1K5DA

Crystal structure of ran-gppnhp-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling activator
molecule keywords GTP-binding nuclear protein RAN
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5dA00
1PVOA 4TMXA 5G53C 2JJ1A 2RGNC 4KLZA 3TAHA 5IK2A 3U4QB 2PMDA 1NBMA 5EE5B 1P4SA 3LBHA 3QENA 4BFUA 4F91B 4OKSA 2QAGA 3NH6A 4Q01A 1DADA 4TMWA 2XJ4A 3ZVLA 4EPRA 1EFTA 2ZSFA 5AJWA 4IHQA 4MITA 5ANRB 3Q8XB 4OK3A 2R6AA 4ZDWA 3WHLA 3MAAC 4JS0A 3QKUA 4HSEA 2FX3A 4WZAE 4P3YA 1Z29A 2PZGA 4S2EA 2ZVPX 4DDWA 3H1TA 2Q9AA 1YZUA 4O3MA 3K9HA 4B33A 1IN5A 1A2KC 1AGRA 2GAOA 4JKIA 1KMHA 1TQ2A 1RC8A 5HKKD 3SJZA 1AKEA 3GJ4A 2ZJ8A 4DZZA 3GD7A 3SNHA 1W4BA 2O8BA 3JZMA 3PITA 1IM2A 4NYMR 4TL8A 4YMSA 4BZPA 2PX3A 4Q4LA 4MGIR 3NKVA 1N6HA 3KKQA 4FWTA 1CRPA 1KK3A 4MA4A 2G88A 2N1BA 1IY1A 1SVMA 2YWEA 4X8OA 3UK6A 1W44A 2Q3HA 4WOPA 4KLNA 3GQBA 2XGJA 1GNPA 1J7KA 2EFDB 1N5LA 4B2IA 1KDOA 2YYZA 4NYMQ 5EE1A 3SBEA 1E9FA 1KNXA 1KDTA 1TQ6A 2AHOA 2V6IA 4JBWA 2E1RA 1RE0A 4BUJA 4IXMA 3SYLA 2BVNA 3NH9A 4LHYA 4MKGA 2WJVA 4MYHA 2HV8A 2AXNA 1TF5A 1XX6A 2CL0X 3QF4B 1R2QA 3O8DA 2VHTA 4JJKA 4KV9A 3ZDQA 5AK0A 5BN3A 4MGYR 3CIOA 4ZV4A 3A36A 4LV5B 1OIWA 2F9MA 1E0KA 4V0OA 2GK7A 2C95A 2XNDD 2GJ8A 2PT7A 5B58C 2RCNA 4L8GA 3N70A 1JEDA 3LBNA 2D2FA 4PPGA 1TF7A 4C7OA 2W6JA 4ACBA 2ZIAA 4YXWA 421PA 4CIDA 5FUVA 4Q1EA 1P2SA 1YR9A 1QG4A 3L82B 1KJZA 3QI2A 1JJ7A 2AR7A 3DMDA 2QGNA 4D26A 4IDOA 1T5IA 1VCMA 4LV8B 4B3GA 4OHXA 5A4JA 3B9QA 3SJBA 2O8BB 1UKVY 3I32A 4B3BA 3G82C 4LJ9A 2WTUA 4Q4JA 2D62A 3WMGA 4QBGB 4PSKA 1CR0A 3TW4A 1KDPA 5KHOC 4PC2A 1SQ5A 3W34A 3B85A 2A3RA 3VR6A 3U5ZB 1Q20A 1UPTA 3NDBB 1XCGB 4IRUB 4NCKA 1KO1A 4AG6A 4DWJA 1ANKA 2C03A 5FBQB 3K1JA 3P4YA 4GOJA 1E9SA 4GBMA 1FNNA 1KY2A 2IWHA 3TH5A 5FBRB 4QM7A 2FSFA 4RZ2A 2BIFA 3MGCA 1G4UR 2GK6A 3GCGA 3R9IA 3RRMA 4CDGA 5KPJA 5K8IA 1Z0KA 2QORA 2Y8EA 5EXXA 4BWYA 3EPJA 3ZVMA 1E2QA 3N5CA 4LHZA 1OJLA 1VYTA 2FFHA 1SVIA 1ZUHA 4EAQA 2QPAA 4M53A 4YMUA 3EPLA 1BMFA 4LJ6A 2IS4A 2NO7A 1G8HA 2ZR9A 3WRXC 3D3QA 2P67A 4TYYA 2WJIA 4O0MA 1NVWQ 2PLRA 1CJKC 1E0SA 3ZH9B 3GFOA 2ZRMA 3LXRA 4PAQA 1LVGA 4CW7A 1RYFA 2WJGA 4X8LA 1Q57A 1XXHE 1ZJ6A 1XXHA 2IL1A 1E79A 4ZCIA 3U6KA 4QBIA 4Z1MA 4TLEA 2MSEB 1F2TA 4JLJA 3C15C 1IXRC 2QMUA 5H1YA 5DHAA 1N6IA 1L4YA 2CVHA 2QA5A 1W5TA 2XXAB 1XEXB 1IN6A 2RGEA 1AZTA 4D25A 2DB3A 4Q1CA 2GTPA 4DLVA 4TZ0A 5EUMA 3Q5EA 3QEJA 1LY1A 1L8QA 4HZIA 3ADCA 1VHTA 2GZHA 2YZ2A 4CEJB 1U99A 3WBKA 2J41A 2ZSAA 4ZIRB 4JYBA 2CCGA 3L0SA 1NIJA 3CBQA 2ODBA 5D3MA 4OHWA 5KSPA 2H57A 4YQFA 3UWKA 1OSNA 2ONKA 2OCAA 1VHLA 5JI3E 3B7GA 4MDEA 3KQUA 3ONWA 3W3AA 4HLUC 5AUQA 1RFLA 3TAUA 3W9YA 4DT1A 2GVZC 1X8KA 1N5IA 2RGNA 1E2HA 2ZAMA 4YC7A 1P60A 4R7ZA 5G41A 3UG6A 3ZVRA 3FKSD 2KE5A 5EJEA 4NL4H 4C0KA 4PO9A 3IEUA 1YQTA 3R7WA 5HZKA 3RLFA 2W6IA 4LBVA 4DLZA 5BYJA 2OEPA 1G17A 3Q9LA 4FXPA 4RCZA 3THYB 4TYWA 1ZC4A 4KHZA 2IX3A 2Q0HA 2PJZA 2VTKA 2GZAA 3VR4A 4DSUA 4M2LA 4LJAA 3IBGA 3FMFA 4HDQB 3K0AB 5DNYB 4BLPA 1FTNA 3SOPA 4OJKA 1SHKA 3FHTA 2UVQA 2CK3D 1KKLA 5E95A 2ORVA 4KXFB 2XAUA 1FFHA 1KSGA 4JYCA 1NVVQ 2QAJA 2J9RA 2BV3A 2QTHA 1F3OA 1EFCA 1U81A 4QM6A 3CNLA 1XJCA 2QTFA 3QY0A 4S35A 3VKGA 4RKEA 2QMHA 3EZ7A 4V0KA 5E3HA 3ETLA 4Q4AA 3TIFA 3HP1A 1W49A 1UBGA 2BBTA 1XEWX 3A1VA 1E2JA 4LJ4A 4OQFA 2HT6A 4XTCS 4LX0A 1WCV1 3EAQA 1TEXA 2C99A 4Q21A 4BFWA 5CB6A 3GLFA 2VP9A 2WAXA 2IWRA 3KTAA 1WP9A 2H17A 2QTVB 3A1TA 4IOLA 3BFVA 4A6PA 1R10A 3HU1A 4XIGS 4DIEA 1N5JA 2DHRA 2ZRKA 2YWGA 5KYKA 2ZJBA 1IAQA 3ND8A 4A82A 4U7DA 2JLRA 1IBRA 1S1MA 2IXEA 1FMLA 1TTTA 5JSZB 2X1VA 4R9UC 3UIEA 3KXLA 2VYFA 1VECA 5FH9A 1MABB 4EFLA 3MSXA 3CZPA 5GJBA 1ESMA 1U8AA 3LAWA 1R8QA 2IYLD 1Z0AA 2MMCA 5JEDA 3KJIA 1YVDA 2VQSA 4TT3A 2ZRNA 2XZPA 3UMSA 1MO6A 2D4HA 3AH8A 4MYCA 3HU2A 4C2TA 3VHLB 5J4LA 1YU9A 2O8EA 1DO0A 3VU9B 2C77A 3SR0A 2OUKA 3PUYA 3JVUA 2IF0A 3CLVA 4KCGA 4CT4B 4G5RA 4F38A 4D0NA 1H8HD 1T91A 2OG2A 4PC7A 1ESNA 5FR2A 1II8A 2G1JA 1MH1A 1E69A 4PQFA 4ZDIA 5DYGA 2C78A 4M22A 1VG9B 3K53A 1FNMA 4RD0A 4C0JA 2IBMA 4EFMA 2GXAA 5LD2B 1GUAA 1XD2A 3B1WA 2PCJA 2ATVA 2ONJA 2CLDX 4EJSA 5LB4A 4X8MA 2XJ9A 3RS3A 4UXIA 4X8HA 1K5DA 2ZE7A 4JVSB 2ZR7A 3E5HA 2JJ8A 3BB1A 4RCYA 2ZE6A 1NKSA 2RKOA 2A9KA 3IO5A 3SJAA 4FIDA 1Z6YA 2JATA 4NP6A 2VP5A 1DAMA 4WXPA 1E0AA 3DM5A 1T5LA 5AUOB 1HY3A 1OKKD 1KZGB 1N6NA 5FOSA 3OFNA 1N0VC 2D3WA 2WBLC 2OCBA 1AGPA 2HLDA 3WYGA 1UFQA 3FB4A 1BMFD 4HAVA 2Q9CA 3C5HA 2OZEA 3IPYA 2DBYA 2OHFA 3QKSB 4XVRA 4FI3C 1QHXA 3ZIAA 2ERYA 3RDPA 3BBPA 2K5UA 2QPOA 1KTVA 4C0SA 2C9CA 5KSOA 1AIPA 2BHRA 1NL3A 2IYSA 3I1FA 4QOSA 2WKRA 3IO3A 2GCPA 1CBUA 3AVQA 3QVUA 3ASZA 1KI1A 2P5TB 1DEKA 2D7CA 2RH5A 4Z1MD 2BEKA 1G18A 1ZAKA 2ZUCA 5IRCD 5AJXA 1Z83A 1G8PA 1OE0A 3LW7A 3HDTA 4XD7A 4XVQA 4HB4A 3CNOA 1A7JA 4TMZA 5JWOA 3FMIA 2VLIA 3BH0A 1Q3TA 2CMKA 1CTQA 1XFAA 2IXGA 2VH5R 4GOXA 1P75A 2PCLA 8OHMA 3RYTC 3HWSA 4LPSA 4NMMA 3T15A 5CITA 1GNQA 4DRZA 5L3QA 1LS1A 3M0EA 3MRSA 5JHGB 3M1IA 5JWRA 4A8JC 2IS1A 1ZBDA 4ASUD 3AP1A 3AF0A 2QE7D 4I81A 4R71A 3KFXA 3KZ1E 4MKHA 2UZIR 2FPMA 4LOAA 1LV7A 4Q9JA 4Q18A 4TTRA 1ZU5A 3CPEA 1MO5A 2AFIE 4QL3A 4Q1DA 4OHZA 5DI3B 5G3YA 4TQ9A 5FTMA 2D74A 5JHHB 2ZSBA 2J45A 3CH5A 3CWQA 3ZVNA 1QVRA 3GJ0A 2JASA 2Z6VA 4M4SA 3RNLA 1EX7A 4MRRA 3EA0A 2JLYA 2DR3A 3PUXA 5HE9A 2ZPTX 3FHCB 4TL6A 4DXAA 3SDZA 3MJHA 2GBLC 5JS7A 1IJEA 1WBBA 2IYUA 2QUZA 4O2RA 1TX4B 4M9ZA 3CZQA 4L4UA 3V00A 4GSYA 2QQ0A 1T3SA 5BQ5A 1XEXA 2NG1A 3SU8A 3IQXA 4AK9A 1OXTA 3THOA 2AL7A 4F4CA 1Q1EA 3LFUA 3THXB 5BW8A 1Q3HA 2FF7A 3TLXA 2OFWA 2WPDA 2BM1A 2OBNA 2X2EA 4RY2A 1ZD8A 1DAEA 1M7BA 1X8JA 2GJ9A 4TYQA 1HT2E 1DARA 1R0YA 4RD6A 5DGXA 3T34A 1KKMA 1J90A 2WV9A 1FOEB 1J99A 2G0TA 1GIAA 4QG7A 4LK2A 3T5DA 2R62A 2OILA 4DSTA 1UEIA 1HQCA 4PZYA 1OYYA 2R6FA 3P27A 3V4RA 3NVAA 2IUSA 1KI4A 1BIFA 5EP1A 1N6KA 4PTLA 4W9MC 3DL0A 4B75A 3PUZA 2IYRA 4I1UA 1II9A 2W0SA 2XOKA 1JAIA 4TLAA 3SN6A 2CLCX 4M1TA 5DIFA 2YWFA 5B30A 5FR1A 4MKFA 1KO8A 2ZXUA 1CR1A 4IFEA 1SVKA 1QDEA 4G3XA 4IVPA 4RD2A 2XTNA 3VKWA 1IN7A 2A5YB 2J0UB 2QSZA 3IEVA 2BC9A 1ZNXA 2W6JD 4ZCMA 3AKYA 4CVNA 4NCNA 4EJSC 2GJSA 2WWWA 4OQMA 2VO1A 2WVJA 1KSFX 1FUKA 5G3ZA 3ECCA 4DDTA 1OFUX 4JT4A 3GEIA 3D8BA 4Q4JB 3TW8B 3GP8A 3ADDA 1G5RA 3CX8A 5LDDC 1P61B 2AN9A 2JJ1D 1ETUA 3T1QA 3TUJC 5BXQC 4DDUA 1QHHA 1XEFA 3PENA 3TNFA 2NQ2C 3W5JA 2EYQA 4LPKA 3B8HA 2HUPA 3R7WB 4ERNA 5FI1B 3I73A 1R5OA 2PMKA 1HE1C 2YC2C 3EC2A 2IUUA 3FFBA 2GVDC 3U7GA 3OEHD 4ESHA 5FPHA 2AK3A 2ZU0C 4UNNA 4EQ6B 1Z0FA 3IDQA 4JLBA 4OHYA 3GEEA 5FUXA 4LHVA 4DCUA 1IXSB 2CDNA 3NBYC 3P20A 5TMPA 3B1ZA 1XZQA 2OCPA 4H1VA 4PSAA 1NVXQ 1AJEA 3X1XA 1S3GA 2V7QA 1G291 3RVBA 1HURA 2QGZA 1E2GA 1RRGA 4F4JA 5F2EA 1TQ4A 2ZETA 4M9SA 2WIBA 1X6VA 1Z47A 1W36B 4EPXA 2ZRLA 3NBFA 2C96A 2Z4RA 2HYIC 2WPDD 1LFDB 2IYZA 2IW3A 3AVXA 4ZIRA 1MR3F 1UDWA 1XMSA 4HLDA 2GNOA 4O25A 4LC1A 4LRWA 1JALA 1ZM3A 3EZFA 1PLLA 2F43B 3QQ5A 3ASYA 1KDRA 5CIWA 5FTJA 2J7KA 1WE2A 4ZCLA 2QMOA 2YOFA 2ORWA 3BFKA 4Q9HA 2WWYA 3BFXA 1D2NA 4OK6A 4HUQB 2FZLA 4MGKR 1F60A 1DE0A 1TADA 1GKUB 3LQQA 1KAOA 1Z6AA 2LKCA 1NY6A 3V4FA 5B2ZA 1UF9A 3J81k 2IXFA 5B64A 4RZXA 4U02A 1G9XA 1OKKA 1OH7A 1M74A 3UG7A 4DBLC 2BCGY 2ZSDA 3GJ5A 4JL6A 4LSGA 3WP0A 4EPVA 2FDCA 1Z0DA 4EJSB 1NN5A 2ZITA 1XB2A 1DG3A 3SS8A 4C0HA 3MWKA 3T1OA 3PUWA 1W0KA 4OI4A 3CWZA 3FPAA 3S1AB 3EIHA 1SULA 3VNVA 1FL9A 2WKQA 2NMVA 1G8YA 3CRMA 3GJ7A 3VMFA 4F4IA 1H65A 3FKSA 1MOZA 1OF1A 2ZU6A 4DVGA 3T06B 3G5UA 5C46F 4ZI3A 2NPFA 4C4PA 3N2EA 2UZ3A 1JBKA 4D4MA 1E2LA 2IYQA 1IOZA 3C5CA 4URZR 3K8YA 4LWZA 1JAHA 1Y3AA 2GXQA 1ZYUA 5E7MA 4N3NA 2N42A 4KFSA 1G7RA 4KFUA 1ELOA 1OFHA 3RHFA 4BZXA 1JI0A 4BECA 3PEUA 3I5XA 2CEAA 4LZZA 3IQWA 4C2UA 1OIXA 4YXWD 3RWOA 2ZAOA 2CNWD 3CO5A 2GZDA 4PC1A 4GMDA 3EWSA 4A0RA 1N6PA 3JZAA 2NZ8A 4BFZA 3A1SA 1TQDA 3CRRA 1OXVA 4BLTA 1A2BA 3QKRA 5D3QA 1CEEA 2R8RA 1NNEA 5KDOA 1KSHA 4OQXA 1XNJA 4WW0A 3WMEA 1JR3E 1DAFA 1RRFA 2W2XA 3HR8A 2A5JA 4UXHA 1RPZA 1AS0A 4QHYA 4XD7D 4DDVA 2JIZA 3BS4A 3MCAA 4MRNA 3PIRA 3OEEA 2AK2A 1XTJA 3AUXA 4BFTA 4Q7JB 3BB4A 4E09A 1N6OA 2QBYB 1CU1A 1E96A 1NI3A 1W36C 3HPRA 2DFTA 2PH1A 2QZ4A 5EZ5A 3FWYA 3TK1A 4MGZR 1R4AA 2ZYTX 4JL8A 1NKTA 5CDFE 2AKYA 2FGKA 3QPVA 5CM8B 5FPYA 3BD9A 4LV6A 1AKYA 4CEHA 3NEJA 3H0KA 5CYPA 2G1KA 1US8A 4PFSA 4JLVA 4QGHA 4QJ3A 2WAYA 4L16A 3K0AA 2P3SA 4RKFA 4A2PA 3EPHA 1S9HA 3WRYC 1QHSA 2EYUA 1Z63A 5FOXA 4AD8A 3Q85A 4FMDF 4QGAA 2XX3A 2XB2A 2VF7A 2AFHE 1P2VA 4DT1B 1XP8A 1LNZA 3MLEA 4ILEA 2QNRA 4FCWA 1TF2A 3NC0C 2VP0A 1E2EA 2YC4C 3DKPA 3P32A 1MRNA 4NZYA 2VP2A 1R0WA 1Q0UA 2ZQ5A 1GSIA 4EPYA 2RHMA 5JBQA 1I4LD 2GEDA 1XEWY 4AY2A 1SZPA 4NCHA 5F98A 2OSBA 3V9PA 1G7SA 2F7SA 2QL6A 1BO6A 2WSSD 4JVLA 4QNMA 3TUIC 2FOLA 4NYJR 1P9RA 4Q9IA 5E7IA 1ZM9A 2IYTA 3B6EA 5KO2A 2GCOA 1SXJE 1M7HA 2FSGA 221PA 1LTQA 4NPHA 4US0R 1Q1ZA 4JVNA 2A5FA 1EFUA 2HT1A 3F0TA 1I2DA 1U90A 3BORA 4A6XA 2QBYA 1GRNA 2V9PA 1XTSA 1ZIPA 3CRW1 4CZ2A 2AWOA 2ZRIA 2VL7A 1WF3A 4MUAA 2DY1A 3BRWD 4A0GA 4ASUA 2ATXA 4AYXA 1BYIA 2FFAA 4HAZA 4UNPA 3SQXA 4PHHA 2G83A 3QPUA 1YHNA 4FN5A 1KI3A 1G3QA 4HAXA 3ZJYA 4LHXA 2XOKD 1XF9A 2NO6A 2J87A 2VEDA 2CCKA 4AKGA 1MV5A 4WA7A 2J1LA 1T4GA 2DCUA 2DWPA 2IEYA 2XNDA 2GCNA 1F2UA 1JNYA 2GEVA 3T1VA 2FNAA 3MG9A 5EXPA 4ARZB 4B3FX 2V7QD 4M1KA 4PO1A 4NH0A 621PA 1KK2A 4DLXA 1EFRA 2PBRA 5JEEA 2CCJA 2O8CB 3B78A 3C4JA 2QY9A 5J40A 1A5TA 1AN0A 1M34E 4ZKEA 4EKDA 5K8LA 2XXAA 1U94A 2LCFA 4XWKA 1EGAA 2WJJA 2GETA 1YJ5A 2DFKB 3VR3A 2HCJB 3L2OB 4CEIB 4KODA 3RABA 2ZRGA 3RRNA 4PQRA 4A8JB 1NVVR 1Z0JA 4UNSA 3CF2A 5F9HA 1QHNA 2ZJZA 3DOEA 2DPXA 2B8TA 3K9GA 2JDIA 5JJKA 3GLIB 1FW6A 3I3SR 5JRZA 2FSHA 2REXB 1M1YE 2CJWB 3AP2A 1VCNA 4LYAA 3RS4A 4AYWA 4XVUA 3FE2A 3HJNA 4U5XA 1IY2A 4EFNA 2OE2A 4RSGA 4BEJA 2OLJA 4NYIQ 1C4OA 5GADl 4I1VA 3KFVA 5TVKA 1E1QD 1JPNA 4OI1A 3EX7C 3GJ8A 3TSWA 1AS2A 2Q3MA 5L8VA 5SZIA 2Q6TA 2GRJA 2XNSA 1KZ7B 3BAFA 5A0FA 3GLFE 3TVTA 2AD5A 4BQSA 2LKDA 2CLSA 4DCSA 1E1RD 1IN8A 2Z43A 4OBEA 3IIMA 3HPQA 4PR0A 1W46A 2H18A 2TMKA 1FP6A 3EZ2A 1VG8A 1RYHA 2CJWA 3HU3A 3P4XA 3VX3A 3IIJA 3BH6A 1T0JB 5UKDA 5B57C 3B9PA 1NSTA 2JEOA 5J4YA 2A2ZA 2E87A 4LC0A 1QHGA 521PA 3SEAA 4JL5A 4HUQA 4TWZA 3MWYW 1R6BX 3WMFA 2XSZA 2J7PD 1OH5A 3MMPA 2J59A 3AVVA 4W5WA 1LB1B 1TUIA 3VX4A 1G7CA 2QENA 3BC1A 3MWLA 3K70C 2RHDA 1VYUA 2RGGA 3IHLA 1E2MA 3GJXC 1GDDA 1VPLA 3LO5A 2HXSA 4URXR 3EZ9A 4KBGA 3AM1A 1QRAA 2JLVA 1DAKA 5LD2C 2QP9X 3C41J 5AWFC 3H84A 3OF5A 4F93B 1XPOA 3OAAA 3Q5DA 2DWOA 2GF9A 1RKBA 1J70A 3DOFA 1JEEA 1G19A 2GJAA 3AP3A 1EK0A 3IKJA 1OHHD 3QF4A 2P6NA 3I8SA 4HAUA 2AXPA 2EFCB 4TYPA 4BASA 5KSZA 2Q9BA 2IA5A 1XRJA 3WNDA 1S1CA 3AVUA 4D80A 1GL9B 1E4YA 3ZD6A 2ZRHA 2HJGA 1P6XA 3NHAA 1SKQA 1MO4A 4LHWA 3ADKA 4BFXA 4TMVA 4QKQA 4GOKA 4KVGA 1P73A 4HDOB 4WZ6A 3U44A 2DFLA 2W6ID 4I1SA 1G41A 1S4QA 4UNQA 1GKIA 5H8WA 2A5GA 3RS2A 2C2HA 4P4SB 3SQWA 4D82A 5FPSA 4PC6A 4DLSA 3UANA 3WYAA 3BOSA 3I4LA 3LVRE 5CJPA 1A82A 2JAQA 4NE2A 4QXAA 5TARA 4AC9A 3ADBA 1KK0A 4V0MA 4LJYA 1AS3A 2B92A 3PG5A 1JXOA 1XD8A 2VHCA 3ZZ0A 1RVDA 3BERA 1UAAA 3FMPB 2GWHA 5J47A 1U0HC 2J0SA 1M6NA 2BBOA 1B0UA 2PEYA 1FUUA 1UKZA 1W0JA 3K0FA 5FOUA 3FHOA 3KKNA 2KSQA 4B74A 1XD9A 2FGJA 4Q02A 2RMKA 1ZW6A 2Q3FA 1MABA 2ZJYA 4QBFA 1ZM4A 1DELA 1QF9A 4JJZA 4ZDKA 4CYMA 2GJKA 1ZRHA 1BYUA 2A7QA 4B44A 1N0UA 3LY5A 5IK2D 1CULC 5JCZA 3IILA 3BH7A 5KNCA 1R5BA 2FN4A 5A5GA 3EASA 1DAGA 3VTKA 3BK7A 3R8CA 1YRBA 3CPJB 3AVWA 3TMKA 1N2CE 3CKLA 3NBZC 2QT0A 3DHWC 4LY6A 1K6MA 4DCNA 4XSHA 3RWMB 2J0QA 1NLZA 1COWD 4QFMA 4KSCA 4BLQA 3FKQA 3TUZC 2GHIA 1Z22A 3KUCA 3LX8A 4TL9A 5JECA 4Q5IA 1ZCAA 2CNWA 4I1OA 5J4KA 1G3MA 2I4IA 3AKEA 2VRWA 3GLHE 3QOFA 3ZYCA 2W0MA 1AK2A 1EFRD 3D31A 3CF6R 3QKRB 3ZQ6A 3W6OA 5FL3A 2A30A 1E94E 3DMNA 4YMWA 4HZUA 4MYUA 5CK5A 1JJVA 4DLRA 4MKIA 4A0HA 4AKHA 4CGZA 3GLGB 4KVAA 5J5CA 1NBMD 4IOKA 2JLQA 4AI6A 5C4MA 1CJTC 3LQRA 1KI8A 3MD0A 1P7CA 3A8TA 1G5PA 3CRQA 1OH6A 2GXUA 3B5JA 1P3JA 2GEUA 3I61A 1OW3B 3SI7A 1IN4A 2BMFA 4PPFA 5JI2E 1GRQA 1OIVA 3CONA 1OXSC 1YR7A 3R9WA 2D2EA 1U8ZA 3K0CC 4TLBA 1LW7A 2R6CA 2HJVA 4CRWB 4JMPA 2QSYA 3EXAA 2PEZA 4B43A 3MUFA 3B1XA 2W2TA 4OK5A 2O8DA 1AQUA 1VKJA 2FPKA 1P5ZB 2O8FA 1T8UA 1XPUA 3OE7D 4LBWA 5CYOA 2ZI5A 4KI0A 3TR0A 1FTSA 4POAA 4MRSA 4NHOA 3DPUA 1NIPA 2C04A 3SBDA 1Z6XA 2HLDD 1G1MA 1SHZA 1YZKA 2ZJOA 1N3BA 1ZNYA 1NF3A 1DG1G 2CL7X 4CEJA 4N1AA 4HLCA 3K0EA 2V1UA 1DAHA 4PAOA 1X3SA 1T3HA 2B7CA 4L5BA 4A0FA 1VG1A 2IF2A 3TSZA 1Z07A 4PANA 2EW1A 4WBSA 5DYIA 1F2UB 1JQJC 3LA6A 1KJYA 2JCSA 2ERXA 1FPMA 1P72A 3GMTA 3CRVA 3WBJA 4QBHA 2QPTA 2OAQ1 1NLYA 2ZRFA 1OFTA 3GJ3A 3QF7A 1Z06A 5DN6A 3A4NA 1R0ZA 5EP2A 3N2IA 2FMXA 2WWFA 3TKLA 1WXQA 4RJLA 1NLFA 2GCOB 2ODWA 4JLPA 4O2LA 5HZHA 3U60B 2MMGA 5H70A 1XCPA 3GEHA 1NBME 3PVSA 5C2JB 5EXSA 1Z3IX 4FCVA 2IYVA 4QGFA 5CJ2A 3TQFA 5M04A 3O8CA 2JLUA 1U8YA 1ZM7A 1FQKA 2WICA 4TT3D 4DSOA 3AB3A 4V02A 4LGMA 1PZNA 3IBYA 1EWRA 2FWRA 3B1VA 5DISB 2QRZA 2VSXA 4JLDA 2BKEA 1XPRA 2GKSA 3WXMA 2NO1A 1KMHB 2VIIA 4UKDA 2H5EA 1R5NA 1KMQA 1E9BA 2L0XA 2FA9A 1KI6A 3LW8A 2OXRA 2NPIA 4DIDA 2V6JA 4IDHA 4GNKA 4PPQA 3QXCA 3Q7QA 3IHWA 1KY3A 2IYYA 2HF8A 2PX0A 4B3DA 1NSFA 2C98A 2ZRBA 2QU8A 2VSOA 4GI7A 1I2MA 1CR4A 3KQNA 1I4DD 3RAPR 4L9WA 3QXJA 2YJTD 3GLIE 3I62A 3IIKA 4IJMA 2ZR0A 1DTSA 5BN5A 2HF9A 2XTMA 3U4QA 3M6AA 2DWQA 4QHSA 3F5FA 2AWNA 5CB8A 3WP1B 4MYTA 2PL3A 2ZANA 3ICEA 3LDAA 4BGDA 2P6UA 1Q1QA 1E79D 4DKXA 2HYDA 3RS0A 4FW9A 2VP6A 4Q66C 4K46A 4M8NE 5E4FA 1GM5A 5JZVA 4R2HA 3UPUA 3FGNA 5CK4A 3PEVA 2O52A 4M9XA 3D6TB 1YZGA 2H8KA 3U7EB 4HATA 4E22A 5L3RA 2FFBA 1YZQA 4KJZA 1CIPA 1ZCBA 4EPWA 1F6BA 1VYVA 3Q7PA 4Q7MB 4B47A 1KO4A 2QM7A 2HDNB 1B23P 3GFPA 4CT5A 4TYNA 3OEED 1XJ0A 3WHKA 3H2YA 1KO7A 1E98A 5L3VA 4OL0A 2V8OA 1IXZA 2E9SA 4W7SA 4GL2A 4ABYA 4Q7LA 5GJVC 2GILA 4B73A 1MO3A 3DO6A 1QHHB 4YLGA 3DKVA 2JLXA 4C30A 4HYYA 1D9ZA 2KB0A 4B71A 1SVLA 2CHQA 2X2FA 4Z54A 1PUJA 2BWJA 3QNUA 1G4AE 4TL7A 3GLIA 4A4DA 1G21E 2ZRDA 3NBXX 5FOVA 4A92A 721PA 1W7AA 3H86A 3REFA 4B2LA 4BEBA 3AGPA 3AEZA 5KPDA 3PXGA 1CS4C 3VR1A 1XJQA 4R2IA 1NG9A 1H8EA 5IT5A 3EIEA 2GDJA 2XB4A 5KDLA 1US8B 4JLMA 1SXJB 3L0PA 1CP2A 3SFZA 1WMSA 2WMOB 3AGQA 3A58B 3TJZA 3DDCA 2W2VA 1D2EA 4LJ7A 3K70D 4A2WA 1AZSC 4UJ3A 1GL7A 1SGWA 2VHJA 3ZZTA 4EUNA 1KOFA 2XZLA 2NOAA 3BGWA 4HZUB 121PA 4KSBA 4NCIA 1S3SA 1W2GA 3CR7A 2C8VA 1IY0A 2REBA 2JA1A 3O8RA 1G16A 2RGDA 4KYUA 4XWAA 4DUGA 4XWOA 2GA8A 1HT1E 3GFTA 5J4VA 5FOWA 3LNCA 4DHEA 4MDFA 1Q22A 2DYKA 4FD2A 1FMJA 1E32A 4E07A 3K9NA 4Q48A 4QNRA 1XWIA 2UKDA 3R20A 4PHFA 4XSGA 3SE0A 1TU3A 4D4KA 2IHBA 2J0UA 1Z0IA 2ZYUX 1ZU4A 4AIIA 2VHQA 5FTLA 5HR5A 2ZRJA 3F8TA 3QXSA 1E0JA 1OFIA 2RGCA 4LBYA 4QC2A 1NMXA 5SZJA 4M1WA 3SFVA 1XTKA 1NMZA 1P2TA 3L0OA 2O8CA 4LYHA 2EU8A 3MJRA 4F7WA 4IDQA 1TNDA 4J0QA 3OIYA 4IKEA 5EUQB 1PUIA 3KJGA 1TPZA 1YR6A 5KOYA 2BBWA 3P1JA 1VCIA 1T8TA 3CX6A 1XTRA 4JT2A 4OYHA 3I5YA 3THWB 5LPNA 4HAWA 1OYWA 2G6BA 1JQLB 5FBWB 3LX5A 3AF3A 4LI0A 4N0DA 1TAGA 2ZEJA 4PSVA 5H68A 4DC9A 5KSYA 3VR5A 3SYKA 4PZLA 3NTUA 3W5IA 2RGBA 1NY5A 1XTQA 2X8AA 5FTKA 1Q44A 1II0A 3LXXA 4FWIB 1WB9A 4EQ6A 1E9RA 4DUGD 1E2KA 1AA9A 2FJUA 2QQEA 2KJQA 1X8LA 5SZHB 2R6DA 4U00A 3THYA 3ZZUA 1HEIA 2BMJA 2QG6A 4FINA 1ZD9A 4ZKDA 1SVWA 1TU4A 1J8MF 1WQ1R 4NBSA 4WIAA 2QT1A 2ZJ2A 4DEYA 5ELXA 1JR3D 4DJTA 3KX2A 5GVSA 1VCOA 2R2AA 2XEXA 5JJLA 2AD1A 5FFMA 3VAAA 4C0AC 2IYWA 4EIWA 3RC8A 1H8HA 4Q9KA 1M7GA 4B3XA 1R7RA 3I8XA 5JWHA 1XDBA 5FOTA 3PR1A 2ZSEA 4HI0E 1E6CA 1U9IA 3GLHA 4TSFD 2XZOA 4B6EA 4DCVA 4YDHB 4AKIA 5DI3A 2F3RA 4ZO4A 4TLCA 2I1QA 4C7OB 4G1UC 3QUSA 4B6FA 3PEWA 1OXUA 3LVQE 5HTKA 1X86B 4N0EA 5EP3A 1BOFA 1PJRA 4JSTA 4WXRA 4F92B 1W47A 5FBVB 4B32A 2BM0A 5L3SB 3LLUA 1AM4D 5SZKB 3W90A 3A1UA 3QG1A 4FMCB 4M1MA 4Q4HA 3GLFB 4QJ4A 2V3CC 4PAMA 5HCIA 5IHPA 2P5SA 2BMDA 1E9AA 5DHFA 5TB5A 1RJ9B 4JLNA 4Q4HB 2P0EA 1D9XA 1KAGA 1EG7A 2W58A 4HDCA 3UXMA 4GT1A 1G5TA 2HXYA 2KBFA 5K8UA 3EIQA 2IS2A 2WJHA 2QE7A 2WWIA 1M2OB 4V0NA 2JIZD 4AWXA 1W48A 3ZS9A 1GTVA 2Z83A 2ZRCA 4QHTA 1SVOA 4WZBE 1OV4A 1G6HA 2EFGA 2O0HA 4URUR 4ESVA 2V1XA 5G40A 1SKYB 5EE3A 4C3ZA 4YMTA 4II7A 2EFEB 1GFIA 2IHYA 1ZUIA 2A78A 1P9NA 1HUQA 1HYQA 3AVPA 3UMFA 1XD2B 2OLKA 3OIVA 2QI9C 4DLUA 2FEMA 2YHSA 3T1TA 3OE7A 2NO9A 1T0HB 4LUCA 3THXA 4IXNA 4ZI2A 5DE3A 3RANA 4V0ME 1JXMA 1KJWA 2X77A 1S9DA 2WSMA 4AURA 3KQKA 1OHHA 1ZVQA 2CBZA 4G5QA 4Q1FA 2ZRPA 4A9AA 2FSIA 4Q4AB 1E99A 2H92A 5HCNA 4NKRA 3SJCA 1S0UA 1QHIA 2RGXA 4W5HA 1X1RA 3C16C 1NN0A 3BIFA 2WMNB 5DO9A 5JRJA 3NG1A 2WHXA 1GVNB 3HYTA 3AF2A 4MH0R 2F1HA 4QRHA 3VR2A 3QKTA 1LF0A 1PLKA 3TQCA 1Z8FA 3SZRA 2R6GA 3QIAA 1Z2CA 5DSZA 2P65A 2J0VA 3OIUA 1OPXA 3I72A 4UXJA 2OXCA 5DN6D 1II8B 1DVRA 2OAP1 4MQBA 3PQCA 3DZ8A 4B3CA 5EZ6B 1GRRA 2ZROA 2CHGA 1UJ2A 4I99A 1S8FA 4CEIA 4US1R 4DLWA 2PJRA 4BPBA 2FG5A 4PPNA 3MFYA 3MWJA 3U61B 3AV0B 4JVMA 2F43A 4MRVA 3PEYA 1W0KD 1KHTA 5KTYA 1N6LA 3ZLJA 4PHGA 5DH9A 1YE8A 3KQLA 2AKAB 1E2DA 1XU4A 2FE4A 4HB3A 1W4RA 3CX7A 1E2IA 4KO8A 4RD3A 1OB5A 3K70B 4Q03A 4HAYA 3RRYA 2G77B 2OBMA 3DVLA 1I4TD 3CW2A 3BJIC 2Q21A 3THWA 1UKYA 3A4MA 2IYXA 1E9EA 1RW4A 3LBIA 2I3BA 3RSLA 4BE7B 3LWNA 4OQNA 5CLLA 3REGA 3U2QA 2ORIA 2JLSA 4G0NA 2CL6X 2CHVA 2F6RA 5BN4A 3U3RA 3B1YA 5KNBA 4Y0AA 3AKDA 1Q21A 3K0FB 1QBKC 2G0NA 3EW9A 1F2TB 2AX4A 1YZLA 3NDPA 2IC5A 4FMBB 2ZRAA 4OJQA 2KI5A 3EARA 4Q47A 2ZS9A 4A36A 5JCPA 4UJ5A 1XMIA 1Z2AA 1UM8A 3OHMA 2BCJQ 5AUNB 2OFOA 4LJ8A 4OI2A 2F1IA 2PZEA 2F1RA 2ZYWX 4D4LA 1NJGA 4BFVA 4D6PA 2VP4A 3VHXA 4P4SA 1Z5ZA 5BWMA 2VF8A 1BS1A 1GNRA 5D3MB 3ICQB 5AJYA 5TXGA 2ZI6A 5TDHA 5DI9A 4DEXA 1CR2A 1ZNZA 4M1SA 3VFDA 3A4LA 1C1YA 2FV8A 3NEYA 2ECKA 4NCJA 2H16A 2NTYC 2WOJA 1HH4A 1XCMA 3X1YA 3U7HB 3GJ6A 1U0JA 3W6NA 1NN3A 4BFYA 1W1WA 4H1UA 3T35A 3UATA 2ZJAA 1G3IA 2QP4A 4IVQA 1DAIA 4D4JA 5JLJA 4CF7A 4ZDJA 3KJEA 4P33A 5TY0A 2R9VA 4LDJA 4C0BA 5L3QB 2BEJA 3FTQA 4A15A 4D0GA 2QRNA 3FYHA 4CEHB 1ZM2A 3LH5A 4AKEA 1KYIA 3KKOA 4FCTA 4C0LA 3TGPA 3P26A 1NMYA 4V0LA 3QJYA 4OI0A 3JVVA 2ZYVX 5HPYB 1KIMA 1SXJD 3K09C 1U98A 2GF0A 4GZLA 4PQYA 2H7VA 5HE8A 1SVSA 3WYFA 2YV5A 3OESA 4IEIA 3QE0A 2IT1A 3CH4B 4H9GA 2WIAA 1A1VA 4TLDA 2ZI9A 1W4CA 4ITRC 2PT5A 1D5CA 3AUYA 4KYIB 1GAJA 4RZUA 5C1BA 5KNDA 821PA 1E1QA 4TN1A 3K09A 4JIMA 2NIPA 3QSYA 4TSFA 4BLSA 2CE7A 1BH2A 1GG2A 3RS5A 2NZJA 3Q72A 1E9CA 3X1WA 1MKYA 5EXTA 1G8GA 4K81B 4FMDB 5KUTA 3PV0A 1C9KA 2I1VB 1L4UA 1GP2A 2RAPA 2QROA 2YKGA 4M9QA 4JLKA 3CNNA 1NJFA 4R98A 3FFAA 5IF9A 2JJ2D 2QAGC 2FH5B 3CUEF 4JSYA 1OT3A 3QBVA 4RD4A 2GXSA 3WNCA 4GRAA 2YOHA 4IOMA 4PX9A 3U3JA 4DCTA 1VIAA 3KL4A 3QG5A 2VA8A 1P2UA 1G64A 2V55B 3B2EA 1W36D 2B6HA 3QKSA 4TMTA 2BJVA 4TMKA 4BZQA 4IW3B 1VTKA 1J8YF 1SXJA 2XITA 3KB1A 1AQYA 4G5GA 3K0CA 5EE0A 4DLTA 2ZTSA 1MT0A 3RC3A 5L3SA 3KUDA 1N0WA 2KBEA 3I92A 4YDSA 2ANBA 5AJVB 3ZGXA 3C8UA 1YR8A 4KU4A 3KDSE 4DSNA 3K0SA 1HQYE 3KQHA 2ZM5A 4URWR 4URVR 1OLOA 4KAXA 3U7FB 1EESA 1G3UA 4L15A 5CDFA 1KI7A 1VDZA 1WRBA 2OO7A 4XH9B 3E2IA 4DB2A 3WY9A 3TSOA 5JFGA 4P4UA 1L7VC 1G20E 5FI0B 5JSZA 3AF4A 3HYRA 1G7TA 1A4RA 1N5KA 1CJUC 2V4ZA 1UKEA 4JKYA 4Y0VA 3GLGA 2QN6A 2ZUDA 1FZQA 1GKYA 4RZ3A 2PLFA 2EFHB 2ZREA 2EWVA 4BLOA 1E2PA 1YZTA 1Z6GA 1J2JA 3TBKA 3KTAB 3LV8A 1IONA 2ZJ5A 1GITA 3EG5A 5GVRA 1IJFA 2O8EB 2YOGA 1TEVA 3LRPA 1O87A 3QVVA 1XBTA 1JPJA 1T9HA 3VKHA 4KFRA 4PXAA 1JR3A 5C18A 3CM0A 3AQ4A 2EQBA 5FL7A 1CRQA 1N6RA 1Y63A 2ZE5A 4Q1BA 5JS8A 5LB2A 5JJIA 2RB4A 5JMTA 2R65A 4P31A 4KBFA 2OM2A 3RS7A 4G01B 2ZVQX 3L8YA 1E2FA 3VNUA 1CJMA 2WM9B 3BB3A 5FBLB 1R0XA 3QXXA 4Z51A 2ZI4A 2NO0A 3NHBA 4FMCF 1D2MA 4B48A 4IDNA 4AG5A 1VIYA 1CF4A 5AJZA 2YVUA 2J46A 5CLQA 3LD9A 4GFDA 4M0LA 2BJWA 3W8NA 4YMVA 3W6PA 3TRFA 2D06A 4PHTA 5TV2A 3X1ZA 1FP7A 5KU1A 4GDFA 2WWGA 2F9LA 3HR7A 4URYR 4TTQA 2XTZA 4US2R 4HB2A 3U6BA 4BFSA 3ZQJA 4E5UA 4W5JA 2SHKA 3H4MA 3F3YA 2OESA 1Z08A 3SHWA 5F9FA 2JLWA 4RFSB 2FPLA 1EFHA 5FTNA 2IS6A 3G0HA 1EX6A 5CM9C 2G3YA 3A37A 2B7BA 2J5XA 1NG1A 2OT3B 4M1OA 4D2IA 5EP4A 4ON9A 1WBDA 2B8WA 1JR6A 2ZUBA 1W2HA 5F3WB 5FL7D 1S96A 1VMAA 3CR8A 1E3MA 2W83A 2GAAA 4IOJA 2IEZA 1F48A 4L9SA 1JB1A 3T12A 2W00A 1NP6A 4A2QA 2BKUA 3OAAD 5C4GB 2ZI7A 3QBTA 4G5SA 3QPWA 3TR5A 4P4TA 3SYNA 1OH8A 2FZ4A 2CE2X 1RZ3A 1SKYE 3E1SA 4IDPA 4ARZA 5BYKA 2C9YA 1HV8A 2WSSA 4WVFA 5GJWC 4GMXA 1DS6A 4JLAA 1O3YA 1ZP6A 1T3LA 3WNBA 4IFBA 2ZS7A 1F5NA 3W8RA 2X19A 3EPKA 3O8BA 2O5VA 2O0JA 3W3ZB 2QP3A 3X1DA 1H8ED 1W5SA 2CXXA 1QVAA 1BKDR 1QHYA 3Q3JB 4XTRA 3AKCA 2ASEA 2LWIA 5AUPB 2BMEA 5GJCA 2YWHA 1OB2A 4GZMA 3K9LA 4C0QC 2C9OA 3ND9A 3C7KA 2JGNA 1VG0B 1R8SA 1Z6TA 2JDID 5CIQA 1P9WA 1XZPA 2WZQA 3UWOA 4ACAA 3EZ6A 3X2SA 4HUTA 3E70C 4C9BA 4LBZA 4TQAA 3DEFA 5DLQC 2QMEA 4RD1A 4V03A 1QZXA 2R44A 1TL7C 4NTZA 2O0KA 5J4HA 2P6RA 4KFTA 1YZNA 4JBXA 1XMJA 1U9IC 4NONA 2Z5FA 1PLJA 4UQOA 4LYJA 3T61A 4Q9LA 1E9DA 2P2LA 4OHVA 1RJ9A 3CPHA 1UDXA 2QEQA 4Q00A 2O8DB 3EC1A 2BOVA 2KWIA 3U3OA 1QG2A 1XTIA 4JBYA 4Z8XA 1GOTA 3DM9B 3L43A 3AVTA 3QEOA 2VSFA 4IVRA 1ONBA 1N25A 4BRWA 2J3EA 1GL6A 2DFNA 4A1FA 3FOZA 3FMOB 3PFIA 4OQLA 3GPLA 2O8FB 5FPTA 4TZ6A 3ZIAD 4JLOA 2FU5C 3OFND 1KNQA 4G5OA 1SXJC 1ZINA 2PZFA 4GPTA 3RSOA 4NYJQ 4RFSA 1KI2A 4TTPA 3DZDA 4LJ5A 4P32A 1KSJA 4HEJA 5HKKA 4GP6A 3VQTA 1U2RA 3U44B 1ZD1A 4Q1AA 3R9XA 2G9NA 2GESA 1JECA 1LS6A 4B2PA 2WJYA 4M1YA 3OEHA 1ZUNB 4GP7A 1UBFA 1T6NA 2N46A 2Z4SA 4TQUS 1COWA 3NC1C 4MUBA 1ZC3A 1Q12A 1TUEA 4NYIR 2CK3A 2EWWA 3T5GA 4DLYA 1HTWA 1DBSA 1GWNA 2RGAA 3A1WA 3LLMA 3NIBA 5K8TA 2D7DA 1WDTA 3EA5A 1L2TA 2F55A 5IDVA 4E03A 1S2MA 2VBCA 3L8ZA 4P0TA 4Z8YA 3BE4A 1V5WA 5EE9A 3NWJA 3AVOA 4EPTA 2OV2A 1D6JA 1FX0B 1KI9A 1CLUA 2IUTA 5P21A 1G3RA 3IUYA 4B35A 6Q21A 4RFVA 1E2NA 1ZNWA 4PO8A 3B13B 1FX0A 3PUVA 1NRJB 5KDDA 2WWHA 1E1RA 4JZKA 1CKEA 4LCBA 1ZMXA 3O47A 3UKDA 2JJ2A 3U3KA 1CXZA 1RIFA 4Q7KA 3B82A 3IPXA 2NGRA 1NVUQ 4YONB 1WA5A 1W4AA 3ZS8A 3C14C 2HEIA 2CVFA 1P62B 2GBLA 2ZS8A 4HB0A 1HE8B 1YKSA 3PJRA 4NU0A 1FQJA 4AYTA 3UMRA 1CJVC 4I4LA 1KI6B 1XXHB 2J7PA 2FEOA 2VPPA 2JLZA 4DB4A 3D7MA 3B60A 2REOA 2ODEA 1OXXK 2HCBA 4B76A 2VHUA 4B34A 3NXSA 1DPFA 4M21A 1Z28A 1ZIOA 1TMKA 2YNMA 2ANCA 4RVCA 3GLHB 1KO5A 4HLQB 3FDIA 1M8PA 2BDTA 2MSCB 4EDHA 3KXKA 3S1AA 5FPKA 1KGDA 1HA3A 2ODNA 5E7JA 2WKPA 3AVYA 1G6OA 2WWXA 2ZI3A 4WAUA 4PC3A 3GLGE 3R8FA 1K8RA 5FUWA 2A5DA 3KKPA 1U0LA 1RRCA 1G8FA 1V43A 4XJXA 4BLRA 3KKMA 3AF1A 4HLUA 1LF5A 4XOIA 3VU9A 1GZSA 3SC3A 4K8OA 3U3MA 5LBIA 3ZD7A 2B21A 4NDZA 5EQTA 4UNRA 3OZXA 4MRPA 4A8JA 2EVWX 1D8TA 2FFQA 4Q19A 2YINC 1NN1A 2MSDB 2QAGB 4ZPXA 2BBSA 3TVDA 1E4VA 3BWDD 5FUYA 3L0IB 1EWQA 3KXIA 3RRZA 1DOAA 5AR1A 1UEJA 2IK8A 3M4YA 3FVQA 1XMVA 3CB4A 1UBCA 4KITB 3A6PC 1UBEA 2OCYC 1IQPA 4QJ5A 2OFXA 2OBLA 1GILA 1IHUA 1KK1A 1UADA 3KB2A 2V54A 1X1SA 3EWAA 3KJHA 3OIWA 3PCRB 1DO2A 1MRSA 1W0JD 1YRAA 1PV4A 1ODFA 4D81A 2H1LA 2C5LA 2F1JA 2WOOA 3BXZA 2Z0MA 1Q1BA 2ZE8A 3SHFA 1EXMA 3IGFA 4LYFA 1K5GA 4QGGA 3TE6A 3CF0A 2F3TA 4D0LB 4PZZA 4IEEA 4BRUA 1RRPA 3QXHA 2XSZD 2QM8A
chains in the Genus database with same CATH superfamily
1ZD3A 1CFZA 1X0XA 2GPTA 2JJ1A 3FWHA 4X60A 5G53C 4UCXA 5JBIA 4EHKA 3PTZA 3LBHA 4IMRA 3M4XA 4P92A 5EE5B 4F91B 4LSZA 1C0PA 3D1VA 1YK0A 2QAGA 5T64A 3URKA 3ZVLA 4YT5A 1CZLA 1NW5A 1WSDA 2ZSFA 1KP2A 3B3GA 4PYJA 1ODKA 1ZHHA 1UMDB 5ANRB 4ZDWA 1WZUA 3V1KA 2DG2A 2PR7A 4JODA 1LFAA 2YWDA 3EWNA 2V58A 1NWCA 4BDTA 1EKXA 4G1EB 1YZ3A 2FX3A 3N5KA 4HSEA 1VP3A 1KBZA 1Z29A 4DDWA 1U9YA 3PKIA 4MW2A 4O3MA 3K2BA 1NAIA 3Q10A 5FWXB 2A7XA 4R1SA 1ULTA 1QCCA 1RI1A 1XJ5A 3JQBC 5HGXA 1TQ2A 2P2DA 2WIKA 1LPAB 2EEPA 4FGKA 1QP0A 4MW7A 1LBSA 3GG2A 3IB3A 1T3GA 1NQXA 1PHRA 2OVBA 2FX5A 1H1DA 2SNIE 2ZJ8A 3AQIA 3JQ8A 3LUJA 4N49A 1N3YA 3GFFA 1R8JA 4C7BA 1HDIA 4G8JA 4WOCA 3JZMA 4IF4A 3KPUA 3JQDA 4RA6A 1Y8QA 4ECAA 4YMSA 4O2BA 4BZPA 1Q2UA 2FUKA 3NKVA 1NJ5A 1N6HA 3KKQA 3OIDA 4IIJA 4IKPA 4MGIR 4OY3A 3H1AA 4D4GA 4FWTA 2CXTA 4MCHA 3SX4A 3FAZA 1T1SA 3S2SA 2N1BA 1QGDA 1OGYA 1B6SA 1PZMA 4X8OA 5GOTA 1W44A 5HFNA 3G23A 3L1IA 3F7NA 1U0NA 2NU6B 3GQBA 4QFDA 4ZAVA 4DPMA 3NHKA 1J7KA 4G89A 5HKAA 1YQDA 4B2IA 2D1SA 4NYMQ 5EE1A 3V7YA 1E9FA 1KNXA 2GFQA 1TQ6A 2AHOA 5E1DA 3T1NA 1PZGA 1RE0A 1BZYA 2H48A 1K6EA 3BTUA 4IXMA 5D51S 4BUJA 3SYLA 4DLLA 2B1QA 3NH9A 3OZVA 4LHYA 4MYHA 4ARVA 1DMSA 1EDOA 3L9WA 1TF5A 4B1FA 1R2QA 3H5TA 4JJKA 3WGGA 1A5AB 4KV9A 5AK0A 1B73A 1NFFA 3CIOA 4MGYR 2RHHA 3RRBA 1ZW1A 5DX8A 3V4PB 5BSWA 3AOEC 2F9MA 1CWUA 2Q99A 2ZJFA 3DV2A 3QA3E 5TQ0A 1JEQB 1FS6A 4ARIA 2XNDD 2CV0A 5CU7A 4RNCA 3DOOA 3NHRA 1VGQA 2DLCX 1XAHA 4RADA 1ZI8A 4JBHA 1P5RA 3UAOA 4PPGA 3X1KA 2AMYA 2O2JA 3EGCA 3QP9A 3STWA 2V5VA 4WL0A 5G0UA 3HGQA 2YFQA 1YGPA 2J3KA 2WTBA 4ANFA 4ACBA 1UOEA 3RG8A 1KZ6A 4GKAA 4CIDA 4F9TA 4QIHA 4G0QA 4TM8A 1ZY2A 4QAJA 4GP9A 3IR5A 2VQ6A 3EGXB 1CZNA 1NMEA 2DT8A 2X0KA 3IVXA 2CVQA 3KVYA 4BRUA 1TVEA 3TQSA 1UKVY 3I32A 4LDQA 3G82C 1LJLA 1LK0A 3OEWA 2D62A 2NSJA 3BMQA 3RYHA 1U0OC 4QBGB 3WMGA 2FPGB 2VUTA 2J85A 3PE4A 5F64A 3FXAA 4CM8B 1KU6A 1SQ5A 2PS3A 2ZYSA 3B85A 4MQ4A 2F48A 2OGZA 4O4IB 4B7UA 3M7IA 4QSHA 3NDBB 1VXRA 1U80A 3N0VA 3UBTA 3OOEA 2ZSJA 3LUPA 3PQ6A 4X91A 3AESA 2J5RA 3BE8A 4E5KA 5FBQB 3O83A 4NC9A 4GOJA 4RA9A 5D85A 2IWHA 4MK4A 3ZWQA 5FPPA 4RZ2A 1EIWA 1Z4MA 3E6AA 4NRDA 4G25A 3R9IA 2ZAIA 3RGWS 2C9MA 5PNTA 4ENSA 3BGDA 4RC9A 2JFBA 4G85A 4MHSA 3TL6A 2B9VA 5JE8A 3U4CA 4BWYA 3EPJA 5AW7A 4LHZA 1I3NA 1VYTA 1UT8A 1RT9A 3D3KA 3IXLA 3ROMA 4EAQA 1G2OA 3A7DA 1X2EA 2PUBA 2ES4A 4DARA 5HCUA 2IS4A 1T8SA 4FDUA 2PRKA 3UUWA 3V97A 1U3CA 2NO7A 1G8HA 3EBOA 1NKVA 1TB4A 1Y6QA 2P67A 3D3QA 3JYPA 4XIYA 3WRXC 1NVWQ 5I9TA 4K1XA 1CJKC 3EVGA 2PFGA 3ZH9B 2FEKA 3EEQA 3N2KA 3GFOA 3LXRA 4N5MA 1P6UA 4P81A 3TMYA 2AQHA 4UHJA 3EOBI 5K0LA 1TLLA 4X8LA 2OMEA 3V2HA 1XNQB 3DTNA 1YB1A 5EOVA 5AVUA 1U5CA 4R40A 3CZ9A 4PFQA 1E5QA 1RWWA 2FZWA 1GGJA 4HRYA 3WNZA 1DV2A 3N2GB 4KXXA 4QGBA 3V9AA 4C4AA 1E3JA 1EFDN 2RGUA 16PKA 2X1LA 4QOJA 5DHAA 1W5TA 1E3WB 2Q1TA 3WSVA 3D4BA 2DBZA 4ZALA 3AL2A 1DTEA 1EDZA 4DIUA 4U2CA 1AZTA 3HACA 4GE3A 4CCWA 4R7TA 1XCJA 4Q1CA 4TVKA 2RH9B 2DB3A 4MYSA 1DTWA 1SEVA 4C14A 1AXEA 1L9XA 3IVAA 5EUMA 3T52A 4B8WA 1GTRA 1TAUA 3QEJA 3DYIA 3PCXA 4CKWA 3TOZA 5IP5A 1XZHA 1NC3A 2YZ2A 4CHTA 3G79A 4S12A 2ZSAA 2BGRA 3MB8A 4ZOLA 4ZQEA 4NJEA 4MJXA 5D3MA 2GN2A 2H0RA 5KSPA 1JJIA 3EF0A 1NURA 1RPAA 2ALJA 1W88A 2OCAA 3VV2A 4OVKA 4XSVA 4Q3DA 5T41A 5IAOA 3ONWA 4HLUC 5EY5B 4U7PB 3BREA 2EG9A 5EEGA 1O0SA 1STOA 4NWIA 4EG3A 1X8KA 1A8SA 1E2HA 3LE8A 1P60A 1EK6A 5AKJA 3UG6A 3ZDXB 4BO4A 3SDSA 1IULA 4KGDA 4NL4H 4C0KA 1FE8A 3IEUA 4Y1GA 3RLFA 1MA3A 3A9WA 4TS1A 1J0XO 1BXRA 2WA2A 2QGFA 3BHJA 3VR4H 4RCZA 1G17A 4DLZA 4FXPA 1FTGA 2RG1A 3GIWA 3F3MA 4KHZA 2HIMA 1VE9A 2Q0HA 3ETEA 3OM9A 3JVIA 5F2OA 3PA6A 2XDYA 4EYEA 4ZYLA 2W6MA 2DHDA 2Y27A 3IP6A 1H4TA 4EI7A 3R9XB 1O4VA 4E1VA 1TJ3A 4RVNA 3ESXA 4IH4A 4XX1A 2INGX 1ZN8A 3L7NA 1G0OA 1SXHA 2GPBA 3CUSA 1FS5A 4HFJA 3TBHA 1M3SA 2CK3D 1KKLA 4ZO8A 5E95A 5GM2A 4WFJA 1UC9A 1FSGA 5EAIA 3WK7A 1KQOA 1QSGA 1NVVQ 1Z8DA 4Q82A 2QR3A 2QTHA 2BV3A 2IDKA 1F3OA 1EFCA 3HADA 3PWTA 2OV4A 3CNLA 4YJGA 4ZVSA 2AFRA 2UZ4A 1G5FA 1A69A 1E3LA 5HZMA 3SC2A 1XPJA 2OHXA 1UOPA 1FJHA 2GFHA 2WG2A 3RBZA 3E81A 4V0KA 3TOSA 5E3HA 1BDMA 4CQJA 4BFCA 5LZ4A 3HP1A 1UBGA 2W2QA 3KZNA 1XEWX 4PX3A 4WY2A 4HDMA 1U2EA 2FOXA 2QRHA 1YTUA 2CLLB 4XTCS 13PKA 1TEXA 3A6EA 3N75A 5BSEA 5CB6A 3GLFA 1O94D 2OQVA 4A27A 4QDUA 2V0GA 1U3GA 1C3VA 3BICA 3I23A 4EF6A 2DULA 2XYHA 1C3OA 2GD0A 3BFVA 3BRCA 1E8MA 5ESXA 3RIGA 4IILA 2NVUB 5IC6A 4ZYYA 2NU8B 5EJAA 4ZTZB 5EN4A 3U4IA 5DXFA 5F35A 3CN7A 4A82A 4FR5A 4FHFA 4W5QA 2XCTB 5C3UA 2FW6A 3HC7A 4KKXB 4MMZB 3P9CA 4G8BA 3WRYA 5D00A 2ARKA 1MABB 2F67A 1SB8A 3QA9A 4FEEA 3W7VA 2H54A 4EFLA 2QKYA 4OV6B 1MX3A 4EOGA 1QZ3A 3CZPA 3WMWA 1U8AA 2P5UA 2MMCA 2XDQB 3LAWA 3NBQA 4YYEA 5KNBH 5LJIA 2MTBA 4GLJA 2XZPA 4QOFA 1GU7A 1JF8A 1H4VB 4GVPA 3PQ7A 4J43A 2Z2IA 2C7OA 2XVYA 2WVGA 3HU2A 2CUZA 4RMHA 4RPJA 3VU9B 3ESCA 1V8OA 4HX2A 5EIWA 3ENNA 3N6RA 3T4UA 3A3YA 1TMYA 3B52X 2VJMB 4DKJA 3GPDG 5EC8A 1ZAYA 1H8HD 3E3OA 4QRDA 5F1KA 3EGDB 3M4NA 4OAOA 3HG7A 1IZYA 4ZDIA 5DYGA 2C78A 3F49S 3G9ZA 1Z75A 1TUGA 4OQQA 4ZGWA 1V5IA 4CI9A 4JWTA 3U31A 2BISA 3D4OA 3EDMA 4S0ZA 3SQMA 1FNMA 4RD0A 3TW8A 1IIRA 4CM9D 3EXIB 1I36A 3B1WA 4FFVA 5DSTA 2QX7A 3HR4A 4JOQA 1HDCA 1L5OA 2XJ9A 3RS3A 5ALUA 2ID8A 4OB7A 4X8HA 4N6OA 2ZR7A 4G0OA 2PUEA 1M8JA 3MT8A 3ONFA 2FDXA 1PDVA 1V16A 2NW6A 2QM3A 3PICA 5E2AA 2CKDA 1WV1A 1Z6YA 2NXJA 3GMSA 4V0RA 5IASA 2VCHA 2E2WA 3DM5A 3K1AA 1T5LA 2I6UA 3JWHA 1KYWA 2FKAA 2WBLC 3GEDA 1QFXA 3WYGA 4UPVA 4UBLA 3JD0A 2AEJA 1FS4A 1HDZA 1UFQA 1HXHA 4YACA 3UUEA 3VYRB 3WKBA 3TSCA 1GPMA 2JHCA 5FF9A 1W75A 3P9PA 3RHTA 1NAHA 5JAHA 2OZEA 3EXHC 2DBYA 2OHFA 3OQ6A 5HYVA 2JLCA 5E6SA 5BN4B 3ZIAA 3FI9A 2W4IA 1A8IA 5FV4A 4KNWA 1IXKA 2JFPA 2AMJA 4X84A 3S2GA 5MDHA 5A3RA 5KSOA 2C9CA 2JGEA 1I01A 4P34A 2BHRA 5L95A 3QEKA 2REQA 4QOSA 3GF4A 2HU7A 3WXBA 1TA0A 1M9NA 1PNVA 3GP3A 3MIZA 1XZAA 3O6VA 4ND3A 3FWKA 1KI1A 1YS1X 3ML1A 4B6PA 4K3UA 4Z1MD 1G18A 2P9JA 4MVJH 3KL2A 2YXNA 1WVGA 1JDTA 1G8PA 3LW7A 4XVQA 3FNGA 5TQJA 3B6ZA 4HB4A 4GGMX 1D2AA 1NW7A 3AINA 4TMZA 3EN0A 3ND7A 1B3RA 1V48A 4MUMA 4EY3A 3OOSA 4ABTA 1GSHA 1MO2A 1NJSA 2PCLA 2PGXA 3ZHZA 3HWSA 4MAMA 4NMMA 1GNQA 5L3QA 7YASA 3SR3A 1W30A 2NNLD 4IUYA 5HQTA 5JATA 1YE5A 2F90A 4OEHA 4QSMA 3U13A 4DRXA 5JHGB 1NXSA 2G04A 3WA6A 1EVYA 1E1NA 2ZXEA 1V25A 3FHLA 4I81A 3KFXA 2VDQB 2UZIR 3B8EA 3WWZA 1LV7A 2ZWVA 1ISGA 2QN1A 4TTRA 5I8PA 3CPEA 4HNSA 3PLAE 1CUIA 4R3UC 4HDKB 2OC4A 1ADYA 1DRUA 3DBOB 5CTJA 4DF3A 5DI3B 4TQ9A 3H75A 3PFGA 3HKEA 3ESDA 1U2TA 3K30A 4AMGA 5LMCA 1SOUA 1FCJA 2J45A 3A9TA 3CH5A 3NOVA 4X1YA 5JS2A 5LP1A 2CNOA 3L8MA 3U3DA 3DJFA 3U0VA 4DY6A 4HNUA 1EX7A 3ZCVA 3HWX1 1YDGA 2DR3A 3KLOA 4CKWB 1BAPA 2ZPTX 3E84A 5DM60 5I9NA 5TMEA 3E15A 1SPXA 4LK3A 2FEXA 2GBLC 2G09A 2QX8A 4JOSA 1X8XA 4BVHA 3IUJA 1OWPA 3N7AA 1LW6E 1V5FA 1JWBB 3CZQA 4TMFA 4L4UA 4D9BA 1LRLA 5CVTA 4R41A 1YUMA 2NVOA 2QQ0A 2V7PA 1E3WA 2NG1A 1A5BB 3QXGA 9ATCA 4AXXA 4R6WA 4AK9A 1OXTA 2JVJA 2ZB3A 2JGFA 3KVRA 3O2SB 1PNTA 3THOA 4QOGA 1B0AA 2X8LA 3L7YA 3THXB 4BHTA 1C3JA 1W25A 3WLHA 1R0RE 1T9ZA 4W1SA 2JHPA 2WPDA 1R0SA 2BM1A 1X92A 2VSYA 4UUBA 3UT5B 4PZ0A 1ZD8A 1DAEA 2F00A 2VSNA 1KZ1A 1M7BA 1X8JA 2QUHA 3AF5A 2DPLA 4IDFA 4C01A 1NWHA 4L1KA 4AN1A 2FZEA 1UP4A 3CUKA 1ZK3A 3H97A 4PR3A 2G0TA 2QTVA 1JS1X 4KZKA 3ZDCA 4C4XA 4DSTA 2VAXA 1FFAA 1RBMA 1UEIA 2G8LA 4PQGA 5E6SB 1P0CA 4C04A 1G6Q1 5CA0F 2G5PA 4P3NA 4LQDA 4YRGA 3NVAA 2IUSA 1O4WA 1VXOA 1II9A 2O3QA 1FXWA 2HA4A 5DMXA 5HJ7A 4GX2A 5KYUB 1DB3A 2I4TA 1QH9A 4NENB 1YC5A 2CLCX 1ZESA 3IBCA 3SN6A 1YRYE 5HDBB 3O0DA 4CV1A 2VJDA 4HVTA 5IVIA 1O96B 2Y1FA 4R68A 3S29A 4X64B 1NATA 4M8LA 1SVKA 2JG3A 5HKBA 2VDVE 2O2YA 5DHTA 3VKWA 3QTBA 2H4FA 1NQOA 3O75A 3OKCA 2C3MA 2BC9A 3GMDA 4LTMA 3ILVA 3AKYA 5TGZA 3W1WA 2I2DA 3QX7A 2ZVJA 3BA6A 4IDCA 1KAQA 4CVNA 2FHSA 4DZTA 5L9AA 3PGJA 1KSFX 2XPCA 3FYSA 1KAHA 2JIQA 5LQKA 1JZQA 3PF8A 2IPLA 1FU7A 1OFUX 3WKDA 1HMPA 5SV2A 4DDTA 1BE8A 2PKQO 3DB1A 3HL4A 4RORA 3OFVA 2VDNB 3G49A 1RMQA 5BV8A 3RIXA 4NU6A 1P61B 2O19A 2AN9A 2JJ1D 4W1QA 1ETUA 2BI4A 3T1QA 3GAFA 4ZHQF 2YS6A 5DNUA 1C81A 5BV1A 2W6NA 3TLYA 3IKMB 1XA0A 4PZEA 3TNFA 3DJYA 4BN5A 2I7CA 3H42B 3RU7A 1TQHA 1QUEA 3BDIA 2G08A 3NB0A 1SC1A 4RWZA 2GBIA 3HXKA 3I73A 2HQBA 4UM9D 4FGLA 1HE1C 2YC2C 2F8LA 3FFBA 2GVDC 4N65A 1M0SA 2YVAA 5AHWA 1DRWA 3COJA 4GBJA 4PG5A 4EQ6B 1PW7A 4L75A 3IDQA 2HSWA 2OGTA 1VE7A 2VHEA 4LHVA 5JDCA 1IXSB 1L8OA 3K32A 3CLSD 1Z6QA 3TDMA 5IF9A 3COPA 2V7QA 1G291 4LE2A 1KARA 2IIPA 2V03A 3GGGA 3BK2A 5AI0A 1NX6A 1UEXC 4G37A 4DHWA 4CXMA 1K6XA 3N8GA 2QD5A 3DYVA 3DT6A 1AB6A 4GDMA 5JG7A 3WWYA 3ZU4A 3EEOA 4H15A 4DQKA 1MD9A 1UZLA 2GYYA 2ZPAA 3TAXA 1RRMA 1YI0A 3ON5A 4J1TC 3ISTA 3ZV5A 2C2BA 4XGQA 1AURA 1P2FA 1MR3F 1UDWA 1UMCB 4ZOBA 3WL7A 4RHCA 3P9ZA 3PHIA 4PN3A 1H9BA 1ZM3A 5ECWA 2JJMA 1NDUA 1PLLA 2F43B 5EIBD 4F2HA 5B1IA 4INZA 4G2NA 3ASYA 3FYDA 4LNUA 4ZVUA 1U1GA 2BLNA 5P8WA 3WLNA 4WN9A 3ITDA 1B42A 1RSZA 3DOHA 3PC4A 4ZCLA 2YOFA 3HVUA 3JU3A 4OK6A 4HUQB 2FZLA 4YS6A 4MGKR 3G9QA 1OYVA 4F46A 1PQPA 2FSSA 3I58A 1TADA 1KAOA 3QQPA 1ISHA 4RDXA 5B2ZA 3ROFA 1UF9A 3WGTA 4MQFA 4U02A 3WQRA 3AF6A 1G9XA 1OKKA 3UG7A 4BC0A 4CCAA 3GJ5A 4JL6A 4IQGA 4RMNA 1T2CA 2X3YA 2WM8A 4JC4A 4KUEA 1X14A 3ZDRA 4EPVA 4CM8A 3W78A 4Y18A 5E9AA 1DG3A 2XWJI 3CO0S 3DOCA 4C0HA 1G2QA 3W5AA 1MF7A 3O91A 4OI4A 1NQTA 3DXFA 3H9UA 3EIHA 4J7XA 4XPIB 4F96A 3G85A 4BNVA 3VMFA 1QU3A 3LQ2A 1KRWA 5AJUA 1H65A 3K0HA 4BO9A 4BMSA 3PQFA 2CNDA 4OIFA 5I4BA 4ZI3A 3LY8A 1VLLA 4G9EA 4YB8A 1GTJ1 5EJ8A 3B53X 3PQ2A 4NCAA 1T5HX 1H5QA 4URZR 1FZTA 2PWPA 3S2ZA 5BURA 1JAHA 1GRCA 2GXQA 1ZYUA 3QYPA 4MB0A 5E7MA 5F5NA 4BMYA 3CISA 4BP9A 2ZTUA 3DE3X 2CJYA 3SVZA 2OENG 1HG0A 1DP4A 2DHQA 5C7YA 3VAYA 1G21B 4KFSA 1ELOA 3RHFA 3K31A 5GTDA 5JR3A 5B53A 3L7JA 4RQBA 1NOKA 2ZAOA 3HYNA 3DCYA 4FOPA 2JBHA 3AI1A 3KAKA 3A1EA 3CXRA 2GZDA 5BY2A 1PBNA 1R9NA 1BMTA 2B9EA 3IS3A 4GMDA 3EWSA 4MV8A 5E6RA 2C7RA 4A0RA 3JZAA 1RQXA 1JAZA 3N7UA 4TSRA 3TD2A 1LPOA 5DBGA 4N0PA 1HEYA 3CRRA 1U5BB 1FDVA 2NYUA 3NR2A 4BLTA 3V2IA 4YJHB 3QKRA 4NECA 2NACA 4TMYA 2HSJA 1CEEA 1YWGO 1TM4E 1NNEA 1WXWA 1P29A 2XKJE 1E7WA 1KSHA 1RYNA 4RGVA 5NULA 4CL8A 1KQGA 3UKOA 2TYSB 4WW0A 5IAJA 1SXGA 3VNRA 1SXIA 4WXEA 2B2NA 5ALVA 3VO1A 5J2TB 4PLCA 3C1UA 2FAXA 3Q88A 2G7ZA 4YCMA 3IPCA 4P7GA 1AS0A 4XD7D 3C7DB 5LZ7A 4F8YA 5BSFA 1ZOIA 5IW8A 4LNUB 2B4TO 3N74A 3OEEA 4MRNA 2AK2A 2O0LA 4XX0A 3VOAA 1XUOA 5J3JA 3GU3A 4IGAA 2FG6C 2FZKA 4PLWA 4F4UA 4CM4A 1YAHA 2LW7A 4BP8A 4DZZA 2GI4A 3OM0A 2Q07A 5BYAA 4PGGA 2HR1A 1UMBA 5JAOA 3HSKA 1JDVA 1GN8A 4RHEA 4RAQA 4QG3A 1PF7E 3PSAA 4EF5A 4ZYWA 3MWEB 1UR5A 3DBLA 2HJRA 1JHAA 1P39A 1TDJA 1XELA 1VSUA 1ZQ9A 4I7EA 2C5HA 4LV6A 3WBBA 3IURA 1GZ6A 2NX2A 5BMVF 4UHKA 3H0KA 2HSDA 1WSAA 4UMDA 1PG0A 2G1KA 2QRJA 3HBMA 3HCRA 3JWEA 1IQRA 1D07A 4F3NA 3FNIA 3KHSA 2P6PA 8MHTA 5AM3A 1S9HA 1O95C 1XYGA 3D7NA 1Z63A 5FOXA 4AD8A 3Q85A 4FMDF 4XUCA 3S2EA 2O2DA 5CA1A 1EQAA 3CVOA 3M9LA 2WAAA 1P2VA 1BHSA 3KTFA 3ZGLA 4DT1B 1T4BA 2ZBRA 4TXJA 3RUAA 2VP0A 2ZIXA 4ZRDA 3DKPA 3TCKA 1A8HA 1MRNA 1QAOA 4YWHA 2YJ4A 4O4JB 2FHPA 2BR4A 5JQWA 4DJDC 1N32B 1ISPA 1X1AA 2GEDA 1I4LD 1DXHA 1PNQA 4PGAA 2WA1A 4PWZA 3AG6A 2IZ0A 3V9PA 1BEZA 2J9ZB 3HBJA 4ZO6A 4FOLA 2XWSA 4QNMA 2BFMA 3GIDA 2WSSD 5FYQA 3TUIC 2VJAA 3PC6A 4M7OA 1WXGA 2WVAA 1GZ7A 1RXIA 2R47A 1YMVA 1SD2A 3ESQA 3KJQA 3KQYA 4R8MA 2E5LB 1QP4A 4IMPA 4FJ0A 2E4AA 4US0R 2E5FA 4I6GA 4XUDA 2Y0BA 3EVNA 4KN8A 3UMGA 5I45A 1XOIA 1T9GS 1XA4A 2HHJA 3BORA 2QBYA 1XQ6A 1GUZA 2A86A 1K6JA 1XTSA 1KY5A 3U3ZA 1PL6A 4AU1A 2IIVA 1ECBA 1PT9A 2B4AA 5K20A 1WF3A 4MUAA 2DY1A 4YMIA 3I6MA 4F6RA 4AYXA 1DSSG 2ZWAA 4Z4HA 3W3AD 2TMDA 3H5RA 4EARA 3SQXA 4PHHA 3WWCA 1T2NA 1WW3A 4M3NA 1M6VA 1W35A 3RU9A 4ZJPA 3SVLA 5JAMA 3I01M 5LDHA 2FXVA 3S7ZA 2XOKD 1H6BA 1C7ZA 2QD2A 1AQIA 1FRVA 3HDGA 1LXCA 3AV3A 4G07A 1UPCA 2OWDA 4AKGA 3FRIA 3HB9A 1T4GA 5AKYA 1HRDA 3R23A 4L4XA 2GEVA 4W5RA 1DIAA 4DNOA 1E60A 3S5JA 4C2AA 5A5VA 5BVHA 2IP2A 2FCAA 3KOMA 3KOZA 2V7QD 5K4AA 2WU4A 1CY7A 1CUZA 2XUFA 2W5UA 1NI4A 2Q0XA 1KK2A 2VCEA 3I30X 621PA 2V7UA 2C2WA 3RAJA 3B78A 1C8KA 2QY9A 3C3PA 1A5TA 2YWBA 3ELYA 5J40A 4ZKEA 3RU3A 4CFSA 4DV4B 3KR1A 5DEOA 4EUKA 4JT9A 2OZKA 3BXHA 4JN6B 1V11B 2O2ZA 4DV3B 1UKBA 1Q0QA 1TM3E 4DUPA 2UVPA 1K89A 4QUBA 3VPFA 3RABA 3WJ2A 4F3CA 2Q0QA 3IBFA 2OMKA 1SK8A 5C32A 3HKDB 5ALOA 1SFRA 4UNSA 5K4HA 3PC3A 1CJSA 1C2TA 2WFAA 5TJHA 5KNCH 2XE8A 3ROTA 3JQFC 1TTHA 2BFPA 3AUKA 3DOEA 2A9RA 4HLNA 5JJKA 1U7WA 3ICCA 1FFDA 3TXAA 5DNCA 2REXB 1POWA 4ZU6X 4JI1B 1VCNA 5JRZA 7MHTA 3O3CA 2OXIA 1Z4QA 3MYYA 4MVJE 3AJAA 1NE7A 1LDYA 1NP3A 4NYIQ 1JIJA 1FXUA 3IHTA 2AW5A 1HORA 2XV1A 3F97A 2CUTA 5HXAA 2RJNA 5JLAA 1QYVA 3ROXA 2O5EA 4JNKA 2VJPA 1Z5GA 2Q6TA 5ULLA 2XNSA 4DVJA 1ORTA 5KS2A 3GLFE 2AD5A 3K6SB 1GADO 2M1XA 5HRAA 2CLSA 2Z43A 4OBEA 3H1BA 2FMIA 3HPQA 1XDWA 3EZ2A 2CJWA 1IWBB 1RYHA 1ZOOA 3AEYA 4BIMA 5UKDA 5TPZD 1T0JB 4DCMA 3V8VA 2C2OA 4PZDA 3WIOA 4JMLA 4Y3UA 3FY4A 2E87A 4G0VA 4OSEA 3BF8A 3HHPA 4LC0A 4QEZA 1UK6A 4IJ6A 1TMGE 2QTBA 4HUQA 4TWZA 3MWYW 3RJMA 3WMFA 1LVHA 1PJ8A 4F72A 1QO9A 2JFHA 2VH2A 2HCTA 2QN7A 3R3HA 4MIYA 4K88A 1RBQA 4AO6A 1OH5A 2O54A 1X7WB 5EPEA 3WGVA 5ALHA 2ZCUA 2R6JA 3G2IA 4QGSA 1MEJA 1LB1B 1ZJ4A 2OZVA 2P91A 3E5NA 4G5YA 3GRVA 3C3EA 1GA6A 4BN4A 5AVTA 1Q3KA 1HE5A 1UXKA 3MWLA 1EX9A 1VYUA 4RYDA 4CPDA 2RAVA 3OQPA 1MZPA 3IHLA 3OO1A 4XAQA 3HCEA 3WQBA 2AJ8A 1M2WA 3GJXC 3AW9A 5KAMA 1KETA 1T34A 1BS2A 2PSJA 3Q3IA 3HI4A 4URXR 3AM1A 4TV8B 3DZHA 4AS1A 3QMPA 2B83A 3V55A 2ZDQA 3WFJA 2XMPA 1DAKA 1Z12A 3KYCB 5AWFC 2QN9A 3G2NA 2WSYB 1XK7A 3SFTA 3U80A 3HXPA 3LBYA 2AUTA 4JJ6A 1XPOA 4JSRA 3INYA 4TSKA 1QFJA 1RAEA 3SC4A 1GCGA 1J70A 2Z2YA 3DOFA 1JEEA 2GJAA 2PSHA 3AL3A 4PZ9A 3IKJA 3M3HA 4L5AA 4BO2A 2EFCB 2Q9BA 2LV8A 2IA5A 3R4CA 4J6FA 1LX6A 4C07A 2AMFA 2XXJA 4HXYA 4WVLA 1GL9B 1W6UA 3O92A 4MI3A 1E4YA 1I3CA 3AUAA 3NHAA 4L5IA 4LHWA 4WY8A 1DQPA 1SKQA 5GONB 4MV3A 5IBQA 1KE2A 4H1HA 5KQMA 3ORSA 2VWGA 3AOEA 4Q3LA 3CZ4A 4TMVA 8GPBA 3S2FA 1IBCA 1JAXA 1P73A 4Q6BA 2NTEA 2DFLA 2W6ID 4I1SA 4LJKA 3VSEA 1UP6A 1RQLA 1B2RA 2RAFA 2RGYA 4OO3A 3W0LB 1MW8X 3T3OA 1UT6A 3P9KA 4EMUA 3VVMA 4B17A 4XR4A 4D82A 6ABPA 2GHTA 2HWKA 2F1KA 2HXGA 4UATA 1FJGB 4P6VF 3I4LA 4I8IA 5CJPA 7ADHA 1L4KA 1P7ZA 3ADBA 2JD2A 4DBVO 4WJZA 4LF5B 1T9BA 4V0MA 4P5PA 1AS3A 2B92A 3NKLA 1XD8A 1HFJA 1T25A 1E7MA 3IAXA 4R1TA 5EWLA 1BROA 3AERB 3SY8A 4CE6A 5J47A 1HOXA 1AX9A 2BBOA 1B0UA 1M6NA 3QJ5A 1DKQA 4MR9A 5U9CA 4U6NA 1XKTA 1ZJWA 1JFLA 1W0JA 4QOHA 2R8BA 1SHTX 1SPBS 4X63A 2GAFA 3KR9A 5JPCA 4LFBB 2A3NA 2KSQA 2C0CA 1J49A 2FGJA 5E1OA 2ZCJA 2BD0A 3FYUA 4Q02A 3L93A 4M46A 4C4YA 3WGIA 1MABA 3ROGA 1WDWB 2X1HA 5IKMA 5F7ZA 4EW2A 1TM5E 1RHRA 1WDMA 1A9OA 4C76A 3VRHA 2D0OB 4JJZA 1WZ2A 3GUUA 1BYUA 1Q0ZA 3ZWDA 3UGKA 1TT7A 4P86A 1CPYA 3GGDA 3OZCA 3CB2A 1N0UA 3M89A 1TYZA 3HJUA 5IK2D 1YA6A 1PP4A 3M70A 1OVMA 2Z5LA 1A4XA 1CULC 5IXJA 1OZAA 1X9IA 1PGNA 3ROEA 1ZJZA 5JCZA 1WZEA 5KNCA 1R5BA 3EC7A 3PD0A 1DAPA 1RPTA 3EASA 2PZKA 4K0RA 1ECLA 2D2IA 2I6XA 2PANA 5AKLA 1MCZA 3LUBA 1TZJA 3AVWA 1NZFA 3JAWA 2FX2A 1YVUA 3GVCA 3MJTA 4OHUA 4RL4A 3J80A 1DEHA 3EFEA 5EKSA 2WVHA 4ALMA 1NYQA 2XA9A 3IPRA 1COWD 4QFMA 4KSCA 2CSUA 3FKQA 4G6ZA 4BLQA 2RFLA 4YMHA 4HDNA 3NWEA 1VHWA 2G72A 4UOEA 3RADC 2VJBA 1K5PA 4PFJA 2COEA 2I4IA 1JA9A 1LLDA 1SCDA 3AKEA 4OHRA 5AKHA 3RTAA 3GLHE 2BH9A 4DC0A 4KB5A 1JKXA 3EVZA 4ZT5A 2R60A 2ZXFA 3ZHYA 4FEAA 4OG2A 2ECQA 4TV9A 1P4GA 3ZQ6A 3W6OA 3KOOA 5FL3A 2A30A 2Q27A 1EFPB 2QZSA 5AOCA 3DMNA 1RIIA 1TFUA 2ECFA 1YRQA 4DTCA 2PWYA 3GLGB 1M2GA 3ZG6A 1P1KA 2JLQA 3E1KA 3NAGA 3TLMA 4AJKA 5C4MA 1AN9A 3QU4A 4IJVA 3LQRA 1MC5A 1P7CA 4XFKA 1GTMA 2EOAA 2N47A 1JB9A 1G5PA 3H2GA 5CLJA 2ISSD 1OH6A 2GXUA 1VB3A 1M67A 1U3FA 5C3MA 3I61A 1DEAA 2GKOA 1PZFA 3OPYB 2XWBF 4P4GA 1EYZA 3HI6A 1AK1A 1BDBA 2FMFA 2OXFA 3DD5A 4X45A 3KD2A 4HY3A 1OIVA 4I6EA 1IVSA 3R9WA 2QXYA 1LW7A 2R6CA 4D6XA 1U8XX 4CRWB 2QSYA 4QXQA 5BSVA 3SVTA 4RO0A 2DAPA 4X7MA 4YASA 3ZCSA 1EUCA 1XZFA 2P41A 3AFNA 4Y2UA 5LA6F 1Y9DA 3HEMA 4F9GA 1AK9A 4HAIA 5CYOA 1GD1O 4KI0A 1Y1SA 3TR0A 4A26A 4POAA 3MS7A 3UKJA 4B79A 4CM5A 5LP6F 1TGYA 1P7PA 4WN9B 5IKPA 5GGYA 3UH0A 3NJRA 2C7PA 1ZUWA 4S1TA 1SHZA 1N3BA 4PLPA 3DTVB 5DNVA 4ZCQA 4HGOA 1K9SA 3ZY2A 1NF3A 2IJGX 3K4HA 3B48A 4RENA 2YY6A 3HDQA 2D2VA 2WF6A 3HA5A 2JGMA 1JJBA 3HRKA 3ZQUA 5AW6A 1DAHA 4PAOA 5EINA 4IP0A 2B7CA 1O08A 3LPAA 1VG1A 3FPBA 1SELA 1Z07A 1XQVA 3W7BA 4PANA 3H8WA 4N3BA 2R751 1F2UB 2AOTB 3LA6A 1J20A 1L8LA 2ACWA 4G0YA 4GXRA 1ZIYA 5DXAA 1FPMA 3SQNA 1H2FA 1LLUA 1Y5RA 3O8QA 1W8DA 1PFGA 3BM5A 3WBJA 4G24A 4EZIA 3A6HA 4KPYA 1USUA 4QBHA 5DLPA 4G4SO 3RE1A 4ARCA 4MKXA 1QMPA 1Z06A 4JWKA 2BFCB 1KZ9A 3N3BC 3A4NA 1F1BA 5EP2A 1UINA 3N2IA 3PL1A 1YVPA 5JH7B 1GFZA 2FMXA 3HCPA 3H99A 1U7XA 4GS5A 2PBFA 3O2JA 2GCOB 1TZMA 2AOVA 2ODWA 2WJPA 3W9BA 3DNMA 1U7UA 4QYIB 3JQEA 5DGIA 5AK6A 1JRLA 1NBME 1OR8A 5IAKA 1T2EA 1Z5NA 4BKPA 5C2JB 1WDLA 2IYVA 4FSDA 4QGFA 1KQNA 3UAZA 2P69A 3DT9A 4BAZA 4DY4A 1I8TA 3KVOA 4G0ZA 4OFXA 1Q95A 1FQKA 3BK1A 1V1RA 3HKEB 1XTBA 2VK4A 1DIOB 1X7XA 2Q6IA 1MTZA 4LGMA 5JMPA 2WDPA 3KHKA 1EWRA 2FWRA 3B1VA 5JFTA 1P1HA 4RF5A 2WLSA 2QRZA 2VSXA 2WYIA 4AJ2A 1CZUA 2RBGA 4D9KA 1F1JA 5DN9A 4UPDA 3DV9A 3Q7RA 2L18A 3DMGA 3ZXSA 5IJ9B 4WKBA 2WFZA 5FRDA 1KMHB 5IMBA 3MJEA 4JJ7A 4PIPA 4B7AA 1R5NA 1KMQA 1E9BA 4MVJM 2R8OA 1QGED 5DTIA 4F60A 3RYIB 1CUBA 4YFVA 3HUDA 3C5WP 3LVFO 5DP1A 4IDHA 3PTAA 3B1KA 3QVTA 2BKLA 3QPAA 1O96A 2QJWA 1IUOA 3IHWA 1KY3A 2O8VA 2O8NA 2UV8A 2PX0A 4B3DA 3KZMA 3DLCA 2VOEA 1C1DA 1I2AA 1LBHA 1SB9A 4V38A 3QYFA 4E5PA 4CMCA 4KQIA 1D2GA 4L9WA 2F8SA 5F5XA 1YR1A 4OKIA 2G8NA 2Y66A 3B2NA 1LSSA 1SG6A 3ICWA 1LBQA 4UM9B 2C4HA 3U4QA 3HUTA 3TNLA 3M6AA 2DERA 1NXVA 4UZEA 2XMGA 2XGGA 1UJ5A 4PYMA 2D1YA 5E9JA 4RUKA 3FPKA 4YUWA 3ICEA 1NHWA 2NSYA 3EXHA 4I5GA 4KQGA 3AJ9A 3RPEA 1PSWA 2BFFA 1KYVA 2A9FA 2XR1A 2HYDA 4FW9A 4MVCA 4AF8A 4Y0NA 4WD3A 4Q66C 4M8NE 4J7CA 4MS4B 5JZVA 2F8MA 1QK4A 1D6NA 1OZFA 4YJDA 2GDZA 4F1KA 1GTL1 2VJOA 5SY9A 1FFWA 1PEAA 2IHZA 2FJ0A 2H8KA 1NFQA