3QVGB

Xrcc1 bound to dna ligase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
EPPDLPVPELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDRMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/ligase
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgB00
2ADOA 3AL2A 3QVGA 3PD7A 4BMDA 4N40A 3EF0A 4IFIA 1CDZA 1OQAA 3PC8C 3COJA 3HUFA 2JW5A 1T2VA 3L46A 2VXBA 1GZHB 2XNHA 3HUEA 3QVGB 4Y18A 1WF6A 2COUA 2INGX 4IGKA 4XPZA 1T2UA 2XNKA 2NTEA 3I0NA 3L40A 2EBUA 3T7KA 1Z56C 2WT8A 3PXAA 3PA6A 2K7FA 2AZMA 2D8MA 3PC7A 3AL3A 1KZYC 3UENA 1T29A 4ID3A 3II6X 3EF1A 3FA2A 3PC8A 4U4AA 4BU0A 2COKA 3K0KA 1IN1A 2L42A 4XQ0A 3I0MA 3K05A 2K6GA 3SHTA 2HTFA 3T7IA 3K15A 1IMOA 2LE0A 3JVEA 3L41A 3T1NA 2EBWA 3KTFA 2EP8A 2R1ZA 1JNXX 1T15A 2E2WA 3K0HA 3PXBA 2COEA 2VXCA 3SQDA 3PXDA 4OFBA 1Y98A 3PC6A 4Y2GA 3UEOA 3PXCX 3U3ZA 1L0BA 2ETXA 1N5OX 2M2IA 5ECGC 3SHVA 3SZMA 1L7BA 4BU1A 3T7JA 4BMCA 3K16A 3PXEA 3OLCX 4JLUA 2DUNA
chains in the Genus database with same CATH superfamily
2FW8A 3M3PA 2G09A 1KVUA 3D5EA 3HR4A 1NJ2A 3I52A 1X7XB 1Y3AA 3TI9A 4TYNA 2EFCB 3FCXA 4II7A 4LCJA 3TIVA 4ZTZB 1IH8A 2ZREA 1UZAA 2Q8QA 3BJMA 1LH0A 3HC7A 3UJ7A 4PFQA 1THZA 3TCXB 1JJ7A 2VZ0A 3OTHA 2BFBB 3QMMA 1MIOB 3DEZA 3F46A 1ZI9A 5FJIA 4KDEA 5C9ZA 1VLQA 2WM3A 2V7WA 2ECQA 3ML1A 4J03A 3LC1O 1VE5A 2MHCA 2TSYB 1YGPA 4QFDA 1IWBB 3E6AA 3PEUA 4MA4A 1GFZA 1K88A 4UUNA 2B0JA 2DTEA 3FNGA 1KI7A 4IS3A 4LV6A 4CF6A 2HDNB 3KTOA 4C4YA 2PRZA 5EXSA 2PSJA 2V7UA 1HT1E 1AF4A 1EUDA 3Q5EA 4AYXA 1KJZA 1SXPA 1S2OA 2X23A 1IWOA 3IHLA 1L7EA 1I3MA 1SXGA 4IGKA 4UREA 2XVMA 1Y4UA 2RGAA 2B4YA 3HJHA 4RM2A 4TXJA 4WZBB 3K2QA 1POWA 3MBKA 4EUFA 3U09A 5KDLA 1H0HA 3QELA 3ROPA 5KQRA 2FVXA 1J56A 3HYCA 3FNQA 2FUCA 1VJCA 3DT6A 4GIBA 4BQSA 2X0DA 1ICEA 2PNFA 4LA4A 3K35A 4F93B 5JRDS 2DUUA 1JHVA 3BD7A 1CZLA 2QL9A 3TW4A 1H2HA 4H7EA 4ARBA 1QYXA 4JEIA 3O2QB 3ASUA 3HNPA 5AYVA 4BU0A 3DB2A 4A0HA 1T3TA 3QENA 4KO8A 4P83A 5EXDA 1B74A 1TVEA 4HB0A 4KWEA 3RG2A 4Y0NA 3WB1A 1EVKA 4MXDA 2I2DA 4Q9KA 2VT7A 4ZJYA 2XHZA 1GPUA 1T9ZA 3A3PA 3CRW1 4LE2A 5F78A 2O6HA 2BMFA 4BL5A 5SZHB 1QOQB 1E7WA 4TSFA 2FTKE 3OEHA 4QD3A 4QO8A 1M2VB 4CMJA 4CT4B 5K3DA 1EP2B 1OC4A 1JHRA 1MHTA 3E8MA 4OOEA 3LYUA 4IO1A 3A1CA 4P4UA 3M5CA 1R0SA 3H84A 4GOOD 3VO8A 4LMPA 3OAAA 2PUJA 1CRLA 4D81A 1ESCA 1KMCA 1V7CA 2E1RA 5J4KA 3FBWA 2DC1A 3EPKA 3C3PA 5FUYA 2ZU0C 1E69A 1XYGA 3WK7A 1KEUA 2ZB7A 3H1EA 3BJZA 3R3YA 1ZBDA 4WY5A 3DVLA 1N8SA 1TAGA 4JJKA 5AOBA 5AP9A 2I9KA 2YIMA 2ZTUA 3X3HA 4QUDA 3L84A 5K3FA 5KOHA 5C4IA 1N5KA 1G0NA 2E4UA 3O4FA 4NCKA 3TTTA 3JZFA 4QUAA 3P9ZA 2YRWA 1SY7A 3L6RA 4MCJA 4ZODA 7YASA 1JHYA 2NXEA 4G1FA 4XH9B 3TIXB 5HKKD 4NU0A 4ZO7A 1GLVA 2JHPA 4EHAA 3WA7A 1HR0B 1OB5A 3O8NA 4JVSB 1XLVA 3TEJA 4LSGA 4GH5A 4XJSA 4KPGA 4DLPA 1TQ4A 5CFRA 3U1TA 3L8YA 3WRVA 1XJWA 1SBTA 1OIVA 4JC0A 4KXYA 3UN1A 2ZAIA 2YWRA 5DYWA 2PRSA 4MYUA 4ARUA 1U7PA 3R0JA 4WOPA 3PI7A 4Z0NA 2PIDA 4V03A 2WTBA 3TEMA 1ISIA 2QUIA 3ZDRA 2C9OA 2NT3A 5DU2A 4FDMA 1MVNA 4QRIA 2QE6A 1JG2A 2GM3A 2Y2UA 2JLCA 2YUTA 3LIIA 3BZBA 3R2JA 4O1IA 2PMCA 4EG1A 1R16A 1ZOPA 1LDEA 3A4VA 1P2SA 5IKMA 1Z6QA 1QFXA 4AWAA 1QFMA 4ENTA 1NT2A 5G3YA 2W0SA 3IE2A 2A5DA 3AIMA 1ZEMA 1KF0A 3TLBA 3U4IA 4WY8A 1Y3BE 2PK3A 4C3VA 3TQTA 4EFNA 1CERA 1OZHA 3AY7A 3QUSA 1HDIA 4TTAA 3ZNPA 3ORSA 1DBSA 4XIJA 3S0JA 4G4IA 3HR7A 3PGXA 3ZZ1A 5E3HA 3GQBA 4P4SA 3DMHA 5MN6A 5K0ZA 1A7AA 1SQSA 3ET4A 1ISFA 1UBTS 4YRNA 1T1EA 1RXWA 4J8PA 2M1ZA 4IJMA 1L5NA 4C7XA 3JQAB 4NX2A 4TMYA 3ZVRA 1JR3D 4Q7LA 3KUXA 4HUQA 4XE5A 5A4IS 3U56A 1KZHA 2W6NA 3AL3A 3M6AA 2XT9A 3GFRA 2BEUA 4FKZA 3HE3A 4RA9B 3RHTA 4C76A 2WF7A 1G7SA 4RX1A 1XEWY 2DVMA 4B79A 1IAVA 1TEHA 3KPJA 1SVIA 5BN3B 1YJXA 4KXQA 3DUWA 1Q0TA 4L50A 1WLSA 2CVFA 1V1RB 3NGXA 1ZHOA 5DT9A 1T2AA 2H07A 2QBYA 4ZU1X 3K0KA 1H9BA 3AIOA 3RSGA 1P29A 1KR5A 4O3MA 3UOWA 5FLXA 2WM2A 2XDWA 3FW1A 3KLBA 4Y0VA 4V0MA 4DB2A 5A4MS 3L1JA 1Q7EA 1RYYA 2ASVA 2AEMA 1PVVA 1JMYA 3A28A 5CW1A 3RV4A 4B6OA 1VP9A 5BQ5A 4XIFA 2XGOA 4Z51A 1ZU5A 3V4LA 5FLEX 1LDYA 1DMSA 3R1IA 2Z30A 3U0VA 4WBNA 4HK4A 1R9JA 3DE2X 5C1BA 3DYIA 1CYDA 4UHEA 5BO5A 1E96A 2H1IA 3G89A 3NDRA 4EKNB 3KTFA 3HM9A 1EBBA 2IEZA 3GJ7A 2Q5HA 2LRHA 2W43A 4LZJA 1ZC3A 1HFJA 4YP5A 4WESB 1XQWA 4EF4A 3BIXA 3LT2A 3FOFC 1OXTA 3KPWA 4OFBA 2P1DA 1LS1A 4KH0A 2DSNA 2XITA 1QK3A 4K3UA 4YTEA 4ZMRA 2GVZC 1L0BA 1MB9A 3MSXA 3ZS9A 1CJSA 1F4VA 2PAFA 3UHAA 2VKQA 2GPAA 3D8TA 2XQJA 4W9RA 3TLXA 1T36A 4QDTA 2EGHA 2ET6A 3DL0A 3E1SA 2C1ZA 1C81A 4NQZA 2GUGA 1HY3A 1T1GA 3UGQA 1WB4A 3L4KA 4F11A 2A9QA 2A0KA 3K9LA 4B3HA 2O6LA 1O9HA 4FBMA 4PEVA 5LA6B 1NZFA 5KNCD 3WOVA 3E9CA 3MA0A 1DIGA 4HWKA 3IE1A 4ZRMA 4HGPA 2Q1YA 2FPLA 1Y5NA 4IIJF 4RY8A 3M2PA 4MGZR 3QU4A 3DAGA 4GP9A 4YRCA 3UJDA 5A02A 5JWRA 5JTUA 1XMOB 2P2LA 1DSSG 3H2HA 4K6FA 5IUKC 1KY3A 3R3XA 5I7OA 1V4VA 2WK1A 2ZIVB 3OC0A 2E4YA 3DB1A 1LBSA 3CN9A 3GJRA 3H5LA 4PAMA 3THXB 1T5OA 4HY3A 2IYYA 2G8NA 4QBFA 1C1HA 1M5TA 3B1KA 4ZKDA 3ERCA 4ENVA 4M9CA 2OB1A 1J1ZA 4QPDA 4NJOA 1L5RA 1RAIA 3WDSA 2XVYA 3LBFA 2AJDA 2OCGA 4IHJF 4YACA 1EK0A 3JASA 1L7AA 3L7KA 2YY5A 3W1VA 4LBYA 2G0AA 3EEOA 5KNCH 5AVXA 2QRVA 3VJKA 4BPBA 2VCEA 1QHNA 1W75A 2VK8A 4LRXA 1L7VC 3G9UA 3H1FA 3IAHA 3V33A 1M7HA 2VTKA 1FMTA 1WY5A 2D00A 2ZYSA 1E2PA 1H6DA 3MQ4A 3P0FA 5AK6A 5E2IA 3WKDA 4E2YA 7REQA 5KBYA 2HK7A 3WLJA 2LKCA 4RKQA 2ZANA 4K9RA 3AM4A 5TNXA 4RQAA 3T35A 1FMFA 2EJWA 4YHHB 4F5WA 2B3TA 1F4PA 2RCYA 4I5IA 4QVKA 3NETA 1NW5A 4OO3A 1S2MA 1PQYA 2A9PA 3DTNA 5T6BA 3ZHTA 1ACJA 1ZH4A 2E4XA 1LPSA 4U4AA 2ZVQX 3K9GA 2EYUA 3RIEA 3L1UA 2NAPA 4MA5A 4RPKA 4ZPXA 4B43A 2GZ2A 4TL6A 1YONA 3WL7A 2HADA 1SKYB 3DVRX 3IYLW 2XAAA 3KS9A 5DHQA 1QX3A 3NUZA 3GVXA 5EIXA 3QPWA 3F6YA 1SVOA 3LJKA 2KJQA 1W2GA 1TK9A 4I9NA 5J4HA 1T3SA 2G3YA 4A5OA 3Q8XB 2HSGA 3OPNA 3VYSB 1T3GA 4ZT3A 1HT3A 4M0MA 1FUEA 1LSOA 3JVVA 1BSVA 4A1FA 2BGMA 2NV2B 3C6XA 2EBWA 1O9GA 2JDID 3TZEA 1JJFA 1U98A 3OIYA 2XDQA 4R51A 2FX5A 1OB2A 1UM8A 3KXPA 3OTQA 3QFHA 4NEQA 3EVDA 2HCTA 2H00A 3RARA 5JSZB 2YWFA 2DLCX 4FEAA 2X5NA 4CDNA 1NOKA 4PBRA 1ZIXA 4GLBA 4OU5A 1GSIA 4Y3UA 4RTOA 3PXDA 3THWA 4G5SA 4H7FA 1IBRA 1E32A 2H2IA 3HUUA 3L7DA 4PG6A 4MQMA 1DIBA 4RZXA 3ZDAA 3G0HA 4ZQEA 3UC9A 4DOMA 1DEAA 1JE0A 4MI6A 2RH9B 1A2KC 1MH1A 2MINB 3FOEC 4TKMA 4MKZA 1QHSA 2GZSA 3O47A 4LE1A 1SVSA 2RC6A 1OH6A 2C3UA 3C14C 3KQMA 4KV7A 5EOVA 2IUUA 3E84A 1Y6GA 1BXRB 1MVOA 3LX4A 3HZZA 5JALA 3EVAA 4H6PA 1EIZA 5EMKA 2Q5QA 2AS0A 3NDIA 3RSSA 1EAYA 3Q6MA 1EA7A 4F1JA 2NU7B 2P9FA 5BYJA 4BMOB 2BF4A 2C4VA 4CQMA 4U0JA 1P2VA 4G0UA 2D5BA 4N6NA 1NVTA 2KW5A 4YMHA 3G13A 5CA0A 2YWJA 1N25A 2FK7A 3HACA 3QVMA 4Q24A 3TX2A 3I2HA 2A6PA 2AUNA 3ECSA 3ASZA 5E4FA 3UOGA 1KP9A 3GLGB 3LBIA 3D7MA 2QHXA 2WUFA 4OQ4A 5I7AA 4YDHB 4MVYA 3PR2B 4FVTA 2W37A 4PC3A 1GLGA 1GVHA 4TLDA 3O74A 2WSLA 5FNVB 3U3KA 5LD2C 1E7RA 1NDHA 1ULUA 3IE0A 2PIAA 4H17A 1E9RA 4ZJUA 1M34E 1NV8A 3BDVA 3PEEA 4NE7A 3ED1A 4IUBS 3CRQA 3RFUA 4YJFB 1BDMA 3T3EA 3W4JA 3SX4A 1QTQA 2W8ZA 4XYMA 1E1MA 1GGEA 3WL3A 2PZ8A 1JLRA 5L3ZA 5BSKA 1PZMA 2R4UA 1T9BA 4P81A 1HEIA 1AUVA 5CFMA 5K8LA 3OBIA 3MIZA 3OCVA 2VXYA 2PZGA 1CDEA 2DFTA 2PT5A 4UTRA 5C3MA 3A9CA 3T12A 1IG0A 2BGNA 4Q3DA 2AC2A 4Q4HB 3G88A 4S1OA 2IL1A 1KI3A 1NQAO 3W3AD 2PANA 3P19A 1N75A 4G4JA 3G5TA 4N49A 3BXOA 3MCAA 4P3KA 1TZBA 5HIJA 5BW6B 3UMGA 3VHQA 4ZYZA 5GVSA 1KNQA 2Z09A 4N65A 4M38A 2A58A 3C24A 2P6PA 4M87A 3FUXA 1F2UA 5F98A 3CCBA 3PPWA 1E94E 3GLVA 1KK3A 1GQSA 1KMMA 3U81A 1Q1AA 2I4IA 3NEAA 1EDDA 1VL1A 3FUCA 4ICIA 5AIAA 1XKLA 2OILA 1NFQA 2UZ1A 3N6XA 4V1CI 2PVSA 1XB2A 4W1QA 3FVWA 1H0KA 2CNOA 4IVPA 1UADA 1E6EA 1R6UA 3L6CA 3TQRA 3JQ9C 2DWUA 5LNK1 1T9GS 4HUJA 2HSWA 2HRCA 5E8JA 5FWDA 3R0XA 4LYHA 4NBVA 2H5LA 4PG5A 4I4CA 3LMKA 3CNHA 3HBFA 4CU5A 3ND5A 3CT6A 2OBLA 4WGGA 1G291 2EFHB 4BFCA 4R98A 1ISSA 3CLTD 3RI3A 3T1QA 2ZT5A 4HGQA 1N5RA 4H60A 4I9HA 2IYFA 3I45A 3TL6A 1VKHA 1CUWA 1Y98A 4WCFC 1VL6A 3R44A 3ZHQA 3EG9B 2O2ZA 3ROFA 2PGIA 4U5XA 1MO6A 1IXSB 1C4OA 5KVCA 2WAOA 4DIBA 5EXTA 4WRRA 3NI2A 3PLRA 4Q3KA 5DN6A 5A3VA 1XA3A 1TZKA 3FXAA 2H1OA 3SQOA 2GZDA 2JFYA 5KOJB 3TSAA 4YA6A 4BX9A 1A9XA 4J0CA 3GJ5A 3NTVA 3OH8A 2C8LA 4OV6B 5FL7A 3P9RA 3RFFA 3CO0S 3G8BA 4UBKA 3RDPA 4BDTA 1ESDA 2EW8A 4IFIA 3RTDA 4CMEA 3KLOA 4J4TA 4KLNA 2OQRA 2EFEB 3IC5A 4Q4AA 2QD3A 1BHJA 1RWPA 3W2TA 2F8MA 2IEDA 3QUCA 2Y0BA 1HDOA 1SELA 3BMCB 4CKWB 4CEIB 3BBPA 1XZPA 2CZGA 2YW2A 5IJAA 1PZXA 1M2NA 4HADA 4I5EA 5ALIA 3N0XA 5DGTA 1N36B 2EBHX 1JKJA 2HRRA 2XCLA 3WK4A 2HM7A 4FMCF 2Q5CA 3PR1A 5E7QA 1IULA 2XZTA 4GP7A 5JBIA 1YFZA 4ZDWA 5IBPA 1APBA 4R01A 1I1HA 2Q0QA 2F4VB 2CFSA 2N75A 2DH6A 3BTUA 1CJUC 5AVKA 4Z54A 1SUCA 4MUIA 2FDCA 1P5HA 1ZY2A 1QYWA 1W4RA 2OORA 1U28C 1F9AA 1S6YA 2QQ0A 3IJRA 3J80A 4GM4A 2NZ2A 4RTSA 1GA1A 3MXTA 1WR8A 3BILA 1Y6FA 2XNKA 3V7YA 2WJAA 4GZLA 4N3BA 1FTNA 5GM2A 3TLEA 4D5GA 2IZ5A 4CLEA 3ICEA 1ODFA 3ITNA 3FBTA 2ODEA 3H5IA 3MWEB 2OBBA 1U4NA 3F8WA 3WMXA 2ZYWX 5LP6A 1GM5A 3DPSA 2OZVA 3Q1KA 2VYNA 3LHSA 3Q3EA 4TWIA 4ZYTA 3DVAA 3NWOA 3IMFA 2GEVA 2RK3A 4KGZA 1WIWA 4MQEA 4DR1B 2Y67A 4E14A 2C97A 2ZSIA 3PC7A 4PTYA 3VOAA 4L9SA 1FNNA 1A8PA 2I2WA 1C7FA 4BO3A 1G17A 2IS1A 1VB3A 1V1MB 16PKA 3A58B 3DOUA 1SWWA 3O0DA 1DAHA 3WWZA 1U7ZA 3UOAB 3VFDA 4QE3A 3HWSA 4RV4A 4NECA 5HMMA 3RU7A 4BNVA 1L1EA 1ZEJA 1CCWA 3ZD8A 1DC5A 3RIMA 4C3UA 3HYLA 2PZKA 2LDXA 4F0JA 1TOAA 4R05A 3PYMA 4QUKA 4RADA 3UCXA 4EVSA 3AUAA 3LE8A 1TIBA 1UH5A 3KZVA 4LVOA 3ADDA 1SHZA 1DRKA 3DCYA 3Q7QA 5HS6A 2X7JA 4XYBA 1RW4A 5AKHA 3OMXA 4X1IB 2VWGA 2QIPA 4C87A 1UJ4A 2SKCA 1K0UA 1BO6A 1N7JA 1ZU4A 3OFND 4X1KB 5KTKA 3UMYA 4P2GA 1ZWKA 2EJCA 4UBNA 4EG7A 5GIOE 2VP9A 2H08A 4PO8A 4WZAB 3CZ5A 5LKAA 2IZOA 2C57A 3B2EA 1N2HA 3TYXA 1ONOA 1JVBA 2HLDD 3O82A 4GP6A 1QGYA 4KC0A 1CV2A 1R12A 2FN9A 1QIHA 3H83A 5KYWA 2XRZA 1O1YA 2NTNA 3H5TA 1ZGGA 5KNLA 4I50A 5JWHA 3ZW7A 3Q87B 3TQOA 1CUIA 1MV8A 1I1QB 4ES6A 3LUGA 2DHQA 4MQ5A 3OJ0A 4AY6A 4EH1A 3K16A 1QR2A 4YDRA 4PQEA 3KYBA 4PSKA 3UK7A 2C04A 4HDMB 4KEAA 3IUMA 2WT4A 5EJ7A 3QBJA 3ZXYA 1ORWA 4ZWNA 4D3XA 2ADOA 4DWWA 1ZN8A 1D2HA 1NRJB 1QZ3A 3CSSA 5A0FA 3ER9A 4OSOA 3L82B 2AG0A 3KKOA 1FJXA 4G65A 3ZLJA 3STWA 4ER6A 4DPLA 1P1RA 4HAWA 3SSNA 4OAPA 3NUGA 1T91A 4BTVA 4XD2A 4WBNF 1F8YA 3P4XA 1LLCA 1W6UA 4R41A 2F1OA 3AUJB 1F9EA 1H94A 3BHIA 3EPLA 4GKJB 4POAA 2CHQA 1QLWA 1WSDA 2I34A 2V55B 1QRSA 1QFSA 1C5KA 4JBXA 3DT9A 3O84A 4RWEA 3CLUC 3KOUA 4ARZB 5AJZA 5TB5A 2FCRA 1UT6A 4I6GA 1SQ0A 5H70A 3DD5A 1BQ3A 2GVDC 1TLLA 3IVMA 2IU4A 4EB6A 1I9GA 5HJ2A 1E2LA 2B25A 4QYXA 4LC0A 2B4AA 3T1VA 1V8PA 3IDSA 3WWDA 2I2FA 4C4TA 4Z53A 3WBJA 4W9NC 4WLFA 1QWSA 3UWSA 4WOCA 1W5EA 1WMAA 5EPUA 2FQ1A 5D51S 5I6DA 2PVPA 3K1ZA 1T9DA 4IILA 5JO9A 2ORIA 5H68A 3SQXA 3ZCPA 3RVDA 3WLNA 1VE7A 4UDOA 2R86A 3L8GA 1QC5A 2EFJA 3T5PA 4G1VA 4BP8A 3RVJA 1F3OA 1EGAA 1UXKA 2NUTB 2Q4RA 4DS3A 4EHFA 2PJDA 3PFNA 3EXHA 4Z2YA 2VJNA 5BNZA 1VMEA 3HFGA 1ES9A 4DCCA 3MJVA 5EIOA 5A0TA 3WSTA 3ZI4A 2K5UA 1JE1A 3VVCA 1VP3A 3Q88A 1MTZA 2WHPB 4RHUA 3T5CA 1N2XA 3WGTA 2UZAA 2O0LA 2R6JA 1L1FA 4C22A 4HLNA 1SRQA 2YN2A 3GEBA 5T57A 4PIVA 2JBAA 4Y2UA 3IQGX 1FFCA 1PAUA 2HWWA 1W36D 4C4ZA 1YQQA 5CB6A 2ZB4A 1L4HA 1V6AA 4KJZA 1WVGA 1JHQA 1EK1A 4PLFA 4FZJA 3L7AA 1NNSA 2A9VA 2BM0A 5DNEA 4AG6A 3PJRA 2IC5A 2WIGA 3LT4A 4UZSA 3LY8A 3RODA 1KXZA 2VAMA 2W00A 3F6BX 4L95C 1Y1KE 2BHSA 4M0PA 4PSDA 3GEDA 1YVEI 3V8PA 2WE7A 5FA6A 2UXDB 4MCIA 4XWKA 4FFDA 4WSOA 4D4IA 2COEA 1PX2A 4GPAA 1SRRA 2IF0A 3LG2A 4WERA 3ZPXA 1EPUA 4MIEA 4URXR 1YK0A 4CNQA 3GCWA 4GX1A 2OGZA 3CF6R 4I36A 3IT0A 2IYOA 3FYCA 2PTGA 4GICA 4WFKA 3ZZUA 4IJ5A 4ZEXA 1P9OA 1FVXA 5B64A 5JS1A 4D46A 4D26A 2GWRA 4HC4A 2WHXA 3WO0A 1P1JA 3FHJA 1T13A 5ALEA 2PX0A 2PWZA 1NXOA 3FZYA 3RS9A 3HKBB 4RQBA 2Q45A 3LX5A 3D6UA 2EV9A 3MT8A 2C07A 2FG6C 1XTRA 3QMWA 1AZSC 2WD7B 4KL8S 4PO9A 3V4OA 1B42A 2JI4A 2NO7A 3W3ZB 1NNLA 1UMBB 1P4HA 4HPWA 4BNIA 4DNFA 3H2YA 2JG3A 1X8JA 3V8RA 1WU8A 3DAHA 4UM7A 1ZIPA 4WIAA 2N46A 2Q3EA 3QKIA 4BFVA 4GEGA 5EIBD 3U9LA 3X1XA 2HEGA 3RSLA 2QTGA 4F8EA 1GL3A 5C1OA 4RMHA 5I7VA 2DM6A 2WG2A 3QE3A 4MGEA 1T8UA 2CL6X 2GYVA 3OPYA 4G4SP 4L75A 1JFLA 4R5MA 5ALDA 2LWIA 1B0UA 4JYAB 2O8DB 4BVKA 4DC1A 2QI9F 4FS3A 3KXLA 3MMSA 3KSDO 1ZR2A 3K9NA 3P1JA 4BEBA 5J2UB 3PNKA 2PR7A 3E48A 4L76A 3BMQA 5I4CA 1WPGA 2QSYA 3FGZA 4QODA 4F96A 3EQ6A 5KREA 3U6BA 5K0SA 2GM4A 4JLVA 1NVXQ 2C4HA 1RP1A 1SFRA 2O2SA 2ZW9A 4AUEA 1AXGA 3IPRA 3LGSA 3HL4A 3VISA 3WSVA 2H2DA 4X7PA 1M2OA 2GFHA 4JJ6A 3QX7A 3GLFB 1GKKA 1FMJA 4FMDB 4ZRDA 3LUKA 3WLFA 5A4FS 5IFLA 5ARDA 1Z73A 4MYRA 1Y3FE 4TXMA 1ORIA 4UARA 4K46A 3VSCA 4AJ2A 8MHTA 1V5GA 5C5CA 3PE6A 3ZDEA 1IIBA 1VSUA 5GONB 2OO5C 4C7JA 4EF5A 3R9XB 1XZGA 4I2VA 2X7HA 4G0ZA 1CUYA 3Q7IA 3PDHA 4OYLA 3IJPA 3ET5A 4LYYA 1FSFA 4UQPA 4CKBB 4JH0A 1ISHA 2NZWA 4HOYA 4QOEA 3ZHUA 3R41A 2WU3A 3HWX1 4MVJP 4QXMA 1FSSA 2BKUA 1GL9B 1W6RA 3DH0A 1P7CA 2FP4A 1DAMA 1VE6A 1MPXA 2QUZA 4IW3B 2AQIA 3ABRB 3UH0A 1W93A 4CU2A 1DGQA 1XD8A 5BSGA 3C8DA 1CUBA 4BPRA 1Q7CA 2X13A 1AQIA 1GVNB 4NC9A 3KJGA 4AXBA 1AMUA 3I3OA 1SVUA 3ZXIA 1UMCA 3K05A 4TL7A 4BP9A 2HT1A 2BEJA 1JDBC 4IDOA 4J76A 4B4OA 5BR8B 1E3WA 5M3BA 3A6HA 4ZYWA 1IBMB 4GU5A 5A4JA 4REQB 1OH8A 2D1TA 4U7TB 2GUWA 1KP2A 2R68A 3GJ6A 4ASUD 3GI1A 1M54A 1RQRA 3ZY5A 1CQWA 2EX0A 3EB9A 3TLMA 2I54A 4WK6A 1S2GA 2ZT6A 5I5EA 3KQNA 1HL7A 1RZRA 1CS0A 2GF2A 2UUAB 4FJ2A 4RH3A 1JNYA 2AK2A 4DC9A 2ZJAA 2QP4A 2GHIA 4PRZA 4M49A 4DFDA 3HN2A 1HYEA 3HKDB 1W0JD 1U9JA 1CIJA 4ZT4A 3S2IA 4BO7A 4JXXA 2XE7A 3EJ6A 4KVFA 1EG7A 4F9GA 2IP2A 2WVJA 4Q1CA 5PNTA 3R8CA 3MJEA 3IQEA 4D7AA 4QWMA 1GG5A 4PNZA 3KL4A 4X95A 5EJMA 3IA2A 1JEQA 1VI6A 2F67A 2PLFA 1PL0A 3DQPA 3QXHA 4N9QA 2ZJYA 4WV3A 3TZHA 5FV7A 1NQ5A 3BHNA 3ETHA 3GEIA 3PDUA 5H80A 5JVDA 1SXJB 1FYXA 2Q0XA 1PTJC 1VIDA 3LKBA 4G3XA 2ODTX 2C5LA 3RS7A 5I9TA 4PN3A 1XU9A 3N8DA 1TW2A 5T64A 1HOTA 3NKLA 3RGGA 4XTRA 2QSJA 2G5GX 2LZ0A 2R87A 3TAHA 1U3UA 2PU5A 4OQXA 5CR9A 2QLBA 2ZOSA 3GELA 2HCFA 5JFTA 1TT5B 4Y2XA 1O94D 3K6JA 5TEWA 3E3MA 1AKMA 1YS7A 3KOOA 5E2AA 3A1VA 1SGWA 4RACA 2JLSA 3NRJA 1CDZA 5EFOA 5FUBA 4GRAA 1BA3A 1UPTA 1QYCA 1VBNA 1FUYB 2E7ZA 2WF6A 2AXQA 2WFAA 1I24A 5TRTA 2Y6UA 3NM6B 3G0GA 2B2XA 3CZRA 5TQ2B 3RVRA 3RVNA 4TLEA 1S8NA 2P67A 3NAMA 1V9CA 2PFKA 1ND5A 3WFJA 5JC1A 5ELXA 1EWTA 2OVBA 1X38A 1JZQA 1P73A 2Y99A 5HF9A 3ZDXB 1VDMA 2GJ4A 1GTSA 2PTHA 3AR7A 4BXOA 1KY2A 4M9UA 4MP8A 4K6KA 4NNOA 4OHWA 3ANMA 5BV0A 3ZD6A 2FPXA 5C4MA 4LDZA 3IAXA 4CMGA 2I4NA 3E0QA 4OVKA 2L69A 4PPQA 3QJYA 4B32A 1ZSNA 3PIIA 4KH1A 3HV2A 5CVUA 2RARA 1DKUA 3IULA 1B6TA 3RHFA 2R6DA 1G4UR 2Q99A 2VRWA 1IC6A 5AKIA 1LRKA 2FV8A 2OKCA 4QULA 2OGUA 2FDRA 4R1QA 2HPVA 3T7RA 3L6DA 1TJ4A 3LPLA 3RVBA 4AMGA 4O4HB 1DBRA 1NN3A 1ZLYA 3WKAA 1EIWA 2WR8A 5AKEA 3NYRA 3P2EA 1MABB 3LQRA 2AE1A 1Z5UA 5IH3A 4A16A 4MVXA 1T4DA 3G0DA 4Z1MA 5B3JC 4RVNA 1SMKA 3ZZMA 3T7TA 4DLYA 1ECJA 5FI3A 4BNDA 1MMFB 2DBZA 3GNLA 1VHTA 1W25A 3F6EX 3I34X 4NOKA 1EUQA 1WHSA 1LXCA 2IF2A 3LLVA 3EQ8A 3H5OA 3RT1A 1XKXA 3AETB 3NHJA 2XRMA 3DTYA 5F51A 1ZOIA 5BNIA 1XTZA 3F5MA 1GKUB 3NHWA 4EMTA 1V5WA 1G8GA 5BQ3A 5IFKA 2WNSA 4HAXA 4CIWA 2R1TA 1L5SA 3P7MA 1YTUA 1MJHA 4B80A 4LF6B 3EDMA 2JFGA 2CHVA 2HQSA 5DRTA 1QE5A 3O1IC 3L1VA 3FKJA 1GKYA 1E1QA 5DWQA 3ANNA 2LW7A 1ZG3A 3E3LA 4IXDA 4MHSA 4O4JA 3HY4A 4MB2A 2SHKA 4GOKA 1PLJA 1SKMA 3VDMA 3TK1A 1FNDA 1GXSB 5AWFC 5LP6F 4KLCA 1ZD2P 3HVUA 4IIHA 1O87A 1Z5NA 4NFLA 5AKLA 1KMNA 5JNSA 4JU9A 5KTTA 1QDLB 4H4CA 4KPEC 2V96A 1OSNA 1Y4SA 2CHEA 2FZ5A 2W83A 2X19A 5CVVA 2HQBA 4YHBA 3ZBQA 1T0PA 3FDXA 4PSUA 2HMSA 1AGPA 4H7IA 5AI6A 4UHDA 1UJNA 4XJXA 1Z4PX 3AF4A 3CUEF 1IHPA 1AS0A 1JHXA 1G5IA 5HIMA 3SC2B 4UPVA 3U62A 1C3XA 4DSZA 4Y8VA 4C6SA 3MJSA 3IP5A 1IBLB 3S8MA 2O3JA 5BWLA 3G0OA 3OLZA 1ZD4A 5COBA 5CDSA 3WZMA 2X86A 5ES4B 4EATA 4R8KA 2BEWA 5LXTB 4IMRA 2FQWA 3UATA 4I3HA 5KJ6A 4BNZA 1P5FA 3H8JA 1AHIA 5ELMA 1PNVA 2H1RA 1XZCA 5LUAA 4DJFC 1GILA 4JHLA 4BB6A 1CUAA 1U2GC 3C6QA 1YS6A 3A0RB 1ISJA 2QN6A 4FFNA 4M60A 2AR0A 1XZQA 4JYCA 4NFYA 2AFIA 2H48A 2PKCA 5A6SA 1DXHA 2J9XB 4PIPA 3A2MA 5LLSA 3QFCA 5JFOA 1OV4A 1E4EB 2FWBA 3GQVA 3K7EA 5DNWA 1V41E 4IH4A 1O6ZA 5AJYA 5JSFA 4FGJA 4X3PA 4TSRA 1OLXB 1UC4B 2JD0A 4YECA 1RBQA 3HA7A 4ZOBA 1V39A 1EM8B 3F1KA 4X6UA 3IELA 1E3DA 2XTAA 4D0GA 4EAQA 4IDPA 2R65A 3ROZA 2RGDA 1YMUA 4QGGA 3VC2A 1LK7A 2WM8A 2ZJ5A 2BP7A 4I50F 4IX1A 4KQIA 4NNJA 3QLTA 4H59A 3QOYA 3UJ3X 1P2DA 4P80A 4PLZA 4DLXA 1U7OA 1BQ4A 4MKXA 5ALTA 1LV8A 4BFLA 3NRCA 2UUCB 4UDYX 4C2BA 1IJKA 1YBHA 1E9VA 2ZR7A 1G6HA 3HUDA 4BQRA 2KBFA 1XF1A 5KSYA 1RRPA 3EVNA 2BUBA 1TTQB 2JF0A 1XD2B 5AD1A 4Y6SA 5JNRA 4HNGA 1E62A 3NT5A 5AM2A 1A7KA 5JD5A 1HURA 3AOEA 1EQUA 3A6LA 4HFNA 4B4UA 3QSYA 3TW6A 2SBTA 4F6RB 4NICA 4O8ZA 5ITSA 2JCXA 2O2HA 2V58A 3GMDA 2E0IA 2RFLA 3AEUB 3LQKA 4FI3C 5FUVA 4RJKA 3VC3A 2IOQA 4L8FA 4R0MA 4YV2A 1IZ9A 1TTTA 3PGMA 2Y71A 3AKDA 1C30B 3IT1A 1A95A 3N28A 2JPDA 4H27A 2Z57A 4WOBA 3UIEA 5CCXA 2AEEA 4GX0A 3RIHA 1AQJA 1FMCA 1J8FA 3L9WA 2IW1A 4Y30A 2J7KA 4Q3AA 2OAP1 3VR4A 2GM9A 1UMDB 1PJ4A 3COPA 1II8B 1NUTA 3OZ7A 2ZRKA 3ETCA 1U8CB 4MWTA 3G1UA 5E9AA 3BQNB 5BN4A 4G2TA 4IEEA 1PFQA 2IELA 2ECFA 2AUMA 3LY9A 4GOND 1MJ5A 1ZFNA 2Q28A 3IO3A 1M0TA 4GO1A 1TUEA 3WL6A 4YUAA 3DMDA 1WDMA 3DLPX 3HBJA 1QZUA 5TQJA 4AP5A 4HNHA 2ZDQA 3AF6A 1SUIA 2F62A 1HQCA 2P1ZA 5A4DA 1PR0A 1WCIB 1ZINA 1S9HA 2BY4A 2FPGA 3MCWA 5FR2A 4DLWA 5ISMA 4FD2A 2HBZA 2NNLD 2VAWA 1YMQA 2OLKA 1T24A 3IBCA 5C3UA 3VAYA 3KR9A 4XVHA 1NBMA 4CFSA 2ZZKA 4XIIA 3FN4A 1FYFA 2XMCA 4LXYA 4MNTA 1R10A 4IG4A 2GH1A 4AO6A 3C1AA 1YRYE 2CXUA 2PYZA 2FETA 5AICA 1AUPA 4JLBA 4N82A 4J94A 1ZK2A 3DEYX 1W49A 3FUTA 2HDOA 3JTMA 4I08A 4FNMA 2Q3LA 3EASA 2YC4C 3QRWA 5EESA 4EABA 5IF9A 4JBHA 5DIZA 1BYIA 1PL6A 1FU4A 1TZCA 4UJ5A 4D57A 5HX7A 2I91A 2QL6A 3M82A 4PYJA 2FR0A 2CKMA 2JJYA 2XTJA 3MJCA 1WE2A 4KVZA 4HAYA 3RWMB 4M7RA 1BOOA 3ZH9B 3BSFA 4Q9IA 5A5DA 1JILA 3LCJA 3QK7A 4HGYA 3WLAA 3CVJA 3IP8A 5AI5A 5D3MB 4A27A 4D8TA 4JT9A 3PWZA 1GA4A 1FA9A 1X1QA 3JQCA 4HN2A 3DR5A 1GDHA 1FTWA 1QFYA 3C85A 4GS5A 4JJGA 1DI0A 3O38A 3R20A 3VDNB 1M66A 4BGDA 4HJXA 4RTLA 3N70A 5JMPA 5AVVA 4DQKA 4CQMB 1J1UA 4J2OA 2NN3C 2D2XA 1GITA 3BE8A 1J0BA 3A36A 1NVWQ 1ZIOA 4WH0A 1QNLA 3BWXA 5I5GA 3AFNA 4JL8A 4J29A 3LWNA 3IEPA 4F4HA 1Y4ZA 4CBVA 4RQUA 5T4HA 1T6ZA 1ENPA 3AVOA 5LBIA 3TG2A 4BFWA 4FOOA 4X84A 5BWCA 1E9AA 5AI4A 3NM5A 3EDCA 4CLDA 4CQNA 4ETIA 3GUZA 5JASA 1OROA 3IOEA 2EVWX 2OEPA 3P9YA 3W2FA 3H3JA 2QVCA 1BW9B 2EF1A 3AONB 1ZICA 3I2FA 3LUAA 3THOA 1O08A 1KI1A 3NGLA 3FFBA 1N7GA 1CWUA 2FEOA 3KT3A 4P0QB 3TZKA 2FMFA 3ICCA 1Q2UA 4KWIA 1RAAA 4RKRA 2OV4A 1CUZA 1DRUA 1QV6A 1BMFA 1L7NA 2QTBA 1K7XB 2XUJA 3GLHE 3WNZA 2VZ8A 1IRXA 2BDEA 1HLFA 2D1SA 4UOQA 1SAYA 1Y9JA 1AXEA 2RONA 2DP4E 3D4LA 3LHFA 1LCIA 1OVGA 2AHOA 1YA4A 5JSUA 1H6AA 2AZTA 3F9RA 3HP7A 4F9EA 1Q0HA 1FLNA 1VLZA 2O07A 3A1WA 3IQFA 3TLAA 3OLQA 1AZTA 1JECA 3MTIA 4KUEA 4XQ0A 3IX7A 4NAUA 1YZVA 4EY6A 3IEMA 3K92A 3RV3A 4INZA 4BLPA 3OU7A 4DLZA 1AUQA 1G6KA 4R2MA 2P9HA 1BDBA 3UG7A 4QXPA 5JANA 5J1TB 5EJ5A 1B26A 5I9LA 1K92A 1R3DA 2HLHA 1UPFA 1VGRA 1BWQA 5KB3A 1QH8A 4ZZ2A 4EGQA 5KYNA 5DM70 4BASA 3U1BA 3PXGA 4CN8A 3UW1A 4GGOA 4CUJA 2JIDA 2VA9A 4LY0A 3FFAA 4L74A 4WDQA 4CTNA 2I2AA 5KWJA 5DNDA 4NLLA 3GRPA 2P4HX 2WSMA 1AUOA 4WXHA 3W8EA 5CDUA 4OHKA 3JQAD 2XCQA 3E0XA 2ZRJA 3G5MA 3KOZA 2YKGA 4B6SA 1D6NA 2A1IA 2Q5OA 4YQYA 3WGQA 1YZTA 5IJ9B 4P7BA 1ZNQO 3PXCX 4A91A 4QX6A 2B1GA 2IIPA 4K28A 1MQ8B 4EUSA 4UKDA 3M4ZA 1TM4E 2JIPA 5CDYA 4H4DA 2GLTA 4B2IA 2D54A 3OLCX 1TM3E 1W94A 1THGA 3D6NB 2WZQA 4RGBA 2XIQA 2P4QA 3C6YA 1BCRA 1AKVA 2KX7A 2ZVDA 5FQNA 4HNTA 3AEQA 4MWSA 4MDHA 4BE7B 5KU7A 5A9TA 5KIAA 4AUMA 3U1VA 1DQPA 1F2DA 4CT5A 2C9MA 4M8NE 2HLPA 5EYPB 5DMXA 3IOCA 5EP3A 3H99A 5JO0A 1UAAA 3DFIA 3X1WA 4XW2A 4JOSA 1W35A 1WMFA 2Y3IA 4AULA 2PT7A 4BUCA 4V39A 4QC2A 1L8LA 4V0NA 3MTBA 4C6TA 5C81A 4G0WA 1HL3A 3QPCA 3HFJA 3NC4A 2HPZA 4NF2A 1Q0SA 2M9MA 3KV1A 4L3WA 3HXMA 5JU6A 2A3RA 1ODSA 2PHZA 1A8UA 3G2NA 3ZWPA 5KSWB 1SEVA 4HB3A 5H81A 3UK6A 3QWHA 3FSJX 1WCWA 2ZT8A 2I3DA 3DD1A 3PWTA 2P2SA 4KMMA 1AA9A 4NKRA 4DUPA 1UXHA 3N2IA 4QM6A 1Q11A 4JVMA 2OFFA 4RXTA 5BSWA 5C35A 1QV9A 1B8PA 1S89A 4KQFA 1IQPA 4WKOA 2GNOA 2IEYA 5JVDF 4M7PA 1T1SA 2XMPA 2MT9A 2PYIA 3NYWA 4IHJB 2HWXA 3HJTA 4DDUA 2O5RA 2IS4A 3CYFA 5GMOA 4LPSA 3MOGA 5EINA 2RK6A 1Z56C 1GTJ1 4MW1A 4PCVA 5EUMA 1OBHA 4D8YA 3PJEA 4E7PA 1NLYA 3GG9A 5AI0A 4RSHA 4ME6A 5HR5A 4G26A 1QF7A 4WFIA 2XCOA 1K5GA 3L92A 3NRBA 5CUQA 1QOZA 2H4XA 4G4SO 3OPQA 5ESRA 3ZQ4A 3ZXXA 1Z3IX 2AZXA 5FL7D 2P4SA 1PS9A 3KHSA 2RJNA 3SPXA 2R7KA 2BFDA 3GLUA 2J3EA 3G23A 3HFRA 4OLAA 5EVCA 2QYSA 5JJBA 2JS7A 2H29A 3F4BA 1EG2A 3QKRA 4Q39A 1DC8A 1S3SA 2O5VA 2WTUA 2VTEA 1UEJA 3KZCA 3VX4A 4S2UA 1Y1PA 2RHCA 3OX4A 2AGVA 4XCVA 4A2WA 1TUGA 2FF7A 2W6CX 3T1TA 4BQNA 1WW3A 4HB2A 5B4TA 4P2BA 1OFIA 1A5TA 4L9AA 4J0DA 4PRLA 1ZQ9A 4Y6GB 4B4VA 5KMGA 4D82A 3FPEA 5F1PA 1X86B 1YB7A 1L4GA 3GJSA 3L41A 4QECA 3O91A 4KITB 3EX7C 2IE0A 2QUJA 1MRSA 3PK0A 4TWRA 5AI8A 4C2AA 4F9TA 1DBVO 1PWYE 3JQEA 1ZXXA 1QCCA 1I10A 1BU8A 3FG9A 1CUXA 3KFLA 4GYYA 4WQMA 2PA0A 5DOZA 2Y05A 4N6OA 1LFDB 4YJ2B 1IHXA 2ZUEA 4NEHB 1A7JA 3AF3A 1YC5A 4I4IA 1RPJA 4HYEA 1Q44A 1JJVA 4DQ0A 1LPNA 2C5AA 2QMHA 4BRZA 5I9BA 4N4AA 5K0TA 3VKHA 2GCOA 3I2IA 5CFOA 1CR6A 1GN9A 2A5JA 3M34A 4IOJA 4R3NA 3GGPA 1G3RA 1FVHA 1RS0A 2NYAA 1VG0B 1M6EX 3FETA 4Z9YA 3SZMA 2FLVA 7MDHA 4OHRA 3UV3A 3EGDA 2NV6A 5L45A 1HK7A 3ILSA 3EISA 3K96A 4JYMA 1YOVA 4PCLA 5FUXA 3TW8A 4M98A 4ARCA 4PPGA 5CCEA 3I1YA 2IHTA 3G5UA 5ENVA 4RIHA 4Q9AA 3R9IA 2G1UA 1AU9A 3RUCA 4PZUA 3SZLA 5KSOA 2AOVA 3PZRA 2WSSA 4QDUA 4E2FA 2R9VA 2GN2A 5IX8A 4AP9A 3HGMA 4Q3EA 1N6OA 4XYEA 2WDPA 4FBGA 3EGWA 3DR3A 1XZJA 1C1DB 4L16A 3VSAA 5D7NA 4FS8A 5EE1A 3PUKA 1SBZA 5HQ3A 3IEVA 3RJMA 3B2QA 4M1YA 5JJIA 3ABQB 1OASA 1R8YA 1QPBA 1KORA 3AG5A 5CK4A 3SR3A 3TWOA 1C0IA 4O4JF 4D56A 2UUBB 1AZWA 1A4XA 5BN5B 4D2IA 3WI7A 3EIUA 3AJEA 2P9ZA 1FNBA 3AI7A 1P1FA 3BORA 1FP4B 3GP3A 2A0XA 3OOEA 4NBUA 4LRSB 2UYOA 4LXXA 2PMDA 2PLRA 3UWDA 1F1BA 5AW1A 1ZRMA 4D6PA 1FOEB 4ALIA 5KWVA 1QAOA 2QL5A 5HDBB 3FSRA 4NDZA 4B85A 2B83A 4DM3A 1Z4MA 5B30A 1EINA 4JIGA 2Z08A 3PKZA 5B7GA 5IKEA 1TVMA 3TLZA 2I87A 2P5TB 5TPWA 5HOQA 2V7XA 5FXMA 4AZSA 4B7ZA 1ZK1A 3U7FB 5CNMA 4ETNA 1JIXA 2G08A 3N39C 4YFVA 3UAXA 1PHRA 2XEDA 1D1PA 1U7HA 4JS0A 2B8WA 1Z6GA 1A5SB 1XAJA 2I1VB 2ZSBA 2Q50A 4IINA 1RBMA 4UBMA 2A1TR 2Q1TA 3KOYA 4AYTA 4KR7A 4F60A 3D7NA 1W48A 2BEKA 2V3WA 1N32B 2JFFA 3R74A 3NWEA 2ZG6A 2VYVD 1LVHA 3M9XA 1G66A 3W9SA 1PNRA 2YZ7A 1IBCA 2C59A 3QTBA 3WLSA 1DJMA 1EP3B 3ACBA 4DLAA 4BNTA 1P1HA 2I71A 1T2NA 4IDEA 4ND6A 3O90A 4JQZA 4S1TA 4XLZA 4KXLA 3G17A 4C0KA 2IUFA 3OD1A 2RGRA 3AMVA 4EZEA 3A6EA 5FTNA 4YAIA 5AM0A 3OCWA 4F8JA 2P69A 4R2IA 1X2BA 2WTEA 3SLGA 1QM5A 1LDMA 2NOAA 3V5NA 3SVLA 5JBQA 3FGNA 4LY6A 4ZQHA 3ZHXA 1ZCFA 4O6VA 2ONJA 1ZJZA 3C3DA 3N07A 3V34A 3COYA 4B7XA 3IVXA 4NMLA 5EP2A 3VYWA 3D4OA 4PNPA 3D43A 4AUKA 1SHUX 5CLJA 1CJKC 2V5UA 3GRRA 4F6LA 3FPFA 1IG3A 3PXBA 1DIHA 2H52A 4OBEA 3V00A 5EGSA 2JVJA 1FL9A 2YWCA 1NKSA 3JD4A 1YHYA 1E2FA 4GMDA 1DPFA 3SQMA 2RKWA 1R5BA 4XWWA 3AUXA 1KOJA 1QO7A 1RSZA 3NV7A 4PG8A 1NBIA 2P9BA 1FFEA 3TQHA 4WN9A 3C6ZA 4LDAA 2QD1A 2VC2B 2VNSA 4N1AA 3CTMA 1JFRA 2IXTA 3ELYA 4M3NA 1BDIA 1XROA 2VKTA 3T0IA 3QG1A 3OLXA 2EKZA 4BFZA 5J47A 5LWQA 1NBEA 4DYDA 1Z0SA 4TXHA 2QR5A 4D8UA 4EI8A 4Z0TA 3SX0A 2HJ9A 1YL5A 4QOJA 4L7QA 4R16A 3FWNA 1LD3A 2ODQA 3RAGA 5ICMA 3TSZA 1AKEA 4ND5A 2W4IA 4ZZ0A 1M0EA 3HU1A 4IXWA 1VLHA 5DYTA 5EAIA 4QGSA 1NQVA 4INOA 4Z4IA 4K9LA 1A88A 3EA5A 1U6KA 1ZUNA 2NYVA 5A4AA 1ZJ6A 1O6BA 1EFAA 2MR5A 4PYOA 5CBPA 4D92A 3F6RA 4II2A 2GXQA 1KDRA 2WVGA 4CDRA 2GK6A 3KZOA 4M1SA 4MQ6A 4EY7A 4A0GA 4YUZA 1UDBA 4LQCA 4GX5A 5LJLA 1FQWA 2IYZA 1GZ7A 5CT6A 3HL0A 4C0LA 4EQ6B 3IHKA 2PSFA 1QO0D 2EP7A 2J6CA 1U7XA 4EB0A 5UKDA 1BTOA 4PYLA 1B2LA 5KAMA 3VOBA 1MT3A 2QOEA 1BIFA 5K3FB 4L9WA 2OQIA 4YXFA 2C82A 3RGWS 2OOSA 1E6CA 2XA9A 3FNBA 5FOXA 2FZ4A 2NO5A 4TV9A 3W90A 3HDGA 1S7GA 3ZU6A 2A86A 3X1YA 4ZT7A 5F1YA 4A8HA 1ZHFA 4Y7DA 3IEIA 3N53A 3ZE1B 1RVDA 4IFTA 1TYBE 1FP2A 4DIKA 4M99A 3MJTA 1DFGA 3S4YA 1RLUA 1T10A 4J0QA 3DO5A 4KQHA 4PNHA 2X4DA 3FLMA 2WF8A 4AICA 4LV8B 5DTIA 1CNEA 2VP6A 4DQDA 4YMUA 4C4AA 5DDIP 4IEIA 3C4QA 1UM9A 1YMVA 2B7LA 3FR8A 5HK9A 4O59O 5DASA 2ZRMA 4KP7A 1L4NA 4FM9A 4LRYA 3OT1A 2ZSKA 1VL5A 3CW2A 3AR3A 4YIHA 3PNSA 4FHGA 2D0OB 2R85A 2OG2A 2JFUA 1H5UA 5EZQA 2B94A 3VPAA 5KOHB 5CW2A 2XCSB 4AN4A 2Z0MA 1WB9A 3O9ZA 2IUYA 4QXAA 3F96A 3TE6A 2PMEA 5CM8B 3E70C 1AS3A 5CXQA 2OBFA 3ME5A 3ZHCA 5JDIC 2J67A 4GXQA 4J07A 3HJRA 4GI1A 1Y63A 3G0BA 1BXKA 3BICA 3LC0A 3N9IA 3UT0A 1PQWA 3EC2A 2XF8A 1LSSA 2OV6A 4ZI2A 1MC5A 4RA6A 2VRCA 2PMWB 3HI6A 4QARA 3IRVA 1KBQA 3CE6A 3GQBB 2WTNA 1IN8A 2VDRB 3NPAA 2DPYA 1HEUA 1Z0DA 4IZHA 4P4GA 5KSZA 3EBPA 2PUGA 1UBKS 3PC3A 2HA0A 1Q83A 5IMBA 3HBNA 4N76A 4NOLA 4AJHA 4HPJB 1UKEA 3NWPA 1KAHA 1EQAA 2SKEA 3LC2O 4YMWA 1C8VB 1LQ2A 3UT5A 1WBDA 1LNSA 3BCHA 4DL9A 1XHEA 4BLOA 2BFWA 2BEUB 2I6SA 2BHTA 4ROSA 3WYNA 2VTBA 4RGVA 1MOPA 3TLKA 3X1ZA 3SQLA 2J0QA 1WF3A 4NPAA 4LC9A 5ELLA 4OXRA 5ALXA 1FE8A 2YV4A 4DZZA 1EK5A 1NLMA 1NRXA 1WD5A 2GN0A 2QBYB 2EJUA 1ZIYA 4P08A 4DXAA 4LN1A 4F5ZA 3H1TA 2HA4A 4QPPA 3AZOA 2FFRA 2NSDA 5B58C 1ULTA 1EVZA 1FFSA 4BO0A 1I2ZA 1N8NA 3F3YA 3IUQA 4FR2A 4BLTA 2C29D 1N6HA 1J06A 3JQ9A 1W4LA 3V32A 5BUSA 2DJIA 3PDJA 2ZJBA 3RREA 2V8BA 1NW9B 2I33A 4WBNB 1WW2A 1YH3A 2RDMA 3NGMA 3Q1LA 2C7OA 2BFEB 3T7AA 4X91A 3KDSE 3DEAA 2VSFA 4R7ZA 4F04A 2XSZD 3T9DA 4DMCA 1S9DA 2GD2A 3P20A 3QH4A 4GSKA 3J81k 4UNSA 2WWXA 5B1EA 3JQ8A 4WCFA 1Q7BA 1IOZA 1U81A 4HBZA 5G0TA 3V1MA 1ZJ4A 1I2AA 1VBKA 1E1RD 1ZUD1 2WAXA 3KBOA 4RD6A 3HPQA 1UZNA 2VSYA 4PG7A 3HYSA 3MJ4A 4R9UC 4FILA 1YUNA 3R7DA 4CM4B 3VUEA 1G6OA 3ORYA 1S1CA 1V6CA 2HUPA 1T36B 2IFTA 2XTNA 4OGWA 5HUJA 5CA1A 3QU2A 1QMGA 3OZVA 1BCSA 2NSJA 2G9ZA 2R8EA 3Q98A 4ER3A 4EW2A 5GJBA 2WTXA 1JG4A 5AR1A 1ZGJA 1I3KA 4R2WA 4NAHA 5JD3A 2FUKA 3VDQA 3NPMA 5FPHA 4I3GA 4AY4A 2R6R1 4X24A 3KNZA 4IFEA 2NVUB 1CEYA 5BYAA 2B7BA 1AV7A 1NC1A 4GYKA 3H2BA 2O5CA 2WPDA 2Y9MB 2XY4A 4D9IA 3L1KA 4JB8A 1GRVA 4XVUA 1ENOA 3VNRA 5FL3A 2FVYA 1TCAA 4WLUA 1SVWA 2YIDA 3I9OA 4OXXA 1BS9A 1TU0A 1OBCA 2ZB2A 2K6GA 1QSGA 3K5HA 1M2JA 1NJ6A 3ASVA 5A05A 4RNDB 1E5XA 1XVVA 1ZESA 1E5TA 1Z8DA 1RWWA 1YZNA 2Z9CA 3B1YA 3IR6A 4N0EA 2AOUA 1DUSA 4M9ZA 5ALKA 4BMSA 1WKBA 4CN9A 1QPZA 3D6JA 1NE7A 1TJ3A 2Y68A 1EE1A 1WM1A 1U28A 4NY1A 1JFFA 1ZN2A 1VTKA 1OA0A 3V1UA 3V8QA 4GMHA 1B73A 1E1KA 1TUIA 2QRVB 2CMGA 1X74A 4H16A 4LDPA 4MUGA 2NACA 3VPGA 4AX4A 2CLSA 2E18A 1XPJA 3MMPA 4FE7A 4I2NA 4B40A 3K6RA 3QYFA 3CEJA 4HFRA 1B6RA 2F3QA 3EEIA 4E32A 5K8CA 1PE0A 3WYEA 3WDLA 2OKGA 2XGSA 3CX8A 1YF3A 3QY9A 3N2GA 1GL7A 5D5HA 5KSPA 4KNWA 1UUFA 2QIOA 3UB3A 2O05A 2O8NA 2G1PA 1W4ZA 2BFCA 1KYZA 2WY2D 3DAYA 3QLJA 3NQ41 4G0OA 3F4KA 5FWAA 4YVFA 2O06A 4Y2HA 1QLJA 4ZO8A 1C3LA 1AKTA 1X0XA 3DL4A 3LK7A 4IWXA 1ECLA 2OXTA 2WMNB 5IYZA 1M1ZA 3BRQA 4Z3KA 3VI3B 3K2BA 3UJ9A 5DTEA 3OEED 1KJWA 4MCHA 2Y0EA 4HNVA 5EUQB 4M1WA 3EWSA 5JZMA 1H85A 1R37A 3I1JA 2PLNA 3EBLA 2C94A 4FZVA 1PL8A 2X5KO 3EA4A 3P32A 4O5AA 5ENZA 5LYJA 1A5BB 3PICA 1OX4A 5JXWA 1VE9A 2PY6A 1KO8A 1S3GA 2HB6A 2CJWA 4KNVA 4PNEA 1X7ZA 1J0AA 4HGNA 2B21A 3E7FA 3LWBA 4P53A 4K6CA 1FU8A 4G1UC 4DLTA 1DJOA 3NG1A 4G0YA 3HXTA 4NCJA 3JR3A 2CLFB 2YS6A 3KTDA 2XDQB 3P4YA 4DXDA 2UV8A 2J30A 2F1JA 5H5JA 3OFKA 3DC2A 4UATA 1YE3A 4MZDA 4BO5A 3DMRA 1TGVA 5KTRA 2ZRIA 3EW9A 2DFKB 5AH0A 4LBVA 3THWB 1X1BA 1RHRA 1X1EA 1C9MA 1EXNA 2EJTA 4XPZA 3VYVA 1TL7C 1KVTA 2J9RA 3F9CA 3MELA 2ZAOA 4I99A 4Q7MB 2H4HA 2X0NA 1YB4A 2YWGA 1E64A 1I2BA 3ESAA 4QDKA 4CV0A 4DA4A 4NHOA 3IR5A 4M54A 1L8XA 2D6FA 2BDUA 4BC1A 1QH0A 2ALJA 2V97A 3GJZA 4QTXA 4I46A 1ADFA 4URZR 1JSLA 2DFLA 3CLSD 3OIUA 3S1AB 4W7IA 4CR7A 4ZVUA 5EHGA 1ZVMA 2V7QA 3KXKA 1EUZA 2QLTA 5BOVA 1TM2A 3FYTA 5KI6A 5TC4A 3SCZA 1UK8A 3TPZA 4CL3A 1HZZC 3FTEA 2IHKA 2ZSUA 2ILVA 2ZIAA 2ZRGA 3EMDA 2AVDA 4KDCA 4RBNA 2QQFA 5EZSA 5J5VA 3D6MA 5THXA 3TB4A 1DAIA 1GZ6A 1FDVA 2GSWA 3DO6A 2CDRA 5AVOA 5IVPA 2EQ5A 2VOEA 2YBEA 2ZWMA 5G4KB 3PXXA 1Z2AA 2QJFA 3E3AA 3CF4A 1URPA 4MS1A 2EERA 1SBNE 3ELBA 3MWDB 2A35A 1KYXA 1U2ZA 1Y4AE 1A98A 2E82A 3FBGA 5K09A 2X8BA 3PCTA 4PGGA 3WGGA 3CVWA 1QQ7A 3MN1A 1DX9A 4B3IA 4EBFA 4OJYA 5TLSA 1J0XO 2BLNA 5LQRA 5CCBA 4JB0A 4E2WA 2EKPA 2AC7A 4BFYA 2VJLA 4DEYA 3EZ6A 1ZKDA 1R15A 1NXXA 5FTWA 1NVVQ 4FNAA 1NXQA 4HL6A 1U63A 3S55A 3MHTA 2KMLA 4W9NA 1KDOA 2CSUA 2FZWA 4NAVA 3OZGA 2IQIA 2ZETA 4MDYA 5CVEA 3EHEA 1FDSA 1RAGA 3OJOA 4JT4A 4QM7A 1RC1A 1K8ZB 3T1HB 1M2HA 4TYMA 4KCGA 3KLNA 3NDBB 3PV0A 3U19A 4YALA 4HDOB 4GE3A 2QT9A 5JI3E 3JYPA 1AKQA 1MXFA 1N6PA 1F2TA 2GAIA 3B53X 3GLQA 4NMWA 3GH1A 3R24A 2WWIA 4OSPA 4P32A 4UVIA 5FBHA 1OIWA 3G2QA 4KACA 4U00A 3NV9A 6Q21A 2OLJA 2QUAA 3LQ4A 4FOLA 2EP5A 4QXRA 4MHOA 1WB5A 1LLQA 2IV2X 4KO4S 1THTA 4Q82A 3X1KA 1L4KA 2Q6VA 3UXEA 1R4MB 4JLKA 3ZDYB 3C6KA 2C4WA 1F2UB 1GCGA 3AFOA 3WZLA 4BE9A 3DAOA 1PNQA 2OHXA 3WK5A 2OD9A 1DP4A 3VHXA 3OQOA 2I78A 4TUYF 1FUIA 1HETA 4XKJA 2UZ1B 2NVWA 2ASEA 1JKFA 1K63A 4TT3D 5K2MA 1F5NA 2A0FA 3O1JC 4HKTA 4UE2A 4X60A 3C39A 1WQ3A 4C4RA 1ZVVA 4AFNA 1S01A 3AEYA 4ITRC 1L5KA 5EI5A 2QKYA 4BBZA 5FOQA 2X15A 2R6GA 4GVPA 1L5YA 5L6LB 2I1WA 4RY9A 3EFHA 2WJPA 1H23A 1V47A 2JD1A 3DNPA 1CUEA 4JP3A 3R7BA 4XIGS 1X39A 8ADHA 5F9FA 4A2PA 3HCCA 1OWLA 2FPKA 2NUPB 1YVDA 4TV8A 1KPHA 2Q49A 1G8AA 3U3XA 4EFMA 1JFVA 2G0TA 3BWCA 3IXLA 4H15A 3DNFA 4E3ZA 4GOJA 1VECA 2GN4A 3IMKA 2QB5A 2FHPA 4Q4LA 1MEEA 4U2GA 2VEDA 3C3AA 4XQEA 3B6EA 3K8YA 5H1YA 2QD4A 3W2GA 2GB4A 3QVOA 1NJGA 2H1CA 1KDPA 4H31A 3GW8A 3MZ0A 2J32A 4JLSA 3DFKA 4QJ4A 3MYRA 3FOAA 1SO8A 4IDDA 4CM5A 4HHEA 1SXJD 3BRWD 5JMOA 3KVOA 4M6WA 3VR5A 1A9XB 2VDLB 3ELWA 4JI4B 1NSFA 5BW4A 4I7EA 1VYVA 1N2ZA 2GZ3A 2C2YA 3N2YA 5HGJA 2O59A 4Y2JA 4Q3NA 2JLYA 4IDNA 1Z5GA 4HX5A 2W48A 4XAQA 3L0BA 3M1AA 3PR3A 3IUPA 1C9DB 2V6GA 4IXNA 4JLJA 3R7AA 4YPVA 4B3TB 1U9ZA 3MWGA 1PSZA 1H66A 2NTYC 2RG7A 4Q4AB 1JQLB 4V3CA 1CR0A 5EFZA 3NHFA 1AHNA 9ABPA 3RVOA 1CQJA 4Q03A 5GAJA 4NXNB 4ZOQI 5HCNA 2TYSB 4BAGA 3FJOA 1YFLA 4YC7A 3LLCA 2GYWA 3BHJA 4ABYA 4A03A 3E9RA 4RV5A 3KU1A 4H77A 4F97A 2QG4A 1WSBA 2PS0A 1C7RA 2VUTA 1DL5A 1SB8A 4UVEA 3K3PA 1R5NA 1DFIA 2N9UA 5AM3A 3AVTA 2ZJ7A 2V7TA 3UB2A 1KAEA 1KR2A 2JKVA 5AKXA 5ICGA 1DMRA 1M1YA 1QHHA 1T1RA 1P4GA 3KIPA 3U80A 5GINE 4TV9F 1S2DA 1U8ZA 2VNHA 2JJ1D 4J7XA 4KOAA 3QWAA 4RYLA 4BTEA 4RULA 4KOEC 3ZJUA 5AKKA 2YCBA 2J6IA 5AUOB 1I7SB 4IDGA 3ESYA 4RZ2A 4JSYA 1EX1A 3CONA 2F43A 1II9A 2IEBA 3F6SA 3IUYA 5G02A 4DIDA 1BX3A 1E99A 1ODJA 1ZCAA 3GZTB 4XVRA 5FFFA 1JEEA 1FMLA 1ORVA 1YB2A 2GYYA 1M5UA 1N6NA 2OO5A 2V74B 2WINI 5CMLA 3UWKA 3WNDA 5TGTA 1XMVA 3DVAB 2DFPA 1RC8A 1DAFA 5EIAA 1Y8AA 4WUTA 4I5DA 2FW0A 2JCVA 2QVZX 4XLLA 1E3JA 1G63A 1J70A 4ZT2A 3GRFA 2I22A 3NIGB 4EKYA 4ZJZA 1H2RS 3JVIA 4PIMA 4DUGA 3AVQA 4YT4A 5IC4A 4IKPA 2CUTA 1A1VA 5B3LA 2JLWA 4MULA 4Z0HO 4Z4QA 3N6VA 1RLTA 2Q2WA 1CY7A 2JB9A 2YHIA 3DE6X 1CXZA 2X40A 3QUTA 4ESHA 2ETVA 2WQ6A 3N74A 4WAUA 2I3GA 3OQJA 4KGDA 3O73A 2GF0A 1SKUA 5I9NA 4A8JB 4CIVA 3HLKA 3WP1B 1Q22A 1NXTA 4JVNA 4M7OA 2DF8A 2Q4OA 1R74A 2OCBA 1JG6A 1BFKA 2RGYA 2J6HA 1I4DD 1JALA 2GN1A 1RQGA 4OFZA 4RHEA 1QRRA 4BO4A 1CU1A 1W46A 5GGYA 3RYHB 3NEPX 3HZRA 3JXEA 4Q66C 4OAQA 1T2VA 1M6VB 2NSLA 4TZTA 3AI1A 3ZJ5A 2HMVA 2VPZA 3I5UA 3M6LA 3ZZ0A 5FUWA 5CURA 4B44A 4BFTA 1QP0A 3ZI7A 4AAYA 4ENQA 1FXSA 3DZGA 2ZYDA 5A3QA 4PR0A 2NXNA 1YQDA 4Y2PA 4UAVA 1TJPB 5DX0A 4JOQA 4MKRA 4PZAA 4J2HA 4IHAA 3PTAA 1MG5A 2ZZNA 1RTTA 5FR1A 3FHCB 1XSEA 2H9AA 3PP8A 2CJXA 3QUAA 3G85A 1XNQB 2IS6A 3EEYA 3BDIA 2ZXFA 3LKDA 4FFBA 4P3XA 4RVHA 5ETJA 1KI6B 1EWRA 2VA8A 4DG5A 2BGJA 1Z2OX 3H7AA 4G41A 1QRUA 5B3AA 4KRGA 4NJEA 3EZLA 3SIPA 1PTJA 5L40A 1DC4A 1Q3KA 1QHXA 4TOIA 5ALSA 3CVVA 3RTEA 4DVGA 1K2VN 3DZBA 4G84A 4YBZA 4JLAA 2C03A 1VQ1A 2EATA 3ABSB 1IY0A 4TTPA 2IEAA 3QSGA 2Y4NA 1QUFA 4X94A 4XD7D 1VG9B 2M32A 2NQTA 3AILA 4LJ5A 3SYKA 1JQ3A 2J85A 5HQTA 3G8YA 4ID3A 1EWKA 4GNRA 1XXHE 3LIPA 4PVCA 1OH7A 1GD1O 4ND3A 2XWSA 4QEZA 3ZK8A 3B5EA 5H0IA 3QEOA 4CG3A 2YMQA 5G41A 4EHNA 4V1CB 1NC3A 1V1JA 3CGWA 3MD0A 6AT1A 5JJKA 4I1PA 1W29A 4D45A 5H02A 5KKNB 4M1EA 4NCAA 3I23A 5JJCA 3VU1A 3S7TA 1S2NA 4YCBA 2V4MA 1V5FA 3LZ6A 3AK4A 3H2KA 3U4CA 4E4RA 3FCEA 1SD5A 2P0YA 3BQMB 1DKRA 1E6WA 4JDPA 4O25A 4CCYB 1U4OA 1PJZA 1DAGA 3KTAB 2QZ9A 3O31A 3N8GA 2VN8A 4LWQA 4O0MA 1ODCA 3TD6A 3WXMA 4OKNA 3V3KA 4EB6B 3OETA 1TFUA 3IA7A 4UHJA 5KCMA 1RWOA 3TQCA 4IOMA 5A4KA 3EPJA 1GPJA 3H65A 2O0MA 1GU0A 3P2IA 1VLMA 2CXTA 2RHRA 4NCBA 3LDGA 3D3QA 2OXEA 3N58A 5K3SA 4QG7A 4C0WA 4ZCPA 4C0SA 1U0NA 3O8BA 5MFZA 3IBYA 2ZJ8A 3S5UA 1I7QB 2BTEA 4KWHA 1JEJA 2EL7A 2YWHA 1U04A 4UTXA 1QC5B 2IYUA 3TRIA 4H2DA 2ZRFA 5KNDD 5AMXA 4L28A 3OMLA 1NP7A 1WLYA 3HCRA 1WETA 2O7QA 3EXHB 3UWMA 1RWVA 2X41A 3AXTA 4YT2A 5CDGA 3QE4A 3EUWA 1SUEA 1VRWA 4I55A 3UY4A 5KYGA 1YDHA 3H1AA 3UGJA 1ATIA 3TKLA 3G8DA 2H11A 2IU3A 1DKQA 3IP1A 3AJDA 1LTKA 4PQRA 1P9NA 3W9BA 1LVUA 1MB2A 1XJCA 2XJ9A 3CLRC 4A2QA 2B8TA 2QRMA 3R3WA 2IEGA 4AJKA 3GFPA 4LG1A 3CVOA 2LBPA 2JBAB 4R69A 3H75A 4B09A 1F2VA 1G8HA 1RKVA 4WZZA 4TVOA 4E2XA 4C08A 5I3CA 4LZZA 2G5PA 2W2VA 2YQ4A 3DMPA 1MENA 3LOUA 4FDLA 2CB9A 4LYAA 5G1PA 3W5SA 5EIHA 3ND8A 4HNAA 1YIOA 1KZ6A 4B3BA 2V7GA 3NLLA 3EDYA 1NUSA 1HYGA 5MGNA 3E27A 1NUPA 1R18A 2DE0X 2PSSA 2WJZB 4FOTA 1E2QA 1GO2A 4ZGBA 3Q7SA 1UINA 4YYEA 1A9RA 1Q0RA 4FCVA 1ZM7A 4XA8A 2JIMA 3L8CA 5DIFA 2NZ8A 2HGZA 1VYHA 4EY3A 4A6XA 3QLVC 4BP3A 1WTCA 1AQLA 2JRCA 4NS1A 5TMBA 5FBWB 4IQGA 3V80A 3JTEA 2PG3A 5ER9A 5J40A 3U5ZB 4PGHA 2ZUVA 4L7VA 3OU2A 2WLTA 4YUYA 2BFAA 2IPNA 2NAFA 3ZWBA 3EODA 1XOIA 2MJLA 3IAEA 3REQB 2DWCA 4A0FA 1GLNA 1LX6A 3R6WA 4BGIA 1A97A 1V8FA 3NBFA 3OKCA 2PXXA 3WLMA 2O1EA 3LQQA 3BQ9A 1ODIA 5AVRA 1G2OA 1GG9A 1JPUA 1JSRA 3TRKA 1U1EA 3NHAA 4ZEMA 1S8AA 2XUZA 3AR2A 2QAGC 1I0IA 4I8XA 2VT2A 3R7LA 4EB3A 4OI0A 3PYLA 5BV2P 4KRFA 5YASA 1TCVA 2FUG6 4ND8A 3O75A 1U2GA 1KSJA 1PGPA 2JAOA 5JSKA 4DR4B 4N0MA 3U17A 4RANA 2NSYA 4P6VF 4GMGA 3AW8A 3WLTA 1TVKA 1VA4A 1Q16A 3HJBA 1C1XA 3NDJA 2ZRLA 3OPYB 1RJ9A 2PU7A 3D6AA 4KQ1A 1N5LA 1JSCA 4P5PA 1G21A 5CPBA 2FMIA 1RPAA 1TTHA 2ZTSA 2CDBA 3KWLA 4UUQA 2HO5A 3KR1A 5K4AA 5A7HA 3TQSA 1RYHA 2PDAA 1SQ6A 3BMQB 4PBTA 3WGUA 1M2KA 5HMLA 4N03A 1A9ZA 3IAM1 3DVSX 4N0PA 4GXRA 4HNQA 5BXYA 2WHRA 1HA3A 4LNUB 3QVKA 4Q4JB 3UUWA 5HXAA 1M2OB 4UEQA 3Q11A 4IGEA 5ALOA 2CW5A 6ABPA 3PJGA 4OK6A 2BJHA 5LQMA 3H9QA 4C89A 5KVQA 3DF9A 3DW3X 4K26A 2BH9A 3D2LA 2P35A 3SEAA 2H2AA 1I33A 4N5IX 2WD9A 3AY0A 2D5CA 4RFVA 5TQ0A 4Y2GA 3P2MA 2WIJA 3FROA 2HX1A 3ON5A 4ZCIA 3I76A 2W42A 1BWRA 4M9RA 5I9SA 4XCQA 4GDMA 1R6AA 4PAWA 4E21A 4MV3A 1HMYA 3QFTA 3B9BA 3H9BA 3D8NA 3ODGA 2FP4B 1CY2A 4BNKA 2H5IA 3KJHA 2ORYA 4DA0A 3ONDA 2C98A 3PQ2A 4JJZA 2JGMA 1PT7A 1H2YA 2RHJA 3I92A 3U26A 1XD9A 2QF7A 4LSMA 3K71B 2Z2XA 3LNTA 3HWWA 4MKIA 5EEGA 3F7TA 3M49A 1D07A 5JNTA 1UMCB 4UUBA 3Q2IA 4XB1A 4GBJA 4FXPA 2QM0A 1E3WB 2A7QA 1YR6A 2ZPAA 3DO8A 1IOLA 3KKMA 5CYGA 3EYWA 3UAVA 1YHZA 4RTMA 4LOLA 4BX2A 3MWYW 1L5FA 3PL1A 3CPEA 3VZRA 2ZULA 4LKOA 1LBQA 1CS0B 1CZOA 1K4YA 2IXDA 1X2EA 4J1SA 4TKVB 1V96A 1NZJA 1ULBA 1YRQA 2OZLB 4OIFA 5JSHA 2NQ2C 4YJ3A 1D0SA 2H2WA 4C20A 4UU8A 1VHJA 3ZWYA 2VQ6A 2FE1A 3E82A 3JATA 4F06A 4YAKA 3ZVKA 4D42A 5IN4A 1DCKA 4J0JA 1JKMA 1JIQA 2CEAA 2PD4A 2RKOA 2AG5A 3S99A 4ACAA 1NUQA 1HDGO 4OQZA 1BDJA 5DTRA 4EG4A 1CNMA 1OX6A 2NTEA 2QN7A 4OSEA 2WUDA 1UP6A 1W0KA 2PZAA 2V1XA 3M1IA 3M6WA 4GPD1 2AT1A 1DO8A 4MQ4A 3O3CA 1QQAA 4H4EA 4J0FA 2CL5A 1OLOA 1RM0A 2EW1A 4R31A 2N1MA 2AEFA 3QFFA 4KLZA 3TI7A 4W7SA 5KNBA 3TFOA 1E3EA 3U4QA 3FZQA 4B6GA 1S0UA 2PGJA 2CNNA 1AKYA 4YP7A 4BQQA 4DB4A 4QFMA 3ZLVA 3LO8A 2Q4TA 4QO7A 3X44A 4KR3A 1Y8QA 1C3OA 3RH0A 4E5DA 3OZWA 2GSDA 2ZEJA 3ZCQA 4BN5A 4D9HA 2PPLA 5BVGA 4BJ5A 3WKCA 3AL0C 3BRSA 4GKBA 1Q50A 4XDHA 1N57A 4CKXA 1WMBA 4CDMA 1TAHA 2DY0A 2JCSA 1SCIA 4TV8F 1HUQA 1WZCA 2HRQA 2JLBA 2Q27A 4RLFA 1UFOA 4EHBA 2O8BA 1Y9EA 2BGRA 2V45A 4KYUA 4R1LA 2YVUA 3GDFA 1QONA 2AN9A 2F3RA 2WU4A 2H8GA 3H9UA 3MRVA 4Q1EA 4RGQA 4TXLA 4YROA 3SYRA 4QG3A 3B6KA 3RUPA 1ESEA 1X7YA 5LMCA 3MF4A 4DIOA 1IPHA 4QJ5A 2FRVA 2C58A 4NULA 3D3EA 3UW3A 4DG8A 4MCAA 4ALMA 4DWVA 1Q0ZA 1BEZA 1ZL2A 3GYBA 4O4LA 3F73A 3W4KA 4WBSA 1Y9DA 3U5TA 1XDBA 1G8JA 4KLRA 4D4KA 3FSGD 4ZVTA 4ZIRA 2GHRA 3ZJTA 4FCCA 1G8FA 2QY6A 3IQWA 5EY5B 1PP4A 1QG4A 2XMSA 3FPCA 4QBKA 4BX0A 2FSFA 4O4IA 1PR1A 4QOFA 2WJHA 3B51X 4EDHA 1IN1A 4YAJA 4O08A 2M2IA 5JD6A 3A05A 4P8RA 2P11A 2YS7A 4JGIA 1ZYUA 3TL3A 4DJ5X 1P3JA 2X0IA 3PC4A 1I2CA 2H4FA 3OOHA 1Q6ZA 5K9ZA 3HJAA 1GGJA 3L6EA 3LV8A 4MEJA 3V1LA 4RORA 3GDOA 5HEKA 2AFIE 2H54A 1X14A 3RT9A 5I4BA 2PUAA 5CJJA 3D31A 3O4IA 4LF7B 1U11A 2GPBA 3QVGA 3EGEA 3KAQA 5H3CA 3WB9A 3EF0A 1UFKA 2JCGA 1SB9A 3WQQA 3KPVA 1LQTA 4TL9A 3PDCA 5BUQA 1P2UA 4I66A 4L72A 3SEFA 3UKDA 4EA7A 4FCWA 3NFYA 1T6BY 4OGLA 3RVPA 5LFAA 5KDOA 3I72A 3ZH2A 1L5WA 2R1TB 3TF5A 1E98A 4ZT5A 3D3WA 3DKRA 4G25A 1XDGA 3RF6A 4QAQA 1RRKA 2ZRCA 1JW9B 4XYLA 1TIKA 4A82A 1W0CA 4NYJR 4D41A 4Q18A 1BROA 1D6JA 4DR2B 4AK9A 3OIWA 3TAUA 4CW7A 4ND1A 2XIJA 3B70A 4MVJG 1R27A 1YHNA 3I53A 4DRYA 3W8RA 2WUEA 1DAEA 3OECA 4QYWA 5DI9A 4GFDA 2H2GA 3E35A 5KTOA 4HX2A 2JANA 3U4MA 4PLTA 1RPNA 4JSTA 2LCFA 1OLUA 3C3EA 5U4QA 3SY8A 1IXKA 2P3QA 2JJ2D 2WYIA 1T3LA 3AP3A 3BHMA 3EXFA 3UHOA 5KQLA 1ISPA 1NBAA 1Z88A 1BX1A 3N3BC 4I9UA 5DGHA 1MQSA 2YNMC 3R5FA 4K81B 4Q37A 2I6XA 3EULA 1P39A 3IPXA 2AH5A 2CMKA 2PS1A 3K9QO 3TOSA 4BNMA 5JR3A 3BTOA 3GARA 3EFEA 1Z68A 4ROTA 3AJAA 2SCUA 4KREA 2BEWB 2C4NA 3GAZA 1SWVA 3ES9A 5DNYB 1SBCA 2IA5A 2IPAB 5BPFA 2QVXX 3PTLA 1Y80A 3NBQA 5MGBA 2HCBA 3T4EA 3UTCA 3R7WA 2X6TA 2PEZA 4D44A 3FDZB 2HCRA 5C51B 3SZOA 2AFHE 2Z6VA 3KV3O 2ACEA 4XX1A 4EI2A 1KO4A 1CT9A 1NF3A 1T2FA 5JQGB 1XZMA 4U9HS 1X77A 3QWBA 3O8RA 2UYHA 2AW5A 2YJ4A 2NW6A 4ITUA 3RQSA 4EY4A 1MP0A 4J6EA 3CWQA 1R8QA 3W5UA 1YIAA 2RGXA 2L0XA 2XDYA 3R3JA 4MLZA 3DHNA 3UMJA 4LSZA 4AIRA 2GTIA 2FRDC 2W90A 5CJ2A 5G0VA 1OT5A 3GOQA 1Y7HA 3PD1A 3P9PA 4MPJA 2XR1A 4BAUA 1GARA 6NULA 1RM4A 4YV7A 3RU2A 1RFGE 1XRSB 2K2WA 1KFJB 2IP1A 4KSYA 4CV2A 1PJBA 2NYUA 1VCIA 3D0RA 3WHKA 1DWPA 1A50B 1WS6A 4GMFA 3E15A 4OP2A 4WKGA 2H4JA 2F4NA 3Q4GA 4WCVA 1WHTA 4MX8A 821PA 4ZEWA 3RCBA 1ADCA 1DKLA 1D0VA 3EQZA 1UPXA 4GPEA 3DZJA 3EUEA 3SHWA 4RZQA 3KSAC 1GZUA 2IDMA 1CK4A 2QM7A 2J5RA 4Z6KA 4TZ0A 3RVQA 4A23A 1GYRA 4EG8A 3JS5A 1YXMA 2J5KA 3JZDA 4YAOA 2B4QA 2BRUC 1KEVA 4X1YA 4YJKA 1Y1LA 1LLUA 1IFXA 3WTBA 4GQIA 5DXFA 4XWOA 3RSCA 4ZYVA 3KR2A 3C41J 1X7WA 1D6MA 2JGRA 5AVJA 5G0WA 3WMFA 5JATA 1FU7A 4ZCTA 1FEZA 2I3ZA 3SMVA 3WJAA 3DG9A 3W5AA 2J0UA 5CVDA 4MVWA 3KM0A 2C2GA 2ZRPA 5JYCA 1IL0A 2QN3A 2G25A 2L18A 4RYDA 1RXYA 2PKRA 3QWFA 4D9FA 3ZJVA 1FFXA 5MHTA 2A5GA 2JGIA 3B3QA 3DONA 3A9VA 3NOVA 4X3OA 5BN4B 3ZTYA 2JDIA 4EO7A 5ALWA 4PWYA 4BQOA 1JXAA 4MRAA 3WRXC 1KAGA 1LJ8A 3I42A 3K1YA 4WFQA 1QS0B 2VRBA 2J8ZA 3EGIA 1XNGA 3BWDD 1NF9A 3V46A 4AI6A 2ZBFA 5FEMA 3VZSA 1EX7A 4RXUA 1PJRA 3BREA 3VPFA 3ZDZB 2YJZA 4EHHA 2Q1WA 1N1GA 2X76A 4FONA 3LBNA 1A76A 1NG1A 4J16C 3A70A 3JY6A 5JNUA 1QTIA 4OY3A 3NBYC 1OZFA 2C5BA 3RLFA 1R5JA 4RPGA 1JDTA 3OQ6A 3R6LA 4CM3A 2HL6A 1Z4LA 1PVDA 3TEFA 3WGIA 2C2BA 1VE3A 1X80A 2WU8A 4X3CA 5AXCA 1SKBA 1PK7A 1FS4A 3ASYA 2JGNA 3DDUA 3FWPA 3LXMA 4I55F 3GFVA 4ISCA 1JPNA 1C7ZA 1NVMB 1O97D 3PUXA 4BP1A 4F3RA 1FIUA 1QCDA 3NOQA 3PFGA 3V2HA 3L7CA 4FYHA 3PPIA 4JWKA 4DTIA 4IHQA 2I66A 1I4TD 3FX2A 3HSSA 2OCLA 2VHWA 4Y2RA 3TBHA 4YV1A 4NESA 3JAMA 1YDGA 5HG0A 1ZLXA 2ZFUA 3JX9A 4XWGA 1IN6A 8ABPA 1O7JA 3KALA 1W34A 4P33A 4BIMA 4ED9A 4M36A 1PQPA 3B5JA 3NP9A 3C5CA 3DUFA 4FYWA 1XQ6A 1P62B 3OQMA 1I4OA 2O7SA 2ZTVA 2OMEA 3H4VA 4HJRA 5CCDA 3F98A 3TGLA 3DLBA 1JRLA 4FEYA 2FRXA 3OEHD 3H5VA 2HK9A 4XARA 5HDQA 2BGTA 3DP9A 4FE4A 3VX3A 1Q7TA 3DEKA 2PFGA 3OAAD 3IBTA 3CNEA 3QM1A 3BK7A 4BATA 1EDBA 4E15A 1XQXA 2ERYA 3CZPA 2FB9A 1RZVA 4BQIA 4KK3A 4ZVNA 3WGMA 4GNKA 2GARA 1E4VA 3CZMA 1QMPA 2A92A 3L4EA 2C5SA 4QTZA 3BTVA 4M8IA 2G04A 1ZHHA 4BKOA 1YRBA 5E3IA 3QHPA 1R8SA 3AHIA 3B82A 3PQ5A 5FA5A 1G3MA 1E79D 3D6FA 3I9V1 1A7UA 3K0HA 5K8TA 4GI5A 4JJAA 3DE7X 3KYCB 4TMFA 2EGGA 4WGFA 3DLHA 2G5CA 3WVNA 3ZHOA 4D98A 4C07A 1OTHA 3QNWA 3FDJA 2DFNA 2J46A 3R8FA 1Z8NA 3RYIA 4JI1B 4B73A 5F7ZA 4DDMA 3UANA 1EXVA 1DWUA 5JBNA 3RAFC 2CLCX 5ECGC 3RU9A 3V4RA 3S8EA 3CGGA 3DSRA 3SGLA 4UULA 2DKFA 1IZ8A 4UM9B 1OR8A 4LQLA 1YR1A 3G79A 2Y76A 3H6HA 3K1AA 1F0YA 1MLDA 1P33A 1XTJA 2VFAA 2VP0A 1Y81A 3A04A 3ADOA 2RHHA 3QV2A 2HXSA 4E31A 4FD3A 3CVXA 2EZ9A 2CDCA 3TECE 2AN5A 2KSQA 2GHQA 2WHYA 2QJTA 2FOIA 1LNZA 1PZEA 3FTDA 4WKCA 2OCXA 5KYUA 4CM8B 1NMQA 3OZDA 2LIVA 2O7NA 3OVMA 3SQNA 2VPPA 4Z49A 3NWBA 4U63A 1NHWA 1MW9X 2R6ZA 3QJGA 4WADA 2DQZA 3OFSA 4KN5A 3H5RA 5IHPA 2FYTA 3T4XA 3NORA 5BN1A 5FFNA 1DRJA 3ZWAA 2FEKA 3QKSB 1GL6A 3PFFA 1UAYA 2G82A 1JEOA 4ZTBA 1E3QA 4RTPA 4OX9Y 3OIDA 1QH8B 2M6RA 3RRJA 1CJBA 3V1NA 1VLVA 3WHPA 3NIFB 1RDFA 1NMEA 2PX8A 4CKCA 1IYZA 4GKAA 4RV9A 2H4YA 1ZD3A 1C0EA 4E4TA 1XXLA 1AH2A 2J4FA 2QNRA 4LF9B 4RMJA 1SXHA 1U5BA 3ECCA 2YMPA 2AMYA 4P0PB 4C0JA 1TZ2A 2MSLA 4LXQA 4YIKA 3E2PA 5D5QA 1YI8A 2AMVA 3MRSA 9ATCA 4V0QA 5CT5A 4FI3F 5CAEA