GA 1MOZA 3MZ0A 3CPHA 4ZOCA 2O2EA 3ROZA 1A2QA 5J9FA 2PWZA 1P7VA 3DL4A 2YJ6A 2P7HA 4GG1A 5DLYA 4Z53A 3LRTA 2O54A 5IJAA 3GIDA 1B73A 3EWIA 4Y1EA 1EQAA 3SYTA 4JI5B 2P79A 2R62A 2YBEA 3F1KA 4G37A 5IU6A 4RD0A 2ZIWB 2QN1A 2XRYA 4U2BA 3VZDA 4IXNA 4XQEA 1P6XA 1T9DA 2AS0A 2DFTA 3CFYA 1D0IA 4JA0A 5DGHA 4FYYA 1KOGA 4WCFA 3ELWA 3AFIA 3VDNB 2WUGA 4RK0A 3K9NA 4KR7A 4R7TA 3BBPA 2G80A 2R3SA 1GKYA 2BM9A 5D6NA 4UPEA 2QLLA 3F96A 4KN6A 1R6VA 1E1RD 2I1LA 2HTEA 3PXDA 5JMWA 1TLLA 3PTAA 2BGLA 2IYRA 4DMUB 2JASA 2QW1A 5BV8A 2GM5A 1PZFA 2X8AA 3WNVA 4BO5A 2VSOA 1VDMA 3IMFA 2H85A 2GYUA 5B1YA 4WLVA 3WNZA 1HEIA 1DCTA 4KGDA 3BHIA 5IBQA 2FN4A 2XH8A 1G7CA 3FHCB 3B9RA 1NKTA 2A67A 4IDAA 4J2HA 4DUGA 1MU0A 2ZAIA 4E5SA 3AB3A 3ULKA 1MX1A 3EG9B 2XQVA 2CEAA 1INLA 4RJTA 3LHDA 3MRTA 2WUFA 4XOIA 3CX6A 3SQLA 3H4TA 2Q0QA 3ETGA 3WISA 1R8SA 2X1MA 2BJHA 2GN8A 1C9YA 1FU4A 3UNXA 1FP4B 1XZEA 3LFHA 3T0IA 3IUBA 3UWDA 4JLJA 4WE3A 1GDHA 4O2AB 1XTRA 3PR2B 2AOUB 1WTCA 3K70C 1ZCAA 2QI9F 4MVXA 3U81A 1QRSA 1PNOA 4ZYTA 1RYYA 2JCXA 4FJ2A 1XDUA 5H1YA 3WDSA 1FDIA 1KBOA 1NMQA 1Q0LA 2FZWA 4IH4A 3KOXA 1OHHD 2LVBA 1UK7A 1NQTA 1T3ZA 1XTIA 3P94A 4U7WA 4I08A 2P27A 2WTAA 3O2JA 5TF4A 2PRZA 2VBIA 1WB5A 1X7WA 4EA9A 2XYPA 3I04M 4B85A 2FOXA 3KVNA 3EHEA 2J1LA 3QLUA 4F46A 3CKMA 3B6EA 3MTEA 3T9DA 5KWSA 2E21A 3VJLA 5LWHA 4X1IA 5IHPA 3AP3A 2BFDB 2GEBA 3QJGA 4RORA 1VSTA 3QUTA 5I7EA 1DLIA 4OPMA 4JQSA 3CKYA 1XCJA 4JY7A 1AS2A 2PZAA 3FZYA 1Q15A 2IP4A 4EYGA 3HSYA 3OIGA 5K3OA 4M9RA 2W42A 4HAVA 2VH1A 1D8TA 1Z2NX 1C7ZA 3JYOA 4CF6A 1CRPA 1R6TA 3DZIA 4YPVA 2OK8A 2P4EA 3CURA 1AK9A 3JQDA 3KKNA 5F78A 3MS2A 1QK5A 4FHEA 3ILSA 5AW9A 3VR5D 3DE5X 3ENKA 3RS4A 1WP9A 3CLSD 5EQFA 1BYUA 3RT9A 4GOJA 1Y5LA 2R00A 1A2OA 3G1UA 4G0QA 5CCEA 5LMUB 4BB5A 1K5GA 2OO5C 3DM5A 5EIBD 1HETA 3L0DA 3CRW1 2VPTA 5FPPA 4YH1A 1YI1A 2Z4SA 2ZBGA 4PPFA 7MDHA 1GNPA 1ZVMA 3AMVA 2X77A 1AMOA 5M5BA 2Q9BA 1JEYB 3PUYA 3SHTA 2INGX 4K1LA 2FZLA 4KTTE 5I9MA 4NBVA 4WZAE 4NYMR 4M53A 2P41A 2PSFA 2ZJBA 3PFHA 1UZAA 221PA 3PPVA 1QO7A 4EK9A 1XKQA 3O4JA 3OHPA 2AE2A 1E9RA 5CLLA 1FSSA 4ALIA 5JPDA 5LZ4A 1RWVA 4MKXA 1GL7A 2GN4A 2HMTA 4U6QA 1YJ5A 3G0BA 2LDXA 2AVDA 1VSVA 1YB6A 3V5NA 3EAGA 3C87A 3HJFA 4OHWA 3LVBA 5KOJB 3GT0A 5K8VA 3I23A 4ZEOA 1Y3IA 2ZPTX 1G4UR 5L9AA 1YVEI 1REQA 5BW6B 2Z04A 3IQZA 1QRAA 3DXXA 3D6NB 4PM4A 1U1IA 1V7PC 3SF0A 3MB8A 1T8PA 4E21A 4AZWA 1GUDA 5CM9C 4EOGA 2GTIA 3CNHA 2RBGA 2Z58A 3G8AA 2CXTA 3BULA 3TVDA 2QWXA 1UPAA 3FWKA 4MYHA 4YRRA 5KNDH 2NO7A 1YJCA 1A8QA 2VSNA 4J0CA 2FPXA 1P8AA 3VX4A 4PSDA 1SBTA 4MMXB 4F2GA 5BUCA 5JXWA 1Z15A 1QSGA 3BD6A 1PJ3A 4Y0VA 5BPHA 4DMMA 2EKBA 4KE9A 5KKNB 3PQDA 2NO6A 4FDLA 3TLKA 3H9UA 3O83A 2ECFA 4LVUA 5L7TA 1LRKA 1G6Q1 2XOEA 3MSXA 3JWPA 1RWKA 2J4DA 4OHMA 3TECE 4ZOEA 2GXQA 1PU2A 2YHUA 4Z3KA 1WD5A 3WL6A 5IM5A 1U3VA 5KO2A 1YBAA 2R44A 1MB2A 3OIVA 4M1TA 4G4SP 4HGQA 4AS2A 4EYEA 3DFKA 3E0XA 1N2OA 2BGNA 3AFMA 4OFBA 3WMRA 1NLZA 4PSCA 3FXAA 3V2IA 4D26A 1BRMA 1M7BA 3PXUA 3NDBB 2PZFA 2W37A 3PGMA 1RMQA 2R6GA 4BVLA 1ISMA 4GF5A 1A8PA 3VHRA 1ELOA 4NS4A 1VJGA 1T9BA 1ZOPA 4KWCA 1IM8A 5CJ2A 4WJKB 2JAXA 4KK4A 5DYYA 4AU1A 3RVRA 1VKHA 2FZCA 3NHAA 1B76A 4FMDB 5REQB 4CGYA 4J9UE 2AEMA 2Y27A 1I51A 2W0SA 2YVKA 4E07A 1UPXA 2XZDA 1PL6A 1XBTA 5ENZA 3BSFA 2H7VA 1QLJA 2ORVA 3IKVA 3KKPA 5KWVA 3M9WA 4GMFA 5G0UA 1UDXA 2B8NA 1OF1A 3WRYA 5IM4F 3I0ZA 3ILXA 3A9RA 3USCS 1SXJD 3LPLA 1HXHA 3U49A 3S1LA 2R6CA 3I28A 4A0QA 3OUTA 4WNAB 3SYNA 3RYIA 1JG6A 5LZ5A 2XLBA 1OLSB 1NP3A 3R3YA 3FSJX 5GZ6A 3X0DA 3ZU5A 3RQIA 3IDZA 1HE8B 3LU1A 1I5OA 4TL8A 4LYFA 1CWUA 3FSGA 3LUPA 1NAIA 1RDFA 4BFYA 2OM2A 3WHIA 4CQNA 5KYKA 3EZLA 4NU8X 1GQSA 3N07A 4V2IA 3SYLA 2V5AA 1B3BA 1NE7A 4FFPA 5MN6A 3RPEA 1J1UA 5IBCA 3BHMA 3QVOA 4XA8A 4IICA 4BATA 1I3NA 2ZSIA 1EX6A 3COYA 4I1SA 1L7AA 4YBRA 1VE9A 3D1LA 4G23A 1ZJYA 1BVUA 1M1YB 1JVBA 2EOAA 4Q4HA 1E1MA 3NM5A 4OYHA 1TQ6A 4YP7A 5DLEA 1ADJA 1I36A 1OGIA 1ZIPA 1N2BA 3AR2A 1I8TA 4DLTA 3CF6R 1QVZA 4JN6B 4WN9A 1E3EA 4WV3A 4JJFA 1K7CA 5CLGA 4BV2A 3BCUA 4OLHA 5DU2A 1OJ7A 5AW8A 3KKLA 5JS1A 1L4NA 3MOIA 1CS4C 3HUEA 3K6RA 3L5KA 3VTAA 4Y2XA 2EQAA 4D3DA 3AWIA 1YKFA 4X64B 3NHLA 3K0CC 4ND5A 1DLJA 1WUTA 4KXLA 3DAHA 5DIFA 2DR0A 2JFHA 2W00A 3OT1B 3CSUA 5HBGA 2AN1A 4ZFNA 1V16A 1C3OB 2FWJA 4YWJA 1ZUIA 4J0QA 5DN9A 1KS9A 3JRXA 3LDGA 3TEMA 2J3JA 4OXIA 1GUBA 4GSLA 4MYCA 1Y37A 2PFGA 3DA8A 1P5ZB 1PQWA 4IH1A 2BEUB 1BE8A 4J3FA 3EXFB 4IFTA 4QQKA 1SC3A 4XVHA 121PA 3DSRA 4ND1A 5K1ZA 4BUJA 3SJAA 1I4OA 4HDNA 4CMIB 2AOTB 3GEHA 2YYAA 4XIYA 3C7TA 1J56A 3JXEA 3OFNA 5HX7A 1SVLA 3NP9A 4A6PA 3M9LA 3IUPA 2C4WA 3KWLA 5I7SA 3UUEA 4D9IA 4PSUA 2HFJA 3WQQA 2NACA 4F04A 1B16A 1FRNA 1WULS 4UXIA 3RVLA 1XZNA 3FBTA 4AO6A 3GT3A 1O0CA 1DZIA 4QYMA 3SQDA 3U5ZB 1EE9A 5EZ5A 3RUAA 1DBQA 3BAZA 4JR1A 4YJ2F 2ONJA 3JPYA 3L6CA 4IZHA 3VHQA 1F60A 4URFA 4ARZA 2VSFA 1O6ZA 2R8BA 1ULSA 2QY6A 2XWSA 5JO9A 3AY6A 2COUA 1C2TA 1JXAA 2HLHA 5ALUA 3W5B