1K5DA

Crystal structure of ran-gppnhp-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling activator
molecule keywords GTP-binding nuclear protein RAN
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5dA00
1MABA 4JL8A 1Q1EA 3VU9B 3B7GA 4QFMA 1JQLB 1VYVA 2F3TA 5EP2A 2G0NA 4OL0A 2EFDB 3VHLB 1LY1A 2PT7A 5C18A 1ZNXA 1I4DD 2QENA 2P2LA 4AYXA 3AVWA 3PUWA 5JCPA 1G1MA 2BWJA 4RD1A 4IDOA 3QKTA 3X1YA 3FHCB 3PJRA 1GL7A 2J0SA 5TV2A 1Z6GA 2WZQA 5DI3B 3SHWA 3WP0A 2QMEA 4EQ6A 3B9QA 4V0LA 3RWOA 1VECA 3K0CA 1XFAA 2IYVA 4IDHA 4IVPA 1W7AA 5AJYA 1H8EA 2IEYA 2J1LA 5FFMA 2FJUA 4NL4H 4EFMA 5JEEA 4DLRA 1NY6A 1VIAA 2A9KA 3C16C 5FTMA 3T61A 3SNHA 2WMOB 1MH1A 4MUAA 4BLSA 1C4OA 1GFIA 3KUCA 2QTVB 1UBEA 4I81A 1EX6A 2CMKA 4DKXA 2FFHA 4NCHA 4TQ9A 3CIOA 4EJSC 4OI4A 2OXCA 1SHZA 1NP6A 4MGKR 1FTNA 1G3IA 3CWQA 3DHWC 3LLMA 4RSGA 1EESA 3UG6A 4LJ9A 2CL6X 3TBKA 4F38A 5L8VA 2PLFA 3I8XA 4MKHA 5AJVB 5M04A 2XTMA 1KNXA 1CF4A 1KI8A 1DAIA 1OB2A 5FL7A 1WA5A 3LXRA 4DVGA 4OJQA 3GLIB 5GJVC 4RZUA 2XJ9A 3GJ4A 3THXA 3ECCA 4DLTA 3CNOA 4HB2A 2AK3A 1BIFA 4JZKA 5FBRB 3FYHA 4NYMQ 1G5TA 4PSVA 4YXWD 4B76A 5JMTA 4Q47A 3E1SA 2O5VA 4C0SA 4QOSA 3MGCA 1VCMA 4YMVA 3DDCA 1E6CA 5EXSA 5HE9A 3C4JA 1D9ZA 5HKKA 1HYQA 3REGA 2OM2A 4YQFA 2YWHA 2FSHA 1UKZA 4IVQA 1NF3A 2EYQA 1G19A 4A1FA 4M1OA 2XTZA 3QVUA 4C0BA 5FOUA 3RS7A 1CKEA 2J0VA 4PSAA 4M1TA 4QHSA 1VG1A 4FN5A 4M21A 2Q3MA 1NMYA 1S9DA 2P5SA 3F8TA 1Z0FA 2OCPA 2SHKA 3GLFB 1UEJA 1NN0A 1OT3A 1W4RA 1SVOA 3CRVA 3QXCA 3M1IA 1CULC 2GBLA 5KPDA 1GILA 1DAFA 4BLQA 1TU4A 2WAYA 1XTIA 4RCZA 4Q9JA 1XXHB 1YR7A 1JR3A 2OZEA 3SHFA 2BCJQ 3I61A 4YXWA 2F3RA 3GFPA 1DARA 1FMLA 1PUJA 4A0GA 1HQCA 4GZLA 4F4CA 1YZNA 4KO8A 4UNRA 4IW3B 2IS6A 4DLZA 3HP1A 4DZZA 3MWKA 5FBWB 4AURA 2IYWA 4TL6A 2C03A 3THWB 2I1QA 2AKYA 2XNDA 1U0HC 1KJWA 4RKEA 2ODBA 2PT5A 5LB4A 1OPXA 4F92B 2QA5A 1R5OA 1ELOA 1QG4A 4JLBA 4NCJA 3P32A 3TMKA 1UBFA 4G0NA 3EPKA 3IEVA 2VL7A 3LWNA 3V00A 3V4FA 3H84A 4DT1B 1SZPA 2BMEA 2HT6A 3AQ4A 4A8JB 2QTFA 3AB3A 2JEOA 2QAGA 3HR7A 2IEZA 4CDGA 1IBRA 1U8ZA 2HXSA 5J4YA 4A36A 5KU1A 4K46A 2DFKB 1E0KA 3GJ3A 2F55A 1XEFA 4R7ZA 1SGWA 4OKSA 5EJEA 1TF5A 2OFXA 4HLCA 2CE7A 1N5IA 1N3BA 3TSWA 1AQUA 3EPLA 1GNQA 4LCBA 4MGZR 4D4LA 4DIDA 4DSOA 5FOVA 3KUDA 1HEIA 2B21A 4JJKA 1MT0A 2G83A 2OEPA 4Q1BA 3AUYA 3AVOA 1SXJE 3K9LA 4HB4A 3RRMA 2XGJA 2IS1A 1EWQA 1KMHB 1S4QA 1XD2B 4WZ6A 3E2IA 1U2RA 3SBEA 3W9YA 2QBYA 2GJSA 5B2ZA 1GDDA 1RE0A 5JFGA 3EG5A 2V4ZA 1F6BA 3UIEA 1OV4A 1RKBA 1Z6TA 2CL7X 4TYPA 2IK8A 3QENA 2G77B 3TUIC 1WQ1R 2FPMA 3EA5A 1P7CA 2IA5A 1U98A 3L43A 4GRAA 5F98A 2W2XA 4HUTA 1YR8A 2EVWX 2Q9AA 4JLDA 3W8RA 3TQFA 1D6JA 5KYKA 2EW1A 3I62A 3GEEA 4Q1FA 3EX7C 4QGFA 4URVR 3DMDA 4RJLA 5TVKA 1QHYA 4URYR 4MDEA 2I1VB 2CXXA 3RRNA 3BORA 4FXPA 1ANKA 4JT4A 3ZIAA 4I1SA 5JLJA 1ZW6A 2VO1A 3WMEA 2VHQA 3AF3A 1Q22A 1T0HB 2MSCB 5KSOA 3N5CA 2JJ2D 2FGJA 1R10A 3QKSB 1XPRA 2BBTA 5GJCA 2WSSA 4GMDA 4Q1AA 3X1WA 2GA8A 4TTRA 1NIPA 4RD6A 1DO2A 3GD7A 3MWYW 1G8HA 1W49A 3OEED 3UMRA 2CJWA 1OYYA 2FSFA 1VMAA 4TT3D 4MITA 4MA4A 5JWHA 1KK2A 3SJAA 4Y0AA 3CW2A 1E2EA 1VYTA 3K09C 4GBMA 2WJIA 1II0A 5FTNA 3R9IA 1OFIA 3BB4A 2WMNB 3CPEA 3BXZA 2OBLA 2XTNA 5BXQC 1L2TA 1WB9A 5E95A 2VPPA 4KFUA 2OILA 3CZQA 2C77A 3L8ZA 4MGIR 5HPYB 2WICA 2ZJ8A 4M1WA 1NIJA 4R9UC 3BH0A 1N6NA 2GESA 3G5UA 1QG2A 1QHIA 5FBQB 2IT1A 3LFUA 5LD2C 2ZRLA 2E1RA 1F3OA 3LVRE 1UDWA 2EWVA 1ZM4A 2Q6TA 4YONB 3BH7A 5DH9A 1S1CA 1X8KA 1JR3E 1JXMA 1CXZA 1EXMA 2ZR9A 1BH2A 4LBYA 2VBCA 3A1SA 2C95A 1HTWA 1E9RA 3EWAA 2XB2A 4Q4JA 3T12A 3VFDA 2VQSA 3B85A 3ZQ6A 2OESA 1SQ5A 2ZRFA 3BOSA 3CX6A 4TT3A 2P6UA 1KK0A 1KMQA 1Q57A 2GVZC 4WIAA 4B74A 2XSZA 5JRJA 2O8DA 3EWSA 2DFLA 4FWIB 3WRXC 2JCSA 2N1BA 2BCGY 4IFBA 2RGGA 3T35A 2KI5A 4GT1A 3RANA 3C14C 4ZDWA 2FFBA 2GJ8A 1IY2A 3B60A 3UK6A 3WXMA 3ZVRA 4PAQA 1M1YE 2W83A 1OXVA 5J4HA 3AEZA 1NJFA 4H1UA 1GSIA 4DB2A 2W6IA 3RABA 1XPOA 1NL3A 3RDPA 1GNPA 3RNLA 4DDUA 1G7SA 4HLUC 2R6AA 1SVMA 1T3LA 1SULA 1IY0A 2JDID 3H86A 1JPJA 1OXXK 2CNWA 2V6JA 2XZOA 2ZE5A 4PXAA 1E0AA 1E9EA 1K5DA 4QGHA 3ZD7A 1Z08A 2ZS7A 5FOWA 4Z51A 4C0HA 3PV0A 4HAWA 5TB5A 4BGDA 3OIVA 5HCNA 1H8HD 2IUTA 1TQ4A 2AD1A 2QROA 3QXHA 4M9SA 4IVRA 4LHYA 4B73A 4DHEA 2A7QA 3CF6R 3MUFA 4B35A 1GITA 1XTKA 1FQJA 4V0NA 3RC8A 4ASUA 2XXAB 2PZFA 1SVSA 2QAJA 4GP7A 4N3NA 4NYIQ 4QJ5A 3CR7A 1YQTA 5E4FA 4B2PA 4NE2A 2F43B 2X1VA 4L9WA 1G18A 5EXXA 2GXAA 2JLXA 4BUJA 1XD9A 2ZUDA 2G88A 1A2KC 2BOVA 2P3SA 3X1ZA 1EFCA 1LW7A 3SEAA 1FPMA 3VX4A 1T0JB 4Q21A 3ND8A 5H1YA 1E0JA 3AVTA 3F5FA 1DO0A 2F1IA 2HCBA 3VR6A 2OSBA 5FPTA 3IPXA 2RHDA 1W2GA 3KQKA 1RRCA 3CKLA 2N46A 1GAJA 4C3ZA 5CB8A 3RHFA 3U3RA 2J7KA 2H5EA 1SXJB 1G20E 4JSTA 2AWNA 2QPTA 2ERYA 3PEUA 4XIGS 1IN4A 5JSZB 3EIHA 5FH9A 4CVNA 1US8B 4UJ5A 1XB2A 4QRHA 1GM5A 1AN0A 1II9A 3OF5A 1QVAA 1E94E 4BZXA 4QBGB 4UQOA 1UKEA 2ZJ2A 4AI6A 3QG1A 2YKGA 5L3QA 2O0JA 1G7CA 1ZM2A 3ICEA 5AUOB 2BM1A 3GLIA 3AKDA 4K81B 2V6IA 5DE3A 2EWWA 4P32A 4IKEA 3A6PC 4JKYA 3N2EA 5KSZA 2WJYA 4JBYA 3BERA 3X1DA 4BEBA 1OHHD 3VX3A 2FX3A 3THXB 1CJVC 4LC0A 1FX0A 4FW9A 1Z28A 2ONKA 5JWRA 3TQCA 3FKQA 3WYAA 2Z4SA 3VAAA 1YJ5A 4N0DA 1S3SA 5A0FA 4EUNA 5IF9A 4Q00A 2JA1A 3EZFA 3B1XA 2VSFA 3T5GA 4G5SA 3PR1A 3VTKA 1EG7A 4C4PA 2AFIE 5FUWA 4L8GA 3SFZA 4CEJA 3GJXC 4DUGA 4IDQA 4FMDF 1YKSA 4HB0A 4PTLA 4D4JA 1G3MA 1P72A 2HF9A 4NU0A 2IC5A 1LS6A 4XJXA 1G21E 3PXGA 4CRWB 1M74A 2ZE6A 2ZSDA 4ESHA 2BMFA 1XXHA 3JZAA 4OQMA 4NH0A 3BWDD 4FI3C 3EASA 3VMFA 4TZ6A 1P2TA 1U0LA 3RAPR 1N0WA 5CDFA 3CRW1 2V1XA 2WBLC 2BKUA 4GOKA 5DYGA 4A4DA 1ZCAA 4J0QA 4P0TA 3THWA 3I4LA 3B13B 2JATA 4HZUB 5E7MA 1E9SA 4UNNA 1D2MA 1NVVR 4LJ6A 2EU8A 2B6HA 2JLWA 5CK5A 3A1TA 1XEWX 2PX0A 1QF9A 4KU4A 2WPDD 4BLOA 4GSYA 4DT1A 1E79D 1JQJC 4O0MA 3CRMA 3K53A 2HLDA 2H17A 3SJCA 1LF0A 3VKGA 3Q9LA 1BKDR 3SBDA 3NC0C 3DMNA 1AZSC 1KO5A 4PPQA 3R9WA 2FV8A 5IRCD 1OE0A 2IL1A 4ZI3A 4ZCMA 1ZBDA 3WMFA 2QAGB 4HAUA 2NPFA 3IEUA 3VNUA 1T5IA 2C98A 3AVPA 3DPUA 2DWQA 1NSTA 2CHVA 4G5OA 4KVAA 2KBEA 1R0XA 2GHIA 2R6CA 3KKQA 3AKCA 2WJJA 2ZR0A 5BN4A 1XD2A 2W00A 4L16A 3QG5A 3B1ZA 2X2EA 5JS8A 1UM8A 3KJGA 1KYIA 5HR5A 1G41A 2VLIA 2Z5FA 4IOJA 4O2LA 4TLBA 2OT3B 3IIJA 3PEWA 2PH1A 2ZU0C 1XBTA 3PIRA 1OFTA 2WVJA 1E1RD 1G4UR 2XX3A 1H65A 3C5HA 5EP1A 3RS4A 3RSOA 1ZNWA 1CRQA 3CPJB 2QBYB 6Q21A 2FN4A 4KI0A 2QZ4A 2R62A 2B92A 3BC1A 1KJZA 3EZ6A 3ASZA 4B32A 4FMBB 3MRSA 4ABYA 3KFXA 2ZANA 1XRJA 3SE0A 2J59A 4V0MA 4JL6A 5EZ6B 1KO8A 4QGAA 2J0UA 2A78A 4DCTA 2FEMA 5AR1A 4JLKA 1TEVA 4OHVA 1U9IA 5DGXA 3AH8A 1VCIA 3HR8A 3LY5A 4BLRA 1WXQA 4RFSB 3SFVA 3BBPA 4Q02A 3TK1A 4XD7D 5CJ2A 4LJAA 3MCAA 2F7SA 3U44B 4BFZA 3ICQB 3NBZC 4HUQA 2OBNA 4B3CA 3O8RA 4B6FA 1EFUA 5DHAA 3AF4A 1Z83A 4NTZA 3UMFA 1KDPA 1OW3B 2OHFA 3O8CA 1EFRA 5J4VA 1IHUA 2REOA 1FUUA 5KHOC 1JAHA 1OKKA 4TMTA 2XZPA 4W5HA 4A9AA 1NBMD 121PA 1TEXA 2NO0A 4PQRA 3L0SA 1LV7A 3OFND 4PZLA 1D9XA 2RGAA 2WTUA 3ADCA 3A1UA 2CJWB 2QUZA 4A2PA 3U7HB 3I92A 1II8B 1WRBA 1XX6A 2AN9A 3IBYA 2ZS8A 3BS4A 1AIPA 4QM7A 5IK2D 4ILEA 2NZ8A 1Z5ZA 1AGPA 5L3RA 4XWKA 3U6BA 1W1WA 2WSMA 2ERXA 3DOEA 5GVRA 3SJBA 3VR4A 2R65A 4E09A 5FUXA 3I5XA 3LVQE 2HV8A 3D6TB 1NSFA 1HE1C 4BRWA 1NVWQ 221PA 1SVKA 3HU3A 4FCVA 2IXGA 4B3XA 5CDFE 3KKMA 5SZJA 1G8YA 2AXPA 3QUSA 1TUIA 4RVCA 3F3YA 3QKRB 5CIQA 1KDTA 2DR3A 2QRZA 3EXAA 1IM2A 2QQEA 1G5PA 2ODEA 3HPQA 3NBFA 1G8PA 2FFQA 3VR1A 4DB4A 4I99A 3CF2A 3KKPA 2QP3A 1OFHA 4Q4JB 4BZPA 1ZINA 4KBFA 4MYHA 3PQCA 3W3AA 1G64A 3ZVMA 2IF2A 2QY9A 5G40A 3LAWA 1EFTA 2XNSA 3MFYA 3MSXA 3KQUA 4YMTA 3R20A 2DWPA 4GP6A 4MYUA 2XZLA 1Q3HA 1J90A 4MRSA 2HT1A 1M7HA 2O8DB 4TLEA 2ZI9A 3OESA 3U3OA 2F9MA 3QE0A 4L4UA 4HI0E 2GTPA 3GJ5A 1QBKC 4Q4LA 4TYQA 1OFUX 4AKIA 4LX0A 4M0LA 5FPYA 4MH0R 2R6GA 1KSHA 4A8JC 1QZXA 4AKGA 3DKVA 4FMCF 4Q1DA 2PEZA 3K70B 3ZZTA 4FCWA 1NKTA 3NHAA 1TMKA 3U3KA 4P4SB 5SZIA 4UNSA 4DCSA 3THYB 2BIFA 2ZM5A 3GFTA 1FP6A 2DB3A 3OE7A 1K6MA 2W6JA 2PEYA 1FNNA 2QQ0A 4TMZA 5JZVA 2YWGA 3SYNA 3AF0A 4LJYA 1R7RA 3P27A 4BEJA 5FPKA 4P31A 1E2NA 3C8UA 2ZUCA 2XXAA 1UAAA 4GFDA 3ZVNA 1P5ZB 3P4XA 5BQ5A 2IYQA 5H8WA 2BJWA 1SVIA 2F43A 1Z6YA 2HXYA 3EA0A 3M4YA 4UNPA 3FKSD 4DRZA 2FGKA 3I72A 4PSKA 2WKQA 2J0QA 4AC9A 5EQTA 4UNQA 4Q01A 4V0ME 2GEDA 3LNCA 2ZI7A 4C30A 4QBHA 1T8TA 3OZXA 3BFXA 3LD9A 4M1SA 1SXJA 3T5DA 3CRQA 2KJQA 2IYUA 3BFVA 4LSGA 5JSZA 2JLRA 4C7OB 4E5UA 3LO5A 1US8A 1XZPA 1G5RA 4HDCA 1YRAA 5K8UA 1COWD 2HJGA 1E9AA 1XJ0A 2P5TB 5FI1B 3TVDA 2JLYA 2ZE8A 3EARA 3ZLJA 1ZM7A 4QHTA 1NY5A 2J3EA 2AKAB 2VA8A 1N6HA 1T9HA 2FWRA 2HDNB 2JAQA 4O3MA 4D6PA 4G1UC 4OYHA 2OV2A 1RRGA 1UBCA 3OAAD 2IYZA 4JSYA 4TTPA 1UADA 1HE8B 4JIMA 2IYLD 4RKFA 1T3SA 4EFNA 2GETA 3OEHD 5LB2A 2ATVA 4DEYA 5CK4A 1GUAA 4RZ3A 5G3YA 5L3QB 3V4RA 4O2RA 1G17A 1W0JD 3W5IA 3MG9A 1P2SA 2X8AA 1ZAKA 2IYSA 2FH5B 4B71A 1Z0JA 2H1LA 4HAXA 3NH6A 1AKYA 2QRNA 4EPVA 4OK3A 1AS3A 2OCAA 3CX7A 2PCLA 5JS7A 1TADA 2CL0X 1DBSA 1XCGB 2GK7A 4OK6A 1FUKA 2EYUA 3K8YA 5B58C 4FMDB 1TUEA 4IFEA 1JI0A 1W4CA 4H1VA 4NPHA 4NBSA 1FX0B 3B1WA 1AGRA 2WHXA 3TE6A 1DTSA 1CJMA 4TYWA 4RZ2A 3DZDA 2OE2A 1XCMA 1GIAA 2OLJA 1P75A 5DIFA 4JVMA 5AUNB 4A6PA 4X8LA 2QSYA 3U7EB 1D2NA 1UPTA 2VYFA 2YJTD 1A2BA 1KK3A 3ZGXA 3AKEA 4CEJB 1NG1A 1W0JA 3Q3JB 5CYPA 4HYYA 2YINC 4LZZA 4TWZA 2D62A 2NGRA 2FPLA 2IYRA 3CWZA 4IOMA 1UDXA 3TIFA 2KWIA 2ZEJA 4HZUA 2RGNA 4I1UA 3DO6A 2CK3D 1KI2A 3S1AA 1L4UA 2ZETA 2V54A 4ZDIA 1BO6A 3LBHA 1IN8A 2ZITA 3GLHE 1HV8A 3K9GA 3U3MA 1G7RA 3A1WA 1N5KA 1OYWA 2BMDA 3AP3A 4DSTA 4QKQA 2NPIA 1E32A 3EZ2A 3L0IB 1TAGA 1GZSA 1ZNZA 2JLQA 1KI9A 5P21A 2ECKA 1NRJB 2NO7A 2J9RA 4LBZA 2ZREA 5KPJA 4JLNA 1BMFD 5KUTA 4OQLA 3KB2A 3QXXA 3GMTA 1AQYA 4B3BA 3VR3A 4S35A 2OAP1 3AP2A 2F1HA 1DAGA 1E2MA 3HWSA 4ZCLA 2G9NA 1G6OA 1XMJA 2FA9A 3PEVA 3IUYA 1YR9A 2ZRBA 1OJLA 3HU1A 3VNVA 4MUBA 1E4YA 1YZTA 2C9YA 1DAHA 2KSQA 4V03A 4TL9A 1SVLA 2R8RA 1OH7A 3QQ5A 1AA9A 1PLJA 4ARZA 3ZZ0A 3BFKA 1ZUNB 1R8QA 3K0AA 1A5TA 1KTVA 3W8NA 4PPFA 4UJ3A 3AV0B 3DL0A 3AVYA 4GOJA 1Q44A 1JJVA 2FSGA 4QNMA 2PCJA 3B9PA 4LYJA 1LTQA 2G0TA 3SI7A 1F5NA 2G1JA 1MV5A 4Q9KA 4NYJR 1U8YA 4H9GA 3W5JA 4A2QA 1EX7A 1E2QA 1OXUA 2ORIA 2IWHA 3ZJYA 1N6PA 4RY2A 2JJ1D 3PENA 2F9LA 2GILA 4BLTA 3QXJA 3ONWA 4LHXA 1WP9A 3K0CC 1CLUA 1XTSA 2JIZD 4ZO4A 3LRPA 2B7CA 1Q1QA 2VRWA 2ZE7A 4NCNA 2GXSA 1CU1A 4RD2A 3RS2A 1UJ2A 3IHWA 2A5YB 3K0FA 4ZIRB 1YR6A 1Z2AA 1UEIA 3NKVA 3JVUA 4RFSA 1GP2A 1I4LD 4Z8YA 3FWYA 1CR1A 1RC8A 2O0HA 2MSEB 2AK2A 2ZTSA 4C0KA 3U44A 4DLUA 4XVRA 2J0UB 3B6EA 2VH5R 5KO2A 2XOKD 1PV4A 3D3QA 4DC9A 5B57C 5K8IA 1W36B 2Q3HA 3N70A 821PA 1X8LA 5G41A 1GOTA 4AIIA 1GKUB 3KTAB 3LDAA 4NHOA 3QEJA 5IT5A 2J5XA 1W4BA 5K8TA 2ANCA 4IJMA 3TW4A 4HUQB 1KSJA 3KJHA 1OXTA 4Z1MD 4GDFA 3A36A 2ZRGA 4JLJA 4PPNA 3T06B 2IXEA 1DEKA 3CUEF 4LJ8A 1Q0UA 3PITA 4YMUA 3NH9A 2ZJYA 2YV5A 1II8A 2BHRA 2BEJA 1G3UA 2WJVA 4I4LA 5FPHA 1I4TD 2VHJA 1G3RA 2W2TA 4URUR 1ZU4A 4LY6A 2OUKA 2PZGA 1IN5A 4JYBA 4QL3A 1JEDA 1HA3A 2FU5C 2Q9BA 4C2UA 2ZXUA 3L8YA 4PHTA 1GRQA 1D8TA 4XVUA 1X86B 3BAFA 3FFAA 2JJ2A 4B34A 3U60B 2JJ8A 5CLLA 1S8FA 5BN3A 3QKRA 4D4KA 2C9OA 2WAXA 3NIBA 3PUYA 4DCUA 4XVQA 5AWFC 4LHWA 1QVRA 1HT1E 2G3YA 1YRBA 2NO9A 1DOAA 4HAYA 3C5CA 3T15A 3TH5A 2P0EA 1CJUC 1KJYA 4HLQB 3OEEA 3CNNA 1ODFA 1KI4A 5J4KA 4ACAA 2YWFA 2CCJA 2GBLC 2J87A 4F91B 4Q7LA 2QP9X 2W0MA 2KB0A 4WVFA 1RW4A 1KAGA 4AKEA 3PUVA 4U5XA 4FMCB 1NMZA 2VP9A 2ZSFA 3QPWA 5JECA 2NMVA 5A4JA 5CB6A 3EPHA 2X19A 2HJVA 1J70A 2YZ2A 3GFOA 2E9SA 3H4MA 3RRZA 3D8BA 4DCVA 4DWJA 4B47A 5GADl 3ZH9B 1MOZA 4EAQA 3M0EA 2ZYUX 2QEQA 4P4SA 2XAUA 3TAUA 4IEIA 3THYA 2BEKA 4CEHB 1ZM9A 3GLHB 1NVXQ 2BM0A 4EKDA 4Z54A 2UZ3A 1RYFA 4JVLA 1T5LA 3IIMA 3KL4A 4DLWA 2QAGC 3RLFA 3W6PA 3FHTA 3SZRA 1P3JA 2GKSA 3EZ7A 1F2TA 1ETUA 1KI1A 1N0UA 3BB1A 4D82A 2GZHA 2D7DA 2PJRA 5C4MA 3U4QA 4FINA 3SQWA 3QPVA 4M9XA 3MWJA 5ANRB 4TQAA 1E4VA 4ZKEA 4PC7A 1I2DA 2Q9CA 3FB4A 3TNFA 4IHQA 2ZRJA 2Z0MA 4X8HA 4JVSB 5EUQB 1FZQA 4CF7A 4IRUB 3UXMA 4WW0A 1XPUA 2LKDA 3QJYA 5HZHA 3C15C 4OJKA 4TSFD 4KFTA 2QPAA 4RFVA 2B8WA 2YNMA 4CGZA 4C7OA 5JI3E 4F4IA 5F9FA 4PC1A 2JDIA 2OO7A 5EXPA 2OXRA 1KGDA 4KYIB 1D5CA 2ZJBA 4P4UA 4BQSA 4JLAA 4DBLC 3VHXA 1E2LA 3SJZA 2BBWA 2DFNA 1UFQA 1H8HA 3C7KA 1DAMA 3UWOA 4ZKDA 2QSZA 5KNCA 1RFLA 5TARA 4TQUS 4UXHA 1ZVQA 3U2QA 4BFUA 1MO5A 4A2WA 2GAAA 5AK0A 2H57A 1UKYA 1F2UA 4QGGA 3IBGA 4C0JA 2VP2A 2ZROA 3EC1A 1KI6B 3QBVA 4QBIA 1TF7A 3IDQA 4Q4HA 2FNAA 1JBKA 1TX4B 1DELA 2D06A 4OHWA 4D81A 1HH4A 4M4SA 2UZIR 4WA7A 3NBYC 2IHBA 1S9HA 5J5CA 3A58B 4KAXA 3TLXA 4DDTA 621PA 2Z43A 2ZSBA 3MMPA 4NONA 5JBQA 2RKOA 1DS6A 4WXPA 1NJGA 3RRYA 1GL9B 2PLRA 4PR0A 4X8MA 4F93B 1JR6A 5JWOA 4WBSA 5LDDC 1LNZA 4URXR 5D3MA 4UXJA 5KTYA 3H1TA 3AKYA 5HTKA 3IILA 2IS4A 3A8TA 2RGEA 1R2QA 3CONA 1ZNYA 4N1AA 3Q8XB 5CITA 2A5GA 1P61B 1IXSB 4MRNA 3LH5A 4DSNA 1YHNA 3FMOB 3T1TA 4AYWA 1WCV1 3RVBA 4JLOA 1CP2A 2Z4RA 2O8EB 5H68A 2QT1A 2YYZA 4CT4B 5DLQC 1VCOA 5GJBA 2UVQA 5C4GB 5FUVA 4KLNA 2O8BB 5CIWA 4LV8B 2J45A 3AVQA 3FMFA 2FFAA 3UWKA 3LQQA 4A82A 2FSIA 3U7GA 4B43A 1N6LA 1PLLA 1KZ7B 2BC9A 3KDSE 2CCKA 1Z22A 1XP8A 4XWOA 2WM9B 2KBFA 1Z0DA 2HYIC 3ADDA 4TLDA 4TMWA 1MO4A 1ZJ6A 1U94A 2R6DA 1IXZA 4PQFA 4EIWA 1R0YA 5KNDA 5CM8B 1TL7C 2P67A 1HURA 2LWIA 1BS1A 3D7MA 4HDQB 4MRPA 1OHHA 1OH8A 1GTVA 2V8OA 4G5QA 5KDOA 4CT5A 2H8KA 2V7QD 2FZ4A 1PLKA 3MJRA 3UKDA 2VSXA 1V43A 1ZYUA 3WBJA 3WY9A 3B2EA 4JMPA 5BYKA 2WOOA 3K0EA 1RIFA 5KSPA 3S1AB 3ZS8A 3AF2A 1VHLA 4D0NA 2TMKA 4NZYA 1KDRA 4Q1CA 2ZUBA 3CO5A 3GEHA 2WWXA 3A4LA 3PCRB 1P2UA 4I1VA 4P4TA 2IX3A 1E1QD 1GL6A 1Y63A 3LW7A 2ZRNA 5DN6D 1BYIA 3F0TA 3Q85A 4BLPA 1Y3AA 3K70C 3IQXA 2R6FA 4IXNA 1J8YF 3VKHA 2GVDC 2GXUA 3JVVA 4GL2A 1XJCA 3K9HA 2NO6A 4UKDA 3LA6A 1Z0AA 4WOPA 4A0RA 3E5HA 4TMXA 1J2JA 2QMHA 2D7CA 3ZYCA 2ZQ5A 4ZDKA 1Q20A 2ZJZA 3B78A 4ZV4A 3SYLA 1TQDA 3W6OA 2A30A 1FTSA 1P9RA 3QXSA 1E2HA 1N2CE 2ZJOA 1LVGA 2V7QA 2GJKA 1W44A 3PUZA 3QEOA 2HEIA 4PZZA 1AS2A 1P9NA 2H92A 3GJ8A 1E98A 1J8MF 1X3SA 4JBXA 2C04A 2H18A 3CBQA 1NVUQ 2PX3A 4ARZB 2CHGA 2H16A 2Z6VA 1G6HA 3K0AB 4FWTA 1N5JA 2WPDA 1KI7A 3HYTA 2CLCX 1J7KA 1U99A 4TTQA 3W6NA 1E79A 4M9QA 2R44A 3MD0A 4EFLA 3Q7QA 3DZ8A 1AK2A 1F60A 1TNDA 2J46A 2JGNA 421PA 1OIXA 1R8SA 4ZIRA 4F4JA 1ZD9A 3SC3A 1ONBA 1AM4D 3ZZUA 1MO3A 1WBDA 3LBIA 2NIPA 5DNYB 4PQYA 3BH6A 4HB3A 1TPZA 4HSEA 1E9FA 2AHOA 1E9BA 2LKCA 4PX9A 3K0FB 4AY2A 1Q21A 3KTAA 3T1QA 1EWRA 2GCPA 1R5BA 1DVRA 4TLAA 1KSGA 5A5GA 1IAQA 1XMIA 4L15A 5HE8A 5FR1A 1MRNA 2LCFA 4ITRC 4LGMA 3NBXX 2QMUA 4JL5A 4LJ4A 5CJPA 3KKNA 4B33A 2OG2A 4GI7A 3U3JA 1BOFA 3RWMB 1E1RA 3UANA 2X77A 1KKLA 2PL3A 2ZVPX 4MYTA 4AG5A 1N5LA 5JJKA 2Q21A 2RH5A 8OHMA 4PHFA 2IHYA 3QI2A 4LRWA 4EJSA 1OB5A 1OXSC 1JB1A 1LS1A 4IDPA 521PA 2GCNA 4IOKA 4C0AC 4Q48A 4U02A 1YZKA 3A4NA 5CM9C 3TSZA 2DYKA 2FDCA 4G5RA 3NC1C 4XSHA 4CZ2A 1YZUA 2D2FA 1QHHB 1P9WA 3DM5A 1X6VA 1ZC3A 4G3XA 4XD7A 5GJWC 1YVDA 1VG0B 4Q5IA 5HCIA 2JLSA 1R0WA 3E70C 5IHPA 4V02A 1Q1BA 3B5JA 1I2MA 1L8QA 1JECA 1XNJA 5KSYA 1XDBA 3HU2A 4A92A 4AYTA 1CRPA 2P6RA 3A1VA 2GCOB 3CB4A 1NBMA 4W5JA 1CJTC 2ZRAA 1R6BX 3OFNA 4OI1A 3ZS9A 3GJ0A 2O52A 3FTQA 1JNYA 4KFSA 4KYUA 5F9HA 1RJ9A 2W58A 4YDHB 4PAMA 4BECA 1XTRA 3TJZA 4JYCA 2RB4A 5E3HA 2GEVA 3SQXA 2C8VA 1FMJA 3HYRA 1N6RA 2O8CA 2IYXA 5AJZA 5IK2A 4OQNA 1N0VC 4YLGA 2Q3FA 4R2IA 3TGPA 5ELXA 2V3CC 1HQYE 5DISB 1FNMA 1P6XA 4CEHA 1N6IA 4LJ5A 1Z29A 3GLHA 1TU3A 2ZRCA 5F2EA 3CX8A 2C9CA 2GZDA 4HZIA 4YDSA 4ZDJA 3LW8A 4A0FA 1QHGA 4TL7A 5TMPA 2BJVA 1IQPA 4RD4A 1Z06A 2WKPA 4LDJA 3UPUA 2QT0A 4PANA 2IYTA 1UBGA 3HDTA 2IUSA 1M34E 1E0SA 3JZMA 5G3ZA 3SS8A 5DO9A 1FFHA 1EK0A 1P62B 4B6EA 4EPTA 1YE8A 4MQBA 1KAOA 4LV5B 2FZLA 4DLYA 1F2TB 4TZ0A 4PC6A 2PJZA 3B8HA 4PFSA 3U4QB 3QY0A 2VIIA 1ESMA 2OCBA 2R2AA 1QHNA 5LPNA 4C2TA 1VKJA 2CBZA 4JLPA 4M1YA 2Z83A 1NNEA 2DCUA 4NYJQ 3BGWA 4XH9B 3ASYA 1A4RA 2ZPTX 2GWHA 1XCPA 4TL8A 4JT2A 2F1RA 1HY3A 2PZEA 1DAEA 1PZNA 1Z8FA 3W34A 2BMJA 2ZAOA 1OIVA 5EE3A 2WIBA 2JLUA 2CHQA 3UMSA 4KODA 4CEIA 4NCKA 3NDBB 2OFWA 4M22A 4POAA 2QN6A 3IIKA 5C2JB 2ZVQX 3IO3A 1KI6A 3NWJA 1W36C 2IF0A 1U9IC 3NTUA 4E07A 1WE2A 4LYHA 2DBYA 2ZJAA 3AVXA 2VTKA 2BVNA 5FL7D 4MKGA 3FKSA 1DE0A 1GG2A 4R98A 1F2UB 2ASEA 3NG1A 4DJTA 1MO6A 3Q7PA 3WMGA 1IN6A 2DHRA 4Q4HB 1OSNA 4B2IA 4C0LA 3O8DA 3K1JA 5C46F 1KOFA 1ZMXA 2WWFA 3ADKA 3PUXA 4FCTA 4JKIA 4BFXA 4DCNA 2ZRKA 3TUZC 3QF4A 4KVGA 2YOHA 4OI2A 5HKKD 3EIQA 721PA 1RPZA 2NG1A 4DDWA 1CTQA 1COWA 5DSZA 5D3MB 4ZPXA 5JJLA 3QKUA 4S2EA 5F3WB 1DG1G 4A0HA 2O8EA 1Z2CA 1X1SA 5AJXA 3FOZA 3TRFA 4HLDA 5BW8A 3KFVA 4CYMA 1E2FA 3CRRA 4PZYA 2O8BA 4Q4AB 1P73A 3OAAA 4KLZA 1NBME 2JASA 3IKJA 1KI3A 1KO7A 3AVVA 2WJHA 3W90A 1AKEA 1W46A 2CCGA 3OEHA 3K09A 1JR3D 1RZ3A 2EFCB 1Z6AA 2WWYA 4BPBA 1NN3A 2RGXA 2RMKA 2WKRA 3BB3A 4DIEA 4TYNA 1XEXA 1E2KA 4A15A 2ZJ5A 5JCZA 1QRAA 2EFEB 1XMVA 2H7VA 2ZYTX 3ADBA 3QVVA 2XNDD 3FMPB 5E7IA 4ZCIA 1G9XA 2YC2C 2AWOA 3GP8A 3T1OA 5EE0A 1SKQA 4KSCA 1FL9A 1S0UA 2QG6A 2GXQA 3QOFA 4M8NE 3RSLA 1E3MA 4DDVA 3FGNA 3TVTA 5EE9A 4IXMA 2VP6A 2FF7A 4I1OA 2VF8A 4IEEA 4OBEA 3LXXA 2RGBA 3NEJA 1CIPA 1M6NA 3I32A 4LC1A 4L9SA 4OQFA 3ZQJA 2OCYC 2QE7D 3EC2A 2X2FA 2QM7A 1TTTA 1G16A 2P6NA 3A37A 1JPNA 1SVWA 1E2PA 2D4HA 3U6KA 1JALA 1KNQA 4E03A 4LUCA 2CLDX 2GF9A 3KQNA 3KKOA 3AM1A 3CH5A 5EZ5A 1G7TA 3SR0A 4D80A 2QNRA 4LBWA 3LBNA 4LI0A 2WWGA 3WRYC 2CK3A 3KXLA 1U0JA 2C2HA 2XITA 4AG6A 4AK9A 2VHTA 3I1FA 4HLUA 4BE7B 3AVUA 1P2VA 4NCIA 5L3SA 2CEAA 2CE2X 3VKWA 4DLXA 1X8JA 3IHLA 4L5BA 1G8FA 1R4AA 3QNUA 5AUQA 2FMXA 3G82C 3WYFA 1A7JA 1GKIA 2Q0HA 1XU4A 1ZD8A 3LLUA 4M9ZA 4MYCA 4MRRA 4RD0A 5AJWA 2QE7A 4UXIA 1G3QA 5H70A 4Q1EA 4MKFA 1BMFA 1XWIA 2QTHA 4BWYA 1MR3F 2HYDA 4Q7KA 4XWAA 1SXJC 1ZCBA 2VP5A 3SN6A 1N25A 3QSYA 3BJIC 1XF9A 2D3WA 3CH4B 3H2YA 3B1VA 1ZRHA 1CR0A 5FTJA 4II7A 2RAPA 5FOXA 3ZIAD 3PVSA 2IXFA 3I3SR 4YMSA 4RCYA 1CEEA 1M8PA 2J7PD 5J40A 4QBFA 3TW8B 3GJ7A 1Z0KA 2W2VA 2RGDA 5IDVA 2VEDA 2WSSD 2VP4A 2NO1A 1DG3A 3DOFA 1Z3IX 1T4GA 3R8FA 2C99A 4US1R 1XMSA 1XTJA 2ZRDA 3SDZA 4R71A 3BE4A 1GVNB 2GF0A 2E87A 3AP1A 1BYUA 2O0KA 2RHMA 4KV9A 2JJ1A 1ZIPA 1DPFA 1RRFA 2YVUA 2FE4A 2JIZA 3KZ1E 3CZPA 3O47A 3QF7A 2VP0A 4QXAA 2ODNA 3RS5A 3MJHA 1GWNA 5JHHB 3KJIA 1W0KD 4EJSB 3BRWD 3U61B 1QHHA 4LJ7A 2V1UA 2J7PA 4WZBE 4LYFA 1FP7A 1XD8A 1RRPA 5DI9A 2HUPA 4JJZA 3WHLA 4TYYA 2A2ZA 3Q72A 1NLFA 4B48A 4Q7JB 4D0GA 2A5FA 2XOKA 4NMMA 1ZUHA 3L82B 3T34A 1ZC4A 3K0SA 1XTQA 5KDLA 2DY1A 2NQ2C 3VQTA 2GDJA 2B8TA 2DWOA 2XJ4A 2OAQ1 2YOFA 2ZI3A 1TQ2A 3FDIA 2XSZD 3EW9A 4OHZA 2GCOA 4BFYA 2L0XA 4Z1MA 4NYMR 5CYOA 4WZAE 2R9VA 5FUYA 1O87A 4LWZA 4ESVA 2HCJB 4V0OA 4MDFA 5JRZA 5JHGB 1KKMA 1W47A 2QM8A 4R2HA 4QJ4A 1T3HA 4U7DA 2FOLA 4P33A 4JLVA 4FIDA 4OI0A 1B23P 3GLGA 5K8LA 1W0KA 3H0KA 4KCGA 4LK2A 1X1RA 2RGNC 3K70D 2ORVA 3TKLA 4QM6A 1QHSA 1VYUA 4KFRA 2W6ID 2OLKA 1NVVQ 2ZRMA 1RJ9B 2PMKA 3R7WA 1Z47A 1OIWA 3DM9B 1IJEA 4KITB 2CNWD 1B0UA 4IOLA 4DXAA 3FMIA 5J4LA 3NEYA 2O8CB 5KNBA 2WOJA 4US2R 2P65A 1U8AA 1ZU5A 2CVFA 1EFHA 2EQBA 2ZI6A 3RC3A 4US0R 3P1JA 3LX5A 1G4AE 2ZIAA 3R8CA 4EPXA 2W0SA 2B7BA 5EUMA 5L3VA 3VR5A 2ZI5A 2NZJA 5KOYA 1W5SA 1XZQA 4ASUD 3QBTA 3EAQA 3BK7A 1RVDA 2REBA 2WWHA 4JBWA 3I5YA 1FQKA 2I4IA 1AJEA 1A82A 1E99A 5FL3A 2YOGA 2FG5A 1SKYE 1WDTA 1VCNA 3I73A 1YZQA 4B44A 2RGCA 4HEJA 4D4MA 2ZRIA 3REFA 3THOA 1A1VA 2OBMA 1JEEA 4W9MC 1E9CA 2XEXA 1E2IA 4DLVA 4OHXA 4PC3A 2ORWA 2RCNA 2D2EA 1PJRA 4HAZA 1P4SA 3ETLA 5FI0B 1E9DA 3N2IA 3PFIA 4Q9HA 3KQHA 1OLOA 3VU9A 4U00A 2AX4A 2ZS9A 2CLSA 1L7VC 2D74A 2A5JA 1E69A 2O8FB 2AL7A 2QL6A 1TF2A 1JJ7A 4FD2A 1MABB 4GZMA 4W5WA 3WHKA 4DLSA 2VHUA 4P3YA 4W7SA 5TDHA 3FVQA 1N6OA 1KSFX 1V5WA 3U5ZB 5DI3A 3LQRA 4ERNA 4CEIB 1FOEB 4LPKA 4YMWA 1KY2A 1N6KA 2DPXA 5EP4A 3TR0A 2MMCA 5DYIA 1KHTA 2YWEA 1RYHA 3EZ9A 4QNRA 1T6NA 2G1KA 1ZIOA 3LX8A 1NI3A 4EQ6B 3WNDA 1KIMA 4Q18A 5FOTA 5TY0A 5BN5A 2REXB 4YC7A 4EDHA 3KJEA 4TMKA 4LBVA 4TSFA 3B82A 3L2OB 1ESNA 4KJZA 1C9KA 5JJIA 4URWR 1GKYA 1G8GA 2GZAA 2ZYWX 3BIFA 1XJQA 1IONA 3HPRA 4O25A 4BFTA 4AKHA 3CPHA 1S1MA 2ZSAA 1G291 2MSDB 4OHYA 2EFHB 2OFOA 5KDDA 1Z0IA 2QU8A 3QF4B 1VG8A 1YZGA 3M6AA 3Q5EA 4Z8XA 1R5NA 3WYGA 4DUGD 5E7JA 3TAHA 1Z63A 3ZD6A 4Q4AA 1PUIA 3OIWA 4B3GA 3UATA 4URZR 2GAOA 3ZDQA 2KE5A 3LV8A 1J99A 4TN1A 4OK5A 1HT2E 2F6RA 1MRSA 3TUJC 1C1YA 4Q7MB 5B30A 1D2EA 2J41A 5D3QA 4KXFB 1W2HA 1WMSA 2JLZA 2ODWA 1Q12A 1VDZA 5FTKA 4BASA 3KXKA 3FFBA 3A4MA 3ZVLA 3KB1A 3GLGE 1LF5A 4G5GA 2BKEA 5FTLA 3PEYA 1CR2A 2WV9A 3G0HA 4CIDA 5HZKA 1KO4A 1QDEA 4D2IA 1NLZA 1KDOA 4JVNA 2YHSA 4DSUA 3UG7A 3RS3A 2IUUA 1VG9B 4PHHA 1XEXB 1NKSA 2A3RA 4CW7A 4NKRA 3SOPA 1Z6XA 1U81A 4X8OA 2BBSA 4D0LB 2WIAA 3V9PA 3GCGA 1F48A 2BBOA 3HJNA 3IGFA 2Y8EA 3GLFA 5LD2B 2HLDD 1U90A 3O8BA 2UKDA 4KHZA 1DAKA 2HF8A 1IN7A 2GNOA 1SHKA 3WBKA 2BV3A 1NLYA 4PHGA 3DEFA 3J81k 4QC2A 2AD5A 4LHVA 3X1XA 2C5LA 1S96A 3FE2A 1CR4A 1OF1A 4C0QC 3KXIA 3WNCA 3AGPA 4ON9A 3MWLA 1S2MA 4LV6A 2K5UA 4MKIA 4M2LA 3AF1A 2FEOA 4PC2A 5TXGA 4EPYA 5GVSA 2PMDA 4TMVA 3L0PA 3IPYA 4A6XA 4QG7A 1Q3TA 4PO9A 2CVHA 5AUPB 1JAIA 1NG9A 2BDTA 4AD8A 2CDNA 4NDZA 4B3DA 2C96A 2GJ9A 3KX2A 3NDPA 5FBVB 4K8OA 4ACBA 2GJAA 4A8JA 4HAVA 1ZM3A 3P26A 3P20A 3X2SA 1E96A 1S3GA 5C1BA 3TSOA 2QGZA 3SU8A 2ZYVX 3GJ6A 4NP6A 5FOSA 1NMXA 4WXRA 4IDNA 4XTCS 5L3SB 5FBLB 1E1QA 4GPTA 4XOIA 4M1KA 4OQXA 5DN6A 1WF3A 3L0OA 1SKYB 1O3YA 5EE1A 4B3FX 2IBMA 2QP4A 1UF9A 1W4AA 4PO8A 1GRRA 1W36D 4C9BA 3DVLA 4Q03A 5BYJA 3MAAC 4LHZA 4MRVA 4WAUA 3GQBA 1M7BA 2GRJA 2VSOA 3OIYA 4MGYR 1OH6A 1YU9A 1FW6A 3MLEA 3U7FB 2NTYC 1KMHA 4M53A 3CR8A 4NYIR 5B64A 2ZU6A 5J47A 2ZI4A 3OHMA 3WNBA 5JI2E 5DHFA 3VR2A 3EPJA 1IXRC 1KZGB 3B1YA 1E2DA 1EFRD 4XTRA 2FPKA 1Q1ZA 1T8UA 2A5DA 2QI9C 1OKKD 1CJKC 4JS0A 2XB4A 5SZHB 4GNKA 4G01B 2GK6A 3RS0A 4EPWA 4Q19A 1DADA 2V55B 3FHOA 2JLVA 1JXOA 2ZAMA 1W48A 1OH5A 3WP1B 2ANBA 2ZRPA 1R0ZA 2VF7A 3C41J 3TR5A 1YZLA 2C78A 3IO5A 1PVOA 2DFTA 3Q5DA 4BFVA 3GLIE 2QORA 3KQLA 1ZD1A 4PO1A 4D26A 1CBUA 3QKSA 1AZTA 1ZUIA 1IY1A 1IJFA 1Z07A 2QMOA 2ZR7A 1W5TA 1VPLA 3NHBA 3QIAA 1AS0A 4KSBA 1XEWY 5FPSA 2AXNA 4HATA 2V9PA 1KO1A 2WJGA 4RZXA 3K9NA 2PBRA 1LFDB 1KY3A 1K5GA 3NXSA 1GNRA 4M1MA 5LBIA 2N42A 4E22A 4QJ3A 4N0EA 4JLMA 4F7WA 1GRNA 4KBGA 5JEDA 1QHXA 5BWMA 1E2JA 1L4YA 3DKPA 4LPSA 2NOAA 2GEUA 2QGNA 2I3BA 3FPAA 2G6BA 3GLFE 3CNLA 3AUXA 1T91A 2IYYA 2ONJA 4Q9IA 5EXTA 1E2GA 3CF0A 2QPOA 1KK1A 2ZRHA 4XSGA 3EIEA 2YC4C 5EP3A 3GEIA 1XXHE 3T1VA 5FR2A 3GLGB 4BFSA 2ZSEA 4RD3A 1CS4C 3ND9A 1VTKA 1M2OB 3PG5A 3QPUA 2F1JA 3OIUA 4B75A 3R7WB 2EFGA 1MKYA 1NN5A 2WWIA 3R9XA 3OE7D 2W6JD 3NVAA 1IOZA 4B2LA 1UKVY 4BFWA 1P60A 3CLVA 4GOXA 1EGAA 1ZP6A 3I8SA 4BRUA 4EPRA 3W3ZB 4GMXA 5CLQA 4AWXA 2IS2A 3SYKA 1K8RA 3RYTC 4TLCA 4Q9LA 4BZQA 2VHCA 1LB1B 1VIYA 4LOAA 5UKDA 3AGQA 4V0KA 2IW3A 1M7GA 2AFHE 4ZI2A 4LYAA 5EE5B 5SZKB 4DEXA 2IWRA 4D25A 1HUQA 1TQ6A 4PPGA 3BD9A 2AR7A 3IQWA 3CM0A 5G53C 1SXJD 4PAOA 4Y0VA 2WWWA 2ATXA 4Q66C 4QHYA 3GPLA 1H8ED 3P4YA 1WBBA 1NN1A 2O8FA 1VHTA 4HDOB 2MMGA 3D31A
chains in the Genus database with same CATH superfamily
1L5VA 1MABA 3HDGA 2PYZA 4JL8A 3IMCA 2CVOA 1SO8A 5E9WA 1DKLA 1JQLB 1VYVA 4QFMA 5FNZA 1DMRA 5EP2A 2F3SA 1JIQA 1TAQA 2G0NA 1P8AA 1SCNE 2EFDB 2NV2B 2UZAA 4OL0A 2PT7A 2BGRA 2DQSA 3HCDA 4PBTA 3VHLB 2XUJA 4CL8A 5LOVA 3N53A 4BMCA 1BAPA 2XUQA 1G1MA 4JI5B 2BWJA 2I2BA 2YYAA 5I9LA 1T15A 4YRZA 1FS4A 3N58A 3PJRA 1SY7A 1XMXA 4GOND 1Z6GA 2Z9BA 4YLEA 1INLA 4UBKA 2HMUA 1PO7A 5DGIA 3D8SA 3ON5A 3RWOA 1JEYA 1I7DA 3JPWA 5KYUB 4FHGA 1W7AA 5DTQA 5A5EA 1E8DA 5FFMA 4EFMA 2JCGA 4HBZA 3PFHA 4L72A 5CBPB 4DLRA 1RZVA 3DV0A 1WWKA 4GRDA 2OD2A 3RTGA 5BPFA 1MH1A 1YWGO 3ZX4A 2R6ZA 1GFIA 1Y98A 1UBEA 3CVVA 2BI7A 5E6UB 4J1NA 4OB7A 3RIYA 2Q99A 4TQ9A 3DWFA 1T6BY 3CIOA 2BMVA 2BGNA 1U63A 1GQFA 1TIBA 1G2PA 2JKZA 2QUKA 1YNSA 2IEAA 3T7KA 4F85A 1OGIA 2AF3C 2H29A 4WADA 1Z13A 4P84A 2OXCA 1RQNA 3DF9A 3T3PB 4MGKR 5KTSA 4MV4A 3QE2A 4AUKA 3ABZA 1S2DA 2CL6X 3QV2A 1A5SB 1PDVA 4Y2UA 4F5EA 7AT1A 4LWQA 4MKHA 1IK6A 2XTMA 1A9XA 3ROMA 1E6MA 3ISJA 2DSTA 1KI8A 3M6MD 4TYMA 5SY6A 3WYCA 1RZRA 1OB2A 5EMHA 3LXRA 4DVGA 2HMAA 2DJIA 1Y6RA 3GLIB 5GJVC 2EL7A 1VSQA 2X0NA 1S3IA 3DTTA 1DBPA 2NYRA 3LCCA 5TPZD 4HLNA 2VHVA 4BN4A 4KQ6A 2XWBF 3FSGD 3T7SA 4E2FA 3O1IC 4KXLA 5THKA 3DFZA 4C0SA 1GHTA 4GX2A 4D45A 1RMTA 1V41E 3MB5A 4OHUA 2OHIA 2C07A 4ENWA 1R6DA 3B9RA 4B6GA 1D9ZA 1X74A 2ZUEA 3REGA 3STXA 3TDKA 4JP8A 1EK5A 3KJNA 2YWHA 4YQFA 4IVQA 5MN4A 2D1SA 4XLZA 1WQ3A 1QH8B 3QTLA 4NV0A 4WZAA 2EYQA 5DCLA 4YRPA 3SKXA 4FNMA 4NEHB 4KR9A 1Q92A 2HTEA 4C0BA 4GEGA 1PGJA 1RZUA 3RS7A 3QEKA 3RTAA 4PSAA 4QHSA 1OUMA 2C92A 5JE8A 2IXAA 5LUBA 2Q3MA 4WACA 1NUUA 3F8TA 1Z0FA 2LE0A 2JKYA 2OCPA 4TKMA 4X1KB 5HW0A 1OT3A 5C8DA 3JZFA 2I6FA 3HVKA 4IXWA 4EO9A 3WLAA 2FEAA 1DBRA 4RNCA 1CULC 1JZTA 2NZVG 2ZCVA 1GILA 1DAFA 4B4WA 1K92A 4BLQA 1XTIA 1MVLA 3WYEA 3NLLA 5AQ1A 2BCJQ 4MYDA 2JNWA 4NU8X 3EXIA 1GFSA 1SC4A 2CLKB 1I4WA 1H2EA 1FMLA 1VFPA 1CY4A 3GFPA 4X6UA 4A0GA 4KO8A 1A2QA 4LNAA 3DE3X 3WLFA 5FBWB 2VRCD 4AURA 1VL5A 2CMFA 4OP1A 3THWB 3HWWA 2HRDA 2AKYA 1R4NA 3C85A 1FNCA 2PT5A 2XH8A 3DCNA 3H8WA 3N86A 4N41A 1OPXA 3OQIA 3NVMB 1YCGA 1UC8A 1RXEA 1ELOA 1QG4A 4K9DA 4UDNA 3TMKA 3HXLA 1UBFA 2KLBA 3GQVA 4L5CA 3V00A 5FPPA 1K98A 2HT6A 2EKZA 2C0PA 4E5DA 3HM9A 3PTZA 4GX0A 1E4OA 3AB3A 4FDUA 4MWTA 4ZXPA 4R8MA 3OI7A 4LDNA 1QTIA 4YMHA 3O83A 1IBRA 1RWKA 3F46A 1JDBC 4JXKA 5J4YA 3OOJA 3GCWA 1KBZA 3NRJA 1XEFA 1GGEA 1HLFA 4NOLA 1TXGA 1AMOA 1PJCA 4DMLA 1SGWA 4BV9A 1FEZA 4Z7OB 3DOCA 3DXXA 1KAMA 4JI4B 3TSWA 4AMGA 2G07A 1AQUA 3VHQA 1BRMA 1E4EB 3G8BA 4E6EA 1WS6A 2PUDA 5FOVA 1VA4A 4KQWA 3DXFA 4Q1BA 4JBLA 4U1RA 5ARDA 3TBHA 2QL9A 3AUYA 4HB4A 1SXJE 4A03A 4BNHA 2R4QA 2O3UA 1S4QA 1XD2B 5G2OA 3AY6A 4HSGA 3BTVA 4J0DA 1FDIA 3EDCA 3EG5A 1SK9A 2V4ZA 2OQVA 5JFGA 1H4VB 4CKYA 1OV4A 5ICSA 1P3DA 1U7UA 3AEQA 3O4VA 3QENA 1QZUA 4U7GA 1PFGA 2HSEA 4CKZA 1XAGA 3BDVA 5ITWA 5JZ9A 2A1UB 1CF2O 2ISQA 4HADA 1P7CA 4PHCA 2OA0A 3VR0A 2MSKA 3PYMA 1M5UA 4HUTA 1T25A 2XE6A 4EA8A 1B1CA 5EIBD 5GQSA 4EA7A 5KYKA 5I7OA 3T8YA 1ZESA 1LSOA 2C3OA 2SCUB 3B89A 2A33A 2QN7A 4Q1FA 4Z86A 2AA3A 5DYTA 4MP3A 3DMDA 4CFYA 4URVR 1X80A 2Q6KA 1J23A 5TVKA 3E9MA 1QHYA 1PQYA 1YDFA 3STHA 1WTAA 3ZDZB 5TPWB 4Z3OA 3KLBA 4MDEA 4MPDA 2BFBB 1JTFA 1OVGA 2QAIA 2VZ0A 3A6GA 4I1SA 3WMEA 4F1WA 1WABA 3EH1A 5DLYA 2VHQA 4MPTA 1MEOA 2MSCB 2PPLA 5EWLB 3RBXA 3QKSB 3ANTA 2WABA 1XPRA 4EB6B 2W8BA 2Q0XA 2WSYB 4TTRA 1NLMA 4ND8B 2O48X 2PU5A 5AW2A 1P1RA 2QJFA 4DMGA 2YVKA 4YDRA 5BSVA 3MWYW 3GEMA 3KKZA 5CYGA 3FPSA 1VKZA 1IHOA 1Q1AA 4K87A 1E3LA 3SHVA 5K0NA 1JQBA 1AG9A 2E55A 3FYUA 3GT0A 1NW5A 1JKFA 1MX5A 3GIDA 3SBEA 1U7OA 3K09C 4RKQA 1QNLA 2WJIA 3KJXA 4QSHA 3R7BA 3R9IA 1VBMA 3BB4A 1U2DA 1HMYA 1I94B 2V3WA 2NSLA 4AUNA 1GGMA 2XTNA 5DNUA 1J2YA 1L2TA 1LW6E 1LPNA 3DLCA 1DNPA 2ADFA 4KFUA 4L4RA 4JODA 4S1NA 5T64A 4N0QA 1PJLA 2ZJ8A 3PNSA 5ALGA 1LTHR 4M1WA 4R9UC 5I4IA 2DBVO 4RX1A 4EEZA 1QG2A 1QHIA 3H1PA 3ZWKA 2R5NA 1G6KA 3JQPA 3LFUA 1V5EA 3ROFA 2C5BA 1T4BA 2E1RA 2ZRLA 3PXDA 2A0YA 1ZIXA 2Q6TA 4LE1A 4PGGA 4V24A 2W2KA 5DH9A 1T0UA 1TUGA 2VYVA 3UAXA 4ECAA 1EM8B 1UXOA 1JXMA 1EBUA 2ZR9A 3O7WA 1VCHA 3KT3A 4G0OA 4X85A 3RHTA 1BH2A 3SS7X 1S7CA 2EBFX 2QVLA 3QPBA 1HTWA 3G2HA 1DRJA 1U5AA 1PNRA 1P1HA 4X1IB 3EFHA 1N3YA 1N9KA 2F64A 1JA0A 1WZEA 3P2EA 3GVXA 3KHSA 3DE0X 1KMQA 2GVZC 3BWYA 3IP1A 4WIAA 5B58T 3TPFA 5KYVA 4B74A 4DIOA 3OCUA 5K3CA 3G5LA 2JFPA 2O50A 3TS1A 4LFAB 1W87A 1HT0A 2K87A 2JJQA 1OTHA 4MRMB 3SLRA 2N1BA 1ADFA 2R1TB 3PNBA 1YZHA 4BS9A 1U0NA 1KE2A 3RSZA 2AOUA 3KTFA 4BJHB 3JATB 3SVTA 2Q46A 2GJ8A 2AJ8A 3DH0A 2EBUA 1M1YE 2J33A 1QRTA 4ZHQA 1FSPA 2OHOA 1OXVA 5J4HA 3DAFA 3AEZA 1UFRA 2QN1A 3QHAA 3WQBA 3JS5A 2JBWA 3PD7A 3JQAB 3KOZA 4FGLA 5CTAA 1UDAA 2FLVA 1U0SY 1XPOA 1YDEA 1E8MA 1GNPA 2BF7A 5C8YA 1G7SA 1Q1NA 2DKOA 4JHXA 1M6YA 2IBTA 2REQB 4U7JA 1SULA 4P58A 1IY0A 4Z0HO 3S2YA 3V2IA 1OXXK 2V6JA 2XZOA 2ZE5A 1E9EA 3AL3A 5GWXA 4QGHA 5CT6A 3ZD7A 4BCBA 1Y1RA 3RVDA 2J9XB 4OJTA 1GFWA 1PQWA 5LU9A 4YO7A 4NS4A 4B80A 4KIFA 3NOOA 2CFOA 1D4AA 1SM4A 5HCNA 4N0PA 3UT5A 1MUUA 5FPQA 4ZHQF 4BL5A 3P4UA 4IVRA 5BO5A 1XLTA 3MUFA 1T9DA 5JFTA 3NYRA 3N76A 4IWNA 4BN0A 2KQUA 5C9ZA 8ADHA 3O1LA 4FD3A 4V0NA 3RC8A 5C8YF 4NCAA 4N3NA 1T0IA 4TRMA 3DL7A 3PA6A 4NYIQ 2QYSA 4GC9A 3URMA 5E4FA 4AUEA 4CF4A 5K4GA 3JSAA 1TVKB 3MF4A 1AXEA 2QZ9A 5IN4A 3D7KA 3GU3A 2GXAA 3AF6A 1NNUA 3I2KA 1NXWA 2G88A 2I6QA 4ENRA 5E1BA 3BN3A 4X7MA 1EUQA 1MVNA 3SYTA 3D3JA 4HGOA 5KYUA 3BK2A 3VX4A 1FPMA 1PVVA 3E53A 3VR4H 3LRTA 3OPYI 2F1IA 3VR6A 2HCBA 2CYAA 3DSRA 5CBPA 1LSUA 4BXOB 2GD1O 3MWEA 4R1PA 2EJCA 3RRBA 5FX2A 1PE0A 3RR2A 4H60A 5EIOA 1W2GA 1GQRA 3KQKA 1RRCA 3CKLA 1Z5VA 5IH3A 1UBOS 4F3KA 4F9FA 4HQFA 4OB8A 4PF1A 4ALJA 2P9EA 2QPTA 5DM60 1DO8A 1UBSB 4GR4A 4MUGA 3NCHA 1IN4A 2XZTA 5FH9A 1NW4A 3QBEA 1HETA 1U2SA 4AX4A 1XB2A 1UDCA 2FDRA 1AN0A 3EW7A 2FX2A 5K1ZA 4D42A 1QVAA 1LBQA 3KS9A 1TJNA 1YDWA 2BD0A 1IB6A 4RIEA 5BWOA 4WCFC 2FPXA 3K0HA 3H1BA 1ZZEA 5DMHA 5F4BA 2E2WA 5FWDA 5ESDA 4AI6A 1HNNA 1S2IA 1Y3CE 5A3QA 3HXPA 1WQ4A 2VWQA 3QG1A 3FBTA 3GRUA 4JC5A 1L1FA 1G7CA 2YQ5A 2P69A 3LHIA 4FP9A 4FE3A 1PJSA 1FPQA 4U2FA 3T4UA 5AUOB 2V65A 1I33A 3ANNA 4ITUA 4PONA 2O7NA 3GLIA 1FZTA 2VDWB 5LJLA 5DE3A 4JIGA 4X44A 1DQYA 3V3TA 4YXFA 4IKEA 4WCVA 1JLSA 4WNYA 2R86A 4JKYA 3RG2A 4B8ZA 1BN7A 1OWMA 2W7TA 4MJ7A 1GQYA 1IB0A 4BMXA 4ZYWA 1IC6A 3QU5A 4C05A 3G1TA 1MJGA 3BERA 4YO8A 3NFRA 2H1WA 4ZC8A 5J63A 2FX3A 3THXB 5LQSA 3V4ZA 4LC0A 5HZMA 1NP3A 5ALXA 1DG9A 5TC4A 5FUBA 4B2YA 1UJ4A 3VAAA 1KMMA 1YJ5A 3GFFA 4YN3A 5IEJA 4BX3A 3GZNB 2PS0A 1NMEA 3O3OB 2JA1A 3N7UA 2PX2A 3DZKA 1B15A 2NN3C 1YI1A 1P77A 4ETWA 3S29A 2GEFA 4NBWA 3VTKA 2A5LA 2I1WA 2AFIE 1YDMA 2GASA 1NJSA 3D7NA 3SFZA 3MFQA 1RKUA 4CEJA 1NX9A 4X1KA 4HB0A 1R0BA 1YGYA 3G9TA 3ITNA 1KE1A 1JIJA 3VBCA 1YV9A 2XMSA 3WGHA 4D4JA 1FNDA 1X9HA 4ND6A 1F3LA 1Y80A 1K7SN 1M74A 1KQOA 1N0HA 3EZNA 1NM5A 1DQSA 2BMFA 2O2GA 2O2YA 3JZAA 2BKXA 1AKUA 4CKBB 4ESHA 4OQMA 2W6ZA 4N6OA 4FI3C 1IIBA 2G82A 3Q1LA 2G28A 1V48A 4NI5A 3PNQA 4FS8A 1Z7WA 2JFNA 5H59A 2Z1DA 3KYCB 1M1ZA 4HH0A 4A4DA 1XAIA 3LLSA 3THWA 1QFSA 4OFZA 3AUAA 1GTJ1 3I6YA 4HZUB 5E0OA 3N87A 3PB3A 3C8DA 2EU8A 2B6HA 3LDUA 5CK5A 3D0KA 2UYCA 3Q88A 5LQKA 3DFMA 5F7ZA 5IW8A 4CN8A 3WG9A 1ULHA 3BQ9A 4GSYA 1E3WB 4TRJA 4E14A 4OJYA 3T4PA 4C14A 2PQ0A 2X13A 4C6HA 2CF6A 3K53A 2Z08A 1C3XA 3M5CA 3P45A 4J16A 2H17A 3PRHA 1FBNA 4XCXA 2XB6A 1DEXA 3VKGA 1ODCA 3Q9LA 3QVSA 2NYVA 4MB6A 3N0RA 3GGPA 3NC0C 4XE5A 3CURA 1AZSC 5IJXA 5CFMA 2WFAA 2PZLA 1JP7A 3SKYA 2QSJA 1OE0A 3AFOA 1YCDA 1MMFB 1UT6A 2HK7A 4O1IA 4UHCA 4ZI3A 2XVZA 4B3SB 1ZBDA 2QJRA 4BXOA 2NZYA 1B0PA 1E4EA 3PE6A 1YH3A 2RHTA 4XJSA 5D01A 3VNUA 1P81A 1H0RA 3V7WA 1UEXC 2DWQA 2C54A 4UZEA 3RRXA 2G8LA 4I2NA 4X20A 3E5NA 3IR5A 4G5OA 1A88A 2B5VA 3V9AA 2Z8ZA 3PQ4A 1POXA 2BLLA 3AKCA 2ZR0A 3ET4A 5AK5A 3W9UA 5BN4A 1QU2A 1XD2A 3GK3A 2W00A 3HY6A 2OBYA 1MX9A 3P52A 3QG5A 2X2EA 1F8XA 4O2AB 3RUFA 1UM8A 5JS8A 1FMFA 4EW3A 2QVBA 2CN1A 4QAQA 4R5MA 5HR5A 1KYZA 2VLIA 3PLRA 4IOJA 1VL8A 4K05A 4O2LA 3IUBA 1J9ZA 1PS8A 3PEWA 3VYSB 2PK3A 3QP9A 3PFFA 3RS4A 1EVKA 3G2KA 2GWRA 2A1UA 4LIPD 2VDPB 3RUDA 2VQEB 3O2SB 3H0EA 2FN4A 4Q82A 5K0EA 3DHYA 5BUSA 4M0PA 1RHQA 2AF4C 1SOWA 2CVPA 3DBOB 2HSWA 3PZBA 1KJZA 4J3FA 1VIDA 5HIIA 3TD9A 2RJ3A 4LGYA 4ABYA 2HA7A 2OK8A 3KFXA 1QP0A 1XRJA 1EDOA 3SE0A 1NRIA 4JL6A 2IEDA 2J5BA 3SDSA 4QGAA 3UYLA 3AFHA 1VMIA 3ICVA 4Q24A 2ZGVA 2VTBA 2XRFA 4JLKA 5U4QA 5B12A 1EXNA 3ZJTA 5DGXA 3THSA 4BLRA 1A1SA 3SFVA 2UYOA 4H17A 1KAQA 3TK1A 1NBIA 2D0PB 5CJ2A 4LJAA 4ZEMA 2F7SA 4OEHA 3INNA 3KUXA 1YASA 3E22B 5AOAA 2P6MA 4M1ZA 3TLYA 3NBZC 4EB6A 1G20B 2VDVE 1G5IA 1CE8B 3FUXA 1I0IA 4R1OA 1F5SA 4B3CA 4B6FA 1DCFA 3W5HA 1B8UA 1Z83A 3KYDB 1LTKA 3NANA 3PUIA 1O9GA 4LY9A 4RHEA 4Y9TA 3UMFA 4BKOA 4F06A 4N7JA 5BR1A 1I4OA 4M0FA 2RH4A 1Q91A 1TC2A 5HMMA 1LH0A 4C4TA 4H4EA 1MD9A 5KHOC 2HQ1A 2WIGA 3NEAA 2DBQA 4W5HA 4A9AA 1QIDA 1NBMD 3EOZA 4N65A 3TI9A 2J3KA 1I2BA 3L7IA 2WU8A 5DOVA 4YHHB 2RC5A 3ZHCA 4DUZB 4HH3C 2AMJA 4L5YA 3VO2A 3ZCVA 3A1UA 4GO1A 4BUZA 1SXIA 2CJWB 2QUZA 4J1SA 2JGLA 1J07A 4GH5A 4ZT7A 1GN8A 4TWIA 2AN9A 1WRBA 1A5AB 5DX1A 4C5BA 1JEJA 2BRUA 2ZS8A 1UOEA 4RL6A 1G63A 2Q4TA 4ZALA 3VZCA 2A92A 4CMIB 3E2PA 1WAMA 3LTEA 4TLLB 4ILEA 2C5FA 3I9JA 3BRSA 4DN6A 3U6BA 3IRVA 1MX3A 4HO1X 2WSMA 1SMKA 1E2UA 1QM5A 4P35A 1GZ7A 4P36A 4WOJA 4HWRA 2AXEA 3I5XA 1H6CA 3EGCA 4E1BA 1ZHFA 3R4VA 1RSZA 1NBWB 3VPHA 5LMZA 3FJYA 3OPNA 2C2GA 221PA 1YS4A 2FP4A 3MGGA 4HCJA 4KAAA 1SQFA 4P81A 3UHPA 4B3XA 2PUGA 1P7ZA 3KKMA 5T4BA 2RJNA 3RJZA 1XMOB 4MW6A 4XQ9A 4X1IA 4FLFA 1L5QA 5F5LA 2Y68A 4HT3B 2UYQA 3LZDA 3F3YA 2DAPA 3QKRB 1CQIB 1J21A 3HFSA 4Z9FA 2QQEA 4YQEA 1V4NA 4UBIA 4UTVA 4QYTA 1EA5A 2MDTA 2GAJA 2UZ1B 5J2TA 5CXXA 5BT9A 2CLFB 4WECA 3CF2A 3KKPA 4D8XA 4TZTA 1OFHA 2R1TA 1YBHA 4KBFA 4RPKA 3L7LA 3W3AA 1XA3A 4UEOA 2IF2A 4IINA 3OQVA 4O02B 3RQIA 3MFYA 3TI7A 3KQUA 1RYYA 4RF5A 4GP6A 2C57A 4MARA 1Q95A 1T6XA 4WHMA 4IIHA 2IPOA 2XUOA 4KPGA 2I9KA 3U3OA 1Z18A 2F9MA 1KAHA 2VXCA 2I99A 3JQAA 3QEMB 4KGDA 4OATA 3DL2A 4X61A 3GJ5A 5AI0A 3BG5A 1X7WA 4UDYX 4Q4LA 2REQA 3DVQX 4GLLA 1AU9A 2ADMA 2IY9A 3HGQA 1YBFA 4HMQA 4MH0R 5J2TF 1KSHA 3G7NA 1WEHA 4ZA2A 3PKZA 4A8JC 5JVDA 4FMCF 2ILVA 3R74A 1NVGA 3ZZTA 4FCWA 2I71A 1UC9A 4UPVA 3PQ7A 1PHPA 4P4SB 1K6XA 4UNSA 5SZIA 5CH5A 2LIVA 3IR6A 4GVLA 4LQ4A 1ZBQA 1HT3A 3GFTA 4G36A 3JQFA 4GWGA 3IOEA 4YAGA 1U2QA 1PT9A 2PAAA 2Q5OA 2QQ0A 3IDSA 4DC1A 1EA7A 3HCBA 3SYNA 1R7RA 4CM8B 4E4YA 2PXXA 4AZ0B 4OX9Y 1WU8A 2QX7A 4GMFA 4P31A 5LNK1 3B5EA 3TPCA 4ARVA 1DKOA 1ZX1A 4IV5A 4J7XA 3HJFA 2Y6VA 2Y3IA 1JFFB 3WIOA 2IHJA 1I6KA 3WSTA 1ZKDA 1JQDA 5JVDF 4RTQA 5JMOA 5DZSA 1CUBA 2DM6A 4F5WA 2R79A 5FTWA 4HDRB 5KCZA 1VI2A 3WLKX 2RAFA 4RPHA 4C5AA 4HDAA 4AC9A 4DR1B 4Q01A 3CLHA 2VVTA 3MJTA 4QFDA 5HIJA 1P1JA 2R48A 3E6AA 4LN1A 1N2HA 4V0ME 1Y8RB 2GEDA 2IZ7A 3LNCA 3N2LA 1T8TA 1F7UA 3OZXA 4FSXA 1FFGA 1NMQA 3CRQA 2P2ZA 2DSNA 3UAZA 2IYUA 2XIQA 4H7KA 1EH5A 1YS9A 3DULA 2EW8A 1C4KA 3TLGB 5FUMA 5IVHA 1C2YA 3EY9A 4QQ8A 1GG9A 3A3NA 3C2QA 5J5VA 4JUAA 4HDCA 4IIVA 1KYYA 4QUJA 1JMVA 3NO4A 3OM9A 2HJGA 4KZKA 5FI1B 3T3HA 1NPYA 4KE6A 3TVDA 4CQMD 4KK3A 4P34A 1EUDB 2AR0A 4XQ0A 5ALOA 5ALSA 1RQ2A 3V2HA 3LUFA 3VM6A 5IAJA 2ZDHA 1MG5A 4EVSA 1MJNA 2Q7XA 1MBZA 1T9HA 2JAQA 3A0UA 2X2OA 1ONPA 3KVOA 5I7HA 3N8GA 4O8CA 2E21A 2A58A 4F3RA 4OREX 2IV7A 4H1WA 1VL1A 2VI5A 3JWIA 2VDWA 3CH7A 1Q5PA 1HE8B 1SB9A 1I7PA 4WN3A 2GETA 4CR7A 4DEYA 1SXGA 3QUQA 4RZ3A 5G3YA 4KIWA 3V4RA 2YJ4A 3OZDA 1L5NA 4BJ1A 3O82A 3DYBA 1DFIA 4HAIA 3MG9A 1VPEA 2X8AA 1ZAKA 2FH5B 3ED1A 2VQFB 2QTLA 1JR2A 2V9CA 2QRNA 4EPVA 3WIVA 5JXGA 4E51A 2J0SA 2JVIA 5AVVA 2QTCA 1YVPA 4HJRA 2GK7A 3GZNA 1FUKA 3N2GB 2P9ZA 5B58C 3PNPA 4Y2GA 1TUEA 4DYVA 1UT8A 3AI2A 2QXTA 4O59O 4H1VA 1XNGA 4NBSA 5AVJA 3DMTC 1ZI9A 5C31A 2P7IA 2W4QA 3NOXA 1YC5A 2WD8A 4K86A 4QDKA 5DXAA 3JY6A 4L3VA 3M6FA 3V8VA 5CEFA 4JJ4A 1Y4SA 2CT8A 2X4IA 4RZ2A 3DZDA 3PHBE 3WWZA 5LU8A 2MINB 4G0VA 1O4WA 1P75A 4BTVA 4H31A 3G3EA 4F71A 1IG3A 3OX2A 3N39C 1XQ6A 1I2ZA 2QSYA 2H7YA 3QKWA 4X8LA 3ZV6A 4HNTA 1XZNA 1UPTA 1NUHA 4QDZA 1QDLB 4V3CA 2H54A 4UUPA 2OQRA 2YFYA 1ZEJA 3Q3JB 4PTYA 1ESEA 5GONB 4K9NA 2YINC 1CD5A 3OJWA 4LZZA 4EH1A 3UY4A 4TWZA 1T9KA 2H5JA 1UXKA 2BUAA 2LIPA 2NGRA 3KYCA 3Q98A 4GXRA 2OV4A 1OFUA 5TPZA 3CWZA 4IOMA 3TE7A 1UDXA 2KWIA 4HZUA 4TKZA 3FSGA 3DAGA 1WB9A 1ZMOA 1L7OA 1L4UA 2AC2A 2ZETA 2V54A 1FVHA 1BO6A 4QJBA 5C4IA 3KVVA 2ZITA 3L41A 1HV8A 3WGJA 4WXEA 3U3MA 3KHKA 4H7HA 1OT5A 1SD2A 5IP5A 4X7PA 4NEGA 1E3WA 4DSTA 4QKQA 4Y2PA 1VLQA 1E32A 3L0IB 3B6MA 5IJAA 2XMCA 2GZ2A 2WNIA 2HCFA 4MMYB 4HQRA 3NJRA 2ECKA 4RJKA 1REQB 1ZA1A 2BEWB 4BJ6A 2CV1A 1B8OA 1Z17A 5CX1B 2UUOA 1SUCA 3W78A 1X7XB 2RHLA 4FM9A 2EF0A 5IT9A 3ZY6A 5HUJA 3NHZA 4OQLA 1A9TA 4NAHA 5IPFA 3BKWA 4HDNB 1XZHA 1QTQA 3QFSA 4IQ8A 5C7LO 5KWVA 1WMAA 2I6TA 2PV7A 5K45A 1SFRA 2JHFA 1DAGA 1OFVA 5B1HA 4R9SA 5B2EA 1MQ9A 1UPBA 1XMJA 1JQ3A 2FA9A 3ECSA 3M8KA 5ENVA 3IUYA 3EULA 2ZWAA 3BHJA 3GP3A 1RKVA 4YUAA 1YZTA 3WWEA 2C9YA 2QLFA 4V03A 3C3CA 2VJBA 3BYZA 4QFCA 2OZLB 2XW6A 4NABA 2VJPA 2Q2QA 3JYPA 3LPNA 3FNIA 2OV3A 2V3VA 3BFKA 3UOGA 4M54A 1RMYA 2VRCA 3ZZ0A 4DMRA 4MIEA 1FJGB 5DRTA 4WY5A 1PSZA 4OQPA 1C0EA 2ZIXB 4Y2RA 3JYHA 4J1TA 4UCXA 1LTQA 1SQ6A 1BCSB 4BO8A 3OA2A 4EHLA 1DKPA 1F5NA 4Q9KA 2L42A 4KXVA 3GF4A 4A2QA 1YL5A 1OXUA 5JTUA 4MICA 2P4QA 4AO6A 4DQXA 2F9LA 4IJQA 1FP4B 5BSTA 1RYNA 3QXJA 2QN3A 4AICA 1DXQA 3H04A 5E7QA 4ZPJA 3I9KA 4JDPA 4OFWA 1CLUA 5TX7A 3PL1A 3HS3A 3LRPA 2EEZA 4PYOA 1Y1LA 2PMCA 2ACWA 1Q1QA 3LIIA 5FT9A 1LEHA 2AIRA 1XXLA 2XMZA 1UJ2A 1NV8A 2A5YB 2HI0A 4FYMA 4OJNA 1OBHA 5EHNA 3RU3A 3D02A 1ST2A 1R6VA 3JQCA 3RWBA 2O8BA 2PTGA 4B6QA 5JZOA 1CR1A 2O0HA 2ZTSA 2AK2A 2AW5A 3HM2A 4KWIA 1W6RA 3E22A 4FYHA 4MV7A 2J0UB 2JKVA 2VH5R 1JLKA 4O5OA 5J9FA 3H3FA 3D6JA 3JX9A 1CE8A 1QNFA 5B57C 2Q3HA 1CEXA 1X8LA 1GOTA 3KYDA 1GKUB 3WYDA 2YJZA 3KTAB 3DVAB 3QEJA 4GM0A 4DQUA 4KVZA 2G9RA 4M8IA 4QT4A 4AKSA 1A9RA 1RCFA 4OMDA 4IJMA 3PWZA 5EWJA 4QOEA 2QN9A 1XT6A 2OYSA 2ZRGA 2B9EA 5GV8A 2F1OA 3O9VA 4EF6A 4GDFA 1FRQA 1L5RA 2IXEA 2QZZA 1SQ0A 1WXFA 3QY9A 3OJLA 4RA9B 1ZITA 1Y48E 1WSBA 2YV5A 2BHRA 1JE0A 2C8LA 3AJDA 3HN2A 3B48A 3QV1A 3WLNA 5CVVA 4UC0A 1H0SA 1N2GA 5HEKA 1G3RA 4ALMA 4LWOA 1PDWA 4LY6A 2ZPUA 1LFAA 2OUKA 3OUZA 1GPYA 1Z25A 3SR3A 1A5ZA 1E3IA 1HA3A 2QW0X 3ONEA 1SC3A 1LSSA 3G0DA 2WU1A 2ZXUA 4EB8A 1I30A 3L8YA 3MCWA 1SUFA 3MGAA 2G76A 2VQ6A 1AXGA 4Z99A 5DRYA 3ZIDA 5I7WA 3TN7A 2AE1A 4E0BA 5D00A 1DV2A 1KORA 3SQNA 2J9FB 3BAFA 3G02A 3R0QA 4OHBA 5I7SA 5AK4A 5ALEA 4LJKA 3QKRA 1CQIA 1TJ4A 2HRBA 2WAXA 1N77A 4IDAA 2CSXA 4XVQA 2OXIA 3CJTA 2C4HA 1Y82A 4HAYA 1HT1E 2UZ1A 1YRBA 3EPPA 3GPIA 4JOCA 1QQ6A 2WT4A 3K32A 4YCMA 4HLQB 4GPIB 2RAVA 5F5XA 1XROA 2GYYA 4LK3A 3V32A 3MLAA 4P38A 4ZYLA 4F91B 1OJ7A 1Z36A 3RTBA 1U80A 4FOOA 4H3VA 4MQLA 4EUEA 3RC9A 1Z5PA 2AHRA 2I3AA 1N2BA 4J0KA 1QK4A 4FLEA 4U39A 3QEMA 1MAAA 3ABOB 1NMZA 2VP9A 2ZSFA 3Q12A 2IIPA 1R9NA 1K7XB 2P9HA 3EUWA 4PPYA 2ECFA 3KEQA 4YCLA 1CYEA 5A4JA 3DZFA 3A9TA 4B6PA 4G63A 2X19A 1FYVA 2E9SA 2WVHA 4C7MA 3D8BA 4DCVA 1A8IA 4DWJA 2IEIA 3LCRA 3QPAA 4B47A 1MOZA 1FLDA 2BE9A 2QD4A 4P4SA 1FFCA 4G5FA 4RH0A 1GGFA 3I2JA 4QDOA 1BRTA 3OICA 5BVGB 4FYVA 1B0ZA 4OQZA 1XWFA 1MXFA 2BM0A 4YCNA 1JDSA 4AZ0A 4QODA 4JENA 1T5LA 3SNKA 3MHTA 2QAGC 3RLFA 4H0CA 3PF8A 1F20A 4IKOA 4RLHA 1GNSA 1P3JA 3LT1A 1C3OB 4F3NA 3H7AA 1ETUA 1KI1A 1CPYA 4YV0A 5I9NA 1MB2A 1N0UA 1XHEA 3BB1A 3GG9A 5ALPA 2GZHA 1JQKA 3NB0A 4GP9A 4DPLA 5FWNA 3U4QA 2TRSB 4FINA 4JC0A 5JANA 2H2IA 3QPVA 4TQAA 4ZKEA 4PC7A 2P41A 3L7AA 3RF7A 2GPYA 3NKLA 4HDRA 5DOZA 3TNFA 2VXOA 2ZRJA 1E7WA 1QGUA 4LVNA 1SURA 1OLSA 3Q15C 2V74B 1B2LA 4IRUB 2M1XA 1NZFA 5CUQA 3UXMA 3VXKA 2C7PA 4R1UA 4C4XA 5FNVA 1Y8RA 2IDZA 1N2CA 3QX8A 3EFBA 4D5EA 3C15C 2F8LA 3IAM6 2QPAA 4RFVA 1KWKA 5FJJA 3TLGA 4CGZA 5J43A 3CXRA 4BX2A 4FYYA 2IDKA 5F7XA 5JI3E 3DC7A 5EXPA 1HC7A 1LRJA 4YAWA 4A73A 2OXRA 3BIXA 1M2FA 3SEZA 2Q29A 1D5CA 1VPDA 2ZJBA 3L6BA 4B8YA 3QEBZ 2WVGA 5AVOA 4KDEA 4P4UA 5DN9A 4AFNA 4BQSA 1EUDA 2I7XA 3F5SA 5IJ0B 1DT5A 2BBWA 1IH8A 3HBAA 4PVCA 5H70A 3SJZA 3WLQA 5ALHA 2XZLA 3D5EA 1HDZA 5FNVF 4W1PA 4AQ7A 1R6AA 1CUSA 1KGSA 2GERA 3DAHA 4HYTA 4MKZA 4UXHA 2IFTA 2JS7A 3LF2A 4XX0B 5TARA 1P5JA 3WKEA 4J4BA 4BFUA 4D79A 1SBIA 1FU8A 1X1EA 4BB5A 5JDIC 2ZSUA 1EDZA 1AURA 1F2UA 1CUEA 1P18A 3PNMA 1NF2A 3TQIA 3U56A 4DDMA 3LT5A 2JAOA 3IDQA 1A8SA 2OWDA 2XYGA 1V5IA 1WBJB 4CQLA 5B3JC 4D81A 1MW8X 4OX9B 3HKCA 1Z8HA 4Y2SA 5JZSA 4W8HA 3NBYC 2J08A 4CI0B 1W88A 3K30A 2HBZA 1MOQA 1QO0D 2G7ZA 4W9RA 1JU3A 1K75A 1P1IA 4DDTA 4L76A 2C29D 4MCJA 5EJGA 2C3PA 1NJGA 3BCUA 3FI0A 1QE3A 3G0CA 1GL9B 3IUJA 3K35A 3OE4A 1JR6A 1YA4A 1YFZA 1ZN2A 4F93B 2QI9F 5LDDC 1U3UA 2W70A 1RPAA 2QLNA 3N2GA 4OXXA 2Q41A 4PG6A 4ND1A 4X90A 3D3WA 4L1KA 4GZ5A 2IS4A 1SIOA 5F2OA 3CONA 3GT3A 4K03A 5CA0F 2Q4BA 5JT1A 1Y0BA 2A5GA 1YU6A 2L69A 4MPJA 4TMYA 1ZJ5A 1TIKA 5DU2A 1O96B 3RU7A 3FMOB 5DP1A 4B5LA 3PX2A 7MHTA 2H5IA 2MINA 1I3MA 2J9GA 1SUIA 3I6MA 3ZC3A 5H68A 1PR4A 2P5UA 4IJKA 5GJBA 1VCOA 2HMYB 5GZ1A 2PXAA 4NK5A 1T9GS 3ORQA 1A9QA 5ALJA 5KYNA 5BNTA 4KLNA 3C1TA 2O8BB 5CIWA 1EJ6A 5GONA 3PYXA 3UWKA 1PZHA 1HDYA 2WTMA 2AUNA 3I76A 4L08A 2BC9A 1ST3A 2CXNA 5ADUS 4YMGA 1Z22A 1DDIA 2WM9B 3GV0A 4RVGA 4TMWA 1WZNA 2DR0A 3O4FA 3DLPX 2R6DA 4W82A 4MWOA 2BI8A 2JGEA 2CUNA 2QL7A 2WWTA 3JR7A 4MVJP 4GZ6A 4EHKA 4AQYB 5CM8B 3EF0A 2PQ2A 2IE8A 4ZTBA 5F5NA 4JUDX 1HURA 4MRPA 1BS1A 1IVYA 3EYWA 3G2IA 2I2CA 4EYSA 3P2IA 1OH8A 3LKDA 2QIPA 2H8KA 4JOBA 2PUFA 4JBHA 4N8DA 2XBUA 1LRKA 1JX6A 4UFOA 4DJDC 2ZUUA 5GONF 3B2EA 3NV9A 1VM6A 1WPRA 5BYKA 1C7QA 3GFVA 1RAEA 3MRVA 5KSPA 1C9JA 2O19A 1TIPA 2CFRA 2O2EA 2BEWA 2XD9A 4NQRA 5FEMA 4YAKA 5KJ6A 1FYEA 4OIFA 3GEHA 2WWXA 3A4LA 3PCRB 4I1VA 5CX1A 5ED0A 5G1OA 3LW7A 5SY9A 1Y3DE 3E23A 1H05A 3G88A 5ETJA 1BYIA 3DFUA 3Q85A 4F4DA 4L2IA 1Y3AA 4TSKA 3K70C 4HDNA 4IXNA 5LLDA 2JHCA 4JU9A 2PUJA 3SSMA 3K31A 1I1OA 4CT0A 4HEA1 3LYHA 3Q1KA 4XQEA 5KQRA 4P7JA 1XJCA 1XKXA 3HI6A 3RSCA 4NH4A 4QXMA 3FROA 1I4EB 2PZKA 2X0IA 1EIZA 4PLYA 3MMNA 3GT7A 3T7IA 3AR9A 4KN8A 2XVMA