1K5DA

Crystal structure of ran-gppnhp-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein RAN
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling activator
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5dA00
1Q12A 3Q85A 1D8TA 2RGNA 2VL7A 4XIGS 1G64A 2F1IA 3B13B 3K0SA 1CJUC 4UXJA 2QROA 4EIWA 1O87A 5BW8A 4XWAA 2OE2A 5DHFA 2NMVA 4JL6A 1KMHA 2CE2X 1P62B 2CNWA 4C0LA 1I4DD 1OXSC 3X1ZA 1G8FA 2WWIA 3LXRA 5TMPA 4RFVA 1ZINA 4URYR 2CLDX 2ZQ5A 3U44B 3PEVA 3TW8B 3P1JA 2H5EA 2WWHA 3OEED 3MSXA 3RS2A 2R8RA 4S2EA 4BWYA 3KQUA 4HAYA 2WSSD 3MD0A 1Z63A 4DCNA 5LB4A 2F43A 3UG6A 1UADA 2OCPA 1R0WA 3HPQA 4NCKA 3SYNA 1ZVQA 1GKYA 2CHQA 1G5TA 2OXCA 4A2PA 4DKXA 1KKMA 5F3WB 1AZTA 5JLJA 1NSFA 2CCJA 5AK0A 2VHJA 5JBQA 4NBSA 1Y63A 3FHOA 3NKVA 4JLVA 3TRFA 4EAQA 1BYIA 2WJIA 4Q4HB 1W46A 1UDXA 4B2LA 4LBYA 3TVDA 1DOAA 2IEYA 2X77A 4TT3A 3F5FA 2KBEA 5JHHB 2AKYA 2F9LA 2I4IA 2ZVPX 1EWRA 2QN6A 3LBNA 2PX0A 1SVWA 3RSOA 1JALA 3GJ6A 5L3SB 4JBXA 1KK2A 2VIIA 4B48A 2GXQA 4X8LA 1KO8A 1NVVR 5EP2A 3F0TA 1GL6A 5H1YA 5HKKD 4GP7A 2QL6A 4U02A 3BFXA 3GLIA 3KXIA 4DLWA 3PR1A 2WKQA 4V0KA 3AGPA 4Q02A 3KJEA 3LVQE 4HZUA 1RRFA 4NYMR 4GT1A 5SZJA 4A6PA 1DG1G 1U0HC 2ZJ2A 4AIIA 1WQ1R 3U7HB 1ZM9A 2J0SA 4CVNA 2XJ4A 2ZU0C 5IDVA 4C0QC 1UPTA 2IYTA 2XNSA 5JRZA 4PAOA 3AF2A 1D9ZA 1VMAA 1E0SA 2D4HA 2XNDA 3GJ7A 1T0JB 4KI0A 3O8DA 2IUTA 1C9KA 3FMIA 2JLWA 3AVUA 4HI0E 4JYCA 3A8TA 1CJTC 5FOWA 3IKJA 4KVGA 3GD7A 3ZLJA 1E9FA 4BPBA 2OFXA 1E2KA 4PPGA 5SZHB 4P33A 4HDQB 3LXXA 5BN3A 1E9SA 2BM0A 3U3RA 3RC8A 4R2IA 2AHOA 2ODEA 4A6XA 1KHTA 2WJGA 4XD7A 4URXR 4Q7JB 4V0ME 4PFSA 2ZJ5A 3DDCA 3E5HA 4POAA 4KBGA 5EUQB 3U2QA 1QF9A 2NO9A 1OSNA 2XSZD 1EFUA 3I4LA 3C16C 4AG5A 4HUTA 2O0HA 2BHRA 2HT1A 4QM7A 3EZ6A 3SHFA 2FA9A 4QBGB 4B34A 5L3SA 2YHSA 1KY2A 4MRNA 5G41A 3SQWA 3A58B 3AKYA 4WXRA 1MV5A 2IS4A 3BK7A 1PLKA 1OB5A 1G3UA 1U0JA 5JJKA 4HLCA 1FFHA 1A7JA 3GJXC 5TXGA 1YZTA 1FX0B 4PX9A 2QPTA 5CITA 1JB1A 1QG4A 1F2UA 4XTRA 5J4LA 1EWQA 1K8RA 5KNDA 3G82C 3ETLA 1N0UA 3K0AA 3WBKA 2VP4A 5DNYB 2IWHA 1Q1QA 4JL8A 2GRJA 3RS0A 5P21A 1OF1A 5JFGA 4FCTA 3WMGA 2KBFA 4OQNA 5FUXA 3AH8A 4JLNA 3SYKA 1M8PA 4TLCA 2BKEA 4BFZA 4AKIA 1XMIA 3REGA 3F8TA 4CGZA 2BCGY 4XTCS 4C3ZA 1NBMD 2O8EB 4RZUA 4GOJA 1LS6A 2ZS8A 3U7EB 1A82A 2ANCA 2B92A 4JLPA 1L4YA 3FYHA 2FFHA 4AYTA 5L3QB 4LK2A 3P20A 2DBYA 2PL3A 2FSHA 3QKUA 2VP9A 1EESA 4CW7A 2FOLA 3EXAA 4DCVA 4TLDA 1G3QA 1P5ZB 1EG7A 2P5TB 4DWJA 3PUVA 3WMEA 4TTPA 4G5RA 2W2TA 121PA 3GLIE 4E5UA 3HWSA 2NPFA 1ZU4A 3BH6A 2XXAA 3LX5A 2I1QA 4YQFA 4PC2A 2RGCA 2RGXA 4I4LA 4L15A 1CBUA 2MMGA 3FB4A 4B3DA 1DG3A 3L0OA 3TQCA 4NTZA 5KSYA 5B64A 3EX7C 1Z2AA 1G41A 3J81k 4CEIB 1U8ZA 4HLQB 2AR7A 3C5CA 3L2OB 3U6BA 3W90A 3BC1A 3RS5A 2BEJA 3LO5A 3W3AA 5DSZA 3M4YA 5DN6D 2PZFA 2IX3A 1OFUX 2BDTA 5E7JA 1HE8B 2ZIAA 2WOOA 5J40A 1HT2E 1YVDA 2G1KA 3IILA 3QVVA 4E07A 3IUYA 1BS1A 4TLEA 2Z6VA 1Z6YA 2OBMA 1G8HA 2FF7A 3K8YA 4C7OB 3ASYA 1KJYA 4ACBA 5FBLB 4K8OA 2GNOA 4M53A 2C95A 2BV3A 2C9OA 4CEJB 4O2RA 2GETA 3CZQA 3LW8A 3R20A 1XEXB 2CCGA 2F1HA 4CRWB 3KKPA 3QXXA 1LF5A 1JAHA 1R0XA 4OHWA 1ZIOA 2D7DA 1NN5A 1N25A 2ZI7A 2JIZA 1P73A 4A2WA 3WNCA 2WVJA 2GHIA 4HDOB 2O8EA 2VHQA 1SXJA 4XH9B 2OO7A 2GF9A 5JWHA 5FOSA 1VECA 2QQEA 1ZRHA 2FH5B 4TL6A 5FR1A 4LJ5A 3B82A 4Q4AB 2G0NA 3ASZA 2V7QA 4P4TA 4JVNA 4Q9IA 1I2DA 5L3QA 3P27A 1WBDA 4FW9A 4GMDA 2ZRLA 5KO2A 1KI2A 2QRNA 4W5JA 3O8RA 3TNFA 2AWNA 1XDBA 4Q18A 3DM5A 1YZNA 1Z0JA 1J2JA 3PIRA 2GILA 3ZS9A 2IYRA 3CF6R 1MO4A 2JGNA 2QGNA 3SE0A 4IOJA 2CJWA 1G16A 4RZXA 4GRAA 4NPHA 1TF2A 1Z0AA 3U60B 2GXUA 3AKEA 2BEKA 3NIBA 2BBSA 4NCNA 5DYIA 1OW3B 5CJ2A 3TIFA 2ZRJA 3LAWA 2ASEA 5DHAA 3EIHA 2EYQA 1EFRA 5JCPA 1JQLB 1TEXA 1UEJA 4PC1A 1KO4A 4HLUA 3T34A 3GLHE 5FBRB 2F7SA 1HQYE 2B8WA 2PCJA 1DVRA 3JZAA 4F4IA 1T4GA 2P3SA 3QG1A 3CX8A 5EE3A 2OM2A 4Z54A 1BH2A 5IT5A 4BE7B 1NG9A 1BKDR 2XB4A 1KI9A 1IM2A 2AFIE 4Q03A 4V0NA 1OH5A 3TVTA 4A0GA 4NHOA 1FMJA 3X1WA 3BFKA 5EZ6B 2IUUA 3GLGA 1TADA 2W2VA 3S1AA 1Q3HA 2C78A 1NIPA 4LOAA 2IXEA 1XEXA 1NP6A 5DI9A 3AGQA 3D7MA 3EWAA 5CB6A 3A1WA 1UKYA 3B6EA 1WBBA 1XEWX 5CLLA 2P0EA 4AY2A 2PCLA 4D81A 2JLSA 1ZD1A 3SC3A 5K8TA 3R8CA 4Q4AA 4II7A 1UDWA 3B7GA 2G9NA 1VIAA 2JLXA 4V0OA 3HPRA 3V4FA 4Q21A 2HF8A 4TT3D 4D0LB 4DLTA 5G3YA 1X1RA 3FFAA 4KBFA 3AP3A 4B32A 4TZ6A 3R9IA 1WF3A 1OT3A 4JBYA 3BS4A 2O8DB 2PH1A 4ILEA 1MRNA 2GJAA 2O8CB 1IN6A 1JXMA 1KI8A 2VTKA 2WWGA 4JLOA 4LWZA 5J4YA 2AWOA 1XXHA 3B1VA 3F3YA 5DO9A 3ZIAA 3K0FA 3FE2A 4URVR 2OUKA 1G1MA 5D3MB 1HEIA 1TF5A 1VCMA 1AK2A 2G83A 1WB9A 1R7RA 2FEOA 2F55A 2Z4SA 2KJQA 2ATXA 2OBLA 1Z6XA 3IPYA 2ZRDA 3BB1A 1NI3A 1S3GA 3MWKA 1I4LD 3TUZC 4X8HA 1H8HA 3OIUA 4NP6A 1IBRA 5C4GB 1MO3A 1DS6A 1UBEA 4OJQA 5HCNA 3BH7A 2HT6A 1P60A 2W83A 4CDGA 2Q3MA 4FXPA 2XNDD 5AWFC 3QVUA 1CLUA 4XVUA 3I73A 5A5GA 4MKHA 1WE2A 2WBLC 1WP9A 2EVWX 2DFTA 3EWSA 4RSGA 4QGFA 1IJFA 2V6IA 4A82A 1WDTA 3ND8A 4OL0A 1VIYA 1Q0UA 4H1VA 2VLIA 4MGKR 5JMTA 4QXAA 2C9YA 4I99A 1E1RA 4C2TA 2FU5C 3AVPA 3RRMA 5DGXA 4JLMA 2ZROA 4IJMA 1N5JA 1YR9A 3K53A 2QEQA 4KVAA 5DI3A 2C77A 1GL7A 2V3CC 1GNQA 5KUTA 3WYFA 3MRSA 5FBQB 1X86B 4XD7D 1JNYA 3BE4A 4MQBA 4RVCA 2ORVA 3MFYA 3NBXX 3IIMA 4QHYA 1XTIA 1DTSA 4JT2A 1JR3D 1G7SA 4MGIR 3UMRA 3NH6A 3H1TA 3CPEA 2GVZC 3CBQA 2QAJA 1Z22A 1XD2A 3EARA 1XJQA 3QKSA 2CL0X 1AJEA 4OI1A 1NJGA 5J47A 4BLOA 1GNRA 1U8AA 4HB2A 1VDZA 4M21A 3U3KA 2G6BA 3SS8A 1XMJA 4PO8A 5A4JA 2GAOA 1DAIA 3TQFA 1JJVA 1CR0A 4PZZA 2BMEA 4MYHA 5GJWC 3E1SA 3CLVA 4UXIA 2REXB 1PJRA 3H2YA 2GCOA 4PO9A 3DPUA 2XGJA 1IXRC 4HDCA 3BORA 4OK6A 4URUR 1Q3TA 1E1QA 1OJLA 1U8YA 4IW3B 5EP4A 5GVRA 2P2LA 1G18A 1ZBDA 2CEAA 4P32A 1DAFA 3KFVA 1KDTA 3QXJA 2NZ8A 3OFNA 1BYUA 4LY6A 3KTAA 1I4TD 4DCTA 2OBNA 3I5YA 3ZS8A 4EPVA 2PJRA 2ZETA 5FOTA 1AQUA 4AKHA 1Q22A 5C46F 1E94E 1OIVA 1G8GA 1P75A 4UNSA 4MUAA 1FW6A 1F5NA 4Z8YA 2E87A 1LFDB 2QMHA 4IDPA 2FSGA 4KFTA 3TUJC 1TQ4A 1FQJA 2V1XA 4EJSC 2A3RA 3U61B 1W4BA 4PSAA 2PLRA 2F1RA 1US8B 1ZC3A 2ZR0A 1WRBA 2XOKD 3AVQA 2ONJA 3Q5EA 4O3MA 2ZJAA 4AYXA 2V8OA 3KQLA 2D7CA 4QGHA 2BBWA 1VHLA 2V9PA 3H86A 1UF9A 4IRUB 1WA5A 4RKFA 2AD1A 4PQRA 3OIVA 2QA5A 3KXLA 4B74A 4JS0A 3QNUA 4GL2A 2BBOA 3CRMA 2Z4RA 5KDOA 1GILA 2PEZA 4QRHA 4QG7A 1II0A 1SVKA 3U4QA 4Q1FA 2NO6A 4RZ2A 4EJSB 3LA6A 1MRSA 3DHWC 5JECA 5KDLA 2ZI5A 3HR7A 3R7WB 1BOFA 1FQKA 3KKNA 4GNKA 4L9SA 1QHIA 4A0RA 2Q3FA 2REBA 2FN4A 4QL3A 1L8QA 4HUQB 5BN5A 4LV6A 1GSIA 2JIZD 2AL7A 3D6TB 2OFWA 1SXJD 1N5LA 3NDBB 5GJBA 4IVRA 2CHGA 3B60A 3QF4A 2C98A 2J9RA 4EQ6A 2V7QD 4DB4A 2YWEA 3LLMA 5JI2E 2NTYC 2ZSDA 3ZJYA 3SBDA 4C0SA 1WXQA 4PXAA 3A6PC 2IT1A 4NE2A 5KSPA 3W5IA 1P2VA 4MRRA 4FCVA 1G291 4O25A 3HYTA 3ZVRA 1ZNZA 1HUQA 3NWJA 1AIPA 2OFOA 1JEEA 1OXVA 2CMKA 5KSOA 1KZ7B 5TARA 5FPHA 4HB4A 4K46A 3SYLA 4OHYA 3CRQA 2V54A 2RH5A 1RKBA 1XD9A 2ORIA 3KDSE 3ICEA 4YMVA 5JEDA 2HJVA 1RYHA 2Q9AA 1EFRD 2YV5A 1ZAKA 3MMPA 4V0LA 2FFQA 1E96A 3AQ4A 2ZAMA 4BQSA 5SZIA 2C2HA 4M9XA 1C4OA 2JCSA 4TYYA 1C1YA 2OAP1 2XITA 4F4JA 2ZE6A 1G6OA 1KI6A 4TQAA 1G7CA 2GVDC 2IS2A 4TZ0A 2YNMA 4HAWA 1R8QA 3IPXA 2RGBA 1U2RA 3CB4A 1JR6A 3UKDA 3AEZA 3IIJA 3NBZC 4PZLA 2AXNA 1UBCA 1NIJA 1F48A 1DAGA 4G5GA 3TUIC 4CT5A 1ODFA 4Q1CA 2HXSA 2JASA 4KXFB 1CJVC 3QUSA 5DE3A 2GJ8A 3SJZA 2J7KA 2QENA 2ZAOA 4KSCA 1TU3A 4O2LA 1HQCA 1NNEA 1X8KA 2A2ZA 3T1OA 1GTVA 1A2KC 2D06A 2OG2A 2Q21A 2OCAA 2ZSAA 3TBKA 5BYJA 3BBPA 3FOZA 1OFIA 2WAXA 3EPHA 3SJCA 3ADDA 2XZOA 1SHKA 5LB2A 3IDQA 1GRRA 4PSKA 3OEHA 3B5JA 3WXMA 4UJ5A 4XSHA 4DT1B 5K8IA 3I61A 2QORA 4DLUA 3NBFA 5IRCD 3T35A 4RJLA 2QBYB 1XMVA 1YQTA 4QKQA 2FZLA 4PPFA 2G0TA 4KFRA 4PTLA 2O0KA 3IGFA 4LI0A 4GDFA 3AVTA 1AGPA 4QBFA 4DDWA 3EAQA 3WMFA 3I3SR 4Q66C 2YOGA 1DEKA 4DDUA 4BFSA 3W8NA 4EDHA 3N2EA 3Q3JB 3CUEF 2NG1A 3CH4B 1QHXA 1XEFA 1YZUA 2KI5A 4IOKA 3THYB 1S2MA 1DAMA 3ZIAD 1EFCA 4V0MA 3BIFA 4OI4A 1DE0A 2E1RA 5DLQC 2PT7A 1XF9A 4XWKA 4K81B 1Q1EA 4KO8A 3CONA 3L8YA 4LV5B 2XX3A 4LC0A 3NHAA 1XTJA 1OFHA 4Q47A 3T15A 3UMFA 2IXFA 2FZ4A 2FSIA 1NY6A 1R5BA 2RHMA 3C7KA 5AUPB 2ZREA 1TQ6A 2BOVA 2QU8A 4QJ5A 1SZPA 5JCZA 5AJVB 4BASA 2GA8A 4IDOA 5J4KA 3RWOA 4TYWA 1H8HD 2QAGA 1KO7A 4QNMA 2UVQA 5M04A 1B0UA 4OJKA 4KSBA 5GVSA 2ZTSA 1H8EA 1SGWA 1NN3A 2IYXA 1MR3F 1OIWA 1II8A 3HU3A 1KSFX 2FNAA 2JA1A 5D3QA 1OH6A 5AJWA 4OI2A 3X1XA 1CXZA 4QGGA 8OHMA 4C4PA 1U98A 3K9NA 2J41A 3G0HA 1E2DA 4B6EA 2OHFA 6Q21A 1OLOA 2JATA 3HYRA 3VR1A 4KODA 3PITA 4Q1EA 2CL6X 5FOUA 4PQYA 3DZDA 3WNBA 1E1RD 1VCOA 3TR5A 1FNMA 5LPNA 4IHQA 4OKSA 2JLQA 3C8UA 3T1QA 3EPLA 2DWQA 4IDHA 4E09A 3PJRA 2IW3A 3OIWA 2ODWA 1E99A 2QP9X 2JAQA 2QSZA 2R2AA 3Q8XB 3SBEA 3TJZA 3K70C 3AVYA 3A4LA 4A92A 1HYQA 1CU1A 3LVRE 4DZZA 2QBYA 1BMFA 4PO1A 1FNNA 4JBWA 2NO1A 3PQCA 1E2FA 1NLZA 3TK1A 2W0MA 3JVVA 4C0BA 1N5KA 1UFQA 2GXSA 4TMKA 1FUUA 3HDTA 3M0EA 621PA 4NH0A 4BEJA 3B1ZA 3PXGA 2QQ0A 2AFHE 2B21A 3A37A 4QNRA 5BYKA 5HPYB 3WBJA 1BIFA 2PBRA 3QIAA 4GSYA 3AB3A 3T61A 4B3FX 2ZXUA 3W8RA 4A9AA 5AUNB 4D4JA 5HR5A 3K70B 4XJXA 4DIDA 4G01B 4HYYA 1XP8A 4AD8A 5JHGB 1A1VA 3LW7A 4RCYA 1Q57A 4KCGA 4Q1DA 4XVRA 1YRBA 1VG0B 4DVGA 1DAEA 4BLPA 1S96A 3RRZA 5TV2A 2ZYWX 4D4MA 2YKGA 3U44A 3GLHB 1XEWY 4OHXA 3TSWA 3EG5A 4LJYA 3SZRA 4G5OA 2DWPA 1ZUHA 2ZI4A 4A4DA 2WWFA 4TL9A 4Q1AA 1E1QD 3NDPA 5FI0B 3LFUA 4M22A 1M74A 2XAUA 4ZIRB 2DFLA 3RS7A 4W5WA 3OFND 3NH9A 4S35A 4BLRA 1NKTA 4HAUA 2A5JA 1M1YE 1PLJA 4ZDJA 5L8VA 1XX6A 4IEIA 2FPLA 4Q4HA 5UKDA 3GFPA 1P7CA 4C0AC 1OE0A 3DMNA 1YRAA 2HUPA 3QENA 1X8LA 1RRGA 3B9PA 3WNDA 1OYYA 4WBSA 3EASA 1IY0A 2F9MA 3T1VA 4P4SB 3HJNA 5KOYA 3LH5A 1W2GA 2IS1A 1XU4A 4RY2A 1E9BA 1W36C 4Q4LA 2GEVA 3C4JA 2GF0A 3SFVA 2WKRA 1II9A 3QXSA 1CP2A 5HTKA 3X2SA 1YR6A 4FCWA 2CK3A 4US0R 3EZ9A 1W1WA 1A5TA 4DDTA 2ZR9A 2JJ2A 4JKIA 5FUYA 1SVOA 2GAAA 1XFAA 2ZRBA 1HE1C 2OCYC 3PUZA 3QQ5A 4GZLA 3RC3A 5CK5A 1R0ZA 4CZ2A 2P6UA 1S1MA 1OKKA 1E2JA 2ZRCA 5EE1A 5JSZB 1GWNA 4LYFA 4ESVA 3V9PA 2XTZA 3DM9B 2FDCA 3DKPA 2VP5A 3KJGA 1KJWA 1Q1ZA 4L8GA 2F1JA 1W36B 4PPQA 2EFCB 4ASUA 3GLHA 2VSOA 1QRAA 3CO5A 3RRNA 3QF7A 1TX4B 2X2EA 1L7VC 2RAPA 2WKPA 4PQFA 1ZW6A 5EXPA 2IF2A 2IEZA 3I8XA 3RLFA 4A36A 5IHPA 1M6NA 4FINA 1FZQA 2ZE5A 3IO5A 2PLFA 3ND9A 1T6NA 1LB1B 4Z1MA 3U5ZB 4DLSA 1YZQA 3LLUA 1J70A 4HAVA 1ZUNB 1P61B 4FMCF 3HP1A 2O8FB 5KNBA 3KKQA 1Y3AA 1E9AA 4NL4H 3R8FA 1RIFA 2JLVA 1JBKA 3MGCA 1AN0A 1QHHB 2J45A 3ADBA 2GCPA 3TSOA 3W34A 1P4SA 2C9CA 1OB2A 3UWKA 5TY0A 1RJ9B 4A8JC 4PZYA 4I1OA 3VX4A 1GKUB 3KKMA 5FPSA 4Q4JB 3K0CC 3VU9B 2J0VA 1TQ2A 2ZE7A 4IXMA 1E2MA 4QJ4A 2EU8A 2I1VB 2ZSEA 1TMKA 2PMKA 2B7BA 3AF3A 1FX0A 2A5DA 2UZIR 4ABYA 1NRJB 2YC4C 3ONWA 5KHOC 3E2IA 3K9HA 1W47A 1N0WA 3WRXC 2JLUA 1KJZA 5CLQA 3H0KA 2D2EA 5JJLA 4D0NA 1N5IA 5CJPA 5AUQA 4NYJQ 2JEOA 4U5XA 4FWIB 2DPXA 2BM1A 3UWOA 4KLNA 5H70A 4Q1BA 3A1UA 3RHFA 4DLRA 4P31A 3W6NA 4BLQA 4A8JB 1IXSB 4HAXA 1E98A 3KZ1E 2IA5A 4WVFA 4ZI2A 2ZITA 3BXZA 5JS8A 4LYAA 1JJ7A 2DWOA 3QJYA 1MT0A 2Z83A 1PZNA 3QPWA 5FOVA 4EUNA 2RHDA 4ARZB 1Z6GA 3QPVA 1NSTA 2FWRA 2ZRNA 3OZXA 4JVMA 2GJ9A 2QSYA 1TUEA 2ZSBA 4ITRC 4OHZA 4DEYA 1KMQA 3CWZA 4LSGA 3ZDQA 5EXTA 1T5LA 5H68A 4IEEA 1E32A 4F38A 1GP2A 1CR2A 3L0SA 2YINC 4MYTA 2ERYA 1GIAA 1HY3A 3OEHD 1W5TA 4OI0A 1T3LA 1YE8A 1KK0A 4LPSA 5CDFE 421PA 1EX6A 4PPNA 4TQUS 2EFDB 4I1VA 4JLKA 3KB2A 2QPOA 3KQHA 2O8FA 2BMJA 1XTKA 3CW2A 2W6JA 3GLFB 4CEIA 1EGAA 4Q01A 1IN7A 1F2TB 1F3OA 2H16A 1VG9B 1XCPA 4QBHA 3SN6A 3GJ8A 4M1TA 3ECCA 3KJHA 3C15C 3THXB 3AVWA 4EKDA 1CEEA 4GOXA 4BZQA 4Q4JA 2OZEA 2ZUDA 3U7GA 2CLSA 2CNWD 2EFGA 1KAOA 1G8YA 2QTHA 4HEJA 2VQSA 4WXPA 2BMFA 5FPKA 1TL7C 4KU4A 5CM8B 4C7OA 4HSEA 3BB4A 3DMDA 4P0TA 1YKSA 4N0DA 4CEJA 3JVUA 1P9WA 4M1KA 3A1TA 4TN1A 3K9LA 1G7RA 2Q6TA 3CF2A 3BH0A 1H8ED 1N6HA 1QZXA 2WV9A 4IDQA 2R6DA 2F3RA 3U3MA 1OXXK 2ZI3A 1RVDA 4NDZA 1KO1A 2W6IA 4LYHA 3LQQA 5G40A 3FFBA 1HH4A 2YWFA 2EQBA 2ZRHA 5KNCA 1LF0A 1E9DA 3THWB 1PVOA 1NG1A 1E2QA 3I92A 3QI2A 1DAHA 1N6NA 4PR0A 1QBKC 1UKEA 2EWVA 3WRYC 3B9QA 3VFDA 4DUGA 4NYJR 1CRQA 4D4KA 1ZJ6A 1D9XA 3FMOB 1P9NA 3BOSA 2G1JA 2SHKA 1ZP6A 2P6RA 1BMFD 1VPLA 4ACAA 3KX2A 5CB8A 1OXTA 2ZJBA 2EFHB 3DOEA 2VSXA 2R65A 3QG5A 2R6FA 3MWLA 3PG5A 2F3TA 1W2HA 1V5WA 2PX3A 1F2TA 1ANKA 2H57A 4AYWA 1E2LA 1E69A 1LV7A 3C5HA 2NIPA 1Q1BA 1J90A 1G21E 1ZC4A 2V6JA 4TTQA 3SR0A 2A7QA 3ZYCA 4GP6A 1ZNWA 5H8WA 1E6CA 2PEYA 5EXXA 3GQBA 1E0KA 4DSTA 2FX3A 1XTQA 2AKAB 1AA9A 2GJKA 1QVRA 3BRWD 2HLDA 3SNHA 1GFIA 1AKEA 1OXUA 1OV4A 1GM5A 1R10A 1OFTA 3KXKA 4UNRA 3KKOA 4URZR 4KITB 2QP4A 4JSTA 4KHZA 1FOEB 1GKIA 1U9IC 1KOFA 4TMWA 4F91B 3QEJA 1IHUA 4U00A 2ZRPA 1N2CE 4CIDA 1SVIA 1P6XA 1RFLA 1PLLA 4IFBA 4DHEA 3U7FB 1UKZA 3Q7PA 4XOIA 1D2EA 2N42A 2J0UB 5JI3E 5KU1A 4I81A 1KY3A 4F93B 1VHTA 1W4RA 4QC2A 4HATA 2R6CA 1AM4D 3N70A 2E9SA 3UANA 1AS0A 1E2NA 1H65A 1YZGA 1COWA 2WOJA 1MABB 3QY0A 2GZDA 3GJ5A 4HZIA 4TLBA 2D3WA 4E22A 3QKRB 4QBIA 1IJEA 4U7DA 1IY2A 2O8DA 2VHTA 2ERXA 2GZHA 4US2R 4D80A 2O8CA 2VRWA 5FBVB 1R0YA 3WYGA 1K5DA 3I1FA 3B8HA 3FTQA 4DSOA 1U94A 1NVXQ 4M9QA 5D3MA 4B2IA 1VG1A 2FE4A 2CK3D 5J4HA 2QT1A 3W6PA 1ZD8A 4XVQA 2V4ZA 1SVMA 2P65A 3MG9A 3LBHA 2JJ2D 1GUAA 4C0KA 1ZNXA 3PENA 1KDRA 3LY5A 1ZM2A 2N46A 1P3JA 1QHSA 1XTRA 2C96A 1OKKD 3GMTA 2ZJOA 3AF4A 1E2GA 4LBVA 4RFSB 4TWZA 5E4FA 3RNLA 721PA 2KSQA 5F2EA 3VHLB 3WHLA 2MSEB 4BLTA 2OV2A 1X8JA 1RZ3A 4ASUD 3CR8A 4ZKDA 1DO2A 2H8KA 2BCJQ 3OAAA 4D2IA 4TQ9A 2VF8A 4EFMA 1KZGB 4AI6A 3QBVA 1CJMA 1G5RA 2H18A 2QY9A 2ZANA 5DISB 4BZPA 3ADCA 1DAKA 1HURA 4Q9JA 5GADl 1DELA 5DH9A 2ORWA 2GEUA 4LZZA 1M2OB 5FPYA 4PSVA 3GLFE 1KK1A 3EIQA 4R7ZA 2WM9B 2NO7A 2QTVB 4JLBA 3B1XA 4TYQA 5FTLA 2OCBA 3JZMA 4Q00A 3U6KA 3TH5A 4Z1MD 3GEHA 1XJCA 3B1YA 1KDOA 2J3EA 2C04A 2QZ4A 2XZLA 1LY1A 1NLYA 1YZLA 2EW1A 4MITA 3AF0A 1JPNA 5FR2A 1IXZA 1XTSA 2CXXA 1G6HA 1MABA 2IYLD 3NEJA 3CNLA 1E4YA 4RD1A 2ZSFA 3K0EA 5LDDC 4YONB 2BIFA 4IOMA 4PAQA 3QKRA 1Z07A 5E7IA 3EC2A 3VKGA 2YYZA 2QMEA 2VEDA 2J87A 2GK7A 3EA5A 3MWYW 1E0JA 3PUWA 2UZ3A 1M7GA 4M8NE 1XCGB 2GBLC 1TTTA 1E9CA 1XZQA 3PVSA 2P6NA 3KFXA 2V55B 2KWIA 4WZBE 4YLGA 4AURA 2ZRAA 3A1VA 2QMUA 2ZJZA 2NGRA 2OAQ1 4NZYA 4C0HA 4Q9KA 1J7KA 2D62A 3KB1A 1TUIA 2OEPA 1KO5A 4JL5A 4LDJA 1Q20A 2J46A 4LC1A 4PC3A 4CT4B 1A4RA 4FD2A 3ZZUA 2PT5A 5EP3A 1AGRA 1S0UA 5EZ5A 4D26A 2WSMA 1EFHA 4QM6A 3GJ0A 3HU2A 3BWDD 1NMYA 2HCJB 3B85A 4RD4A 1KNXA 4H9GA 2Q9CA 4WZ6A 2BC9A 1YJ5A 3SJAA 2XZPA 4LCBA 1Z5ZA 1O3YA 2O8BB 3RSLA 4B3CA 2RGNC 2IUSA 4EPRA 4B3BA 1X6VA 2X2FA 3FPAA 4LHVA 1NF3A 1V43A 3LBIA 5F9HA 2W58A 1XJ0A 4B76A 4CEHB 2VA8A 5K8UA 3VKWA 2QUZA 4B71A 3NXSA 4MKIA 2R6GA 4MH0R 4UNPA 3D8BA 1OH8A 5FUWA 1N6RA 1US8A 4XWOA 3GJ4A 4WAUA 2W6JD 4FMCB 3EIEA 3BJIC 1KNQA 3REFA 1RPZA 3P32A 2DHRA 4TSFA 1AS2A 4LHZA 4GMXA 3HU1A 4G3XA 2Q9BA 1EFTA 3ZVLA 2FJUA 2WIAA 3IHLA 1TPZA 3RS3A 5LBIA 1UJ2A 4XSGA 1ETUA 1GDDA 1WCV1 1KMHB 4EJSA 1B23P 2GTPA 4RD6A 5TVKA 3LX8A 3CNNA 3R7WA 3GEIA 2WPDA 4H1UA 3RWMB 2HV8A 1Q44A 2ZYVX 3B1WA 4LJ6A 4ZCMA 1OYWA 2PMDA 2YWHA 1GNPA 4OQMA 3VKHA 3CRW1 4JLDA 2W2XA 3MAAC 2QPAA 2VPPA 4PHTA 4YXWA 4HUQA 5CYPA 2PZEA 3SJBA 5L3VA 1N0VC 2CE7A 3AKCA 1Z06A 3SHWA 1RRCA 1ZIPA 3VMFA 4KJZA 4M2LA 3IQWA 2W6ID 2ZR7A 3TW4A 1KIMA 2NQ2C 3IO3A 2QE7A 3QXCA 3TGPA 4MRVA 1M7HA 2WMOB 3EA0A 3TAHA 4R71A 2WHXA 2YJTD 4TMXA 4ZDWA 3EZ2A 1GRQA 2X8AA 4WW0A 3QE0A 2AK3A 2VH5R 2GKSA 4HZUB 1FP7A 2ZE8A 3DL0A 2CCKA 4BFVA 1KKLA 2I3BA 2ZJ8A 5JWOA 4DJTA 1QDEA 5CIQA 4DUGD 4DLVA 3K09A 4LUCA 2FFBA 3LDAA 3VTKA 4B44A 3Q7QA 4CEHA 2IC5A 2ZEJA 3W9YA 4B47A 4BEBA 4KAXA 4UNNA 3QBTA 1G4AE 4RD2A 4N0EA 2ZI9A 1E2IA 1X3SA 2VP0A 2IYZA 1JPJA 4E03A 1GZSA 3A36A 5FBWB 1IN5A 3PEYA 1T8UA 2VP2A 5E3HA 4BECA 5E7MA 5AJYA 4ZPXA 2RGAA 1NBME 2ONKA 1Z6TA 3FMFA 1HTWA 2O5VA 2QTFA 4QFMA 1XPUA 2LWIA 2EFEB 2DR3A 3DEFA 2IF0A 1Z47A 3I8SA 4AKEA 1G19A 5C18A 4W9MC 2RKOA 5F98A 5G3ZA 3CR7A 2L0XA 5HE9A 2HLDD 3OF5A 3B2EA 1G17A 4IXNA 4LBZA 3V00A 1TNDA 3ZGXA 3H84A 3RDPA 4NCJA 1GOTA 2Z43A 4L4UA 3VAAA 1YHNA 4Q7MB 4OQXA 1TEVA 1G8PA 2DYKA 1PUIA 1GAJA 1CRPA 3EZFA 3ZZTA 5KPDA 2Z0MA 2C8VA 1LVGA 1YR8A 2XTNA 1XZPA 4DC9A 4LJ4A 1ZNYA 3KQKA 1JI0A 4DT1A 2IYQA 4B2PA 1AKYA 4D0GA 1Z29A 5C1BA 1Z2CA 1HA3A 4BUJA 4N3NA 2H7VA 4UNQA 4DCUA 3AM1A 4N1AA 3CF0A 4JSYA 3QXHA 3KQNA 2WJHA 4GI7A 1DARA 5FL7A 1COWD 3TLXA 2REOA 1P2SA 2JDIA 3K9GA 4LHWA 1ZM4A 2P5SA 4L9WA 4TMTA 4FMDB 3AVXA 1VYTA 4A2QA 4UJ3A 1S3SA 3RRYA 2PZGA 2QM8A 4HLDA 4M9ZA 3L8ZA 1W0JA 4HB0A 4IOLA 4DLZA 2ZI6A 5EXSA 5FTNA 4US1R 3AVOA 4M0LA 4GBMA 2B6HA 3THYA 2FG5A 3BGWA 4NKRA 3VR5A 3NC0C 4V03A 1Z8FA 1S4QA 1F2UB 1N6PA 3CX6A 3FMPB 1CTQA 3K0AB 3P26A 3VNUA 1UBFA 3DO6A 3M1IA 4ZCLA 1XB2A 4BLSA 1IY1A 3GEEA 1IOZA 3QEOA 1EX7A 2CHVA 4NYIQ 1KSGA 1A2BA 2G3YA 4OK5A 4GPTA 4LJ9A 2CBZA 4D82A 3IBGA 2X1VA 1TQDA 3OAAD 4TL7A 2MSCB 3GFOA 4BFXA 5EE5B 3WY9A 2VHUA 2H17A 1XPOA 1ZCAA 2ZRKA 4Q9HA 5CK4A 4FMBB 1LNZA 4GZMA 1DBSA 3LQRA 1YU9A 3RAPR 3VX3A 4IVPA 4RKEA 2ODNA 2WICA 3AKDA 3FWYA 2C99A 3A1SA 2J0QA 4G5QA 3VR4A 1J8YF 1ZCBA 2XXAB 1N6LA 1G5PA 2GESA 4C0JA 2RMKA 1FMLA 2FV8A 3FKQA 2GJSA 3ICQB 4OHVA 2D2FA 1G3MA 1UKVY 5DIFA 2R44A 3GFTA 1P2TA 3VQTA 3O47A 1BO6A 2JLZA 2GK6A 1IONA 3EPJA 1S1CA 3UATA 1GVNB 3DKVA 3DOFA 3MJHA 3NG1A 4ZV4A 1JR3A 4C9BA 4YDHB 5CDFA 3PUYA 3ADKA 1GG2A 3CZPA 4EPYA 3FKSA 4F7WA 4CF7A 2VYFA 3FVQA 3I72A 1SXJC 2AN9A 4LJ7A 4GFDA 1W0KA 2ZYUX 3ZH9B 1E79A 2P67A 4LHXA 3MWJA 1Z0KA 4WA7A 2NZJA 3AVVA 1RW4A 4I1UA 5C2JB 2GWHA 1CS4C 3RS4A 4J0QA 3B78A 3L82B 2VBCA 3ZQ6A 4KLZA 2XB2A 2QT0A 2ZUBA 5IF9A 4DEXA 5ANRB 5F9FA 1Z0FA 2Q0HA 4I1SA 4ZIRA 2EYUA 4JVSB 2WIBA 1SXJB 2ZJYA 1ZYUA 2YC2C 1N6IA 3LD9A 3R9XA 5FTMA 5HZKA 3AF1A 1SKQA 4P3YA 3D3QA 2AD5A 3MCAA 2AX4A 3NHBA 5AJZA 4MYUA 1Z3IX 3KUDA 1D2NA 4M1YA 3TAUA 2J1LA 4HLUC 2OILA 2WWYA 3DVLA 2IYYA 2RGEA 5KYKA 2KE5A 1UAAA 3WP1B 1NJFA 4ON9A 1DPFA 1JECA 1NMXA 3THOA 2CJWB 2C5LA 4NU0A 4P4SA 3UXMA 4DDVA 2ZM5A 4KFUA 2B7CA 2G77B 3T5DA 4NYIR 1ZD9A 2FFAA 5EE9A 1SVSA 1IN4A 1E2PA 2JLRA 4Q7LA 2WJJA 5TDHA 4TSFD 3LRPA 3UG7A 2XOKA 5B58C 3T1TA 2QM7A 1XWIA 3CH5A 2BVNA 1Z6AA 2AK2A 5BQ5A 2ZVQX 2HJGA 1D5CA 1CIPA 2YWGA 1QHGA 3GCGA 1S9HA 2ANBA 2XTMA 1MKYA 4KFSA 4MGZR 4OQLA 4AK9A 5JSZA 3N5CA 1OH7A 4PC7A 1N6OA 5HE8A 1U99A 3I62A 1XMSA 4TYNA 3X1YA 1NMZA 2J7PA 2WPDD 5B30A 3SI7A 3Q72A 2FGJA 1QG2A 4PHGA 4Y0AA 4V02A 1EXMA 3GLGB 4YXWD 1Z0IA 5K8LA 1LTQA 2QG6A 4JJKA 3S1AB 1ESNA 2ZS9A 1GITA 2ODBA 2QNRA 3NBYC 3WP0A 1ZM3A 5JRJA 1T91A 1ESMA 1U0LA 1T0HB 1RYFA 4A0HA 2EWWA 2OESA 3VR3A 3I32A 2DB3A 2ZRMA 2BBTA 4EFLA 1JR3E 3SQXA 1G7TA 1QHYA 2IK8A 2QE7D 4OBEA 4FN5A 1TU4A 3QOFA 1KI7A 5FTKA 4OYHA 4L5BA 4Q7KA 4PC6A 1G9XA 4NCIA 3RYTC 1MH1A 3CPHA 4M1WA 1IQPA 3LV8A 3BD9A 4WOPA 1QHHA 4R2HA 4JIMA 5CIWA 5BWMA 4NMMA 2HYIC 3PUXA 4EPTA 3PEWA 4TL8A 1RJ9A 3I5XA 3AUXA 4DXAA 2HYDA 2NO0A 221PA 4LJ8A 3CKLA 4GOKA 4ZO4A 3VU9A 1P72A 2CDNA 1N3BA 1XXHB 4UXHA 3BAFA 3K0FB 4MRPA 5FTJA 5B2ZA 4Q5IA 2FEMA 3UK6A 4A15A 3RABA 5IK2A 4BZXA 3AP1A 3KJIA 3ZQJA 5CYOA 4OQFA 2JJ1A 4TMZA 1OHHA 3IQXA 2HCBA 1W5SA 2IXGA 2N1BA 4TYPA 4KYUA 1F60A 2IYVA 1UBGA 4MKGA 4A8JA 1D6JA 5BN4A 1FL9A 2H1LA 3SOPA 4JLAA 4EPWA 2AXPA 2FSFA 4DSUA 1SHZA 1D2MA 3N2IA 3GPLA 3V4RA 5FPTA 3CPJB 3K0CA 4BFTA 5EJEA 3CRVA 1SKYB 4LBWA 3O8CA 4ARZA 4PHFA 5KSZA 4JT4A 1MO5A 2ZRGA 4W7SA 3TE6A 3P4YA 2A30A 4A1FA 4QHSA 4FMDF 4JLJA 4MA4A 3AP2A 1FP6A 2HF9A 3OE7A 1W44A 3E70C 4WIAA 2CVHA 3KL4A 1CJKC 1DO0A 3CWQA 2OLJA 4YDSA 3L0IB 1DADA 3H4MA 1M7BA 1L2TA 4YC7A 5DI3B 5C4MA 1M34E 3QSYA 2FPMA 3SU8A 2WAYA 5FL7D 1Z28A 1XBTA 1Q21A 1GRNA 2IYSA 3A4NA 3CRRA 2OT3B 4ZKEA 3X1DA 2JDID 1T5IA 1VG8A 2C03A 3CX7A 3MJRA 3TKLA 4YMUA 5GJCA 4ZDIA 2NOAA 3GLFA 3IEUA 4RD3A 2KB0A 1W0JD 5E95A 2WTUA 4R98A 5AJXA 3QPUA 4LJAA 3A4MA 2ZUCA 2DFNA 3U3OA 1NVUQ 3THXA 2MMCA 1XD2B 3QKSB 4RCZA 4FWTA 2Z5FA 2WMNB 3TMKA 4HB3A 3W6OA 2GDJA 4LYJA 3C41J 2ZPTX 4X8OA 3D31A 3CIOA 3SDZA 2WWXA 3VR2A 1N6KA 2BWJA 1KYIA 3EC1A 5JZVA 1SXJE 4PAMA 4FIDA 4MDFA 1RC8A 2HXYA 2QMOA 3OEEA 3K1JA 3W3ZB 2GCOB 1S9DA 5JJIA 2WSSA 2V1UA 4BFWA 4C2UA 4Q48A 2YOHA 1KAGA 1KSHA 4QGAA 5A0FA 1Z83A 3SEAA 2BKUA 5J4VA 4B75A 4EPXA 4JVLA 1W48A 1YR7A 4BFYA 4LHYA 4X8MA 3KTAB 3RANA 4JJZA 4D6PA 1NLFA 1VYVA 3ZVNA 3THWA 3IBYA 3LNCA 2PJZA 4UQOA 2GXAA 1X1SA 3ZZ0A 4B6FA 1R4AA 2X19A 3G5UA 1UM8A 2O0JA 2XJ9A 4Z8XA 2O52A 1XNJA 3OHMA 4DRZA 3AV0B 2CVFA 1FTSA 2A5GA 2WZQA 2Y8EA 1K5GA 1E9EA 3L43A 2WJVA 2ZU6A 2BMDA 1QHNA 2VSFA 4YMSA 4NCHA 2RGGA 4JZKA 5HKKA 1W7AA 3IEVA 1KI4A 1KI3A 5FOXA 4ZI3A 5EE0A 2WJYA 3UIEA 4IKEA 1MO6A 1E0AA 5AUOB 3IIKA 1JEDA 5EUMA 1HT1E 2GEDA 2GCNA 1VCIA 3FKSD 5FH9A 3WHKA 4BRWA 4G5SA 1S8FA 4DLYA 3GLGE 1W0KD 2DY1A 1E79D 1E3MA 4QJ3A 3K70D 2A5FA 2QGZA 4M4SA 3U4QB 3GP8A 1NY5A 3OIYA 3U3JA 3O8BA 4AKGA 4Q9LA 1J99A 1KK3A 2CLCX 4RD0A 4PANA 3BB3A 2ECKA 4M1MA 2R62A 2B8TA 2JLYA 2NPIA 3EPKA 3SFZA 1R5OA 5LD2C 2LKDA 2LCFA 3MUFA 1J8MF 3NEYA 4HAZA 1R2QA 4B35A 4EFNA 2MSDB 3RVBA 3WYAA 2IL1A 2IBMA 2A9KA 2JJ8A 4DSNA 2J0UA 4LPKA 1R8SA 3QF4B 2VF7A 4MYCA 2ZYTX 4ESHA 4BRUA 1CR1A 4EQ6B 1ZM7A 2YOFA 4AG6A 3Q5DA 4P4UA 4DIEA 3FDIA 4LRWA 1XXHE 2G88A 2DCUA 2RB4A 1W49A 3NVAA 4IVQA 4URWR 1U9IA 4G1UC 5LD2B 1T8TA 2XSZA 2IWRA 2HDNB 1R5NA 2FGKA 3T06B 4DCSA 3MLEA 4TLAA 4B3GA 1CKEA 4M1OA 4M9SA 1LW7A 1ZU5A 3DZ8A 3UPUA 2VP6A 4F4CA 1NVWQ 1E9RA 2J5XA 1AS3A 1RE0A 5EQTA 1OIXA 5FI1B 1G3IA 5KDDA 2H92A 3EZ7A 4Q19A 4BGDA 5B57C 5JEEA 1NN0A 2QRZA 3OESA 5L3RA 4LX0A 2R9VA 2VHCA 1G3RA 3EW9A 1SKYE 1W4CA 1VCNA 3VHXA 4B73A 5BXQC 1CULC 1KI6B 2YZ2A 3NTUA 4Y0VA 5HZHA 1JAIA 1KDPA 2K5UA 4RFSA 5KPJA 2IHBA 1E2EA 2ZS7A 3TSZA 3ZVMA 4W5HA 4C30A 1CR4A 2ZRFA 1W36D 3PFIA 1NBMA 4FI3C 521PA 2J7PD 1VKJA 3GJ3A 1IAQA 1ONBA 4AC9A 4KV9A 2OXRA 2DFKB 2VO1A 1JQJC 2IYUA 1W4AA 4QOSA 5DYGA 4BFUA 4R9UC 1Z0DA 3LWNA 3KUCA 4YMTA 1I2MA 821PA 1PUJA 1AQYA 3K09C 4LV8B 4A0FA 2IS6A 1CF4A 2IYWA 3FGNA 4L16A 1U90A 3ZD6A 2BJVA 1WMSA 3VR6A 2ATVA 3AUYA 3ZD7A 2XEXA 1U81A 1TAGA 3R9WA 2QP3A 4OK3A 2W00A 1R6BX 5JS7A 1NN1A 1KTVA 1QVAA 4G0NA 2WWWA 1FPMA 1T9HA 3C14C 1NL3A 5ELXA 2F6RA 3UMSA 3IHWA 2IHYA 3CM0A 3PEUA 4DB2A 2BJWA 3QKTA 1SVLA 1L4UA 2UKDA 2QAGC 1KGDA 3M6AA 3L0PA 3P4XA 4JMPA 4MRSA 2QI9C 4B3XA 4B43A 1SQ5A 4ERNA 1MOZA 4D4LA 5KTYA 5DN6A 1FTNA 1YZKA 1XCMA 2A5YB 4JYBA 5J5CA 5TB5A 5EP1A 4MKFA 4PHHA 1XRJA 3VNVA 4Z51A 5AR1A 2FPKA 4YMWA 2GZAA 1PV4A 5IK2D 1Z08A 1AZSC 4IDNA 4ZDKA 2JJ1D 1OHHD 1VYUA 1VTKA 1NVVQ 5FL3A 4MUBA 4DBLC 1EK0A 1JXOA 2TMKA 2QAGB 1NKSA 2YVUA 3BERA 2F43B 1TF7A 3FHCB 3Q9LA 2R6AA 4O0MA 1T3SA 1P2UA 1ELOA 4CYMA 2W0SA 1KSJA 2J59A 3NC1C 4D25A 5FUVA 1IN8A 4B33A 2RGDA 3W5JA 2FMXA 1II8B 4MGYR 1SULA 2GBLA 4TTRA 1LS1A 5JWRA 2OSBA 4KYIB 4NYMQ 2HEIA 2OLKA 4DLXA 5HCIA 4ZCIA 3PV0A 2RCNA 3CNOA 4LGMA 3OE7D 1XD8A 2Q3HA 1ZUIA 4F92B 4WZAE 1XPRA 2O8BA 1K6MA 3HR8A 3PCRB 1HV8A 5FFMA 5G53C 1F6BA 1T3HA 4UKDA 5CM9C 1UEIA 1RRPA 3T12A 2CL7X 4NONA 3T5GA 1G4UR 5SZKB 4AWXA 4M1SA 4IFEA 4QHTA 1P9RA 1KI1A 4MDEA 3GLIB 1E2HA 1OPXA 1ZMXA 4RZ3A 1E4VA 4TMVA 5GJVC 2D74A 2ZRIA 1GL9B 2A78A 2LKCA 3FHTA 4JKYA 1G20E 3BFVA 1FUKA 3TR0A
chains in the Genus database with same CATH superfamily
1Q12A 2AOUB 3Q85A 1D8TA 1DXQA 3FA2A 1G64A 2VXCA 4B83A 1T2VA 1RYYA 3ZTTA 2EZ9A 5AVVA 3K0SA 4LXGA 4QYWA 5DFAA 2NVUB 1IXYA 2QXTA 1N5DA 3TKAA 1O5IA 3ENZA 2G09A 5AI8A 3UC5A 3S2YA 1KMHA 2DETA 4QZVA 2HF7A 4RIEA 3RARA 2I4MA 2X0DA 4R3NA 3HYCA 4GZ5A 1IATA 2IEGA 3LXRA 3WB1A 1WMFA 4RFVA 1C2TA 4CF5A 3ZWAA 4CKWA 1VHJA 2GM5A 1FRNA 4Z9XA 3MSXA 2EBUA 3UK7A 4BWYA 4ZEVA 3C7AA 2D8MA 5T6BA 1AO0A 2WSSD 3MD0A 3TTTA 4YROA 3HMQA 3NIWA 2ZIZA 3TLMA 3U9SA 1OCEA 1WCIA 3GAZA 3ET4A 3M3HA 2RGYA 4Q12A 5IJ9B 1R0WA 3HPQA 4NCKA 5CJJA 2FEWB 1VI5A 4M1EA 1G5TA 3GDGA 7ABPA 3W8DA 3AW8A 4FYIA 4IIBA 4P86A 3WZ2A 4D8VA 5F3WB 4R8MA 4FEAA 3H2SA 2V97A 3RC7A 3KT0A 1RTKA 4PZCA 2VHJA 4ZAFA 1I3OA 2NZUG 1PQ4A 4FNOA 1TAUA 3I83A 3EZLA 3FHOA 2K4MA 3GRFA 3TRFA 1VMEA 1SUEA 2Z2XA 4EAQA 1BYIA 4M49A 4BNWA 1HNWB 2MYNA 1W46A 4NWIA 1DOAA 1XZBA 1H2ZA 1Z4QA 2IEYA 3LO8A 4KLRA 4TT3A 1KJIA 5I8PA 5JHHB 1O89A 1F8YA 2XV1A 4C3OB 1UANA 3OD5A 1EWRA 3AV3A 2YHIB 3PR3A 5JJCA 3NHKA 4AKTA 1EGHA 7AT1A 1TI7A 4JBXA 4WOBA 5L3SB 1QQ7A 3FFXA 1QE5A 4JKOA 4ND3A 3U5TA 3TIIA 4HKTA 1GUFA 3SEZA 3E81A 1U4OA 1GL6A 2NADA 4TV9A 2MR5A 2HNBA 2GN1A 2WQZA 5FI5A 3OTOB 4JR0A 3Q8MA 4U02A 2I2BA 3BFXA 4DN6A 4EW6A 5KTSA 1QQBA 2BSQA 5KVAA 3PR1A 2WKQA 2RK3A 2X76A 1PL7A 5I9TA 5MN6A 1FRZA 1RLJA 1LTHR 3H5AA 3HEBA 5IYZF 1CRWG 4Q02A 4GRIA 4RKWA 3H97A 2AOUA 1JJFA 2I0FA 5SZJA 2A8YA 4XM1A 4A6PA 3RPEA 1U0HC 1D3AA 2ZJ2A 4M76B 3N8IA 2NVUA 5LQDA 4DR6B 3NWEA 4XB2A 3SR4A 4G89A 4RPIA 4GKVA 4R9NA 1I4EB 4L5AA 4C6TA 2X5XA 2XJ4A 4EG3A 3HXOA 1JU9A 2G67A 2HMAA 2NN3C 3AF2A 2D4HA 2JPDA 4KI0A 4ML3A 4B09A 1DMRA 1T0JB 3BRWA 4RYLA 4S1NA 5E7QA 3T3IA 2ACKA 3FMIA 3W6ZA 3N0WA 1WZ2A 4LZAA 3KYBA 4UU0A 2HMUA 4HOYA 3BAZA 1G6KA 2I4NA 5AKKA 2VK2A 3BMNB 4NZZA 2A0YA 3UWDA 1SC1A 3DVAB 4UVEA 5TLSA 4HWTA 5IJ9A 3UJPA 1E9FA 2C5FA 4R8KA 2AFIB 4OQZA 4Q16A 1E2KA 1FTQA 2PUWA 4JGBA 4NBLA 2D5LA 4PQGA 2RHGB 3LXXA 1RWQA 2W6NA 3P2KA 5ITZB 4FU0A 5LYYA 2BM0A 1H94A 3JS5A 3O3NB 1QYXA 5U4QA 2GZRA 4PLCA 3U3RA 2AHOA 1PUXA 1QOQB 3FF4A 5E2AA 2I9KA 2EXXA 2WJGA 1Q15A 2IELA 4WRRA 1NGSA 4POAA 4MR8A 4KBGA 5EUQB 2PZ8A 2CUTA 3PFKA 1E7RA 1QF9A 1OSNA 2CB0A 2A88A 2PRSA 2XSZD 3FNGA 3WGNA 1TJ4A 2YHIA 1N7IA 2J85A 3Q3EA 4OPMA 3SHFA 5L3SA 3PEFA 3UJ6A 4PCAA 3SG0A 1LBEA 3FTNA 3BK7A 2X7JA 1QH9A 1DBWA 1G3UA 1QYRA 5DBHX 4HLCA 3U9TA 1OB5A 3GJXC 2E3JA 4TXNA 4NJEA 1GPMA 1K1EA 1HRKA 4YCSA 1QG4A 2QLNA 3EFOA 1GGEA 1LLFA 1OPRA 3WGHA 1AHPA 3WA7A 3B3AA 4QYTA 2VWPA 1HXHA 1K8RA 4XTRA 4ER0A 3COYA 2X1HA 1UKBA 2JLCA 3ETLA 3K0AA 4I66A 3V7WA 3O7WA 3FD8A 5H83A 2C61A 3DQZA 4IF4A 1QYDA 1F8FA 2KBFA 1PR0A 4TPKA 5IUNC 5BW5A 2NT3A 4TLCA 4HWPA 4BFZA 1XMIA 5BSUA 4ZZ0A 4RIGA 5K6AC 1HE2A 1Q7EA 4RZUA 1QH0A 4I19A 4KQ1A 1YNOA 1A82A 1MW9X 3H6KA 5EQDA 4EYGA 3QU5A 3L4BC 4PYNA 3T3GA 4FI3F 3WNZA 1C7ZA 3FYHA 3H42B 1PK7A 4AYTA 5E6RA 3V8VA 1UBLS 1Y7PA 2C8JA 1FTYA 2XVYA 3X1KA 2FMFA 4YEDA 4RNDB 2PL3A 2FSHA 3JPYA 4FUQA 1RNLA 1QH1B 3GNTA 2X4GA 4TLDA 1G3QA 5EIBC 1FDSA 4DQUA 4TTPA 2FUG6 121PA 2CFCA 1ZOSA 3U4HA 5F4ZA 2NPFA 2P4SA 3BH6A 2Q8NA 2WQ6A 3QP9A 1A8SA 4G86A 2I1QA 2WU3A 2IGBA 4EDFA 3HACA 4A8PA 2CF6A 4CQMD 4IP0A 2ZR8A 4Y6OA 1QFJA 1YC2A 1FDRA 1Z26A 2C5EA 3DSRA 4HNRA 8ABPA 5KSYA 1WW8A 1EHYA 5CG2A 4IVNA 1H5NA 1TUBB 4HGQA 4HLQB 3L2OB 1R66A 1BGWA 1JFVA 2HSJA 3U6BA 2Q1UA 4R51A 3CJRA 3M5WA 3W90A 1UOOA 3BC1A 2DERA 1NM5A 2QD4A 5K03A 2A94A 1QPBA 1XCLA 2FMKA 1CETA 1HE8B 3EZNA 2H2IA 2WOOA 3IQZA 4FE3A 1HT2E 2G1KA 3IILA 2IODA 3BRCA 1YRYE 4TLEA 4E12A 2Z6VA 1WTCA 1I9CA 1C3OA 1LTKA 4ZOLF 5KJEA 3TINA 3G85A 4ETIA 3AC0A 5K45A 1K2WA 3M5DA 3VNBA 5KNDH 4G65A 2QRVB 4JU8A 4ROSA 1CS0B 2OZLB 5FBLB 4DBVO 4YMLA 4D9IA 3FSGD 4M53A 4CEJB 3OCWA 2JZCA 2F1HA 4U5QA 1X7XB 1T1JA 3CISA 1QIDA 2EQ5A 3QXXA 4KYVA 1R0XA 1A4IA 3HN6A 5G4LA 5KYXB 2VUIB 3OZ7A 4HVAA 3DXFA 3PNMA 1F4LA 4GOND 2GHIA 3G2JA 4JB0A 4DLPA 4RHEA 5JWHA 2NU6A 2BD0A 1EHCA 4NBKA 1YOVA 4K9MA 5AM5A 4YRRA 1YBHA 4TL6A 3JAMA 2ZAYA 1NZDA 2EKPA 3B82A 2IY7A 3PHBE 3ZK7A 4BMPB 2V7QA 4P4TA 3FI0A 1U7TA 4JWKA 1JBQA 3RC2A 2QL7A 1UP7A 3Q3CA 1JIXA 1WBDA 1F7VA 2IDKA 2ZRLA 5KO2A 3KV3O 4FGZA 2X41A 3UKJA 4BJ6A 3RD5A 1N0HA 2CJFA 2Q6LA 3E9YA 3PIRA 3AJ8A 4DANA 1RSZA 3ZS9A 5BUCA 3O8OB 2IPOA 1J0BA 1MO4A 4EG0A 4IOJA 4JOSA 2YS6A 1AO3A 3RS9A 3N0TA 1GUZA 1U2DC 1R9JA 5EQFA 1L7AA 2WF6A 4I55B 1UMDA 4DR1B 3IAM1 3NIBA 2BEKA 4AROA 4L8VA 3GRCA 4NCNA 4RCVA 4CT0A 4OM7A 4CLRB 4D3SA 2HHLA 3KS9A 5CBPA 4OYRA 2XHEA 5DHAA 2AS0A 2EATA 2CC2A 1C9MA 4RF2A 3RQSA 3OJXA 3VNQA 5K20A 2ZJ0A 3AHDA 2WYHA 2D1TA 5JCPA 1TEXA 2PWZA 3KU4A 4FLFA 3C43A 3GBVA 2PZJA 3GLHE 3C6YA 3OP1A 3Q7SA 3BREA 3VPBA 4ZGWA 1UAYA 2WTMA 5KS2A 5ETJA 4WLEA 2Q3DA 3AR5A 2OM2A 2VQ3A 4IS2A 1BH2A 4KQ2A 4B5KA 4E2XA 1L1QA 4W5QA 3A2KA 2F2TA 3G0CA 4HEA6 5EFZA 1XRMA 2QIOA 1YMUA 3B52X 3I45A 1SKUA 5I48A 1KI9A 4FOSA 1SZCA 5CXSA 4Q03A 4BBAA 5DMHA 2Q4EA 1OH5A 3WQSB 3QBEA 2QRVA 3D4IA 3DYIA 3HMKA 2WIFA 2XYHA 2AMVA 2PHZA 1T2CA 3JD2A 3NTRA 1E5VA 4QXMA 1ATZA 5EZ6B 3OLVA 3S1AA 3QVGA 1QDLB 4I1RA 2IXEA 3I0MA 5BT9A 1OLXA 5DI9A 3MB8A 3AGQA 1JG7A 3D7MA 3UH0A 1XKLA 1UKCA 4IHJA 2AG0A 4OB7A 4XCXA 3S70A 2Z1MA 3VOAA 3O0DA 4UBMA 1WW2A 5HG0A 4OMUA 3IR7A 4JI6B 3LUKA 5ITVA 2GM3A 3TL2A 3KQOA 1R6XA 1KJNA 3O74A 3F5MA 4YJKA 1NDQA 1NR5A 2JLSA 5LFAA 3FFWA 3JASA 3FTEA 1WY5A 2VT2A 4HNGA 4DNOA 2EC5A 3B7GA 4W5OA 4TX1A 3HVHA 3WLQA 3URKA 5HDQA 2FTKE 2NQ8A 3G7UA 4F85A 3NYQA 4IH9A 1Z2EA 2P1DA 1Y7LA 2E5WA 4IRMA 1I1HA 2BTOA 3FFAA 4L28A 1WIWA 3SF8A 4AQYB 3AP3A 1TJ3A 3FTPA 1C8KA 3HNOA 3L0BA 3R5HA 4LI3X 1VA5A 4LRTB 4TS4A 2JVKA 4B32A 4BNKA 1P29A 1WF3A 3FOFC 1UZNA 3KJQA 3O8OA 2GR9A 1M0SA 2O8DB 3T7IA 4H4EA 1ZH2A 3K8ZA 10MHA 1Z4MA 3TB4A 4C2BA 2DT8A 4I55A 4OV6B 2CXRA 4G36A 4LWZA 1A50B 2AWOA 1XXHA 5FYDA 4K9QA 1MO2A 2O3SA 2GEJA 1M1ZA 2YQ5A 4FTWA 2WHPB 1IG0A 4IO0A 3S44A 3SFTA 3QW2A 2Z1DA 4G0UA 4NXMB 5E3JA 3BDAA 3GJTA 3TCXB 2FEOA 2XUJA 2GCIA 3P0HA 4K6OA 1Y89A 1TMGE 2CJPA 4UMEA 4I36A 1LPSA 1WHTB 1Z6XA 2H51A 5TPWB 3V8PA 3BB1A 4LXIA 3ZGOA 4JHXA 5HF5A 4CNBA 3TUZC 5A9SB 1H8HA 3OIUA 4NP6A 4ATNA 3MD9A 3HKCB 4PSUA 4AB1A 5HCNA 3D7SA 4BVFA 2P6PA 2HT6A 1P60A 2W83A 2VDNB 5EXDA 1QVZA 1FMCA 2LDBA 3GVHA 4RDCA 1KEVA 1PK8A 1SM4A 2JH8A 3CW8X 5AWFC 3I73A 4MNTA 4XVUA 3SHQA 5F7JA 4MKHA 1LX7A 4BKPA 3FYSA 3EXEB 2UYGA 2DH5A 3VVBA 2DFTA 3P5SA 1EUYA 5C1DA 3WK5A 2MINA 2VHEA 4Y9DA 4F5ZA 4H1VA 3STHA 3MILA 1HYBA 3TM5A 2PVCA 4MUYA 4B8ZA 4JU9A 5HJ5A 2X58A 4QXAA 4KNVA 3ABSB 4YASA 3U3DA 3PQ6A 1IWBB 2FU5C 3AVPA 3DV2A 5ALHA 3RRMA 4WE3A 3WQHA 4J0GA 4BNYA 5JFTA 4DA8A 4ZVSA 1N5JA 3K53A 4C04A 5DI3A 4YPVA 2ZZNA 3I37X 2V3CC 1GNQA 1J25A 4PZ9A 1P7VA 3AUFA 1N2JA 1X86B 1EM8B 1H6DA 4PZEA 1ADCA 1SVUA 1YS6A 5C34B 1QMPA 3QMMA 4EKYA 2W6OA 1MJNA 3NBXX 2FSSA 1GAXA 3PFHA 4PZUA 4P3OA 4JT2A 1UC8A 2C2WA 1RXVA 3FCEA 3CUTA 3H1TA 4FHZA 2WJ3A 2QRUA 3A3NA 5HIMA 4D9HA 1ZGZA 4DE5A 1ES9A 3EARA 1GGMA 3IALA 4CR6A 2P4UA 2CL0X 1BFUA 5K8CA 4XGIA 1BWQA 3LQYA 3C7TA 4OI1A 4EI2A 1X9HA 2HRDA 4BLOA 4GLOA 5LN1A 3GELA 5E1OA 1EFLA 3OZDA 1X7HA 2GA9A 4M21A 3SS8A 1Z3CA 1ZOIA 3R3JA 4A26A 5KNDD 3KE8A 1MHTA 3EXG2 2RJOA 5JY6A 3KZVA 2BMEA 2QVLA 2OO5C 4MYHA 4LF6B 1TM1E 1FLAA 2IHJA 3NW9A 1LPBB 3E1SA 3CLVA 4UXIA 3H2YA 3K7EA 1TU0A 2YVAA 2I76A 3HBAA 2QVXX 4HDCA 5K0SA 1PNRA 3NOQA 3HJAA 3AUJB 3TOSA 3WGVA 4OK6A 3T5CA 4ZYXA 5K2OA 3GH3A 4OXYA 1OJLA 2I6UA 1U8YA 5A9TA 3AW9A 3UXHA 2P2LA 1JLKA 1QE3A 3K1TA 3PC4A 1XZ8A 1ORHA 1SELA 1DAFA 4RH1A 4TVOA 1IY9A 3PQ7A 2NZ8A 3C5VA 4YK7A 3SX4A 1BYUA 5IBCA 2BFFA 2FYTA 3CEAA 1LQ2A 3GMSA 2Q5EA 4QTTB 5ALQA 2PSEA 2B0JA 4DCTA 3EXEA 2DFPA 3ZS8A 5TF0A 1WV0A 3PGJA 5JRDS 4RMIA 5AVRA 4PG8A 5EJAA 3UHAA 2RHWA 2EJVA 2JHGA 1E94E 1SJ9A 4XUCA 1P74A 4FFMA 5BSEA 1E0DA 3VZRA 1FW6A 4Z8YA 3DE1X 4MV7A 5GIPE 3JXEA 4WLNA 3ZD8A 3ZN2A 1CQJA 1DV2A 1ZWLA 1ZD3A 2FSGA 3QWAA 3TUJC 4HGYA 4XI9A 4YT2A 3ACDA 4QRDA 4EFKA 1HDIA 2HB6A 5ECYA 1J0CA 3L92A 4FYKA 1FQJA 3EY4A 4LZJA 2JA2A 4N6OA 4N7RA 4OLHA 2HMSA 1AGNA 1O97C 2JFXA 3KKEA 4PWYA 1EM8A 2PLRA 1EVEA 1WXHA 1VM6A 2HK9A 2HSGA 2NU9A 4G41A 4MUFA 4O2AA 2QRPA 4C07A 4Y9RA 1NXPA 1WRBA 2XOKD 2Z04A 3GGGA 5MF6A 2O7VA 4O3MA 1KPGA 2ZBQA 3Q4GA 1JAZA 1FLNA 1T36B 1O58A 4ANFA 4D97A 1VHLA 5C37A 3OLQA 1UF9A 1YV9A 3LOUA 3OE1A 1TM2A 5B1IA 5JY1A 3FJYA 5LQJA 4WNIA 5BY2A 1CCWA 2QA5A 3KXLA 3MTGA 5J4LA 2BBOA 3CRMA 4PFQA 3H0CA 1N2HA 2PEZA 3WK6A 6AT1A 5KDOA 3LQKA 2ILVA 3Q7RA 1SVKA 4QQRA 4ARSA 3U4QA 1JFTA 3QUCA 4B31A 4WLVA 1WUKS 3QY9A 5AK6A 3V4LA 2IDZA 3USCS 4ZYUA 5AVXA 4IUDS 5AHRA 2HCRA 1RPJA 4G37A 5JECA 3HR7A 1Q1NA 5AK4A 1O0SA 4R3WA 1J20A 4TS3A 5LL6P 1FQKA 4JNCA 4YP0A 5EKUA 1QTIA 3X1JA 3OETA 1VI2A 5GWXA 3KSAC 3VZBA 2OGSA 2QPLA 2OK7A 4KLAA 1XZGA 1XVVA 4C0XA 1TK9A 3FGOA 5BN5A 4IXWA 1PNQA 4IZ6A 4LV6A 2IZ5A 4ZU1X 4ZU3A 1ZXBA 2BGWA 4S05A 1X13A 4Z1OA 1N5LA 1RXCA 3H5TA 2BGMA 3B60A 3KR1A 3KP1A 3F9CA 5CDYA 3WWOA 1LRLA 2C98A 4F3KA 1BWRA 4GR9A 4R1NA 3K1ZA 4Z9FA 1QFSA 2F62A 4MPJA 2G17A 5JI2E 1XMXA 2WHEA 2ZSDA 4R84A 1HLFA 3MAGA 4EBFA 1VIDA 1WXQA 3LZ6A 3NPMA 4IG4A 1XQXA 5BMVA 1ODIA 3COSA 3IT1A 5KSPA 4JUDX 2CFOA 2WR8A 4MRRA 4O25A 4PBTA 3HYTA 4IV8A 4P7GA 2ON6A 3ZVRA 3MCZA 3QEMA 3CSDA 1AIPA 2OFOA 1SBIA 3P52A 3NVKI 2ZIXB 4EYSA 1EJ0A 1HE3A 1KZ7B 4PS1A 5T8KA 5KSOA 5A6SA 2CV1A 1LLDA 2TMDA 3SYLA 2Y0EA 1YH3A 2RH5A 1AXRA 1CF2O 3KDSE 1R8XA 4BUCA 3H7AA 1PE0A 1RAGA 3NTOA 4H18A 4F86A 1QE0A 3S2IA 1EFRD 1JG4A 1JHAA 4G1VA 1E96A 2FW0A 2ZAMA 3RBZA 5E9AA 4EQZA 2PH5A 3IR5A 2XUPA 4F4JA 2BKXA 2P62A 3GLRA 1OZAA 2QTGA 1G6OA 1SN7A 3QJ5A 1G7CA 4A0SA 5BNWA 2IS2A 3WWZA 4CQNA 2AXQA 4M1QA 2V7GA 1WG8A 3CE6A 3V2IA 3TTVA 4LA4A 3L01A 2ZYAA 1R8QA 3IPXA 3NT4A 1JR6A 2HZBA 3IS3A 3WI7A 1M0EA 2CUZA 2AXNA 4KOAA 3OZAA 1E7QA 1V39A 1DT5A 1ISMA 1UBCA 1NC3A 1NIJA 3AEXA 1FXWF 4M60A 1CEQA 1DAGA 1CE8A 2CMGA 4CT5A 4KMSA 1ODFA 2HXSA 4WJKB 5DGIA 3LPDA 2OLEA 1U0FA 1E1NA 2GJ8A 2ZAOA 2QENA 4IJ6A 4WA8A 5H0IA 1O94D 4O2LA 1HTTA 2ZUTA 1GTVA 4YJ2A 5IVDA 2ZSAA 2D5AA 1XZFA 4HD8A 4QPPA 1BQEA 1QK4A 1RTTA 1JHPA 3AUKA 3QEKA 4L0QA 4WXEA 5JAOA 3I6IA 1AUPA 2CHEA 2R8XA 3AESA 3FWNA 3K2IA 4NE9A 5EJ2A 2DR2A 4XM0A 3DLBA 4PSKA 4IZIA 4HJXA 3IKMB 2P9ZA 4EUKA 2H9AA 2VPXA 3R3YA 4MUKA 5K8IA 2FHPA 1ZITA 3DWEX 5IRCD 1PJAA 5JASA 2J9FB 2QBYB 2V7BA 1YQTA 5HGXA 3EFBA 5FWNA 2G0TA 2JGDB 1POXA 3KSUA 1WVMA 2X42A 3QV2A 4MB0A 3MS7A 1Y6JA 1IPHA 2PGIA 4NATA 1M6WA 1DEKA 2H1RA 3JATB 5AM2A 2ZIXA 3NI2A 3CUEF 3CH4B 3PHLA 4O4JB 5CNKA 4CL3A 1RHKA 1XEFA 2QT9A 2WFAA 1U8UA 4F2WA 3GMDA 4PE5B 1S2MA 1ZXXA 1DAMA 4NBWA 1TJYA 3MTDA 5AVZA 2A9OA 2XXJA 2E1RA 1U0SY 2PT7A 4M55A 3WSVA 1GCUA 4JELA 5DBEX 3LOPA 3LVBA 4XWKA 2HHHB 2P2SA 3QUQA 3EEYA 3P9CA 2HU7A 1Z2PX 2ZDHA 4QVIA 1DRVA 3NHAA 1XTJA 3UUFA 4JYZA 1NTOA 2IXFA 4RQBA 1Z18A 2RHMA 1F5SA 2QMYA 3C7KA 1D0VA 3HYLA 2ZREA 3QE2A 3U80A 4CM3A 2FMTA 2LZ0A 2QK4A 5EINA 4BASA 2GA8A 3L8MA 3IP6A 3HL4A 2QAGA 5DZSA 4QNMA 4JEHA 4CCSA 5DTIA 3JRWA 1ZLYA 2UVQA 3C1AA 1Z74A 4EW3A 4OJKA 5B6IA 5B7QA 2ZTSA 3BD8A 5IFLA 1NN3A 2II6A 2PA0A 4P35A 2FLKA 1UPBA 2HMTA 1ZN8A 1II8A 3KVYA 4QPCA 2G7MC 1MQAA 1VJRA 5AJWA 1VI6A 1U02A 2XE6A 3X1XA 2PWPA 4QGGA 3ZI0A 4B4WA 1U98A 4UBNA 2J5RA 1U0EA 3SZLA 3NVDA 4L2IB 2OHFA 3IPLA 4MS3B 2B83A 3WC4A 3P9NA 1NXXA 2G9VA 4H6PA 4DQDA 3VTZA 3F7TA 1E1RD 4Z9AA 4EA9A 5JS1A 1S6YA 2X6RA 4H59A 4KE9A 4F9TA 3EPLA 3MHTA 2DWQA 3X44A 4MWSA 4KI7A 3PJRA 1XU9A 1E6LA 2ODWA 4TSRA 4LGYA 2JAQA 4OQYA 4YRPA 3BMQA 1QNFA 3OCUA 3LDFA 3O7MA 3G89A 1HYQA 1YHYA 3LVRE 4DZZA 1QLHA 5ALPA 5MFPA 3RWBA 2QBYA 4B82A 1BMFA 4EEZA 2F3PA 3F3SA 1WXIA 2JGDA 3BE8A 3I01A 3PQCA 4ENPA 1JUDA 2P3OA 3LTEA 1NAHA 5K0CA 3ESXA 3BDVA 3OIFA 4LEIA 4PG7A 1KXZA 4DUPA 1MG5A 5KAMA 1YK1A 3ZIUA 3FZQA 4BEJA 3B1ZA 5EC8A 2WZCA 2JC3A 4J7XA 4ZT7A 1XA0A 2AFHE 3JATA 3K4HA 4MVYA 4QNRA 5ULLA 3QMPA 5JROA 3WBJA 5IBQA 4FFRA 1M1UA 3QIAA 2R751 1KTIA 5I51A 3AB3A 1K08A 4CUKA 2VA9A 1TYAE 2P4EA 3ANYB 3CRZA 3N7UA 1YT5A 3W8RA 1PVVA 4CWAA 1WDLA 2BN4A 2X14A 3JYLA 3P8ZA 4G01B 4QX6A 4GQIA 5EPOA 2GPAA 4AD8A 2FRDA 4F60A 4XVRA 4HV4A 1A1VA 4JDUA 2HDOA 1YRBA 4DVGA 3F4LA 4BLPA 1B6RA 4OIFA 5TV2A 2ZYWX 3CVVA 3GLHB 4BUZA 4LGCA 1Q0LA 4Y2GA 3TSWA 5BRAA 3SZRA 4KXVA 3EBPA 4LNUB 1DWPA 2VPWA 4KP7A 5AJUA 4OHPA 2WT9A 4A4DA 2XOEA 2Z09A 3F8SA 4FSXA 3K92A 4OAOA 4G8DA 4UUQA 5D85A 3V42A 4Q1AA 4X91A 3T9AA 1TT5B 2F59A 2HADA 3NDPA 4O5OA 3LFUA 5FI0B 2OV8A 3X2EA 3C8MA 3GUVA 3EVZA 3RRXA 5CCDA 3V4PB 3CX3A 4W5WA 5TSDA 4S35A 1SOMA 3WKDA 1SEVA 1M1YE 1AK9A 2OGUA 2DKFA 4X6UA 4MV4A 1KYQA 1N2SA 4NU8X 3UPDA 4YAUA 3E7FA 4OXQA 3WX0A 4IQFA 5WRFA 4AG3A 2FPLA 3WTCA 3DZCA 3HBMA 2Q3EA 4QOFA 5UKDA 2O1XA 3ECSA 2RIRA 3DO8A 3HBLA 4HXFB 1GAQA 1N8SA 3DH0A 1ZJYA 2X22A 4MKRA 2ZB3A 1NM5C 1YRAA 2I3GA 2XUZA 3JD1A 2HUPA 3PXBA 3USZA 1RRGA 2Z2YA 5TQJA 4CDNA 4GQAA 1OYYA 1SURA 2JAUA 1IY0A 1V8FA 1DIRA 2F9MA 3B2QA 3MLBA 4H1HA 2X1LA 4MAFA 4P4NA 1A7AA 3HJNA 3LH5A 4P4SB 5KOYA 1G5HA 1XU4A 4I6GA 5A1TA 5LU8A 4CV1A 4B6QA 2Q2QA 1UPFA 1I33A 1PDOA 4Q4LA 2X3FA 1UIRA 1BFKA 2EIXA 1FC0A 4WSOA 4FW8A 3QXSA 4ER3A 1DKPA 2G71A 2FUG1 2VNAA 2CK3A 2QTBA 3EZ9A 2P9CA 3LGAA 4BE9A 5EWJA 1I13A 3F6BX 1G2PA 3ERCA 2W90A 4HY3A 1XFAA 3T9DA 2OCYC 2XB9A 2GPWA 1R0ZA 3KWLA 1PEAA 1RZVA 2EKQA 4CFZA 5JSZB 5C9ZA 2YX1A 2AUTA 1P1KA 1QRDA 3LIIA 1SK8A 3OZFA 1TJPB 3D5TA 3BWCA 4AJ1A 1LU9A 3PL1A 4AMZA 3QMVA 4PPQA 4ASUA 1ESZA 3ORHA 3V6MA 3GLHA 1G21B 1U2ZA 1QRAA 2VSOA 4Q7EA 3VJMA 1X7ZB 4QEDA 1CY0A 4WLOA 4LNUA 2HRQA 3HA2A 4M0UA 2PGAA 3VYUB 2WG0A 5KOHA 5TR9A 4LMBA 3AI1A 1TX4B 3DLIA 4HTFA 3F6PA 2RAPA 3COPA 3ZU6A 5A3RA 2NZ2A 3UMJA 1WUTA 4H4CA 3DEIA 3HWX1 4GEKA 1FTWA 5K2MA 1UP6A 1QFYA 2QV7A 5BQPA 3IJEB 1EIWA 5IHPA 5JNVA 3IO5A 2PLFA 3AHEA 2Q5JA 4MUJA 2FWIA 4R1TA 1LB1B 5DGCA 4Z1MA 1YZQA 3PNLA 2HMYB 3SY8A 5BVHA 1J70A 4I6EA 2OVBA 4BQPA 4ENTA 3HWRA 4QU8A 1AHIA 3KKQA 3O82A 5DW3A 1WNTA 1L4MA 2DTEA 4FB5A 1DUIA 2CXPA 1XNRB 4KH0A 4HCJA 5D5PA 4GMGA 4E5YA 3KYDB 3ZCQA 4HDRB 3PGMA 3O2QB 1NUQA 1RJ9B 1V5GA 3Q6IA 4PCVA 4A8JC 5EJ5A 1WR8A 3VX4A 1YQUA 2F3QA 2VBGA 5LIPA 2HWXA 4Q4JB 3R9XA 5IJWA 4RGBA 2I1VB 2EJCA 4LYEA 3WLPA 4K03A 2GNPA 4LKRA 4EY4A 2XDYA 4BNIA 2XRYA 1XL1A 1KETA 4TMYA 2H3EA 5CLQA 4HQ0A 5DYNA 4D0NA 1N5IA 1H9BA 4RGQA 1Y9EA 4JEIA 1QIMA 3LHSA 2DC1A 4U5XA 1CUZA 5BN1A 2R7KA 1F51E 2PY6A 1T1IA 2YNMD 5DHSA 1VRWA 4BATA 2VG8A 1LWNA 4Q1BA 1M6VB 1Y1LA 3RHFA 1DWOA 3OEYA 4P31A 3W6NA 1IXSB 4E4TA 2QVGA 3OOJA 1DLIA 1SBQA 2P4HX 1AQIA 3N2KA 4WVFA 1IDOA 3UJHA 5ALFA 1NUUA 1VL1A 4MZXA 4FZRA 3QJYA 4I4TA 4N48A 3MT9A 4HEQA 1USGA 4ARZB 5EHXA 1JHUA 3VPGA 2FWRA 1LPAB 1P6UA 2ZRNA 3O73A 3OZXA 4JVMA 4ZVPA 3RNLA 3H17A 4FSDA 3RT9A 3CWZA 5KYWB 1X7ZA 4GBGA 4XFJA 3QUBA 4LSGA 5EXTA 5CB4F 4CIBA 3EK2A 4HEHA 4NH4A 5H68A 4MEBA 4URHA 4HEA1 3L0SA 1CR2A 2WVGA 3K6JA 4BBPA 4DPLA 3BCSA 1T1RA 2XT6A 4TLLB 1TTPB 1X1DA 3HDGA 1ULTA 3U7IA 1JVBA 1K3TA 4TXHA 4JAVC 5IBRA 4LPSA 5ENDA 5C4IA 421PA 3FOBA 4MAMA 2CWDA 3WLOA 4H7FA 3H2HA 4R2MA 3ZE0B 5K0BA 1DCFA 4HN4B 3ZGVA 5KNBH 4WKNA 2F00A 2CT8A 5KTTA 1E20A 3CW2A 4CEIA 2PAAA 2X7XA 2XCIA 4U7WA 4OHKA 5F52A 2AN1A 2Y4OA 4KX3A 4KN5A 3ROQA 3UYLA 4AF8A 3LUJA 3TPZA 2A1UB 4CN9A 1HI9A 3KYDA 1K3FA 3OQMA 2WZBA 4HDRA 2C83A 2VJDA 3THXB 5FAXA 3AVWA 4EKDA 2H52A 2V6FA 3M49A 1ND6A 2PZLA 4BZQA 1T13A 1CEEA 3EAFA 3AT1A 5CA1B 2IIQA 4OP1A 4Q4JA 1A8PA 1XQ9A 2ZUDA 5A4JA 2BELA 3EE6A 5LDGA 3DAPA 1KAOA 1U0NA 4C21A 3M4ZA 4NG5A 2LIPA 1AKWA 1RM3A 4BO2A 2PE5A 4C7OA 3TMYA 3DMDA 1JIJA 3PWZA 3AEQB 1PI3A 1PBTA 2I29A 2XYPA 2VPQA 1M9NA 2BGNA 4TN1A 3A1TA 2A6PA 3K9LA 3EMBA 4G6ZA 1HC7A 2JI6A 1UCFA 4CIXA 4QOEA 1DEAA 1D6SA 4D6XA 2FX2A 1CD5A 4XIIA 4F56A 1N6HA 4IDQA 1UWCA 4CETA 5C1IA 4D8XA 1OT5A 1IBCA 3EGXB 4EATA 1JQ5A 1KO1A 3DOIA 4M3NA 2WIKA 4M98A 3LQQA 5G40A 3FFBA 1V95A 1GSAA 3L8GA 2NSYA 1HH4A 2ZRHA 3NKFA 1E9DA 1JP7A 1R3DA 3P7MA 3S8YA 4YJFB 1PVOA 1ISIA 3GROA 5C7IO 3ON5A 3DR3A 3GUZA 1E2QA 1LBSA 5CBKA 1NU6A 2OV6A 3D59A 2C0PA 2Q1TA 5DNAA 1Y48E 2GEKA 1KVUA 3FWKA 4TWBA 4K0KB 1SWVA 1T8YA 2C9ZA 4CTNA 5IZCA 3VFDA 1FFSA 2OD2A 4NYJR 2HZ7A 1WCYA 1JDVA 2O2IA 3PXXA 1D9XA 4ND1A 5BYBA 1QC5A 3V4SA 5I6DA 1VB3A 2P6RA 2QVZX 3T7SA 5KX5F 3NETA 3DOEA 3T7TA 3ZV3A 2JCYA 3Q9NA 4I6JA 2ZTHA 1IZ9A 3GEGA 3M6UA 3QG5A 4BXOB 4P2GA 3F6RA 4IEFB 2FHSA 5JCJD 3DMRA 4P08A 5THXA 3CMMA 1AUQA 5IWCA 2CN1A 1C3VA 1N5OX 4MDYA 1LV7A 2J09A 3W06A 1J90A 4KWIA 1ZIXA 4Q3EA 3MJVA 1QZUA 2A7QA 4ZXPA 4B6OA 2OMEA 9ABPA 4NU5A 5CCEA 2VDUE 4OSEA 1E6CA 2PEYA 1CYEA 3PD0A 3FLMA 3ICPA 6CHYA 1AA9A 1TGVA 3BRWD 2HLDA 5LP6B 1AKEA 1V9CA 4D41A 5DKFA 1VJ5A 2CZCA 1RYBA 2C8LA 1D04A 1JAXA 3KXKA 2GAFA 4UNRA 1YSCA 3X0DA 4KHZA 1FW8A 3OA0A 4JOCA 2PUBA 4U6NA 3Q10A 2IUYA 3K0HA 4U7PB 1HMPA 4K9KA 2Q99A 5EERA 1LV8A 5ENVA 3SK0A 5EMLA 3QU9A 1JXAA 3JQAB 1P6XA 3DTNA 1RFLA 1PLLA 2WUDA 4DHEA 5ALMA 4A91A 4BFCA 3Q7PA 4WI1A 4XOIA 2N42A 3H9QA 3K6SA 2KW5A 3G2OA 5IVKA 4AJIA 1KY3A 5BR1A 1TCVA 1TIBA 3DMYA 3DBIA 3Q11A 5JYBA 2R25B 4UTPA 3I6YA 4AJ2A 1E2NA 2IYFA 4YJFA 1VLMA 1OI7A 4CV2A 4XWWA 1WXXA 2R48A 2WOJA 5B55A 3QY0A 4BN0A 4HZIA 2D3WA 2Z9DA 4LVUA 1PIWA 3QKRB 4C03A 4RK6A 5JXIA 4KREA 3JAKA 1PJSA 2JCGA 4TWIA 2ERXA 3V33A 3RYHA 3MJEA 3NM6B 4US2R 1E4EA 1XLVA 2IP1A 1N8TA 2O8CA 4A1OA 2GT1A 1FRQA 1X1CA 2GI4A 4CMJA 3BN3A 1V6CA 2QRQA 3I1FA 3NYWA 4DMKA 3W1EA 1Z5WA 1YFKA 4Z99A 3IRVA 2VJQA 3ICOA 4G5YA 2RGRA 3V8QA 2B5WA 3WL4A 5KTKA 1YI1A 1E6MA 1L4GA 1QFXA 2W7TA 2EZ4A 1ZD8A 4AMVA 1USVA 7MHTA 3G8CA 1GUAA 4W4TA 5EFOA 4C0KA 3VHXB 5LZ8A 2VQFB 1KDRA 2OC4A 3QFHA 4W63A 4ZCTA 3AF4A 3B70A 3L6CA 4ITVA 3ZWXA 1ADGA 3DBVO 2GPJA 3OZBA 4LF7B 2JW5A 5F2EA 4W1QA 2MSEB 4BLTA 5JD6A 2ZJFA 4R1PA 1KH1A 1C8LA 2O20A 2BL4A 3DEYX 4FYHA 3D8UA 1DO2A 4CIYA 5LM3A 4I50B 2WK1A 4TQ9A 4EFMA 1K68A 3B6IA 2C0CA 4DMLA 4QOHA 2PUEA 5I7HA 5SICE 5JH7B 1G5RA 3LCUA 3EVDA 4XQ9A 2H18A 4BZPA 5AVSA 2LVBA 1HURA 1U8EA 2R85A 2XDAA 3HN2A 1DQSA 2VJMB 4H31A 1LQTA 5JMPA 4KIWA 1TKAA 2C4UA 5T8KC 1HWYA 3GLFE 1ZGGA 4R7ZA 3W8FA 3C3BA 5BURA 2WM9B 2OK8A 2QTVB 3P2MA 3QBJA 5DHRA 3T9CA 2IEIA 2OCBA 1CZRA 3JZMA 2NYUA 4JFAA 4Q00A 1PD1A 5BXYA 1XJCA 3B1YA 1KDOA 2VJNA 2APJA 3D8RA 2HQOA 2VHVA 3IKLA 4K9SA 4BVGA 1LY1A 3CVXA 1KR2A 5CFLA 5C52B 2EW1A 4MITA 4RULA 4AQ7A <