3G9ZA

Crystal structure of este5, was soaked by p-nitrophenyl caprylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
b'MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9zA00
4B80A 1MAAA 5EI5A 2PSDA 4D9JA 4EA6A 4YK7A 3WWDA 2OCLA 4H7KA 3BIWA 3O4GA 4MWSA 4HXGA 2DCMA 1QIGA 4Y2QA 1E8NA 2RGUA 3PF8A 2BJHA 5SYMA 5T4HA 2XUQA 4PF1A 4XJVA 2ONCA 2Y2UA 2ORYA 3BXPA 3A2MA 5AK6A 2JGFA 5E2IA 3QVMA 4H7IA 2OLEA 3R41A 3CCBA 3OC0A 4X90A 5CH5A 4B7ZA 4CCWA 3OTQA 4A5SA 2XUIA 4OD0A 4X85A 2HA0A 4P93A 5AKXA 2O7RA 1UZAA 3DLTA 4H7FA 1HPLA 4M0EA 1OILA 1ZD2P 6YASA 3FSGD 1QIEA 4A23A 1R50A 3N0TA 1ACLA 2HM7A 4LKOA 5CH8A 3EF3A 2PU7A 1J2EA 1MAHA 3G7NA 1B6GA 4AO7A 4QA9A 1CEXA 4LYDA 3G9XA 5EFZA 2D5LA 5EHXA 1PFQA 3CXUA 3X3HA 4J7AA 1CUVA 4BRZA 5D3ZA 2D0DA 1EHYA 1EI9A 4BP9A 5DWDA 1JJFA 3OM8A 1N8SA 1BE0A 3R3WA 2GBCA 1O6FA 4JUIA 5CMLA 5IVHA 4CCYB 4ROTA 2ZSIA 4ZREA 3STXA 1Q0RA 4C4YA 5FXMA 2C0QA 5ALNA 2VJAA 2BGNA 5HKBA 1FFAA 3WK4A 1FJ2A 1QTIA 1ZOIA 2XUHA 2IX9A 1E5TA 4Y2PA 2ZYIA 1VJ5A 1ZJ5A 1H2ZA 4H0CA 5JADA 4KJXA 3WL7A 3RLIA 3ANSA 1DTEA 3D0KA 2GBIA 4C89A 1F6WA 1XZJA 1AZWA 1N1MA 1UKAA 5K3EA 3C8HA 3H18A 2ACKA 2WIJA 2JGKA 4GECA 4UBLA 3AZOA 1XROA 2RONA 2JEZA 5AM2A 3DCNA 3FCXA 5K3BA 1BRTA 3PFCA 2VJDA 4M0FA 4PQEA 4X95A 4Q1VA 3I28A 4MYDA 4BE4A 1MN6A 4E14A 2YYSA 1XQXA 1GPNA 2HU7A 1R1DA 2DR0A 3FYTA 2XQFA 4KE6A 3HJUA 1NX9A 5CT4A 1CUUA 5EGNA 2ZSHA 2E3JA 2HA2A 1O6GA 5HQ3B 2XQJA 1MU0A 3KXPA 1XQYA 4W63A 1H23A 2HRRA 4W1RA 1ZIXA 3B5EA 3V1MA 1LZLA 2Z8ZA 3DYVA 1IZ7A 5T4BA 3I6YA 2DHEA 1XZBA 2WUGA 4LXHA 1HL7A 1A88A 3DOIA 4X6XA 1H2YA 4BDTA 2V98A 5EIAA 4RE6A 1MJ5A 1ACJA 2GYWA 3MUOA 2WLSA 4KAJA 1YB6A 2RIPA 3ZLUA 3BIXA 3AINA 5ALIA 3R3XA 2B4KA 1EK1A 2VT7A 1XZEA 2H7CA 2HA3A 2IIVA 3F98A 4QDTA 3V9AA 2CB9A 3E4DA 1MNQA 4KYVA 5HQ3A 5JD5A 4BAGA 2XMRA 4GLBA 4DNFA 2B9VA 1X2BA 1UT6A 3AILA 4DM7A 5FLKA 2K2QB 2HA6A 1CRLA 3ANTA 4W9RA 4C87A 4X91A 1XZKA 4H7DA 4KE8A 4BTVA 3FBWA 2ZYHA 3I6MA 1FSSA 2DHCA 4GDMA 1CPYA 4Y2JA 2R11A 4PW0A 2XMQA 5AK5A 4X97A 2VAVA 2JGIA 1QTRA 2CMFA 1TRHA 4IHAA 1ZI6A 5EHQA 1XZDA 1XZAA 1A8SA 4B0OA 1CFJA 2PUHA 3D5EA 1XZMA 2OCIA 5I9IA 4ZI5A 3ICWA 2OQIA 3FWHA 4WFIA 5ALYA 3I2GA 3STUA 1DWOA 2B61A 3FLAA 3KOOA 1P0PA 3GFFA 4AO8A 5FUMA 2B20A 3QMWA 4FBLA 4QLAA 2HFJA 4HXFB 2BUCA 5JAHA 3FYUB 2NW6A 2HL6A 3E0XA 3WK9A 3YASA 5AM3A 5ALZA 1DWQA 3H2GA 5HZGA 1AQLA 5AJHA 5EIHA 1CUSA 4G4JA 3HEAA 2XUDA 2X76A 3UMJA 5LZ7A 3CN9A 5AIBA 3D2CA 3I2IA 1Q83A 4MWTA 1DT5A 2RHWA 4JEIA 4BDSA 3G0GA 5K3FA 1Q84A 1CLEA 5AI0A 4IH1A 1UWCA 3HXKA 3VJMA 1Y37A 2O2IA 1JFRA 4N5IX 1KU6A 3C6XA 1SCQA 1MTZA 5AM1A 2WHQA 1QFMA 3C8DA 2AJDA 4PSDA 3VJKA 4FWBA 1XRNA 2VSQA 3G0CA 2VJBA 4X3CA 3LIPA 3QPCA 1JJBA 3R3YA 2G5TA 4AQDA 1UOOA 3FYUA 2CBGA 4NS4A 3IULA 5EIEA 1CUEA 5ALXA 5A6VA 3RARA 2CKMA 1WCYA 4UFOA 5JAOA 1J06A 4H7EA 3ED1A 3O0DA 3WYNA 1Q0ZA 4KACA 4J0CA 5T4EA 1YA4A 4I4CA 1ZI9A 2QR5A 4QDOA 2W6CX 3G9ZA 5FDFA 2C58A 2JGEA 3ILSA 4DNPA 1X2EA 1XRLA 5LZ4A 3DD5A 3L1IA 4ITVA 2JGLA 3EBLA 2CEKA 3EQ9A 3JW8A 1QZ3A 3LLCA 1ZI8A 1Z68A 1QIMA 4HZGA 3MVEA 1GKLA 3LP5A 1QONA 4AX4A 1ZD5A 2XMGA 3VJLA 3IUQA 1LPPA 4CG3A 5LKRA 1N5RA 3O4IA 4Y2YA 4WY8A 4FBMA 3LS2A 3I2FA 5HF6A 4BB0A 4XWGA 3C6BA 1EVQA 2ZYRA 4LHEA 1GGVA 3EQ7A 2WM2A 3I1YA 5AIAA 5FOQA 3DJYA 5A62A 1G4HA 3D7RA 1CV2A 3GA7A 3WKEA 4Q34A 1U2EA 5JD4A 1YA8A 3IB3A 4B84A 4B81A 2HRQA 3FLEA 3WIBA 1WB6A 4N5HX 3HABA 5K3AA 3NUZA 2WFLB 4NZZA 5BV7A 3STTA 5FV4A 1XQVA 1R9MA 1CUJA 1GZ7A 1ZJ4A 5ALEA 1G5FA 5DLPA 4ARAA 2GBGA 2C0PA 5AO9A 2V96A 2C7BA 1L7AA 1AMNA 5EHNA 4UBJA 3C5VA 5C81A 2BAGA 1K63A 4B85A 1A8UA 4FTWA 3IUJA 1QJ4A 2AJCA 5AI4A 1TCAA 4GEGA 1GPLA 3MUNA 1D07A 2XUJA 2QXUA 3RKSA 1SFRA 2ZJ6A 4KAAA 3I6ZA 3HI4A 4J3JA 2VEOA 4DSAA 4CI9A 1ODSA 5YASA 1B41A 2HU5A 1DQZA 2WFLA 1MT3A 1CQZA 2I78A 2Q0XA 4ZXFA 5FP0A 4WDRA 1VKHA 2GZSA 4S0XA 3QBJA 4UPDA 3RK4A 2HDWA 4F60A 5JAUA 1GPKA 5IKXA 4H7HA 3I2HA 5AKJA 3F9CA 4I19A 2WG0A 1EINA 2GYUA 4AMYA 4X6YA 4LXGA 3BF8A 3QM1A 3QPDA 4NMWA 1YB7A 3B3QA 1IUNA 4YASA 1R9NA 3L1HA 4L72A 2QS9A 2FJPA 4C4ZA 1XKTA 2OGSA 5AI9A 5JASA 1MX5A 2V9ZA 1HKHA 3C6YA 4UHEA 2PSEA 1TAHA 4IH4A 1XLUA 5LZ5A 3D59A 5DNVA 4W1QA 2RAUA 4DIUA 1WHSA 4U2DA 1CUCA 3I1IA 2XUFA 3AJAA 5AICA 2XUGA 3M3DA 3STWA 1CIJA 4N8DA 4Q3OA 1P0IA 3DYIA 2XLCA 2ES4A 4GW3A 4OPMA 3H1AA 3KSRA 2YXPX 4MQLA 1UK6A 2PKYX 2PU5A 1H22A 3STVA 4NVRA 3FLBA 4Z49A 1XZIA 5C8VA 2H9YA 1ZD4A 3FVTA 3W9UA 4LIPD 2EDAA 3OOSA 1WB5A 1VA5A 4BVKA 5IH7A 4P92A 4EY8A 5AKKA 3IUNA 4F0JA 1AKNA 4EY4A 1G66A 1LNSA 2XUOA 2O2GA 3OPMA 2I03A 4FLEA 5CXUA 4TGLA 1XFDA 4H35A 3WL6A 4EBBA 5CT8A 5ALGA 1XZHA 3CN7A 3WL5A 1HQDA 4UBOA 1DQYA 1DWPA 4B83A 1UK7A 2AJBA 2ZJ7A 3BDIA 3ESCA 3I2KA 5FPPA 5SYNA 3W04A 2WU3A 4PSUA 3M83A 2LIPA 5CBKA 1ZGBA 3HC7A 4C88A 3G02A 3O4HA 3VKFA 4UHHA 1AX9A 1W6RA 1ISPA 2I3DA 5ALUA 2VTVA 2WKWA 4DNQA 3DQZA 2HIHA 1U8EA 2G5PA 2WUEA 1QIJA 3PDCA 1CUWA 4AXBA 2ECFA 1TCBA 1UXOA 1ODCA 4BVJA 1CUGA 3DNMA 5K3DA 3IIIA 2Z5GA 3BJRA 4Q05A 3D4LA 5I8PA 3H0CA 2QM0A 3C6ZA 1MX1A 4HRYA 1GQRA 1FFCA 2OAGA 1XRMA 2XMDA 1CVLA 4L3WA 1DX6A 2WUDA 2BUAA 3BWXA 1FFEA 2J4FA 3JYHA 1EXWA 4G4GA 1W52X 3F8SA 2ROQA 3H17A 4BCCA 1YCDA 3GROA 4Y2SA 3BDVA 1LZKA 2GYVA 3ZLTA 2WTMA 2BGRA 3DKRA 3SK0A 3DOHA 5IVIA 3FAKA 1F0PA 1UOQA 1ORWA 2PL5A 5HCUA 2XQKA 1EH5A 5JZ9A 3WL8A 1W4LA 3R40A 4J0JA 5AI8A 2VAXA 3D2BA 4QDUA 3R3VA 3SX4A 3FSGA 1GT6A 1IUPA 5AP9A 4BE9A 5HF5A 2C4HA 2WHPB 3DL4A 3DS8A 1L7RA 5JANA 1CUDA 3FCYA 3IA2A 3R3ZA 4CG2A 4PV7A 4QDZA 4AB1A 3Q0TA 4UBMA 1WM1A 3I2JA 1RWQA 3LIIA 4QE3A 4TPKA 1WHTA 3PICA 4J03A 1MNAA 3D3NA 5BOVA 4X71A 1DINA 4INZA 1E66A 1EB8A 2C5FA 1LPOA 5K3FB 3W06A 5A71A 2CJPA 4E46A 5JYCA 4FFVA 2PVSA 4HAIA 5E4JA 2G4LA 4G8CA 3S2ZA 2XB6A 2XQGA 5E4TA 1DU4A 2WJ6A 4XX1A 4Y2UA 4QLOA 2WHPA 1CUZA 3F96A 3QH4A 4KRYA 1LPAB 4Y2TA 3QITA 4Q82A 4BRSA 4J0DA 4WDQA 3QYJA 5AI5A 4B82A 1VZ2A 1PJAA 2WG2A 2DQZA 5JIBA 2H7XA 1RP1A 3O95A 4X7BA 4FHZA 3WZMA 4F5ZA 2R8BA 5AOBA 4G5XA 5ALWA 5J3JA 4X00A 5D3KA 4Y9SA 4HXEB 1DX4A 1QIKA 3C45A 5JD6A 4MQMA 4GXNA 5HKAA 1VZ3A 4QWMA 4XIIA 1BS9A 2DHDA 1Y7IA 3AUKA 1BEZA 3GELA 5JZSA 5AK3A 2QKYA 2PBLA 5LIPA 4QDXA 1HDEA 1CUFA 5K5EA 1UFOA 4Y7DA 4CIBA 4K2AA 4E15A 5LYYA 5JARA 1GQSA 2XMSA 4J0GA 1UKCA 5A7GA 3N2ZB 5JZBA 3W2TA 1K8QA 2PM8A 3WMRA 4AZ3A 3AFIA 2OCGA 4Y2RA 2WSLA 5DNWA 4X6UA 1VA4A 2HHAA 2QJRA 1XRPA 3KWFA 3H2HA 2QVBA 4KE7A 5AM5A 5I7UA 1W1IA 3ESAA 2WFZA 1EB9A 3VVMA 4DMCA 2QJWA 3EIOA 5HK9A 5CRIA 3BJMA 4FNMA 5DYTA 4W1PA 2WJ3A 4BTLA 1VE7A 2XE4A 3HACA 2ZYSA 5DYYA 2VQ6A 2UZ0A 4HTAA 1CR6A 2XUAA 3G0BA 1SOMA 2VA9A 1VLQA 2QUAA 1H2XA 1TK3A 3WK8A 4W1SA 3PE6A 3ESDA 2DQYA 1MPXA 2HA5A 4BAZA 3NWOA 5ALMA 1H2WA 4FOLA 3WJ1A 5ALLA 3G0DA 4U2FA 3P2MA 2P8SA 4ARBA 3D2AA 3E3AA 5JAPA 5ISMA 4EY5A 2XT0A 3H19A 4O08A 4GHWA 1GXSA 4G1FA 3WLAA 1VXRA 4GBGA 1YR2A 2XMCA 3AZQA 3KD2A 2AXEA 3G9TA 3F67A 3OURA 2WU4A 3WWCA 1ZD3A 3CCCA 3DEAA 3QPAA 1DT3A 3FYUC 1XLVA 4N8EA 4BYMA 4EY7A 5H3HA 4FNGA 4XVCA 3M81A 1ORVA 1NU6A 1QOZA 1QO7A 3C87A 5EHZA 4U2GA 1THGA 4MEBA 3L1JA 5ALTA 4UFPA 1WPRA 1L7QA 2HU8A 3U0VA 4OYYA 1CUIA 5AKYA 3V48A 1F0NA 3H2KA 3DL7A 2QMQA 2WQZA 4DNOA 5DTJA 5C8ZA 1C4XA 3F97A 4EY6A 2PPLA 2JF0A 3C43A 4J0IA 3ZLVA 3TGLA 4HS9A 3WIOA 2QUBA 5ALFA 2Y2VA 4ZV9A 2BUBA 3R3UA 5A7FA 2JGJA 3WQHA 1JMKC 1PV1A 1LLFA 4LYEA 1J1IA 4QWWA 1EX9A 2EDCA 5ALOA 1C7JA 5AKGA 1CUAA 1FFBA 7YASA 1ZGCA 4QEKA 3C5WP 5AKZA 1ETHA 4L9AA 5ESRA 3VXKA 3HRHA 4IQ4A 1YAHA 4AMZA 4G4IA 2QTBA 4WY5A 1XLWA 4DMKA 1K6EA 1ZIYA 4KR0A 1LGYA 5HF9A 1OXMA 3ZWQA 4BCBA 2WIFA 4RPCA 3S8YA 3TJMA 2O2HA 1P0QA 4H18A 3HSSA 1HLGA 1N5MA 2JEYA 3UUEA 4P08A 1UK8A 4K5QA 4F21A 1IUOA 4YX9A 2ZJFA 3RM3A 4DMHA 4X94A 1LBTA 1R3DA 4EZIA 4OYLA 4G9GA 4BAUA 3A2NA 4H77A 1SCIA 4C6HA 1QIHA 4IO0A 2XUPA 1EDDA 4Q3LA 3WZLA 4EHBA 4GWLA 4JYMA 1QIFA 2CUTA 2H7YA 1W75A 3H04A 3KWJA 3WA7A 3A2LA 4X93A 2QRUA 3PI6A 4K6KA 4J0HA 3WKCA 2X8BA 4Y2VA 2J3DA 4KE9A 4ZV7A 4J0KA 3QMVA 1QE3A 3H1BA 5AM4A 2ZVDA 5CURA 4OB7A 3UUFA 1QO9A 4OB6A 1X70A 5AH0A 3WK6A 4UBIA 1TKRA 3WWEA 3W9BA 3EQ8A 5ALKA 1ODTC 3ZI7A 3O9VA 4ZWNA 3G0IA 3FVRA 4RGYA 3WYDA 1ZICA 2PSFA 3VVLA 1R4ZA 1XRQA 4MJ3A 5AOAA 1XRRA 2WFMA 4K6HA 1G42A 5JALA 1MX9A 5LKAA 4CCYA 2PSJA 4V2IA 1BU8A 3ZPXA 2HA7A 2OGZA 1CUXA 4BZWA 5LLSA 3HZOA 4QNNA 5IVKA 1YSCA 2OPHA 2J4CA 2AJ8A 2CZQA 3IUMA 3JWEA 1YS2X 3T4UA 1AUOA 1BCSA 3BF7A 3R0VA 1VXOA 2FUKA 4UBNA 1CUYA 1BROA 1UOPA 1XZLA 5AK4A 2WILA 3E1GA 1I6WA 1VOTA 2GZRA 4TVKA 1E8DA 2XMBA 2XQIA 1K5PA 1WPXA 1CUBA 3ESBA 4UHDA 3WI7A 4EUSA 3HYSA 4U2EA 1SC9A 2H1IA 1M33A 2QZPA 2OAEA 5D7BA 3TEJA 4B6GA 4JNCA 4FDMA 2WJ4A 1WB4A 2YH2A 1U65A 1QGED 5AOCA 3OG9A 5E4YA 1J07A 2Y1KA 1GKKA 3IURA 1R88A 5AKLA 3SWWA 1WOMA 5BWCA 2Y6UA 1THTA 5KWIA 1XQWA 1JU3A 4OSEA 4UUQA 3T52A 5CTAA 4RNCA 2QT9A 5LZ8A 5ALVA 2RHTA 2G63A 4IH9A 1UK9A 5A7HA 2XDWA 5CT5A 1LPBB 3QZUA 1LPNA 1MO2A 1S8OA 2Z3ZA 1RYYA 4WFKA 4U2CA 5KREA 4AN1A 2OXEA 3KDAA 3WJ2A 2JGMA 1K4YA 2PX6A 2V97A 2WIDA 5HFNA 2BKLA 5A2GA 4BCDA 1TQHA 5CT9A 3WKAA 4UFNA 1JJIA 2WIKA 5ALHA 2O7VA 5IVDA 1W76A 1IZ8A 4MEAA 1JT2A 1T2NA 5AKHA 5JATA 5D6OA 3BE8A 4MXDA 2HADA 3K6KA 4KEAA 2JBWA 1KU0A 5ALJA 4DSZA 1LBSA 2FJ0A 4ZGBA 4OB8A 2OG1A 3O9MA 2VATA 1AURA 1QFSA 4AO6A 5AKEA 3DKKA 5DNUA 3GZJA 2BFNA 2WG1A 3WKDA 3PUHA 3PUIA 3O4JA 4UHFA 1BN7A 2EEPA 4WCVA 5T4FA 2IITA 5LZ2A 1LPMA 5HFAA 2WIGA 3STYA 1EA5A 2C5GA 1C7IA 2PUJA 3G8YA 3DDUA 3V1LA 1NU8A 2BCEA 3WWPA 4BVLA 5F4ZA 4B9EA 3M82A 1E3QA 3NOXA 4G8BA 3IDAA 2HFKA 4FFWA 3VISA 4PNZA 3TRDA 1Y7HA 4OU4A 4PSCA 4PO3X 2XLBA 4HVTA 3AIKA 5FRDA 5LZ9A 3H2IA 4OUKX 1FFDA 1BCRA 4A16A 4OU5A 4RE5A 2WUFA 1XZGA 4BP8A 4JH0A 1XZCA 2Z3WA 4DGQA 4M0MA 4L0CA 5FPQA 3ICVA 5DYWA 4BC0A 3C70A 4CFSA 4FKBA 2OCKA 5C7YA 2J3QA 2OQVA 4BZZA 5ALDA 5HK8A 4X92A 3G9UA 4WJLA 1UKBA 5CT6A 1EVEA 2VT6A 1A7UA 4FLFA 1A8QA 1CUHA 4Q3KA 2XMZA 3U1TA 4G9EA 2ACEA 3W05A 5KWJA 1JMYA 3AIMA 2Y6VA 3PFBA 2Z8XA 3MGAA 1KEZA 3WK7A 1CQWA 5AM0A 3A70A 3A6ZA 1QLWA 2QOEA 3ZV7A 3WWOA 1EDEA 3FNBA 1XZFA 5HF8A 3WK5A 4E11A 5AI6A 4KAFA 4C4XA 1U4NA 1EDBA 4ETWA 5ALSA 4CG1A 1LPSA 5AHXA 5C8XA 1YASA 2WHRA 4I3FA 4JYPA 1JU4A 5ALPA 5CH3A 4C01A 3H2JA 4AZ0A 3BL8A 3V1KA 5K3CA 5ALQA 2XI4A 4DYHA 4UHBA 5AKIA 2I3ZA 3Q8WA 4YPVA 4B9AA 3WKBA 3K2IA 1OCEA 3B12A 4OCZA 1AGYA 2RI6A 4KRXA 3AIOA 2VF2A 1VE6A 1HBJA 1YAJA 4BBZA 4EB0A 2YASA 1XKLA 5FKJA 3WA6A 3PF9A 4H7JA 5LP1A 4U2BA 4LXIA 1BN6A 2X5XA 5DTIA 4DTCA 1QIIA 4CIAA 4G8DA 4GI1A 2HA4A 4HRXA 3GBSA 3IBTA 2XUKA 4UHCA 4MYSA 3SC2A 3AZPA 3LCRA 3K9BA 4P9NA 1EK2A 3GUUA 1JI3A 3NGMA 2OGTA 4ZRDA 5BWBA 4Y2XA 2GBFA 4AN0A 1P0MA 4WFJA 2DFPA 2QXTA 2WTNA 1TCCA 5CW2A 1AC5A 5DJ5A 1E89A 1QIDA 1TIBA 2W22A 4K6GA 2AJLI 1YS1X 1T4MA 2DSNA 1F8UA 4N8SA 5ALRA 2VJCA 2FX5A 3VDXA 2JIDA 1USWA 4BC1A 3V1NA 1JKMA 4FMPA 3FOBA 4DMFA 1SCKA 4DLNA 4BATA 1E8MA 4UBKA 5CXXA 1IMJA 2PSHA 1BEEA 4QZVA 5KBYA 4FLMA 1IVYA 3IVMA 3HLKA 3QMMA 4B0PA
chains in the Genus database with same CATH superfamily
2C4MA 1MPTA 4B80A 4BOYA 2ZRMA 3RREA 3M5DA 3CX7A 3RTGA 3ZHOA 4D9JA 2O5CA 1XK6A 1AHHA 3CU5A 2QW8A 1FXUA 1H8ED 1NWHA 4MR8B 3SF0A 3TGWA 3E3LA 1U0GA 1KK3A 5LMCA 2QN3A 2OCLA 4H7KA 1ZFNA 2V7WA 3UC5A 2AV6A 3S2IA 3QE4A 4B3RB 1E2IA 2WV9A 4FE7A 1NUUA 2NX2A 2XIJA 3A11A 3IUBA 3NHAA 3O7WA 3AO0B 4MWSA 3AF3A 3GGDA 1QIGA 1T6YA 4FW9A 4Y2QA 3ZWXA 4AP5A 3GL9A 3JVEA 4Q24A 2BMFA 3Q3JB 4AJLA 1FTWA 4MGZR 4DR3B 5SYMA 2NVUB 1YD7A 4QPDA 4Y6GB 3EEYA 4MA0A 2XUQA 5AMXA 3EDMA 4H3KB 2R7LA 4YEDA 1JQEA 3QXJA 4Q3CA 1W36B 3VOAA 3AI1A 3KELA 4AY2A 1UADA 3HCRA 4KXXA 2ZDGA 4YS6A 2MSDB 3A05A 4DV3B 1GNVA 1SBZA 4IIHA 4URYR 1CE8A 4FR2A 5E2IA 4F9FA 2O8BA 1GGMA 1Y1QA 2F6RA 1CZLA 4RSGA 3RKUA 5JLJA 2ZJBA 3BPSA 3AUXA 2R7AA 4PZ0A 1QFJA 1XTVA 3I5MA 2VXCA 5KOHB 1FS5A 4PNPA 1NW7A 1VHWA 2WMNB 3HMQA 2WU8A 5EP4A 5HQJA 2WWVD 4GZ6A 2LDXA 3F7MA 3Q4GA 5EQDA 3AB8A 4HGOA 4CCWA 2PDAA 1O3YA 1QV6A 2I65A 4U7TB 5BR7A 4PHHA 3VI3B 2O6HA 4ZAVA 3R23A 2QSJA 4OD0A 1FPQA 1UBSB 2I7CA 4EHKA 1PK9A 1UZAA 1XZ8A 4UAVA 4E94A 3THWB 2JNWA 3DLTA 4H7FA 1Z0AA 2ODEA 4Y6SA 1JRLA 1V3QE 3F9RA 2RKBA 3G1TA 3TRKA 4WI1A 2NT3A 3E7WA 3ZNQA 4A8JB 1RKVA 2XCTB 5CUQA 2BW0A 3QEMA 4FDLA 3ON5A 3BSWA 2DP4E 1D1QA 1R50A 3N0TA 4RWEA 4E2FA 3QLVC 5FOVA 3EWAA 3QENA 3TTWA 1JKJA 3DVRX 3P32A 4YXFA 5HJ5A 1A7JA 3W7AA 5I8ZA 1J20A 2GD1O 1MIHA 2NU9A 3KPVA 1L5VA 3UHJA 1N6NA 5L6LB 3EF3A 1ID8A 2QY6A 2V59A 4FQ8A 2VR1A 1CR4A 3RS5A 3GCDA 1FP7A 4URWR 4GL2A 4Q9KA 2FRDC 1CW2B 1OI7A 1PQWA 1SR8A 2HK6A 3K9LA 4XVRA 4CEJA 3BCHA 2D1RA 2OCBA 3SLGA 2WVAA 4J29A 1S2LA 2YMLA 1U3GA 1CEXA 3AW8A 5EFZA 4QSMA 2C2KA 3X43A 4F56A 3D5TA 2ZUEA 1QC5A 4DLTA 5GAJA 3SXUB 3TLMA 2NPOA 1PFYA 3PHCA 2DH5A 2POQX 1M8JA 3K8QA 1F4LA 3DB1A 1M1XB 2IHUA 2NVWA 3CKMA 2YY5A 3K6JA 1JUDA 3KKMA 3OIUA 5E3JA 1V9CA 1EI9A 3R1IA 2XB4A 3V8RA 1QV9A 1M1NB 2RIRA 4BNFA 4PYQA 5BMVF 1MRZA 5LM3A 1E6LA 1N8SA 4LRUA 3OZTA 4JGBA 1VKRA 1XWFA 3BFKA 4CT0A 4LA4A 3IAM1 3PFWO 1XCMA 2O3QA 3BGSA 4MQBA 1G2QA 1O6FA 4ENVA 2PJUA 4KXUA 1TQ2A 4CDGA 1TVKA 1I6LA 3IO5A 1EP1B 121PA 2ALJA 1NXTA 3KUDA 2GPJA 1VCMA 4JYAB 3KZKA 1EHCA 5DBIA 5JXIA 3CUEF 4X54A 2GEJA 3WAKA 2YHBA 4XD2A 4C4YA 1LW6E 5FXMA 2WM3A 3K2BA 2BGNA 4K1XA 3WK4A 3ZHCA 5KTRA 3LHDA 1SELA 3IAFA 1YB4A 1C3VA 3KM0A 1PQYA 4L8GA 3RSHA 4EHIA 1E3MA 4WKNA 4MHSA 3PTZA 2EQBA 5EIFA 3I45A 3VAZA 2VQEB 4G1CA 4LMRA 3WSVA 2IU4A 4KSYA 1NVFA 4KQXA 1R6XA 1VJ5A 4ZQFA 2PVCA 2AQIA 3H4TA 3PA8A 4QX6A 1GO2A 3RSCA 1MLDA 2QL5A 4Z7QB 3DZIA 1YL5A 2GAAA 2VSYA 3Q11A 4D99A 4CL3A 2IV7A 1M1YA 2R00A 4QUKA 4YDQA 4DBZA 5CFOA 3C7KA 1U11A 2GBIA 3K30A 3DHEA 4UMEA 1F6WA 1AZWA 3CO0S 3O75A 4P4UA 5IEBA 4LX8A 1QE0A 1XEWY 3LKBA 1U5AA 5G1NA 3S1LA 5A9SB 5C37A 5FTLA 1UKAA 1U0BB 4XX0B 2C4WA 3ELBA 2CXSA 1TM4E 2L18A 3H18A 4BNIA 5BRJA 4P4GA 4XA8A 4DGSA 3AYXB 1CX9B 1JA1A 2MIIA 1CSEE 4PYKA 1Z7GA 4OP2A 5KU1A 3EGIA 5EGSA 5JECA 2IYZA 1VYVA 4HXYA 1UAAA 4HGZA 3FNQA 4HI0E 4PTZA 2ICAA 1XROA 2A92A 5MN5A 5DWQA 4QBGB 5GIPE 1RAGA 3AOEC 2JFYA 3DCNA 1KJJA 3FCXA 3LH5A 3PGLA 2O2JA 3LZ6A 5K3BA 5IHXA 1JJVA 3PL1A 2HYDA 4E2ZA 4TSFA 1E1LA 5FPSA 4CM3A 2BM8A 1GNLA 1XTKA 4PQEA 4X95A 5J2TF 1LK7A 4IDGA 4Q1VA 5DISB 3LXRA 1EUQA 4RIIA 2NO0A 3OSUA 5IJ0B 4DQ0A 2HHCA 3QX3A 2HLNA 3HADA 1U94A 2EKLA 2RG1A 4YUAA 2H1RA 2Q27A 4HBZA 4OBWA 1C80A 1Q6YA 2NQ2C 1KVRA 1XQXA 4OMCA 4AS3A 2XEXA 1KP3A 1UJ4A 1GL6A 1N2IA 1VPDA 4PC3A 3J7TA 1R1DA 1V4VA 3N3AC 1N2CE 4F5EA 3WRYA 3FYTA 2CXQA 2AXNA 2HRZA 2XQFA 3GGGA 1R4MA 3KSBC 1FJGB 2C4VA 2ZM5A 1TX4B 1FXSA 2YHSA 2QRVA 4L51A 4UUNA 4YMWA 1A5AB 4N39A 4OOEA 2E3JA 3AY6A 2A7QA 3L06A 4IXWA 1QUFA 4AWAA 3WFJA 4GX0A 5TPWB 1JBKA 1MU0A 2IELA 4DAOA 2WNIA 2P9JA 1V5IA 2AZXA 3O4VA 2X0JA 1QYRA 3KHSA 1JG6A 1SH7A 2HRRA 4JMLA 2QMEA 1NKSA 3ZTTA 1E64A 2N1BA 3V6LA 1GG5A 5HHTA 1ZIXA 4FMDF 2OO5A 2EKBA 3T34A 3HKEB 1XN1A 3TX6A 3RFVA 4V02A 4EELA 3QNUA 2ZTSA 1TU0A 2C83A 4RULA 4BUJA 2DHEA 2VJYA 1XZBA 2WUGA 3JCZA 1W1UA 4O4IA 4LXHA 4TTRA 1ECJA 1HL7A 2Y0BA 3TW0A 4M76B 3R74A 1G20E 1A88A 1VPVA 3JAKB 4HB0A 2AJTA 1IRIA 1DJNA 2H2GA 2TMKA 4CKCA 3KJXA 4Y6PA 2V98A 3R0XA 3AR2A 1E3WA 3BT7A 4EH1A 2JIRA 4RE6A 2RGNC 3ROTA 1MJ5A 2QD3A 2PSSA 4HYYA 4MQ6A 3GJXC 3MUOA 4FDAA 1YI0A 3MZ0A 5HJ7A 3AHCA 4HTFA 2IYTA 2ZVQX 4NZMA 4TTAA 5G1PA 5CDUA 4PQYA 2H92A 4HGRA 1Z5OA 3VZBA 1MRNA 3L7YA 2XIQA 4C07A 4TYQA 4F84A 5LPNA 3Q8KA 4BWFB 3O7MA 3HXPA 5ALIA 3QVGA 3V4FA 2XEDA 1X9HA 2XE7A 2DR2A 3TD6A 1Y8AA 1RXCA 3RAEC 3AF0A 1VIDA 2P6MA 2JFUA 2VZLA 1Z8HA 2F64A 1NI4A 3E05A 3RFTA 3PRYA 3EGWA 3KZMA 2H7CA 4R1OA 2HA3A 2OHGA 4JLOA 3IOEA 4CGYA 4R7GA 2ZYGA 3ITNA 3OIDA 3R6GA 2CB9A 2YNMA 3LNCA 3QWHA 3RJTA 5BSHA 1RPJA 2QHXA 3A9RA 3MS7A 5GJWC 5HWSA 2VG8A 4GLBA 4URXR 4B35A 2DQKA 3DP9A 2WB2A 2O2DA 3IR5A 5DHSA 5A6SA 2WOJA 1NL3A 4ALJA 1P8AA 2VNHA 2HR1A 1M8FA 1ZK1A 4IVNA 5JXGA 1UT6A 3AILA 1SGWA 2JHAA 3HVUA 3AIIA 4M1OA 4RHYA 3PE3A 4IIVA 4OSPA 4M88A 5BVHB 3L4JA 5FLKA 2WVJA 1BOOA 3NM4A 4M8NE 3RJ9A 1CR2A 3BJEA 1ZRNA 4C87A 5KQGA 2Y77A 3ZCTA 2BE7A 4LSGA 2GUGA 3RBZA 3TNFA 1VRVA 2X9NA 1IN6A 1E6WA 1Q3KA 1QAOA 2M98A 4NONA 1SPXA 4QEDA 1Z82A 2DHCA 2GFIA 2YWRA 3NOVA 4GDMA 2VF5X 4BMYA 3IGFA 5C53B 4TM7A 2RHRA 2VK8A 5JCOA 5AK5A 4P5EA 3ZUGA 4NQRA 4CPDA 4R6XA 3CLRC 3W0LB 5FPTA 5C5EA 2XWPA 1E2PA 2H07A 2Q46A 4EO7A 4PRYA 1U7ZA 5F1PA 3KXKA 1H65A 1BGXT 1QTRA 3VV2A 3W34A 5HM8A 4TMTA 2GAFA 1Z0KA 3TIIA 2BMJA 2YVKA 2D7CA 3O3OB 1OH8A 4LF9B 1OWNA 3A1EA 3DD1A 3LYHA 4I55A 3DVLA 1W19A 1R9JA 2ZYVX 1XZDA 3F5FA 4QJBA 3X1JA 3D1JA 2Y1FA 2PS0A 5HZMA 4PPNA 4QJIA 4B0OA 3H8JA 1QPZA 1E9SA 2I6GA 3I92A 3SF8A 3MUEA 3UOWA 3WFZA 4B4VA 5A9TA 3LPAA 3GPLA 2FFHA 4XWWA 4C5CA 2FX3A 1G17A 3NKVA 3AY3A 2GCOA 2K6GA 3M9WA 4TRRA 1QQ6A 1QHHA 1RZUA 2ABWA 3T4EA 2JHGA 2YHAA 1WBJB 3HI6A 3PNKA 2OQIA 1GTMA 1XMVA 1O0BA 4LZPA 3P9ZA 2CVPA 3I2GA 4UTRA 3SLKA 4BBJA 1HLPA 4C08A 3B8EA 3WB9A 3QYPA 2FU5C 2B61A 4C1NA 3MQ4A 4N0PA 3NYQA 1DRKA 3GFFA 2WZDA 5M3BA 4ZK6A 3RPEA 4Q4DA 1Q7BA 1IDN1 1R4NB 3QNWA 4EG6A 5HKKA 4CNQA 1P5HA 4FBLA 1MZPA 3UMYA 3TUZC 4JI3B 4G26A 1KJ8A 3DKVA 3PNSA 3TQCA 4A7PA 4JP5A 5C1PA 2JH9A 1DO8A 5JRZA 4R68A 3GV0A 2PH5A 1CRWG 4L22A 1QRDA 2XCLA 2X1LA 5BVGB 3MJ4A 4HXFB 3HU2A 3CX3A 2WU1A 2AKAB 4EF5A 1GRCA 4EEXA 4QULA 2CJXA 3TDMA 5JAHA 1CKEA 1YDFA 2CNWA 4U7JA 4HEA1 3OESA 5DASA 5DHTA 3E0XA 3TS1A 5AM3A 2P2SA 4QUBA 3H2GA 1VE9A 4B4UA 2R84A 1FNDA 3HJHA 1W9HA 5AJHA 4IDFA 1IUKA 4OHOA 5EIHA 2D7DA 2A9FA 1EM8A 1K75A 3E8MA 4G4JA 1D0SA 2WPDA 2P9TA 3U61B 4JYZA 4NHOA 3D0RA 3EYWA 4QPNA 1Z38A 3DE6X 3CN9A 3KT8A 4RS4A 3UA4A 3UJ9A 2ZBPA 1IJKA 2Y27A 5F2KA 4YYEA 2PZEA 1WZCA 1ZH6A 2CHUA 1RT9A 1PW7A 1E2HA 3IA7A 4MWTA 4LFCB 3S70A 4IDPA 1DT5A 3ZY5A 4W9NC 1ISIA 2AUTA 2Y99A 3HCEA 4JEIA 3F6BX 5D7NA 4BX8A 4YRKA 5E6UA 3GHYA 3UT6A 5FA6A 1IPEA 2JJ2A 1N9ZA 1T9AA 5K3FA 4O63O 3LKDA 5AI0A 2J5QA 4B8WA 1GL9B 5CBPA 2FWBA 1L6IA 3KJZA 1RCUA 1FMLA 1RVV1 1UWCA 4MB2A 1XZNA 3SX0A 3WWYA 3HXKA 2HSWA 3IT3A 1GU7A 4IJVA 1BH2A 2AX4A 3KNZA 4JBNA 5KJFA 4MHTA 1JFRA 2RHHA 4N5IX 1GDDA 4J91A 1SCQA 3C3PA 2H2HA 3HXTA 3ROEA 1CQJA 1EG2A 1Z22A 4KPUA 3WNZA 5C8YF 4EA9A 3OY2A 5CYFA 3TNJA 2O3SA 1KYVA 1QFMA 1W2WB 1DTWB 1P2DA 3X2FA 1XO1A 3IKLA 4GRAA 5DHAA 1XCOA 2WF9A 3L43A 3VJKA 1L7VC 4BO7A 2BWJA 4Q7JB 1WOYA 1GAXA 3A6HA 2TS1A 3B82A 2ZJ2A 3FZQA 4JT2A 1SIUA 2RHOA 2E6KA 4Q3AA 3G0CA 3FNRA 3IV7A 4QL3A 1K5DA 5CA1A 1M10A 2AN9A 3VFDA 3X0DA 2WMOB 3LCMA 3BQ9A 4DV0B 3TBFA 3GVPA 2OYRA 4NS4A 3SHQA 5B2EA 2BEUA 3FKJA 1Y1TA 3P97A 2J0VA 2VWQA 3E7FA 3IULA 3SIRA 1CUEA 2DRIA 1Q7GA 3M6AA 1V7PC 2O2ZA 4UXIA 3ZWNA 3SZOA 4A8TA 3RARA 1YBFA 5EXTA 1YMQA 3U4QA 1WDMA 2H31A 3QVWA 4EYOA 1BDMA 2CKMA 2FPRA 4WA8A 4WY2A 5CDTA 3RK0A 1PZFA 5KTPA 4RPLA 2CVOA 1ZUD1 3K2QA 1BRMA 2PEYA 4YJFA 3LVQE 2W98A 4H7EA 2C3PA 5DM60 3L02A 4O02B 2ZAIA 4DLYA 5JH7F 3OLVA 3WYNA 4AFNA 4JSTA 2NIPA 4UMFA 3U9SA 2B83A 1KYXA 1KK1A 2Q4BA 4ZA2A 2WSYB 5D86A 4J0CA 5G0SA 1HY3A 3AERB 4PRZA 5T4EA 3WLMA 3FMFA 3BILA 4HB4A 4KX5A 2QR5A 2HY7A 5CFRA 3IQHX 2G5CA 3C7CB 3MJSA 2HK8A 3JASB 2WT8A 2JGEA 3GLHB 4FGLA 5KTSA 1X8JA 4A92A 1N6LA 1DIHA 2QD5A 2EKDA 3ABSB 3HLYA 4G97A 3MK31 2Y0PA 4X3PA 3W2HA 1XVTA 3X1MA 5KYYB 5LZ4A 3CLUD 3DD5A 3L1IA 2QW1A 1AJEA 4ITVA 1JIIA 2EJBA 1J97A 3H1PA 5KMGB 5CLGA 1OZAA 5B2ZA 2IC5A 2ZULA 1NYRA 1S1CA 2QQ0A 1KI2A 3A3KA 4FOPA 1W8IA 4GNKA 2C2WA 3EPLA 1QIMA 4RHTA 4XLTA 1J0AA 1VJCA 1E61A 2JD2A 1CY2A 1YS4A 1X1CA 3MVEA 3RVSA 4MRNA 1R0CA 3FYSA 4IR7A 5JS8A 3PA6A 1V8DA 3PIDA 2XMGA 4G0QA 7MHTA 1SBQA 1FDUA 1LPPA 1T9KA 2YQ4A 2APJA 3II6X 2ZREA 3UGKA 1JFVA 5L95A 2ZT8A 3IV9A 1RQ2A 2H8GA 3O4IA 4I9FA 3QPVA 4MQFA 4WY8A 3ZHZA 4N3GA 3TMYA 2EZ9A 3GEGA 4QELA 1LJLA 5K6AA 4Q39A 2H48A 1H69A 5JSFA 3I2FA 5A3SA 1X1DA 2QB5A 3T61A 5ABPA 1XHEA 4BFVA 3GT3A 3IAUA 5IM5A 1A9XB 4D8WA 4DSNA 3A3OA 1MDBA 4GRIA 2J6CA 2P69A 3NOOA 4U7FA 4WCDA 2IYYA 3CT4A 2P3OA 1EVQA 1Z35A 2EG9A 3NWBA 2G8LA 2DXIA 1ZSVA 3FHJA 2PA3A 3GQBA 1U0FA 4WASA 3VM6A 4EHAA 2HIMA 3HV2A 1U0OC 1DNPA 1PT8A 2DVMA 1R8QA 2FSFA 3NIBA 1H3EA 2V3CC 1TC2A 1TW2A 1IM5A 3G88A 3KYDB 3EFOB 4B3BA 5EJ4A 2I7XA 4MQEA 5CW1A 5AOVA 5A62A 2GXQA 1NMYA 4NL4H 3RS8A 2YHIA 4TWBA 2OORC 3GA7A 3AB7A 3DR5A 4OGKA 4PAOA 2DULA 2V58A 3ZDQA 1FNNA 2BPOA 3ZGZA 3EDQA 4UDOA 2L17A 5J58A 4BNNA 2IDZA 1J0CA 2QM3A 1JR2A 3EFHA 3F1KA 4LJLA 2OFPA 3QLVA 3FLEA 4ZYUA 2O8BB 3C14C 3EZ2A 5K3AA 3HABA 1FFYA 3LFUA 2GRAA 5I7RA 3JTMA 3CVYA 4OH7A 1H9CA 3RC9A 3T9DA 3Q6NA 3NOQA 4L9WA 3ZBTA 4ZMRA 5BV7A 3ZIDA 4RF3A 1XQVA 3CUYA 1R9MA 2J31A 1RXYA 1PGQA 1IM8A 1ZJ4A 4TSFD 1WRBA 3RG8A 3VR3A 3D81A 5ALEA 3SQLA 2QRNA 1G5FA 3B38A 2P79A 3C3WA 2GD6A 3HVHA 2BFDA 3NU1A 4CM1A 4DA9A 2GBGA 3BSSA 4M4SA 1QP0A 5D85A 1XEXB 1QQAA 3G9QA 1PS9A 2V96A 2C7BA 4EMSA 1CZRA 1PFWA 2GB4A 5LVAA 1O94C 2PX8A 4GSYA 3HJAA 4ZAXA 2W2PA 5KNDH 4HPXB 2Q5CA 4P3KA 1GPMA 2QDXA 3K9CA 5MFZA 4OHCA 4EQZA 3C5VA 5C81A 2BAGA 3MJRA 3UF0A 4K88A 4B85A 5KIAA 1T2UA 4EMBA 4MDEA 3NDPA 3QEMB 4D8VA 3RASA 2Z9BA 4FTWA 4YY3B 1F2UB 1UOEA 3EXIA 1QJ4A 1EFRA 1RS0A 2AJCA 1DCTA 1LLQA 3FMIA 4HDKA 1E6EA 1JKJB 4R8KA 4Y0VA 1LY1A 1TCAA 1GPLA 1YB1A 4ZDIA 3CUSA 2XUJA 3O21A 3K1ZA 2QXUA 3WYAA 3RKSA 3A31A 1SFRA 3AKDA 4JU8A 4KAAA 3R6DA 5FWYB 3GEEA 2IOFK 5E38A 3AHDA 1QQ5A 1RZVA 3FUTA 4R83A 3CEJA 2WEKA 2A2ZA 3O1IC 5CR9A 1WCWA 4QTUB 4AJOA 4CI9A 5FTNA 2WVGA 2XRFA 2ZJ0A 2ZRAA 1B41A 3N8KA 4HBGA 3KS9A 2HU5A 1P81A 4E5VA 1I1NA 1QG0A 4LTMA 3GRKA 1DAFA 3C6QA 2YVLA 2RG7A 1C7ZA 4GVPA 3ZCPA 1MABA 1YVPA 1S7GA 4TLMB 2AG0A 5LNK6 4GPIB 1ZCFA 1D4AA 2I78A 4J1TA 1DXHA 1FFSA 4L2IA 4YJ3F 5FP0A 5EPOA 2Q5JA 4ZGWA 1F3LA 2OSVA 4XYEA 2HDWA 3RK4A 5C2JB 1I7SB 3RUDA 2FQ1A 2I6QA 4BFSA 2PD6A 2PX4A 5JAUA 5IKXA 4IZOA 1XKQA 2VI5A 2FZ4A 4PLGA 2Q2OA 2RKWA 3MB5A 5CK5A 5F7ZA 3ZZ1A 3GLFE 1HOXA 3K6SB 2QU8A 4H7HA 1W47A 4RVFA 1YUMA 3B6ZA 1TVKB 4ETNA 1Q0UA 2DPGA 2IZ7A 1EPUA 3T1OA 3DQQA 1ODFA 3GG2A 4L0MA 3EIEA 3HMKA 3MQFA 1KI3A 1EINA 4V03A 4GXRA 2GYUA 2X22A 1URPA 2JAWA 1JALA 3ZE9A 4ZI7B 1I5RA 5F77A 1AO3A 1M2FA 2I7TA 4Z9XA 2DU8A 2YNMD 3AHGA 3X1KA 1SZPA 5JTUA 3QMMA 3UPTA 3CNHA 3UCEA 4AKIA 2DTXA 1WMEA 4ZC1A 5C0OE 4NMWA 3R5JA 1QZXA 1TUEA 4CUJA 5BV0A 1JXMA 1H2RS 1IUNA 3NVMB 1UQTA 3H2SA 1P2VA 2QAGC 4EMUA 5FAXA 1T0UA 3S0JA 4ENSA 1TU4A 1R9NA 2ONZA 4PG7A 4L72A 1NSFA 3T9EA 2OBNA 4D0GA 2QS9A 2FJPA 3KWLA 2Z04A 4YCLA 1DOHA 4ZJYA 5AI9A 5BQOA 5CB6A 2AG1A 1VL2A 1NQXA 1OX4B 3AX6A 3DMHA 1X8LA 2K2WA 3FFTA 2BHSA 3OLCX 1CHDA 2C77A 2R6R1 4GPEA 2P35A 1XXLA 1M1YB 2D5BA 5GONB 2PSEA 1SG9A 4IH4A 4DWVA 5LZ5A 4FXOA 2CXRA 3IAS6 5TNXA 4W1QA 4MV4A 2RAUA 2FF5A 1JVSA 3DT8A 2CVHA 4U2DA 4Y30A 2ZR7A 1S5PA 2BMEA 3MS4A 4O59O 1P7YA 3LDUA 2VYQA 4Y1EA 1W94A 1JDUA 1V2HE 4IFBA 1HNNA 2XUGA 3F4LA 4H15A 5DXJA 1DHTA 5DYGA 3M3DA 3RUEA 2E4UA 3UANA 1A2OA 3BUSA 3HN7A 4I9NA 1YRWA 4QJ4A 4HYTA 1P5JA 3NHLA 4J9UE 4RF4A 4RPIA 1AVTA 3LUKA 1ADYA 2BTQA 3H84A 3JATA 1NR5A 3NCTA 4BUCA 4LOIA 2MOKA 4DUZB 2Z4TA 5IT4A 3ZVKA 2IYAA 4OPMA 4R54A 5IJWA 1GR1A 2HJWA 5DOVA 2WIAA 2Y05A 5EC8A 5MF6A 3H2YA 1BG6A 2HT6A 2YW2A 1EVZA 4RZXA 3AVYA 1NDQA 2IQ5A 1IY8A 3AFGA 3JVVA 3KYIB 4CU5A 4EUKA 3U7GA 2WWYA 3TWOA 3IEUA 1FMTA 3UJPA 2PKXA 3S40A 2UXBB 4EI9A 1X0VA 2PU5A 5LBTA 5CB4A 3I9JA 3FM9A 3BB3A 4ZO4A 2YS7A 4IS2A 3D7KA 5DM1A 2D2IA 3ZWKA 4YCSA 3OZ7A 3PB3A 5JRDS 3PKJA 5DDIP 4Z49A 2IHJA 5LB4A 5EL0A 10MHA 1OLXA 2Z56A 1HT0A 3OPYB 1R4MB 3HU5A 4LIPD 4BKUA 5L3SB 1WB5A 2X14A 3PX3A 2QRVB 5H16A 3HYTA 5HKKD 2OUIA 3JAWA 4AU1A 3BVPA 2QUIA 4BVKA 3K9HA 5EMKA 4P92A 1G5TA 4JR0A 5AKKA 4JP1A 2HEIA 1Z7EA 1RLTA 2VUIB 3G1WA 3OPVA 1V8BA 2J0EA 3IUNA 4FDUA 4X8MA 4PN7A 2QYTA 4DQUA 4F92B 4WL0A 4HB2A 4HK4A 5JJ5A 3HJFA 2I54A 1JYEA 1TAQA 2PR7A 3MT8A 2C9DA 2GTHA 3ZVLA 4ZK2A 3DOCA 3ZHVA 3BBLA 4LDPA 3SBOA 4E5PA 1U99A 2CNWD 5CXUA 4TLDA 3T4PA 5IG2A 3IOYA 5KC8A 2AW5A 1XFDA 2IYPA 1KBZA 1I4EB 1J24A 3D1LA 2F9MA 5KAPA 4RK5A 4DJ5X 3UAXA 4Q4CA 3CN7A 3OA0A 3R0JA 5IAOA 1LK5A 2B36A 1Q21A 1ZD1A 1HQDA 4UBOA 1Z4JA 4E31A 2AVNA 5A06A 3CG4A 1WXQA 1P7WA 4EIWA 1RFGE 2CN1A 3V7WA 5BW8A 3PGKA 1N3IA 3E35A 2WPDD 3H1EA 3IRUA 3LQ1A 3NHSA 4M0PA 1H93A 4OXXA 3VTFA 721PA 1ULHA 1ONSA 3BDIA 3MD9A 1WUHS 5ADVA 2PTHA 3CR8A 2CCKA 3KOXA 5BV2P 2ZJ1A 2AUNA 3A1VA 5BV8A 3C5HA 5H68A 4HLNA 4GPD1 1WBBA 3P0JA 2JJ2D 1PT5A 2O8DB 3DLBA 1XQ1A 4C88A 2DGDA 3LLSA 4D1YA 1MMFB 4RTLA 1RCTE 3GT7A 4D92A 3ER8A 3WGTA 3DONA 2H4ZA 3D0QA 1EUZA 2B8EA 4MJXA 1IAVA 5DB4A 5KZMB 3HXMA 1T9HA 2ATXA 1ISPA 1WP4A 2WWFA 2ZRNA 4B45A 2BSQA 1N78A 4S3MA 1AHIA 1JQBA 9ATCA 2OZPA 2OP1A 3CH5A 3OZDA 2OGWA 2D4HA 2WNSA 3U16A 1QUEA 4HOYA 2WKWA 2QRPA 4MO2A 2ONYA 3JQBA 1LXCA 2DT8A 4WUVA 3GLGA 1TAUA 4U6QA 3HWSA 2KBEA 2MTBA 3AF4A 1E1CB 1U8EA 4LS3A 3LC1O 5CFNA 3AJDA 2DWCA 2IP2A 2RB4A 3NHKA 5A6SB 1Q2XA 2ACWA 2GJSA 1QIJA 4L3OA 3WGIA 4HEJA 1CQPA 3EIXA 3GRZA 3PDCA 4R2LA 5HIMA 5TR9A 1UMBB 4LDRA 5CJJA 3WYGA 2RGDA 1N0UA 1NXWA 4P7BA 2JI8A 5HMMA 1ODCA 3M6IA 3NRBA 1YJ5A 2PNJA 3RV4A 5LOVA 4BN4A 3FNGA 3BQNB 1D03A 4D98A 3CO5A 3BJRA 4OBBA 3SHTA 2ZITA 4BPBA 3E1KA 2LKDA 4JELA 1HC7A 1UWVA 1Q22A 3H0CA 2QM0A 3C6ZA 5P21A 2HZBA 1PJBA 3NP7A 5CDGA 1FDIA 2R6JA 4JLVA 2CHGA 2WSIA 3FNIA 3K70D 2Q8NA 3AEUB 4PU0A 1GQRA 4REQA 3I83A 4PONA 3M5PA 4XIGS 4BJ6A 4RK4A 2DBZA 4L3WA 4CTOA 3NWJA 1S8FA 1GGJA 3HL4A 4B6JA 2QVGA 2YV5A 4LYAA 2OECA 2EZUA 4G4GA 1W52X 4XVQA 4PR0A 5I9TA 1I2ZA 4I55B 3GU3A 3H17A 4YDRA 1NC3A 3RHTA 4IGIA 3FFXA 3QYAA 3ZR4B 4ENUA 2UAGA 3AKCA 3OBIA 4AP6A 4O4JF 1LZKA 3TN7A 1AS0A 1M6NA 4GMFA 3DAFA 3FTEA 2RHGB 4ESHA 1N5KA 1UKYA 2PA0A 2PT5A 3DOEA 3PRHA 5FLXA 2BGRA 3ZXUB 1FZTA 2C2OA 3DOHA 1M3SA 2AZMA 2GCOB 5IVIA 3Q98A 3WTBA 5FADA 4FZ5A 4GMGA 5CB0A 3FA2A 3AVQA 2P9GA 4LGVA 1OZGA 3PQ2A 1J09A 5HCUA 5L9AA 1KMIY 2F3RA 1HURA 4FYPA 4MYCA 1G8HA 1N6HA 2YL2A 1EVYA 4X66B 1F48A 4QTXA 3IE2A 1IY2A 1LA2A 4ZZ1A 1QG2A 1GN8A 4RVGA 3D2BA 3STHA 4DYVA 1QK4A 4QDUA 3TIVA 4W5NA 3FSGA 1GT6A 2HWWA 3CRZA 2CK3D 2FLKA 1A71A 2ZI4A 4E32A 4TL7A 2R97A 3SYMA 3C4QA 2C4HA 3I32A 5KVVA 2RGEA 3DL4A 4Z6KA 3Q3GE 3K73O 1XPRA 3W1EA 1VHLA 5L7TA 4IHJA 1T0BA 2PV0A 2WZBA 2X9VA 4UQLA 3V80A 4QU0A 1Z5WA 2XWBF 5EP3A 1YRBA 4IOKA 3IPRA 1ZQ9A 2BMAA 2ZJOA 5HUJA 5D1HA 3RVBA 4IZIA 4B7UA 4IGEA 3RNOA 1QE5A 2YFQA 3FCYA 1UPUA 1CDEA 1UUFA 2AOUA 5EPUA 1R37A 1AKVA 1XEAA 3PPWA 2ATEA 3QUBA 4UBMA 5HS6A 1ECGA 4RKQA 4V24A 4JASB 3A7DA 3ST7A 2I6TA 3TTUA 2Y8EA 3UVEA 3TE7A 3TAHA 3ZI4A 4CF5A 4FQ7A 1K4MA 1WM1A 4FFOA 3WHIA 4C0SA 3K6RA 3LECA 3QF4A 4QE3A 2FVYA 4JENA 4TPKA 4ABYA 4BBAA 5LSAA 3F49S 1GHTA 2YC4C 3OEYA 3QBVA 4C03A 2FTKE 3OJOA 4DSTA 1WZIA 2XF2A 3LAWA 2EJWA 1RYEA 4RWZA 4ZQEA 5BOVA 3PVCA 1E3EA 2YZMA 4INJA 4INZA 5EQTA 4CHGA 4JFRA 1QKJA 1B8PA 1V48A 1U7TA 3B1YA 3R3HA 4UASA 4MO9A 2GSWA 5A3VA 1LPOA 2F3QA 4TT8A 1DMSA 3OOEA 5K3FB 2QTLA 2UZ1B 4KXYA 4GO1A 5DM4A 4DDMA 3PJDA 4OLBA 5EIBC 3O8DA 4NNPA 3ESRA 1VP9A 2I9PA 2QLLA 2JH3A 2QNBA 4R98A 5JCXA 5L7WA 3S55A 2AZ4A 3IKJA 1X86B 2FGKA 3A9TA 4KHPB 4ZJZA 1KOJA 4FFVA 5L45A 3VR3D 2ZPAA 4O2AB 5HE8A 3SAJA 1G16A 1IWPB 2V7UA 4LSMA 3D3KA 5I7OA 3JQ9C 3KUKA 3S7ZA 1WIWA 5CFMA 1GTSA 3ZDBA 5HNKA 2ISCA 2UUOA 4C14A 3EIFA 2XB6A 4F3CA 1MO4A 1C1XA 3PFHA 5L51A 3GLUA 3NNSA 4R51A 3KQKA 4TV9A 4JI7B 3C4VA 1KDZA 3LC7O 2WHPA 1VSBA 3OVMA 1CUZA 4TS4A 1E1DA 1L8AA 3BK1A 4AECA 2Q5FA 3LXUX 4YRNA 5HR5A 1D4ZA 2FR8A 4BLOA 2C7RA 4KRYA 4W82A 4X45A 4ZALA 5D1NA 1ZIDA 2FXIA 3QITA 3PRKE 4NC9A 4XTCS 4J0DA 4JVMA 1KEUA 4CL2A 1YR1A 3CV3A 3QYJA 4MWBA 4P3YA 4CE6A 5H3CA 1SXGA 3LDGA 1AZTA 1Z73A 1W29A 4KR9A 3O82A 1PJAA 4A0SA 4LMBA 1Y63A 2RH9B 1JHOA 2G9RA 4NFYA 4EUFA 2CXPA 4GR4A 3N53A 4TKZA 3TR0A 2H7XA 1P0CA 1RP1A 4X7BA 1ZN8A 4GI3A 4D02A 4A27A 4J6EA 2X8AA 3G2OA 2FZEA 1ZG3A 1KO1A 3TVDA 2OHHA 1P4HA 3VO2A 4CKWA 1EGQA 4PPGA 4G5XA 1XD2A 2RBKA 1RAEA 4X00A 3M89A 1FVXA 3C24A 4EPWA 3CGGA 5DLDA 4F45A 1VP3A 3AJ9A 4Y9SA 4ZT5A 5LA6B 4A2CA 1P2UA 1QPGA 2YMPA 3ZXXA 3VH4A 1P5FA 4U7WA 2VLBA 4IVQA 2G9NA 1Z0ZA 2VVTA 6ADHA 2BC9A 5J63A 1VZ3A 2HNAA 4XIIA 5JS2A 3UZUA 2P9EA 1A5SB 2IXDA 5D5HA 2B6NA 1HT2E 3B9BA 2NSYA 2SECE 4TTIA 2YN4A 4CLDA 1VPWA 2ZUCA 2CDAA 5AW2A 2QBYB 1JQDA 1N5OX 3N7TA 2RCNA 4YAOA 5AK3A 1JU9A 5DHQA 2AFHA 1YS9A 5CVEA 2X7HA 2ZPTX 1IVSA 1J56A 2I6UA 1JW9B 2IZOA 4A73A 3H1FA 2GJ4A 4ZEWA 2ZU0C 5JJCA 1SU6A 1B7GO 2J48A 3M1IA 5GTDA 1YACA 2H5LA 3L92A 1M2OB 2VHWA 4E15A 3FCUB 1JA9A 2ZTMA 4B4DA 2IYLD 1OA0A 5JWHA 1TMKA 1XLTA 2RHCA 4G65A 2B5OA 1CVRA 2QX4A 5JARA 4BL5A 4XYBA 3WZ2A 1NLZA 5JZOA 2CMHA 2QTGA 3IEXA 2PR2A 3OMWA 4O1HA 4ON9A 3UUWA 4Z4GA 4MVWA 1NC1A 4ZCMA 2SICE 3MTEA 3OAAA 3KLMX 1U6KA 4Q18A 1RXUA 1J21A 3IR7A 4QYMA 4E07A 4MQFB 8MHTA 3WGUA 4P32A 3TOVA 1MO3A 2XT6A 4K28A 1F7UA 1QCYA 4I8XA 4MUNA 3KALA 3T15A 4FGZA 3ESQA 2PUBA 4MV0A 4DANA 3K5IA 2ORVA 1R0WA 2VCEA 4BO1A 4NDZA 1CC1S 3AF2A 4WLNA 1ZRSA 4GLJA 1E6KA 1E7YA 1Z0SA 1G1MA 3DAGA 1DG3A 1SKAA 2WSLA 5CA0A 4C06A 1Z0JA 1QZTA 3GI1A 3FSRA 3ZU5A 1KAEA 1RM4A 1NY6A 3GQBB 2QTHA 4NE9A 3ZW9A 4UMVA 4E5NA 5JV5A 2XOEA 2AZDA 4IEIA 4X6UA 2EVWX 4LV8B 4JDUA 5JS1A 2OBBA 3QV2A 1E3DA 3L4BA 1YZNA 2QTVA 4MQEB 3K1AA 4RYDA 2QTNA 3DHNA 5LP6C 3UEOA 2ST1A 2ECOA 3L5KA 4ZTBA 1RRFA 3B6KA 2IW1A 1U81A 4MUXA 1TU3A 1OREA 2Z1MA 1V3VA 3WWZA 1BQ4A 2XYHA 2O8FB 3GAMA 3UXEA 3NJRA 1NPDA 5EJEA 1RSZA 5I7UA 1A1SA 4EF6A 4L8WB 1TQDA 2ZQ5A 2Y0CA 1XG5A 3RJ5A 3SU8A 3CUUA 3QOYA 2V4UA 3DC2A 2A5JA 3SYKA 3I37X 1A5TA 2O0KA 4F3RA 1UC5B 4BB9A 2JARA 2VDVE 3BHMA 3CB2A 3AWIA 2VIIA 3EIOA 4TTSA 4RETA 5KKAA 4B1FA 1G9XA 1NW6A 3GC6A 2DUWA 4FNMA 1WW2A 1WV1A 2QNIA 2GEKA 4FGJA 4KN6A 2R6ZA 1GTL1 4W1PA 2GQ0A 2HW8A 4OI2A 4GDFA 1G3RA 3MOSA 3ETLA 2NYRA 3TW4A 2VQ6A 5JMWA 4AY5A 5K0SA 2BFDB 2FFQA 1PQPA 4KO2S 3ANYB 4K87A 1TM7E 1YRLA 2CDRA 2OCAA 4LBYA 2JI7A 3PQFA 4LNUB 2BFCA 1AN9A 1T8PA 1NXPA 1U2QA 1VLQA 3HU3A 3SYRA 3ZK7A 2IZZA 4OHKA 4DR5B 1DKUA 3K15A 1A27A 2IP4A 5CX1A 2ZJ3A 4LG1A 4W1SA 3WK8A 2GTPA 2Z95A 3JXEA 5K0BA 4CF4A 4LOAA 3KT6A 4MUMA 4CUZA 3ESDA 3HB7A 4LZZA 1JG1A 3WYEA 5B7QA 3N2GB 4MA4A 3DPSA 3PE4A 4DDUA 4BAZA 4CKCB 3PQ6A 3WJAA 4OHPA 2J5XA 5J5CA 5FH9A 4L07A 2I2FA 2ZT7A 5E3IA 3OX4A 4Z0HO 2J9RA 3NGLA 1NUQA 3GQVA 2NV0A 5T57A 3RC7A 4CM4B 3BCRA 3G0DA 2VHTA 1O9HA 2QIOA 4N7JA 4UNIA 4I1PA 5JMTA 1C8VB 1L3IA 1UH5A 1MJFA 3P2MA 4JKIA 4B43A 1A5BB 1V0JA 2IBTA 1NW9B 2ZAYA 3GLTA 3FDZA 3MXTA 4RLFA 2ZAGA 3WICA 4DCPA 3C1UA 1YCHA 1GL7A 1PS8A 2I67A 3UMVA 4MAFA 2XT0A 4KRFA 3V4OA 3UPUA 1ZM3A 4GHWA 4ZANA 1GXSA 4G1FA 2IXGA 3NUQA 2AX3A 1PK8A 2J0UB 4IUYA 1DKPA 1RFLA 1ZDMA 4S1OA 1JLLB 3IMCA 4YRDA 5IX8A 2IU0A 1COZA 4GBGA 1T9BA 5F9MA 4Z9YA 3OT5A 4B7XA 4Z7JA 1YR2A 2CJYA 1ADCA 1MABB 1I3CA 4J0FA 2FKAA 2M32A 2XMCA 4P3OA 4WZ6A 2WB4A 3IE1A 1GEEA 1O9GA 1ORRA 4MGHA 4L2IB 1Z5VA 1P3Y1 1R5JA 4YRAA 2PGNA 2GLTA 1BXRA 3QLTA 2D3WA 3NRJA 1KPGA 3TSAA 3WWCA 2CDCA 3ABQB 3ROXA 5LLTA 3CNQS 3RTBA 4MVJF 5CAEB 3GRCA 3E03A 4RH1A 4B32A 2WJVA 3FYUC 3RYFB 1NXSA 2AOTA 3JQDA 2EC5A 5G3ZA 4CM8A 4LE1A 2UYHA 1TTHA 8LDHA 4N8EA 4EY7A 2BHTA 3BXOA 3NVKI 3F4KA 1KMNA 4PO8A 1SVUA 3KOYA 4F2DA 2VTDA 2DFKB 3GWGA 1O5IA 3ITEA 4FNGA 4XVCA 4U9IS 1N5JA 2P2CA 1JQAA 1TGVA 2M2IA 4BFTA 2V5UA 1HYQA 3TLKA 3C87A 1PWYE 1N2XA 1PUIA 2JJMA 3L1JA 1MQ8B 1OUMA 3CRVA 3Q9LA 4ME6A 2HI0A 1V35A 4M9XA 4QVIA 4K9PA 4A6XA 5F5XA 3VNAA 2HU8A 1LEHA 1ZZEA 2XTJA 4KXNA 4D9MA 3G2LA 1QVVA 2Q9AA 1BZYA 4IL5A 5FR2A 2C3YA 3DMFA 4KBYA 2J0SA 4QFCA 1CUIA 2HUNA 4U02A 4D74A 5AKYA 3NNDA 4CN8A 3GZTB 3TH5A 1ANKA 5BYJA 3HYLA 3H2KA 1ZJWA 1S3FA 1KJ9A 2PX2A 2PX3A 3CRW1 5FAKA 2O8NA 1NZJA 3EWNA 3RGGA 2FW6A 1ICIA 4G56A 1C4XA 4OUDB 2I6SA 3L8GA 4YMLA 1EBFA 1Z5PA 2WW8A 1RBZA 3SQDA 4DCGA 1V1MB 4K05A 3ZLVA 1D1SA 2YWEA 3DTNA 3FPSA 4R31A 5T8KA 2ZIUB 4BLWA 3DA8A 1ZM7A 1T26A 5HX7A 3KSZO 3A7EA 4Q4HB 3F47A 3RGWS 2Y2VA 3HBFA 2BUBA 4ZV9A 3VR6A 3OOWA 4EGJA 4HUTA 5H3LA 3GPIA 5A7FA 3JYPA 5NLLA 1BJKA 2PUWA 4NYMQ 4BXOA 3DZBA 5JS6A 2IXEA 4IDNA 3DPUA 2E4XA 4DLSA 1P1CA 1F1BA 3DE5X 2GN8A 2OZLA 2JS7A 3BWEA 3HKCA 2GWHA 8ADHA 2FLWA 2QRGA 3QKTA 2HBQA 3I5YA 5ALOA 1C7JA 6ABPA 3F6SA 1YOBA 4NICA 4IGKA 3LVFO 1B1AA 1CUAA 1BH6A 3HL0A 3MMPA 3OKFA 5F2NA 3P0FA 1FFBA 1BMDA 1KNXA 3P71T 3A4YA 2PLWA 3WGYA 4EJMA 4L9AA 4V0NA 1ENOA 1HE1C 5ARDA 1Y5RA 4W5HA 1LWOA 3E9NA 5D2CA 3SZLA 4D9BA 4DMGA 3TZLA 3PJGA 3VDQA 1KY3A 2J3HA 1MH1A 3B48A 1JLMA 4G4IA 4MEJA 3FAZA 1XTIA 3LYAA 2HF8A 3OEHD 1JVNA 2Z2ZA 1XLWA 5KYUA 5CB4B 5LQNA 5L6MB 4IDAA 1F0KA 4ZFNA 2ZPUA 4OIMA 1EUCB 5HF9A 1QF7A 2MINB 1OXMA 4PZUA 5JHGB 2BGIA 3ZYCA 3WGNA 2V3WA 4MLZA 1OLXB 2YCBA 3AUSA 3ZK8A 4BCBA 4EMTA 3QEOA 3KQOA 4C5AA 2LD4A 2VJNA 4UE3S 3TPCA 5CFLA 4CFZA 4Z54A 5BWNA 4LDQA 1J8DA 1HRKA 2PGXA 2OILA 2R6GA 2VO1A 4I5FA 4IUCS 3JAWB 4M8LA 4UTZA 3WQQA 4DT1A 3JZDA 3I64A 3ZZTA 1ZR4A 3EW9A 1TZMA 1VE3A 4I46A 1OWMA 2XNCA 3OBBA 4JOCA 2GAOA 4MRRA 4TLCA 5KVAA 1YC5A 3UUEA 3ZE0B 4C0AC 5LQDA 2XF8A 2I1VB 1GQYA 3CH6A 1RJ9A 3D7SA 4EA7A 1U1GA 2VQSA 1IQUA 4NNJA 4YQFA 1QTQA 2WKSA 2JFHA 1SAYA 3V3KA 2J1LA 2JAHA 5K2OA 2DF8A 1DHRA 2C4UA 2PEZA 2A1TS 3BDAA 3PTLA 1SCAA 1NMQA 1KBOA 3WGVA 4TYYA 3RVMA 4A0HA 2C2HA 1C3XA 4DJDC 4EZIA 4OYRA 1FRQA 4MR7B 1UJ2A 4OYLA 4UQOA 4CU2A 3AG5A 3MFYA 4DLUA 1OC4A 4A6PA 1WKBA 4X1YA 4Z2AA 3MQ2A 1IN8A 4IVPA 2G9QA 3P9NA 5JDIA 3A2NA 2AK2A 2CZCA 4H77A 4LVUA 4C6HA 4CHTA 3E9ZA 1J8FA 4JC0A 3HFSA 2FMKA 2OQRA 4DIFA 5F9HA 1Y82A 1XU9A 2AWOA 3RR2A 5HQTA 2QI9F 2G1AA 4Q9LA 5FTKA 3HCDA 3WZLA 3IHTA 3MMXA 2CUTA 5D87A 4C5BA 3V34A 1I6MA 2GKGA 5CG1A 2IA5A 1J00A 4LCJA 3U09A 1GCOA 2H7YA 2EU8A 1IULA 4BNGA 4PICA 5SZKB 2EBHX 1QHSA 1V1RB 5FOXA 1BW9A 1ZR2A 1Y6GA 2BSXA 2ZSJA 2YWGA 4WKOA 1F2TA 1W93A 3H04A 3QVSA 1J33A 3A2LA 5HSGA 2C8KA 1XF9A 1YZYA 5ULLA 4BO8A 4D45A 2FPIB 3QVVA 5SY9A 5FI1B 1II8A 1U5BA 4MZXA 2IUUA 4LRWA 5KAMA 3QW4B 4J0HA 5A4FS 3WKCA 2BF4A 2F9LA 2IOQA 2X8BA 3DMYA 3NEAA 5IK2A 1Y3AA 2JAPA 2PNFA 3TAXA 1R0ZA 3VKVA 4KE9A 2VUSA 4Y1RA 1K0UA 3VU9A 3GLGB 3SPXA 1UM9B 2I7DA 5E6RB 1KFJB 2GBPA 4J0KA 4MGKR 3GJTA 3QSYA 1M0WA 3FFBA 1WS6A 1QE3A 1U0SY 4OK3A 2K87A 1NJ5A 4HDNA 4AZTA 1Y81A 2CCJA 3UXHA 4TRJA 3WYFA 2HLHA 3M6FA 2OMKA 4M8KA 4R0VA 4YHBA 3RIYA 1C9DB 5HZHA 4INPA 3KE9A 4WOKA 2TMYA 3KEOA 5CURA 4PRKA 4F6CA 2OUKA 4S1WA 4F1WA 4PTYA 5BNWA 3K09A 3ZLJA 3R77A 2XY4A 3WGKA 3SBDA 4YMTA 3VDNB 2O4CA 3UHAA 4C7BA 2NTVA 1YMVA 4OB6A 4BVHA 2UZIR 2O59A 3KXIA 5BSUA 3W79A 4ZCIA 3WK6A 5FI3A 1TKRA 1K9SA 4IRUB 1UBUS 2R9VA 2CFOA 2DFNA 4RDXA 5CCBA 3KLOA 3GMTA 1SK8A 2Q6KA 2YHUA 1GLVA 1T36A 4JC5A 1ACMA 1T8WA 5DN6A 2IEGA 1M7GA 1JNYA 4DCTA 1YFLA 1YJBA 4WK0B 1GZ3A 2FPKA 2J3EA 4HQ0A 4REQB 1KO7A 1YONA 1BDHA 1X1AA 1ISHA 1RPTA 3AC0A 2V7PA 1X74A 1VKZA 4PYJA 2OENG 1XRQA 3P4XA 4YUYA 2QN2A 4W8OA 1TCUA 1G21A 1XRRA 1XVAA 5JXHA 1T8TA 5IS2A 4IV5A 4L02A 1F38A 2WFMA 1XZPA 1FQOA 4RKYA 3HUUA 5EEHA 1SVWA 1SHKA 1DXOA 5COBA 1Q7TA 1MX9A 2Z09A 3FRJA 2ZIGA 4PIPA 5JPIA 3ONWA 5IJ9B 5K4GA 4XQ9A 4LV5B 1R74A 2HKIA 1RBYA 3SIWA 4XE5A 1EP3B 5GGYA 1BU8A 3T3EA 5BQFA 3ZE8A 2OGZA 2FEXA 1QF9A 1JE1A 1TFRA 3T3IA 1S01A 1S1MA 4BO3A 3KG2A 4XD7D 1MGPA 3BMXA 2PRKA 4U9UA 4RAOA 5IVKA 3F4BA 2OLJA 4NYMR 1RQPA 1GPDG 3CGWA 5F5LA 4WHMA 2CGEA 3SXPA 4YIHA 1PRYA 1KO8A 1PTKA 3ROGA 2QJTA 2XNHA 3DAYA 4F85A 3CKKA 1SXQA 3AH8A 3AP2A 4UZSA 3GVHA 4PNHA 2WM9B 1Y3CE 4X84A 3R5FA 3NMUF 5DCYA 4GRDA 1CK4A 4E5MA 4II7A 1GQOA 1B3RA 1QR2A 3ADOA 1D8AA 4MMXB 2PGDA 1O96B 3MS2A 3RQSA 3DKPA 3KQSA 4KBGA 4MS1B 4DRZA 2D1YA 4ALNA 2VHJA 4RTPA 2OVFA 2VZ0A 1VXOA 2FUKA 2ANCA 3RS9A 3ASUA 1UP4A 2C03A 2MDTA 4OGWA 2YFYA 3ZG6A 4UBNA 1CUYA 3IYLW 3AETA 2OV2A 2WILA 1WDTA 4E2WA 3BD7A 4OAPA 1Z39A 2HLDA 2TMDA 3A4MA 4XGKA 3HDYA 2GZRA 1GFIA 2KB0A 4CMIA 1E8DA 1L9XA 4B6RA 5EJIA 1EWRA 2KX7A 4HWTA 1F4PA 1DEHA 5F7OA 1WPXA 4UHDA 3ESBA 4GL4A 1R64A 5AXDA 1XALA 4QJ3A 1WCXA 2P90A 3HYSA 4U2EA 4GSLA 2VRCA 2AOUB 3L1KA 3P0RA 3PR2B 4FGKA 3D5QA 2PJZA 4NEQA 2FDRA 3MCVA 2BFPA 3U4IA 3AR3A 4KQWA 4RPGA 1V11B 2QY9A 2QZPA 2MCFA 1AV6A 3NBFA 2W93A 3QRWA 2PV7A 3HS3A 1VJTA 3QF4B 3U62A 4B6GA 4JNCA 2WJ4A 4HN2A 1GG2A 3WX0A 2R68A 4MI6A 2X5JO 1QGED 1A0OA 2H52A 2FUCA 3UWPA 4EVQA 1Z2AA 3C16C 5EJ2A 2G3YA 3OECA 3V8NA 3ORRA 2GZDA 4QQKA 3SSAA 5J59A 1EX1A 2Y1KA 3EVBA 3U2QA 2XCUA 3IURA 3TTTA 2QA5A 4TV8B 3L8EA 3QV1A 2F90A 3QFFA 2F8MA 3ZOKA 1YRQA 1U0RA 3QE0A 4NH4A 4NULA 1X15A 1W8DA 3A14A 3M9LA 2Y0EA 5KCMA 2JLCA 2R8XA 3Q2KA 3BTSA 4PX5A 4F5YA 5BWCA 2H1WA 2VDJA 3BRCA 4IG4A 3IMEA 2XVMA 4B3XA 2LV8A 1B42A 2ZG6A 3EMKA 4RA6B 3ELUA 5G53C 2XOKA 3TMAA 2I8AA 4CM6A 4KBFA 3KQNA 3RAJA 3T95A 1JU3A 1F1JA 5L3QA 1P39A 4OSEA 3T52A 1UBMS 5JSKA 4U0JA 3UY4A 4B7CA 3TQOA 4J0EA 1ZHHA 1HDRA 2ZI6A 5LZ8A 2RHTA 1HZJA 3BKXA 5IARA 3EVDA 4MKGA 2J9YB 4QYIA 5A7HA 1G291 2NAPA 2JHCA 3OZRA 3TL6A 4WFQA 1F8YA 5GM2A 2B4AA 4LJ5A 3QXGA 4DNXA 2P41A 2ZB8A 3GJZA 1AUQA 4L28A 3ZZMA 1OBFO 2RHJA 3O5AA 3BC1A 3JRXA 5B64A 1VFNA 1I1QB 1W44A 3FBTA 3KDAA 4TMZA 5C32A 5JI2E 1GM5A 1G8JA 1WA5A 4MX8A 2AB0A 4JZYA 2CUZA 2W6PA 3ONFA 4FCVA 5P8WA 2POCA 4WLOA 1J2JA 2LNDA 3MG9A 1XF1A 2BKLA 3EGEA 3WDLA 4BKPA 3EK2A 1OYYA 2FCRA 1QO0A 2ZIFA 4BNMA 3FMOB 2JFXA 3SEAA 2GBLC 1N7HA 1HKUA 2A67A 1G98A 2BIFA 1VCIA 4CKWB 1PSDA 3CC8A 2PRSA 1W76A 5CGQB 1G8AA 2EV9A 1L5NA 5DP2A 1YF3A 1PJLA 4EECA 2TRSB 4N54A 3GLSA 2OFFA 1SULA 2Q1TA 1UANA 4CF3A 4QOGA 1Z75A 2ONKA 5TQJA 3DLCA 3I23A 2AYZA 4J76A 4D57A 2FSHA 3HFRA 5DK4A 3RI3A 1Y1RA 2DG2A 4EKIA 3FPAA 1UDRA 5C1DA 1R0LA 5ITZB 5JATA 2JG3A 4M9CA 1SVLA 2DH6A 3G49A 3M6MD 2YTZA 3FF4A 4MV5A 1JHVA 3KUXA 4TWIA 3WYCA 2X9LA 2GAJA 3LY9A 1N7GA 4FILA 5AESA 3DOFA 1EE2A 2RJ3A 3WIDA 4LRYA 4DBLC 4FR5A 4UEOA 3VNSA 4PR3A 4ZMSA 4D0LB 4LY0A 5KWVA 5ADHA 5ALJA 4MW5A 1E1RD 4G07A 2AFHB 1KBQA 2P2DA 4YPFA 1REQB 2NN3C 2R44A 4WESB 3UW1A 1RYDA 4DIEA 1WEHA 1B16A 4DWOA 2IHZA 1UKZA 2C4KA 2HTEA 2QP4A 1KZGB 1ZPDA 1WXDA 3KQVA 4OKSA 4JXJA 3F6PA 4YLGA 4R01A 5IP5A 3PQCA 3EFBA 3QVOA 3RDPA 3D8SA 3MGKA 4MUYA 2PJDA 3KE8A 5HKOA 3RYCA 3GZJA 3QELA 3ZXYA 2BFNA 2I3GA 4R2JA 4KWHA 4RSHA 1PFGA 1C3OB 5CLIA 5B2FA 5BORA 3B6JA 1O6ZA 4G1VA 3W6PA 2YXDA 3CONA 3IVGA 4QXMA 3O4JA 1PI3A 2PL3A 4KXMA 4RQAA 4YR9A 4S1NA 4BFLA 4GXQA 1O8CA 2BH9A 2Y67A 4HFRA 4U7HA 5LZ2A 2JFQA 2BN4A 3W8NA 1KERA 4GBMA 1JQ5A 3LUAA 2X4IA 1G64A 2QTCA 4JLAA 4JJEA 421PA 4Y6RA 4V3CA 1MENA 4WZBA 5DHRA 5BSGA 4P81A 2J07A 3ILHA 3KR9A 5ARCA 4B6OA 1TOAA 1EA5A 3DWFA 3CSDA 1IPHA 1V5WA 2PMFA 3DDUA 5D5PA 5I7EA 5IC6A 4GVLA 4ZCPA 3RTEA 2BCEA 4YMHA 1QWSA 1OZ0A 1FP2A 4TTPA 4FT4A 3ZQKA 3ECAA 1Z36A 1XTBA 2HJ9A 5GWXA 4HMOA 3ZQ4A 4JJ4A 1DX9A 4RCVA 1S3IA 4UU7A 1EEXB 3VISA 4ZI7F 3V32A 3I8OA 4L15A 5AHOA 4MI3A 1JZSA 3W9YA 5HUHA 3K1AB 3F6EX 1D4OA 1Y7HA 2XNSA 3EG5A 3MTDA 4OU4A 1ZRMA 4PSCA 1GYRA 4L73A 4PBTA 5BN3B 1I9CA 1N2OA 2FPXA 5HYVA 4IEEA 4KZPA 1FB5A 1X77A 2XLBA 3GXOA 3RHSA 1K9VF 2NZYA 9ABPA 1ONBA 3ZDDA 1RJDA 4KIJA 3HVKA 4HVTA 4JEMA 5FRDA 1FFDA 2XBUA 3ETJA 2ZQYA 4A16A 4OU5A 3EIHA 3PPIA 4MW0A 3PGJA 1CS0A 2Z2KA 4Q1CA 4JH0A 4XTRA 2Z3WA 1DQNA 4CL8A 4D2IA 3VPHA 4DGQA 1U80A 4JOQA 1OWOA 5DPMA 2REQA 4L0CA 2R1VA 2A14A 2BONA 3ICVA 4QDJA 5GONF 5DYWA 3AUUA 4BC0A 2GHQA 3PT5A 3O2JA 1X1EA 2O2SA 2WY2D 1HGXA 3I4LA 3OIFA 1TMOA 3HDVA 1ULTA 1IBLB 2QMOA 1GCIA 3C3MA 2Z9CA 4Q9HA 1KAGA 3U19A 1J5EB 3CLKA 4Z4CA 1KSGA 1RJEA 5DNDA 2R5FA 3M6LA 1CIVA 4ZKDA 1GWNA 3IJPA 4J1QA 2BFCB 3IHKA 4P5DA 1PDOA 4DL9A 4EW6A 4I6JA 1ILWA 1HE8B 3JZAA 4MCHA 1N3LA 1V47A 3H9GA 3RVNA 4BNZA 4CKEB 1NI5A 2IPAB 2VT6A 3GA0A 4QODA 1U1IA 3LOPA 5CX1B 4WEQA 3Q8LA 4EW2A 2JIMA 4H1HA 1CUHA 4IYRA 8ABPA 1JR3A 4ND7A 4G9EA 1MRSA 4XGQA 4CQNA 1IWOA 3NG1A 2DQ4A 5F5NA 1NUTA 2ZRHA 3VPAA 2F17A 2QQGA 5IBCA 1U9IA 3ZJTA 1J8QA 2Z8XA 3FY4A 3MGAA 3SICE 4Y0AA 3KSUA 2FMXA 1KEPA 3K8YA 3QX8A 1MOZA 4NU8X 4X20B 1T2CA 4TN1A 2CNBA 1JHYA 2RMKA 4XUGB 4ND2A 3HR8A 1E1NA 1C9MA 2J9XB 2PTGA 1EDEA 3FNBA 3SKXA 3ZV7A 5B1EA 1T2DA 4LJRA 3FTQA 4DG9A 3NTUA 2PZKA 4WXMA 2OC9A 3FDZB 4KAFA 1CQXA 3HCCA 4ETWA 3FOZA 1RPNA 5AHXA 1B26A 4P2GA 2EYUA 5C8XA 1EDZA 4N3BA 3GF4A 1ZH2A 1D9ZA 4ZHQA 1GXSB 2NNWB 3B6IA 3CPSA 4JYPA 4A6EA 4BNDB 1E1KA 5CH3A 2H5JA 3HR4A 3PIIA 4C01A 4P82A 3FTFA 1UDCA 3TINA 1ZY2A 4Z1OA 2YICA 1RXIA 4A03A 3NYWA 1BMTA 3VR4A 4EQ6A 4OI4A 2FWIA 3T0FA 1NDHA 1VSQA 2QAGB 2R87A 3L1UA 1WB9A 3RFXA 4M2LA 4DW8A 3RSSA 1FIUA 3DAHA 3Q8WA 4YPVA 4YO8A 3H87A 4IINA 4JB3A 4HDCA 2XTAA 1S6YA 2J6BA 2JASA 5IEJA 3LL7A 1AGYA 3DE2X 3ENWA 1C29B 2VNKA 2I80A 3QIVA 1OTXA 3MJDA 2VOJA 2H5EA 4EB3A 2ZK7A 3VAAA 2QMHA 2CFRA 1WWKA 2JFWA 1O5TA 1LH0A 1R27A 1W9MA 4YMSA 3CYFA 1IY1A 3AKYA 4BBZA 5B6PA 2RE8A 5EJFA 3QVTA 1W48A 5C5DA 2X6QA 3WA6A 1RWXA 3UNXA 2V4ZA 3PF9A 4W6ZA 3TDKA 3WLLA 3ADDA 1C7RA 1QG4A 4O4HB 2B8JA 3FPHA 5JSYA 3TCNA 4EHHA 1C3JA 1MIOA 4PLVA 4YRMA 1NSYA 3DFUA 3O8RA 2VXYA 2X5XA 2VKQA 3ZY3A 3TF5A 4DTCA 3E61A 5IK2D 1TEZA 2OM6A 2I55A 2CT8A 4B46A 1F20A 5FL7D 5MGNA 4I4NA 1T1SA 5K51A 1Z7WA 3K2EA 3PXCX 4KGZA 4YCBA 3GBSA 4D4JA 4AQYB 1RE0A 2GM3A 4B31A 3KYCA 3CNEA 2XDQB 4MYSA 4D8YA 3S8EA 1ABBA 3ZTWA 4DQLA 3KKKA 3LCRA 2CFTA 3BORA 5DH9A 3HCPA 5GGXA 1KE2A 4UUPA 3UAGA 3JVDA 4BEWA 5ICSA 5FUYA 1DPGA 5BPFA 5IF3A 3IBFA 2OGTA 3IEKA 3LBIA 4ZRDA 1KH3A 1RMQA 1JIXA 1ZJZA 3MHPA 3T0GA 5BWBA 3GMIA 1NXOA 3O3CA 4Q9NA 4EG0A 4ZARA 2GBFA 2JKZA 3RHZA 3CLSD 1IHPA 1BKYA 1XEWX 2VT3A 4C4SA 1G0OA 2ZYWX 4CV0A 1Q14A 1TCCA 3LBNA 2G09A 1XVIA 4DTIA 2NSHA 4N0DA 4RADA 3FX2A 1KI4A 1MQ9A 2ZE5A 4OHFA 2Q4OA 1AC5A 1E9V