1K5DA

Crystal structure of ran-gppnhp-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein RAN
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling activator
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5dA00
5EE1A 2BWJA 2CLCX 5HKKD 5FTNA 2EFCB 4O3MA 3AF1A 1MKYA 3RRNA 1UDWA 1W4CA 3LFUA 3DOFA 4A0RA 1FW6A 4CVNA 1G5PA 4F91B 1KNQA 1HEIA 2RMKA 2WBLC 4B44A 4P0TA 1KO7A 4G0NA 3B78A 1P5ZB 1OB2A 1F2UB 2XTMA 1TAGA 2VL7A 2P6RA 4OK5A 3IPXA 5GJWC 2GJAA 1Z5ZA 3B13B 1KAOA 1R6BX 1B0UA 1DVRA 3SU8A 1KZ7B 2MMGA 621PA 3GJ4A 5EP1A 1E2FA 1II0A 4LJ6A 4PAQA 4MQBA 2QAJA 4JVSB 1GAJA 4MUAA 2FH5B 3RHFA 3ZDQA 1E1RD 5C4MA 1Z6AA 2AK3A 1X8LA 5AWFC 4M4SA 3EX7C 2Q6TA 2QE7A 2R65A 3LDAA 3I8SA 2WZQA 3C16C 3TW4A 1G7CA 4TZ6A 4DLYA 4OQNA 5IT5A 1OXTA 4KFRA 1XTRA 4LJ7A 1KMHA 4JLVA 2WSMA 2JLRA 2X77A 3QPWA 4NP6A 2GZDA 3RRZA 4E5UA 1Z0KA 3I3SR 2IXEA 5EUMA 2AFHE 4EIWA 4OYHA 1SHZA 1ZP6A 2ZU0C 3CH4B 1ZUIA 2NO1A 2IYWA 4L16A 1E2IA 2BVNA 3KQKA 4URZR 4HATA 1R4AA 3KX2A 5F9HA 2V4ZA 2YNMA 1XD2A 4TLCA 1KJYA 2VIIA 3OEED 3THXA 2ZI9A 4KHZA 3RS3A 3GFOA 4QGFA 1XD8A 2IHBA 3GEHA 2Q9BA 2IYQA 5FI0B 3THYB 2PZGA 1QHGA 4XWAA 4Z1MA 1II9A 2E1RA 4IOLA 4E09A 4B6EA 1E1QA 1MO6A 1HQCA 1MO3A 4MRSA 4BFYA 2XEXA 3L0SA 4KYUA 4NYIR 4D4KA 1G3QA 2G9NA 1CJMA 3NG1A 3VHXA 2IEZA 3OFND 4TL6A 3X1WA 3B1WA 5HCIA 4CZ2A 3QF4A 5EP4A 5KDDA 1N2CE 3GJ3A 2VH5R 3R7WB 2AD1A 2W00A 2OBLA 3Q72A 4QGAA 1H8EA 3FFBA 2EFHB 1XEWX 1GZSA 1QVRA 1SVOA 2FFBA 2BIFA 1E2EA 2Q3MA 5M04A 2ZRGA 2O0KA 3EWSA 1UBEA 3MCAA 4TT3D 1N6LA 3TSWA 3A4MA 3UATA 1NG1A 3BIFA 3I4LA 1XF9A 3MFYA 4HI0E 1FTNA 4F4CA 3LBIA 1R0ZA 5CB8A 3X1ZA 5E3HA 1JAIA 4CRWB 2ANBA 3DMDA 4B48A 3I8XA 3SOPA 1SKQA 2P0EA 2EYUA 3EARA 4V02A 2VO1A 2PJRA 1W1WA 2J46A 4KVGA 1SZPA 1S0UA 2BCJQ 2VHCA 1YZUA 5F98A 1Q3HA 5FTKA 2ZJOA 3K70C 3IILA 4LJ9A 2A3RA 4B3DA 1CF4A 1R2QA 2KJQA 3DVLA 3L0OA 4PC2A 4ASUA 3QKSA 1QHNA 1H65A 1XXHE 4HAXA 4N0DA 4BFWA 4JMPA 1XPUA 2WAXA 2XTNA 1G64A 1K5GA 5TVKA 1UAAA 5GVSA 1W2GA 3PG5A 5FUYA 1GKYA 3L0IB 4LHVA 3MJHA 4L9WA 2VHJA 4JSTA 5G40A 2D7DA 2ZVPX 4LC0A 3GLIB 5CLQA 2NZ8A 3QE0A 3BJIC 2VA8A 4DCVA 1NG9A 2IBMA 2QU8A 2ZUDA 4UXJA 1M7HA 1ONBA 1ZIOA 1NF3A 4AI6A 1DAGA 3LLMA 4PHFA 4QG7A 2CVHA 3F0TA 4KVAA 1EESA 5GJCA 3N2EA 1T0JB 3DZDA 5CJPA 1CTQA 1ZM3A 2OT3B 4BEBA 1LF5A 3JVVA 3S1AA 3ZVMA 1OYWA 3G0HA 1AM4D 3P26A 5CIWA 2GWHA 1G20E 3WYGA 1AS2A 4Z54A 3NBFA 4Q1DA 4GL2A 4RZUA 1ZBDA 2Z43A 3QJYA 2OEPA 4MDFA 1XJQA 2W83A 1F48A 4DDVA 1IY2A 4R98A 1IJFA 1Z0JA 2RHDA 4FINA 3ZQJA 4O0MA 4YXWA 1NVVQ 1XMSA 2OXCA 4YMSA 2ZSBA 3LWNA 3ADKA 1U0LA 1E9FA 3SJAA 2HDNB 3BH0A 4WOPA 1JAHA 2VP0A 5EXXA 3K0SA 4PQYA 3A37A 1HTWA 3CBQA 1OFUX 4B34A 5EP2A 2YINC 3RS4A 3B1YA 4R71A 1UPTA 2DBYA 5AJZA 2G83A 3VR4A 1CJVC 2C5LA 2CNWA 1R10A 4W7SA 3CF6R 4FIDA 1VDZA 4Q7JB 2AXPA 4RCYA 3A1VA 1AJEA 4PTLA 4W9MC 5EE5B 3AKYA 3IHLA 1N5KA 3LD9A 4OHWA 4TQAA 3AP1A 3B1XA 2GK7A 2QGZA 4FMCF 5GJBA 1T6NA 1XCMA 1LS6A 1AQYA 1CR4A 5LBIA 3MJRA 4BFUA 1T91A 2RAPA 3Q8XB 1KSGA 3DMNA 3SBDA 2FWRA 2JA1A 2ZE5A 3B1ZA 2ZI7A 4IHQA 2V6IA 1MH1A 2JCSA 4EPXA 4IVRA 3HWSA 4BQSA 3TUJC 2J0UB 1AGPA 3A4LA 4P4TA 3TQCA 4LJ5A 4QC2A 1HURA 2ZJYA 4TLDA 2PX3A 1JPNA 2JATA 3V4RA 3GD7A 2AL7A 5DYGA 4DLSA 2V9PA 3IKJA 4UJ3A 2PJZA 5F9FA 5B64A 3O8BA 2JASA 4I1SA 4JBYA 1E94E 1KI3A 2QTVB 3KUCA 5A0FA 3HYTA 3NVAA 2CDNA 2V1UA 3IO5A 4V0LA 1ZM4A 5TXGA 1WXQA 5JS7A 3DPUA 4FI3C 4NYMQ 3WNDA 1XCPA 1N3BA 4AKEA 4CGZA 1GNRA 2QPOA 3B60A 4CDGA 4DLRA 3EZFA 3UWKA 5J4YA 2BMEA 1TNDA 2NO6A 3A1WA 1E32A 3IIKA 1KDOA 2BCGY 2KE5A 4E03A 2J7PD 1LFDB 2CCGA 2GJKA 4MH0R 3RVBA 3EASA 3T5GA 3TR0A 4B35A 1X86B 2VSXA 2FPKA 3H0KA 2ZRLA 2FFAA 1UFQA 3GLHB 4FCTA 4G5SA 4HEJA 1QZXA 1WMSA 2ZJBA 4JSYA 4NU0A 3UMFA 3VAAA 1AZTA 2VRWA 3LRPA 3O47A 4TQ9A 2JLXA 1DAEA 3LX8A 721PA 1HE8B 1XD9A 2WMNB 2WPDD 2F43A 2FV8A 2ZAMA 4OQXA 2HJVA 2XNSA 3QI2A 1UEJA 4A8JB 1G5RA 4DDUA 1JXOA 3OIVA 4JL6A 3CRVA 3B8HA 4BGDA 1JXMA 2O0HA 2AKYA 1P72A 2OILA 5CM9C 5GJVC 4AD8A 4EKDA 3AKEA 3TRFA 1OIXA 2XSZD 3U4QA 2QT0A 2H7VA 5FBRB 3MWJA 2JJ2D 1EFRA 4AYXA 2G1KA 1E2HA 1TEXA 4MYCA 1TTTA 1CXZA 2ODBA 2GJ9A 3RRMA 1EWRA 2F7SA 3SR0A 2O8FA 1MO5A 3MWKA 2FOLA 1ZU4A 1KI2A 5FTMA 4ESVA 1GRNA 4KFUA 3FTQA 4RZ2A 4US2R 3BC1A 1QVAA 4BZPA 3KQUA 4GZLA 3RC3A 1ZCAA 4XVUA 1QHYA 4RD6A 4DIEA 4F4JA 1PJRA 1T3LA 5P21A 4CT5A 2F55A 4J0QA 3NC0C 5EE3A 2FSHA 5CJ2A 4C30A 2GA8A 5K8TA 1SVSA 3KKNA 5FFMA 4HLDA 1VMAA 2XB4A 5AJVB 2BBSA 4EDHA 3IBGA 1NKSA 4B33A 1US8B 4AIIA 4QBGB 4EPRA 1KI4A 1TQ4A 3IHWA 4LYJA 4MGYR 1M74A 4QGHA 4CYMA 3VKHA 2D06A 2IXFA 1RW4A 4XTRA 3W3AA 1S9HA 3CZPA 1YU9A 5FL7D 2AWNA 3TJZA 5KSYA 3CUEF 2G88A 1XFAA 3C41J 1BS1A 3U3OA 2B6HA 4EJSA 1Q21A 5CB6A 3B1VA 3DKVA 4D26A 5HCNA 2AFIE 2CMKA 3K09C 3CONA 2CJWB 4JLOA 2NPFA 4BUJA 1CP2A 4DT1A 2QBYB 2GCOA 5ANRB 4OL0A 5FI1B 3RWMB 1Z6XA 3BD9A 1HT1E 3AF2A 2FZLA 5TV2A 3U3MA 3BB4A 4ARZA 4PAMA 3TVTA 3AF0A 4B2LA 4DLVA 3FFAA 2FGKA 2R6CA 5KDOA 4M9SA 4Z51A 1P9WA 1XX6A 2ASEA 4GDFA 1FZQA 2ZI6A 4JJKA 4JLMA 2QM8A 4LX0A 5JSZB 3DZ8A 1N6NA 2QMEA 1WE2A 2ZRMA 4BFTA 1WDTA 2ZRPA 4Q4JA 2WIBA 4LK2A 3TUZC 4Q02A 4ESHA 1KGDA 4Q21A 1D2EA 3EAQA 4CEJA 1KK1A 1DEKA 4LYHA 4QXAA 2HF8A 3BH6A 3IQWA 1FQJA 4JBWA 2XJ4A 4MKFA 4P4SB 4ON9A 4AKHA 1IN8A 5BYKA 3PEYA 1J70A 2RCNA 5FR2A 1XTIA 4XD7A 1ZIPA 2V1XA 4WXRA 4GMDA 1M2OB 1K5DA 1R5OA 4TMVA 4OI2A 1JR6A 1NI3A 4AK9A 2C9YA 3CRRA 2JLSA 3KQNA 2ZR9A 1PV4A 1T5IA 5HZHA 2YOFA 2REXB 1CJKC 3PITA 2IK8A 4JBXA 4A2QA 3KTAB 2YHSA 1OXUA 2VTKA 5CITA 1TQ2A 1OHHA 1PLJA 1KY3A 3VX3A 4QJ5A 1WRBA 3LW8A 2QMOA 2CLDX 3ZVNA 1YVDA 2JIZA 2WIAA 3EPHA 2QQ0A 4NCHA 3THWB 3PIRA 3LW7A 2X2EA 1W0KA 3MWLA 1XEXA 3M1IA 4C0BA 3CF0A 4C9BA 1KDPA 4D0GA 1E3MA 3ZQ6A 1BMFA 4KI0A 4A8JC 2PLFA 3W34A 1ZAKA 3ECCA 3NDBB 4W5WA 1COWD 1Q12A 2F1IA 2G0TA 1KSJA 2RGBA 2GEDA 2D74A 1OXSC 2NO9A 3R9WA 2DWQA 2XNDA 3GEIA 4LI0A 2O8EB 4PFSA 1JBKA 2N42A 4US1R 3VU9A 3AQ4A 5FOVA 4P32A 4YLGA 2ZE7A 3TNFA 3QKRB 4JL8A 3VTKA 4OQFA 4BLSA 3HU2A 4C7OB 4I1UA 3KJGA 4Q9KA 1HH4A 3A36A 2BBTA 3I72A 4BFVA 2CCKA 3CWZA 5EP3A 1CJTC 1E79D 4IOJA 2GILA 1NSTA 4HLCA 4DCUA 5J4KA 1MRSA 1M8PA 2HXYA 5EUQB 3AVYA 1E4VA 1M34E 4LC1A 4QKQA 3AVTA 2GXSA 2J87A 4GFDA 2GHIA 3PQCA 1G6HA 2A7QA 4HDQB 2V6JA 2BKUA 2FA9A 4TL7A 2FPLA 1NLFA 2ODEA 2PMKA 3WP1B 3NH9A 3AUYA 1Z08A 3TVDA 1GIAA 4HUQA 3WYAA 5JWRA 5BN5A 3D7MA 1TL7C 2RGNA 4PX9A 4A36A 3FDIA 3O8RA 3AF3A 1C4OA 4E07A 2WAYA 3V9PA 2QP9X 1CULC 4QFMA 2OZEA 2QY9A 2GCPA 2GBLA 2FEOA 1N25A 5FBLB 1G3UA 4Q03A 3R8FA 2ZRHA 3QF7A 1A4RA 3ZGXA 2GETA 3SC3A 2V54A 1U9IA 1VECA 4DSUA 2R6DA 2B7BA 5DN6A 4M9XA 4A2WA 1FP7A 4Q19A 4DLXA 1C1YA 5JEEA 1OW3B 2IF0A 1A2BA 1PLKA 1ZUHA 4G5RA 1F60A 3WHLA 4LBVA 3QXJA 1U0HC 4RD1A 2GZAA 2YOGA 1LS1A 4OI4A 3K0CC 1S2MA 1Z22A 4PHTA 5B30A 3VR1A 2ZYWX 3OEHA 2DFNA 3L8YA 5TY0A 1VKJA 2QAGA 3SQWA 4A92A 4UJ5A 1UEIA 3PCRB 1ZM7A 821PA 4QL3A 2CEAA 2OHFA 5FOTA 5GVRA 1RJ9A 1YZQA 4HZUB 2Q3HA 3UMRA 1BH2A 4B2PA 4OHVA 2J7KA 4MGZR 3VQTA 1U81A 1P9NA 5DI9A 3V00A 3MAAC 1CR1A 1J99A 1T8UA 2GEVA 3SYLA 4NMMA 2QPTA 1G291 5FUVA 1OH5A 1DARA 4Q01A 1F2UA 5A5GA 3FKSD 2R8RA 4QBHA 3LQQA 3P4YA 4Q9JA 2Z4RA 2ZYUX 4RVCA 2F1RA 2R44A 4FMDB 3QG1A 4I99A 4DLWA 5TARA 3D3QA 2ZIAA 1OKKA 4ZDJA 2XXAB 1QG4A 5IDVA 1NN3A 4U5XA 4JLJA 2IYRA 3PVSA 3LVRE 2QN6A 3DM5A 2PLRA 3T5DA 1NMYA 3CPEA 3TW8B 4XSHA 1VYVA 4QOSA 3UG7A 1ZD8A 2KWIA 2VP5A 4TYQA 3WY9A 3ZZ0A 1NN5A 1VYTA 4DCNA 1T5LA 2JLYA 4HDOB 2ATXA 5BXQC 2JLVA 1W0JA 4DEYA 2A78A 3HU3A 4YMTA 4ZIRA 4MYTA 1GFIA 3LO5A 4AKGA 3R9XA 1HV8A 4TMWA 1LF0A 4URXR 2WKQA 2VQSA 4JVLA 2C78A 1OYYA 2FF7A 1D5CA 1KAGA 2YV5A 3ADCA 4V0MA 4Q4AB 4QBFA 3QXHA 1OFHA 3FMPB 3MGCA 3VNVA 1U98A 4NBSA 4Q5IA 3RYTC 1RKBA 2G1JA 1II8B 4TQUS 3OEHD 1M6NA 1UF9A 1ZD1A 1KKLA 3KJEA 2VYFA 2EYQA 2WSSA 5D3MB 3KKMA 4CEIB 2WOOA 1CKEA 4BLQA 3U44A 4GPTA 4JLBA 3NC1C 1G41A 3QXCA 2PCJA 4EPTA 5BW8A 1RRCA 5L3QB 5KSPA 3GEEA 4M0LA 4YMVA 4TTPA 2ZETA 3EZ7A 1M1YE 4C0HA 3AP3A 4O2RA 4OK3A 2V55B 2ATVA 1WF3A 2ZQ5A 3Q3JB 5AUPB 1N6OA 2C8VA 2YZ2A 3OIUA 2JAQA 1F2TA 2HUPA 5IF9A 1NSFA 5HZKA 3BB1A 1JJVA 4V03A 3U2QA 4R2IA 3KKPA 3BGWA 1J90A 1OIVA 4WZAE 5AR1A 4PQRA 2CLSA 4IDNA 1G5TA 4D4LA 2QORA 1T9HA 5FTLA 2GAOA 2GZHA 2NO0A 3VX4A 3FKQA 2FDCA 3AVWA 2WHXA 2ZRNA 2OFWA 2ORVA 3CX6A 1WP9A 4Q47A 1SVMA 3R7WA 2AN9A 2IUTA 4Q1BA 1Q3TA 3GQBA 3QBTA 5KUTA 4OHXA 1R0YA 5AUQA 3LNCA 5UKDA 2V7QA 5E95A 3U6KA 3GJ8A 4V0ME 2OFOA 3QKUA 4A6XA 4PXAA 1DAFA 2QRZA 3ND8A 1NRJB 3H84A 3BB3A 4KSBA 2AX4A 2NPIA 1Z8FA 4GMXA 4OQLA 3TUIC 1Y3AA 1SQ5A 5DGXA 4M1YA 4JZKA 1TUIA 2JGNA 3ZIAA 5FOXA 3ZS9A 4AYTA 4MRNA 1QF9A 4Y0VA 3T1TA 4TLAA 1E6CA 3KUDA 3PXGA 2MSDB 5FOWA 3TK1A 2C98A 1HT2E 1E9SA 1U8YA 1X6VA 2WWYA 2A9KA 4PC3A 4QBIA 2QA5A 4ZV4A 3L0PA 3TGPA 4ZKEA 1R0WA 2C77A 1ZJ6A 3GLFA 4KFSA 1NBMA 3PUVA 3DEFA 5JWHA 4B47A 2OUKA 2X2FA 3FWYA 1N6KA 1W5SA 3BFKA 4PPQA 1P2VA 3DO6A 2WICA 3C15C 3K0FB 4I4LA 4OK6A 2QMUA 1KI6B 2IYVA 2PX0A 3B6EA 3CW2A 4W5HA 5KHOC 3SQXA 3BAFA 1IN6A 4D4MA 3GJ5A 3G82C 1U8AA 3BWDD 1ZVQA 4LPSA 1P4SA 5EJEA 3GLIA 1XJ0A 2Z0MA 2QE7D 5TMPA 2QMHA 1D2NA 4HLUA 5J47A 4L8GA 1L8QA 1NL3A 5J4HA 4PZYA 1E9EA 1KMHB 3PEVA 2NQ2C 4NTZA 3T12A 3RS5A 1AKYA 3WP0A 1OH7A 5JMTA 1OT3A 3OE7A 4ZO4A 4QM6A 1SULA 3KKQA 2AK2A 1DOAA 2JLZA 1V5WA 4NCKA 1SVKA 4Q18A 3UXMA 2YYZA 2ZI4A 1E0KA 1P61B 1GDDA 2JLQA 1CU1A 4NYJQ 4MA4A 4FMBB 2GTPA 5EZ5A 4B74A 4F38A 1WBDA 1G16A 5DHAA 1DAMA 4CEHA 3G5UA 3KB1A 2C99A 4OI0A 1P7CA 2NG1A 1E69A 1OSNA 1XXHB 2HLDA 221PA 1KDRA 1K6MA 4RKFA 5F2EA 5E7IA 2Z5FA 3U7EB 4GNKA 1RIFA 1EGAA 1G3MA 2ZRCA 4Z1MD 3GLFE 4ZCIA 4PSVA 1C9KA 1NBME 1ZNXA 1SGWA 3GJ7A 1E2PA 1F6BA 1Z07A 1KNXA 4TWZA 1E1QD 4WA7A 4DCSA 4BE7B 3K53A 5CDFA 4KITB 4QGGA 3QF4B 4JIMA 1ETUA 4AWXA 1EX6A 3QUSA 3T15A 3W5JA 3GLIE 3A4NA 1N0VC 1FFHA 3I73A 4HAVA 4KLZA 4NL4H 1P75A 1MV5A 5HE8A 2CCJA 4XJXA 3TQFA 3K09A 3AVVA 1H8ED 2ZUBA 4QJ4A 4PO8A 2XZLA 2P5SA 4OQMA 1D2MA 4B3XA 1NP6A 4US0R 2WWHA 4PHGA 4Q1EA 5CK5A 2AWOA 5JRJA 4LSGA 5DH9A 2WWIA 1I2DA 1CLUA 4A1FA 1ESNA 3B85A 2OM2A 5EXTA 1KMQA 4LHYA 1ZC4A 4ZDIA 1SXJA 4WW0A 1RRGA 4D0NA 2P65A 4HLQB 1IAQA 1MOZA 1U2RA 2HCJB 1YKSA 2R62A 3CX8A 4TYYA 1FOEB 2D62A 4LYAA 2ZS9A 3FHTA 4TMTA 5AJYA 1G7TA 3QKSB 3BFVA 2GDJA 1Q1BA 3FMOB 4Q00A 2YC4C 2NO7A 4ASUD 4B3CA 3HPRA 3BORA 5L3VA 4Z8XA 2B8TA 5DE3A 4LJYA 1L7VC 2YWGA 4QRHA 4KU4A 5C2JB 2KBFA 3AB3A 3CR7A 1JJ7A 521PA 1E2GA 3B82A 3I5YA 1VTKA 3B2EA 3CRW1 5CDFE 4RKEA 3CPHA 5AJWA 3EZ6A 4EUNA 3W6OA 1VCNA 4DVGA 2XAUA 4FXPA 2DY1A 2J5XA 5KDLA 4DJTA 2EFGA 4C2UA 1GWNA 1L4YA 2ZSFA 1J2JA 1N5JA 5JRZA 3UK6A 2XITA 5KYKA 3GLHA 1XPRA 5BQ5A 1TUEA 2IWHA 2BKEA 2FX3A 3O8DA 2QGNA 5IK2A 3O8CA 1XJCA 5K8IA 1IXRC 5ELXA 4D25A 2BC9A 2QTHA 1Q1QA 1SXJE 1H8HA 2B7CA 5LD2B 3U5ZB 3WYFA 2ZRJA 1A82A 2F9LA 2VLIA 4IOKA 3N2IA 1YR8A 3EPKA 1G4AE 5DYIA 2RGXA 3C5HA 3SBEA 3CRMA 2EWWA 2EW1A 1G8FA 1IHUA 1PLLA 2JDIA 4NYIQ 4YXWD 3ZVRA 3LV8A 4II7A 2BMFA 2C03A 4M1OA 4TZ0A 4LBYA 1E9BA 1KO4A 3QPUA 3JZMA 1N6IA 3RC8A 1YRBA 2IC5A 4RSGA 3KJIA 3W9YA 2NTYC 1CJUC 4B32A 1OE0A 3K0AA 1UKYA 4D2IA 3IO3A 5FPSA 3M6AA 3I92A 2QP3A 4URWR 2CNWD 3ICQB 2N46A 1ZCBA 4PR0A 1I4TD 4PPFA 1XTSA 1XTKA 2OCBA 4LBWA 2QEQA 3RSOA 1Q22A 2EFDB 2YWFA 3SFZA 2XZPA 3B9QA 3QNUA 4H1UA 4WIAA 4ITRC 3T34A 4E22A 4ERNA 4B75A 1UKVY 3P4XA 4DHEA 4BZXA 2BV3A 2ZJ8A 1KKMA 2WJHA 3A1UA 3CX7A 5IRCD 1RPZA 1W36B 3C14C 2Y8EA 4MRPA 1KI7A 4UNPA 2W2TA 1ELOA 2IS1A 4IW3B 2WJVA 2Z83A 1W36D 3WMFA 4EFNA 1E9AA 1FMLA 3CKLA 1TF5A 2HYIC 2DFLA 1US8A 1YZGA 4QHSA 5DISB 4X8HA 4B3GA 2P6UA 4KODA 1DELA 4D4JA 5CK4A 2IT1A 5JHGB 2WVJA 2OCPA 1EFTA 3CH5A 3GLGA 2PT7A 1IXZA 4LHZA 4JL5A 3K0EA 4C0AC 2WWFA 2JJ1A 2D2FA 5JEDA 3Q5EA 4FWTA 2ZI3A 5SZKB 1RZ3A 1AZSC 5KO2A 4LY6A 1XPOA 4DUGA 4LJ8A 1R8SA 2FSFA 4WXPA 1ZU5A 3SZRA 1JEDA 2QBYA 2FMXA 4DRZA 3IQXA 1GM5A 3TSZA 2G6BA 5DI3B 1ZNZA 2OAP1 2Q0HA 4GOJA 1MR3F 4TSFA 4TTRA 5C18A 4RFSB 1R0XA 2D7CA 1NLZA 3UPUA 5L3SA 5K8UA 1Z47A 4NZYA 1GITA 2C96A 2H18A 5JSZA 4GP6A 1E99A 3KL4A 2JEOA 2AR7A 1X8KA 3ADDA 3PUYA 5IHPA 1FQKA 3VR6A 1BIFA 4PC1A 4DCTA 1G8PA 1NMZA 3SJBA 3W3ZB 1VYUA 2F43B 1DAKA 2ZAOA 4A0GA 1P2SA 3NBYC 3Q5DA 2IEYA 4BFZA 5TDHA 1GL6A 1W49A 4KAXA 2O8BB 3IIMA 4M1KA 3FHCB 2A5DA 3V4FA 4A6PA 1Z0AA 3BBPA 1E0JA 4P4SA 1EG7A 2IF2A 2XZOA 1NNEA 3D6TB 4G5QA 4DSNA 3AVXA 2EU8A 5FPYA 3VMFA 2OLKA 2CXXA 4PPNA 2WWGA 1EXMA 3GLGE 4U00A 2G3YA 2QM7A 1XU4A 2FNAA 1XMJA 2DFTA 3SHWA 3SYKA 4HDCA 1JB1A 1KK0A 4C3ZA 2W6IA 2IYZA 1WQ1R 1EFRD 3R8CA 2C2HA 3MLEA 1JI0A 2O8FB 2GXUA 3X1YA 2KI5A 3HDTA 3THWA 3FE2A 1UBFA 2ZE8A 4JVNA 1DG1G 2VF7A 2ZU6A 4PSAA 5HR5A 3T61A 4N0EA 1R5NA 2ZRFA 4AYWA 1HE1C 2ZM5A 1GL9B 4XWKA 4LYFA 2ZANA 4X8MA 3QG5A 2WWWA 3QKTA 5LD2C 1I4LD 2O8CB 2BMDA 2RGEA 3AVOA 4S2EA 4C0JA 3LVQE 2ZSEA 2W0MA 1G1MA 3LY5A 4D0LB 3TLXA 2O8DB 1IN7A 4TN1A 3ZH9B 5JWOA 2O8EA 3BE4A 3TR5A 1GP2A 2GVZC 2LCFA 3FMFA 4YDHB 2WV9A 5AUNB 3WNBA 2CK3A 5AUOB 5BN4A 3DKPA 1P6XA 1KI1A 4EQ6A 2QTFA 2WKPA 3QKRA 4PSKA 3EIEA 1N6RA 1UADA 4JLNA 4C7OA 4TYPA 1Z83A 2QG6A 2Q9CA 2RGGA 3A1TA 4A0FA 2DPXA 2IHYA 2W0SA 1KI8A 3HR8A 4FMDF 4Q48A 5EZ6B 5JLJA 2W6JA 1JR3A 1ZUNB 2OCYC 4A82A 3GMTA 1VCOA 5F3WB 5LPNA 1FX0B 1E9DA 5FPTA 4IXNA 4GBMA 3IEVA 3CWQA 4KJZA 2R2AA 1G8YA 4MRRA 4TL9A 1SKYE 4DT1B 2ODNA 1XP8A 2GCOB 2FGJA 8OHMA 2A30A 4ARZB 1WBBA 1FTSA 4ILEA 2NOAA 3CNNA 1TU3A 1T3HA 2YWHA 2IS4A 3K9HA 3NIBA 1W36C 4KV9A 5LDDC 1IY0A 3ZLJA 1JALA 1AGRA 1L4UA 4KXFB 3UG6A 4JLKA 3X1XA 1TQDA 3PENA 4G5GA 1GRRA 1KSFX 4FN5A 2O5VA 3EZ9A 1MABA 4DB2A 4I81A 3P32A 4P33A 4Q4JB 4ZKDA 1I2MA 2K5UA 2BMJA 1VG8A 2H1LA 2ZSDA 4OKSA 4DB4A 1R7RA 1GTVA 1VIAA 4BLRA 1G7SA 1RYFA 2G77B 2ZRKA 1KSHA 4MKHA 1EWQA 4CT4B 1DBSA 1P9RA 2ORWA 4XVQA 1QBKC 1OPXA 3PFIA 4NCNA 3KQLA 4LBZA 4MITA 1G17A 3AV0B 4XD7D 1NIPA 2WJIA 1E2MA 2BM1A 3RS2A 1AS3A 4UXHA 2F3TA 2HV8A 2IYLD 3MMPA 1JR3E 1IXSB 4DSTA 4HZUA 2JJ8A 5HE9A 3AVUA 2IYUA 1LY1A 2F9MA 5L8VA 3OAAA 4HUTA 1R5BA 1Z6YA 1HUQA 4CW7A 1KK3A 1P3JA 3NBZC 1OHHD 1QRAA 4B6FA 1CRQA 4QHTA 2JIZD 3VKGA 3SEAA 1ZNWA 1OXVA 1W7AA 1W0KD 5KNDA 4QNMA 4X8LA 4NPHA 3IPYA 4IXMA 2XXAA 1BMFD 4Q1FA 1S1MA 1KO8A 3CM0A 2XOKA 3L8ZA 1OLOA 2GKSA 1S9DA 3AF4A 1X8JA 2VSFA 4PO9A 4AY2A 3PUWA 4U7DA 1XMIA 3OF5A 1U0JA 4P31A 2HYDA 3VU9B 3UIEA 5HPYB 2XNDD 4OJKA 4ACBA 2RGDA 1ZD9A 5CYOA 2J9RA 4JJZA 2QSZA 1OFTA 5BYJA 5HKKA 2NGRA 3TMKA 1FL9A 5EQTA 4F93B 4PAOA 2PMDA 2VP2A 3E70C 1AS0A 2IYYA 1E98A 3UKDA 2Z4SA 3U7HB 1VIYA 4NCJA 3BOSA 3VR3A 2OV2A 1XMVA 1OV4A 3PUZA 3U6BA 3LX5A 3AVPA 3U3JA 5JHHB 1TEVA 1S96A 2QT1A 1QDEA 1XRJA 2E9SA 2IW3A 4IVPA 2ZS7A 4KLNA 4IJMA 4D80A 3K1JA 2OAQ1 2ZJAA 1E2LA 1II8A 2OESA 2X8AA 3LXXA 1PUIA 4CEIA 2QP4A 5DLQC 3QQ5A 3U7GA 1GOTA 3QEJA 2IS2A 3WRYC 2V3CC 4TYWA 2O0JA 1E1RA 2OSBA 3HP1A 3TAHA 5JI2E 1BKDR 2P3SA 4GT1A 4LV6A 4TMZA 3EC1A 3T35A 1QHHB 1QHIA 5FBVB 1JNYA 2CVFA 2NIPA 5EE9A 3ETLA 4MKGA 4KBGA 1RRFA 5SZJA 2NZJA 4ZCMA 3A1SA 1N6PA 1T8TA 1Z29A 2ZVQX 4GI7A 3W6PA 5DN6D 1JPJA 3F8TA 2OFXA 2HT6A 4NE2A 1BYUA 4BFXA 1HYQA 4WVFA 1UBCA 1W5TA 4ZCLA 4TTQA 3ZYCA 3QXXA 4FD2A 2VP9A 1DS6A 2ZEJA 4KBFA 4XOIA 4V0OA 1P2UA 4U02A 3MUFA 3PEUA 4G01B 4EPVA 3K70D 5H1YA 4PO1A 2QAGB 4XWOA 2PEZA 5KOYA 2UZ3A 2DWPA 4NCIA 3P20A 5FL3A 1AK2A 1RJ9B 4DSOA 1YR6A 2ZUCA 3OEEA 4D82A 3CLVA 4BECA 4H1VA 2GVDC 4Q9IA 2J3EA 1S4QA 2ZYVX 3L82B 4YMUA 1YHNA 1ZNYA 4Q4HB 1GSIA 3MRSA 4OHZA 5B58C 2ZR0A 2ZRBA 1SVLA 1V43A 3GP8A 3MG9A 1S3GA 1W2HA 5HTKA 3KFXA 3THYA 3U3RA 4HAUA 3I62A 1DE0A 4F7WA 4UNRA 5A4JA 1CIPA 1XEFA 2IA5A 2J1LA 3FB4A 3BXZA 1NVVR 1XEWY 4YQFA 2QQEA 3U61B 3ZVLA 1IBRA 3CR8A 4GSYA 4QM7A 1CR0A 3CO5A 3OFNA 2ODWA 1FUKA 3THOA 4KCGA 1OKKD 4GOXA 4KO8A 5DSZA 5LB4A 2IYSA 2PBRA 1ESMA 2F6RA 1D9XA 4GZMA 2KSQA 2RB4A 4XH9B 3FGNA 3SJZA 2ZJZA 3BFXA 1AN0A 1KK2A 3IDQA 1YR9A 3GFTA 2YVUA 4LHXA 4C2TA 2QUZA 3ZJYA 4ZIRB 1PVOA 1IN4A 4LGMA 3K0FA 2CL0X 2H17A 1KI6A 4RCZA 3MWYW 4TT3A 5G3YA 3CRQA 3H2YA 3OHMA 1W0JD 4EFLA 4IKEA 3B7GA 1XDBA 5FH9A 4EPYA 3L2OB 4B43A 1W48A 3Q7QA 1YR7A 4WZBE 1M7BA 4DZZA 2G0NA 2GJSA 4BRUA 2OBMA 3JZAA 2Q3FA 1OB5A 1W4RA 2HJGA 1Z0IA 3ZD7A 4JKIA 1A2KC 4Q1CA 2B92A 4LWZA 1EX7A 1VG1A 1FNMA 3N5CA 4Q9LA 4URYR 5KPDA 3U44B 4Y0AA 4TMKA 4RZXA 1G9XA 1OFIA 1D8TA 2VSOA 3U7FB 1JEEA 2GK6A 4TMXA 2WSSD 5EE0A 1ZRHA 1CS4C 3EPJA 2PT5A 4B71A 2CHVA 1LNZA 4KYIB 4UXIA 1P62B 2DWOA 3LQRA 1R8QA 2OO7A 4LJAA 4HB4A 5FOUA 1XXHA 3H1TA 4ZDWA 3CF2A 1G18A 2CE7A 1QHSA 2PZFA 1E96A 3VR2A 2BM0A 4NYMR 3SI7A 1F2TB 4MYHA 3I61A 4G5OA 3VNUA 1G3IA 4A15A 2RHMA 4K46A 3MD0A 1O87A 2BHRA 4XVRA 5CLLA 2D3WA 3H86A 3IIJA 1U99A 2CBZA 3HPQA 4O2LA 4ZI2A 3RDPA 3TSOA 1GKUB 2ZREA 5JFGA 1G6OA 2BBOA 1TF2A 2RGNC 2O52A 2YWEA 3GJ6A 1XB2A 2CL7X 2EQBA 2FJUA 4CIDA 5JJLA 4IDHA 3EIHA 2AHOA 2DB3A 2GCNA 3PEWA 2GBLC 1XZQA 4M53A 1NIJA 1DPFA 2WJJA 3I5XA 1UDXA 2QENA 1XD2B 3EA0A 4JYCA 1ZYUA 2R9VA 5JI3E 4HB3A 4FW9A 3THXB 2V7QD 1Q57A 1YZLA 2ZS8A 3W8RA 3EIQA 1U9IC 3HR7A 2FE4A 3KXKA 4IVQA 2RKOA 5SZHB 1Z6GA 1HY3A 1Z06A 4WZ6A 4IOMA 4MUBA 2E87A 3EC2A 1EFCA 3ZIAD 1Z28A 3AVQA 1J7KA 5C1BA 2REOA 4P4UA 2P5TB 1AQUA 1WA5A 3RLFA 4DDTA 3FOZA 4TL8A 1KJZA 2IX3A 1SHKA 3GLFB 3FHOA 1N0WA 4LPKA 4Q7KA 1LTQA 2TMKA 2QAGC 4EFMA 2BJVA 1KDTA 2BEKA 3RSLA 4L9SA 4UNNA 4M1SA 4B73A 1P60A 4RZ3A 4BEJA 3ZD6A 2CE2X 2DR3A 1NBMD 2DFKB 2UZIR 4W5JA 2ONJA 1Z6TA 3GJXC 4C0QC 2IXGA 4JS0A 4JT4A 2P67A 2VEDA 1LW7A 3EWAA 3LAWA 4M21A 3SS8A 1TF7A 3QVUA 4YDSA 2ZXUA 2ZTSA 1XWIA 1G3RA 3A8TA 1JQLB 1W47A 4WBSA 3C5CA 3QPVA 1N5LA 5G41A 4EPWA 4RY2A 2YJTD 2J0UA 2IYXA 6Q21A 5EXSA 2MSCB 3ZS8A 2YOHA 2ZYTX 1G7RA 1GUAA 3FVQA 4ZI3A 4HZIA 2YC2C 1CBUA 5TB5A 1I4DD 1CEEA 4BPBA 3TE6A 4AG5A 3OE7D 4DLTA 2IWRA 3C8UA 4LRWA 1FNNA 3Q85A 3ND9A 4HYYA 3AM1A 4ABYA 4PQFA 4LJ4A 1A1VA 4CEHB 4UNQA 4LCBA 3NHBA 1Z2AA 4LV8B 1DO0A 4WAUA 2FZ4A 1KZGB 5KPJA 2BJWA 1WB9A 3EA5A 4QHYA 4HAWA 4LDJA 2GNOA 2ZITA 2HEIA 2IUUA 4KSCA 5JZVA 4Q4LA 3GPLA 1QHXA 2RGAA 3QENA 1TQ6A 1G21E 2HLDD 3EG5A 3FPAA 4M1WA 1HA3A 4JVMA 4GP7A 2J7PA 4XSGA 2NMVA 4DLUA 3RAPR 2ZE6A 1TX4B 1IJEA 3GCGA 3HU1A 2FSIA 3NTUA 4C0LA 2OG2A 2ZPTX 3BS4A 2R6GA 4YMWA 2XX3A 5D3QA 1KJWA 3S1AB 1GRQA 5FBQB 1JECA 4D6PA 2GEUA 2WJGA 3N70A 1VG0B 1IQPA 2QNRA 1RE0A 2WPDA 3WXMA 3QIAA 1XNJA 5KSZA 5J4LA 1KI9A 1MRNA 2J0VA 4HAZA 2HXSA 1Q44A 3RABA 1RC8A 2VHUA 4JT2A 3MSXA 3H4MA 2ERXA 2J41A 4A8JA 5C4GB 1EFUA 1E9CA 2H16A 2H57A 4PC7A 1Q0UA 2HF9A 2XSZA 3LBNA 1VHTA 3KXLA 1ODFA 5CM8B 2ZRDA 2CHGA 5DNYB 1SXJB 1ZC3A 2I3BA 2JJ2A 5SZIA 3RS0A 4OJQA 4RD4A 1A5TA 2F1JA 4B76A 5CYPA 4AKIA 1OH6A 1SXJD 3EXAA 3VFDA 5FOSA 3NEJA 2CHQA 4IEIA 1VCMA 4GOKA 1NMXA 4TLBA 5E7JA 2AD5A 1GVNB 3P1JA 3UMSA 4RD2A 5JBQA 4BRWA 3NDPA 4D81A 2N1BA 3W8NA 1XTJA 1OF1A 3SNHA 2A5YB 3NXSA 1IONA 2D2EA 4KFTA 5KSOA 5JJKA 2I1QA 1Z0FA 2VHQA 3RANA 2OLJA 5H70A 4G3XA 4UQOA 1E2DA 5DI3A 4F4IA 3CPJB 1VPLA 2UVQA 4DIDA 1Q1ZA 4MGIR 1W44A 4R7ZA 4RFSA 2F1HA 1BYIA 2MSEB 4YONB 3WNCA 1J8YF 1E2JA 1YE8A 1DAHA 3GLHE 3REGA 1HQYE 3KXIA 5JS8A 1ZINA 1KYIA 5FPKA 1X1SA 1XBTA 2W2XA 2FSGA 2OCAA 1E0AA 2FPMA 2QRNA 4DC9A 4MKIA 1AKEA 2WKRA 3VHLB 5BN3A 3X1DA 1UM8A 2BOVA 5KNCA 3WBJA 3QBVA 1F5NA 3JVUA 5FL7A 4XIGS 3EPLA 4MDEA 2KBEA 1L2TA 2ZI5A 2R6AA 2XTZA 4IRUB 4N3NA 4XTCS 3RRYA 3EW9A 2YKGA 3LA6A 1TMKA 5IK2D 2O8BA 4GRAA 3ICEA 2ERYA 2CL6X 1EFHA 3SE0A 1TADA 3NHAA 3J81k 4N1AA 1ZMXA 2QZ4A 1H8HD 2C95A 2PEYA 1DG3A 3K0CA 2CJWA 1UBGA 2EFEB 2VP6A 5AK0A 2RGCA 1YJ5A 4CF7A 2QROA 1NJGA 1T3SA 4HLUC 1LB1B 3TH5A 1ZM9A 2WWXA 2JDID 4RD0A 3ASYA 2HCBA 3KDSE 4OI1A 2QSYA 5G3ZA 3B5JA 3QXSA 2WMOB 2R6FA 3K0AB 1D6JA 2GXQA 2OBNA 3F5FA 4NONA 4IDQA 2XJ9A 4R9UC 1KHTA 2IS6A 4F92B 1NKTA 1YZNA 4TLEA 1GL7A 1N5IA 2FG5A 3OIWA 3UWOA 4BZQA 2A5GA 3KFVA 4QJ3A 2C9OA 4Q7MB 3T06B 2ECKA 3PV0A 1T0HB 4BLTA 1DADA 1DAIA 2O8CA 1EK0A 2Q9AA 2OE2A 4FMCB 2O8DA 1NY6A 1RRPA 4FCVA 1Q20A 3BRWD 4JKYA 3QEOA 2QL6A 3U4QB 4NKRA 4M1MA 4QNRA 1G4UR 3FMIA 3PUXA 1UKZA 1W4AA 3WMEA 2UKDA 1NVWQ 1WCV1 4PPGA 4LV5B 2I1VB 3DHWC 1E2NA 3M4YA 3GLGB 2EVWX 2ZRIA 3KTAA 4PZZA 4V0KA 1Z2CA 2ZR7A 3X2SA 5JJIA 4PANA 5GADl 3EZ2A 5JCPA 4DEXA 5FUWA 1RVDA 3AKCA 1GG2A 2JJ1D 3SN6A 1FX0A 3AUXA 5FPHA 2WTUA 2AXNA 4DUGD 2BDTA 2W58A 4RJLA 1FUUA 1COWA 1E2QA 2J0QA 4I1VA 4K81B 2GESA 3R20A 4Z8YA 4C4PA 4C0SA 3FYHA 4NHOA 1QG2A 4A2PA 1U8ZA 1X3SA 3AKDA 2GF0A 2PH1A 4JYBA 2WJYA 4LHWA 4FWIB 4MGKR 4TSFD 3Q7PA 5DIFA 5J40A 5JCZA 3DDCA 5L3SB 4DDWA 4BFSA 2PL3A 4B2IA 3NWJA 3T1OA 4JLDA 1D9ZA 1E4YA 1SXJC 4IFEA 4A0HA 1NN0A 3RS7A 3AEZA 3HJNA 2Q21A 1VG9B 3REFA 4YC7A 1YZTA 2H5EA 3WMGA 2FN4A 1KTVA 1E79A 4R2HA 1XTQA 3SDZA 3DM9B 1O3YA 4AURA 3QSYA 121PA 1PZNA 1VHLA 3T1QA 1NN1A 3K8YA 3KJHA 4M8NE 4A4DA 1M7GA 4S35A 2GRJA 3E1SA 2RH5A 3Q9LA 5BWMA 1DO2A 1KIMA 2FFQA 2KB0A 4OHYA 1UJ2A 4FCWA 4DXAA 2VPPA 3VKWA 2REBA 4Q7LA 2A5JA 3NBXX 4EJSB 4IFBA 1B23P 2B8WA 4BLPA 2IUSA 2AKAB 2H92A 4OBEA 1VCIA 4DLZA 4BLOA 1U94A 3AH8A 1MO4A 1MT0A 2ANCA 4B3BA 1SKYB 3AGQA 3DOEA 4DWJA 3K9NA 2LKDA 1KOFA 2ZJ5A 5K8LA 2XGJA 5FR1A 3P27A 3D8BA 4TYNA 3W6NA 1AIPA 2W6ID 4Q9HA 2XB2A 2QPAA 1E9RA 1W46A 4ZDKA 3LH5A 3SFVA 4O25A 3VR5A 1BOFA 2H8KA 1Q1EA 4M2LA 2JLUA 1U90A 4BASA 2Z6VA 5DHFA 2FEMA 1FPMA 1GILA 4Q66C 4RFVA 4CEJB 3ASZA 4LOAA 3SHFA 1A7JA 3PR1A 1XZPA 4URUR 1LVGA 4M9QA 2ZRAA 3T1VA 3CIOA 2DHRA 3GJ0A 1E2KA 2LWIA 3K9GA 1GNQA 1IOZA 1S3SA 4G1UC 4M1TA 4HB2A 4LZZA 3KZ1E 4EQ6B 1SVIA 2A2ZA 4MRVA 4P3YA 1GKIA 2A5FA 2MMCA 3KQHA 2GAAA 2CK3D 3K9LA 2BEJA 1J8MF 1N6HA 1F3OA 4DKXA 1OXXK 1Y63A 2F3RA 3A6PC 3DL0A 5KU1A 4JLAA 2W2VA 4JLPA 2VBCA 2FFHA 1TPZA 4L4UA 3WRXC 3CNLA 3QY0A 1ZM2A 4IDOA 4K8OA 4I1OA 3FKSA 5H8WA 5FBWB 2VF8A 4POAA 3IBYA 1TU4A 1E0SA 5J5CA 5LB2A 2W6JD 1JR3D 5E7MA 1XEXB 3I1FA 3L43A 3CNOA 5C46F 2B21A 3ZZUA 1CRPA 1GNPA 3NKVA 1NJFA 1NVUQ 1SVWA 1X1RA 3CB4A 4UNSA 3C4JA 3SYNA 2PCLA 3OZXA 1NVXQ 3W90A 1FP6A 1S1CA 4A9AA 4HSEA 4ZPXA 5B57C 3U3KA 2ZJ2A 3AP2A 5E4FA 2GF9A 3F3YA 4AC9A 1KO5A 2FU5C 5KNBA 2I4IA 4BWYA 1RYHA 1MABB 4NH0A 3ADBA 2P6NA 5KTYA 3WHKA 2WM9B 4LUCA 1QHHA 1AA9A 1IY1A 1YQTA 4URVR 4L5BA 5H68A 3M0EA 1IM2A 2C04A 1YRAA 1OJLA 1BO6A 4H9GA 4V0NA 3ZZTA 1Z0DA 3TAUA 3RWOA 2J45A 3E2IA 3OIYA 2GXAA 2ZROA 3KKOA 5AJXA 3E5HA 3TIFA 4AG6A 3BERA 4RD3A 5CIQA 3CZQA 3QVVA 1N0UA 1K8RA 4PZLA 4IDPA 3IUYA 1ANKA 2D4HA 3LXRA 2ONKA 2V8OA 2P2LA 1XCGB 4L15A 3R9IA 4Q4AA 3C7KA 421PA 1NY5A 1JQJC 3B9PA 1NLYA 1UKEA 2SHKA 3AGPA 5FUXA 3BK7A 1LV7A 1G19A 1OIWA 3KB2A 4HUQB 2VHTA 4DBLC 5J4VA 3LBHA 1Z63A 4PHHA 2LKCA 3A58B 4IEEA 1G8HA 4MYUA 5D3MA 2QI9C 2EWVA 1KO1A 3OESA 1Z3IX 2JLWA 1W4BA 2BBWA 4HB0A 1YZKA 2C9CA 4EAQA 2IL1A 1PUJA 1IN5A 3QOFA 4UKDA 5JECA 3IGFA 1ZW6A 4X8OA 2WOJA 4NYJR 3OAAD 5L3QA 2X19A 3ONWA 1KY2A 1T4GA 3HYRA 2HT1A 4Q4HA 3U60B 3TKLA 4NDZA 1RFLA 1OH8A 3LLUA 2ZSAA 3RNLA 3I32A 3TBKA 2GJ8A 2IYTA 1P2TA 4ACAA 1DTSA 2DCUA 3NEYA 3UANA 2J59A 4PC6A 3WBKA 3SJCA 3GFPA 4M22A 4M9ZA 3IEUA 4Q1AA 1S8FA 5EXPA 4C0KA 1G8GA 2L0XA 4EJSC 2OXRA 1P73A 3D31A 5FTJA 5L3RA 3K70B 3NH6A 5G53C 3BH7A 3PJRA 1FMJA 5DO9A 5B2ZA 3W5IA 2XOKD 2VP4A 4B3FX 2ORIA 2PZEA 2J0SA 1CR2A 2DYKA 2X1VA 4HAYA
chains in the Genus database with same CATH superfamily
3U48A 3HWWA 4EBFA 4S1PA 3GLQA 3VR0A 4E88A 3IAHA 3RWBA 4B3TB 3HS3A 1ZN2A 3NIFB 3ZK8A 4Q3AA 1QG0A 2HSEA 2VOEA 3BSSA 4GGMX 4ONEA 5ALEA 3UN1A 4B6JA 4C7BA 3EHEA 5LOVA 3KS9A 3CGWA 4OHPA 4ZRMA 3I2GA 4A0RA 4YMUA 4FQ7A 2PE5A 4CVNA 1G5PA 4F91B 3U81A 3WDMA 2WBLC 3WGZA 4B44A 2P35A 3BXXA 4JCOA 4CKEA 4E46A 3G0IA 3SK0A 4PW0A 1P5ZB 1POXA 3UV6A 1OB2A 4BHTA 2JHAA 3ZE7A 4EI9A 2P6RA 1MAAA 2E55A 4I66A 3V4SA 4XFJA 2GJAA 3V33A 1X19A 3R23A 4BNVA 2Y1XA 1U7XA 2BFNA 1T10A 2FRDA 1USUA 5KNBH 1WLYA 4UU0A 1OU0A 3V6LA 3F7MA 2I65A 2ZPUA 5KTPA 2CDCA 3GJ4A 3TINA 2QU7A 1H3FA 1T9CA 4G36A 1X8XA 1II0A 2QAJA 2IVZA 4TKUB 4NWIA 4JVSB 1MIOB 1GDTA 2FFJA 1PDOA 3GW8A 1MP0A 3CFYA 3I0ZA 5SYAA 3RUDA 5AHKA 3HKEB 2ZVJA 3WYDA 2DBZA 4N6GA 1I9CA 2V65A 5ALYA 3WNVA 4MCIA 3E18A 1P1IA 1QPGA 1SUPA 3PGJA 5AWFC 4M4SA 2D2IA 2YCBA 4JASB 3RC9A 2PWPA 3UAYA 2W98A 4LF7B 2WZQA 3GHYA 4IQ8A 3LC1O 3U7QB 2P78A 4ZO6A 1J42A 4H77A 4PX5A 4BQEA 5TGTA 2AXEA 5SY4A 1HLFA 5BSHA 1H5UA 2XKJE 5KBYA 3G2JA 5L3ZA 4K1XA 1ZVVA 4ND5A 1KAQA 1KMHA 1LBTA 5JEEA 4F2GA 5KYXB 2JGIA 1Z0KA 1EX1A 1X7YB 1XRRA 2EX4A 1S02A 4E6EA 4R9VA 2Z1MA 4WZBB 4RY0A 1ZUIA 3GAFA 5LYJF 3ZGVA 3PDCA 2BVNA 4QAJA 4DF3A 5L53A 3JYPA 3AJDA 4HATA 1GQOA 2SNIE 4MGHA 5JADA 3KX2A 1FP1D 1PGQA 5BRNA 1THMA 2YNMA 1OBOA 5B7NA 3HFSA 4XFKA 4MVJH 4TLCA 4FTWA 1KJYA 2VIIA 5IX8A 4REMA 3THXA 1SR8A 4KHZA 2RCYA 2FEKA 3KR0A 1UZNA 3RS3A 1XD8A 3HKDB 1NBAA 1NC1A 1DXYA 3KB6A 3GEHA 5BN4A 5DTRA 2MDTA 2BKLA 3I6ZA 3ND7A 1PL6A 3QMVA 4WRRA 3U13A 1X1CA 3D6MA 2C8KA 1A4IA 2CNBA 3FWHA 3ADPA 4IOLA 3ZTTA 4DCMA 5TR9A 3T8YA 5B5SA 2PUVA 5BMOA 2Z6UA 1MO6A 5AK4A 3S81A 2NYVA 2XEXA 3MWDB 5C7YA 2AOXA 3RV4A 1U8UA 4EENA 4N9QA 5JBNA 4WFIA 2Q4TA 3V4PB 4LXHA 4FFLA 1OX5A 3D6NB 3E61A 1VI2A 5T3YA 1XRLA 3X1WA 5IUJC 7REQB 2COUA 4YS6A 5FOQA 3EVZA 3W4KA 2VHXA 5AOCA 5EP4A 2P2GA 2JI4A 2TMDA 2X1LA 3EIFA 3GJ3A 4NDAA 3WMRA 2AD1A 3T5BA 3ZDZB 2W00A 4RH3A 2OBLA 3Q72A 5IJ9A 1GRCA 1O03A 3MT7A 1AUXA 1UWVA 3D8SA 1IUNA 3K92A 3EXHC 2FFBA 4HFJA 1OAAA 4OSEA 4D8YA 2WSBA 2YXLA 3IHKA 2Q3MA 4RAQA 1E8MA 3AZOA 2ICAA 5FPPA 3WHPA 3NNDA 3PUIA 1ZXXA 3SC4A 5A3RA 5M04A 4UULA 5MN4A 2ZRGA 3UHAA 3EWSA 5ALTA 1A50B 1N6LA 2MR5A 5A1JA 4ZQGA 1XF9A 4J07A 2BZSA 3STYA 1P4RA 1T0BA 3R5KA 3WLFA 1OY1A 3H3XA 4F4CA 3DOOA 3ZXUB 1JAIA 2R6ZA 1RQ7A 2F59A 4CRWB 2MINA 1CY7A 1PJQA 3I8XA 3ZXSA 3SOPA 1SKQA 2GYYA 2LRHA 5E1OA 1A9TA 5IFKA 2PJRA 4BN4A 3L8FA 4JEMA 4HWRA 4CLOA 1SZPA 2BCJQ 4KACA 2VXCA 3WSTA 3OX1A 1RWPA 4OSOA 1CF4A 2IUFA 4PGMA 4B3DA 3L9WA 5HKAA 5BUQA 2KJQA 3VDMA 4K6HA 2FSVA 4XCQA 4FDUA 3MB5A 4HAXA 3SBXA 5I9SA 4R1QA 1X15A 2WAXA 2XTNA 4GWGA 1G64A 2JD1A 1X7ZB 1W2GA 2J4DA 5LYJA 4ND3A 1GKYA 3EEIA 5EHXA 4L9WA 2VHJA 4EVQA 2H8GA 1Z4PX 2J9XB 2NZ8A 2O2IA 3BJIC 5CW1A 4X3CA 5PNTA 2IBMA 5BV0A 4AP5A 3FB1A 4BY9E 2ZUDA 2XH8A 4KGVA 1M7HA 1NBOA 1NR1A 2RKWA 2BR5A 4GDMA 3ZLBA 3D6AA 4V0QA 3GZNA 1FRFS 1GLGA 4XUEA 5AHXA 2PQMA 4D6YA 1WZNA 5CJPA 3GT7A 1ADFA 2A92A 1ZM3A 4JQSA 4AP9A 3DOCA 1QCYA 1LBSA 1T5HX 3TW0A 1YB1A 4QNNA 3G0HA 1OYWA 1KJIA 1YDHA 5A9SB 2GWHA 2QN1A 4XGIA 1AS2A 1EJ6A 2PL9A 5EMKA 3QHQA 4XCVA 1MJHA 2Q2VA 4Q1DA 4QQRA 2HLPA 4H1WA 3WLOA 3O2JA 5IWCA 1WMDA 4BQNA 1A9XB 1F48A 2H9AA 1ENOA 1IY2A 1JG6A 1KR2A 4FSDA 1IJFA 1Z0JA 2O14A 2B94A 2O8CB 2Y99A 3IV9A 1WUKS 4DJEC 4YXWA 1XMSA 1T8RA 2D5BA 1FLDA 2Y67A 2I9PA 1JEQA 1U0LA 3ADKA 4IGEA 1K2WA 3R6LA 5C3UA 5LZ8A 3SJAA 4DW8A 5EXXA 3K0SA 4IR7A 4BMXA 5HMLA 5EP2A 3C1TA 4E08A 1UPTA 2DBYA 4WERA 3ZQKA 1G21B 4AJEA 4RHXA 3IP7A 4BZWA 4LMPA 1X1AA 3JWPA 3VR4A 2FR8A 2CNWA 3NKFA 1JT2A 1R10A 3GCDA 5JXJA 4JUFA 1NVGA 3CF6R 5CVUA 2ZB2A 3R5JA 1IZ8A 1K4MA 4FIDA 1P0FA 1PJAA 3PFCA 4Q7JB 4P58A 4RCYA 4YO7A 4DS3A 1DXQA 2WIJA 2R47A 1QNFA 3ISVA 4HQFA 2AV6A 1Y9DA 1Y3CE 4PS1A 2SCUB 5LP6C 3OCWA 3SXUB 1QDUA 2WABA 2V7VA 1XCMA 2CXTA 1ECJA 1PW5A 3HSYA 3IC5A 2H4JA 4LDAA 2QWXA 5LBIA 3VPHA 4PN7A 2HHAA 3FFTA 1C0EA 2R66A 4W5NA 2GS9A 2VSQA 2ZE5A 4OYRA 2NLOA 2XE4A 1MH1A 4F71A 3S27A 1RAFA 3KXPA 4C4YA 1Q19A 4IDBA 2J0UB 3LPDA 3TQCA 3FDJA 2CKMA 2YYAA 3GOHA 5IF3A 3F4LA 1MNAA 4DYDA 2LNDA 1OAKA 2A84A 5IJZA 1FYXA 5CCDA 4BVBA 2ZJYA 4XFDA 1JH9A 2ZBFA 4RPHA 3PFHA 4D98A 1DBVO 4EAAA 4BOYA 1G6KA 2AL7A 4DLSA 1JJFA 3LRTA 3D2AA 3DMTA 3BFJA 4J7UA 3DD1A 3PSAA 3Q7TA 4OHOA 4CUKA 3O9ZA 4D8XA 2XD9A 4HPJB 1GCIA 4I1SA 1QVVA 2HBQA 2QTVB 3PRYA 5A0FA 3HYTA 3F96A 4FBLA 1NWCA 2XCTB 3IO5A 4U2GA 2ZATA 2FPPA 1RSZA 1WXQA 4AROA 3CE9A 2FWJA 4F3YA 4X6UA 2GD0A 4ARAA 4DCJA 4WNYA 1OV6A 2O2CA 3V6MA 3WNDA 3M82A 5HA5A 4DIBA 4D5GA 1OU4A 3GAAA 2DRIA 3VA7A 2QE6A 3FOBA 3ILYA 3B60A 3EZFA 3WBFA 3DOUA 1FFCA 3T7DA 1XKXA 4PZEA 2BMEA 4PYQA 2FP3A 3RT7A 3WFZA 2P9TA 4CKYA 1ISHA 3RSCA 1UKCA 3ZLVA 3S68A 2J7PD 3TR0A 3SSNA 4HPXB 2AG0A 2KX7A 1QRDA 2ZJ3A 4MRMB 1V1RB 3MRXA 3DMPA 5EGSA 2AW5A 2XMSA 1PG2A 3WRXA 1ZHOA 1UFQA 3NP9A 4Q39A 4FCTA 3ITKA 1L1RA 3HDYA 4JSYA 1JDBB 3O47A 4LIPD 4DSZA 1V37A 3OVMA 4AJKA 4A5OA 4BB5A 721PA 3QP9A 4OQXA 4HGQA 2X76A 3TSYA 1GA4A 1RYYA 1H22A 3K4HA 3RI3A 2P4QA 3B6KA 2LGJA 1BDJA 1BE1A 3B89A 3E4CA 1JXOA 3QA9A 4UQPA 2YXDA 4BP3A 2BE7A 2AKYA 1P72A 3VI3B 3GLVA 1YRYE 3FNGA 3BIOA 3U0VA 1VP3A 1IHDA 2Q0QA 3N3AC 5T4BA 3VOSA 4PSUA 1FZTA 3SAJA 2XSZD 6LDHA 2XE7A 3NAQA 4G0UA 3JWEA 3NWPA 1F8XA 4RMHA 1VJ1A 3G17A 4GD3Q 1Z37A 2AS0A 2JJ2D 4YT2A 1T2VA 3RD5A 3RYFA 1OBVA 2G1KA 1XLVA 4CIYA 3JQ6A 4MYCA 1CXZA 4NEHB 5TJ9A 4J0GA 5A5FA 1YBHA 2GJ9A 1H2RS 1PYGA 1VL2A 1KQNA 4AMZA 3G2MA 2Q1WA 2F7SA 3RRMA 3WGLA 3RAGA 2Y71A 3UJNA 2J8ZA 1XR3A 1ZU4A 2BELA 3PX2A 4C1NA 4RV5A 3T3OA 2C84A 1TYEB 1R6AA 2UXCB 4ITUA 3DBHA 1R64A 3BC1A 4D8WA 1QVAA 3V8QA 2DQZA 3IIEA 1Z5GA 3HKBB 3JS5A 4GZLA 4LZJA 2W2LD 1S8OA 4Q82A 3V8VA 1Q14A 4DIEA 4ZT5A 4K6KA 3DYBA 4M0KA 1KYYA 2SECE 3HB9A 7AT1A 4CT5A 3J81A 1SXHA 2F55A 2HDWA 3G1WA 3W4IA 4X93A 1WUIS 1LPAB 1OVMA 2VJCA 3O8NA 1P29A 1CLEA 1JWBB 3ZH2A 5CJ2A 3NTOA 5CT5A 3UWSA 2GEBA 1ORHA 2A9JA 3DMFA 3W5SA 5AM0A 2XB4A 3ANXA 4B4VA 2BBSA 4DPLA 4EDHA 4CKWA 4ICIA 4QBGB 4EPRA 1KI4A 1O9HA 1T5BA 3IHWA 3RLIA 1M74A 4NBUA 4F8JA 1OGYA 3P9KA 2PKQO 3ZYZA 4EGAA 1GNTA 2G5CA 4YA6A 2I3AA 9ABPA 1O5IA 5TLSA 1GPAA 2IY9A 3CUEF 2GN6A 3O1HB 3OX3A 1XTVA 5H0IA 3H5RA 4BP8A 4OGKA 1D4AA 3PGA1 3HVRA 2B6HA 3GGCA 3UBTA 4FYHA 4HX2A 1CY2A 3GFSA 4MVJI 1T5SA 2UAGA 4RBNA 3K09C 5COAA 4BUJA 3OCUA 1TJ4A 4BWFB 2CSXA 3G2NA 4OL0A 4R2LA 3EW7A 1KVTA 2C92A 5TV2A 4ARZA 3N2YA 4PXYA 5C1IA 3IULA 1YR3A 1PQYA 4P3NA 3FFAA 4EM6A 2IZ7A 3T1YB 2Z3VA 1IUPA 3SQLA 5KDOA 2EJVA 3JRWA 1R37A 4B3IA 1UQRA 5AM3A 1FZQA 3DG9A 1X7HA 3LDHA 3L7OA 5E4TA 3GELA 5JMPA 3GVPA 4G0ZA 4X95A 2NUPA 1GPNA 2R5FA 4KNVA 4XPZA 3GT4A 2Y76A 3RG8A 2UUPA 5JCXA 2BSXA 1B3RA 4BBZA 3FNFA 1O08A 4Q4JA 4ESHA 2NUTB 3LOQA 4HMQA 1QORA 3ORFA 4H35A 2OO5C 3DL7A 1ZG3A 1B7GO 4LXYA 3EAQA 1URPA 4CEJA 4OB8A 4DNOA 1KVSA 1SBYA 4LYHA 2HF8A 3IQWA 5BR8B 3KK0A 5HOQA 1FQJA 3MWGA 3IXMA 4QDZA 5JE8A 2JK0A 3USES 4ON9A 4AKHA 5DIZA 1DTWA 4CM4B 4IWXA 4MMXB 4INPA 1R18A 4XD7A 4WXRA 1A8SA 1M2OB 2Z2YA 4XUCA 3GRKA 3KWLA 3WI7A 2C2XA 2UZAA 3HABA 3EFEA 4OXXA 3TS1A 1NI3A 3QLTA 2VDNB 3B52X 4Y6PA 1PV4A 2Z2IA 1T5IA 5HZHA 2HHCA 4J3FA 3AI7A 4BNXA 4EO7A 1RP1A 3L01A 2IK8A 4FPXA 4JBXA 4HJRA 1JJAA 5DM70 3U3ZA 4A2QA 2OM6A 2YHSA 1FYWA 5CITA 1OHHA 1EE9A 3GUZA 1KY3A 1WXGA 4RMIA 2NAPA 1WRBA 3LW8A 4TV9B 4UTZA 2JIZA 3I5MA 4X9XA 4Y2XA 3LW7A 1DT3A 3IV7A 2X9NA 3T7TA 2ZIEA 3AHHA 4YLYA 1JDBC 4JXXA 3KQQA 1KORA 2BP7B 2Q2QA 2YZKA 4MUMA 2YICA 4AJ4A 4Z3DA 1TMOA 2ZCUA 1AA6A 3QNWA 1E3MA 1X3LA 4BU0A 3A05A 3I52A 4G84A 4JUBA 3PX3A 1M0EA 3O8OA 3CXUA 5U9CA 3MK31 2W93A 2YRXA 3ECCA 3OZDA 4N6NA 3KR2A 3AUTA 1TECE 1NZDA 1OWPA 4FQ8A 4WY5A 3ZXYA 4PHCA 1KSJA 2GEDA 1VZ3A 2YR0A 2HRQA 3G0OA 2DWQA 2XNDA 2EKBA 3OZIA 4Z6KA 2E0IA 3DGEC 5JAPA 2AZDA 4PFSA 1O6CA 3IP5A 3R6TA 2DPHA 2CVZA 1QB8A 4UM9D 3VU9A 3ZJ5A 5HSGA 1V2HE 4P32A 1R8YA 3N7TA 2GEJA 2GSDA 3VTKA 4OQFA 3NRJA 2JCBA 3HU2A 4IZ6A 1B14A 3BSFA 4Q9KA 5LKRA 1RQPA 1U4OA 4BFVA 2J4CA 3I72A 3NALA 1OA1A 5FP0A 5EP3A 4JK3A 4R1NA 1HQKA 3S8EA 3D0KA 4MVJF 1NSTA 2O8NA 5TGZA 4DV7B 3L07A 4HLCA 3SMQA 3E7PA 1H9AA 2SKCA 3T9BA 3EVEA 2ZIFA 1E4VA 5H16A 2VJPA 2GXSA 2XYHA 4G0YA 3H2JA 7GPBA 4NXNB 2V6JA 2O48X 2CWWA 2BKUA 3CZAA 3UA3A 5TGDA 1OAOC 1MPTA 3EZXA 4NULA 4TL7A 5L4NA 1CX9B 1XU7A 3JAKA 1XWWA 2BMAA 5KVCA 4WACA 2NSJA 1L6RA 3WP1B 3L5OA 2O54A 1YIDA 4XGNA 2PSDA 1P17A 1Z08A 1GIAA 3ISTA 4W1SA 2XE8A 3S7ZA 3PGXA 1YUMA 3TVDA 5ICEA 1IUOA 1EVEA 1POWA 2CNOA 2IQIA 2OBYA 2OL4A 3ENVA 4PX9A 3RIYA 4A36A 4NNJA 4TVKA 4N3CA 1C4OA 4MUHA 4U3JA 2IZ0A 2QY9A 2GWRA 1N25A 1A96A 1W29A 3N2GB 4FX5A 2AQHA 3MAJA 5DNDA 3QVOA 4AUKA 2ZJ4A 4P22A 1TAUA 4EW6A 3QF7A 3AI1A 3H16A 3AI3A 4HDNB 3HXMA 1ESZA 2WD7A 4N82A 3VH1A 4H7JA 3GLSA 3SC3A 4UVIA 4DSUA 4TXMA 1TT7A 4G37A 5FNVB 1VLZA 2J9ZB 1MW8X 4DV1B 3VR5D 1JHMA 1ZCZA 3QYFA 1ZZGA 1O94A 5JDCC 3CLTD 4UMVA 1FP7A 2FAXA 3KZXA 2NWQA 3OPQA 4JLSA 5C7OO 4PZ9A 3FD8A 1XTUA 2H85A 4KW7A 3HB1A 1CUDA 3LWDA 4TLMB 4YAIA 1A2BA 1CZRA 4ENSA 3IDFA 4LF8B 5H59A 3QFSA 2H1FA 3QXJA 1U0HC 3I2KA 3TEFA 2GZAA 3DAFA 4ZJYA 8ABPA 3PJDA 4CMHA 1YBVA 1Y6ZA 1F0KA 1EH5A 2WTXA 1YUBA 3BXPA 4H7EA 1U65A 4G4IA 4LNUA 4RVSA 4UJ5A 4YT5A 3MMSA 3PCRB 3RUPA 4QL3A 4DIOA 2NYRA 1PUXA 4M1QA 4B2PA 1RYEA 1X9IA 4ZK6A 3VQTA 1GXSA 1P9NA 2B8NA 3L49A 3RF6A 4FR2A 4EHLA 3MAAC 1Q5PA 2FMUA 1M8FA 1ZOSA 4UU1A 1APBA 1ZJJA 2I7TA 2R1UA 1G291 4IQFA 4YP7A 1I1NA 5KU7A 3BRSA 1OH5A 1J0XO 4TVBA 5KVSA 1T15A 4EB6B 5B4TA 1T3ZA 3JATA 4QBHA 3LQQA 4MVJA 2IUYA 3HMKA 3PZBA 4A2CA 1YXMA 2V45A 4FMDB 3QG1A 4JB0A 4I5FA 4O2BB 4DLWA 4E5KA 2ZIAA 3VBCA 1VIDA 1OKKA 1OBFO 2BFMA 3B6JA 4HGZA 4WZZA 1QG4A 2XXAB 4YUZA 1Y5MA 1NN3A 1MU0A 4L6CA 3HY4A 2QN6A 4FI3F 4F3RA 3D6HA 3T5DA 5BPHA 4DC1A 2HSGA 3DD5A 1F4PA 2R8YA 2XWQA 4RXMA 1DJOA 1ZD8A 5JXGA 1EU1A 1BGWA 1K7CA 2X4IA 2X7XA 3OY7A 4TYQA 5DPMA 5LQSA 1NN5A 4QARA 3ZZ0A 2IGTA 3GH1A 5LP6B 5KNBD 4EZEA 4LE0A 2JLYA 4HDOB 1R5JA 3F6SA 3RARA 4IIUA 4WECA 2FUEA 2P3LA 2CFRA 3GV0A 3L1UA 4WNCA 3WB1A 4BO7A 1BEEA 3FTPA 4MYTA 1GFIA 1EZ4A 4G26A 1P2DA 2XXBA 5C8ZA 3WMXA 5KTRA 1BGVA 1V26A 1N3YA 2FQYA 3B6ZA 2VQSA 4X5OA 1BCSA 4DBVO 1OYYA 4F4HA 4GKJB 2ZUSA 4EKYA 1GT91 4QYSA 1MGOA 2QL9A 1BA2A 1D5CA 4DREA 1JHQA 2W9XA 4DLPA 4X7MA 4TKMA 5JLAA 2Z8XA 1UKBA 3EQ7A 4QBFA 4Q4AB 1O2DA 1OFHA 3PD1A 4LFAB 3VNVA 2O1SA 2D1SA 2HWUA 4CHTA 3KAQA 3T1HB 5L6LB 4Q5IA 1MBZA 5JXWA 1UMCA 3SZOA 1EA7A 4S04A 1S6YA 3QQPA 1PFYA 1ZD1A 2DUUA 1KKLA 2QJWA 4NS1A 5I7HA 2Q5LA 1GAXA 3F9RA 3ITEA 5ECGC 4GPTA 2AG5A 2EZ9A 4JLBA 1G41A 4ZU6X 1JLKA 5BP7A 2PCJA 1F20A 3AUSA 3MINB 2ODAA 1RRCA 1XVLA 1U1GA 4YMVA 2G70A 4YRFA 2W8BB 3WL7A 1AUQA 1CRLA 3GLUA 4YJFB 4UTNA 5D51S 1PWXA 3AP3A 1U5BA 5KQMA 4WH0A 2R0QC 1EM8A 4X24A 2V55B 3BWCA 2GPWA 3SDBA 1UXKA 1WF3A 4HYTA 1NRIA 2ZQ5A 3LGSA 4JB3A 3ROGA 5KJFA 3OIUA 4U6NA 1F2TA 3IEKA 5CNIA 1UXIA 4MUIA 3BRQA 3DDZX 4I5GA 3U2QA 1VIMA 1NPTO 2E4VA 4R2IA 3UWDA 4OGGA 4CIVA 3KKPA 1V16A 4WZAE 4LSMA 1TKAA 3RAEC 1NDHA 1VLHA 4P80A 2GZHA 1HTBA 4FCCA 4K6GA 5AM4A 3RVKA 4LTNA 4YAEA 2QTNA 3TD9A 1HZZA 1EI9A 2OV8A 3AVWA 1MX3A 3D0OA 2Z5VA 3WRVA 2NU8A 1C0KA 4Q47A 1ZGZA 4QXMA 2FQWA 2Y2VA 3UKJA 3R7WA 2AN9A 3VC7A 4EI7A 1Q3TA 4CUZA 3QBTA 4NR0A 4OHXA 1DL5A 1T26A 4UM5A 2GBFA 1G8AA 5BWNA 3HYCA 4KAJA 1Q7TA 4LC9A 4I5DA 3Q2IA 4CETA 2V0CA 1HFJA 4V0ME 5D6NA 5EHNA 2Q2NA 5IZ4A 4R1MA 4A6XA 2EFJA 4UTVA 3ND8A 1NRJB 1PEKE 4PTZA 2HQRA 5JQGF 2NZ2A 2OZPA 2A4MA 2NPIA 1Z8FA 4GMXA 5FWYA 5H9WA 1AV6A 5DXJA 3TUIC 1ISPA 3WGTA 2C5BA 2Y1KA 3JWHA 1QF6A 1EDZA 4PLPA 3WZMA 1Y3FE 2VJMB 4MRNA 3DTVB 3U9SA 4C78A 3H9JA 4ZEVA 5IJ0B 2CFIA 3PXGA 2MSDB 3F3MA 2PSSA 2J07A 3DZGA 4ALNA 1TZJA 4LKRA 2A9KA 3HCCA 1L7OA 2VDWB 2GD1O 3U0BA 2PAFA 5DX0A 5IDXA 3TGPA 1VL5A 1R0WA 2NADA 3FETA 4QUAA 3G2PA 5FYQA 2YWBA 3DEIA 5BSWA 2C4TA 3FCEA 3IJRA 3KD2A 1D8AA 3OBBA 5G02A 1H93A 2OUKA 4U7PB 1HDZA 4BE4A 1PKEA 1SCNE 2G5TA 5ALWA 3UUEA 4W5HA 2DERA 1JH8A 2IPOA 1IN6A 2V96A 4KFCA 1PX0A 3ZI0A 4WN9A 1FJGB 3G82C 1SD2A 1U8AA 3BWDD 3LCJA 4HNAB 1Q95A 1FB5A 1UDAA 3C6QA 3DAPA 2Z0MA 2QE7D 2C7VA 2QMHA 3MPUA 1L3CA 1CUHA 2C7OA 4X20B 3RK1A 3VGJA 2B2XA 5J4HA 3F49S 3I0NA 4X65B 3NHFA 1TK2A 2SICE 3MS7A 3PEVA 1BW9B 1FFDA 2X3YA 4FK8A 4GG1A 2DP4E 4LE2A 4NTZA 1AKYA 5JAOA 2M6KA 2B1RA 1C5KA 2IQ5A 1B2LA 2Q4OA 1ISIA 4ZVKA 2YVKA 5GQSA 3IE2A 4Q18A 1O6BA 1Q74A 4I9HA 5ICSA 3GLTA 5C8YB 5AVSA 1UC4B 2X8LA 4B7CA 1E0KA 1P61B 1EX9A 1NUTA 2V3WA 2EERA 3V7YA 5B7GA 1CU1A 2J5QA 2WYWA 5EI5A 2GTPA 2GBIA 4FE7A 4X61A 4Z4CA 4F38A 4YO8A 1EVKA 2F3UA 1G16A 3E48A 3GYBA 2WPNA 5DF1A 4V0RA 1AUVA 1CUCA 2G72A 1EKXA 2BGUA 3I6YA 2ZUWA 3JRNA 2HLDA 2B8JA 4IQ0A 4KTVE 3NI2A 3RHSA 2XGMA 2YXNA 4I4CA 1K6MA 1XTZA 2YFQA 4WFJA 3TPZA 3PLAE 4UDYX 2G04A 1XLTA 2DBVO 1AD2A 1M54A 4LVCA 5T67A 3UMJA 2K7FA 1ZNXA 2PZLA 2RAVA 1DI0A 1ODLA 1E2PA 1F6BA 1NNUA 1GPLA 1Z07A 2C57A 2WMDA 3D5EA 3KYDB 3PDJA 4HQLA 4BE7B 2PGOA 4HVLA 3ZDBA 4YBZA 3MNFA 3K53A 3V80A 4RSMA 1N5DA 4F3CA 4EHNA 2QRMA 3DOIA 4JIMA 2PX6A 1JBEA 1U02A 3QUSA 3HJCA 2RBEA 4F5EA 3FWKA 4HNVA 3I73A 2POCA 3ZCUA 2GO7A 4P3PA 3L0DA 3I9NA 3T41A 1MV5A 2ABWA 2YHIB 3TFOA 3W2TA 4CG3A 2CCJA 1KEEA 3A6FA 3I6MA 4HFMA 4QJ4A 4F12A 4PO8A 2XZLA 1KU6A 1Z5VA 2AFVA 3AERB 3ZW9A 4B3XA 3CEMA 4US0R 4PHGA 3V55A 4BO8A 4YR9A 1I3KA 1L7QA 3N2LA 1BVHA 2HBZA 2WA1A 4LSGA 5DH9A 4DOMA 4TWIA 4M0MA 1WX1A 3ZOZA 5I8PA 4CM9D 2OM2A 5G0UA 3BGIA 5K4GA 1HSZA 1SQ0A 4AQYB 3VU0A 1CERA 1QTRA 1SXJA 1RRGA 3AJRA 4D0NA 4BB6A 4ME6A 3TXAA 1MOZA 1V11A 2E4ZA 1HKUA 3GI1A 1VDMA 3V48A 3PDIB 3WS7A 2P0YA 4TMTA 5AJYA 4RK0A 3QKSB 3FIJA 4BU1A 3E1GA 3M6FA 3O7WA 4U9HS 4RTQA 1K6IA 3NTRA 1U8FO 5B6PA 2O5CA 3F78A 1L5GB 1ZJ4A 2D1YA 3HN2A 1PVVA 3LL7A 4K7JA 4ZMBA 4F46A 4LJYA 1D2RA 2WUFA 4DCCA 1S7CA 5BQPA 1CUSA 1RHJA 2KBFA 2VKTA 3AB3A 2YDXA 3GNLA 1E2GA 2ZYAA 5REQA 3SMVA 6AT1A 4HVTA 5FAKA 3I5YA 3B2EA 4LZWA 1WKCA 1L9XA 3CRW1 5EIHA 4BX2A 3JQ7A 4CFYA 3R0QA 1HTTA 3CJTA 4IHJF 3H11A 2ZDQA 4WLUA 1KAEA 4YJ2A 2GZMA 4MO2A 1G2QA 4FXPA 1T29A 3O92A 3PP8A 2QQ5A 2ZSFA 1Z74A 4J1NA 5JRZA 3ZWCA 1XPRA 2ZSHA 4M88A 2B1IA 1SIBE 3UJCA 2IWHA 3QUBA 1VPTA 2BKEA 1N9GB 4RO0A 2B35A 4KSYA 2G5PA 2QGNA 2VSYA 4Q3OA 3VOAA 1E1NA 4F72A 5IK2A 3I4CA 5A4AA 1RI4A 3O8CA 1Z36A 1MOPA 1XJCA 2G82A 1U3VA 1L5LA 4E1BA 3AFOA 2FQXA 1UODA 4AJIA 5ELXA 1NUSA 1OLSB 4D25A 2J3IA 3H5IA 3SCZA 3BTSA 1Q1QA 4R31A 4BIIA 2B7CA 3U5ZB 3BJEA 4A6DA 3WYFA 2F9LA 1KAMA 1SZCA 1DT5A 2I2BA 1EBUA 1ZRNA 3A70A 3OZAA 3EPKA 3HI6A 5CXXA 4BMPB 1I14A 1OTHA 1RI5A 1R6XA 2MYTA 3A9TA 3CRMA 3DNMA 2E2WA 2EW1A 1XHLA 1CEYA 3HRKA 3TSAA 5C7IO 3QYJA 2EL9A 2WW8A 2BZ0A 5FULA 4R4JA 2Z1NA 4M1OA 2BUBA 1OVGA 1E9BA 1KO4A 3HA5A 1WW2A 3QPUA 4WXMA 5IJAA 3RC8A 3KUXA 5ALUA 4M7RA 1Y8ZA 4JB8A 4ZQHA 1ACJA 1SCIA 1CJUC 2JKVA 3BMOB 1DNPA 3BA6A 1BXGA 4GMFA 1UKYA 4HS9A 4B32A 4D2IA 2WILA 5EWJA 2QK4A 1RP7A 2OD2A 4RL4A 4Y30A 1MC1A 4MI3A 1L4GA 2VDOB 4GMGA 2Q9UA 4GX5A 3IPAA 1XTKA 3QFFA 2A6PA 4UMFA 5GONA 3PQ8A 5HIMA 2QM0A 2V6FA 1Q22A 1EEXB 2XZPA 4E22A 5CNKA 3ACBA 3GJYA 1WPXA 2VAPA 1FFSA 3LUHA 4H7IA 4DHEA 1TQ8A 3PC3A 4WNAA 4N54A 5IASA 2BV3A 3A1UA 3C7AA 3CX7A 4FILA 3BMQB 3GLKA 4M83A 3GVCA 5CVCA 5JH7F 4P54A 1RPZA 4LF9B 1H9CA 1KI7A 5H3LA 4MV6A 4UTXA 4MX8A 3ROXA 3WV4A 4B6SA 3TJRA 2BFEA 1KZ4A 2H2DA 2WJVA 3ZTWA 1F6WA 3UOAB 4YJ3B 3WMFA 3QA3E 4FZJA 4HDKB 1TF5A 4MR7A 2AJTA 3DYVA 3NHLA 2X41A 3TPCA 2ZSJA 1FLAA 1EAMA 1SN7A 3I05A 4IHJA 4YJKA 5DISB 4AF8A 3MC1A 1CDZA 1DELA 4Y1RA 5CK4A 4D4JA 1BFDA 4X1YA 2A88A 3O4GA 5EUBA 4E2ZA 5BV7A 1FMTA 5JHGB 5ELMA 3ZHUA 5CUQA 3REOA 5HRAA 1EUZA 4XR4A 3AQIA 3KTFA 1NV8A 3K0EA 1C8VB 4YJHB 4RORA 1IIRA 2ES4A 2QRQA 3P2OA 3C3BA 4WLFA 5JEDA 5L9AA 2JPDA 3MUNA 1AZSC 4KR0A 5A7FA 4LY6A 2ZYIA 4LJ8A 1R8SA 1ISJA 1HOXA 2GEKA 3HDVA 5K8VA 1T43A 4YCMA 2JFYA 1YI0A 2CMFA 5CDGA 2V7EA 1L7MA 1WETA 3ISJA 5TC4A 4TSFA 1MR3F 2GH1A 4B79A 4J6EA 5K6AA 3OWHA 2D7CA 2PUFA 2MJLA 3M6VA 1C1XA 1VJRA 2QZ9A 3UPUA 1PK8A 1J9EA 4REQB 5L3SA 3NZEA 1CEXA 1RRVA 3UUWA 2Y68A 3LHIA 3LSTA 4Z49A 5ED4A 2H18A 4QUEA 5JSZA 4GU5A 2J5RA 5FHRA 3GNSA 1RADA 4GP6A 1U2DC 4AZ0A 5SY9A 2JFVA 1X8KA 3ADDA 3PNBA 4J9VA 4RIIA 1ZK0A 3U4IA 1E4EB 1FQKA 3L79A 4AMGA 4J76A 4NV3A 3SSMA 4TTVA 5TJHA 4C2BA 3IAAA 5LA6A 3V3TA 3W3ZB 3W6UA 5CB4F 1XZAA 2F43B 2GBGA 3NBYC 1UZUA 1W5FA 5LCXA 3PEEA 5TDHA 3SC6A 1GL6A 1ODTC 1W49A 2VXOA 4KAXA 2O8BB 2OY0A 1X92A 1IWPB 2A5DA 3FHCB 3H0EA 3V4FA 1YS1X 1Z0AA 3KOUA 4L02A 3O1LA 3ZE1B 1F0PA 1OLUA 1JZSA 4P4SA 5F1PA 5JYEA 2XZOA 3D6TB 3L7CA 1NNEA 4GXQA 5BN1A 5JSUA 5AVVA 5C8DA 1ADYA 4QPJC 2AOWA 4FNGA 2WWGA 4BNNA 1NA5A 3ER8A 2ZBUA 3GLGE 4U00A 3ZHRA 2QM7A 3B7WA 2PD3A 1BJRE 3CEJA 4IO0A 2NU9B 3PHLA 3HFRA 4NU5A 2ZIUB 2DFTA 3SR3A 4BX9A 3STTA 3WO1A 1HQDA 3SHWA 3FOFC 2HB6A 1JB1A 1SCAA 3WE7A 1ZQ9A 2W6IA 1WQ1R 3LT1A 1EFRD 3H2KA 3J7AC 1KH3A 1TA0A 3Q88A 5BNWA 1E1KA 2C2HA 4MIEA 1YQXA 1BXRB 3WIEA 2GXUA 2O8FB 1SEVA 5J5AA 4QDTA 2QGFA 3THWA 1IB6A 3PLNA 4WKCA 3TTYA 4DBLE 5BW4A 1U1EA 2VF7A 4XM0A 5AVQA 5HR5A 3FNEA 3T61A 3CSSA 3F4BA 4RS3A 4GQIA 4QO8A 2VF4X 2WF5A 4EELA 2CXUA 1GL9B 5LMNB 4LYFA 1VXRA 1MVOA 5DCYA 4WXYB 1HFEL 2HLNA 3UWMA 3NIDB 3LUBA 5K6RA 3E7XA 4NMHA 4TZTA 1PW7A 1I7NA 3OCZA 4DA8A 1PQUA 5KNCH 4YPFA 1AU9A 1V71A 3E8XA 4ZHQF 1SBCA 3Q7RA 1IN7A 3ZH9B 2H2HA 2EC5A 4C04A 3BE4A 3TR5A 4ZYTA 3BXHA 1GP2A 2LCFA 3FMFA 2H1SA 5EZSA 3GDWA 1M5RA 4LJRA 2ZUUA 1OREA 3H8SA 1JG2A 1XRMA 4EQ6A 3E0QA 2WKPA 5TQ2B 2E4UA 3OFVA 4S1OA 1TMGE 3K5HA 4FYKA 1UADA 1OPRA 3TTUA 4E3ZA 1C41A 3JPWA 5KZMB 1P7PA 1JHAA 1YSCA 2RC6A 4URFA 1D4FA 2QG6A 2CXOA 1PYDA 3DF9A 3KYIB 3A1TA 5CTJA 3KSAC 2IHYA 2R6JA 4EG1A 1QV9A 2ESRA 2G80A 4P7GA 5BORA 5JC8A 5EZYA 4EUHA 5F3WB 2ILVA 3WYNA 4A82A 5ITWA 2FN9A 1EGQA 1S2OA 2IITA 3A9UA 5FI5A 5FPTA 4NBTA 4LKOA 4GBMA 4RSRA 1F9EA 5BSKA 1N77A 3CWQA 1NXOA 3KALA 1G8YA 4TL9A 1U7UA 3EAFA 3FZYA 2COKA 2OAGA 1WBBA 1GZ5A 1SXGA 4HNGA 2I6XA 2Z08A 1UK7A 1ISRA 3HBNA 3CNNA 1M1NB 3EWIA 3I83A 3NGXA 3ZDAA 2IS4A 5BNIA 5KJ1A 1RLTA 2VCEA 3ZLJA 3VR6H 1JALA 3ORSA 1YCGA 1PFKA 3G7SA 4HXFB 2QVXX 2GVNA 5C9ZA 3PENA 1E8NA 3GGPA 4JELA 1KSFX 1ZK1A 4MQFB 2EIXA 4EHHA 1MABA 1UXHA 3VYTB 2C5FA 4PCVA 3P32A 3W1EA 3L77A 3N86A 4AICA 1I2MA 2MSKA 1WMAA 4BMYA