3QVGB

Xrcc1 bound to dna ligase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
EPPDLPVPELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDRMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/ligase
molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgB00
3L40A 2JW5A 1GZHB 3I0NA 3PC8C 3UEOA 3PXEA 4Y18A 2E2WA 4XQ0A 4JLUA 4ID3A 3T1NA 1OQAA 2COEA 3K0HA 2COKA 3T7KA 5ECGC 4BMCA 1T15A 1CDZA 3K05A 1IN1A 2XNKA 2ETXA 2EP8A 3SQDA 4U4AA 3PC8A 1Z56C 1T2UA 4IGKA 3UENA 4BU0A 3JVEA 4OFBA 4N40A 1L7BA 1IMOA 4XPZA 3EF0A 3L41A 2L42A 1L0BA 2M2IA 3AL2A 2ADOA 3PC7A 3QVGA 3II6X 3SHTA 3COJA 4BU1A 2LE0A 3PXAA 2AZMA 3K16A 1WF6A 3HUEA 3SHVA 2VXBA 3OLCX 4Y2GA 2NTEA 3PXBA 3K15A 2COUA 2D8MA 3L46A 1JNXX 3KTFA 2HTFA 3U3ZA 3K0KA 3PA6A 1T29A 3AL3A 3PC6A 3T7IA 1Y98A 3HUFA 3I0MA 2XNHA 3T7JA 1KZYC 1T2VA 2INGX 2VXCA 3QVGB 2K6GA 3FA2A 3PXCX 3PD7A 4IFIA 3SZMA 2WT8A 3EF1A 2EBUA 3PXDA 2EBWA 2DUNA 2K7FA 1N5OX 4BMDA 2R1ZA
chains in the Genus database with same CATH superfamily
3JQBA 1BMFD 3C7DB 4Q03A 1H3NA 2HIHA 1W73A 2KX7A 5D5HA 4S0XA 4NFLA 4I1IA 3A05A 4QD3A 1EQUA 4JB8A 1TA4A 2YIVX 4ID3A 2H52A 3E9RA 3F6CA 4H3VA 4D3YA 3NAGA 2RE8A 1NBOA 2X4DA 3WIUA 5K2OA 2R0QC 4CR6A 1ZU4A 2HY7A 4C4PA 4JV5B 2DF8A 3NIDB 2J3QA 2EFDB 3Q87B 4IX1A 4PGGA 4UBOA 1E2FA 4YA6A 3PNPA 4F4FA 5ITVA 1A5TA 1MC4A 2VHEA 4R9SA 5T8KA 3GW8A 1I2CA 1W5AA 1OZGA 2GK6A 1IDN1 2ZYVX 2HSJA 1L8OA 4FFNA 5DBOA 2IU0A 4F4JA 3K9HA 1K8YB 4I4TA 2WWGA 1Z0IA 3DONA 4RUKA 5E7QA 4UM9B 4TSKA 4OX9Y 4DMKA 2YNMA 3B7WA 3GFSA 2WP0A 1GLNA 3IEIA 4KFSA 1O9HA 2QTZA 2RI0A 2V98A 4M1TA 3L3BA 4IINA 3DEIA 4TMZA 3VI3B 4WUTA 4ZRDA 1NFQA 3ACDA 4YJHB 5CCEA 1N2IA 4UDOA 1PJSA 4BNGA 2L2QA 2PH7A 3UK1A 5KMGB 4DA7A 1P77A 5ALYA 1OZAA 2Q5CA 1IL0A 1U8FO 5CD1A 4RX1A 1YR1A 4HXGA 4P5DA 1YO6A 3EF0A 1XRMA 1M75A 3EY4A 4JLAA 4D4GA 4KR3A 2EBFX 4J0DA 4XRRA 3MTGA 5F52A 4IHAA 2AOVA 1E7MA 1E2HA 3VYSB 5AW7A 2F2TA 1DBVO 3GYGA 2QT0A 3TTVA 4B9AA 1UEIA 5DISB 4BEVA 1E1QD 2WJYA 5D7NA 1Z4OA 2BMVA 3IBYA 5E1BA 2WLSA 3DLCA 5K1ZA 4R71A 1SXJE 3ZWMA 1YE5A 4MVJI 3L92A 3USZA 4ZTUB 3W3ZB 2WF9A 2H0RA 4EPWA 4WN9B 2I6GA 4EL0A 2B3TA 1L9KA 4YXFA 2CUNA 2PWAA 4QUDA 4UD6A 1B8PA 4OO3A 5H9VA 3WIBA 2ZUSA 1ATIA 3N8IA 3I5MA 5B58C 5C37A 2PKWA 4ZI7F 4RTQA 4R2HA 4C76A 2YTZA 3OTHA 1VB5A 1QYXA 4KLAA 4BFTA 4PNHA 3UY4A 2AJTA 2QIOA 1YOBA 4Z0HO 2XXBA 3OT5A 4EYSA 1E1KA 2GRUA 3JW8A 1GCOA 2AH5A 4I55A 1T36A 1D8TA 5AK6A 4ZVLA 4EECA 4HS9A 1YVPA 1WLYA 2JBHA 3N2KA 4Z3DA 4EHLA 1PD0A 2QORA 4WKGA 1AMUA 4CMAA 2GYWA 1GT91 4F71A 5JHGB 3MA0A 5C5DA 3LT1A 1TD9A 1QCYA 2LZ0A 4HD8A 2I87A 2TRSB 5JNLA 1E4OA 3EUEA 2EX0A 1U2DC 3KZCA 3A6ZA 1P62B 3NWJA 1RHUA 2VWGA 3OPXA 2FW6A 4PPFA 5IM5A 5BOSB 3IHKA 3JSXA 2UUAB 2AMFA 3P20A 1F8UA 4JS0A 4W1SA 1BHJA 3NNSA 5CLHA 3PDIB 2WB2A 5JCPA 1PVDA 4EB6A 4EGQA 5HVNA 2B2XA 4MKFA 5HBGA 2Z8XA 4O2BB 1XTZA 3OCWA 1IEXA 2VH2A 1KJNA 3L8HA 1IOWA 2MMGA 4E0BA 3T5PA 3AXSA 3MXTA 3RYFB 3HJFA 3NOQA 4PTYA 3TIGA 2RH8A 4JDUA 5B58T 2IOFK 4M54A 1TF2A 2MYNA 1NATA 1FFBA 1V6CA 3G23A 3UJAA 1KSJA 3PPVA 1GJRA 3ZU5A 1F9AA 2C07A 4YRLA 1ZGBA 1RPJA 4Y6PA 1X3LA 1WPXA 2XTJA 2YYZA 1NR1A 1NW9B 4BPRA 4CIDA 3VR3A 3OQ1A 3WMFA 2DQKA 2D2FA 2DWUA 1Z17A 2IE8A 2Z2IA 1C30B 1FC0A 5G4LA 2OLKA 2GMWA 2ROQA 4RTPA 2FFBA 1UOOA 4GE0A 1BZYA 4RK6A 1O5TA 3NHKA 5EXPA 3ABZA 3DBVO 3JZIA 2IGTA 2CFCA 4LGYA 2PFKA 3PJGA 3AC0A 1NC1A 2R1TB 5D84A 3FTDA 3Q88A 2VZ8A 4IJ5A 3SZ3A 5HGJA 5KHOC 3PFHA 1P17A 3UPDA 4WK2B 5C7OO 5TLSA 4DJJA 1UOPA 2WSBA 3KKKA 4PRLA 5TY0A 4DCMA 4X7MA 4KX5A 1QGUA 2X86A 5BNIA 3PBKA 4GZ5A 4X7BA 1YHNA 3OJWA 3CMCO 2N0SA 5K09A 5KOIA 3A1EA 3D0KA 5ALMA 1MAVA 3WQBA 4B75A 2ZIXB 3GJ6A 3K5WA 3LGXA 2PBZA 4MCAA 5HS4A 2XUKA 4ECEA 4US1R 1EGVB 2NPOA 2WHPA 4K9QA 1PFYA 1U2QA 4UU0A 4LZLA 4RTMA 4LMPA 4BP1A 4B7ZA 4HQRA 4B80A 2FPSA 3G2PA 1IMOA 1SQSA 2GZ2A 2PXCA 4KWEA 5ALQA 3E7XA 3RGGA 1EHCA 3OQIB 4AKTA 1YA6A 2UYOA 1C4WA 3KVRA 4E70A 4BZPA 3IEKA 3SIWA 4GMXA 5J5VA 1S7CA 2G9ZA 5T4HA 2GRAA 4U2FA 4N76A 2CFRA 2VK4A 3R6TA 4L8FA 2FFAA 4DCTA 3KLNA 4UHHA 5DI3B 2WDZA 3IVXA 3QWBA 3PUKA 4GH5A 3BE5A 2NG1A 3CUYA 4JU9A 4MUHA 3EPKA 3E9YA 1DB3A 1TYDE 1ZIOA 3BXOA 4PLWA 4MA5A 3RS9A 1UC5B 5DI9A 3ZLJA 1B0AA 3H1FA 1JIJA 1CLEA 3AEUA 3HB9A 2BONA 2WE7A 3LQ1A 2IEBA 3F49S 4OHBA 3UW3A 2RGAA 1ZAYA 5HEKA 3HZOA 5EWLA 4P38A 1VHWA 3WSWA 1NZFA 3K96A 4TUYB 4HEJA 4D41A 2CMDA 1COWA 1WXWA 2GF0A 5EVCA 3RUIA 4DNQA 2JAHA 4Z7OB 4OXNA 4KAXA 1YDHA 4ZDJA 3DAYA 1BRTA 2PJZA 5AVZA 5JV5A 3P9NA 3HEBA 4LJ4A 4P54A 5IU6A 4R3NA 1SJ9A 3IVRA 5LP6A 1NASA 4L6CA 2WWIA 5K3FB 5C34B 1XB2A 2FQQA 3GFQA 4QQNA 1KI7A 2PT5A 3AM3A 3H83A 4MHOA 3RIXA 2DCUA 1LWOA 1XDWA 4A0GA 5IXYA 5JQWA 2PG3A 3L43A 3QWIA 2NZUG 2OM6A 4DUGD 3A26A 3IP8A 4K40A 2ET6A 4FNMA 5BN1A 4NYMQ 5JYBA 2F9LA 3BIWA 1ZSVA 1FRZA 3K70D 1Q0TA 4MXDA 1KH1A 4KODA 4EEZA 2QLTA 1BVRA 2VH1A 3H8SA 4FQ5A 4KMMA 4V0KA 4DKXA 5F78A 5AVRA 3G3EA 1HYBA 4A26A 1IWBB 5C7YA 3L18A 1T0PA 5EJ7A 2XKKA 5J4VA 8GPBA 1V47A 5JW6A 3IP5A 1G16A 3QXHA 4DWWA 4KK3A 1NJ8A 2E9SA 2NADA 2ANBA 4RZHA 5LBUA 1QJCA 5F35A 5HRUA 1T5DX 4QGAA 1XRSB 1RPAA 2WD7A 4B6OA 4TTPA 1Z0FA 4AJPA 4TXLA 4FEYA 3T3GA 4WL0A 4O4HB 4OK5A 1BMQA 2HK6A 2QHXA 3EXHC 1ODLA 4WEQA 4Z8XA 3AR7A 3L6CA 4WINA 3E48A 3V4ZA 3I34X 4CKBA 3U61B 2JH9A 1NVAA 4BVBA 4ALJA 1QYWA 1WZCA 4R2LA 5DHUA 5KQSA 5CT6A 4MROA 4BQFA 5E9WA 2B0JA 2Q4RA 2E49A 4DDHA 3DT6A 4GI2A 4N7JA 3BL6A 3FHOA 2JJ2D 2QPTA 1SG9A 1XZNA 2IWRA 4OEHA 4NJEA 3TB4A 1ZH6A 1SZPA 1UPUA 2Q6TA 1NJFA 5GINE 2YMPA 2R44A 3MHPA 5JADA 4PZDA 1W2GA 4ZVMA 1R5NA 2HA6A 3AGPA 1ESZA 4LVCA 3G1TA 3T1HB 2YRXA 4RV5A 1PLJA 4IGKA 3CRVA 3F5SA 1TPYA 4LECA 4LC9A 3PXGA 4OQXA 3BIXA 2ODBA 5JS2A 5HUJA 2HQSA 1DC8A 3MIZA 2Y1LA 5EC8A 3RWMB 3CPSA 3PTZA 3ZWBA 2B69A 5EWJA 1IB0A 3CZPA 1JR2A 1L0BA 4YYZA 3NYRA 1FFXA 3SR3A 1ORRA 1FUYB 1H05A 5B64A 4CLRA 4TTJA 2YKGA 4DLVA 1Y7LA 3UK2A 5KKAA 3OUTA 3O4IA 4P3XA 2OENG 4HMOA 4GF5A 4BFLA 4W5RA 3KSBC 1H22A 3H6KA 3VAYA 1QTNA 1O0SA 3ORYA 4G81A 3LQFA 2GDZA 1RCTE 2W0SA 1PE0A 4C0KA 4W7IA 4CDNA 2XVMA 5CYGA 1UBTS 4X1IB 3CNNA 1PJ2A 3AESB 3IAUA 1QORA 4ZO4A 3GFVA 4WK6A 4QNRA 2NVBA 3FSGA 1YR8A 2HMSA 4QL3A 5LR6A 5ECWA 5IFLA 2F7SA 3I9MA 3E27A 4OQEA 1M7HA 4OXQA 3GDOA 3E9MA 2FPKA 1NBAA 3ZUPA 1YZNA 4MYDA 3L7BA 1MN6A 1F38A 1Z13A 1GGEA 4PZAA 3RYCA 1QYVA 1XPUA 3K0KA 2DP4E 4KAFA 5K2MA 4S2UA 3TLBA 3NT4A 1TFRA 1T8UA 3AHJA 1E7WA 1LTQA 2J4FA 1XDBA 3GROA 1JB1A 4ZREA 3HSYA 3T3NA 2QXTA 5EWMB 4IM7A 2H65A 4AP9A 3NBQA 2QYHA 3SSOA 2VSYA 5AOCA 3WDLA 5K3BA 3AJ9A 5EOVA 1FUUA 3B3JA 1M72A 3O83A 5AM5A 1Y1KE 1H5NA 5JRZA 4DGSA 3DYBA 3NBXX 1UBKS 1KS2A 3RTGA 2PDAA 3N86A 1YZKA 1HG0A 4LZJA 4R5MA 2JAUA 3WGGA 2B5VA 2FSFA 1DAIA 4O25A 4OATA 2IIBA 3HN7A 4AMBA 4BMDA 3EZ2A 1YFJA 4HC4A 2CFTA 4GUAA 2PZEA 2YWDA 4MAFA 4NC9A 4WBNA 4TPKA 2CUKA 1OF1A 4WOBA 5J23A 2W6CX 2IUUA 1NP3A 5M34A 1WBDA 2ZVJA 3CLRD 4JLSA 1L7QA 3P52A 2LP4Y 3B7PA 3GHHA 4KVFA 5CPFA 2Q9BA 5AHWA 4JCCA 5FWYA 3BM5A 1XELA 2X8AA 3E03A 3BRWD 1CR1A 1X2EA 3O8QB 2ONZA 3K32A 3M33A 5I5GA 1YZ3A 1RWKA 3DBOB 5A9RA 1EU1A 1TJYA 2JK1A 2ZB4A 5LB4A 1BE6A 3WKAA 1IULA 3IPRA 4L7VA 1RWWA 2IBTA 3FI0A 1CR2A 2QAGC 1BQ4A 1JQEA 2OAP1 4BECA 3SEQA 4MYTA 1WBBA 1PIWA 3PICA 1OX4B 2ZJBA 5FL7A 2C9BA 3WGMA 4BFZA 3N0TA 1YF3A 1LGYA 3MBIA 4XYEA 3OO0A 1HFEL 3AUYA 5DSTA 1R0KA 5DHAA 3DCIA 5LXTF 3GGOA 1SXIA 3JWPA 4RF5A 2FP4A 3ZC3A 3LKVA 3M9LA 5EIOA 4FT4A 5FFFA 2BEKA 1QV6A 2W2LD 3CN9A 2WAXA 3GNTA 2FN7A 3M8KA 5F7OA 2G04A 3EIFA 4DHWA 3CIFA 5KSZA 4OI0A 3AEYA 3F7NA 1URPA 3ORFA 4IHJF 3ANLA 3PVCA 3HG7A 4JB0A 1FQKA 4IDAA 4LTMA 3B6EA 4ENWA 1XRRA 2QROA 1JECA 1O97D 4O29A 4DYHA 3P2KA 1NKTA 2M98A 1XXLA 4G85A 4KRXA 1ZIYA 2P2DA 4C4OA 5D1HA 5I48A 3E7PA 4YWHA 3RVPA 4LF5B 3Q7IA 2CFIA 1U2DA 1VPLA 2PEYA 3DMRA 3MAAC 3P2EA 3G0BA 1IK4A 4XOUA 3AILA 4BNNA 1PFKA 3AP3A 3JR7A 4A23A 1QOQB 4FFSA 1SXHA 1OXSC 1RRFA 5FORA 3TR6A 3ZCPA 3P4UA 5C5CA 1L8XA 1EKXA 1AX9A 2G4VA 13PKA 2M6SA 2W6ZA 4ZQEA 1GPBA 1K27A 2I8AA 3OE7D 1T1EA 4N01A 1D2AA 2BFFA 3VR5H 1YR7A 2GASA 5THKA 2XAUA 4FB4A 1ABFA 1GEGA 2X3UA 4F12A 2HWYA 1EFVA 4BRUA 3HN6A 4ZAFA 1BJTA 1ODCA 1UK8A 5FJIA 4Q18A 1C0EA 2DOKA 4EI7A 3HDQA 5HM8A 1HEYA 1L7AA 1HA3A 4WLUA 4Q3DA 2VHWA 5TF0A 3GGJA 1JFRA 2BHSA 3A37A 4B0PA 1S2OA 1LA2A 1OI7A 3LWNA 3W3AH 3X43A 3DVSX 3EG9B 1XTRA 5FUXA 4A8PA 3B12A 3PK0A 3CNOA 3D7LA 3LLUA 3VSEA 1Y3HA 1PEYA 2XITA 1QS0A 3P2OA 3PHBE 4B7AA 3WWEA 1JA9A 4JL5A 4KWIA 3ID6C 1FE8A 3ISJA 3H97A 3M6VA 5LA6A 4UOQA 3BMQA 4Q4LA 1X1SA 2O23A 5IXSA 4BX3A 3M3HA 1E2IA 4MEBA 1YWGO 4MVJD 4KZKA 3UZUA 4BLTA 2OBMA 4LSMA 4DAEA 1T43A 4B43A 4Z9AA 2PBFA 1RDFA 4IQGA 3FGNA 1NM5C 3DZKA 3PNBA 4NMWA 4QUBA 5B7GA 4F85A 1EFHA 3P9QA 3DHVA 3SWWA 1EK2A 1QIKA 1GDHA 3SZMA 1J09A 3H84A 3LDUA 1F17A 4MW6A 1TM3E 121PA 1ZGCA 4TWZA 1OHHD 3RVNA 3ZBPA 1GUAA 3AL0C 4RTRA 3S7TA 3MJSA 1LC3A 1M3SA 3UV3A 2VJQA 5I45A 3OZFA 4JC4A 1LW7A 3HNPA 1QMPA 2P3OA 3ILXA 3PC8C 4DZTA 3OO1A 2VK1A 3MJRA 2I2BA 3OIUA 4P5EA 3ZI7A 2AOWA 2HQ1A 3HJCA 3MMXA 1UJ2A 1F0PA 1T0IA 2X7HA 5EMHA 2HV8A 5DEOA 2HF2A 4UTVA 5B1YA 3U7HB 2WSSA 3ECAA 1CUFA 2ZRMA 1E1CA 3GWZA 4MIKA 1S01A 3OBBA 1U1EA 2IYWA 3CLHA 2C78A 1WKVA 3O9VA 1NZJA 1VG1A 4KO3S 5F23A 3KVYA 5ANRB 1G8GA 3AOEA 3ZJUA 1UODA 1USIA 3UUEA 3NYWA 5FPYA 3ZVNA 1JDBB 5AP9A 2QYOA 4N18A 1X7WA 1XRLA 3NOVA 4B76A 3NALA 3L02A 4O2AA 1WSBA 2FFHA 3V8PA 3TEFA 4TXMA 4XD2A 3WB1A 1XJ0A 3MBKA 4NL4H 3DEKA 3NETA 1U81A 3T8YA 3S5UA 2UZ1A 3ORRA 5H3LA 2X8JB 5F3RA 1U5CA 4AZVA 5JXJA 1XMQB 2G17A 1C3OB 3C7CB 2EJWA 1TOAA 4XUGB 5GZ3A 5AOVA 4GWGA 1UBHS 1RE1A 5FV4A 1CP2A 5GM1A 3NV9A 2O2HA 3P0EA 3RSFA 3V9PA 1O3YA 1USVA 4EPVA 3HNRA 2GJ4A 3OEEA 4LSGA 2CLDX 2DJIA 4LYAA 1YIOA 3NATA 1NQTA 1E6WA 1J24A 1NVVQ 4FILA 1U7XA 4B4UA 1IPEA 2I67A 3SQOA 2HLDD 5JDCA 2G07A 1OXTA 1IN7A 1DZ3A 3I1FA 3LQ2A 4LBZA 3G5MA 9ATCA 3LZDA 4TTQA 8ABPA 5G0VA 1QUFA 4GWLA 4DQKA 5IZ4A 2PIAA 4FU0A 4NCJA 4OB7A 1LDYA 3DMNA 3V1KA 4CFSA 5KOJA 1MIHA 2Z09A 3RFTA 2YY7A 4O4JB 2O8EA 1SXJA 2VUHB 5BWCA 8AT1A 4F2GA 2GPAA 4NMHA 4RD6A 3F74A 4O1IA 1DXYA 5A4AA 4IOMA 3MCTA 1DRUA 2Y1KA 1L1FA 1KAEA 3Q8WA 2DBVO 2OPBA 1FZQA 3MF4A 1QQAA 2YWBA 1N7HA 2YMQA 3A9TA 3CG0A 3H1EA 3EPHA 2PH1A 3WGIA 4G1UC 1N5MA 3FI9A 1IOLA 2GN6A 4DUYB 5LZ9A 3TKAA 4DW8A 1IRXA 3DSRA 5C52B 2ZCUA 3MD9A 5HZGA 1FP6A 3IJ5A 1FOEB 2MWMA 4JUDX 3A9CA 4KN6A 4WI1A 3DPIA 4BTVA 1X7XB 1I4WA 1UM8A 4DDVA 4TMTA 5IK2D 2ZQ5A 2X3YA 1YCGA 1XZBA 2HIMA 3NIWA 1TKBA 4P4UA 4V03A 1U2GA 4FX2A 4DJEC 1VP3A 1ZIDA 3HSKA 4RIFA 2XZPA 1E5TA 1TW3A 3BD8A 1HMYA 1HKUA 2Z5GA 3OHMA 5ALZA 2PY6A 5AJYA 5EHIA 3V1MA 4XGQA 1NTOA 4XM1A 4YALA 4ZXPA 2HSGA 4EHAA 4EZIA 3QLUC 1ZITA 3AWDA 2MOKA 2BHRA 2Z3VA 3WGKA 1OB5A 2V7PA 3L0OA 2B4AA 4HKTA 1KMHA 3HCCA 3KP1A 1RJ9A 4CDMA 3GGPA 4BB5A 4KEAA 2PMEA 4GR5A 4D0GA 1UFRA 4DZZA 3F9IA 4KPYA 1TTHA 4U2CA 1VKNA 5E7MA 4BEWA 2J46A 1QCZA 2Q5OA 4WLNA 4X63A 4ARZA 3VNVA 3P9SA 4XQ0A 2BEUA 2GB4A 3UICA 5ALEA 4U9IS 4PWZA 4HFMA 2WAYA 5CB8A 5KWVA 5FUQA 5AHKA 2TECE 3LPNA 2W58A 3BMNB 4G09A 3DFMA 3O4GA 1GY8A 3Q4GA 2HRDA 4G0YA 1L4BA 2GN1A 2GTIA 4QJBA 4HFNA 4UCXA 3K5PA 5C4MA 5AVSA 3ADCA 3RU7A 1KA9H 4ZT6A 1CQXA 3ELWA 1KJQA 3PHCA 5CUQA 5D00A 5J43A 1DJMA 4B2YA 1E1LA 4WWHA 1FFAA 3BB3A 3INRA 4RVHA 2C4WA 1UWVA 2GF9A 3OPYA 3NG1A 2DFNA 1JDSA 4MVJF 4M0PA 3JAWB 4YJGA 1QV9A 1KIAA 4ZPXA 3V33A 3DWEX 4P7GA 2EKQA 4B3TB 1TU3A 3T3PB 1IDOA 5H02A 1J8VA 3KZVA 4C6TB 5IJ0A 3EGDA 1RPTA 2QU7A 3DM9B 4GP7A 4F0JA 4ARVA 2QT1A 1SCUA 4JP2A 3KOMA 2CJPA 2NX2A 3D4NA 3H2GA 3AV0B 4UATA 1V0JA 4QGFA 4TXJA 3KQOA 3RUDA 3WLKX 3H11B 4LRQA 4DSAA 1R88A 3THWB 3ZCUA 1Q17A 1RYDA 2B4TO 3BB4A 1E69A 4GGPA 2LKDA 4L51A 5CHYA 2CF6A 5L3SA 1W44A 2WJWA 4K9OA 3UJ6A 1YI8A 3FVTA 3WLFA 1AVTA 3W4IA 3HDVA 5E3JA 2XXAA 3ZQJA 3C5VA 4AWXA 4WLEA 4XLZA 2ZBDA 4ZALA 2N1MA 2XNJA 2WUVA 3F3YA 4B3FX 2D00A 1HLGA 4NYJR 5E6SB 4G8JA 4M4SA 4PG8A 2AD1A 5D2CA 3MS7A 2Y9PB 1DHRA 3C3CA 3CRW1 3OY7A 1DNPA 3ILVA 3K0BA 1SPBS 4CM9D 4QXAA 4B79A 1N7JA 1BFKA 4RNCA 4H15A 5KBYA 2UAGA 2R68A 2WVJA 4RGYA 4AJ4A 2WV9A 2DU8A 3S55A 4OAPA 1EZ4A 1CJBA 3Q9UA 1VYTA 3G82C 4GLJA 1EGHA 2AQKA 4JP1A 4R8LA 3LYHA 1O1YA 2BDTA 2OCAA 4A6EA 4YRNA 4I8DA 4RTOA 2BE7A 4U8HA 4B17A 2JFFA 3PG5A 1KE2A 2NXCA 4RC9A 3SQLA 5HMMA 2QRMA 2C5AA 3UB3A 1Z68A 2FV8A 1ZGJA 4CHGA 3RUAA 3ZOZA 1Y5IA 1WUHS 4TMKA 1ZH4A 3V8EA 3IMKA 3GGCA 3CVUA 5ES3A 5BSWA 2PD4A 2QAGA 3M6UA 1RPNA 4FBGA 1AF7A 2QLNA 4PC7A 2V8OA 4EH1A 3VGJA 5IJWA 1G5PA 4KPUB 2O5EA 3MVEA 4QAQA 4D9JA 2P9FA 2XUAA 4C7VA 4MYUA 2PUBA 3TN7A 3EXFA 4R84A 4J1TC 3FA2A 4FDMA 4PXSA 3TLJA 4Q6WA 2WIAA 2M6RA 1LSSA 1XCLA 1R1DA 1FF9A 2ZFUA 3LQRA 4JJFA 3NEJA 3QF4A 2WILA 2OXIA 3IIJA 1ID1A 2PGDA 4N41A 4UNNA 1FSGA 4D2IA 3SYTA 2RJOA 5GV8A 1E1QA 1UMBA 4YAOA 4E5YA 2GBLC 2C83A 2H5LA 2VNIA 1UR5A 2A94A 1HE3A 2XRYA 2NNWB 4HB4A 3OAAD 4HZUB 4JHLA 4WZBB 2Z30A 1G5QA 3LQ4A 5BSVA 4L0MA 5BWLA 2VQDA 3FTEA 3SM3A 2JHPA 5L7TA 1GPJA 1XG5A 3GEDA 4KTVE 4MTCA 4LTDA 3H13A 3QEMB 1D4ZA 4QYIB 3RIGA 4PAWA 1KFKB 1Z6PA 2GLUA 2GGSA 3ETNA 3NTOA 4NZYA 2ASVA 5JTUA 1XTBA 3L4JA 4LJ9A 3ACCA 1KAMA 4F5YA 4K6CA 4BMVA 1HKHA 3M2TA 3TTWA 1FSPA 1UFQA 5DP2A 1MJNA 3BJZA 2C61A 3E5MA 3LBAA 3P94A 4UQOA 1A9RA 2DLNA 4GC9A 4A9AA 1MOQA 1Z0SA 2COEA 1PJZA 5JAUA 3VFDA 4YNBA 1MAWA 1MB2A 1Y8QB 2C9YA 3RE1A 5J58A 4TZ0A 4I1VA 1YDEA 1ZM3A 1BGXT 1R00A 4LXQA 2QV0A 5CHEA 1TQ4A 1ICEA 2NIPA 1PO7A 3DVRX 2D74A 1BXGB 2Y1EA 1R5JA 4NMXB 4TZTA 1NI4A 3BGDA 2B5WA 5EMLA 3EZ9A 2VF8A 4Y8VA 3DM5A 1EQAA 1BGWA 1QHSA 2Y8EA 4KR0A 4RMNA 4ZVOA 1Q1AA 4AMVA 4HGQA 1PWXA 2D8AA 5I3CA 2QPOA 2X7XA 4FIDA 4OGFA 1NUAA 2WF8A 4JJ6A 4OFBA 5FBHA 1RRGA 3QWAA 4KLRA 2QQ5A 5DTQA 1EFLA 4D3FA 2Y99A 3JQ6A 2OOSA 1KQFA 2VDKB 3WGLA 1NNSA 3KKZA 4AUMA 2FSGA 1GFSA 2G9NA 4DG8A 1SUAA 3V48A 4OP3A 4D5GA 2JJMA 3IILA 2V1XA 3ZZUA 4AW9A 5T67A 4NZNA 4QYTA 4C1NA 3SICE 1KU0A 2PLNA 2R5WA 9ABPA 4Z2YA 3TZ6A 4JJIA 4QU9A 3WFIA 2G7MC 2HBRA 2QY6A 4RGVA 5DBIA 4RM3A 4WZZA 5KU1A 3OU2A 1A8UA 3SMQA 1O6GA 3K8OE 3U0BA 1OAOA 1AK9A 1UK9A 3GMIA 5DN6A 3F4KA 4BMOB 4CMIB 4UXHA 4AT1A 4NPCA 4MKHA 3AG6A 2VRWA 4WZAE 5CH5A 5FTMA 3O6VA 1NT2A 4LMBA 4V0NA 1RAAA 1RTKA 3W4KA 2BMJA 1W7AA 1OH6A 1JEYB 3HA7A 4TT3A 4DQLA 1NT4A 2NZVG 3K2EA 3PUHA 1M1ZA 2CB0A 4NG4A 1LRKA 4DJFC 4LZAA 4F7WA 1F5SA 4ZVKA 1C3XA 3FPSA 4ZQBA 3R7SA 5A4IS 1XKXA 1T2AA 2PGXA 3UHOA 1B3RA 4X8OA 3ZV5A 2W2KA 4JJGA 1M6WA 2MU1A 3D3KA 2IEZA 4QASA 2ECQA 4EY6A 2EJVA 3L7CA 2EW1A 2D0DA 2NZJA 3QVGB 3IOMA 4NVRA 2Y1OA 3KQPA 2QRPA 3A6GA 1V8BA 1ZMBA 1CR4A 1L5FA 3FHCB 3RLIA 2R1UA 2E0IA 4Q0MA 4B31A 2VTVA 2VYVD 1ZNWA 3LVBA 4KQ2A 1UDCA 1LPMA 1W87A 2WWTA 3RJTA 4EG3A 4ABTA 1N2SA 4B5KA 4GNKA 3CX4A 1UIRA 4R6XA 5B7QA 3MJFA 3NMUF 1KI9A 3RS7A 2XYVA 4ZCSA 1R6AA 3ZS8A 4Q12A 4B8YA 5ADVA 3PQ3A 1QUEA 3E23A 1S4MA 4J07A 4RZXA 3EISA 1QPZA 3GPBA 2YMMA 2H2DA 2BFMA 5EXEA 2BM0A 3NHYA 5A5EA 1IJFA 1ANKA 1RTTA 4R01A 4ZRMA 5HJEA 3U5ZB 2JCGA 4NFSA 4LRYA 4NTZA 4P1ZA 2XDWA 4KDFA 3H75A 1FRNA 1PLKA 4H7HA 3CUEF 5JMWA 1XROA 4GPTA 5E6RA 5AVTA 5JT1A 2AMLA 1C7FA 5TPZD 4RULA 2BFCB 5EKUA 1LBSA 2QD1A 1SEVA 3F90A 5FO0A 1UOQA 1SR8A 3G8DA 3PEVA 2XGMA 2R1VB 4CIYA 2DCMA 1RLOA 3B3QA 1S8OA 4NDAA 1ONSA 5JZOA 2JGRA 2VG8A 5TSDA 4ZA2A 1LH0A 4QRDA 1IWPB 1JPUA 1B41A 1PBNA 1BDBA 1V5FA 1WMAA 2QRJA 2RMKA 2X9QA 3PCRB 4QBIA 2OESA 5LLDA 2SNIE 3URKA 1TT5A 5EFOA 1A8IA 4P93A 2WNIA 5AKEA 2LR0A 1GGVA 1KEWA 1S89A 4DG9A 7MDHA 521PA 2OO5C 4RWZA 4EPTA 4LNAA 1L6IA 1AHHA 3DMFA 5EE9A 4YIKA 1R5OA 1UC8A 4G5YA 3U9SA 3UENA 1BMDA 2W98A 5GVSA 1JMVA 3PLAE 5I9MA 1A5BB 3I92A 1T91A 4PG4A 4F45A 5CJPA 4R7TA 3R0JA 3TLGB 3VZPA 1M6HA 4N3NA 3M34A 3P9ZA 4L76A 4XUCA 3MOGA 1QU2A 4DCSA 3GA5A 4C4AA 1I10A 3R7AA 4FI3F 3M1AA 1JDBC 1KQGA 3ZE6A 2IH5A 1TCVA 1JX6A 4M55A 3UHPA 4IXMA 4C22A 2WKSA 2FJUA 1AKQA 1E7YA 2GAJA 3LU1A 3Q0TA 4JJEA 4F4UA 1QGZA 3U37A 4C2AA 4NCNA 4YUZA 4UMVA 5GGXA 1AUXA 1HT0A 2CLOB 4PRYA 3ZHZA 1E59A 1ONPA 2AE2A 1YS9A 1HE4A 1WF3A 3ETJA 1TLLA 4TRNA 1IM5A 2YXDA 4ZK6A 1UP4A 1H66A 1PW7A 4KC0A 5DASA 4YMGA 2O8NA 2QE7D 2P90A 3KSDO 1U11A 1YV9A 4BFCA 1Y34E 2P5UA 1YRAA 4F8JA 2UXBB 2XYRA 3RRZA 1RWPA 4KU4A 2JJ2A 4MUNA 1YOVB 2NWQA 2UZ0A 2PYDA 2D7DA 4K9SA 4E21A 1E3EA 2PSDA 3G7UA 3PGXA 3WIDA 3VOBA 1GPWB 1NDQA 3BXFA 3BTSA 1IG0A 1U4SA 4MW7A 4A0FA 3U60B 3BXEA 1US8A 2QBYA 4PIPA 3L4KA 4Q4HA 5TQ0A 4DHEA 5CDGA 3E3NA 4Y1RB 2Z5LA 3QH4A 3V4RA 1VIYA 3G5UA 1ECGA 4KXFB 4PGHA 2LDBA 2D1QA 5K45A 5EYPB 3V5NA 5EESA 1XCOA 5JMTA 3P9YA 2O5RA 5SV2A 3OUUA 2NO1A 1H8ED 3RSGA 4F86A 4BY9E 2AQIA 1UJMA 4IFIA 2CBGA 2RHOA 2IYAA 4OHMA 1TF7A 4MEAA 3NOOA 2C4UA 1KO1A 1RI4A 1ZP6A 4GPAA 4XX0B 3TCKA 3B89A 5FPPA 5HK8A 2IXGA 1E3DA 3ONNA 4BVHA 1S9DA 1JJIA 3ULKA 1F7VA 4BHTA 3QM1A 3VO8A 1OPRA 1VLQA 2D54A 3U6BA 4YP0A 5G53C 1PTJC 1FFEA 4QOEA 4KR2A 2BHLA 2AVDA 4O4HA 4HGPA 5KC9A 4B3GA 1PNTA 3N39C 3HP4A 4GU5A 4TVOA 3THRA 1SUEA 3W5VA 3A6KA 3OESA 4HB3A 4DCPA 2J5XA 4JQSA 4QBKA 3RUPA 5DLQC 1IHOA 3PHJA 2Q2QA 3HN2A 4A0SA 3IAS1 2AKEA 3OZGA 1E18A 4C06A 4OXIA 3FOZA 4DM7A 2P9HA 3FOEC 1QPGA 3BXPA 1YNSA 2I4IA 3AH8A 1QONA 1WDMA 2XJ9A 4NYMR 3M70A 4C4YA 2J0SA 3KB8A 2E6UX 4RGBA 1HZZC 1HQCA 3ZOKA 2WFLA 5JQGB 1MZPA 1GGNA 2AB0A 2MJLA 1M7BA 2ZR7A 3QKIA 5LIRA 4D9IA 3GJSA 5EMMA 2AOUA 5LQSA 3LJKA 1HGXA 3INGA 2Z9CA 5TJHA 2EYUA 1OFHA 5AI8A 5GGYA 2GBPA 1D4OA 3KELA 4E5DA 5J47A 3PB3A 1X87A 3LUBA 5FPSA 3P9CA 4MGKR 3WOHA 1T2UA 5DXFA 3V8QA 4BFWA 1T2EA 1VOTA 4AJLA 2YH2A 1RHQA 2PS1A 2GCIA 4XFDA 5EINA 8OHMA 3EEOA 2FPIA 1A2OA 1LZKA 2EJTA 3FCSB 1IBMB 2Z0MA 2YFHA 3U7FB 1XYGA 1REQA 2NSHA 1NVWQ 3ES9A 4N5NA 5BVHA 4J1TA 3VVBA 1BXRB 5BNTA 3BORA 3R6WA 4YJ2A 3NI2A 2A84A 2VDQB 2ZXUA 1NVGA 4HNQA 4L2IB 4BX9A 3AEZA 3HU1A 1WRBA 2VTDA 4KXVA 4HAUA 3AESA 5CX1B 1E1RA 3X2FA 1LLUA 1NI3A 4KGDA 2HK8A 4X84A 4BVKA 3BRWA 1XN1A 5CAEA 1UBMS 2GBLA 2WSLA 4Q1EA 4BNVA 4XPIB 3WLNA 3AHIA 5P21A 1S3GA 3T7AA 3QFSA 3EGVA 3R3SA 2WHEA 2FGKA 3DEYX 4C0JA 1LPAB 3D9QX 2JIQA 2V7TA 4OGGA 1SVMA 2W22A 1ISSA 1W4AA 4HGZA 2EGGA 3SXUA 4EG4A 2N1BA 1C29B 1BD3A 1PUXA 2VPPA 2BZSA 3AVPA 3BXGA 4DVJA 1M8GA 3VZDA 4CCYB 3NEYA 4ZCIA 5CK5A 5BW5A 4PIMA 2JZCA 4NBKA 3VPBA 2W2LA 4ZGBA 1LJ8A 3ZZ0A 3I1IA 2P1ZA 2ZGVA 2BRUC 3TJRA 3RVOA 4OIMA 1YJ8A 5DULA 4C21A 2P1RA 2HU8A 4MDYA 5AI6A 4KVZA 4UZSA 3DZIA 3R3JA 1P60A 1RABA 2JCXA 3HB5X 1YFZA 4H4DA 4BNWA 1YJXA 1X86B 4ERXA 2EV9A 5HW0A 1QE3A 2NXWA 2ZU6A 3WADA 3LFTA 2QVCA 3PPXA 5G2OA 2W90A 8LDHA 1FNMA 3EDMA 4PYQA 1AGXA 3VSBA 3IEVA 1IVSA 3TZBA 3I30X 3PVSA 5GMOA 5HTKA 4FK8A 1KZ6A 2BFOA 2O2EA 5DGDA 5ITZB 1AY0A 4QTXA 1SHJA 3GPIA 3RBXA 3LBHA 4LE2A 3SCZA 3UTCA 1Q20A 1SEPA 2Q1SA 4HLUA 2E18A 4HZIA 4MR7A 3T35A 2VQFB 1U8TA 3VU9A 2RGNC 1ND5A 5K0FA 1ODFA 4UBNA 3KWJA 4P7FA 5I7UA 1I94B 4K9RA 4RA6A 1OE0A 3EYAA 4MUGA 1AGNA 1QJ4A 2R8EA 2XRMA 4KXWA 3SC6A 1L5HA 3SF8B 3NWBA 2E1RA 2HLNA 4GS5A 4PAQA 4WHMA 5ENZA 4CI9A 2YZKA 5AVOA 4DILA 5AKYA 3QFTA 3C4JA 4V0LA 3ZDXB 2XQFA 5JD4A 2XYPA 1ZXXA 1XLWA 5AK4A 1Z6ZA 4MPTA 2AI1A 4DV4B 1K6JA 1U28C 1UMDA 1XXHE 3ADBA 3NW9A 1K3UB 1U8UA 4ENVA 3GNSA 2CXRA 1IQUA 4P4SA 3T9AA 3D4BA 4TTIA 2Y4NA 5KAPA 1DFIA 1RYMA 4OAOA 1NU6A 3VTFA 3P5SA 4ZI7B 2I03A 4MARA 2B82A 3SXPA 4BVLA 1WAMA 3A2NA 1UBCA 2QM0A 4Q9NA 4S2EA 1BA2A 3G0GA 3N8HA 4FPXA 3UAOA 4CEIA 4XIFA 4MP6A 4U4AA 4JI8B 1ACMA 2QN8A 2Y76A 1B74A 2BTQB 2ZJFA 5LZ4A 4CJXA 3W5IA 2ERYA 2H4YA 2A4MA 2DBQA 1QHHA 2HJGA 1TM5E 1K0FA 2O2XA 1VLJA 2MINA 3FYUB 4W7SA 2PMBA 3A10A 1Z12A 3LHIA 3RJ5A 3VR6D 2XOXA 1GN9A 3ZU6A 1B14A 1F48A 2O2SA 1G8PA 1HO3A 1DX4A 1G2OA 1TT7A 2GUWA 3H9QA 3SZGA 3GXOA 3UMCA 2O54A 5B4TA 3J7TA 3U5TA 1JYSA 2C8VA 4MRMA 1RXVA 4QC2A 3STXA 3SI7A 1UKCA 5AJVB 1W9HA 2KLHA 3CEAA 3PC2A 2OHOA 4RDCA 4JUBA 4A5SA 1PWEA 2FZCA 3KZMA 2OGWA 4G1VA 3UPTA 3VX4A 5COQA 2R9VA 4HNUA 3B60A 1I33A 4WH0A 5HCNA 3DE5X 4GPBA 4QOSA 1U0JA 4DKJA 4LV5B 5JBNA 4BC1A 5JSZB 2VJYA 5TGDA 1DS6A 1Z8DA 3WLQA 4IS2A 1F4VA 4FNGA 3B2QA 3EFOA 3QUCA 5IYZF 1DTWB 3IDFA 3L2OB 2BLLA 2Y0DA 4M8LA 4GLBA 2PZGA 2J7PA 4PGFA 3TIFA 5BN4A 1KZGB 4FSDA 4PYOA 1SHLA 1RXYA 3QXJA 2VKTA 3CCCA 3NOXA 3AJDA 1F60A 1G5RA 2A9RA 2GAIA 2G9UA 3N1UA 4G4JA 4K88A 3KU1A 5HIKA 3U4AA 2ZE6A 1VE3A 3ROMA 1WG8A 3GD5A 5DNDA 4LOAA 1SKMA 4I5EA 5KYUA 1IBCA 3DGFC 4FKMA 5HOQA 2GQ0A 1DCMA 3I6BA 2O8VA 4XYBA 2FPGB 1POXA 4R81A 3SYLA 4D8TA 3Q2OA 2OCYC 4GOLD 3G5AA 3AUUA 5EE3A 1YDFA 2BTEA 4M22A 4JNCA 2RAVA 1LFDB 2YC2C 3K1AB 5DTRA 3VC3A 1SKUA 1DRVA 2HLDA 1J8FA 3OTQA 3QXXA 1PEAA 2PLWA 2ECKA 3GLGB 3SKYA 4Y0AA 2ZT5A 1WJGA 2CV0A 2HF7A 3MNFA 4YP5A 2GPBA 5T7BA 3P1JA 5IVIA 1GTVA 3DB2A 3PFIA 3S40A 3ZZMA 1GZHB 1ZUHA 1QE5A 4PC1A 2FZEA 1MDBA 1JKJB 1U0BB 3UMFA 4E33A 4C20A 3Q3EA 2MSDB 3VBCA 3GY0A 2OORA 3FHTA 3F8TA 4N0QA 1QGDA 1C4OA 3TXYA 4EUHA 3U44A 1B6SA 3UWOA 1FU8A 2MT9A 4IL5A 5CT5A 4EATA 2Q5JA 5HIJA 3IUYA 1RWQA 2I9PA 4FDAA 3GT7A 4KXYA 3EVFA 1QC5B 2AF3C 4BKMA 4ZT2A 1XQXA 1PV2A 2NTJA 3CSUA 4RA9B 4M49A 3ABSB 1M6YA 4BLVA 3QQPA 2HFKA 3CJRA 3K0HA 1W9MA 4XCQA 4TLLB 2ADFA 2YWGA 3P2MA 3ZDQA 4J3JA 3PXUA 2V4UA 2NU8B 3U7QB 4AXXA 5A04A 4OUDA 5DWDA 1M1NA 3IBFA 1C1DB 1W88A 5T3UA 4GG1A 5IK2A 2Y2UA 4N03A 3NFYA 4GSKA 3IT2A 1UXGA 3R7NA 3MWDA 1SB9A 4JN6B 4RLHA 3V8MA 4UNRA 2MYUA 4GOKA 4QJIA 2P40A 1EBFA 1SBTA 1JVNA 2Q7XA 4TV9A 1GDDA 1T10A 3JAKB 4IIJF 1SKYE 4MLPA 4G5QA 4MVJG 1O0CA 2PCLA 1HDEA 1Z56C 5K8CA 2AI3A 4IYRA 2R4TA 2FEMA 2VSXA 3C5CA 3DL2A 4ENTA 2HQOA 4MUEA 4EJ6A 5DNCA 2CMKA 3EPJA 2CWWA 1IZZA 3HXPA 4J9VA 1UL1X 1WDWB 1FXWA 3E5RA 1I80A 1N34B 2YFKA 1TEVA 2AR0A 2ZSAA 1GPYA 5ESRA 3Q7PA 1CQWA 1S6YA 2BFNA 3K0CA 5KWJA 1ZESA 3TRDA 3T0GA 1P8AA 1ZH0A 1RHRA 5I9NA 1H3EA 4REMA 3W5BA 7MHTA 3A27A 3LX4A 1BQEA 4FN5A 2C7BA 4XM0A 3VUEA 4KQ1A 4JITA 3LXUX 1OIVA 3K3PA 4UHCA 4UDYX 3HXOA 4B6PA 4CM3A 1OWOA 2WIGA 3TLKA 7ADHA 3S3TA 3B51X 4BO2A 1X0VA 1TGVA 1KI3A 1NVKA 3V1UA 4CR7A 1WM1A 1GWNA 1JDTA 2CMFA 2HPZA 1R4AA 2FPLA 2XMQA 4TS4A 1DJPA 2IZOA 4FUQA 1ADJA 4YT4A 1GAXA 2YYSA 1BXKA 1ZKMA 1OR8A 1QRRA 2I8LA 1NVVR 1XZDA 3DE7X 2PFGA 1U4NA 2ODAA 2Q6OA 3T3HA 4WZAA 4TMWA 4UUBA 2YFYA 4NDZA 3RU3A 2HGSA 3OLVA 4M9UA 4ZQGA 3SQNA 4TVBA 2RGWA 4I08A 1SBNE 4MVXA 1PZNA 4YN3A 3WL3A 1WOMA 5CM9C 4EGFA 1G4HA 5EJ4A 1NG9A 2W2MA 4GL4A 1B26A 5ETJA 3PFWO 2F43B 3KYJB 4CMJA 1HZZA 1SUIA 2AW5A 1A9OA 4Q16A 1HMPA 5U4XA 3VISA 4HNVA 1ZMOA 1ZUNB 3LH5A 4EHKA 4OQLA 2VAXA 1G8MA 4MRRA 1B73A 2JGKA 3NKFA 3O93A 4HEHA 3CTPA 4MYCA 5G0UA 2O1SA 1K5GA 1HG1A 5JRDS 2ZOSA 2IEAA 1L5MA 1FDIA 2OAEA 3CV3A 2Q1YA 1P9WA 3FUXA 3JYOA 3O31A 4GPEA 4IIFA 4P8RA 2YHIB 5EQDA 5FTKA 4DMMA 1W93A 5C8YF 5ADWA 1VIMA 4M53A 4CM9A 4E11A 3AVQA 1G5HA 1W85A 3BS4A 2GZ1A 3IR5A 4O5AA 3O3CA 1JJVA 1LJLA 1Z06A 3K20A 1KOGA 2ZIEA 4PCLA 1S96A 3OIVA 3WL8A 3QI7A 3CVJA 4LEIA 2YFQA 3R9XA 2NVOA 2DPXA 3PX3A 3NPMA 5ICMA 2X58A 1TVCA 4GOND 3T0IA 2R11A 2PL9A 4F7DA 2ZDHA 3OP1A 3WY9A 1YD7A 1CF4A 1OQAA 3RTEA 4RPHA 1FTGA 4TLBA 3D3JA 4J0JA 3KUCA 1N2CE 1HDGO 3OZSA 4I3HA 3UV7A 2JIZD 4MULA 4X3OA 4RS4A 1UT5A 3W1EA 4MRAA 5K0ZA 1OKKD 5C1DA 2ID7A 3P9XA 5E1OA 1RS0A 1V5IA 3DL7A 1I7SB 2FEOA 3KLOA 5BWBA 3FZQA 2YUIA 5AICA 4AF6A 3H7IA 2POCA 5ALFA 1I9GA 5LUBA 4ILKA 1XZHA 4A73A 1GRNA 1C0KA 2REBA 2XGOA 2ZYIA 3ED1A 4RW0A 1H2WA 1A5SB 1FMJA 3P71T 4Q3OA 2WW8A 4C3VA 2H4HA 1D2EA 2A5GA 2CL5A 4I5GA 4IDCA 2UXDB 1BS9A 2YJ6A 3IOYA 4X3PA 3BMOB 3WNCA 2BRUA 4FHFA 5HSGA 3OPNA 5AM0A 3GDGA 5D87A 3QELB 1L3CA 4QOIA 1UMCA 2HB6A 3NB0A 4DA8A 1TVMA 2HPAA 1YZGA 4Q7MB 3VC1A 3MILA 1P0MA 3N05A 4LWQA 3FSEA 2ZJ7A 3O5AA 4UCQA 3CZAA 1I4EB 2Z3ZA 3F1LA 3FYDA 3HO6A 2KMLA 3K09A 3LCUA 4IZIA 2YHSA 3A6DA 4MRPA 4PLHA 4XXHA 4ZU3A 3Q7TA 3VAZA 1SVLA 1NW7A 4XJSA 2HHJA 3F8WA 3WRXC 4MQ6A 4Z49A 5JPDA 1G5FA 2WNSA 3B82A 3A1SA 4QSHA 2Y0BA 5JOQA 3PRHA 4YC7A 1JR3D 2RCYA 1RCUA 2IVZA 2NUPB 1P1JA 2A8YA 3E82A 1IPFA 3CT6A 3PC4A 1XTIA 2PMDA 3IUSA 1RACA 4MR8A 1K6IA 1XEXB 2AUMA 1IZ7A 2C2WA 1J23A 2BMAA 1PL0A 1JDPA 3CUSA 2JCBA 1LCIA 3A1UA 3ZLBA 2XQVA 2XUIA 4GXQA 5JANA 2BFWA 4OAQA 2ZUWA 1OYVA 3B2NA 4B3SB 4K2AA 4ZCPA 3ZE0B 4V0QA 4C9BA 2O8BB 4QBFA 3CURA 2X4GA 3MTBA 4URWR 5DEIA 5JU6A 1U28A 1YBMA 1B93A 4OHRA 2INGX 5ESXA 4CQLA 5CIWA 3RUCA 2CL0X 2QLLA 4Z0PA 5BQXA 2QX9A 1HDYA 1VJ5A 2WZQA 4BJHB 4Y2QA 1RLTA 5FI1B 1DO0A 1VLVA 1SIWA 3UCXA 1FP4B 1TYAE 1XE3A 2SCUA 2X42A 3DWIA 3IIMA 1JKFA 1PYGA 5G4KB 2ZSJA 4Y2VA 4QLBA 2NU9A 2OEPA 4X41A 5C8XA 5LXTB 1WXFA 3TVDA 4LJ7A 1Z7WA 1LVUA 2TMYA 2ZAYA 4P84A 5JASA 1ZD3A 2VWQA 2X0IA 3JQ8B 4WGFA 3NCHA 4F3NA 1O96B 1KH2A 1SU8A 2VF5X 1ZBDA 4LTNA 2CHVA 2TMKA 4IHJB 4EENA 1CUYA 2X2OA 2P2YA 3A3KA 1DDIA 4NE2A 3KCQA 1FB5A 4GE3A 3TI7A 1ZGZA 1YMQA 4JI6B 5LQDA 4NENA 3EEBA 2JRCA 4L8LA 3MWYW 2ZTMA 4MS4B 4AMZA 4DJDC 1KZ1A 2OCLA 2A1IA 5C8DA 3OIWA 2PD6A 3HKDB 4IGAA 3LZCA 1JU9A 1CY6A 2O7SA 3ODPA 1ZM9A 2F67A 3A4VA 1NLYA 3DLHA 1GKLA 1O87A 4N5HX 2WJAA 2G1JA 1RKUA 2JFUA 3KD2A 5EMNA 5HKKD 4A1FA 4CLXA 3MN1A 3UWKA 2ALJA 5AYVA 2IYLD 3GELA 1H2FA 1NDUA 3COZA 2MSEB 5ECGC 2FSPA 3KUXA 1NP6A 5HG0A 2I7XA 3N0VA 4MCJA 3ICPA 4Z51A 3A04A 3L9WA 1YZFA 3M9XA 4LC1A 2PX3A 3EVNA 3HP1A 4QXRA 3I6MA 5HS6A 3SMVA 4FDLA 4LJKA 1PR3A 2BFEB 1T6XA 3N2YA 3S4YA 1EI9A 4OL9A 4W1RA 1I5OA 1K8QA 1QLHA 2FPUA 2O6LA 1F5NA 1L7XA 3A6LA 4GZ6A 3STYA 1HE1C 5DH9A 2R00A 1B6GA 1GR1A 4KG7A 4X1YB 4DG5A 1EWVA 4WJZA 1ADCA 4KPGA 3UK7A 2IV7A 4IYJA 2I2XB 4AG5A 1UOEA 5IC5A 3O91A 2Z6UA 3EAGA 3IE0A 4WOJA 3WRYC 3OE1A 2XEXA 3HCPA 4OG2A 4JEUA 2JZOA 4PGAA 2QYTA 6ADHA 3UFBA 4I6JA 1CQZA 2VR1A 1H8HD 2Z1DA 5D8DA 3HU3A 1I7PA 2JKZA 1WP9A 3P45A 1KEKA 2GCOA 3LK7A 4I1OA 3BIOA 3FBGA 2AMJA 2IX9A 2Q21A 4L5JA 4R05A 2WZDA 2X1HA 4AZSA 1UMKA 2C42A 2FHPA 3IFSA 5L6LB 1YB2A 3OQJA 4YAIA 1PFQA 4M3NA 5KQPA 4QPCA 1L7EA 4ZTZB 2O8DA 2PVPA 3QTLA 4QAJA 3N76A 4ZEOA 1ECCA 1FSZA 1OXBB 2Z98A 4LJ6A 5TPZA 3FYSA 4J49A 3SEFA 1SBZA 2BEWA 4OA8A 1PRYA 1WZNA 3EQ9A 4FX5A 5CNIA 2IZ7A 4NAUA 2ODTX 3NBZC 1UJNA 3FYUC 3L46A 4OL0A 3OJ0A 2HKIA 4PS0A 3AZOA 4IO1A 5K3CA 1J0XO 2A0XA 3GCZA 3ZD7A 4B4WA 1D0VA 1H2ZA 2AD5A 2NUTA 4CIVA 3OU6A 3QMWA 2CLCX 2AUTA 4JL8A 2FOXA 4K9DA 4Y6LA 5IVKA 1U3DA 1VL0A 3SJCA 3A9VA 1SXQA 3U39A 1WX1A 1GZ7A 2JGDA 3QVWA 2EAUA 2JLQA 1QAOA 1H9BA 2YVKA 4UHJA 4F1KA 1M0TA 1TTPB 2V7WA 5BMVF 1QNLA 1F0KA 2GN4A 2YY6A 4U63A 2QKYA 3TNLA 1JGTA 2HMVA 1P39A 5DPMA 1RVDA 1UCFA 2Q5HA 4RHTA 3LUFA 1VMDA 4NV3A 4DRZA 2X15A 1RRPA 5M5BA 2DQSA 2HDOA 3FLAA 1M2EA 3GT3A 4GSYA 3L07A 221PA 2D3WA 1NN3A 3Q2KA 3WRVA 2YV5A 2DKOA 3HA3A 4IXTA 8ADHA 3FX2A 1VHJA 4GI1A 2RGRA 2DHQA 3BJRA 3HR4A 3M6LA 3D1VA 2Q3FA 4RMJA 4ZHQA 1Z39A 4PEVA 3LUGA 1JR3E 2VYCA 3KM0A 3NVDA 4WKNA 1KPGA 3BFPA 3CRMA 3Q5GA 1AGRA 1N8SA 1TRKA 3CQ9A 1XZGA 3O4FA 1AMNA 4RSMA 3WKBA 2XB8A 1SBYA 3VJLA 2GN2A 4BUJA 5JJLA 2OT3B 1LX6A 2CEAA 2FPWA 4NQRA 4Z7QB 4G56A 4L4RA 3VR5D 1FW8A 2LIVA 3OZEA 4QELA 1WTCA 4EHJA 3PFNA 1SOWA 4KXMA 4RPJA 3NHFA 4HSGA 4HVAA 3KQHA 2F55A 1RYNA 3AP2A 1A7AA 4C1BA 4P33A 3QKUA 1TUBA 4IY1A 3LFHA 4ZAZA 2CNWD 1J6UA 2PKCA 4YT8A 1JSZA 4CDRA 1H1TA 5C7LO 5F33A 1XXHA 2ZAIA 3G0CA 2WKQA 4RKRA 4PO3X 4XVHA 2Y67A 2ZBGA 3BF7A 3RPEA 3VSDA 2OV8A 1ZVKA 1NAIA 1HE8B 1Z4PX 3TKLA 3W3AD 1EX9A 1U98A 2FHSA 4URZR 5IBRA 1LX7A 1WB9A 4NH4A 3KZKA 1CY0A 2D1TA 2AMYA 1S3FA 2BWJA 2G9RA 3OCCA 2QLBA 1OFUA 1H8EA 3FMPB 4CM8A 5IRCD 2QTVA 4LRWA 1WW8A 4WNAB 4RHYA 3HCRA 2XSZD 4MGHA 5HPYB 3KDSE 1E1DA 4QPDA 1D2GA 1C9EA 3FY4A 2VPTA 3PHLA 5AI0A 3ETGA 3BIJA 4OBEA 1T4BA 2OB1A 4QPNA 3C1UA 4Y2YA 4KE9A 2GD2A 2W6QA 2Z3WA 4MV1A 1EP2B 3ZJTA 4F3YA 3IA2A 5TPWB 3ZE1B 5ES4B 1L8QA 4BQEA 2HMYB 4KLZA 4XVCA 3BBLA 4UU1A 5JNSA 3WIOA 3Q8MA 2GAFA 5DB4A 3ADOA 5JO9A 4I3FA 3B85A 2REQB 3E1SA 3KALA 4YDHB 4AY4A 4ENPA 1DBRA 1Z2AA 2NGRA 3JVUA 2VDLB 3NHAA 1DBIA 1Y8RA 4DY6A 4YPVA 2A2ZA 4BQOA 5JFGA 3IKTA 3E8SA 2R8RA 3JZDA 3FROA 3QBEA 3TLZA 1AKYA 2Y77A 4PSDA 4HX5A 1NLMA 3OMXA 4FMCF 1SVOA 4KACA 2PJDA 4ZICA 2SICE 1EFRD 4LQDA 1L5SA 3QXSA 1RZVA 2FK7A 2X3FA 3RC3A 3QV1A 4JVOA 2V9CA 3OKAA 5CM2Z 1W5TA 1EM8A 1FBTA 3FMVA 1P5ZB 2KM1A 4TKZA 1YQXA 4NH0A 4G0ZA 4MRVA 5DYYA 1DHTA 1VA5A 3D4IA 5FR2A 5SY9A 4AJ9A 5DX1A 2VXCA 2A1UA 4FS8A 3ONFA 3VU0A 5JJBA 2FEWB 2FX2A 1P9NA 4U39A 4UD2A 2EZUA 1JHMA 5LU9A 3GUUA 4BE4A 1H4SA 2P2CA 1Y4DE 3LIPA 1PJQA 1JI3A 1PL7A 1DELA 2QA5A 2GT1A 2FLVA 5GZ6A 3BZBA 5AHOA 2R6R1 3WGQA 4RTNA 1Y5NA 3KT0A 3CUVA 5ALVA 1WUKS 2NPFA 1Q5PA 3PWZA 2GPYA 3ZW8A 5AVUA 1B1AA 1G0NA 1XLTC 1QIIA 3BZUA 4LHZA 1ZPDA 3ZWDA 2XUQA 1GPMA 1XAHA 5JJKA 3SJBA 4FT2A 3WTBA 1A27A 3JU3A 1DZIA 4D0NA 5A3VA 4RD2A 4Z4FA 1E6LA 5JI3E 3IA7A 2Y3IA 4P81A 5BQ3A 2VUSA 4RZQA 1Y1LA 1QIMA 4LDRA 4MZDA 3B6ZA 5D3MA 3N5CA 1JYEA 1R4MA 4HEA6 4C4SA 4WSOA 4RZ3A 1F2UA 3IL2A 3P4YA 2OB2A 4ZP1A 1ISHA 4LMRA 4AYXA 2LCFA 4EF4A 5FUVA 2I1WA 2HEGA 3A3NA 2O48X 1HSOA 3JATA 3V7FA 5K8TA 5PGMA 4IUYA 1K2WA 2G25A 3EDOA 5CYFA 1QZ3A 4MQFA 1TMKA 3DFIA 3KTDA 3R7WB 2IPNA 3HJUA 3IELA 1Z75A 4BO5A 1GZDA 3IT3A 4F06A 4NBLA 3D2BA 5K20A 4G9BA 4NJMA 2EFHB 3KD3A 3TTSA 1USKA 1PZEA 1Z45A 3CZ9A 5FUWA 1B8OA 5ED4A 3LP6A 3ZHYA 4LJAA 5EN4A 3ZQKA 4D8VA 1Q16A 3ZWXA 3OEWA 4RENA 1D1TA 3JQ9C 5JNTA 3C8UA 3E53A 2K4MA 1QX4A 1CJTC 3VNRA 2Q6KA 4UE3S 1UC4B 2V7UA 4L0QA 2WB4A 1VP9A 3OT4A 5JH7A 3HXMA 1SCKA 2JFBA 1Y33E 2C4NA 2IK8A 2PJUA 1HL7A 1NW8A 3NGMA 5TC4A 4EYKA 3V46A 2VBFA 5LMZA 3FRHA 3EVTA 4AK9A 4KYVA 3W0LB 4EQ6A 3OVMA 3AVWA 1S2IA 1EDZA 4WJLA 2DPGA 2IPMA 1VBFA 3BH7A 2VDWA 2VOJA 3DOFA 2CYCA 1J0BA 5HHTA 2VF7A 4R9NA 3GRUA 4YS6A 2VJPA 3GV0A 5F3WB 4G0UA 2VHTA 2XF2A 1A1VA 2IYUA 3GP5A 1B43A 2DM6A 1K97A 4GOJA 4M8IA 2LPMA 4TQUS 1NKVA 5HF5A 3RS2A 2O3SA 3EN0A 3OQNA 4D96A 1K7YA 1YJBA 1QIHA 4KAJA 3K6SA 3DZ8A 4Q9HA 2CXTA 1H4TA 4LJ5A 1A9XB 1VPWA 1HYQA 3I62A 5EZYA 4LOJA 1OXKB 5I7HA 1T29A 1ZICA 2ZUDA 1IATA 1ULSA 4A6PA 2A35A 2QT9A 3BQ9A 4YP7A 4EMUA 4H3SA 5BSHA 1Z3IX 2CNKA 1AO0A 3AVVA 4JYBA 1QIGA 2Q6VA 1F20A 2JLRA 4EVRA 3OLZA 5CEFA 4YRIA 2V96A 3VR6A 1R0YA 4L4YA 1UBRS 3NTLA 4NULA 4R8RA 1U31A 3WQRA 1XQ9A 2VEDA 4KN8A 1DBWA 2QD4A 1N2EA 3ZZNA 3N2LA 1B23P 3K0AA 1FFWA 2HU7A 5DLDA 4LFBB 4IW3B 1X9IA 5C3UA 1NBMA 1TW2A 3KX2A 1UBNA 3ND8A 5EZQA 1NRJB 1X3SA 2Q3MA 1U2PA 3ZCTA 1KFCB 3CXRA 1DOZA 4QU5A 3HB0A 2BKAA 1O9BA 2QW8A 3PZRA 2AR9A 2XZDA 3ILYA 5FQOA 2AQHA 3MIIA 4JT2A 4JIMA 3WRYA 4LHWA 5JEDA 4NXNB 4V39A 4N5MA 2GH1A 3K8ZA 2VQEB 2J0UB 1H2BA 1RADA 3K9BA 4IO0A 4AJ2A 1QKKA 3GLIE 1YZLA 3F4LA 2Q7OE 4HAOA 1U0SY 5FEMA 5AW0A 4Y6RA 3U4IA 3IOCA 5H4HA 4DTIA 3ZHCA 2BP7B 2OY0A 3OI7A 3Q6IA 4INAA 4CUJA 5DGTA 4ZC1A 3TZCA 1Z7EA 4FMDF 4J94A 2J3MA 4MGIR 3ZW7A 1AQJA 1J49A 1N2CA 4Z4QA 2I2FA 5H3CA 4MV5A 2QJWA 4M0CA 3KL2A 3TS1A 2V7GA 5CDYA 2FZGA 2JFZA 3MTDA 1CRZA 1N5DA 2NQ8A 3VHXB 1VCNA 1CUUA 5HCUA 4AC9A 3TE7A 4US0R 3G59A 3RSQA 1NIJA 1QAMA 4A4DA 3L4EA 4HX2A 4YJFA 5CTJA 4I4IA 2I2CA 1IM2A 1JLLA 1U2RA 1KSHA 3LYUA 4GHWA 2H2AA 2VPXA 4J2OA 4YACA 2VPIA 2PRYA 1ACLA 5BQOA 1H2EA 4BUZA 4F3RA 2NM0A 2O0JA 2OMEA 4WGGA 3HKCB 1CRWG 3SPXA 3X1YA 3M6FA 1LF0A 3G7SA 3J7AC 3VKWA 3I9FA 5B3JA 3PC7A 1E2EA 2JDID 3ED5A 3IQXA 2VRCA 3P32A 3MT0A 4J3FA 3N7AA 1RZRD 2NV0A 1VMIA 3BMCA 2ACWA 1U3UA 3CWQA 4L0DA 3WWYA 2OZVA 4HATA 4RQUA 1K6MA 3MMPA 5AKJA 4KJXA 1XZJA 1RWVA 2QTWB 4Q9DA 3MT8A 4N12A 3RVDA 1KJJA 2EF0A 1NYLA 4OFZA 2HNKA 4RLQA 1LQ2A 3HCFA 4UU7A 5A0FA 1NU8A 1F0YA 3ICOA 2VP5A 5LMCA 1WB4A 2X6RA 4Z9YA 3X2SA 1Z07A 1V4BA 3AFOA 5BNWA 3UHAA 2DECA 3VNSA 3SHWA 4Q6BA 3P27A 2O8FB 1C1XB 2QL5A 4ABYA 4COKA 3AL3A 3SKVA 4IMPA 3LHFA 3TEJA 1OIXA 1K6XA 4X71A 4K1LA 5FOSA 1JQ5A 1QZXA 3AERB 4EW6A 1U3CA 1BN6A 4JA2A 1JHOA 4G1BA 3BA1A 4Y6GB 1XU4A 3ZWOA 4WD3A 5IKXA 3TI9A 2XBMA 1DMRA 3MGGA 1Y1TA 2Q0SA 3PNSA 1ZR4A 2BJWA 3EFHA 2IXBA 2DFTA 3RB8A 3UJNA 4ZQHA 5K4AA 1Z2EA 1ICIA 3DMYA 4D3XA 1NXPA 2HDHA 3EZFA 2AYXA 4CLOB 2N3ZA 1J25A 3U49A 1XU7A 2MYPA 1MKYA 1UPBA 1SKAA 4GKVA 4RK0A 3ZK7A 1C0IA 1NN0A 2F8MA 2GJ8A 1A5ZA 3T54A 4DT1B 5AW3A 1OZ0A 2AFRA 3EHEA 1Q15A 3HLTA 4CV1A 1QNFA 1JG7A 2VZEA 5CIYA 1NN5A 4AYWA 4MX8A 3L40A 4D3ZA 1P7WA 4Z6KA 4V1CI 2IRWA 2IYEA 3K1YA 3ENNA 2A67A 3KVOA 1OWMA 1R66A 1G8AA 2OD2A 1NF3A 3EC2A 3H5LA 5EGNA 1G63A 1U4OA 3PPWA 4IWXA 3O0TA 1GZVA 1QIDA 1SUDA 5B2ZA 3IHLA 2BGTA 2DSTA 3NRCA 3U0VA 1YR9A 3UKJA 3ONVA 2EDAA 2C96A 1TYZA 4JEIA 5CX4A 3ZV7A 4DQDA 3DOCA 2R8XA 1UBFA 4H4EA 5HTOA 4M1MA 3R3YA 4HS4A 1GGKA 1H9CA 3SHOA 3UBTA 3MTQA 2MSKA 1H42A 4PLZA 1TVKB 3ITNA 2OGUA 1VTKA 1KKMA 4MAMA 4QOJA 2I78A 2ON6A 1VJ0A 2DRIA 2UUCB 2GK4A 2P0YA 1VL5A 2JFQA 4BBPA 1R7RA 3UMMA 2Q0QA 4Q3LA 4RK5A 4EJSB 1MPTA 2GXSA 3OA2A 2GPNA 1LPSA 1NQXA 2LNDA 1XF1A 3G2LA 2NOAA 3HRHA 3NPAA 3FGPA 5LMNB 2CEKA 4KI0A 1QSGA 4HAXA 1MIOA 2FWIA 2YWRA 1YFKA 3WXMA 3SS7X 3O2SB 4ACBA 4LF4B 1YS4A 5D5PA 1MB4A 1KY5A 2BJVA 4X60A 2OCPA 4NS1A 3MZ0A 4I1RA 3RANA 1YQGA 3AIOA 1DAFA 4PZEA 5DE3A 4B83A 3F6YA 1HUQA 1DXQA 2IT1A 4FSXA 3VKFA 4WDRA 4KWCA 3GBVA 3T15A 2HD4A 3I2FA 3I64A 4R1MA 1G5IA 3FAKA 4QBTA 1E4VA 1HBJA 1FDTA 4B0OA 2W2QA 1OLXA 1RAGA 4R8SA 1WNTA 3U31A 3P5BA 3WMEA 3W1WA 1NXSA 4IDGA 2X5OA 2ZE5A 3QEOA 3K16A 4K6MA 3AM5A 4GI3A 4QJ3A 2PT9A 3STVA 1M8FA 4L5AA 1K8RA 4IUBS 1DKOA 4JI0B 2YCLA 2V54A 2H7YA 2BUAA 3PFCA 3OZRA 3LPCA 2I6QA 3IUMA 1KYQA 2JIZA 2WVAA 2HJWA 1DWOA 3PNKA 4HWGA 4BLUA 3N58A 1OKKA 2O3RA 3MJEA 1OI3A 2R97A 4R0NA 4CGZA 2YJNA 4D0SA 3I37X 4TKUA 3PQ4A 4CPDA 2HF9A 2I29A 4FYYA 1O97C 4JKOA 1SCNE 3I9LA 3C74A 1KO4A 1FLAA 4JQCA 5C1PA 1A7UA 2X4LA 1P4RA 2Z57A 3O9MA 4OMUA 2BD0A 2C99A 4N7RA 2I3AA 3HI4A 3IJRA 5IFKA 1QGED 1Y6RA 1Z4MA 4GLLA 4O63O 4KRYA 1VI6A 2DQYA 2EKZA 4P0TA 4W82A 3NXKA 3U26A 3ZGVA 5GV7A 1UH5A 1ZYUA 3E2PA 3GQBB 4D46A 3CW8X 1KMMA 4MUKA 5DVZA 1RNLA 3OD1A 2OQVA 4DIBA 4YLEA 1G60A 1M0WA 1N9GB 2ZULA 2O7RA 1G3QA 3KXLA 3TF5A 4Q3NA 3UM9A 4GZMA 1J2EA 3A2MA 1QHEA 2MIIA 1ISFA 1D0SA 1ZJ6A 3D3NA 5F9FA 3ASVA 3GJ7A 2CN1A 4ZFNA 2AJBA 1IG3A 1XKTA 3PUZA 2G72A 2CE7A 2OCXA 1X8LA 3OMLA 4MW2A 5ERGB 4TQAA 1CE8B 5I8WA 1DTEA 1LDMA 1YMUA 3L05A 5DYIA 1A0OA 1U0HC 2C29D 4K28A 5AQEA 4AWAA 5KJ1A 1ZAKA 4DUZB 4I66A 1KY4A 2OP0A 3HKEA 5ELLA 1YRLA 1N4AA 5H8WA 1DX9A 2Q5EA 4MUIA 2PEZA 2FX5A 1CJMA 3ZLUA 4AS1A 4G37A 1XZLA 2AFHA 3GD7A 1XCBA 4DB2A 4R2JA 2CHQA 1QF6A 4A2WA 3AHEA 2RHTA 2ZYSA 1PWHA 3UT5B 2Q4TA 1POWA 4LF8B 1U7TA 2D06A 1HQKA 1I6WA 3JWJA 3OM9A 2P77A 3MW8A 1FPQA 2QVLA 5C8ZA 4ITUA 1M2GA 1BTOA 4MUYA 4M8NE 5AMXA 1JTFA 1EA5A 1R10A 3BSFA 3ESZA 4BNZA 4NONA 4PBRA 3OETA 3P0FA 2E5WA 1AQUA 3MJDA 1PR6A 3KO8A 4D9GA 6CHYA 1K4MA 1X2BA 4MPPA 4HDRA 4JOSA 1KEPA 3KKMA 4IGEA 5AM3A 3NDBB 4ER6A 2O8CB 3QW4B 2M32A 3IO5A 1O57A 1JG2A 5GIPE 1SD1A 3CIOA 4M6WA 1J70A 4IDQA 4GR4A 2W6ID 5AVVA 5KNCH 1GL6A 4KQEA 2D0IA 3ESAA 3MGKA 2E5FA 4MW5A 4MQEA 3UN1A 3VOSA 4RE5A 4EHNA 4XD7D 5BV7A 1Q3KA 2FNAA 3WYFA 1F3OA 2FWBA 2MMCA 3K9LA 2C7QA 4G1MB 3WB9A 4F3TA 1VLZA 1CZNA 3KRTA 3H9BA 3RCBA 2XB6A 1I4LD 1XEXA 2GESA 2QSJA 3KEMA 4BE7B 4EJ0A 2ILVA 5CFNA 4KB5A 3THYB 1E98A 3L04A 4LGVA 1QFMA 2H7VA 5HKKA 3EDCA 3A28A 3HUUA 3IOBA 2LXNA 2C31A 3KPYA 4RS3A 2JI6A 4PO1A 1OILA 2VYND 4Z53A 3U4MA 2DGDA 2GPJA 4UW9A 1RXWA 2XMPA 1VI2A 3SG0A 4JGIA 4F96A 5I3ZA 1BFDA 1CJCA 3RIYA 3S8EA 4AY6A 1ONBA 4OXKA 1S3SA 4N5IX 1E2PA 3VH4A 1UXJA 4BZZA 2EARA 4BCBA 4W5TA 2C95A 3DOJA 1HR0B 2YL2A 1TK2A 2F48A 3KEQA 1R37A 3N59A 4FFPA 1MF7A 4LGMA 4IHKA 5DIZA 3KZ1E 4YREA 3QBDA 3E22B 4EDFA 4ZDIA 1IY1A 1KBOA 2ZTUA 2NSYA 4HWTA 1E1YA 5CH8A 4DZRA 3FGZA 3FPBA 4ZVSA 3BAFA 1ODIA 1XKLA 4C05A 4NIMA 1C9MA 4JVNA 3DHWC 3T5MA 2IS4A 1GGHA 4NLLA 2AFIE 4U2GA 1ZD8A 4JKIA 2B7CA 4O5OA 4EPRA 3C0KA 5C18A 3W5AA 1SO8A 1T1RA 2AR7A 2EL7A 5FLKA 4DWVA 1MX3A 1UJCA 1WUIS 1T9GS 1Y7PA 1Z22A 3L0BA 3INYA 3CF6R 4EUKA 3O2JA 5BUCA 2VKQA 3U3MA 5IX8A 1E5LA 3B3FA 5FLYA 2F1HA 2HN9A 1TJ3A 2P6UA 2X13A 4AX8A 3H2BA 1PTKA 4OHOA 4A2CA 2RHWA 1YXMA 1KZ7B 4BWVA 1DO8A 3H4MA 1ORDA 5LKRA 3HFSA 1TCBA 3OTIA 5CA0A 3TAUA 4HDMB 4TVSA 3TQSA 3UUWA 2FZ5A 1BWRA 3A4MA 3PLNA 2ZRKA 5HXAA 2G0TA 4GKKB 4HH1A 3Q0EA 5F9HA 1SQ5A 2A92A 3AW9A 1FDVA 1GARA 4NHEA 2PIDA 1MRSA 4NU8X 5H59A 4DLAA 3LO5A 4ES6A 2Q07A 4ZAWA 3BRSA 5CA1A 3EF3A 2CLHB 1CXZA 3TZLA 4AS2A 5A2QA 4EBBA 3KE9A 3M1IA 4BNFA 2D1SA 3DBRB 4CCSA 3SC4A 3FWYA 4YRKA 1X0XA 1EBUA 2ATIA 2ODNA 2OM2A 3G2HA 3M5DA 4OM8A 3R23A 3I9KA 5HCIA 3U7EB 1I4TD 5IMSA 2O2GA 5JCZA 2QOEA 2FPPB 3PYMA 3GDHA 3OFVA 2PX6A 4PCAA 2GO7A 2V7QA 3H1BA 2ZRGA 3FDXA 1G3RA 3GZJA 5FFNA 4BVGA 4IIUA 2XCRB 3H9UA 3F5MA 5IYZB 2R7AA 1DWUA 3D2CA 4KXQA 3IPXA 1NX9A 4P4TA 4UOEA 2OMKA 3FZEA 4Q48A 2Z83A 1E7RA 1VJCA 2H48A 2Q5IA 4FZVA 1WULS 1Z8HA 1KFEB 2MR6A 2WOJA 3U40A 2PV7A 4TROA 3LDHA 3OX4A 4U7TB 1JZTA 4A2PA 1C41A 2I7TA 4N4AA 1HE2A 3EPPA 4D42A 5ADHA 4GMGA 4LOIA 3EIUA 1DRWA 2ACKA 4CKEB 4LQLA 5DLPA 2QXUA 3BXHA 1WCIB 3IUJA 5TMDA 2JNWA 3KFLA 1C7ZA 1J5XA 1U3GA 3GBSA 1ORHA 2VJMB 2DT5A 1XFDA 2QGZA 2VT2A 3FDZA 2FSHA 3VNAA 1XMPA 4BMYA 1Q44A 2VNSA 1FSSA 2GM5A 3E1KA 4U1RA 2AG6A 4WKPA 3VYUB 4BJ3A 2WQ7A 1TJ4A 1CUWA 2P2NA 3G2IA 3FETA 1F0NA 4NBVA 3QEBZ 3JALB 3LF1A 2QRVA 1YAHA 1AZWA 4ZVTA 3ZHUA 1C3JA 4FXOA 3T7DA 4QDJA 1E92A 1E96A 2WT9A 5EP3A 3V32A 1X80B 4HGOA 3VR5A 3H2IA 1AH2A 3W8DA 3UT6A 2FPRA 2CNNA 1C2YA 3EUWA 3LTNC 1VB3A 2FEPA 2GD0A 1FYWA 1QH9A 1F6DA 1WHSA 3ZKWA 5BSRA 1ZY2A 2XA1A 4JB2A 2BKXA 1XZCA 2EJCA 3USCS 4F6RB 1E6KA 4P53A 3TLEA 4BMXA 2IGBA 4LDAA 4FCCA 3ZXXA 2CT8A 1SHUX 2ZWAA 4KE6A 4F46A 1OLUB 2A1TR 3VM6A 4QNMA 5A1TA 1FVFA 3FUTA 3EUAA 1KRHA 4HCJA 1E4YA 1I9CA 1W6UA 2YQ4A 2P2GA 1YQTA 2Q27A 3UA3A 4COOA 3ANTA 3FBWA 4ERNA 1E2DA 1T5SA 2XSZA 1IEQA 2GPWA 2H9YA 5JY1A 3IKJA 4OK3A 4K7JA 1RC0A 4C3UA 5LOVF 3C3YA 1T9KA 3TYXA 3G0HA 2Z95A 1SHKA 2OBXA 3F7TA 3K1ZA 3O8CA 2CMHA 3FLBA 3LL7A 3R8XA 2IDZA 2WZBA 1V7ZA 4GC5A 1G55A 2JG3A 2PQ0A 1KO8A 3TW8A 5JS6A 1QCDA 1PP4A 3WYGA 3WG9A 4IIJB 1Q6ZA 1ZRSA 2QN6A 1CKEA 1KEEB 2ONYA 2UYGA 2ZRIA 1SQFA 1W46A 2AC2A 2FWJA 5DBHX 2ZJ6A 4DFDA 3PKJA 3CF4A 3IYLW 4OLFA 1T1IA 1QRUA 2NUBA 2R6ZA 3RFUA 5HKBA 5EEGA 4F9GA 5HRCA 4Y9SA 1E8DA 4PLTA 2IYYA 3WC4A 1B0PA 2H1OA 3KQQA 4NNPA 2DULA 1VPTA 3A1VA 1ZHHA 2DWOA 1XAIA 3VPFA 5SY6A 2NV2B 1X7YB 7GPBA 1FFHA 1OTYA 3CE9A 3GLIA 2QS9A 1EVYA 1SG0A 1N5LA 5SY4A 4EFKA 4DDUA 3PT5A 3BOSA 4WNCA 1PYOA 1OLOA 3QLJA 2XWSA 4ZOLF 3QA3E 4IFBA 4UFNA 1P61B 2FY8A 3CZ4A 3NHJA 4IJMA 2PHZA 4D92A 2IXDA 4V38A 1MXHA 1JE0A 2PS0A 5IN4A 3AFHA 1WHTB 2QTMA 4BKPA 3DBHB 3TD2A 1U9IC 1QAQA 2QI9C 4XYMA 1FQOA 4NCXA 3EH2A 4YMSA 4UHDA 2GRJA 4MMYB 3DEFA 4ZZ2A 2ZRBA 1DDGA 3IAHA 2ZJ2A 3AK4A 3E70C 1CP3A 1ZXBA 1G8YA 1EP1B 2HX1A 3KBBA 1VIAA 1E4EB 4H6VA 5IT4A 2P65A 1MEEA 4E2YA 5LL6P 1AB5A 3F96A 1KAOA 3R5KA 3SVZA 2GWHA 1CY8A 1TNDA 3N2ZB 4FI3C 1NY5A 4YMHA 1MO6A 3KOYA 4GP9A 4Q82A 3OZWA 1W0JD 2ADOA 3OFJA 4BX8A 4B44A 1ZSNA 4YXWD 2FN3A 2ZWVA 1R3UA 3ZHRA 3D0OA 2AL7A 4FLFA 1Q0QA 1DKPA 1R12A 2YV4A 1JH8A 5FKJA 3SD7A 1NVBA 2XB2A 2OXEA 4M1KA 2IW3A 2SHKA 3LX8A 1BVYF 2BI8A 2GZHA 4LGCA 3ZWCA 4XWWA 2VDMB 3H86A 4FGZA 3T7CA 3WLPA 2DY1A 3JQAB 3DKIA 1ESDA 1Q7CA 4EJSC 2DYKA 4OHZA 5TS2A 3VSAA 3A4IA 3I5AA 3QOFA 1NVMB 3R74A 1ECLA 4BAGA 4F5DA 1FTYA 4H7JA 1UUFA 4EFDA 3AG5A 5C8YB 1P2SA 2J31A 4DLWA 2DPHA 2CJWB 3A6HA 3G17A 1A9TA 1HRDA 4AN0A 4C29A 2KI5A 1G8FA 2Y4OA 4RHEA 3T3IA 5IWCA 1Q2UA 5JECA 2NP7A 1L8AA 2AJDA 4XIIA 4CV3A 1JVSA 3A3PA 3PA6A 3C5EA 3T3MB 4D4IA 1V5EA 1KHHA 5HIAA 2C8KA 3UXHA 4YMUA 1MVOA 2QY9A 5GAJA 2HMAA 4C0AC 5HZMA 4BQIA 4BL5A 5BN3B 3NAMA 4B40A 1T2CA 3NT5A 5LDGA 3KJQA 1ODSA 1Z6XA 5HFAA 4DVGA 2QL9A 5TRTA 3QX8A 1XR3A 4XRGA 1H93A 2YC4C 3MT7A 4JLOA 2QENA 3DF7A 2M9MA 3FTQA 1BOFA 2G4CA 3FVVA 2CDNA 1WDTA 2JLAA 4HVTA 2JFYA 4DXHA 2O0KA 2DBYA 3QSGA 3BWBA 2OYRA 5AVWA 3AM1A 2JEYA 2PU5A 1UKEA 4ANFA 3RRMA 4P0QB 1QF9A 4JLDA 1KI6B 3REQA 4NCBA 4NS4A 3Q3CA 4MJ7A 5FD8A 1UZNA 3IDAA 2J9FB 4M87A 4MMXB 4WRRA 5ECDA 3WYCA 5BY2A 5G1NA 2IVFA 1DG1G 5TT0A 4GICA 1VL2A 3C3PA 4OH7A 1KWKA 4B85A 1E2JA 3U3RA 1RMQA 3MRVA 1QX3A 3LC2O 1H3FA 2OO3A 1R0RE 2AC4A 2ZAOA 3PJEA 2B1QA 2NAPA 4H0FA 3ETDA 4W6QA 3GU3A 4BCCA 1R15A 4PCUA 2YN2A 4P31A 1SHZA 1BVUA 3D02A 5AJWA 5ED0A 3DDZX 1DSSG 3EX7C 4YQZA 3UAZA 2FMXA 2C3PA 3S68A 5IVDA 1O7JA 1GZ4A 1XDZA 2R7LA 1E60A 3RR2A 2ZLBA 4PANA 1ZK4A 2FSVC 3LT2A 2I7CA 3QPBA 3T9DA 1PWYE 4AECA 1SUBA 1UBOS 3IAEA 4YJ3F 5LDDC 1F8YA 2CXNA 3FW1A 3GEPA 4PZPA 1CEQA 4RFSA 2PKYX 1SD2A 1MO5A 4UMDA 1TA9A 5K9ZA 5HP4A 1GZUA 2BKLA 3UOAB 1W35A 2WSYB 3OF5A 3AEXA 2X76A 4I36A 4UZEA 1PLLA 1ATZA 3FKSD 4ZTBA 3OIFA 4EZBA 2HK7A 3NRBA 3GUCA 1NUPA 1SVKA 1J8MF 1K3TA 2YDXA 3Q40A 4DEVA 4QA9A 2ISSD 1RM3A 2GNOA 2HUPA 3K30A 5DBFA 2D62A 5FBQB 5JDIA 3IUPA 1X7DA 4EMTA 2OA0A 4UAJA 3ROPA 2OQIA 3NH6A 1AD2A 4H17A 5K6AC 1QDLB 4X5OA 1I6KA 2G70A 4OI4A 2ECFA 1SC4A 2DHRA 2FFRA 2G7ZA 5AD1A 4GUDA 1TVEA 5JSKA 4UUAA 3I52A 3W2IA 2QRKA 1Z5GA 2CLIB 3MT9A 3S6JA 4MS3A 2QUIA 3K9QO 4BLPA 2AN9A 2VIIA 3FWKA 3SZUA 4BFUA 2GJKA 5CVDA 1CJUC 1OC2A 5AW9A 2XHEA 1XALA 1OGIA 1VE7A 2BZ0A 2V55B 2BH9A 3CKYA 4YI3A 3RS8A 2Z6AA 1AQYA 1W75A 3VR4H 4OQDA 2AN5A 1P2BA 1GVHA 3AI3A 1QANA 1M1XB 5AQ1A 5CBPB 3TTYA 2WTAA 1BEUB 3G6KA 3MINB 4HQNA 4WXHA 1NBIA 3QF7A 1P4HA 3BSWA 2FSIA 4QXPA 5E9AA 2DERA 3ROKA 4DY4A 1DIGA 4QT0A 2PCJA 3FB4A 2FWAA 1VECA 1E0DA 3GG9A 3HKBA 4RZSA 4NHOA 1HL3A 2QB5A 4XR4A 3DL0A 1L7RA 3C3XA 2UUPA 4OHFA 2DPYA 3QVUA 4JQOA 3WK7A 1V5WA 1H2RS 1ONNA 3DMDA 2ZCJA 3AKCA 1G6KA 4HUQB 2FF5A 3CLUC 4MR9B 1PN3A 2I33A 4UEQA 3TOZA 1G6Q1 1XO1A 3G8CA 5A9SB 3CR8A 2ZVDA 4FOPA 3TPFA 5ADUS 2C88A 1U8AA 5DM2A 1ZEJA 1OZFA 3X1XA 5JAZA 4N9WA 2PRIA 4AJOA 3ICQB 3HL0A 5B53A 3ZQ6A 1JEEA 2JA1A 1XCPA 3GVXA 3HYRA 4UM8B 3T6KA 1YL6A 1G19A 4Y2SA 5A7GA 2AZXA